5AZ2H

Crystal structure of the fab fragment of 9e5, a murine monoclonal antibody specific for human epiregulin
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
220
Chain Sequence
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPLNDKTKYDPKFQGKATITADTSSNSAYLQLSSLTSEDTAVYYCSRGGGDPVFVYWGQGTLVTVSAAKTTPPSVYPLAPGSAANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-human epiregulin antibody 9E5 Fab heavy chain
publication title Epiregulin Recognition Mechanisms by Anti-epiregulin Antibody 9E5: STRUCTURAL, FUNCTIONAL, AND MOLECULAR DYNAMICS SIMULATION ANALYSES
pubmed doi rcsb
total genus 45
structure length 220
sequence length 222
ec nomenclature
pdb deposition date 2015-09-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5az2H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5az2H02
1OPGL 4Y8DC 3IDMB 4WWID 5KG9A 5EU6D 3WIHA 3QG7L 2ZSVA 5C0DB 1WFNA 2DOCA 3T0EE 3BKYL 2AEPH 5E5UB 1A1MA 2HH0H 2HT4D 3GSUA 4N1CA 3SKJH 1OAKH 1ZOXA 2XICA 4Z7WA 5F6HI 3Q5TA 4KK5D 1MPAH 3BWUC 4RWYL 2E6JA 1X5ZA 1GAFH 4ZFOA 5F6IB 4OM0L 3UBXI 1YN6A 1NFIA 5EORL 1A3QA 3OV6A 1E6OH 3UTSA 5C6TL 2WWKT 2FR4A 2PYFA 3GJEA 1PJ9A 5GQBA 4UTAH 2ADGA 3CX2A 5EG6C 3HC0B 1I9RL 1KCVH 1S7WA 4JFEE 3TNNB 2MOVA 1M7IA 1XH3A 3X11A 4M9OA 2DBLL 4KROD 5JMOC 4K94C 4OLVL 2VERN 2APWA 4GKZA 5T3XE 4I0PB 5CKAA 2D03L 3EYOB 4Z18A 5KS9A 3MOAH 4KTEH 4Y19D 3MCKB 4RGNE 3TNMA 1MRCH 1N0XH 4MCYB 4AYFA 4YUEH 3WFEL 2GJZA 5ILTL 1OTSD 1QO3A 2KUTA 2EH8H 3MLPA 3NVQA 3WXWL 1CXHA 2VDQL 3QFJB 4OZFB 1LMKA 3V6ZA 3QQ3A 2WIMA 3IU4L 1UJTA 4Y5YC 4PUBL 4CVUA 2PXYD 4NN7B 1OHQA 1XIWC 3W39B 1S3KL 4G43B 5F7DA 4PRNA 3FB6B 4I0PD 1V05A 2FD6H 4CU8A 4KU1A 1U3YA 2AJSH 2CUMA 4OD1L 1AHWB 2EYSB 5GGQH 2WBKA 2GFBB 1MLCA 4MCZB 5H8DA 3WS3A 2P8LB 2XN9B 1WF5A 1ACYH 3RVUC 1LP9A 1G7QA 1FVEA 2C1PA 4U1NB 3DX7A 4X7TA 1G9EA 3UTPD 2X70B 5F72S 2H9GB 5CEXB 1JJUA 3BP5A 4PRDA 4E41D 4Z6AT 1I7ZB 4BFGA 1NCWL 1WJ3A 4N0FA 4PJHB 2A73B 5EZIL 3QPQC 5EN2B 4FS0A 1T20A 3VGAB 5C0FA 2IGFH 1MUJB 3T0VA 4F9PA 5MEPA 3MCLL 2I9TB 4P57A 2NZ9D 5F3HB 5DMGC 1LILA 3EKCA 2IFFH 1FBIL 4P5MA 1M05A 