2A9NL

A mutation designed to alter crystal packing permits structural analysis of a tight-binding fluorescein-scfv complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
109
Chain Sequence
VLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGTGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords fluorescein-scfv light chain
publication title A mutation designed to alter crystal packing permits structural analysis of a tight-binding fluorescein-scFv complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 109
sequence length 109
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a9nL00
5ALBL 3UTQB 4K8RC 4OV6F 3H3BC 3LMJL 3VXQB 3KPLB 1LO0L 5TDNA 1VENA 5C6TL 1ODAA 1MQ8A 5LWYL 4GRLC 4X99B 1F4HA 2FYYA 4WNQB 1MHPH 4ELMF 4MDIB 2X6MA 1MRDL 4EI6B 2G5BB 3OJDA 4UTBH 5BO1H 1NCDL 2DQFA 2C1OB 4NPYB 3MLTA 3IVKA 2JIXB 3NCMA 3QEQE 3VFPB 6FABH 4LCWA 5DD0H 4U31A 4EQ3A 1FFOA 4XAWL 1F8TH 3EGSA 4K2UH 4JFQB 3WIFA 5D1QD 35C8H 1NGZA 3QG6B 1OVZA 3ZMRA 4CNIB 1BZ9B 3CUPA 3ARRA 3P4MA 3ZE1E 3SDCB 4R2GD 2KQMA 3LN9A 5D7SL 3U46A 1KTDB 2QR0A 2WW8A 5DMIL 3A6CH 3MO1B 2FRGP 3PL6B 2G60H 4OB5H 1D9KA 5F44A 4ZFGH 1U6AL 5CMAB 4PJBA 4PJDB 1D6VH 4XWGL 4YHML 1YNKL 5LCVH 2R0ZH 3GSOB 2Z8VC 2HT3D 1QFOA 1TMCB 4FQIH 4LVNB 2ADIA 1T3FA 2PXYD 3OZ9H 5MERA 1H15A 3L3DB 1Q72H 5F7NC 1KEML 5T3XD 1MJUL 1FN4A 2V7NA 3PWLA 3P40A 5ITFA 3VG9B 2XNAB 3PHQB 3T3PF 5DEFB 4EN3A 4P5MB 1A7QH 3V5HB 1G9NC 1ADQL 3MV7B 1EBPA 3SGDI 3SKOA 5C0EA 4JZNA 4MQXC 4X6FB 4U0QB 1U41A 3VRJB 3PQYE 5JOPD 5HHOD 1IM3A 2F5BL 4QKXB 5TE7H 4OT1L 4JZOA 1JGLH 3MX0A 5J1SC 2XY2A 3MLUL 1FZMA 3MA7B 4XPGL 5JHDB 3VFMB 4F33B 3B6SB 5JIIA 4P23B 5DQ9B 4WFED 3ARBB 4OZGA 5ALCL 4H20L 2VXQH 4PG9B 1X7QA 3FN9A 5CLTA 1E4WH 4PJFE 3I85A 4FP8H 2J5LC 1TJHL 3QIBB 2R69H 3STBA 1FORH 2DQJL 4YC2B 1UH4A 1D5MA 4PP2A 1VSCA 1QFPA 4Y5XB 1N5AB 3W82A 1KJ2A 4MJ2A 3NBNA 1YEJH 4TSCH 1XF3B 2RIKA 4JO2L 4M43L 1S7SB 3OG4B 3TA3C 3BE1H 5C0AE 4GQ9H 1SYVA 3LZFL 2A77L 4AG4H 4WU5A 3ARED 3BP7B 3EYSH 1ORSB 4P3WA 1ZVSA 2JB6B 2YSSB 1VFBA 1PKQB 3V0AC 1QRND 2Q7YA 2PO6A 4NN5B 4ZAKA 4KUZH 4ZSOB 5I74B 4LL9A 3MV01 3OF6A 3L95A 3FQTA 4ZNEE 5FGCB 3IU4L 1T0NB 1X5JA 3IJHA 2D03L 3D1MC 5J1TC 5J3HC 5GGSY 2DLTA 3RI5K 5GZNC 2X4RB 5D5MF 1JWMA 1F4XH 3CJJA 4Y19D 3GO1L 2X2YA 3U7YH 2ZSWB 4HXBH 4QWWC 3PDGA 1HQRB 5GGVY 3SDDB 5L88L 3FT2B 3GEWB 3LN5A 4ZFOL 1J8HB 3K1DA 3ZKXC 3QZWB 1ZEAL 5HHNB 4MQSB 3V5KB 3CDCA 3WHXB 5DURB 4UTAL 3MOBL 1LP9F 4R4NC 1QOKA 1VB9A 1PG7X 4XNUH 5EU3A 2WMPA 3BGMA 3VXPB 3KXFB 3MBXL 5F3BA 1XGUA 2FECI 4MNHA 1DQLL 4NFDA 4O2FB 3LKOB 4OZHB 1MAJA 1S9VB 5DRZB 4M6NL 5M95B 1E4KA 2F53E 3WKNA 1KENH 1YEDA 3ZT5A 1EGJL 3TJHC 4HWBA 4ZS7H 1A9EA 2ARJB 2ERJC 5ICXA 4XPAL 1REIA 3SCMA 3N1QC 5F96L 4O58H 5HDBE 1B0WA 1ZE3C 3T08A 5C07D 4MNGE 3RX8A 4OQTH 3NOIA 3DXAB 1QHPA 2DDQH 2EH8H 2AQ1A 5I0ZA 3FZUC 4NRXA 3CVIH 5C3LD 2ZSVB 1KCKA 1JZ8A 3U7WH 5INCA 3U83A 3H9ZA 1MLBB 2CGRH 2YRZA 2GFBA 2CXKA 4MB3A 4K55A 3K0WA 1YJDC 4XNQA 1H8OA 2YA2A 4IOSD 1TJGH 3K81A 3RZCA 2ITCB 2BDNH 1KB5A 5ERWB 2YD6A 4CVUA 2UUDK 43CAA 5HDQH 3HI6H 4OUUA 5F89B 2DAVA 2COQA 2ICWI 5JPMB 4DKEH 4LVHB 3BIBX 1NMBH 5D9SA 2AQ3A 1AQDA 2LU7A 3EO0B 4OCRH 1TNNA 2PYEA 3QO1A 1MH5B 2VDLH 3CZFB 2IAMA 1OP9A 5F7WC 4OV5B 4QTIL 5TPWH 1D5XB 2VLKE 3KJ6L 5E4EB 5IBLC 4YDVA 1I4FB 3D18B 3RWDA 3DVGB 1R3JA 2PF6A 3PQYA 5MENE 2E9JA 4UTBL 5BO1L 2HT2C 2NW2B 3EHBD 2XACC 6FABL 1B4RA 4D0DB 1IEAB 3MRFB 4J3OC 4FQQB 3WS3A 5HYSB 4K2UL 3S4SA 4P9MH 4G6FB 1FIEA 2HFFB 2KKQA 5FA3A 2NNAA 2ZG3A 4OIBA 3QWQB 1I9IH 4YGVA 4HZAA 3FONB 3RPIB 3V4UH 4P5TD 5DRWA 1GOHA 2HJFA 1B2WL 2HKHL 2NY3C 4G7YH 1DUYA 2E5EA 2BNUA 2G60L 4CVXB 2VNCA 4ZFGL 4XXDA 5TGBA 2FR4B 5C0AA 4JFFB 5LCVL 2R0ZL 1DBKL 1I1AB 4FQIL 1G0YR 3BEWB 4C56B 3OZ9L 2KPNA 3IFOA 4GMSH 3M17B 1CE6A 2OR7A 4G6KL 3UTTA 3PWVA 1Q72L 5IFHH 2Q76B 3TYGH 3L5JA 1R3KA 3PHOA 1A0QL 2WBJA 4XX1G 5TDOA 1SMAA 2VXVH 5E0QA 1A7QL 3CD4A 2KZWA 1CE1H 3MZTA 2OTWB 3M07A 1SMOA 4TVPH 5D1ZA 4HSQA 5KAQF 4LDEB 3GFUA 1PX3A 1U93B 3V6ZB 3L6FB 4MNQA 4MXVF 1OP3H 4CVZA 1CVSC 1KT2B 5DZLA 1JGLL 2IPKA 2W0FA 1B4JL 5CWSB 1I1YA 3QUXA 5H94A 4QHLB 5ICZB 4NO5B 5D71H 1MFDH 3ARTA 4P23C 1DE4B 3QXWA 3BJ91 1YMMD 2VXQL 4FP8L 1S78C 2C3HA 3HS0B 1ZGLM 4K94H 2R69L 1L7IH 4BQ8A 1FORL 4W4NA 5HI3D 3VXME 3IDJA 4L8CB 1WZKA 5E8EA 5KN5A 4O4YH 5EOCJ 1NCAH 3OKMB 2XKNB 3D3VA 4TSCL 2F53A 3D2UA 3DX8B 5E8PA 2VUYA 2FZ3B 5I8KH 3QEHA 4GBXC 4DUWA 2FWOA 1KYOK 1ZGLB 1A1NA 3DO7B 5E94B 4L8SC 1H0DA 1A9BA 1JWUA 3RI5F 5CEZD 3MJ7B 2NY6D 3FFCD 4MNGA 2OP4H 4NN5C 4GAGL 1T66C 4KUZL 3PP4L 4WV1C 2I25N 2CUHA 1AGDA 3QDGA 2A6IA 2HN7A 4N0UE 3G9VA 3MRQB 5JOFA 1LEIB 3O0RH 3SJVE 3S3SA 1DSFH 4OM0H 3DYOA 1JI1A 3QPXH 1MFAL 2BVTA 3U7YL 1NEZB 1B0RA 1QSFE 2J3SA 5D4QA 1UM6L 4N1CA 3X13B 1NKOA 5HHPA 4HDIB 3CXDL 1JF1A 1A3RH 5ACLA 3O8XD 1KB9K 4PRHD 1Z9SA 3QQ4A 3W9EB 1T0PB 3QDJB 1P84J 1QTYT 2OX5A 5JLZA 1HE7A 1NFDB 4PGDB 4TUKH 4WEUD 5EPMB 4U7MA 4OCXL 4XVJH 1M7IB 3JVGC 1KENL 3PDOA 2OZ4A 2X4OB 1UB5A 2XFXA 4YNYA 4O58L 2R8SH 1CDYA 3WNMA 2BSTA 2BXZA 3LQAC 1K3ZA 5IV2A 4OQTL 2XN9E 3GMPA 2LU3A 4OF8A 4RFEB 4POZD 5DJYA 4E0RB 4FZ8H 2DDQL 3PG2A 