2A9NL

A mutation designed to alter crystal packing permits structural analysis of a tight-binding fluorescein-scfv complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
109
structure length
109
Chain Sequence
VLTQPSSVSAAPGQKVTISCSGSTSNIGNNYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNSASLDISGLQSEDEADYYCAAWDDSLSEFLFGTGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mutation designed to alter crystal packing permits structural analysis of a tight-binding fluorescein-scFv complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords fluorescein-scfv light chain
total genus 25
structure length 109
sequence length 109
chains with identical sequence M
ec nomenclature
pdb deposition date 2005-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a9nL00
2DMBA 3KPRD 2VLLA 4KKBD 1VCAA 3CLFH 4P5MB 2ADIA 2VXSL 1JRHL 2COQA 3MBXH 4OZ4B 1AO7D 2FBOJ 4WJ5A 3RDTD 2P4AB 5I1LB 3VI4E 5IFAH 1CU4H 1JPSH 1CLYL 1XGPA 3QAZC 1CIDA 4M7KH 3BIAX 1NBYA 1MCBA 1AFVL 1A7PH 4UZGA 3EO9L 4OTXL 2CDGA 1QEWA 1HKLH 1C7TA 2J8HA 5CUSL 5FO7A 3ZHDA 4QKXB 2VZSA 3MJ6A 3IFPB 4TSBH 1UWXK 4JFED 1Q0XH 5GSRB 3HG1D 1F2QA 4EXKA 2BNQA 4JFYA 5T5FH 1KTRL 4HFWB 3V6ZA 4ZFOA 3EYQD 3VFTB 4TSAL 1O0VA 1I8LC 2P5WA 5SV4A 2WIIB 5FECA 3QQ9D 3LD8B 4XX1G 1T21A 1WAAF 3O8XC 4TSCL 4KKLD 1OF2B 1HXYA 4B53A 3FQTB 5IEKB 4ZUVB 1CDYA 2EDXA 1DEDA 1S7SA 4PJ8B 4ZMAT 2X4SA 1PFCA 1FNEA 3H2WA 2VDLH 2ZOKB 4M02A 1VGKB 2J12B 5E6ZA 2FX7H 5F6IC 3MRPA 3F6IA 1S9KC 5A2KH 4JRYB 4PJDA 1INDL 1B0RA 4XPHL 2E7BA 1W0VA 4RGOH 2F53D 4PRDB 4WIQA 3KXFB 4BZ1H 2OJEB 2OJZH 2YPLD 3RZCB 3WFBL 3WXWL 2OMNA 1DVFC 1LO0L 4TOYH 1BGXH 2P47B 4MJIE 2EYSA 4PBXA 4OI9A 1ZT4A 1NH6A 5KVFH 1XCTA 4Z0BH 3V4PH 2CK0H 3Q2CA 1H3GA 2H32H 4R9HA 1X5YA 3O9WA 5JXAH 3WD5L 4GW1B 1A6VH 1MWAB 2WUBH 5GRZA 4X7EC 3VFOA 3TNNA 5EWIH 5J8OA 4FQHA 5HHMD 3EO1B 1BZ7B 2VDML 5CCKL 3CVHH 4IJ3B 2V9QA 4WFFD 4YHML 1BIHA 2ENYA 1GGCH 2XG4A 5CIPA 1DBJH 4KRPB 3CXHK 3UXFA 3HLAA 2YPLE 1U8NB 3HZMB 1VEPA 1K6QL 3O8XB 4TTDC 4LCWA 3IJSA 5JLZB 3OJMB 5C71A 1ZLWK 4NM8H 3MLXL 1YEFL 4WV1A 1AHWC 5AG9A 3BD3A 2O26U 4PJXB 1JNNL 1ZA3B 4FFVD 2R0WL 3GSRB 4NOFA 1ZHNB 3WCYA 2APBA 3G9VA 4JO4L 1BPVA 1QLFA 4ZUTB 1EO8L 2I60L 1X5XA 5C0AB 3NN8B 4YAQB 5F7DB 3L3HB 1CLOL 4F9PA 4ETYA 1DQQB 4JR9L 3SE9L 4NGHH 5D8JL 1A4JA 5IROC 4ODSL 4O2CB 1MCLA 1Q9LA 1QPPA 1OQXA 5D2LA 4CRPA 2KZWA 3HUJE 2H6PB 2VLRA 1DQDH 1T20A 4OF8A 2IEPA 1X9QA 1U8KB 5FB8A 4GRWF 1EAPB 4Z7WF 1CD8A 3CFBB 3ARED 3GIZL 4UIMB 2EDLA 5I76B 2QR0B 4YE4H 3OJVC 1ZTXH 1Q1JH 1H5BB 5I1KH 2A74B 3T3MF 4XC1L 4M8VA 4G8GA 4KVNL 1C12B 2A1WH 4JFPA 5DMIL 3QO0A 3E0GA 2VXSH 1ORQB 4PJGA 5FDYA 1KN4H 3QG6B 3GM0A 8FABB 3PJSB 4OCYL 3P4OB 4ZS6C 2OTUB 4FNLH 1MNUL 1T0MA 2OK0L 3VDCA 3BYTA 3IDGA 1S7XB 5CZXC 3T4AB 3TYGH 1YECH 2JJUA 3WDJA 2OZ4A 5J9PB 1MCPL 1T3FB 3QZWB 3CSPA 4JFZL 1B0GA 1FFNA 2F54E 3ARSA 4KXZH 4PJEB 5C08E 1GAFL 5KSVA 3T2PA 2C4XA 1V7MH 2KQNA 1IAMA 5HVWA 3O3DA 3OX8B 2FIKA 4M43L 2BRRL 4MHHI 4ODVH 4Z77A 2I26N 2X70A 4B7LA 4Y4FC 5FF6A 4AG4L 3BHBB 3QDGD 1EVTC 2JE8A 4JPWH 4PS4L 4N8CH 3BKYL 5FYJL 4OF3A 4FZEH 2DKUA 3VWJA 5CEZH 5I8OH 1JPSL 3FQWB 3FOMB 2HRPL 4X6DF 4HIHB 3PWPB 3OR7A 1SHMA 2DQEH 5I71B 4LPYA 1J1PH 4J3XA 1LEGB 3WIFB 5DRZB 2P43B 1BF2A 3B2VL 3MNVB 1QFHA 3G6JA 2DS4A 3D3VE 2FB4H 5DJXB 4F58H 1FNGB 5CSZA 1U3HC 1KTLB 4PJAA 5EO1A 4J3VA 5DO2C 2J8UA 2Q8AH 3CVIL 2APXA 1IC5H 3OGCB 1T89C 3DO3A 3RWGA 2PXYD 1UWGL 4U0RC 1A6UH 2CXGA 1E6OH 1KB5H 3GK8H 3MRPB 5B38B 2WWKT 5L8JB 5E5UB 4I18C 1B0RB 3IXAB 4TVPL 5IJVA 5D7KE 4AT6A 4JVUA 1S78D 4OZIA 3C5SA 1QYGH 4JG0L 4RFEB 3TBWA 3HS0B 1KIQB 1TJIH 4JB9L 2YPVH 1CVRA 3NZ8A 3MLRL 3TBTB 1K4DB 2GAZA 5CJOH 1HN1A 1V5JA 5I1HH 1EGJA 4WI8A 4AM0A 4Q2ZB 3JUYA 2XACC 3NCEB 3ZDZE 3REWA 3QQ3A 4GLRI 4PJ8D 2Q8AL 4XPAL 3V95A 1MWAA 5HPMB 4JO1L 4ODHL 2I9LB 1PYWA 4IOSD 4X5XA 1A1OB 4GRWH 1KLFA 2W60A 2ZUTA 3DRQB 3TT3H 4MLIA 1CQKA 3BIKB 1IT9H 1N8ZA 4Z76A 3D1MC 4W4OA 2PXYB 1MIML 3ECBB 1IGIL 4TQEH 1JZ5A 2L7UA 2FEEI 3CSGA 3OAZK 4G8IB 3RL1B 3IFNH 3VXRB 2P5EB 1RVFH 3PWLA 4W4NA 5ACZA 4E0RA 3BIBX 2MPAH 4APQD 3G6JF 5TE4H 4JY4B 2QQKL 2IG2H 2M26A 4OGAD 1I8KB 4MD4A 3LKQB 1BD2D 5JXEA 3QHFH 4QRTB 3EYQC 3UPRA 1UJTA 3DX6B 1YZZA 1FNLA 2AJSH 5INCA 1F42A 5EBMB 4GAGL 1YEEH 2FJFA 1FL3A 3BD4A 5C0ND 2CGRL 3BD5A 3B2UD 5C0IA 1OVZA 4NDMB 5KOVC 1TTGA 4X98B 3OAUH 3THML 3D9AL 1VERA 3VXMD 5B39A 3IJHA 5K9JH 2X4NB 1RJZB 2OCFD 4WFED 4G7YH 3D48R 5D2NC 1CK0H 4W68A 1MCPH 2E7MA 2MFNA 5ALCL 1Q72H 3HE7C 5D1ZC 5IHZB 4JRYD 5DLML 4Q0XL 2W91A 1S7QA 4EZMA 4UQ2A 3B5GA 4FQPA 5IQ7L 5B8CC 3KS0H 1NGQH 4XRCB 4J4PD 4D9LH 5I76A 4O51A 1KB5B 1QLRA 2CKNA 3BWUC 3LRGA 1DANT 4UB0L 3JTTB 3LMJL 4K9EC 3OV6A 1PG7X 1RZKL 4P5TB 5KTEH 4DUVA 4H1LG 4JPVL 4TTDD 4JFPB 1EMTL 2C1PB 4DGVH 3FB7A 3KS0J 5LVEA 4XC1H 3SPVA 1TENA 2HJKA 4E42B 1SMAA 4D3CH 1RV6X 2ZSWA 3SCMD 2DQDH 1IQDB 2FLRT 4HXAH 4PJEF 1NFIA 3IGAA 4BSVB 3FRUB 3AUVA 4RMSA 1KJ2H 4YHZL 5DMIH 1V3MA 5EU7E 2CIIB 1YUHB 3FN0H 1IC7H 5C0BE 1OTTD 3B43A 4F8TA 3IDGB 2HT4D 3VFSB 5J6HA 5C0CA 1F58L 2CKBB 5FGCE 5I18L 5AUMA 3G9AB 3RUGE 1X5HA 1YY8A 4JAMA 4KMQA 2O93L 3H0TA 3D18A 2QQNL 4NNXB 1BJ1H 1T83A 3LN4A 