1LDPH 2AP2A 4N8VA 4U1MA 3DURA 5CD3A 3CVIL 2Q6WB 3O2WL 2FO4B 4G5ZH 2B4CH 4X4ME 4L9LB 4W70A 2UY6A 4P9HC 2CGRL 4S0SD 4DGYH 4X4YB 4IMLA 2R1YB 4KI5C 5ESQB 1LO5B 4G8GD 4N5ED 3VFGH 5ACMA 3WE6A 1UQSB 5HDQL 4XP6L 4J4PD 4MD5B 5BRZB 2OK0H 3C9NB 4H8WL 1A7OH 2DYPD 3W39A 2EDRA 1BREA 1NMBL 4G43B 3DTXA 4K9EL 2YC1A 5E8DH 1WFNA 3LEVH 2DLHA 5LGHL 4PTUA 5TPWL 1ZS8A 3QAZC 4ODUB 4DZ8A 5D7JB 1RZKH 2RGSA 1ED3A 1DBBH 5EULV 4FN0A 4G42B 3S36X 4HS8H 2A6KA 3B9VA 4PJAF 5JW5A 4KDVA 1MJJA 4QRRB 4OTXL 1MI5B 5FYKE 3VWJC 4LNVA 3NA4A 3O4LB 2CKBL 3G5YB 2G9HB 1I9IL 1N0XH 3QISA 1U8KB 3V4UL 2UY7A 4PPTA 1WAAF 3I75B 3VXMA 3OKDB 1OF2B 4L4TB 4PJDE 4G7YL 4NRYB 2XPGA 4WI8A 4LRIC 2OL3B 4B41A 1E27B 4AH2B 3EOYG 4KK8C 3CFEB 4X9GA 2HMID 2G5RA 1QG3A 4U3CA 2OQJA 3LKPA 2VWEC 4GMSL 4X6DA 1UM5H 1Y0LB 4KJWC 3DO3A 3TYGL 1NL0H 5CBAB 2NY2D 1U58B 1IQDA 1RZ7H 3QUKA 3MV7E 1MNUH 4N0UA 4KUCF 5L8LB 2VXVL 3CH8A 3OR7A 5C0RH 3G6JB 4QRPB 5BW7C 1CE1L 1W0VB 4Y8AA 5EA0H 1T1WB 3AMKA 1KPUB 3M1BB 3ARGB 1DBAH 4NHUB 5C92A 1QSFA 1QYGL 3HMWH 5JHDE 3RTQA 5DVNA 3VW3L 3MFFB 5IEHB 3V6OC 2A0LC 2BSRB 2OR9H 5A2IH 3W11C 1CFVL 4NRZB 1JZ4A 4WI9A 5BOZG 3DETD 5MP6L 1WEJH 2CRYA 1F02I 8FABB 4XP9L 3HZYB 5GJTH 25C8H 5DK3A 1L7IL 5T1KA 5IMOB 3P2TA 3BZEB 3UJIL 4K7PH 4O4YL 5CHNA 1NCAL 1NCNA 4P48A 5T33H 5AAMA 1NFIB 4H26B 3O6MH 4ZDHA 4NKOA 3T8XA 5I8KL 1X4ZA 1PKQE 2FX7H 3BZFA 1WJ3A 2MNUA 3TN0C 4G6JH 3DYMA 1JPTL 4GS7B 5IFJB 3QXUA 5KSAA 4ZSOE 4NQDB 4PJBF 3DMMB 3O4OB 2OP4L 1TPXC 2E7CA 4YDLC 5FGCE 2V17L 3GMQB 2MCPL 1C12B 1ZHBB 1ZWIB 4MS8C 3JUZA 3SE8H 4P2RB 1A8JH 2Q20A 5CP7A 4X4MA 2IFFH 5BMFH 1DSFL 3OKLB 4I18B 1NGYB 3LKSB 3QPXL 5K9OA 1ACYH 1J8HE 1X6LA 4KROB 4MA3B 2CRIA 4AENA 1ACZA 3LAFA 2YR3A 4UZGA 5C09D 1A3RL 3O9WC 1QFWM 1CXFA 3PGFH 3PIQA 4Y16D 3VXQA 3KPLA 4LGSB 3L1OH 3SDXB 3EJZC 1IGJB 2HJKA 5A3ID 1FRGL 4BFEA 3KXFE 3TNMB 3WFHB 4WNQA 3HKFA 1X5GA 4TUKL 3MRKB 4EI6A 4OZHE 5HD8C 4YK4C 5IMKB 1X3DA 3RL1B 4XVJL 4HWUA 4Z77B 4OZGF 3RU8L 1NMCB 3VWKD 3VFPA 1ZLUK 4HJGB 5C7XH 1VA9A 2H32B 1R5WB 3UPCA 1NUFA 3DOSA 3ZTJG 4OZ4B 4JFQA 3L3IB 1XCQB 2YWYA 3TYFB 3QG6A 4CNIA 3DXAE 1HN1A 3S88H 2R8SL 1JRHI 4YBQC 3SDCA 1BGXH 1G7JA 1UVQB 1T89C 2R1XB 4TTGA 3B8SA 1KTDA 5EBMB 4FZ8L 1YQ2A 1U8PB 1LDPL 3H9SE 3PL6A 3ULVE 3MJ6A 3O41A 1UYWL 1XGYL 2BOCB 4G5ZL 2B4CL 4L9LC 1KNOA 4PJDA 1JHTB 3F6IA 1T21A 4DZBB 1J88A 4Z7UB 1CFTB 3LDBC 5AYUH 3VXSB 3OKOB 2ESVB 3VFGL 5L9DH 2E9IA 4HPOH 1XGQB 4OIAA 3LQZB 3TPUA 4DK3A 1LO3H 1PBYA 1F6LL 5HGBB 2MMXA 2C5DC 1R3LB 2LVEA 4KRPD 5E8DL 4P5MA 2IBZY 3QQNA 4NQED 1ZLSL 5DYOA 3V5HA 3MV7A 5D6CA 4M5YL 4P99A 4YZFF 4MA8L 3W0WA 3VRJA 1RZKL 4ZXBB 1HINH 2ORBH 4HIXH 3MCLH 3BT2H 4WO4B 5K9QI 4HS8L 3MA7A 2CO7B 1HNGA 2YN3A 5JHDA 4Z0XB 3ZTNH 3VFMA 4F33A 3B6SA 1DUZB 5DQ9A 3ARBA 3O6KH 4TVSa 3UJJH 4ORZC 3QUZC 3KG5A 2RHEA 1JUFB 3ULSB 1AD9B 4OSUH 2Q8AH 2VJXA 2XYCA 4CU6A 4Y5XA 3EJYD 3GHBH 1N0XL 1WGOA 4XHQA 1FZJB 1XF3A 1RU9H 4UILH 1PD6A 1S7SA 2YPLD 5FKPB 3QFDB 3NZHH 4MA1B 3BP7A 1ORSA 4YEEA 2XI9A 4C56E 2YSSA 1NCBH 2DQHH 4N68A 4CW1B 4LBEB 4FFYL 2IGFH 3N9GH 3WHE1 3U48A 2JE8A 1UM5L 1K8DB 1U0QA 2Z9TA 1NL0L 5GRVK 3OKKB 5EIVA 1RZ7L 3RKDC 3CFIC 4XZUB 3F7YA 4XP1L 1MNUL 4DW2H 2DMBA 4R4FH 2X4RA 4I5BB 1N0LA 3KR3H 4WRLA 5CIPH 3WBDA 5C0RL 2ZSWA 5EA0L 2BX5A 3MBED 1HQRA 2JCCA 1QZ1A 1J8HA 4XC3H 3QZWA 3V5KA 5DD3H 4QHUA 3ARGC 3ECBB 3RY5A 2AK4D 1AGFB 2O5YH 2P24B 3LH2H 4ODTH 5J7CC 2OR9L 2VQTA 3NVQA 3VD4A 1HXMB 4JGUA 3MRDB 4ENED 3FQWA 4M62L 1WEJL 1TQCB 2YXFA 5EU5A 5F6HJ 3LKOA 25C8L 5FV2A 3S35X 3X3FH 5DRZA 3AROA 4QYOB 4IOFD 3EFDH 1U8NB 1IEHA 1Q9WB 3OGCB 4ONHA 5HTSA 4K7PL 4PJFF 3WXVH 4G9FA 4MX7B 2H41A 4LKCB 3O6ML 5DDHB 1QFUH 3S96B 4G6JL 1L4IA 3OR6A 4P46D 1KJMB 3DMMC 3FB8B 2WWMD 4L5FH 4HX1B 2P5ED 1NAKH 3L9RA 4KKBD 4QHNA 2ZG2A 1KLUB 3O81A 1IQWL 3SE8L 2ZCKH 2CK2A 3QDAA 1RK0B 1FNFA 1MY7A 4I18C 5ERWA 4PJEB 5IHLB 4JY5H 3IJSB 4LSTH 5JPMA 4OF3A 3M8OH 2C3VA 3EO0A 5DEGB 1PQZB 1HOCB 1MH5A 3CZFA 5GRJH 3BKJH 3SE4A 1OGAB 1R5IB 2CR3A 3L1OL 3P77A 1LVEA 3QDJE 3SY0B 1TZHA 1HH6A 1NFDE 2X4NA 1KIPB 5DSCB 5IIEB 2OM5A 1HCVA 1ZANH 3NFSH 2WQ8A 3IDXH 3D18A 3Q1SH 5HDLA 4R2GB 3DVNB 3V52L 1JNNH 4ZO8A 5DWUH 1ZSDB 4M7JH 4UV4H 2NW2A 5K33A 4PB0H 1G7PB 1ONQB 1HEZB 1YDPA 5EO1B 1A6AB 5BZDB 3TC9A 4UT7L 4D0DA 4E41B 1VCAA 4NN7B 1IEAA 1A64A 5C6PB 5C7XL 3MRFA 4FQQA 2YA1A 5HYSA 4ZS6D 5DUMH 3VFVB 1QUNA 3K2MC 4LNRB 4U49A 2J88L 3ZE0F 2R0WL 3O6FD 4HGMA 3P30H 5T1MB 3S88L 4OLXL 5DUBB 1ZVYA 1BGXL 4L4VE 4X7CC 2VDMH 4FQXD 1EZVY 4ZFOB 2EZ0D 3T4AB 5A16A 4GW1A 3G6DH 5HYEA 1U91B 1YY9D 3BDBA 3TVMB 1E28B 3ZSSA 4BM7A 2FR4A 1GGCH 4Y5YB 3K4DA 4JFFA 4G8FB 4O02H 5BRZE 1K5NB 1UCBL 5AYUL 1OWRM 3PWNB 3UTSD 3RGVD 3F12A 3M17A 5HHOB 4KVNH 5L9DL 3FO9B 2NXZD 2Q76A 1E6JL 3MA9L 1IM9B 3HUJA 1LO3L 1A2YA 5JUEL 3DECA 3MQIA 1FL3B 1VKXB 2GIYA 4FTVB 3WL9B 1JL8A 2NLJB 1JPSL 2OTWA 4WFHD 4HQQH 4AJ0A 1EJOL 2H6PB 4ZXBC 5HPMB 3QSKB 1HINL 1X5YA 1U93A 3V6ZA 2ORBL 5BV7H 1KT2A 3MCLL 2ZUQB 4LPVA 5HVWA 2EDHA 5C2BL 5CWSA 5ICZA 4QHLA 5HVHC 1RHHA 4LP5A 3ZTNL 2RAMA 4PG2C 4XX1E 3ZKQD 1DE4A 1XIWC 4FXLA 1MI5E 4OCMC 2EDOA 3OSKA 3O4LE 3O6KL 3MUJA 2Q86A 5F7YC 1XF2B 1QRNB 1DL7H 3HS0A 3NACH 1XR8B 3WJLC 5E2WH 2X4QB 4OSUL 3ZYIA 1QKZH 4HUNB 4L8CA 3MGAA 3OKMA 1KBGH 3DGGB 1NLDL 2IBZX 4OUOA 3VD3A 4OIIH 2FEDC 3C6LC 5AD0B 3NZHL 5IK3B 1BPVA 1ZGLA 4DVBA 1J05A 5E94A 2DQHL 3NH7H 3L3OB 2IGFL 3N9GL 5TQ0H 4D9RD 5SX4H 1NBVH 4XMKL 4NKQB 3IXAB 5C0CD 2DD8H 2BCKA 3N85H 4MAYC 2AJXH 3VGDA 4Y7MA 3MRQA 4UIMB 5SWQB 5GS0H 4X5XB 1CGXA 5F1IB 3G6JE 4E42B 4QRPE 4BZ2L 1FH5H 3CFJA 4DW2L 4R4FL 4RNRB 1TCRA 3KR3L 4XRCA 2XT1B 3QI9C 1MVUA 4XCCL 2CD0A 3ES6B 1NEZA 4KRLB 2FHCA 5I9QB 4XMLH 4FQ1H 4JCLA 4XC3L 4HDIA 5F88B 2VDQH 4POUB 4RAVA 1QLRA 4ODTL 1FZOB 4GW4B 3QYCA 4Z9KB 3QDJA 1NJ9B 4R9HA 5D7IE 1NFDA 4PGDA 3UYPA 2IBGA 3ARWA 1TETH 3X3GH 5EPMA 1JE6A 1IL1B 1M7IA 1UJTA 3BRDA 2GK0B 4XPHH 3G6AB 3EFDL 5BXFB 3SE3A 4RGNC 4J1UA 4PTTB 1U8QB 4S1QL 1S3KH 4NQDE 5AZEH 4Q0XH 3BP6B 3DUUA 3HFMH 4LSDA 4L4JA 4E0RA 5C0DB 1FVEB 2NY5H 5FM8A 4L5FL 4MWFA 5MI0C 5CINH 4P2RE 2Q6WA 2FO4A 1ZA6A 2P7TB 4P4KD 3KPSD 4EEEA 4X4YA 2ZCKL 5SWZB 2XA8H 4YXLL 2R1YA 2UV3A 1MCPL 5ESQA 1HH9B 1CDHA 4K3EH 4PJ8B 1BWMA 2IPUK 1UQSA 2NX5B 4Y2DD 1MFEH 4MD5A 5BRZA 3C9NA 4JY5L 1KIQB 4LSTL 4F2MB 3M8OL 4G43A 3NCCB 4RIRB 3SDXE 3MV8D 3T0AA 5BVPH 1C5DA 4KWUA 5GRJL 5C2UB 4LCUB 3QCUL 5DHVH 5M94B 2ZP0T 5D1QC 5F7DA 1BFTA 1G0XA 3ESUF 4PD4K 5JQHC 5D7JA 3Q1SL 3H3PH 3DSFH 4R2GC 2Y36H 1JNNL 1AKJB 4M7JL 4S1RL 2EDJA 4CU8A 4G42A 4PB0L 1OPGH 3IFLH 3OB0H 1OM3L 3QXAB 4QRRA 1NGWB 2PW1B 3GSUB 5JO5B 5DUML 5ISZD 1N5YH 1MI5A 2HT3C 4LAQH 2PXYC 4S1SH 3O4LA 5F9WC 1P7QB 1K9TA 1T7YA 1KJVB 2NW3A 5F6IB 2G9HA 2VDML 1U8KA 2QKIB 2MQCA 3I75A 1KTRL 1OF2A 3BWAB 4L4TA 1VESA 4NRYA 3G6DL 4HT1H 3U4BH 5GGTH 1LO2H 2XXMB 1L6ZA 2OL3A 4Z7UE 3TBWB 1LEGA 5HHMB 1E27A 2VLRD 4AH2A 3VXSE 5JORB 3CFEA 3CLFH 2ESVE 3MTRA 5DK2B 4O02L 1JVKA 2EYRB 2E8YA 2NTFB 4R0LB 4KVNL 4FG6D 1Y0LA 2XRAH 2Y5EA 1J8KA 5IKCA 2P5WA 4O9HH 5T5NG 5CBAA 1U58A 4EDXB 4NHCH 2YBRA 3G5XA 3LHPH 4JKPH 1B6UA 2I5YH 1UZ6E 4OCWH 1I85A 3FOMB 3G6JA 4QRPA 1W0VA 1FPTH 4R7NB 1FG2B 3M1BA 4R7DB 2XTJD 2EDNA 4YHZH 1EZVX 2R4SL 5AAWA 4NZDA 4NHUA 2HFGH 5BV7L 1EUTA 4AIXA 3FQRB 4F8TA 1I8IB 4KJQD 3MFFA 4KUCD 5J1AB 5T1LD 2BSRA 2QQNH 2FNBA 4NRZA 3GMMB 5IWLA 3QHTC 3P4LA 3AREC 4D0BB 2APWA 1DLHA 2DBLH 3BXNA 4LRNH 2W60B 8FABA 4Q6IC 3NACL 3WS6A 3HZYA 5E2WL 5F7KC 1JHLH 5IMOA 1NGQL 5ABDE 4DN4L 1QKZL 5GQBA 1WWCA 3BZEA 1IC7L 5GISH 1KBGL 3KPOB 2MTPA 1X44A 1CN4A 1NFIA 4H26A 5C9KA 4KKCD 4LCWD 4OIIL 4NBXB 2DTMH 2YPKA 3W5NA 1JF6A 2M1KA 3EIFA 1UXSB 2Y23A 1SYSB 5IFJA 4C83A 5E2UH 3V0VB 3VXRB 3C8KB 1UH3A 4PJDF 3SGKA 5TQ0L 2PKDA 2XQYG 5B39G 1IJ9A 3GSQB 1N2RB 5DJ8A 1LGVA 3TBTB 1C12A 3O8XB 1CG9A 1ZHBA 4LLDB 2DM4A 5GPRA 2AJXL 4P2RA 2YZ1A 2BVUA 1FH5L 3NCFB 4Y1AB 3OKLA 1NGYA 3LKSA 1F4YH 3PGCA 4ZPVB 1SBBA 1JJUA 1ZVHA 4MA3A 5L8JB 1UZ8B 3NFNB 4XGZA 4Q9QL 4XMLL 5J8OA 1QR1B 3PNWB 4MJ5A 2EC8A 2IBBA 3P9LB 3ETBF 4BELD 1IGJA 1K3IA 5DTFB 3TNMA 5ADOH 1C16A 3WFHA 4EN3D 5TQ2H 4KFZC 1TETL 3MRKA 1IC5H 1KB5H 4XCNB 1JTTA 3A67H 4ZFFB 5FCUH 4APQB 3BGFB 4Z77A 4WWKB 1SEQH 1RD6A 1TXKA 4XPHL 4O5LL 4HJGA 1IT9L 3BX7C 1NEUA 4ZO9A 2H32A 1R5WA 5IVNA 4XCFH 5CEYB 5CKAA 1UWEL 1ZHNB 3L3IA 2IADB 4U0RC 4NQUA 3TYFA 4OGXH 2CR6A 4G8GB 5AZEL 2WK2A 3AU1B 2WIIA 5FECA 2YWZA 2A6DB 2R1XA 3HFML 3C87A 1ZXQA 1FDLH 4GAYB 4D0CB 3C60B 1N59A 2ZOKB 2J8HA 1GGYA 5CINL 1Q0YH 4OFDA 2ZUTA 4PRPA 2BOCA 2BRRH 4AY0A 5I19H 1ZKAA 1JHTA 1A6PA 4DZBA 4XCEA 3MZGB 4PJEE 2HVJB 1CFTA 1ZA3B 2OJEB 3VXSA 2R0LH 1SJHA 2WWKT 4BQ9A 4JPVL 3OKOA 2V5YA 1X4YA 3OGOE 1MFEL 3LSOB 1XGQA 4LLUB 5SV4A 1CLOH 2PO6D 2VDRH 3EHBC 4I0KA 4MYWB 1OGAE 3GIVA 4FQPA 1FBIL 3VCLB 3GMNB 2K7QA 5BVPL 3OF6D 5DD6A 1XF5A 2VZTA 1AXSB 3VXNA 3CNKA 2JLLA 1F11B 4WIQA 1D3CA 3HI1A 7FABH 1YEKL 4CJ1A 1RZJL 1AQKL 2VIRB 1YN6B 5HGDA 3H3PL 3OBAA 4PJ7B 4OKDA 1H5BB 3DSFL 4M02A 2V9RA 1PSKH 1HHGA 4P5TC 3REVB 4E41E 1H3VA 1RURH 3DX9B 4WHCA 4WO4A 4Z0XA 1OPGL 3IFLL 1DUZA 1QEWA 4MXQD 1GC1H 4QGTA 2QADB 1S9XA 2BZDA 3KWWB 1M7XA 3ARPA 2GEEA 1WZMA 2OJZH 4N0YH 1N5YL 5IMLB 2N1KA 1ZHKB 4XBPB 4LAQL 1UJ3B 3MJ9H 4S1SL 2J7LA 1AD9A 2Y6SD 2AJSH 1VFAB 4QXWA 1IAOB 3KPMB 4EBQH 4NWUH 3QDHA 4MMZC 4HT1L 3QFDA 3U4BL 5INDB 3BN3B 3GMOB 1LO2L 5C1MB 2EXYD 4KJPD 5GZOD 2N4IA 2EDTA 4FFWD 4JFOB 3CLFL 5HHOE 2I9TB 4CW1A 5EOQH 3ULVF 3DV4B 3V2AR 4B50A 2APTA 3X11B 1A47A 2XRAL 4PREB 2Q8BH 1K8DA 1U8HA 3IRPX 4KTYA 3OKKA 1FHGA 1KJ2L 4ODXB 4WFEE 4XZUA 3FO0H 1I1CA 4FTVE 4R96A 2I5YL 4NUGH 4LSVH 4BJLA 3EOBA 4GG8B 1FPTL 2YPVH 1QBLH 4CN1A 3LKQB 1M7DA 3RZCD 3U7AA 3UCRA 4CMHB 5HI3C 1KELH 1AGFA 3T0VA 3RWJB 5B39B 5C08B 3CXHK 2XG5A 2B1HL 2PYED 3HB3D 2IAMD 5IQ7H 1HXMA 4PRNB 2EDFA 3MRDA 1GVIA 1QRNE 1G6VK 2DBLL 4LRNL 2NY6C 4H25B 5I1GH 5F9AC 4M4PA 1JHLL 4QYOA 4H8WC 1U8NA 3RIAK 3NIDE 1J1PH 2FB4L 3PQYD 1Q9WA 3OGCA 1WF5A 2CRZA 3FTGA 4U1LB 4MX7A 5GS1C 3BW9B 4K9EC 4RISH 4LKCA 4JQXC 5DDHA 5KSVB 3LIZH 3LEXB 2L4OA 5D1XA 3EAKA 2HFEB 4ORGB 2ZJSH 1Y6KR 2W9EH 1KJMA 5D72L 3FB8A 5D2NA 3GDBA 5EO0B 4HX1A 5JPNB 4BH8A 2Z35B 1FQ9C 3O8XC 1T83C 1KLUA 1EAPA 2OZ4H 4HWBL 2MKLC 3HLAB 3Q6GH 4CADB 4WHYH 2AJZB 4ODVH 4PJEA 3HUJF 3WJJC 1F4YL 2XXCB 4LSRH 5C0AD 3AS0A 2EDEA 4JM2B 2NXYB 1U3ZA 5ELIA 3VWKB 4HUWB 4UQ2A 5EZIH 3P9MB 5L6YH 2DICA 1E4XI 4HULB 3UTTD 1OGAA 