1VACB 2X9YA 3BZEB 5I1DB 2BNRE 3SOBL 2IH1B 1HSBB 3HMXA 1MHPL 3QYCA 2X70B 3RGVC 2IAND 3GJFK 3B3IB 2BRRH 1NGYB 2Q7YA 3BDBA 3TBVA 1GPOL 3T3PF 2MJWA 3U4BL 3DX7A 2BVEA 5FK9A 2PO6B 4G3YH 1SEBB 4XWOC 1V8HA 3WMSA 4HUMB 5L2KB 1HIMH 4ZFGH 3ZT5A 2Q87A 5HHQB 5JNYB 5I1JH 4MJ2A 3G5ZB 3L95A 4LSSH 5IKCB 2QLVB 1G7HA 3O2DA 3HC0A 1WV7T 4YHPB 3VFMB 5ETUB 3TV3H 5SV3A 4CVXB 2XRAH 3O8XD 1TPXB 4H8WL 5T3ZL 5KS9B 2BP3A 5F1NB 4GMSL 2ESVA 1AD9B 4KK5C 3B9KD 4JANA 4OIIL 1NEZG 2O61B 3BT2H 3C6LA 1AGBB 2E7HA 2YD9A 1ZS8B 4KMTH 2J8UB 2ZZUT 2OR9L 3JVGA 2NTFB 3GMMB 2AABH 1NAMA 3BPLB 3O6FC 1S9WA 3D9AH 1EO7A 4KROB 3FB8B 5B38A 1LILA 3B2VH 2VLRD 5I8CB 3MLZL 1NGPH 3UP1A 1KG0B 2NW2A 4M1DH 1HNGA 4P57B 5FGBC 5JHLH 3MRCA 3TBWB 1G6RL 1E28B 2XWTB 2ITDB 3B8YA 3LIZH 1JI2A 2I27N 1CGTA 2XWJB 4N1EA 3TIEB 5IWLC 3TBTA 5F1OB 4APQA 4IMLB 5D1QA 1IGYA 1Q9OB 1I9IH 2BOBB 1MJ7H 3OKMA 1U91B 3HE6B 3ROOA 4I8DA 1FDLH 3PGDB 4WV1C 3FONB 4X5XB 4AL8L 1KCSL 3O2VH 2RAMA 4KQ4H 1RIVH 4NQSA 2HJLA 3BIKA 3HG1E 3K7UA 3VJ6B 1MUJB 4HC1A 4HG4J 2G60H 1GOHA 4Q6IB 3CDFA 3P77A 1Q9WB 1F45A 1RJLB 2ED8A 1DR9A 2ARJB 4TUOA 2CO6B 1SYVB 3EYUL 5FHBH 5IFJB 4YUEH 4KROC 2BSRA 4I3RL 5C2BH 3GHEH 4ZTPL 2D7TH 1JGDB 3UTZB 1MHHA 3D85A 1QA9B 2QADD 3E2HC 3IDNB 1EJOL 3FO1B 2X10A 4N90D 5B39G 3RTQB 1RUAH 2HFTA 1RIUH 1FLTX 1DLFH 2ZOLA 1D6VH 3MGOA 2EXYD 4Z7NE 3HC4L 3ZYJA 1JP5A 3TZVC 1I7ZB 1MLBA 1YY9D 3H9ZA 2CLVA 3DETD 3DVNB 2G60L 3C6LC 4GXUM 4NRZA 2IBZY 3PWJB 2BNRD 4J6RH 4PPTA 1QO3B 2CIKA 5IJKA 3EYUH 5LG1A 1RZGA 1U8IB 4U3HA 5DRXA 2E8YA 2D0FA 3GI8H 4OIAA 2X89A 5C1MB 1WZ1L 3HAEH 2VXVH 2BVQA 2VN4A 3I9GH 4P46B 3NA4A 4KGLA 4LLAA 2E7LA 1HYSD 2D3VA 5T1LA 3BZFA 3DVGA 1MELA 4P3CL 5IIEB 2CGRH 1BFVH 1HDMA 5L9DL 3KXFD 3J7HA 5F96L 3I3EA 4WW2F 4YPGB 1HEZA 3UDWA 1FHGA 2EYRA 3S36H 5GGSY 3QIBD 2H9GA 1WCQA 1I8IA 3FB7B 1IL1B 3ARDD 2YEZB 1XGQB 2EO1A 4WY7H 4EVNB 2K1MA 4H26A 3HI5H 3QQ4A 4PJ5B 3UBXA 4WO4B 3I2CH 2AJYH 4YGAB 2FJGB 4LSRL 3VFPB 4L5FL 4U31A 1BVZA 1KJ2A 4PD4J 1T83C 4LQ1A 1U8MA 2EC9T 4X9BA 1P53A 1T22A 5E4EC 1NL0L 3RNQB 3HG1B 3MMEB 3VXUA 2VDOH 5IHUH 3MV7A 2GSIB 4TSBL 1BD2B 3VI4F 1FSKC 4N0YL 5HHMB 2YBRB 4NQTA 4WI4A 1DANU 1HSBA 1UCTA 3MV7D 1INDH 3GM8A 4X7DC 1Q0YL 4MD0B 2FECL 4YLQT 3LDBB 2V2WA 4YHNB 3RKPA 1FORL 3U4BH 1LE5A 1AD0A 1TZHB 2XPGB 5FKPB 1Y18B 2RFXA 5IQ9B 4A6YL 1OW0C 4LMQE 1S7RB 5ITBH 1CVSC 1PEWA 3MUJA 3PWNA 4MDJA 3E6HB 4IRSC 4XZUB 4GS7C 3V5KA 5HXMA 3ARDA 2FWOB 4JG1L 4EOWL 2LABA 4N0UA 3L5WA 5I1CH 5C09A 3OJ2C 1KCRL 2E7LC 2ATKA 2X4QB 4ELKA 1H0DA 3SQOL 3JVGC 1RUQH 2VXQL 4HQQH 4AEHH 4BZ1L 1E4JA 1UJ3C 1A6PA 4XAKD 4GMSH 4NKOB 1KN2L 1BMGA 2O61A 5FOJA 5KG9A 5IW1B 1UYWH 2H3NA 5D93B 5F97E 1CDCA 4XAWH 3O4LA 3QNZA 1FZKB 32C2B 3U6RA 1ZAGA 4LCCA 1J1XH 3WN5C 1JZ3A 1S9WB 3HPJB 3MRRA 4P3DA 3P9MA 2VKWA 5GHWL 3KR3H 3C60A 2R2EB 1XGTB 5CP7B 1OD7A 2P5EE 2P8LA 3NCFB 3P0YL 4XHQA 1AC6A 1RIHH 4NQDB 4OD1L 4U1MB 4U6YA 4HH9A 5L0QB 5DJAA 4D0BA 1DCLA 3ESVF 3CFCH 5EPMB 3O6MH 4QRUA 2CDGB 3MGTA 5ISZA 1LEKB 4NNYB 5EIIA 1NMBL 3QDGE 4QWWC 1IC4L 5EFIB 1A14H 1DBJL 4FXKB 3LPWA 4MDIB 2W0FB 1MFDL 5KSBA 3K80A 1YEDA 5D2NB 6CGTA 3ULUC 1H15B 4PJFE 2XN9A 2Y7QB 3X3GL 5J12B 3MJGX 3RUGB 1OLZA 1KTKE 2XN9D 4X7SH 5DT1L 3NIFE 4O58H 3L3JA 5EH1A 4TUOB 4XNYH 4PJBB 3DURA 5IFJA 3MODL 1YC8A 4DZBA 1DSFL 3S35X 1N4XL 1FG9C 3NCMA 4K3GA 4N8VB 4PJ9D 1FVCB 1OAUH 4MA7L 3FO1A 4GT7A 5DJ8A 5ICZA 2QHRL 3KXFA 4NIKB 3FOLA 1MQ8A 3A6BL 1RMFH 5GQBA 3P9LB 5DJ6A 2FX8L 1DBKH 2EKSA 4NRZB 2QSQA 1YECL 3H7BA 1NMAH 1FO0L 4Z7WE 4RFOH 4JFXA 5E6ID 3SDCC 3T0EB 3S7GA 5MHSD 3WL9A 2YUWA 4I0PD 4NM8L 5HVGB 4M48H 1ZANL 4NRXA 4WFHD 4NZTL 5BVPL 3UJTH 1YMME 5MP6L 3B5HA 3D85D 1VADA 3C2AH 4XNQA 4P2CG 3K46A 4L4TB 3TZVA 4R3SA 1D5BB 1D9KA 4Y0GA 3QEGL 1IEHA 3D5OF 1U8LA 5I19H 1F3JB 2BFVL 4M7KL 3GK8L 4JQVA 2JCCB 3KPMB 2AQ3A 3QDGB 4EBQL 4WO4A 1WBYA 25C8L 5ECJE 3UTTA 3FB6A 3AB0B 3VFPA 5KZCD 5IP4A 3K8MA 2P44B 1QFOA 2FCBA 2NX5E 2R8SH 1LO5B 3SDDC 3S36L 1HINL 2GJJA 1RULL 4Z6AT 1HXMA 1YEHL 5C6TH 5I16B 3ILPB 4OCMC 4XMPH 4G8EB 1CXKA 2YS4A 4M5ZL 1VGEH 1KCVL 4JO4H 4L29A 4NM4H 2XZAL 1BBJB 5AYUH 4ZSOA 4MD5B 3O6FB 3KYKH 3C8HA 5EBLA 3A6CH 2EDYA 2XA8H 3LSOA 3MROB 3RVUC 3GJFB 1T7WA 4QRPB 2A74A 3V52H 1IKNC 3TYFB 3IETB 1F97A 3U7YL 2W9DL 1YN6A 3O11B 3AXLA 4PRPA 2X7LB 4KRPC 4DZ8A 4M61A 3BZ4A 1LO2L 2VZOA 2WV3A 3GBNH 4PY7B 2HKFH 3QIWB 4IJ3C 5DK2A 3E6HA 3BPOC 4WTXA 1V7ML 2G75A 4HDIB 3QNYB 4Z0BL 2ATKB 1G0XA 3M17A 3U0TB 1G9NC 4F9LC 3T0VA 1XF4A 1QSFE 3WUWB 1JK8A 3OKNB 3V7MA 4JRWA 4XNZC 3WNLA 1NSNH 2JJSC 4R96A 4NUJA 2PR4H 2EE2A 5IUSA 2PNDA 1G9ML 5FYJE 4CNIB 1IAIL 3F12B 1I8MA 5ELIA 1YEGL 5EUOF 4YWGL 1CICD 1EK3A 1LD9A 3RQ3A 5H2BB 4Y16C 1SVCP 3PQYB 3T0AA 4Z7OF 3VGEA 1UG9A 4O02L 4KKLC 4AJ0A 2MWCA 3VE0A 3RWEB 4ISVB 1XAUA 4JZOB 4U6YB 4C57C 5CILH 4K7PY 3QP3A 5ICXB 3SKMA 2Z91A 1K8DB 3KPQB 4G43A 4K23L 5HYSA 3PP4H 2ZUSA 3FO9B 4QYOA 3QWOB 1NDMB 2BDNH 5D7IA 4NNYA 4U33A 4QHMA 4M3JA 4HZLA 4HIHA 1NCAH 3FAWA 3B9AA 4MCYA 5DHVA 2Z92A 4HKXB 1ONQB 1YEDB 4D3CL 4R0LB 3MNVA 4UV4H 4PRHA 4ZXBA 4N5ED 1A14L 1L7TL 4OZGA 4YWGH 2AK4E 3W5NA 3FAXA 5HVHC 4Y4HB 4QHUB 4HLZG 3WFDH 4XP5L 3MV9E 3HUJB 1ACYH 5EA0L 4OT1L 3TO2B 4PG9B 1Z5LA 4FS0A 