3PWUB 1R5IA 1KIPA 1NC4D 5ADOL 2WBJD 3WV0A 3JV4B 5B8CC 1FZKB 3DVNA 1KB5L 1YMHB 1ZSDA 1T0MB 3A67L 5DMJB 4PRAB 4POZC 4S0TD 1G7PA 1ONQA 1HEZA 5EO1A 1WIOA 1A6AA 4LPTA 5E2JA 1RVFH 4MNQD 4E41A 2GY5A 4MJ4A 2YOCA 3WIHA 1MHEA 5EIQA 3BD4A 4XCFL 5FA4B 5BJTB 3QP3A 4XB7A 4NKIH 3QUXD 4MHHI 3AAZB 4X80H 4LNRA 4OZFB 4XWOD 4OGXL 1IGYB 5T1MA 1JZ2A 1GHFL 4N5EC 1OT1A 4IJ3B 5DUBA 5AWNH 3G5ZA 3BN9D 4J4PC 1DBJH 4U3XA 4U6TA 3K2UL 4PJGB 2OCFD 5DR5H 1B0GB 1Q0YL 1VGEL 5SWZE 3VRIA 1OTSD 2BRRL 4Y5YA 1D5BA 5FO8A 1FNSL 3D3VD 2F53D 2FL5B 4G8FA 2NX5E 3CDFA 3WUWB 1K5NA 3PWNA 2R0LL 4TNVK 5DRNB 5HHVH 3FO9A 4JB9L 4Y8DC 4FHBD 4MZ3A 4NFCA 3QCTH 2VDRL 3R4DA 5KZCB 2ADFH 4QNPE 1IM9A 1I3RB 5F9OL 3TA3A 2DQUH 4QRQB 1F2QA 3ROOA 2EE2A 3QDGD 1AIFA 1FL3A 5DC9B 4FTVA 2AKRB 3WL9A 5K9QG 1PG7H 2H8PB 3VFSA 2DQTL 5FV1L 2WP3O 4QF1B 2H6PA 5HPMA 4RMTA 3MRCB 5EZLB 3RJDA 3H6JA 1ZTXL 5JIKA 1NFDF 3TBYA 1U95A 4M7ZB 1NBYB 2P4AB 1GC1L 4G6AD 5I2IB 5A43C 2Z0BA 1AC0A 1P4LA 2OJZL 1YA5A 2P45B 3G5VA 4P59H 2VAAB 3VE0B 5I1LA 1MCKA 1P84K 2GITB 2HMIC 3ZE2E 1XR8A 2CQVA 1DR9A 3MJ9L 2X4QA 3UROR 2AJSL 4F7PA 4PV9B 5DI8B 3KPQB 1EV2E 3DGGA 1NMAH 4NWUL 2NY2C 4EBQL 3GBMH 4D3CL 4OJFH 1BQLH 5HHME 1ZLWH 2X05A 2DLFH 5KAQG 1DN0B 1T20B 4GAJH 4PS4H 5AD0A 5IK3A 1FE8H 4JPIA 4WDIB 3V6FB 5SX5K 1WQVT 3D85D 3L3OA 1I8KA 3I02B 5EOQL 2WBKA 4LLWB 3Q3GB 5CSBA 3D87B 3IXAA 2Q8BL 1INQB 1VERA 2NY1B 4LLQB 4UIMA 5CGMA 3CU7A 4LVOB 4X5XA 5F1IA 4E42A 2NQCA 3KNBB 3GM0A 1F58H 3DETC 2IALB 2V2XB 2YPVL 3MRIB 2B8OT 1G6RA 1QBLL 3BOVA 1CTNA 4TULH 1GGBL 4L3EB 1KELL 1VFOA 5F88A 1FGVH 4ODHH 5E4IA 4BZ1L 4F58L 1AR1D 1NC2B 3BUYB 3EDFA 4LPXA 4HK0B 1FZOA 3RIAF 4GW4A 5H37H 2B4CC 1NJ9A 2FX9L 3R06B 5IQ7L 1UWGH 1RJZB 1IL1A 1TJIL 3MLPA 3WNOA 4YUEH 5AUMB 1RUKH 5I1GL 2CKNA 2OXHA 2ADJA 2P5EB 3JWOC 4BQCA 2XZAH 3VFWB 1J1PL 5BXFA 5J4MA 3AY4C 4HS3B 4MD0A 1C08B 4H5SA 1U8QA 1RFDH 5ILTH 2BVOA 3TO4B 1FV1B 5GGRY 3VXRE 3GB7B 5DFVD 2V5TA 3BP6A 4RMQA 4TRPH 2Y7QB 3D0LB 2ZJSL 1RHFA 2W9EL 2CLRB 1GSMA 4JGMA 5C0DA 3KLHD 3O3BB 3TO2B 1FVEA 1ES0B 3P4OA 5DC0A 3ILPB 3MCKB 2Q1EA 1WCQA 2N7AA 4Y16C 4HCRH 3C5ZA 2Y06H 2OZ4L 4Y1AE 3VXMD 5SWZA 5A3IC 3BEVA 1SVZA 3Q6GL 1HH9A 3GSRB 4PJ8A 4ODVL 2BY1A 2NX5A 4UV7H 1MHCB 3MJ8B 3U4AA 3K8LA 4X7FC 1KIQA 3P0VL 4F2MA 2ADGB 4YHIA 3MC0A 3G6JF 3ARFB 4PR5B 3VGFA 3VWKC 4RIRA 5EZIL 5GRVL 5L6YL 3U2SB 4MXWH 3E6HB 4RZCA 1GRWA 3TZVB 4HGKC 5EU4B 1OW0A 3T3MF 1JGUH 1I3GL 1Q9LA 4HFWA 2FLBT 1TTFA 1NUNB 4RCAA 3U0TB 4DVRH 1AKJA 4JDVB 4N9OB 4DGIH 4I3RH 4NBZB 1QSFD 5J6GB 3RTQD 1V7MH 2VKWA 4BFIA 3QCVH 2PW1A 3N1FC 5JO5A 5TF0A 1YUHB 4G8GE 1LEKB 4PGCB 4X80L 5EO9B 5CIPB 4KK5D 4LLYA 3ZYJA 4TVPE 1P7QA 1KJVA 5J11B 3FT4A 4MLIA 2NXZB 5AWNL 1DBJL 2QEJA 1SQ2N 5IHBA 1Z3GL 3PF2A 2QKIA 3L7EB 5DR5L 5T1KD 3HRPA 4KMTH 4KRPC 3TBWA 5JW4R 5JORA 5JXEA 1BEYL 4CDGC 5DK2A 1GOFA 4PJHB 4XNXH 3D39B 2EYRA 1J87A 2NTFA 5HY9B 4R0LA 1FO0H 5HHVL 1EEZB 1G7MA 1G1CA 3NCEB 2YD7A 2BVPB 1OARL 1ZT4B 5KSAD 1C7SA 3MXVH 3QCTL 3IETB 1YEHL 5E6ID 2XN9D 2DQUL 3R0MA 3GJFB 1CD8A 4JCMA 5FM4A 1A6WH 3IRZA 4QT5A 4KDTC 4L8SA 4UU9B 4PJ7E 2NY4D 4R7NA 1FG2A 4R7DA 4BYHA 5IHZB 3SDXF 3IGAB 2J2ZA 2BHZA 3WFBH 4JFPB 5C0IA 3VGBA 2VZSA 3EJYC 3FQRA 1I8IA 3AXLA 4JJHA 4EJ1C 5IB2B 2Q3AA 2J6EA 2JB5L 5IJVB 4KKNA 3PWPA 4U6YB 3CK0L 3WLWD 4K3DH 4JFZH 4NWTL 1OAYH 2VN7A 4FQCL 1MCOL 5FGSA 4NQCB 4P59L 2Q87A 2GQHA 4K07A 4P2OB 4GLRI 1H9VA 5B4MD 3IDGB 3T09A 5GGVH 3X12B 1LHZA 4ERSH 5C0CB 4NSKA 3PP3H 1NMAL 3KPOA 2NY0D 3GBML 4HUUA 1BQLL 4GAJL 4PS4L 5GS2H 3VRLE 4X6BB 1FE8L 3C5JA 1HZHL 3V0VA 2EEBA 1FVDB 4FMKA 3VXRA 3C8KA 3H8NA 3T1FB 5ID0A 3MBEC 1UXWB 5JR1L 4M7LT 1N2RA 2BSSB 3SDCD 4EIZC 2DBJA 3TBTA 4F9PA 5ITBH 5F8RC 2VXSL 4IEFB 1EJ6A 3VU2A 4YXKH 2HH0L 1KB9J 5KBNC 2AJYH 3HCVB 4AEEA 3PL6D 4LVOC 4KHXL 3SKNB 4MJIA 4Y1AA 4ENEC 1F58L 2X7LB 4P49A 3TEUA 1K4CA 3TH4T 1GGIH 4HS6A 1UZ8A 3NFNA 1GAFH 1QR1A 1C8PA 5C08E 3PNWA 4IOFC 1KCLA 2H26B 4TULL 1UZ6F 2BSED 4I2XB 5FGBA 5EUOB 1FGVL 4ODHL 3S36H 3P9LA 4J2XA 1W72H 3WD5H 1PZ5A 5GXBB 5DTFA 4JRYB 4KTDH 3RVUD 3ARUA 4PRBB 1UWGL 5EBWB 3TJEH 3MV7D 4J7RA 4XCNA 3BJLA 5FKAB 4P46C 4APQA 3W0WD 4WWKA 5I1IH 1OAZH 1RUKL 2YD3A 2WWMC 2EIDA 5IP4A 2CIKA 4KKBC 4WI6A 3TF7C 4I0PB 5JHDD 2CIIA 5ILTL 3EO9H 3RQ3A 1TTGA 4F7EB 1MSPA 1X9QA 4LFHD 1MLCA 3ARBD 3QH3A 4Y4HB 5ACZB 2A6DA 1JCKA 2WQRA 1QRKA 1XT5A 2JK5B 1L6XA 2CSPA 3BFOA 4GAYA 5C09E 4D0CA 3QIBD 3C60A 1Q0XL 3FB5B 5ADPL 5BV7B 4X0KB 4WUUB 3MV8B 4HMEA 5E8NA 3QFJA 1KGCE 4XHJD 2C26A 3QUYB 1MCEA 4KQ3L 2HVJA 2GUOA 3HZVB 1ZA3A 2OJEA 3B5GA 3U30B 1RZIA 3RA7H 2D31A 4GG6B 3LSOA 5LAXB 3CMOH 1JZ6A 4PJ9B 1CLZH 1OL0A 2VLLB 3IKKA 4OLUH 2AJVH 3VCLA 3GMNA 3K74B 3MACH 2ATKB 4LRIA 4KXZI 3BIKA 1PGRB 3HC3H 1KG0A 4ZS6C 3GSXA 1CL7I 4BFBD 5ISZB 1HCFX 1T1YA 2VIRA 3O6FC 3RVVD 3W9DB 4J3UA 4PJ7A 3WFDH 1H5BA 4LVEA 2W9LA 1YPZA 3AM8C 4FQXC 3SOBH 3ZZ1A 3REVA 3DX9A 3SDDD 4LEXH 2EZ0C 5D93B 1J8HD 1U3HB 1RY7B 2ZOLA 4L3CA 1YY9C 5AG8A 5T5FH 3WFCH 4YWGH 4OGYH 4XPBL 3MRGA 5FM5O 3KWWA 3UAJD 3QCVL 5IMLA 1ZHKA 4XBPA 5GS2D 1GZPA 4PJGE 4HH9B 3RGVC 2VH5H 3KXFD 3RKPA 2NXZC 1BF2A 1J1OL 2PYFB 3MRBA 4JVUA 1I8LC 4JZJB 3BH9B 3IFNH 2C9AA 4KMTL 4F57H 5INDA 3GMOA 4Z7NE 4ODSH 4HK3J 4G9FD 1J0ZA 4UMGA 1UA6L 3DV4A 3JZ7A 5D96B 3UDWA 3T3PE 2BNQA 4B0MM 1FO0L 3X11A 4PREA 3DXAD 5FGRA 3SBWA 1QSZA 4PJEF 4ODXA 3QNZB 4XP5H 5I30L 3B2VH 3ULVD 4NO2A 3I6GA 4YBHA 2JJTA 1JPGB 2R2HB 3S37L 3AS2A 3LKQA 2FYYB 1A6UH 3PDDA 3WFBL 4PBVC 1CXEA 1MAMH 5E00B 3Q5TA 2ED9A 3OJDB 3RWJA 1DQTA 4IHOA 5C08A 1YNTB 3IVKB 2Y4SA 5CJOL 3L5XH 3TP4A 4K3DL 4JFZL 4PRNA 3SGJC 5IB3A 1B9ZA 1FFOB 2ZUUA 4JPKH 2GKIA 1ND0B 3QWOB 4H25A 1U8MB 3CFBB 5GGVL 3A0OA 3ARYA 4PJXB 4H0GA 1HYRC 3I6KA 4ELKA 3U46B 4U1LA 2QR0B 1PVHA 3H9YA 4NNYB 2AGJH 1D9KB 2DL9A 3LEXA 4MQ7B 1BHGA 5K59F 4PJBB 2HFEA 4ORGA 5DHVB 4RX4A 1R0AH 1IAII 3GSNA 3QNXB 4G6FD 2AK4E 5EO0A 1LD9B 3QQ3A 5JPNA 1H15B 2Z35A 4XMPH 5ITBL 1W8NA 4YXKL 4GXVL 5HSFA 1WITA 4UQ3A 3HLAA 4Z7QE 2AJYL 5CJXA 2UZXB 3L5WA 5IOPB 1OAUH 2AJZA 3I9GL 3S4SG 1CGVA 5E7FA 4O51A 4JFFD 4JZNB 1W0YT 1I1AD 4JM2A 4L3EE 4Z95H 1HIML 3P9MA 1FNAA 1IKNC 1N7ML 1CWVA 2K7PA 2YKLH 3PWUA 1WWWX 5JQ6H 1HHHB 3S36L 4JZOB 1W72L 5CZVL 3WD5L 4I4WB 1FZMB 3ULVL 4E5XB 1IGIH 3IB4A 1MIEH 1SVCP 2XKUA 3JV4A 3TJEL 4Z78B 1FYTA 1BBDH 1YMHA 2P5EE 4JR9H 1T0MA 3IJYB 3RWFB 3ZSTA 4LASL 1D5MB 4PP2B 3ZL4L 4OLYL 4P4KC 4PLOB 4JKKA 5BJTA 5I16A 1A14H 3IDUA 3AAZA 4OZFA 2BXYA 5DMGD 1IGYA 1SYVB 4RMSA 3HG1B 3NIDF 2XWBB 4Y2DC 4ONGH 1XAUA 3QNYA 3GJEA 3VA6A 1YEIH 4HJJH 2B2XL 1WBYA 4JREC 4W68A 3C5SA 1FVCA 4ZAKB 1NANI 4OQ1A 5CSGA 3RY4A 5BV7C 1B0GA 2VZ1A 5GSRA 2VDOL 2AABL 3IJHB 2FL5A 1QBBA 2E27H 1CGYA 3WUWA 4AK1A 1MCJA 3NZ8B 5FXCH 3HE7A 4KVCL 4EQ2A 2VDNH 3RA7L 1CLYH 4HIEA 1ZMYA 3CMOL 3CCHA 5HYJA 1UKQA 3NCYP 1KXVC 1CLZL 1II4E 5J12B 1I3RA 4OLUL 2AJVL 1S9WB 2VDPL 3MACL 5DVKA 1XCTA 1BIIA 3B3IB 4XCYB 3HC3L 2P42B 5E2TL 2AKRA 5C71A 5D7LB 3QQ9D 1AGCA 1Q9OB 3ZDYE 1WZLA 3MRCA 5EZLA 1T2QL 1XGUB 1U8IB 2YUXA 5B3NA 5ICYA 5L7XH 4MNHB 3S35H 1LO4L 4RDQG 5T5FL 3WFCL 4YWGL 1CZ8H 3FRUA 4OGYL 5I2IA 1C5CH 3NN8B 1KULA 3GK8H 1UCTA 1FSKC 1NANH 2GITA 5DHXB 3SCMB 3QDJD 2GI7A 3LB6D 4RMRA 1ORQA 1WTGT 4FG6C 4M8QA 2FD6H 2NZIA 3EZJB 3KPQA 5DI8A 3ULUH 3RDTA 2JJWA 1PW3A 4YJZL 3GKWH 4HBCH 3OKNA 2E9BA 4WI7A 3IFNL 5SWSB 5I66A 1T20A 2FGWL 5EC2B 4ODSL 4PJHE 4WFHE 5EU6A 1I1FB 1BOYA 3D39E 3V6FA 1SJVA 2GFBB 3R0NA 4MVBD 4D94A 5KG9A 1RQ5A 3LKRB 4XNQB 1D5IH 5E08H 2XTJC 3WXWL 4LLWA 1PG7W 3Q3GA 1T6WA 4HAGA 43CAB 4OUUB 1J0IA 1CL7L 1OSZB 4KJQC 4DJMA 1INQA 2BY3A 5EOCH 1DZBA 4LLQA 1OP3K 3FQNB 2PYEB 4XP5L 4MXVE 4WHYG 2IALA 2WV3A 2X44D 4QNPF 3MRIA 5HGAB 4R3SB 4YDVB 1A6UL 3QHFH 5E6ZA 5JZ7D 1MCHA 1MAML 5BRZD 1S5HA 2CXGA 4N8VG 1EERB 1AXTH 3GNMH 1NC2A 3QG7L 1QBAA 3BUYA 3FN0H 4HK0A 4Z0BL 3T0XA 4NQCE 4KKCC 3OPZH 3L5XL 1I9EA 4EUPH 4LIQH 4EXKA 4JPKL 4CVWA 4HKZB 4KTEH 3S4SB 3KLAB 2DIAA 5C0CE 4LSUH 1OQOA 5D7JD 1BQSA 2NNAB 4RSVA 5D70H 3GBLA 4YGVB 4HS3A 1Z2KA 1C08A 1OHQA 3DV6A 3MV11 5DRWB 3ZE2F 2AGJL 3NPZB 2BNUB 3TO4A 4WFFE 3C09C 2ICWB 5E56A 3GB7A 3JV0A 4HUKB 3TIDA 3EBAA 4QRRD 1NCUA 4CMMB 3AS3A 4PBWD 2Y7QA 3D0LA 4TQEH 1MFCH 5JW4Q 4C4KO 2CLRA 1RZJC 1MI5D 5I75B 1RIUL 3TO2A 1ES0A 3O4LD 4ONOA 1BM3H 4JM4H 1JP5A 5MHSD 3ILPA 1QFWH 4WJ5A 1FLTX 4V2BA 3PWVB 1BQHA 5FK9B 4R97C 1BVLB 3H3KA 4L4TD 4EXPX 1R3KB 4K23H 3GSRA 1AHWA 2WBJB 2ZKHH 4J3WA 4EN3C 4HEPG 4ZOAA 1MHCA 3MJ8A 1FAIH 1UC6A 4DKDC 1MF2H 4Z76A 1BZ7B 4I2XE 4Z95L 5F8QC 5EUOE 1EEYB 3ARFA 5D1ZB 1S8DA 2J8OA 2R23A 3LD8C 3QHZH 3E6HA 4M8VA 2YKLL 4DGVH 4JRYE 3TZVA 5EU4A 3SQBA 3BHBA 3QUXB 4OBSA 2A2QT 3T77A 1MIEL 1FFRA 3UJTL 4HJ0D 2Z8WC 3U0TA 5JMRA 3TCXA 4QRPD 4LAJH 5J57B 1BBDL 2O61B 5KOMC 4JR9L 4YHPB 1P7KB 4JHAH 3CSGA 4MHHG 4HUMB 3T1WA 5F7LB 4CAGA 4HIIB 4A2LA 5L0QB 3D2UB 1YUHA 1LEKA 4PGCA 2QSCH 5EO9A 3QEHB 2X1PA 5I6XB 3D5OF 1J86A 2BERA 4ONGL 3FOLB 4WUUE 1JWUB 3MV8E 4HJJL 5EU7E 2PO6C 4ZAKC 1P2CB 4OI7A 3RJQB 4NQTA 4CJ0A 4HAFA 4YBLC 3QDGB 5FOBB 2A6IB 2HN7B 2VDKL 3E0GA 5JOFB 4U1HB 2B7DT 3O3DB 4PJHA 4GG6E 3D39A 4XP4H 5HY9A 4JDZB 4M6OH 2B20A 1A4JB 1DJSA 1B0RB 1K8IB 1OCWH 3IETA 3IDNB 2XWTB 5ISZE 4MXQC 3GJFA 1CGTA 4JAMB 4RMWA 5FO9A 4P2RD 2OL3L 3QQ4B 1MCFA 3EJJX 2P48B 3V4VL 2CJUL 3IGAA 4YFLF 5JLZB 3MLXH 2Y6SC 4URTB 4JFPA 4PJAE 1CD9B 5IB2A 5GJSL 4KROD 4MAYA 1WV7T 2YXMA 2VR4A 4IRZL 5FHBL 5B3JE 5IJVA 4ZOBA 4U6YA 5GS3A 1BOGB 3P0YH 1E4KC 2EO1A 1JHKL 5H37G 1CZ8L 2EXYC 4KJPC 4Z8FH 1C5CL 1UB5B 5GZOC 1S5IH 4KQ4H 1NCTA 4FFWC 4P2OA 4JRWA 1DQDH 3Q48A 4PJCB 4YNYB 1CFNB 3IDGA 2GTZB 2BSTB 4U6VH 5JA8B 2FD6L 3ULUL 4QXGH 1MQKH 2D7OA 3GKWL 3HI5H 4U1MB 3VA2C 3DURB 5CD3B 4YGAB 4PRIB 1G7HB 5I1JL 5IQ9B 4IMLB 4XPFH 3T1FA 2DN7A 1VEMA 3WCYA 5JTWA 1UXWA 4GKZB 5FUZH 1D5IL 1M1SA 1WIPA 5E08L 3NABL 4TN9A 3RZCC 2H2PD 1JN6B 2BSSA 4FQJH 3WE6B 2O5ZH 5I1EL 1FJ1A 2PCPA 4LU5L 4K8RH 1J7VR 5EOCL 3STZB 3DTXB 1TVHB 2YS4A 1DLFH 3HB3C 2IAMC 2XTLA 4MGXA 4NT6A 4D2NA 3EDJA 1RJCA 3J8F7 4R26H 1JBJA 3VXSD 3QHFL 1BJ1H 2H26A 4IRSB 4LDOB 4Q9RH 2HTLD 4I2XA 2BC4B 2F9BT 2B39A 4I1NB 4JO3H 5EUOA 3NGBC 4M7LH 2QQQA 4PJ7F 1AXTL 3GNML 3U1SH 1QO3B 3FN0L 2VTFA 5EWIH 4PLNC 4JRYA 5J56B 3OPZL 3RWEB 5JW5B 2JTDA 5EBWA 5CBEA 4MCZA 2WUBL 1Z9OA 3STLB 5C0ND 4PJXE 1JMXA 3MRPB 2MOVA 3QIWB 2C4XA 1GIGH 1F6AB 3DLQR 4WO4D 5KS9B 4I0PA 4PJBE 5IUSA 2XPGB 1LQSR 2GT9B 4F7EA 2D9CA 4Y4HA 4TQEL 