4YHLL 2AJVH 4NZRL 3RWHB 3MA7A 2W65A 1U3ZA 1Z3GH 3JWDL 2V6HA 2YZ8A 3N0PB 5E8PA 2GTWA 4AIOA 4PJ7B 1CDUA 5D1QD 2LU3A 4BQ6A 1J12A 4M7ZB 1S3KL 2FDBP 3GJFH 1SYSA 1X5ZA 3SE8L 1OAUL 4MA7H 12E8H 4RFNB 4Y5XC 1BJ8A 5BO1H 3CC5A 3WFHB 1UWXH 4QEGA 3RWJA 4N0CD 4WU7B 3QI9D 4L4VD 4XNYL 4H5SB 4MX7B 3RNKB 5IV2A 2QQQA 1JGUH 1LO0H 4WU5A 3NCCB 4ZTOL 4X6DB 1SM3L 3BQUA 3EKCA 4GW4B 1NC4D 2ADJA 1A6WL 5ESAB 1RFDL 3QWQB 4OM1H 4I0KA 1A1OA 2B8OT 3B9KA 2DYPD 4P2QD 1ETZB 1EGJH 1G7IB 4Z7QE 5I66B 5KSAA 3MRGA 4YDLC 3WL9B 3MJ9H 4BZ2L 4P2RE 4S1RL 3KPSE 1HH9B 3U36B 4R2GC 2A9MH 4G8IA 1E6JL 1QLEH 4RNRB 5DJ0A 4FTVE 3EOTL 1MEXH 4LDOB 2EE9A 1IVLA 1GYAA 3I85A 1NCWH 2OR9H 5F7UA 2XQYG 1T7ZA 1F58H 4WWKB 1LK2B 1OWRM 3BO8A 3OKEB 3DX8A 4LFHD 2VDQL 1F3JA 2XY2A 3RL2A 4DOHE 4RA0C 3SE3A 3GEWB 2WNGA 5IB5A 2AXFA 5FM8A 3VXNB 4L3CA 2I5YL 1FGNH 1NFKA 1FL5B 3V2AR 4C56E 4O5LL 4JKLA 2GITA 2DTSA 4GKSB 1RUMH 2V17L 4NDMA 2QADB 2YD8A 4CVZB 5I0DA 1CCZA 3LDBC 3IJHB 4AYFA 3KYAA 5BXFA 3O3EA 3RX5A 1G9NH 2Y25A 1HXMB 1FCCA 2A77H 1D7FA 1E4XL 2HTKC 4IRSA 2P7TB 5CJQL 3WSQH 4TPRH 4JFHD 4UMGA 2C3HA 1W2KT 4NQCE 3WIHL 2VXTL 1C16A 4X9FA 2H2PD 1IEBA 5JW5A 1YC7A 2OZ4L 4L9LC 2F58L 4OSUH 2L4OA 3FT2A 4NO5A 3ULUF 3S5LA 5BV7B 3TN0A 2V7HA 1MJUL 1NCBL 3KVQA 1CK0L 4JPIB 1JFQL 3GSNB 4OLZL 3VFGL 4UU9B 4ZFZA 4MCZA 1BHGA 4POZD 4DKDC 3TBSA 4NN5C 4TVPE 4K3DH 5SX5H 2ED7A 3CD4A 5LQBL 1Q94A 2W07A 4LLUA 4Z78B 1H8NA 4J4PA 4MNQE 1CZ8L 5F8RC 2HLFD 3JV0A 4RGMC 5C07E 3U9PH 3F7VA 2CIIA 4OIIH 4GBXD 5EUKB 3MBXL 5DD1H 3QUKA 3GZKA 1B0WA 4I0PC 4BSJA 2BJMH 1DN0B 2XIDA 3EYFB 3WUWA 1C5CL 4X6CF 5C0CB 3OQ3B 2RB8A 1UQSA 2YPKB 3BEVB 3FB5B 3O0RH 5BMFL 4OLXL 3VCLA 5HYQB 1NUNB 5CAYB 4K8RH 1DEEA 3LN4B 4X8JB 3W11C 1Q8MA 4UQ3A 4TQEL 4Y2DA 5K9QG 2DQUL 3BH8B 4JJHA 4PV8A 3O2WL 2EC9U 3KPNB 3O6ML 4J1UB 4Y1AB 1ZSDB 5I71C 5FK9B 2Z0BA 1FLRL 5F7MC 2DL9A 4F33B 3D39E 1C1EL 5JZ7D 5F96H 5JR1H 3PHQB 2MPAL 1TLKA 1AIFB 4HK3N 4PRNA 3ZE0F 5L2KD 1LWRA 4PJAF 1PG7L 3QJFB 3LKRB 4J12A 4JDZB 4S1DC 2AS5M 5DRNB 4FP8H 5J06A 2XTJC 2XXMB 3UO1H 4P46C 5B3JE 5A3ID 1CGSL 5EORL 3ULUH 4EUPG 1L7IH 1NBVL 2DLEA 4XPFL 3EGSA 4JKPH 2XQBL 3EFFB 1HXYB 3FO0H 3FT4B 1KEMH 3L1OL 4NKQB 1LP9F 2NTFA 1B4JL 4BH7B 4GUPB 2X4OB 1NAMB 1A2YA 3TPUB 2C7UB 4U2YA 4GKOA 4XCCL 4QWWD 2WSKA 4JRYA 1MFEL 2VDPH 5FKAA 1P2CB 4Z7NF 4QRPE 2A73A 5E0QA 1BVKB 1QBML 2CLRB 2R4RH 1FFPA 5IVXA 2J8UF 3WFHA 1E28A 4L3EB 3H9SA 2EYSB 3TIEA 3N06B 4H5SA 2AEWA 2E27L 3WKML 1A3QA 1JGEB 5D71L 3BAEL 3BXNB 4WFGD 1ADQH 3SO3C 4PBVC 4KVCL 1U8PB 3BDYL 3Q6FB 1JHLH 7CGTA 4ZAKB 4HZAA 1CGWA 3OGOE 3VD9A 4U05A 2JJTC 2AXGB 3GMPB 1KSRA 3B9DA 5AAMA 4XH2A 4HH8A 1YNTB 2FGWL 4P59H 5EO0B 4E9LA 1Q9WA 3P4MA 4NKDB 5K9QI 4XPBH 2Z8WC 3S97C 2BSED 1HHGB 4LCIH 5CIPB 4QY8B 1K2DB 4PRIE 3RVWD 1JWUA 2OQJB 3MJ9A 3SDXE 5CEZL 1I3VA 1GC1L 4G6JH 5DK0B 4DK6A 4OCWL 3QEHA 1DBAL 4LCWB 1LK2A 5HY9B 4AMKH 4LRIA 3CIQA 2I9TA 3GSQA 1DN2A 4GG8B 3RHWK 4HWBH 1TIUA 3O41B 3O81A 4ZS7L 5LBSH 1I7ZA 3BGFB 1CICB 1NDGA 4CVZA 4LKCA 3P3YA 1GGIH 2CR3A 2R29H 4KI5C 5BXFB 3H9HB 3PWJA 1X5KA 2FH8A 2PTTB 1QBLH 3MFGB 4M5ZH 3BGMB 1PX3A 3WJJC 4LSSL 3ZSSA 4MXWH 1RIUL 1KPUA 4JGUA 4OQTA 1AQDB 1U8KA 1U2CA 3LB6C 1FYTE 1AXTL 2XQYK 5TPWH 3ES6B 5IFHH 2FGZA 2YPLA 4OCXH 3DVFA 3X14A 2R4SL 4M1CC 4NO5B 5IM7A 3D25A 4I3RH 4NYLB 1OWWA 3GRWL 2V7HB 5TE7H 2QL1A 1HEZB 1JE6A 5DUBA 3QHZL 5DD0H 1L7TH 3I6LE 3GMLA 3QO0B 4IEFB 5FGSA 3T0EC 4HGMA 2ARWA 4MNHB 5IW6A 1L0YA 1S9YB 3MRLA 5L88H 4L8BA 5AG8A 3U7AA 1ZHLA 3UYPA 4XHJC 3LHPL 4HBCH 2ATPB 5HHXH 1S7XA 3T4AA 2HTLD 2DM7A 4GRLB 5BZWB 3EDFA 1GCFA 3QUYC 1U8MB 2YPKA 3PGFH 4YK4C 1BZ9B 4ELME 4LBEA 2OX5A 4PJEA 3FO0L 4S2SB 1R3LA 1TJGL 2R2BA 4AIZA 5AAWA 4HKJB 2D7OA 4IHOA 2GT9B 4KQ3L 3VD5A 2ZG2A 5FO9B 3IFNL 4QCIA 2ZUVA 4YX2L 2DQJL 4FQCH 1IM9D 1RJCA 3BGFC 1TQCC 3X12A 3PHSA 3TJHD 2J1KA 1JWSB 4NHUB 3S3JA 5F1IB 4X5WB 4Y1AA 3GGWB 1N7ML 5DD3L 1RFDH 3U9UB 1I9JL 3UTPE 3N1PC 4M7JH 1T1WB 1YNKL 3WD5H 5FKPA 1S5IL 3QRGL 1D5IL 3ETBF 3V6FA 1G9EA 4NC2B 5T3XE 1FLRH 4E41A 5SWSD 1Q0YH 3OPZH 5C09B 2MHAB 3NIFF 5IBLC 2ZCLL 3MA9H 3W81A 3UTSB 1BF8A 1F3RB 2E27H 2PYEE 3BW9B 2PN5A 4JEGB 3TV3L 3UYOD 4JN1L 4LKXB 3O6FD 2YPVL 1EBAA 5DUMH 2WQRA 4FZ8H 4KKNA 4Y88A 5D1QC 3VRLF 2ZSVB 5E2VH 3OXSA 4LCIL 4LASL 3MRRB 4Y19E 4XMPL 3MR9A 3TIDB 2DBJA 3O6KH 2PTUA 3M8OL 1AP2A 1NANI 4PJHA 4XT1C 4YHIA 3VRIA 1XGTA 4JHBA 5IVZA 1FGVH 2CRZA 4PB0H 1QRKA 1DBAH 4PJIA 1I1FB 1CBVH 4QXTA 1H3WM 3WNKA 1IC5L 1WWBX 3HS0A 1KGCD 1UJ3B 1JMXA 1KEML 3GSXB 3ZHKA 2C5DC 4B5EA 5KS9F 2O5YL 2AGJL 1KPRA 5F3BA 4RAUA 3KR3L 3MLSH 4KJYA 2GK0B 1PZUB 3WHE1 5JHDE 4Q9QL 5GZND 3ULVH 2FHFA 3VFVB 2OBGA 5JORB 4ZS7H 1ZVHA 5LBSL 3WS3B 3MZGB 2UZXB 4M93C 4G5ZL 4OZHA 3HHRB 4KJWD 3QR2A 3MRKA 1N6UA 3I6LD 4WUUB 4YHYC 2Q8BL 4U6HB 5KJRL 1D6EA 1XT5A 2AK4D 1OAQL 5DFWH 1BLNA 3ARFD 3TT3L 1Z2KA 4GW5A 3ULVC 3VD3A 3EO0B 4HS6B 5DMKB 5KVGH 2LE9A 4U1JA 2X4PB 5CINL 3HTLX 5I1AB 3BN9C 4Z0XA 1E6OL 1KB5L 3GSQB 3LV3A 3QFJA 4Q0XH 4NQDD 4PJCA 3KWWB 1SVZA 3QIBA 4LQFL 5EBMA 5F3HA 3T1WA 1B9ZA 3CVIH 3TLRA 3RGVA 3BPLC 1AGDB 1P4LA 3MRFB 5HGDA 1KJMA 3VFWA 4Z8FL 1OSPL 4JHWL 4PREB 1V3LA 4KRPD 3G5XA 3P0GB 4XCEB 4WI2A 3MNZA 3UTQA 3FQXA 3P30L 