1CXLA 1HWGB 4JO1H 3RZWA 2HAZA 3FB5A 1BM3L 4JM4L 3AMLA 4WUUA 1WC7A 4X0KA 4X6DB 1SBSL 1TZIB 5T3ZH 2EDKA 3VXUB 4AEHH 2D7PA 2JJSA 5IB1B 1R6VA 3QUYA 3WIHH 4F8QA 1IQDB 1G9NH 2CLZA 4I0CC 4K23L 4L1HA 1XEDA 4J12A 2WBJC 2ZKHL 1HHJA 3SO3B 3JV5A 3SDYL 4GG6A 4KZEH 2CDEB 1MF2L 4PJ9A 1A3LH 2VLLA 1DVFB 2IANB 3ARDB 2DQEH 2ATKA 3QHZL 3PV7A 1A7RH 3O2VH 3VD9A 4LOUD 1O5DT 3QUXC 2IPUG 3MLVH 2QQKH 4OZGE 4XWOC 4XNZB 2UZIL 1IGMH 3I84A 5FO7B 2VOTA 3LRSB 3BN9C 2CLVB 2X1XR 4JHAL 1S9KC 1AJ7L 2X4UB 4ZTPH 1XZ0B 1U3HA 3QIUB 4I13B 5I73B 1OTSC 4WI3A 1XH3B 5JIHA 4IDJL 1IGCH 4LHUA 4TUOB 4YHKL 3HG1E 4C55A 4ZDHB 2O26U 4XVUD 2A74A 4HH9A 3UBXA 4TSAH 4NOFA 3QZWG 1CDBA 4UNTA 4AT6A 3BH9A 1EK3A 3GUTB 1EH9A 5CCKH 1J18A 4NIKB 3EDKA 3Q0HA 3WUZA 1VEOA 3MRJB 2NY4B 2PTTB 1H3WM 4XP4L 5D1XD 1T2JA 4L9DA 3AB0B 3VFOB 5K9OB 5LQBH 1OCWL 2IH3B 4X4XA 1MPAH 4AENB 4K71B 1RUMH 4JM2F 1Z9LA 1Q94B 5F6HI 4G6AC 5D7LE 3PIQB 4YH6A 2DQGH 1JPGA 2R2HA 2HJKB 3BPNC 1IARB 2OTPA 3OAUH 4FQLH 3MLXL 2VERN 4N9GB 1FNEB 5C0BB 2PTVA 5E00A 1GH7A 4I77H 1QVOA 3BPOC 3HZMB 1YNTA 2NY0B 3TT3H 2DJ4A 4NOBA 2ZUSA 4JG1H 1OGAD 4JFHE 4Z8FL 1S5IL 8CGTA 4KQ4L 1ND0A 2A9NH 4UT9L 3IS0X 5GGQL 3QWOA 5I0DA 4LSPH 4Z7WB 1U8MA 1KPVB 3ZT6A 1G6RH 3CFBA 1G7JB 2QQLH 4PJXA 1AO7B 3WO4C 2PUQT 3OAZK 1AXIB 4U1KA 4U6VL 5SWSE 4NNYA 1MQKL 5EUKB 4GKOA 5IGXH 5I1HH 1EPFA 3HI5L 2D4FA 4PJGF 3O41B 4E41D 4MQ7A 1YJDH 3CSYB 3B9KB 5DHVA 1KNOB 3P11H 1OD7A 1T21B 2D0GA 2OS7A 4X8JB 3OX8A 3QNXA 5FUZL 4DOHB 1LD9A 4J6RH 4FQJL 4Z7NF 3SE9H 2RFXB 1P4IH 2O5ZL 4C59B 5ID1A 3F7VA 2PYEE 1AR1C 2VQ1A 4QO1A 3TPUB 3BPLC 3ALXA 2FH6A 5HYSG 5IOPA 3TVMD 1DLFL 5DYOB 3THMH 5D6CB 3RVTD 4R26L 1F5WA 3CH1A 3W0WB 2NR6D 3ZKSD 3F58H 4Y4KB 4B7IA 5JHLH 1YEGH 4Q9RL 3HNTH 2EIBA 1HHHA 3C2AH 2R0KL 5I1KH 1LE9B 4I4WA 2DRUA 1IM9D 4E5XA 5EWIL 5GGTA 3GJFK 3TNNA 5DFVC 3K80A 4Z78A 1HKLH 4FTVD 1P69B 3IJYA 3KLHC 4FS0A 2CDFB 1BX2B 4WEBL 1FO0B 3RWFA 5GIRB 4Q97A 5E70A 5KSUA 1DANT 4CGTA 1X5IA 2GW5A 1N4XL 5ETUA 4U2ZA 3V0WL 4EI5B 5IVXA 1BWWA 3RY6A 4PUBH 1FAKT 4HC1H 3KHOA 2AEQH 1HYSD 3NPSB 1JYXA 2FDBP 1I75A 3HG1A 1C5BH 3RWIB 2FBJL 1YQVH 2XWBA 4P5TA 4JO1L 4QRTA 3V7MA 3E2HB 3QWRA 1FLRH 3H2WA 3UTTE 1PZUB 1DDHB 2F8VA 1YY8B 2W92A 5F9JB 1ZGLP 5KVMC 2B1AL 4AEHL 3DIFA 5L2JA 3WIHL 3BSZH 4YIQB 1F42A 5GGSB 3F7YB 3NZ8A 3MRLB 1WUNT 3QJFB 1XR9A 5DT1L 2XZZA 4KZEL 1R5VB 3KAAA 4ZG1A 4MNQE 3BQUB 4WENB 4Z7QF 1A3LL 2JCCB 5BQ7B 1S9WA 2EEDA 3QDMA 3FCTB 4QHUB 2AEWA 3B3IA 4XCYA 3O2VL 3RTQC 3SDAB 4G8IA 5D7LA 1KEGH 3UP1A 2A6JA 2QQKL 1Q9OA 1MY5A 4KK5C 4KRNA 4YDIL 4ISVA 3BAEL 3FQWB 1U8IA 2K3TA 4U1GB 4OCNC 3ALPA 5EU5B 1PJ9A 3ZE0E 2WZPD 3D3VE 1A21A 5E5RB 1H3XA 2VSCA 3BKMH 4ONHB 1YMMA 3NN8A 4GRMB 4G9FB 3T0EA 1CICA 1OT2A 3ZHLA 1MCQA 2GSGA 5DJ0B 1NEZG 1I7ZB 1JTPA 4TSAL 4YR6A 1TLKA 4RA0C 3OR6B 5KSAC 1L7TL 4ONFH 5DQJA 2CK0H 2J6EH 5E6IC 3GSVA 3QDGE 5SWSA 4YDKH 3L9RB 1KACB 2DQIH 4KZDH 4AL8H 1CVRA 3HAEH 5EC2A 1W72B 4QHNB 1UKSA 5J13B 1I1FA 3MV9B 4TUJB 5EH1A 5IBTH 1CI5A 3LKRA 2NY4C 2HFTA 1MFBH 1GYAA 4YFLI 4JFXB 3PUCA 2ATPB 3AB0C 2MKWA 1OSZA 5JW3H 5GS1A 2C3VB 3FQNA 3GHEH 1T7VA 4WCYH 3CXHJ 3TBSA 3TBVB 3WLWC 2WSKA 3SKJH 3EYUH 3C5ZD 2DQGL 3P77B 1X5ZA 1TZHB 1HH6B 5SWZD 2X4NB 4QOKB 5HGAA 4R3SA 4WW2B 4KV5E 3OAUL 4PJ8D 3KPRA 5TF1H 5B4MC 4JANA 1MHPL 2WBWB 5DUPH 1NKRA 2NX5D 4I77L 4PRHA 4EVNB 4LCCB 4Q58C 3WSQH 3WN5B 1YDPB 2NY0C 3TT3L 3I3BA 3EDEA 3ZDYF 2V9TA 5DD0L 5BVJB 5F1NB 2OMNA 3F65A 2BVEA 4NQVB 2Z4QB 4PJCE 1F8TL 5FHAH 1KN4H 3FAWA 2A9NL 4HKZA 3KYMA 3KLAA 35C8L 3N1PC 3PGDB 1ZT7B 1G6RL 3SDCC 1A3QA 1WZ1H 1IFHH 2FJFB 2QQLL 3MNWB 2XZCH 1UACH 1AKJD 2IG2H 4PRIE 1VACB 3A6CL 1YNLH 2QSQA 5IGXL 5A16B 3PL6C 4GW1B 4OB5L 1EDQA 2SEBB 3UPAA 2ICWA 1YJDL 2A83B 4CMMA 1D6VL 1EBAA 2GY7B 2QBWA 5GGUB 1KCVH 5IHUH 5ENWA 3IXTB 4LVNC 2DLGA 5HXMA 4J6RL 1P7QD 1G0DA 3F12B 1V8HA 3SE9L 5DA0B 4PJHF 1P4IL 4IIQB 1CD1B 4JE4B 5FK9A 1BVLA 2F54A 3VG9C 4YPJA 3HUJB 4D8PA 4M1GH 1A2YB 4JHZA 3RVUC 4QRUA 5HHMD 4LGRB 5E5MB 3V6BR 5JXED 3THML 4N0FA 5H35B 3K46A 5FM5M 2DYPA 1BZ7A 3MJ9A 4Z7OE 3F58L 1EEYA 4Q7DA 3WEXB 1YEGL 3HPJB 12E8H 5JHLL 3HNTL 5TE7L 1OAQH 2BVYA 3C2AL 1M05B 5I1KL 3NIGE 1RHHB 5IR1A 2VRAA 1AD0B 3ARBC 5C0GA 4YHOH 2O61A 4HKJB 1MJ7H 1E4WL 3H0TB 4YHPA 1P7KA 1R3IH 5D2LB 2Q86B 3QIBC 2BNRB 4KHTH 5KS9E 4LHQB 4YC2C 4DCQB 1PLGH 3X17A 4Y5XC 2BHYA 4XHJC 4HIIA 1YEJL 3FKUS 4PUBL 5EOTB 4ETYA 4YLQT 2IJ0C 2AEQL 3BE1L 3H7LA 3NPSC 4GQ9L 3VMNA 4AG4L 1C5BL 3EYSL 3W81A 4DVBB 1J05B 3F62A 3FOLA 5H8DA 4X6DE 5I76B 5LVEA 3LS5H 3E2HC 1FLRL 2M2DA 3VXUE 1P2CA 1MIMH 5LGJB 4NJ9H 4KKLC 5I74C 1BQUA 1JK8B 2VXUH 2BCKB 5FOBA 3ZLQC 1T04B 4OCYH 1QA9B 4U1HA 3O3DA 4A6YB 4TNWK 4MLSA 2P8LB 3RVVC 1U8LB 3CFJB 4PFEA 1F4XL 1TCRB 3NFPB 4JDZA 4XRCB 3LRGA 2IANE 1MVUB 5JIPA 3ZDZF 1DN2A 3VXRD 4HXBL 1A4JA 1K8IA 4I8DA 3SDDC 2HWZH 3OXSB 3IDNA 2Z8RA 4BK5A 4F7MB 1M71A 2XWTA 3I3DA 1DANU 2I07B 4JAMA 4BQ6A 2P44B 4XNMB 4RAVB 3UAJC 2AJUH 1QLRB 3EYFB 2OMBA 3OB0K 4DEPB 1NGPH 3F5WA 5EUOF 1KEGL 4MJID 4XNUL 4Y1AD 3NAAH 3ESVF 2VC2H 3DX6B 3OTTA 4WI4A 3BDXA 3VMOA 1MOEA 1BOGA 1IBGH 1FYHB 4MCYB 4X6EB 1QR4A 4IOIB 3BKML 4ZS7L 4J1UB 4QEGA 4RA3A 4PJCA 2VR9A 1CFNA 4YXHH 4IDLA 5I1DB 3B4NA 3E8UH 2GTZA 2YUZA 1OAXH 4UUJA 5CJQH 4JG0H 2VITA 3DUUB 3PV6A 4WU7A 4ETQB 2LTQB 3NA9H 4APQD 4WWKD 4M93B 2J6EL 2EH8L 4MWFB 4YDKL 2FHBA 4PRIA 1G7HA 1HILB 3B43A 4ZTOH 1ZA6B 4AL8L 3U7WL 3MNZB 1LE5A 1AE6H 3ULVC 1IZKA 2BVQA 5IQ9A 5IBTL 5FFLA 4GKZA 2WM0A 1RUAH 1MFBL 1U3JA 1P53A 1TJGL 4LARH 1JN6A 2BDNL 3U0WH 3HI6L 1MWAB 5FYLH 4TVPD 2WINB 5KVFH 4LVHC 4DKEL 3STZA 3C60D 4QXTB 5F1OB 4GG6F 3GHEL 4OCRL 1O0VA 1KIRA 4RWYH 1TVHA 2VDLL 3QFJD 1C5DB 3SE4C 4TPRH 4QRSA 4NYLB 3SKJL 2F15A 5DJ6A 3TPKA 5E4EC 5F7DB 4ZOCA 5C0BE 3GSNH 3I50H 3RWCA 4HIJB 5TF1L 2R15A 4IRSA 5DUPL 2BC4A 3SKMB 2A38A 1VADA 5FUCE 4IS6A 1P9MA 1QO3A 1EVTC 3RWEA 3EZ8A 1MRFH 2EH7H 5F3HA 3MRRA 3VG0H 1I7UA 1F4WH 4Z7WE 5ESVB 5FHAL 1KN4L 3I2CH 4L29B 5B3JF 1AFVH 3STLA 4P9ML 5KANG 1AP2B 1AO7E 4FA8A 1QFHA 3QXDA 5E1AA 2NW3B 1WZ1L 3MRPA 3QIWA 1JYVA 1F2XK 1UACL 2XZCL 4HMDA 1F6AA 3BMVA 5KS9A 2IG2L 1IKFH 2ZPKH 3FB7A 1YNLL 4P2QB 2GT9A 3BP5A 3DVFA 2QADD 3VXTB 1LEGB 3NCYS 1G7QA 4DOHE 5HHXH 3CVHB 3VFUA 3UZEA 5BS0B 1I1AC 2VLJA 1KCVL 4Y5VB 5IHUL 4IRJA 1TZIA 3A6OA 3P3YA 5IKCB 3VXUA 5IB1A 2P5WB 5IFHL 3EYQD 2A1WH 2YBRB 3G5XB 4LDLB 3DWTA 4M1GL 2YK1H 4OZFH 3W0WE 2XICA 1OQXA 2CDEA 1S7QA 1D7FA 1MFNA 1QHOA 3C2SA 4YEFA 4TVPL 5CZXD 1DVFA 4YX2H 2IANA 3ARDA 2BNQD 5B38B 12E8L 1OAQL 4UDTA 2V2WB 5MEOA 3RRQA 4KK9D 4YHYB 1R3HB 5D71L 1MFDL 5DMGC 4JFEB 3GM8A 4KY1H 5FO7A 3L3KB 3OHXB 2X4TA 3LRSA 1DLHB 2D7QA 1CDIA 2HT4D 3BXNB 4YHOL 4M5ZH 3GRWA 2CLVA 4MZ2A 5DD1H 2Z8SA 5DRXB 4MB4A 1MJ7L 1R3IL 2LFGA 2X4UA 1XZ0A 4JFDB 3QIUA 4K94L 2EDLA 5DJZB 4UAOB 3MXWH 2ZNXA 1XH3A 3RVXD 5C08D 3TFKD 4TUOA 4PGZA 4WFGE 4PJXF 3EOTH 3O11B 2YPKB 1N6QH 3K8KA 4TNWF 4C83B 4XI5D 5LGKA 3O2DH 1BJ1J 5HPOA 4NJ9L 5FYLD 3GUTA 5DJ8B 3O6LH 1TVDA 2VXUL 4N8PA 2ZCLH 1CG9B 3M45A 3QEQB 3PABB 4OCYL 4H0IA 1G1YA 1S7XA 1YEEH 3MRJA 4F15B 3O0RL 3QQ9C 2YUVA 2OI9B 2PTTA 4OM0L 4EUPB 2VZOA 2LABA 3PGCB 2JCCE 4RX4D 3VFOA 1A02N 1SY6A 4BUGA 2WNGA 2IH3A 4XGZB 3N50A 2HWZL 4MJ5B 5CGYD 1Q94A 1S7VA 5JMOC 3T2PA 2C1PB 3WKMH 2AJUL 5CJBA 1KGCD 1NGPL 1C16B 3LB6C 4N9GA 1FNEA 5KVDH 2OSLA 5C0BA 4YDJA 2DLIA 4JM2D 3VD7A 2A73B 2NXYD 3HZMA 5M7QA 4GXUN 2YD5A 2D0HA 4Y4FB 1IBGL 5K9KB 4G9FE 4HCRA 1TDQA 1VEPA 1T6VN 3SE3C 4HKBB 3P0GB 1R24B 4FQHB 4MVBC 3KS0H 4Z7WA 4K3JH 4YXHL 1KPVA 5IVXF 4FXKB 2DS4A 2WIIB 5FECB 4JG0L 1AO7A 1FYTD 2LTQC 3WYRA 5JDSB 1RULH 5EUKA 1UWXH 4M93C 2I9LA 1N59B 4LPCA 3BO8A 3MV9E 3O3EA 3MYJB 4PRPB 3CSYA 4ZTOL 3B9KA 1AE6L 1MCRA 1NDMA 4NZTH 3J7HA 4XCEB 4X8JA 4DGYL 4OCSH 3RUGB 1RUAL 1SJHB 2V2TB 4AIOA 5JZ7C 1I9RH 3KPPB 3V7AG 1IC1A 2RFXA 4JN1H 2OK0L 4WVRA 5FYLL 1A7OL 4NNXB 1KLGA 5KVFL 4I48B 3QPQD 3EYOB 1F3JB 3GIVB 5LXGH 4DKFH 3MJGX 4RWYL 4HWEH 5DD6B 1J10A 1XF5B 4QOKE 3S5LB 4TPRL 1CXHA 1LDSA 3LEVL 3VXNB 1EUUA 4NO3B 3T0WA 3W2DH 4OLZH 3HI1B 2LU4A 3GSNL 3I50L 4OLWH 4PYHA 4Y4KA 3TCLA 2AJ3B 5D7JC 3HE7D 1OAKH 5HGDB 5IFAH 1DBBL 1HHGB 4W4OA 5KZCD 1LE9A 1MCNA 3MROA 3IAPA 3FO1B 3N1GC 1QEWB 1MRFL 2EH7L 3VG0L 4NM4H 4ZD3H 4B7LA 3GBNH 1S9XB 1S7UA 1AFVL 2CDFA 1BX2A 3E3QE 1FO0A 5GIRA 1KCRH 1S7RA 1X5LA 2OTUB 3O45B 1QACA 4EI5A 3KYNA 2ZPKL 1J11A 1HDMB 4JFFE 3RWIA 4EOWH 3VGAB 3HNSH 4L8BB 5CILH 3DYPA 3V9FA 1FFPA 5JW4N 2DTSA 2BHUA 4Q2ZB 3OAZH 1DDHA 3V79C 3KHQA 1RPQA 1UG9A 1YY8A 2Z93B 5F9JA 4F3FB 4PJ5B 3HUJE 4N90D 2L7UA 4NKMA 1U8HB 4NP4H 1MEXH 2AV7A 3RDTD 3B8YA 4GKNB 5DO2D 2Z31A 5LBSH 4YIQA 5GGSA 2YK1L 4R96B 3TWCH 1P5UA 4HJ0C 3FRPA 3MRLA 1PEZA 3QJFA 5EU6D 1ZT1B 1I85C 1DBMH 3UZQA 1R5VA 3FFDB 3EOBB 3BQUA 1I8LA 1J0YA 1M7DB 5BQ7A 4YX2L 4YQXH 2DL2A 3FCTA 1DBAL 3HMWL 1F6FB 3SDAA 4NDMB 2NY1D 4YFEA 4NC1C 1LNUA 5C8JB 2W1NA 4KY1L 5IWLC 3OAYH 1NFKA 3BESR 1I7RA 1MUJA 4JY6B 5DD1L 1L0YA 3MUGA 5DD5H 3TESA 5GJTL 4GAFB 5FUOH 4L3ED 4UAOC 5CD5D 3MXWL 4L3AA 3LMJH 4QXUH 3FTGB 3GJFH 4GRMA 1NC2D 1MCLA 2P49B 5T33L 4PY7B 5LWYH 3EOTL 4GRLB 3ZYZA 1N6QL 4QHKJ 5DJ0A 5D1XB 2FX7L 1I7ZA 1N3NB 4NNPH 1MRDH 4GS7C 4OD3H 1NCDH 2XG4A 3O4OC 3SGKC 3BGAA 5D2NB 2X4SB 3O2DL 1NBQA 5MENB 1HHIB 4BH8B 1W2KT 1W72A 2V7HA 2ZCLL 2EDQA 2V5RA 4D9QE 1EAPB 2W65B 3MV9A 4TUJA 3MODH 1YEEL 4ZUWA 2IFFL 5BMFL 5EORH 4OZIB 3TO4D 3BUTA 4G8EB 4JFXA 2ED7A 3ZDXF 2ATPA 2WIMA 1ACYL 4LGPB 4XTRD 1Q38A 4KROC 3NTCH 5DMIH 4AIZA 2HVKA 3WDHA 3HPLB 4UQ2B 3TBVA 4DK6A 3PGFL 4YHMH 3WKML 4QOKA 5DVOA 4Y88A 4N1EA 3S7GA 4WW2A 4DAGH 4M6MH 5KVDL 2EDWA 4UINH 2DKUA 1NUDA 4EVNA 4LCCA 4JGJA 3BRFA 3WN5A 3ARFD 1JNJA 1NMCC 5FOJA 1J0HA 4HLJA 5BVJA 5F1NA 3FQUA 3ARXA 1MHEB 2Z4QA 1ADQH 4NQVA 1ZLWK 3TZVD 4Z6AT 2E7LA 4MDJB 3PGDA 5HVGB 1ZT7A 4K3JL 3MMEB 2H2PC 5DJ2B 3ZT7A 4AM0B 2F5BH 2FJFA 2WLZA 3MNWA 3G5ZB 4OT1H 3DRQB 3WIIH 4A2MA 2ICEA 3QT2A 5IEKA 1VACA 4XPGH 5L2KB 5DJAB 2SEBA 2A83A 3VRIB 3EO1B 2AXFB 1D5BB 5FO8B 4H20H 4K7FA 3AS1A 2PTUA 5GGUA 1FNHA 2J5LB 4OCSL 4AQOA 3IXTA 5IJKA 4RDQF 2DQJH 3SN6N 3MUZ1 1UEYA 1RI8A 2HTLC 4IIQA 4HPOL 3KPSA 3VI4F 1CD1A 2F74A 1JF5A 5DS8B 5LXGL 1CU4H 3TA3B 2YMXH 2VSDA 2A77H 1HI6B 5SX4I 3ROOB 2WP3T 1AIFB 4Y2DA 5E5MA 5H35A 3W2DL 4OLZL 5IM7B 5C0NC 1A7BA 3VFSB 5IROA 4JQVA 3D39D 1BLNA 2XZQH 4GKSB 3WEXA 3HPJA 4ZOEA 4HIXL 5IFAL 3BT2L 4RRPA 1M05A 3TBYB 1U95B 2R2CA 4WO4C 3TV3H 4QRRE 