1IAKA 4GAGH 5B3NA 2ICWA 5DEGA 4NO3B 3WHXB 1TXKA 4XPGH 1V7NH 4S1SL 2NY1C 3MRMA 5ANME 3MV8A 3THMH 3LB6D 1O7VA 4JY6A 1PLGH 3CK0H 1GGTA 3ES6A 3T0BA 5CZVL 4OZFH 1U3JA 4MXVE 4NRXB 1CYGA 5MEPB 2NY3D 4I18A 4YZFE 1LO4L 3B9VA 2NY0B 3HI6L 4URTB 4OQTH 2XKUA 3CAFA 4WNQB 1VFUA 1IQWH 1LNUB 5I9QB 5DSCB 2JIXB 3IYLW 1QR1A 4P23B 1MJ7L 2N7AA 4F80A 2P8MB 4LCYA 1B88A 1IM3A 1EHXA 5BZDB 5A2LH 2XQBH 3D39B 1NFIB 4M62H 1ZLVK 3FHAA 1TQBC 4L8BB 4JFEA 1A7RL 1WBYB 4WW2A 4DVBA 4RMQA 3CFCL 3ARFA 1SY6H 5EU7C 2HA1A 3L3IB 3D2UD 1BVLA 2YOCA 3CK0L 4GRLA 1M7IB 3E3QE 5BZWA 3VXSD 3QQNA 5DMYA 5HYEA 1TQBB 4Z5RA 5I16A 1WWWX 1R3LB 4RGNC 5B22A 4M9OA 5FYJD 5GS0H 2VJXA 3MJ7A 5CGYD 2LTQC 4HKJA 3DSNA 4GRLD 4GKZA 4N9OB 3RU8H 5C9JB 5FUZL 5IR1B 1MRFH 5E2WL 1KUMA 1OM3L 3O4OB 4OQ1A 3IJYA 3A67L 1BBJA 3I3BA 5DYOA 4KFZC 4MQTB 1CF8H 3B3IA 5ENWB 1OAZL 1MVUA 5F1IA 2J6EL 2PO6A 2GCYA 2WUCH 2UWEA 3H3BC 1RUAL 2A9ML 5AEAA 5DD3H 1HI6B 1TVBA 2DI8A 4IIQB 3VD7A 5C0EB 5GS0C 2F5AH 1NMCC 2UYLA 3SY0A 1OGTB 4HBQA 1MJJA 3U46B 4Y4KA 1N6VA 4PP2A 3O3UN 4LVOC 5KVEL 4PY7A 4FQLL 3WFZA 1S7TA 1LO3L 3CLEH 4JRXE 4PV9A 5T3XL 1RZ8B 3DI3B 4P49A 3N1FC 4YHPA 5AYQA 3OBAA 5KVGL 4NO0B 3A0OA 2EIEA 3BDXA 1M4KA 4KUCF 2NY0D 4LAQL 1UFUA 4XWOD 5ANMB 1M71A 4HUUA 5F6HI 2PF6A 2AI0L 3BKYH 2DLGA 4H8WC 2DDQH 5IK3B 1JHKL 2JTDA 2VSCA 3QDJD 4QHNB 5D7JA 3RX8A 1LD9B 2HRPH 4U1GC 3T0ED 1MI5A 1ZANH 1KIPB 5C8JA 3CH1A 3T08A 1DUYA 4OZ4A 2NXZB 4WJ5B 4ZOAA 2YK1L 4ODSH 4RX4D 4PRDA 3CFJA 1INQB 5A3IC 4HUKB 4IM8A 3G6DH 1EGJL 4OUOA 2B2XH 4YR6A 4XP4H 1X4XA 5J3HC 1I1CA 2AV1A 1BQLL 4JRXD 1A6WH 4GRWB 3K3QA 4NSKA 1U91A 4XP5H 4X9GA 1AI1L 1G7JA 2ZNXA 4G9FE 1JZ8A 1RUPH 5DRWA 1JMZA 4QTHB 3BSZL 2EDWA 3C09C 1BAFL 4ODTL 4PJ7F 1JHKH 2I25N 1FBIH 5GS1A 4H25A 2PW2A 4ELMB 1OF2A 3P77B 5TFSL 3HRPA 4XCNA 1A9EA 3T0EE 2WP3O 2ZUQC 2V2TB 1RULH 1XGRB 4Y1AD 4I77L 2YRLA 5GS0D 3LY6A 3MLPA 3U4AA 2ZOKA 5IT2L 2GTWB 3PL6D 2Y23A 3PHOA 2CRMA 1BOYA 3D85B 3IJSB 1TCRB 3DYPA 2A6DA 3V4VL 1MCHA 4I4WA 4H88H 2X4PA 3EOAB 1CFVL 2OJEA 1YEKL 1WCBA 1Z6JT 2VQ1A 3GSRA 1JYVA 1YYLH 1QLFB 4ZUTA 4ZOBA 4AEIH 4Z7UE 2NY2B 4LVNB 3ZE2E 5CBAB 4YHLH 5KVFL 3PP3H 2D7TL 4MX7A 5F7DA 4YAQA 5C07B 1SBSL 3B2UC 4X80H 1DQQA 1DDHA 2LAGB 3OB0H 4DN3H 1CFSA 5GGVY 4QNPE 4LVHC 1A4JB 3MNZB 12E8L 4DFIA 1JTTA 1CT8B 3DPBA 3CSBA 5C0JB 1J8KA 5D8JH 5DRXB 2XOTA 2OZ4H 4XMKH 3SO5A 5JQ6L 1A6TB 4NO3A 2ICCA 2FX7L 1UEYA 4P46A 4X6FB 3IDYC 1RK1A 4F57L 4XVJH 4ZUWB 4Y7MA 5JUEH 3X3FH 1PGRB 4I18B 1CL7I 4MNGA 1UM4H 1C5DA 1I4FA 1TQCB 1LNUA 4HS8H 5B8CB 4LLWA 4L8SA 4RIRA 2Z31C 2YA2A 2VITA 2Y36L 2R39A 3U0WL 3ARTA 4DN3L 4P48A 5JW3H 1N64H 3NH7L 8FABA 1MFEH 1ZA3A 1MQKL 2AXFB 1Z9MA 3FL7A 2EIZA 3QFJD 1ZGLA 3TBYA 2X5PA 3GFUA 1WBXB 3W39B 3NAAH 2YMXL 5C3TA 5CWSB 4WGWB 1JNHB 5JPMB 2JELH 4GKSA 4XCYA 5IQ7H 4JFQB 3ARVA 2AQ1A 4ZO9A 4L9DA 3U82B 1A1NB 4PB9L 3B9EA 4P2YA 2EICA 3DRTB 3RWCB 3RVXC 1KJ3L 3UTSE 3MV7B 5EZLB 5E56A 4F58L 1P4IL 2ZUXA 4KHTL 2NNAB 1BBDL 5ADPL 3HR5B 1FFRA 1C08A 2NY0C 3ZE0E 1TJHL 3TN0B 2GCYB 1RAMA 5I0ZA 3QCTL 4DKFL 3RY6C 3ARFC 1HI6A 1TVBB 3GSNA 1HQRB 3AM8C 1AXSB 4YDKH 1H3XA 1MJJB 1SJXA 3T2NL 1GC1H 3QG6A 1KBGH 3NIGF 2EE3A 5GRXG 1PJ9A 1LEGA 2W1NA 1MRDH 4LRIC 2A6JB 4FQQB 4GAJL 4N5UA 1RUPL 4IRZL 3WS6C 3WLBA 1DN0A 2KDGA 5HGBA 2GQHA 1OPGL 1Q0XL 4IDJH 3MACH 1M71B 1R5VA 3L5HA 4JO2H 4IOIA 4XPBL 1W72H 3QNXA 4L8CB 1JVKA 5T1MB 4AEEA 3V6OC 4X80L 5D7IF 5IK3A 2OTWB 4Y4FD 1X6LA 4F9PC 1I85A 3EFDL 4RGND 4FQ2H 1DUYB 4DW2L 2GYSA 3BHBA 1KN2H 4POUB 3CFJB 4M7LT 1J0YA 2XZZA 1DBBH 4RAHA 1U6AH 4D0BB 5D71H 3U4EB 2EIDA 4NSKB 4DCQB 2C3XA 1FQ9C 2YN5A 1G7JB 2QKIB 3U7WL 3PWPA 4L9LB 4FXKA 3HNTL 4M7LL 1GIGH 3ARDC 4YXHH 1EEZB 2I07A 4R7NA 1I8LA 5EOCJ 3HFMH 1U58B 5IB1B 4KK6C 2AKRB 1NMBH 1U93B 2GSGA 4P2QB 2DIBA 3N85H 2P42B 2HT2D 2YKLL 3ECBA 4PJAB 4XCNB 1S7VA 4L8DA 5E9DE 3K74B 3BP4B 3G08B 3LN9A 5ICYB 3KPTA 1R3KA 2G5RA 1UACL 3VGFA 5FUCE 2WM0A 5E94B 3WEXB 1DJSA 2P5EA 3WUWG 4FQIL 4LFHG 4R7DB 1MF2H 2IH3A 4LEXL 2H41A 1YDPA 2O5XL 1H9VA 4I4WB 4MQXD 3UPRB 4F7MA 1U92B 3C5ZC 4RFEA 3HI1A 3IFLL 4L3EA 4U49A 4D9QE 5F21B 1W0WA 5I75B 5J13C 3BN3B 4R2GD 3IF1A 1DBML 1N7MH 3MZTA 4H1LH 2EKSB 2R2CA 4OCRH 1RJZA 4OLUH 4WHYH 4YHKH 5CEXB 2N4IA 3F7YA 3T8XB 5HYJB 4LP5A 3K2UL 1U8QA 1INEL 1F4HA 4V2CB 2HAZA 2OL3L 1P9MC 2VO5A 1KPVA 4LPCA 3VG0H 4KDTC 3GKZA 3WNOA 5JA9A 3QA3A 4GBXB 1KT2A 2APWA 2EDBA 3DUSA 5TF0A 3ZMRA 2R2HA 3AY4A 3OR6B 4GJTB 4MHHG 3TF7C 4O51B 2DTML 1RU9L 3C60C 3CDCA 4NQVB 2IPUK 5HHME 2QQNH 4X7SL 1A5FH 3O6LL 5FIEA 5ACZB 1CGVA 3WXVL 4L8SB 4RIRB 3QEHB 2C1PA 3UJIH 1URLA 3UBXI 2NXYB 3LKQA 1HZHH 1IGTA 4F3FB 1QVOB 3MOBH 4B50A 1BOGA 1HILA 3BYYA 5E24E 4GAYB 2DLFH 2PYFB 3KLAB 5F1SA 1XF2A 3OHXA 4RGOL 3KLHC 5TDNA 5F9JB 3FB6B 4DW2H 2F5BH 4Y16A 2P46B 5KBNC 1GZPA 3GKWH 5HDBE 1II4E 2HYMA 3H3KA 3HUJF 4HPYH 4KJQD 4P5TC 3NVQA 4N0FB 2V5RA 5IB4B 3SJVB 1NUDA 1OARH 3KG5A 1FZMA 4NNXA 2MNUA 5A16B 3IKKA 1MAKA 3BZEA 5GZNC 3F5WB 1YMMA 4LGRB 4LHQB 4J4PC 1U8OA 3JV6A 4M03A 3T3ME 5DI8B 5EU6E 1ZWIB 4ZDHB 3O9WD 4NJ9L 5AZEL 3TBVB 1N26A 3D25B 4EDWL 3DX7B 3GJFA 1F4XH 2VABA 3DBXA 3QUYB 3VG9C 3I6GB 3H6JA 1YN6B 1IEAA 1IGML 1AXSA 2VQUA 1G7QB 2EDJA 1YJDH 1CI5A 1FPTH 4JKKA 1K6QH 1CLZL 3GSUA 2EIBA 1KBGL 1J8HD 3EJJX 4HJGA 3FCTB 4GQ9L 2A9NH 5ADPH 5E5MB 1YUHA 5B4MC 4CVXA 5I1EH 4O9HH 3LQAH 5IMKB 3RBSA 1ZLWH 2P8PA 5AUMB 2GJ6A 3STLA 4LLMB 1AO7E 3IVKB 1BZ9A 1Z9LA 1I7UA 4LSVH 4OFVA 1JZ6A 1JL8A 4IOIB 5HSFA 4XGZB 3WFCH 4AIZB 3U1SL 3C8DA 5IG7A 1NCDH 2OTWA 4Y16D 3IS1X 2EZ0C 5E70A 4OLXH 1FVEA 2QV2A 2H45A 4O4YL 4X6EB 5BS0A 5F7LB 1K3ZA 2G9HA 4X6CA 4Z7VB 5I1LA 1NGYA 4KRMB 1HE7A 3ULUD 1XF5A 2W9DH 3SKOB 3AS3A 4JQVC 1UWEL 1BQHG 4WUKH 1NDMA 2UV3A 5L2KA 3WUZA 1FC2D 3IFPA 3BP5A 5L9DH 3P4LA 4MJ6A 5GJTL 1FN4A 3X13B 5GSRA 3W0WB 4EJ1C 2NY4B 3LQZA 3S37X 1OAYH 1A0QH 1LP9A 5DHXB 1ZLVH 4HFWA 2CUIA 1BQHB 4ORGB 2Z92B 1QRNE 4D2NA 5HGHB 1ZKAA 5JUEL 5D7LE 3L5IA 5AD0A 3V6OA 4I0PB 5ABDE 2IBGA 3MYJA 1JGLH 3ME0A 4HS8L 1A3LL 1L6ZA 4XP9H 5E4EB 1GGBH 4EQ2A 4NJAH 1H3PH 3SCMB 1MY5A 1CD1B 2HT3D 2RCSL 1L0XA 3GSOA 3RVUD 2VWEC 4K8RD 2X4SB 2VR4A 3GMMA 2ZSVA 3MRIB 1AGCA 5JMRA 5FHBL 5TE6H 4K7PH 4KV5E 1NGPL 3T0XA 2OSLA 4KJPD 2Z31D 3HFML 2MTPA 3SCMC 4ZPVB 5CKAA 1U8HB 4JDVB 2D9CA 3PWVB 3L3GB 2E6QA 2FD6H 4KDVA 4GG6B 3QHZH 5DD0L 1T0NA 4PJ9B 1R5IA 1ZT4B 5H37H 4U7MA 1FO0A 2AP2A 2CJUH 4TNVF 4U1HA 1YN7A 3NCJL 3QDJA 4LASH 3FQUB 3DMMA 4S0SD 2DQFB 4MAYA 3GMNB 1B3JA 2IAMC 2JLLA 4KMTL 5E6IC 1KLUA 5C0GA 4JGJA 3V0VB 1MFBH 2IALB 5GGTH 4YEEA 4I2XA 1EFXD 2QQLL 3NFPB 3ZDXF 1F8TL 1I3RA 1MUJA 3QA3B 4YUEL 5JIPA 2JB6A 4ZG1A 3ALXA 4JM2A 1IGFL 2BHZA 4EUPA 1KB9J 3KJ6L 4NQUA 4YBHA 4O9HL 4Z7VE 1Z0NA 2VZ3A 1C7SA 3FMGL 4Y4HD 4P9MH 1J8HE 1ND0A 1MHHB 2YUVA 1PKQA 4NWTH 5JLZA 3VXQB 2ID5A 2ZNWA 5C2UB 3MUGA 2EEDA 2DM2A 1QSZA 1D5XB 1FG2A 1F6AB 4H26B 3DXAB 4JJ5A 3NOIA 3PABA 1MREH 2FR4A 4LCUB 2FBJL 3MCLH 1MLBB 4IOFC 4NRYA 4XXDB 3CFDA 3RGVB 2ILLA 1TZGH 5JDSA 1KLGB 4KK9D 3TT1L 3O3EB 3U0PB 2VLKE 3RJDA 3M45A 3O45B 4LSUH 1Q9LB 1RZGB 4FZEL 4JZJA 3MUZ1 5I1KL 4EOWH 2ICWB 5IWLA 1S7WA 4KHTH 5FGCB 5A16A 5D7JD 1T20B 4RMWA 4JPWL 3D2UA 5IF0A 5FB8B 2NZ9C 1PQZB 1QSFD 2BX5A 4JHAH 3AREC 4KI5F 5DI8A 3FFCA 4Y5XB 1LK3H 5J3HD 4UAOB 3HE7B 5D1ZB 3S5LB 4PR5B 4JPIA 4NGHL 4YPGA 1I9RL 4HKBB 4D0CB 1GOGA 1UA6L 2EDTA 1R0AL 4P46D 3M8OH 4Y8DC 3QT2A 4LCYB 1F4XL 2YEZA 1XGQA 3LS4H 2FL5A 3REVB 1CFTA 1DTUA 2DWEA 1EDQA 1MWAL 1SEQL 3FCTA 2DDQL 2X41A 3QWRD 4JFEB 3F7VB 1ZEAL 1AHWB 4PBWD 5GS0L 5CP3A 3EYOB 2F53A 2VUOA 1FYHB 5EUKA 1NL0H 2FJGA 3ZYZA 2Y5TB 2AERT 4MWFA 4E5XA 5GJTH 4HXBH 3D0VB 4J23A 1F4WL 4HFUL 5IMKA 3VGDA 2WW8A 4NKOA 4AEHL 3S8WA 2BNQD 5BV7C 3QBTB 1MCCA 1O7SA 2NLJA 4P2QE 3ZL4H 3L7FA 3OSKA 4GKZB 4U6XB 1HQ4B 2NR6D 5E9DB 3DIFA 3TC9A 4UQ3B 4I9WE 2Q7NA 3WDHA 1CR9H 2IGFH 3C60B 3ILQC 4OV5B 1FYTD 3B5TA 2XZCL 1DQTA 1CDGA 4NQDA 2QSVA 4DKAA 4BZYA 3WBDA 5KZCB 1AD0B 5C0EA 3UPCA 4MNQA 3FN9A 3WNPA 1OGTA 1FN4B 4ONHB 2G5BA 5F6HJ 4MA8H 3TJEH 2NY7L 2EZ0D 1L4IA 5I1IL 4M62L 3LS5H 5FYJU 5JDJA 4J3SA 5FM5O 1TZIA 5AD0B 2WWMD 4HIJA 1J18A 3QWRA 4HAFA 5D1XC 3EFFA 4OLZH 4YC2B 3X17A 5B4MD 2HFEB 4I9WD 3WLWD 3IDUA 1NANH 2BNRB 2JJWA 5D9SA 4PJBA 5HJ3B 3QAZB 4QXGL 4CVUA 4GUPA 5CBEB 2YUZA 4NNPH 5DT1H 2WIMA 2Z4QB 4KTDH 3GRWH 4KXZI 1FL6B 4HWZA 1EFXA 5GGQH 3CH1B 2J5LC 4XI5D 4AT6B 3Q5YA 1OSZA 2IG2L 1NEUA 5GRUL 5HYJD 1Q9KB 3UROR 1FFPB 1C5CH 2DD8H 3GI9L 4FFZL 4HH9B 3LEVH 5LJYH 1GL4B 1PSKL 1IC4H 4U1IB 2C4FT 1T0NB 4PJ9A 3QH3B 5BOPA 4RGNE 5DJ6B 1FO0B 1P1ZB 1A6VL 2R1YB 2GAZB 3MSPA 4K55A 1QACA 1HHJB 5F88A 3ZKMC 4U7SA 4PJXF 1AQKL 2VLMD 1IM9B 4PUBL 3Q5TA 1WTLA 3QUML 3T2QA 1G7PA 1WZKA 4KTEH 5SWSE 1J10A 4XBGA 2CDFA 4PYHA 5TF1H 2DLTA 4I1NB 3NFPA 1ZA6A 3MOQA 5GHWH 3DHMA 1YNTA 4OLVL 1JRHH 4QRRD 5IB2A 5HHOD 3VWJC 1UC6A 3RDTC 4CMMA 1IE5A 2W92A 1X5FA 2A0LC 3TH3T 1XGUA 4RAVA 1ND0B 4JO2L 4UOJA 5IVXE 4AG4H 4FFVC 4N68A 5T5NG 3VWKA 5HY9A 3MLTB 3FTGA 1RD6A 1U8LB 4LARL 3FMGH 1T1ZB 5INCB 2NY5C 3E2HB 4YFDB 5AWNL 1SJEB 3O2DL 3UTTB 2BNQE 3SGDI 3U7YH 3VXSA 3AROA 3RHWF 3M1BB 1DVFA 5JTWA 4NQED 3MREA 3O4LD 2P5WE 4HXBL 1OB1A 1MFNA 2W0LA 1MH5A 4MAYD 4QRRE 3KYMB 1BM3L 3DMMD 3HZVB 3SDAC 4QRSB 3VFUA 5C3LD 1UM4L 4MA1C 4ODBD 5IHZA 1KC5H 5TDPB 5BV7H 2AV7A 1WAAA 1OTTC 4PRIA 1PQZA 2FEDD 4U3CA 3DJ9A 1U0QA 3RZCD 2YPLB 5DTFB 4X7CC 3FFCB 3GBLA 2E7CA 4GXUN 3SDXA 4DWHA 1KB5A 1JTPA 1ORSB 4F2MB 4PR5A 4AENA 4F15B 1T7YA 1A21A 5FA3B 4IS6A 5I8KH 5EUOA 4BK5A 1ACYL 5DQ9B 3HZKB 3ISWA 2ZUYA 4UUJA 3JUZA 1F4YH 3ZTNL 1Z9SA 2D7NA 2DWEB 2F19L 5DHYA 3FRUA 5I6XB 4AEIL 4H0HB 2NY7H 5IB3B 3VDBA 5A43C 3ZLQC 3I50L 3EYOA 2VISB 3DV4B 4G9FB 2HVKB 4XVTL 3LOWA 2VXTH 4NN5B 4PRBB 3VFSA 4JFQA 3K1KC 2C1OA 3V9FA 1LO5A 2VXUH 4OKVB 1FJ1A 3DRTA 4NUJB 2VWEE 5M7QA 1FYTA 2R2BB 5ID1B 4NPYB 4NKIH 1HSAA 4QCIB 5CJ5A 2YMXH 1CXHA 4YDIH 2ICWJ 5GRJL 4OV5A 4LEXH 3ULSB 1JWSA 4NHUA 4M00A 2ADGB 3MRDB 5J6GA 3EHBC 3LSOB 2L7JA 1T80A 1KENH 1IAIM 4CGTA 3E6FA 1FRGH 3F8UB 1NBYB 1SEBA 5E8EB 1FAIH 2AJXH 1NLDH 1QEWB 1HQRA 3FO9A 4QYOB 1FE8L 4JFDE 3AXLB 4PRPB 1FCGA 2AEPH 1A9BA 1SJHB 4APQC 4M61B 5HHQA 5JNYA 2BSSA 4PGCA 1D5MB 4HZLB 4MXQC 2UVEA 1MEXL 1OL0A 5IFAL 4LHUA 3GHEL 4ZTPH 3MNWB 3RRQA 1C8PA 4HKXA 3IFOB 5IKCA 4NKIL 3T3PE 4QRRB 3MRQA 1YYML 1V05A 3S37H 2VDQH 5DDHB 1GHFH 3HUJA 3OAUL 5K9JL 2DWDB 2VLRE 4JANB 5C2BL 3EOBB 3DMMC 3L5JA 3AAZB 2E9JA 2HFEA 5FYLE 3UMTA 3SBWC 3HPLA 4PJ8C 3FN3A 5CBEA 