4YHNB 4KV5F 4V1DB 1W8OA 4HW6A 1AD0A 1BF8A 1OLZA 1BIHA 1P4LB 4S2SB 3G5VB 1OTUD 4HKJA 5MHSE 3H0TA 5I1LB 5D2LA 3UJJL 5B21A 1G9MC 5T3XH 5D6DA 2BNRA 1ITCA 3F7PC 3ZKXB 1ZEAH 2Q8AL 1G7IB 4DCQA 4F7PB 4PJCF 4L4TE 4QCIB 3GHBL 4P2QE 4W81A 3BH8A 3ARZA 4UTAH 3MOBH 4CU7A 2VAJA 1RU9L 5EOTA 4UILL 1UB6B 3UTZA 4I3GA 4CBPA 4DFHA 4MA1C 5BS0E 4EOWL 4NQCD 3MBXH 5TH2B 5CILL 1NCBL 4JPIB 4P2OD 4P57B 1P1ZB 5I76A 1DQLH 1I8KB 4JFYB 3BYYA 2EICA 2P5WE 2YEZB 5LGJA 2ENSA 3QO0B 4M6NH 4POYA 1JK8A 1EGJH 3MLWH 15C8H 3S98A 3HAEG 5CGTA 1T04A 1QA9A 4LOUC 4NP4L 1MEXL 4O2EA 4A6YA 3G08A 5LBSL 1WBXB 5CSZA 5F96H 2P8LA 1U8LA 3HR5A 3WHE0 3NFPA 1X5HA 1G84A 1DBML 3D6GA 4WFFD 3T3ME 1UH2A 1G6RB 1WT5A 4ODWA 3ULUE 3GKZA 2IFGA 3OXSA 4F7MA 4YQXL 5DD3L 4NC1E 2I07A 4XNMA 2O5YL 3LN4B 2ZNWA 3LH2L 4JFEE 3EYFA 5BZWA 1UKTA 4Z7OF 3IS1X 5F21B 1DQJB 4XVUC 4PP1D 4JFDE 3DRTA 3DX6A 3NIGF 5FYJE 1CK0H 4YHLH 4KC3B 1TQCC 2XKSA 5DD5L 5T1LA 3X3FL 2ADJB 4MCYA 5FUOL 4X6EA 2ICES 4GW5A 4IOIA 4QTIH 4MD0B 4QXUL 3WXVL 1EAJA 4H5SB 3KJ6H 4U1SB 4JRYD 2BVOB 5KS9F 5I1DA 5D1XC 1QFUL 4LPWA 4NNPL 3ILQD 1NLBH 4ETQA 5EIIB 1VFUA 1Q8MA 2FIKA 3MRHA 3N0PB 4HHAB 4OD3L 4QY8B 1BP3B 5D2NC 1JGDB 2YD1A 3P4OB 1NAKL 4HLZH 1QSEB 4F9LA 2FJHB 1HILA 1NCWH 3MNZA 3MYZA 3C5ZB 2CDGA 4X6DF 2AXGA 3MODL 4LIQE 3LVEA 4I0PD 3BEVB 2KH2B 5EORL 2MFNA 4Y4HD 1MWAA 2WINA 1FIGH 3PWJB 3NTCL 4QXTA 4YHIB 4F80A 1B2WH 2HKHH 4C58B 2NY3B 2R1WB 2ZWLT 4WUUD 1KTKE 3HNVH 1QQDB 1DQQB 3BKJL 5IG7A 1JPST 4RZCB 4NYLA 1HKFA 1EX0A 3QUYD 1DBKH 1Q9LB 1ZANL 3NFSL 4HFWB 4DAGL 4HIJA 3IDXL 2EE6A 5HVFB 4M6ML 3SKMA 4G6KH 4F37K 4UINL 5DWUL 3L3HB 4QLRA 4PJ9D 1ZAGA 4UV4L 4LCIH 3WNLA 3U0PB 1F45A 1A0QH 3ZYOA 3PP3K 4NN7C 3HC4H 4X6CB 4EDWH 3KYOB 1HHKB 4ODBD 4BFIB 5ESVA 1ZV5A 4L29A 1A6TA 1AP2A 1Y18A 4UB0H 5DLMH 1S7TB 4LLYB 3P30L 2MQ3A 2C4FT 3FT4B 3IYLW 3MNVB 3WIIL 2NY7H 1B4JH 4PRPE 1IVLA 1U3HD 4P2QA 1QBMH 3TVMC 3VXTA 1GGCL 4Y5YC 3RUGE 3CFCH 3CVHA 1KFAH 5GS0D 4LHUD 3RVTC 4OFYA 5BS0A 4Y5VA 3N1MC 2NR6C 1IRAY 3L3GB 1G7MB 5D7KE 5I1AA 1TENA 5E9DB 1RJYA 2AXJA 5JNYB 4GBXB 1CU4L 3D9AH 2YMXL 1T22A 1Z5LA 4XXCA 1EFQA 2IC2A 4QT5B 4L8SB 1EXUA 2J1KA 4HQQL 2XZQL 4GAGH 2YD9A 5B38A 5C0IB 1TITA 3PP4H 4WV1B 2ZUQC 3AXLB 3SGDH 2UVFA 2V2WA 1LILA 1ITBB 3TGXA 3TV3L 3OL2A 2VB5A 1R3HA 2BY0A 3PWPB 3HAEB 1HYSC 4OBRA 4JFEA 3L3KA 3OHXA 2RJMA 4OGZA 4OM1H 3VH8A 4UOJA 1MFAH 2R2EB 4PGBB 4N0CD 5DRXA 1ZLVK 2GTWA 3AFLA 1JI2A 1DL7L 5T3XL 4JFDA 5TFSH 2D0FA 1UM6H 5LJYH 5DJZA 4IMKA 3CXDH 4Z7WF 1KC5H 4NSKB 4HUUB 5FCSH 3O11A 4BKLA 3EFFB 3WFEH 1VGKB 3T65B 3C5JB 3NH7L 4OCXH 5IB4A 4M48H 5ID0B 2RQ8A 4PJ5E 4HUVA 2XA3A 4F7CB 4OGAD 5EC1A 1NBVL 5I71B 1U8OB 5HJ3B 4U33A 2DD8L 2EC9T 5DC4B 3MLWL 2XY1A 4HPYH 15C8L 3N85L 3QEQA 3PABA 4NUJB 5GS0L 1D9KD 3FQXA 4MJIB 4EUPA 5CP3H 5TJWK 4R8WH 2APVA 2W0KA 3PE9A 1K4CB 2FHFA 4HS6B 2I26N 4TTDD 5I9QC 1RIVH 4FQ1L 4ZUTB 5EBLA 3O2WH 1OB1B 3HE6A 2VDQL 1OLLA 3H9SB 5I1CH 2C1PA 4M4RA 1J0KA 1PZ5B 3EYVA 1P7HL 5CEZH 4WGVB 3HTLX 5LG1A 4JHWH 3KPNB 4BSVA 1U92B 4XP6H 3X3GL 4H8WH 3OKYA 1CK0L 4YHLL 3IDIB 2A73A 4HIHB 4RMUA 1NCCH 4Y4FA 4K9EH 5K9KA 2CIKB 4KAQH 4OLVH 5HDOA 4M9PA 5F70A 4E9LA 5LGHH 5E03A 1Z0NA 4HKBA 4FQHA 1R24A 2CIIB 3QAZB 3AUVA 4KMQA 1S3KL 4Q0XL 4FXKA 1MLCB 3QH3B 5D2NE 1NLBL 5JDSA 1V3MA 4B5EA 2NY5L 4ZPTB 2G75B 2FX8H 3MYJA 3QFJB 1WFUA 5E8NB 1NCWL 4OZIE 1P5VA 5IW6A 1CGUA 3LV3A 1KPRB 3C5ZC 4RQQA 4OTXH 5A2LH 2XA8L 4KJYB 2GUOB 2QSTA 3RUGA 3VWJB 4PJ8C 4K3EL 5AG9A 2V2TA 2ED8A 1RZIB 3HG1D 4PJFA 2CKBH 3KPPA 2D31B 4UT6H 2AAVA 4NNXA 1FIGL 3QBTB 1C1EH 4I48A 3EYOA 3QWRD 1F3JA 4ZAKD 2GCYA 3GIZH 4F37F 3ZHKA 2FH8A 3HNVL 3LPWA 2JCCF 3S5LA 2EIZB 3BIKB 4OZFG 3UPRA 3SPVB 1KG0B 4NO3A 1OW0C 3GSXB 1Y6MR 3MLRH 3FT3B 5JDJA 2UYLB 1T1YB 2AJ3A 3MR9B 3CGTA 5DZNA 3V7AE 4FXGA 2PN5A 4XC1H 2Y36L 1YPZB 5T3ZE 1AI1H 4YO0B 4LCIL 4ZNEA 2NCMA 1NC4A 2ZOLB 3FO1A 4L3CB 4FFVD 4ZODA 3SKUD 2P1YA 3QDMD 1VDGA 1IGTA 3HC4L 4EDWL 1KOAA 3MRGB 2AQ2A 2R29H 2X89A 3WUWG 1EEQA 3VMPA 4FQ2H 5D7LD 3MFGB 5DLML 4UB0L 1GZPB 4LLVB 3SGEI 2J8UB 5F6IC 5K59E 3BI9X 5CZKA 3DUHA 1QYGH 5L2KE 2JF1A 2OTUA 3O45A 3MRBB 3VW3H 1FFNB 2NY7L 5DMKA 3UX9B 5A40E 5TE4H 1QBML 3MRNB 1CFVH 1HDMA 1A7NH 5GGTL 3BZDA 1GOGA 1EHAA 5MP6H 4L8BA 3CFCL 3HHRB 5I15H 5JXEC 1KFAL 3T0ED 1CICD 1A1OB 1MAKA 1IGFH 4U6XB 4XP9H 4JFHD 4BSWA 4Q2ZA 3SCMD 2PETA 3OXRB 4R0LC 2BNQB 2Z93A 4F3FA 4PJ5A 3UJIH 3GI9H 4O9HL 4NO0B 4GKNA 4NHCL 5SWSD 4JKPL 2NMSA 3LHPL 3D9AL 2K1MA 4KH2A 4X5WB 2HYMA 3CPLB 4OCWL 3BZ4B 3TN0B 1ZT1A 1CT8A 3I6GB 4NO2B 1JPTH 3RWHB 3FFDA 3KS0J 4NCDA 1HSAA 5CJ8A 4YHZL 1TPXB 4YDLB 2V17H 2C4FU 2MCPH 1U3YA 1WVZA 2HFGL 4WW2F 4V1DE 4IHOB 4RAHA 4NDMA 3DVIA 2QQNL 4HEME 4JO4H 3GI8H 2DJUA 3SGEH 5C8JA 3DBXA 1A7PH 4OM1L 5IB3B 1IEBB 4JY6A 5IMMA 2Q3ZA 3VI3E 1CIUA 2I27N 2F8OA 3I6LD 5TFSL 3V4PH 3KPRD 3K7UA 4KU1A 2CUIA 4BFGA 1EFXA 2R2BA 1EMTH 3O9WB 3I6KB 1AR2A 1KC5L 5GISL 4ELKB 1FRGH 4PY7A 3S37X 1FC1A 4GRLA 2DTML 3F6LA 4XH2A 3H7BA 5HI5D 3WFEL 4U3HA 5F7EH 1N3NA 1A6VH 2VLKA 3KLDA 4LMQE 4WHTB 1XGPB 4YK4B 5E2UL 3GSNB 5BCAA 4M48L 1RSFA 3RU8H 4WTZA 2X4SA 2X4PB 3QQ3B 3BPCB 4UDUB 5MENA 5I71C 1HHIA 2H3NB 4GT7A 4F9PC 4HPYL 2W65A 2OR8A