3F12A 2J88L 3S34H 2NR6C 5GGSA 1T2QH 3RGVD 3MR9B 1NUFA 3SDYL 1P6FA 2W0PA 2W38A 3VRIB 2BCKB 2WANA 3PQYA 4PG2A 4JFOB 1W72A 4JE4B 2HKFL 5L8LB 4WI9A 3RWEA 5BRZA 4OCRL 5ICXA 4ERSH 2JJSA 4R4NC 3LMJH 4WU7A 4BFEA 1L7IL 1NBVH 3U4EA 5D72H 1P1ZA 2IQAB 2FZ3A 1IGYB 2BOBA 3OKMB 4DCQA 4HWUA 5LGHH 4QHMB 1KPRB 2JJVA 4KHXH 4JQXC 1P5UA 5JQHC 3NAAL 4L4VE 5DHVB 3FFDB 3RFZC 4GAJH 1YNLL 4HS3A 5EA0H 3B9KB 1P5VA 2X44D 5F89A 4XBGB 1ES0B 1FVDB 3WDIA 3MPCA 3K1DA 2V5SA 5CIPH 5DJ2B 5GRVL 3V52L 4WTZG 4Y4HA 1KC5L 2F54A 1BFOA 3EO1A 4I0CC 4KAQH 3BI9X 4ODXB 3TO2A 1F11A 1L9NA 4M6NH 4QOKA 5GISH 5C0NC 3TPKA 2V7NA 4HQQL 3PUCA 3DV6A 3RWHA 1R3JA 1IRAY 3VH8G 2V9TA 3RPIA 1SEQH 4JPKL 1JF1B 4PJ7A 2VXUL 2BDNL 2H2SD 4WWKA 4G6FB 1UZ6E 2ZCLH 4A6YA 4M8QB 3DVIA 4FQLH 1QD0A 2HH0H 3RL2B 4L4TE 4KVCH 3LV3B 3CFEB 4HUWB 1T1ZA 3HMWL 4W4OC 2E3VA 1XFPA 4NOBA 3AS1A 1W0WB 3I6KA 3TO4A 4BSWB 5H35A 4I3SH 4XBPA 4NP4L 1WWCA 5JHDA 1XR8A 1DVFB 1I1RA 3TFKC 1XCQA 3IAQA 4X6DA 3CCHB 1X4YA 5HTSA 3O2DH 2M1KA 1Q1JL 2WBJB 2R0KH 4Q58C 5KVDH 3KYMA 1MFAL 4F7PB 1U9KA 5D2LB 1AKJD 2ESVD 2NX5B 2A2QT 2VLRB 4OZHE 5F6IB 3OKLB 4OFYA 4NT6A 1Y6MR 3OF6A 1PG7H 4WW1B 3V8CA 1MCOH 3BKML 4JFHE 3QUXC 5CUSH 3TH4T 3P4NA 4G6KH 1B90A 5EC2A 1GGBL 5D5MF 1G6RB 4MQ7B 5JW4Q 1U95B 1YPZA 1VFOA 2DQDL 4F8QA 4IDLA 4KZEL 4LPUA 5I2IB 3NFSH 1JZ2A 1VA9A 3PP3K 4LLUB 4Z78A 1A0QL 2CKBH 2PW1B 1KFAH 3BSZH 2FX9H 1FFQA 4KY1L 4L3CB 5IB3A 4UBDD 4MQSB 3P2TA 3MLXH 3MLUH 4NCC1 3LN5A 4U6TA 5F9JA 3DV4A 3OB0K 5JR1L 4Y16B 3ARGC 1JGVL 1M7IA 1CE6B 2W9EH 2C1OB 5INDA 3X11A 1T22B 3SJVA 1XIWD 1QNZL 2FYYA 2M2DA 3ARBC 1I75A 1RZIB 2XTJD 4HC1H 1S5HA 1S78C 4G8FB 3QDAA 5LGHL 5FM5M 2ZUWA 4WDIB 5IR1A 1XEDA 4M6MH 5EOQH 1YMMB 5TH2B 5L2JA 1IEBB 3RJQB 1G7MA 1BGXL 3FT2B 2ADGA 4S1SH 1OSPH 3QHFL 4FQIH 2V2WB 3DXAD 4MZ3A 5K9KA 3MCKB 1ZSDA 3E6FB 1DQLL 4XC3H 4F7CA 5JIKA 5LQBH 2IBBA 2YN3A 3SDYH 3FQWA 3QXTA 1G7QA 1AIFA 4PRNB 2YC1B 3DGGB 1MCRA 4U1LA 5DRNA 4YBLB 2WZPD 2MCG1 5A2JH 4RGNB 4H1LB 3IFOA 5CZVH 4HC1L 5DRZA 1K8IA 3R4DA 3G5VB 1ZT1A 5GJSL 1ZHKB 4MJ4A 3QUKB 4JDTH 1FRGL 2BMKA 4JR9H 3EYFA 2Q8BH 5ITFB 4R26H 5SX4H 4ZUUA 4KTDL 2NW3B 1FH5H 3BGAA 5FEBA 1FZKA 32C2A 4KK9C 4JVPA 4ODUB 2SEBA 3STZA 4LCCB 1FNSH 2FIRT 4FQ1L 2C7UA 5SWQA 1OD9A 2KPNA 1N3NB 5D7JB 2VRAA 3BH8A 1AR1C 4KUZL 4WUUE 3LH2L 3QQ9C 2G9HB 3W2DH 4JFOA 1INQA 4QLRA 5GGRB 2XZAH 5F7EL 3OPZL 2QHRH 2OP4H 3U79A 1I9IL 5F9WC 4PLNC 1B2WL 5EPMA 1QSEB 3QIUB 4XAWL 1AQKH 3BKMH 3BP5B 2RIKA 4TUJA 2AXHA 4TVPH 8CGTA 1AFVH 3W0WA 4HULB 1MIEL 3E8UL 3LKRA 5EFIA 4JFDD 3TN0C 4MDIA 3PDOA 2PYEB 4JKPL 2I24N 1M05A 5F89B 4ZXBC 4RMUA 3JV4A 3RUGA 3KJ4C 2D03L 5J11B 2F54B 4MGXA 4XNZB 1FGVL 1CXIA 5DD5H 5D72L 2JCCF 3P4MB 1A9EB 4WUUD 3NIDF 4M6NL 3GSOB 3GMRA 1AGEA 1NCTA 3MBEA 1K2DA 4KAQL 4N0YH 4UINH 4P23D 3TPUA 1JPTL 3N9GH 4DN4H 1T66D 5IHUL 2XNAA 4OAWA 4DGYH 1G9MH 4MAUL 3PWUB 4HMEA 5DUPL 4A6YB 5F70A 2Y06L 4CDHA 3EOAA 5I1JL 2CLRA 1U8HA 2KH2B 4RDQG 1WCBB 2GHWB 2FHCA 3RWFA 3BQUD 4ACPA 2FJFB 4GG6A 5JW4R 5H37G 2VZTA 2WP3T 4XVJL 1X4ZA 2HWZH 1CICA 4QRPD 4JY5L 1YN7B 4WCYH 4M93B 4PLOB 4LKCB 3RWDB 2IPTH 4XP4L 2X4NA 4IDJL 1A4KB 3PV7A 4LLQA 1QSVA 4F7PA 2X1OA 1CT8A 5C0JA 4KGJA 5E8DH 3NCYS 2VXQH 3T0EA 1KPUB 4UQ2B 1RK1B 5B38G 3QUMA 3FT3B 2AEPL 3Q5OA 2FRGP 5I30H 1Q38A 1QLRB 3E3QC 1YA5A 5DJDB 4QY8A 5L7XH 5FCUL 4P5TA 5B8CA 2Q86B 3UAJC 3HCVA 3UTSD 4OZGF 4WTWA 2MCPL 3VXOA 1VKXA 5JHDD 3F7QA 3QO1A 5KW9H 3LPGA 2CDEA 2DBLL 3HNVL 5IW6B 3S96A 3IGAB 4PTTA 4XVTH 1S9YA 1RURL 5K59F 5LGJB 3QDGA 3B8SA 3EYVA 1ZGLB 3MLRH 1BP3B 4Y4KD 4ZNCD 4U0QB 4HIEB 1BX2A 3CMGA 4JHZA 2GIYA 3VFGH 1KLGA 1NPUA 5IT2H 5JW4M 4LU5L 4X4YA 3ESUF 5DGQA 2CKBA 1UM5H 2PTTA 4LP4A 3MBEC 5L6YH 4CL7A 2VIRA 1MFDH 3RY4A 4YGVB 3A6OA 4QOKD 4ALAL 3SE9H 1VACA 4NNPL 2FX9L 4EN3A 4U1KA 4P2OD 1PAMA 2YD4A 1NEZB 4V2BA 3OZ9H 3HR5A 4UT9H 1H5BC 4WI6A 5JOFB 1JHLL 1AI1H 3Q48A 2DQIH 1A1MA 3IETA 5CILL 1PY4A 3DO7B 4XBEL 4Z9KB 4XMKL 4Z95H 2F8VA 3GMLB 2PETA 4ODWB 5KSAD 3TN0D 3AGVA 1WQVT 2Y72A 1WFTA 5DK2B 3N9GL 4DN4L 3EUUA 4H1LA 3SGEH 2XG5A 4PGDB 3IDIA 3RWIA 3GIVA 3TEUA 1WZ1H 4LDEB 4NN6B 1M7XA 2AGJH 1N6QH 1K3IA 4U7KA 4LHUD 4LKXA 3FQNB 4XB7A 1QP1A 2ZP0T 4M3KB 2EXWC 4NO0D 2BY0A 3OG4B 2GT9A 5E2VL 5HI5D 1LDPL 3MUHL 3TIDA 4K94L 3OJDA 3QXUA 1I1AA 1IGFH 4YHIB 2ADIB 1OTSC 4K2UH 1I9JH 2HP4A 4IMKA 1I1FA 3W2DL 1QUNA 4X5WA 4ISVA 4JZOA 1RZ7H 2F74A 3LH2H 3WFEH 4R6UA 3SKMB 1T1WA 2HG5A 1RZJH 4PJXE 4MAYC 1NFDF 2PXYC 3DXAE 4MNQB 2RHEA 4YBQC 4TUJB 5HI5C 3SDAB 5F3BB 4OJFL 3ZO0A 3PGDA 1QBMH 3T1FA 5DWUH 1E0OB 2IADB 3UTPD 4YHOH 2DKMA 1ROWA 4IRJC 1AJ7L 2IANB 4G3YL 2Q6WB 2VAAA 1U58A 5IB1A 1A7OH 1RZJC 1J0ZA 3CDGB 2VDLL 2R8SL 1S7VB 1CLCA 4A2LA 5KTEL 5CD5C 5HDQL 1S7SB 4BFIA 1GVIA 4NJ9H 5IHLB 5HHOA 3OXSB 1NGWB 3VA2C 4UV7L 3BVNA 2NYYD 2OL3B 2V2XA 5HI4D 3VW3H 2CMRH 5E1AA 3OKOB 5IVZB 4XI5C 1NAKH 1WITA 2J2ZA 3RWFB 1F4YL 4UTAL 5IOPB 2X1QA 3ARGD 1R24B 2BHUA 3BPCB 1TJGH 3GSXA 2R1XA 3QH3A 1RI8A 2FJHB 4P3CH 5I1CL 4MA8L 3VFWB 2NMSA 4UTBL 4WEBL 3INUH 5F88B 3IRPX 1LE9B 3RKDC 1NGXA 5ESAA 1QSFA 5HYJA 1TETL 4NQEA 4LPTA 4HWBL 4XVSH 1A7RH 1G7PB 2VE6B 3HB3D 2OS7A 1ZVSB 1EHLH 1T4KA 3WS3A 5JOPD 1HZHL 4ONOA 4F7EA 4FQHB 1AR1D 4HJ0C 5EU4A 2X9XA 4NZUL 1NFDA 4PRHD 2VAJA 3QXAA 4ZXBD 3QUZD 4G80A 5E99L 3TNMB 4U1SA 2VDKH 1BEYL 3QUXD 2NY4C 4PJDE 5K9OA 4NQVA 2FLBT 1IFHL 5CMAB 3L3DB 2WQ8A 1VESA 3WE6B 4KZEH 3HCVB 3NFSL 4KDTA 2EYRB 3HE6C 3GMOB 1UWEH 4Z7QF 1CGXA 5IMLA 3MLUL 2CUHA 3GSWB 1IM3B 4FQJL 4OGAC 2EH8L 1OAKH 5CEYB 3T4YA 3QQ4B 4U4BA 1EHLL 3BWAB 3BMVA 3L3OA 1UB5A 3ARFB 1CZ8H 3IRZA 1CDIA 3JWNC 1U2HA 5J1SC 1AGDA 3U30B 4AH2A 1UKQA 3EJZD 4NQCD 3V8OA 2KUTA 5KSBE 3C9NB 4DQOL 2F58H 4PJFA 1WFNA 2BC4A 3G5YA 3WN5B 3BPNB 4QRSA 3VFUB 3AB0C 1JIBA 1IAKB 3OKDA 1JNLL 2H2SC 1WF5A 5SWZB 3TCLA 4XNUL 2AV7B 3QDMB 4YPJA 3ARGB 2JKXA 4BKLA 5I15H 1T2JA 3LIZL 2OL3H 5DQJB 2QR0A 3BQUC 2DJ4A 4PG2C 3TGXA 3IKCA 2VABB 4HLZH 3RY6A 5F9WB 1NC2D 4XMLH 2UYLB 1CDHA 1JNNH 4G6ML 3GNML 5AZ2H 1I7TA 2ENSA 5KVEH 5C0FB 5D7JC 4O2EA 4XP6L 1RZ8A 4WWID 1QG3A 4DVBB 3IDMA 2VISA 4KTYA 4BYHA 3ULUE 1L0QA 3DROA 1RHHB 2Z9TA 4LLDB 4ELMF 3SGDH 3KPRE 4NCDA 3SGEI 3R1GH 3RU8L 3C5JB 1XIWC 2Y1VA 4HUVB 3ZSTA 5IW1A 3IVKA 3BJ91 3UJTL 3FQNA 5CINH 5KSVB 4ZOCA 2R15A 3O4LB 4XGZA 3K4ZA 3MJ7B 3VCLB 3O3DB 1A7QH 3KJ6H 4X8JA 5C08D 2HMIC 2R4RL 3DOSA 1MI5B 5C8JB 4UBDC 4DFHA 4KC3B 1NCNA 3KPNA 5ENWA 3ULSA 1NBQA 3UZQA 4D9RD 2RJMA 1MVUB 1LDPH 4GAFB 1CL7L 2Y07L 3UDWC 5CZXD 3SKOA 3VGHA 3O0RL 1YPZF 5I8OL 1A47A 2EDNA 1KIRB 3FOMA 3QJFA 5D7KD 1PZ5B 5FYLL 4CKVX 4Y5YC 5IEHA 3BP6A 1KELH 4PV9B 5KSBB 1FZJA 1TVHA 3NABL 1AO7A 2ERJC 4NBZB 2VSDA 4NO0A 3RDTA 3SKJH 3ARBB 4H25B 5C0DB 3HMXL 4FQJH 5DDHA 4HXAL 2W59A 3VU2A 2YRPA 1REIA 3ZZ1A 5CS7A 1MCNA 5D7SL 1GJIA 3L3JB 2K7PA 4N1CA 4M7ZC 4JN2B 2W9EL 4NUGH 3MV8D 2JELL 1GGUA 4CU6A 4YC2C 3BVNB 2E9WA 4ZSOE 3PHOB 5JPNA 5B3JF 4GRLC 5E1AB 4JQIL 2C3VA 2AABL 1TCRA 2OSLB 4RZCA 5BQ7B 2LU4A 5DJ8B 1BEYH 3UYRH 4PLJC 4Y19D 5L2KE 3L7EA 4PJBF 3MRNA 2BXZA 1WIUA 4LLYA 2EO9A 3NZ8B 15C8L 2R0LL 1F4AA 2FJHA 4RISH 1N2RB 3BUTA 3QDJB 4AM0B 1YQVH 5D7LA 3AFLA 1NC2A 4NKMB 3FQUA 1DDHB 3BXNA 5C0BB 3INUL 2XXCB 1NGXB 1P7KA 1MQKH 1U8PA 3Q6FA 3SN6N 5DRWB 3V0VA 1ZE3C 1AGFA 5I75C 2AXGA 1OAYL 4I2XB 3ARQA 3PL6B 1A64A 1N8ZB 2J8OA 3QXAB 3Q1SL 3BKJH 1IZKA 1CFNA 1OGAE 4TNWF 1JPGB 1DZBA 5FDWA 4U1SB 1NCWL 4OBRA 2V2TA 2OM5A 4NO2A 1WLHA 5I15L 1R3JB 4XP9L 3AS0A 5M94B 4E0RB 2YWZA 1JHTA 2H1PH 2P45B 1PKQB 3UBXG 3HZYB 4PP1D 4K23H 1YYLL 2BY3A 3MACL 4XWGL 4N1HB 1D5XA 4YHKL 1F6AA 4X6BA 2FB4L 2FHBA 3T4YB 1MFAH 4JFDB 2J6EA 2Z93A 3BWAA 3HI6H 1JV5A 3C60D 1IAOB 2CH8A 5EU5B 4FXLA 3WNMA 4XXDA 1C1EH 5DK3A 2NXYD 3CFKB 1GH7A 4XPAH 2EDEA 3CCHA 3A6CL 3SDXF 4BK4A 4YBQD 1GGCL 3G5YB 3WN5A 3MV9A 4X7FC 4DGVL 5SWZA 3ULVD 1B4RA 5CLWA 2ITCB 3OMZA 1A7QL 3HNSH 4LAJH 4UB0H 5IBUB 4OZFG 5JMOC 4ZSOB 1UCBH 5EO9A 2B4CC 1A6ZA 4WUKL 4XP1L 1KYOJ 4QRPA 3MX0A 2HFFB 1NMAL 5IBUG 5EIQA 1A3RL 5DFVD 3GMQB 3O11A 2OXHA 5T1LD 3RKDD 2IWGA 3U9PL 5BOZG 4BA8A 5IW3A 1IQDA 1EXUA 1T5XB 4G6MH 5AZ2L 3EZ8A 3LN5B 1WEJL 1G0DA 4FQQA 5EOCH 3KLSA 5CWSA 4EN3D 3C2AL 1EZVX 1I1YB 4G7VL 4RMTA 4G6AD 1XF4B 2DQJH 4KH2A 1OTUD 2VLJB 2OJZL 3ZTJG 1JK8B 4HT1L 1A1NA 3HMXH 5GRVK 4OM0H 4HX1A 1DSFH 1GIGL 1YY8B 2BVOB 2XT1B 3H0TB 1J1PL 2IC2A 2VH5H 1S5HB 3IXTA 3KPSA 5EZLA 4WDIA 3DIFB 1MREL 4LOUD 5I1DA 2HKHL 5TH2A 5EBWB 4YNYB 3CX5K 5IGXL 3DHJA 4PTUB 2Q7YB 3TA3D 3VMOA 1XGYH 3S6CA 1HIML 3SEPA 2FX8H 1DQJB 3O3BB 3WO4B 2C26A 5HYSB 5I8EA 5K93A 4FXGB 2Y4SA 4U3XA 4ONHA 4EI5C 3QXWA 2QKIA 4R26L 1KJ2L 4YHZH 5C0AE 4E41B 5HYSG 4GRWE 3PE9A 2QQLH 3VFNA 1IJ9A 3WJLC 3KDMA 2CK2A 1TVHB 3UCRA 2MHAA 2DOCA 2IQ9H 3W0WD 1AO7B 3RDTB 2X1PA 5EU6D 3VWKC 3NIDE 3NABH 4JZJC 1T21B 5HGBB 2YA0A 4YHYB 2V5MA 1A02N 3AM8A 4L8DB 4O00A 4PY8J 2BNRA 1CWVA 1R3IH 1UB6A 1H3UA 3NFNB 2VDPL 5E2JA 4MXQD 4YK4B 2GJ6D 4HCRL 1UYWL 3ZKND 4OBSA 5GS2D 1FL6A 4HWZB 5DVOA 5JPNB 1G6RH 5I8CA 4RZCB 2D7QA 1MF2L 3WYRA 1SYSB 5T5NF 1W0VB 4OM1L 3BN9D 4P57A 3HI1B 3T0WA 4QXTB 2WBJD 1NCCH 2IGFL 4XPTL 3RGHA 2HTLC 1QSEA 2O5ZH 3QIUA 2ITDA 4MJ5B 3FQRB 4NBYB 2NQCA 3SKNB 2QQKH 4WU5B 1CQYA 4FG6C 2CK0L 2BJML 4EDWH 1FFOB 3BT2L 4JCMA 1OY3B 2GK0A 5FAAA 1EX0A 4C4KO 2BSTA 1DBMH 2I07B 2V9RA 1IZJA 1ETZA 3PXJA 5I66A 3JV4B 4TUKH 3WFBH 4QXUH 2H32A 4PJEE 1ZA6B 3FJTA 2AKRA 2GSGB 5D2LE 5IB2B 5DXWA 4FQ2L 1IQWL 1BD2E 1RJLA 3MV01 4ONFH 3G08A 4GQ9H 1U6AL 1FNSL 3CDYA 1R0AH 1VPOH 5IMOB 1U8NA 2B4CH 1G7LB 4OAWB 4Y1AE 4UV4L 3SGKC 2UY6A 1GAFH 3DX8B 3VGAC 1TCMA 4Z7UF 5F7FA 4JO1H 3W82A 4RA3A 3P0VL 1IKFH 3P11L 3MRHA 3X3FL 3R06A 3OKKA 3ROLA 2PYFA 4L4JA 2ZOLB 4F9LA 1TFHA 4OB5H 1QFPA 4YHMH 5J89A 5TGBA 1MFCL 5HDLA 5HGGS 4PD4K 3NN8A 2CLVB 2NX5D 2V5TA 5D6CA 4PJGF 1P84K 2YKLH 2F15A 1FAKT 9CGTA 4ALAH 1H8OA 7FABL 1OB1B 1T89A 3G5XB 3FHQA 1CG9A 2BNUA 4JM4L 2P7TA 5DWUL 3FN0L 4LDLB 1KPVB 2VH5L 3W9DA 1MCSA 1CFQA 3F5WA 5FUCC 1AKJA 5IBLD 3BZFB 5FUOL 4JY6B 3KHQA 4WFEE 3ET9F 3F62A 5IIEA 1J8HB 3AMLA 3RP1A 2GTZB 4PJHE 3EJYC 3LZFH 1RURH 3RAJH 4JRYE 2BZDA 2EH7H 5C0AD 2HFFA 3MOBL 3ZDZF 2B5IB 3CJJA 4G8GB 1PDKA 2CR6A 1TZGL 1EHNA 5IMMA 3OF6D 1R3HA 3RVVD 1P4IH 3HZKA 2PCPA 1ORQA 1IL1A 2MKWA 4PJGB 3CZFA 3MJ9L 4BZ2H 3VXSE 5DA0B 1D5ZB 4MS8D 2ICEA 3P4OA 1FC1A 4S1QH 2YD5A 3ILQD 4RWYH 4WW2B 1XF2B 4WGVB 5ID0A 1MRFL 1I1YA 3LKOB 1U3HD 2VLJA 1QQDB 3FKUS 2IANE 3G6JE 4OD3H 5D1XB 3U2SA 1B0GB 1RUML 2V17H 3D3VA 1NMCB 3VXUB 3PGCB 3M07A 1MRDL 3CX5J 3OX8A 1DFBH 3RI5F 1FZOA 4Y2DB 4WWKD 1AR2A 3N50A 4PV8B 3NPSC 4Q9BA 4XAKE 4MD0A 5BMFH 1NAKL 1KV3A 1FP5A 1T04B 1UM5L 2ZUQB 1D5IH 1BREA 4MB3A 4X83A 3QUYA 1TTUA 5KSUA 3UEZA 4KMLB 2XPGA 3PHQA 4C54A 3X13A 3FO2A 1JFQH 5EU3B 1CS6A 1LP9B 2IF7A 2Y5EA 4JM2C 1F3DJ 3MNWA 4GS7B 3SGJC 4JG1H 4HJGB 4JREC 4XZUA 1BFVL 1T5WA 3LRHA 4PGDA 5J57B 1K85A 3ARDB 3ORJA 4K3DL 5FFLA 5E5MA 1P7QA 5KVDL 4LQFH 4ORZC 2X4QA 1MCWW 3MYJB 3S4SA 4FQXC 1VDGA 1HWGB 3RTQC 1NAML 1MCFA 2EDRA 2FH6A 4LGPB 2YXFA 5ANMA 4ZAKD 4X7TB 1CD1A 2CLZA 4YXHL 3HPLB 3OGCA 3NFNA 1AGCB 2Y6SD 4I77H 3VFRA 3W11D 1RZJL 4ZOEA 1I1AB 3PNWA 1R3IL 4M4PA 3P0YH 2ZCKH 3BX7C 3UTOA 2P8LB 4ZPVA 4OZIB 1MCQA 2YD1A 4U1MA 2GFBB 5F72S 5IVXB 3GUTA 4MSWA 1FNFA 4YR6B 1DE4B 1DUZA 3H9SB 3OTTA 4J3TA 2HG5B 2X42A 1R5IB 3SKNA 4HMDA 1WIOA 2QBWA 3D69A 2VDNL 4XNMA 2IQAA 4U1HB 5EIIB 3KJ4B 4HBCL 5C09E 3LQZB 2DQUH 4F37K 4XMLL 1PX4A 4P4RA 3FFDA 5CGYC 1I9RH 3WFCL 4LVOB 2IALA 4HKZB 1ES0A 4Q74A 1WFOA 3CVHL 2Y7QA 3ZDYE 4XH2B 4MXWL 3BMWA 4WO4D 4ELMA 3BP7B 1WC7A 2FO4A 1BFOB 2DF3A 4LHJB 1GGYA 3AU1B 1F11B 4JM2B 4R4BA 1DQMH 2IPUG 4W6YB 1GXEA 5CD5D 5I8KL 5IROA 2R69H 3DWTA 2APFA 3PQYE 5DD5L 4R4ND 3VXRA 2Z8VC 5DR5L 4HK3J 4DZBB 3LZFL 3P9WB 3RAJL 2AEQL 2ED9A 3ARBD 5EOCL 2A38A 4WFFE 3QPXH 1CXEA 2UWEE 2HTKD 2APVA 3MC0A 3S34L 1KOAA 1NC4A 2YD2A 3JBG7 3CSYA 3DX6A 3FOLB 3PWVA 2OXGA 3UJJL 2FR4B 1YEGH 2NY3C 3RVTC 3QI9A 4L4VA 4DAGH 5KN5B 4JRXA 5E8NB 4XBEH 4WRLA 4X98A 5B39B 5F7NC 2J88H 4HUXB 4W6WB 2DQFA 4MAYB 3SE4A 2HT3C 3O3AA 4HIIB 3GMNA 5TE7L 3O45A 1SBBA 3WS6A 2QSCL 2VC2L 1LO3H 3CLEL 3SKUD 2VE6A 3ARPA 4Y5VB 1GZQB 4JLRA 1OTSD 3QXDA 3KPPA 3P11H 3CU7A 1S7QB 4M5YL 5D70H 5E6IB 1NFDB 5C08B 1MAMH 4DGIL 5IF0B 1AKJB 1EJOH 1I3RB 3B4NA 4UILL 3TNMA 4R97B 4WVRA 3QEQE 1J86A 4Y5XA 5MHSE 1MHPH 3HRZA 4M6OH 4Y19B 2J3SA 2E6JA 1KCLA 4ZQKB 3U30C 2GTZA 1B2WH 1DVFD 1XMWA 1I85C 3QCVL 2VZUA 5GSVA 1U95A 4L4TA 3WFDL 1TETH 4XVSL 5EZJB 4WFGE 4HKBA 3SHSA 5DMGC 4R3SB 4N9GB 4OZFB 2VITB 4ZODA 3TO4D 2WWKO 3D0LB 2ZSWB 2LQRA 1Y6NR 3JWDC 5T1DH 2CUMA 2VL4A 4P5KA 1C5BH 2ICEB 4H0GA 4ZNEE 1OT2A 1KGCE 3HNVH 4Y5YA 4K3JL 3BRDA 2Y5TA 1T1XA 1GRWA 3DTXB 4E5XB 4PRAB 1QQDA 1B4JH 1UXSA 4KK8D 1HINH 2APTA 2YWYA 2AK4B 4GH7B 4PJFB 1S8DA 3U2SB 3ABZA 4LSDA 1N5YH 5DVMA 3D18B 1YMHB 3S88L 2XKNB 3NTCH 4G8EA 2HFGL 4LSTL 2DIAA 4IHOB 3TCLB 1WZMA 3MTRA 3QDMD 2L0DA 4GBXC 5A1AA 4JFFB 3KNBB 4EUPH 2WBWB 1YPZE 2NNAA 3SE3C 5DEFA 3X12B 4MD5A 3V6BR 1E4KC 4UIKL 3BKJL 3KPOB 2HT2C 3ZKQD 2BERA 2PKDA 4QRQA 1F90H 1LO2H 5HBBA 4LSRH 1TNNA 3V4UH 4NC1E 1D9KD 1BQSA 5ALBL 2E9BA 1WTGT 2G5BB 4OCLC 2ZPKH 4EKXA 1KFAL 3DGGA 4KY1H 4D0DA 3REVA 3BESR 1RIHL 5L0QC 2H2PC 2G75B 1AHWA 1TNMA 5D5MB 5D6DA 2X4RA 3FZUC 3M17B 3U0TA 5HHNB 4KWUA 5EWIL 3S4SB 3F58H 3MCG1 3QULB 3TVMD 1MCEA 3KGRA 2BVPA 3QEUB 1UWGH 1ZS8A 1HWHB 3GNMH 3MV8E 3QB7C 3QNXB 4L8CA 1CICC 4LRNH 1I8MB 3LQMA 5MERA 4OQTL 3FB8A 3QFDA 1NCAL 4U2ZA 2DQCL 1CE1H 4X4ZA 3T77B 1X5IA 1J5OH 5H2BA 3RZCC 1HHKB 2W9LA 4ETQA 4K9EH 2AJUL 5ADOH 4PRPE 4V1DA 1V3JA 1Z9OA 3MRCB 1GOFA 2B0SH 5GS3A 2Z91B 3NMEA 3KYNB 3MODH 3VXMB 2AVGA 1LEIA 2EEBA 4OUUB 2J4WL 1YEIH 1Q9OA 1WIPA 4U6VH 4HFUH 5BW7C 1IM9A 4YDLB 4MQXC 4UNUA 5T3ZD 4CU7A 1EO5A 3P30H 3P40A 4HIJB 5IVOA 3ARBA 4QHUA 2HJLB 4Q97A 1ZT7B 4FFYL 1HKFA 4F7TB 3ZYIA 4Q6IA 4YXLH 4OZHB 2ICWI 1X3DA 2EDOA 3MRKB 5ICYA 1CFBA 5T5FL 4TULL 4U6HA 4M6OL 1KCUL 5ILTH 1UXWB 1FNEB 2Z4QA 1X7QB 2XNAB 1CGUA 1WZLA 2EDKA 2FO1A 1A7NL 4B7IA 4GOSA 4FFWD 4AZ8A 2WAHA 3C5ZD 1BBDH 1U42A 4V1DD 1ED3B 4OI7A 5D4QA 3QPXL 4GO6B 3QIBB 3MRNB 1TJHH 5F3HB 4M1CD 4HPYL 3RWJB 4NFDA 3VXSB 1BIIA 2JK5A 1NQBA 1A6AA 3QI9B 4JVWA 4L4VB 1XCTB 3WLWC 4L1HA 3STBA 1NC2B 3BQUB 4K3EL 1NKRA 3FFCD 4LLQB 4J3OC 4X9IA 4PB0L 1U8IA 1HK6A 3ZDXE 3ULVE 4Y5VA 5E03A 4KK6D 5DEGB 4EXPX 5TDPA 2BVQB 2D7PA 4PRID 2K7QA 5T1LB 2P5WD 1BZ7A 3VXUE 2P49B 3QUMB 1T7XA 4XWGH 3RX7A 3DUSB 3NCBB 4QHKI 1TVDA 4FZ8L 5DQDH 1QFWM 3EOTH 3DSFH 3LS5L 1WT5C 1MI5E 5E8DL 3HLAB 3S37L 1A7BA 1H3TA 2WUCL 1N0LA 2C3WA 2YRZA 3MXWH 2AJZA 3VXOB 1VKXB 4N8PA 1I8IB 3MLTA 1SY6A 4OIBA 5HHPB 2CDEB 5LKNA 3D0LA 3S96B 2FEEL 5IB5B 1LO4H 1ZHNA 3EYVB 4PJ5A 1SJEA 5FUZH 5DVKA 1JV5B 3PWPE 5F9AC 1JGUL 3L3KA 4G9FA 1A7OL 1EH9A 3M1BA 1T1XB 4RBPK 4DJMA 1BVLB 5E7BA 2FD6L 3Q6GL 1IGJA 4MYWB 4PRAA 1MCIA 3K2MC 2ZPKL 5MEQA 1FJ1B 5IBTH 2CJUL 5DVNA 2B7DT 4L5FH 5DJYB 4PJ9C 4OD2B 4RDQF 2OR7A 5GZOC 4KI5E 2ITCA 4OFKA 4FTVA 4JFFA 3O4LE 5JW5B 1U8OB 5LXGH 3D3VD 3H3PL 1OAXL 3MRDA 5J6GB 4H88L 1EBPA 4UDUA 1QYGL 2VQTA 4NUGL 4QRQB 2O5YH 4LVHB 1E27A 1J9CT 2R4SH 4HAGA 4XPTH 1TZHA 5FA3A 1N5YL 1C12A 3DO7A 2XTLA 4UU9A 4ZFZB 2XWBB 1Y18A 3DUUB 4L3EE 4JQIH 1A9BB 1SJHA 3ZKMD 1U3YA 1Q94B 1S7RA 4UTBH 2Z31A 2NY2C 2RGSA 4LVNC 4K71B 3WJJA 5EZOH 2FWOA 4C56D 2GY5A 2Q1EA 15C8H 2P1YA 2R0LH 5L88L 3GSVB 4PGBA 4WENB 5HGAA 4LHUG 4BQCA 4EQ3A 1J0IA 2DWDA 2BVPB 1GHFL 3QEUA 3RVXD 2QJDA 3BRGC 1JWMA 3CPLB 1I7UB 1YYMH 2R9HC 4NJAL 2ZG1A 5IESL 3VMPA 2C9AA 5HHVH 3IDJB 2KZ1B 1D6VL 1Z0MA 3LKNA 1AH1A 1FVEB 3QXVA 2RBLA 1HHKA 1KIUA 4POYA 1LVEA 4JZNA 2N7BA 2NZ9D 4ETQB 1K5NB 3S3PA 1W72B 4PLKD 3SQBA 4JREB 5DJAB 4AK1A 2WWMC 2AJXL 4GRMB 4XXCA