1R3HB 4ZTOL 4PTUB 3OPZL 1RZ7H 1NCDL 1DVFC 2HVJB 3MRRA 3I2CH 5I8KL 3ZKND 3JWDL 3LN4A 2X1XR 1CR9L 1JYNA 1HKLL 1XR9B 4MB4A 5I16B 4XBEH 5DT1H 5GGTH 1RMFH 3SDXA 1L7TL 1UWGL 3OR7B 5BQ7A 3B9EA 4G7YL 3TPUA 2NW3B 3C8KB 5LAXA 4PJXE 2RGSA 7CGTA 1Z9SA 4NNXB 3BZFA 3TYFA 5I1LB 1CFNB 2VWEC 4JQVC 4OQTL 1OP5H 4HFWB 3QDJD 3UZQA 5HJ3A 3MLZH 2IANA 4X7SL 3H8NA 3FB7B 4UOW0 4ZUUA 5ICYA 3ULUD 1N59B 4K2UL 4LDLB 3DXAE 5GIRB 2AV7A 4RDQG 3QNYA 1IAIM 5HI3D 4QWWC 3DVIA 1UENA 5D6CA 3QISA 4F15B 4NPYA 3JTTA 5F7FA 3GRWL 4R26H 3QHZH 1UWEH 2JJSA 4HUUB 4OCXL 2MCPH 3BQUC 5GISH 1AP2B 1BIIA 5ANMA 1QFWI 3MRGB 4RFOH 4CU6A 1KPUA 4ELKB 3GSNA 5IMMB 4KQ3L 1SYSB 4PJ7A 4RWHA 5DHVA 3BJLA 5DO2D 5E08H 3SCMA 2BHUA 4LEXH 2PO6D 5CHNB 3VCLA 4BM7A 4Y4KA 3BIAX 3HC4L 4QHNA 3UTTA 5IEHA 1A4KA 5JW4N 3WFDL 1A7NH 5BZWB 2E8ZA 4IHOA 5E5MB 3O0RH 1JGEA 1NLBL 2KQMA 4YHPA 2QHRH 4HIXL 1U8LA 5J1SC 4NRXB 1PEWA 3D6GA 4RAVB 2ZCKL 3W2DL 5KVEH 4RMWA 3L3HA 2X1OA 3SE3A 1BJ1H 5FA3B 3D18B 2FX8H 4LPXA 4LARH 3SKNA 4M1CC 4UI2A 3O3AB 3T3PE 1X5KA 3GIVB 3RFZC 4F7CA 5E2TH 3ROLA 4TVSa 4JN2A 1NCCL 3FMGL 4K7PX 2GK0B 1N2RA 3DRTA 5FM5O 4PR5A 4PB0L 5E95B 4PJGF 4OGYH 4G3YL 1MH5A 3RZWA 4P0DA 1MFAH 4OD3L 5EUOE 2G60L 1HH9A 2SEBA 1KXVC 3F12A 4NQDA 2V6HA 1AFVH 1L0YA 5ADOH 2NY4B 4M7ZB 2DIBA 2BVOB 4Y7MA 1HZHH 3Q0HA 4HG4J 4U31A 1ZS8B 2BNRE 1D6EB 3QUMB 4P2RA 3TA3D 3NFSH 4NNPH 2XA8L 3MR9B 1J0YA 3DTXA 3DVGB 4QRRB 1ZHBB 3IJSA 3OJVC 3RVWC 3VG9C 4DUWA 5D9SB 3VD9A 1TZIA 2I60H 4XVSL 1ONQB 1AY1L 1IARB 1SM3H 2VXQL 5B38G 5IB1B 4PREA 1URLA 2H41A 5HHXL 1KCLA 5C0EA 3NIDE 2IH3A 32C2A 4OGXH 3MV7B 4M7LL 1VFUA 3ARQA 3IDYB 2DQIH 1U6AL 4GAFB 2K7QA 2R4SH 1OGAE 5TDOB 2P5WA 4PJXF 3NMEA 4AIOA 2D31B 5E8EB 1KNOB 1U8OB 4MX7A 3KYNB 3SE4C 5IHUH 1D7FA 1SEBA 4X0KA 3WD5L 1OSPH 4QRRD 3GUTB 3GMOA 3QXDA 3PGDB 3UPAA 1KTLB 3A6CL 3RRQA 3KNBA 5SX4I 3KPLA 3ULUH 1RULH 1TIUA 3BXNB 2QQKL 4ELMF 1EGJL 3EJJX 3A67L 4EIZC 4KMTH 4G6FD 2DQJL 5AZ2L 1W72H 3IXAB 3H3KA 4H5SA 5DJDA 2B1AL 3U0PA 4R7DA 2OR9L 2A77H 3L3GB 4UUJA 2OTUB 4FG6D 3KJ6L 3PDOB 1EPFA 4JLRB 5E2WH 1J88A 3DUUA 1LD9B 1DLFH 4FFWD 5FUZH 2MQ3A 5FYJU 4Y4HB 4Q97A 1ZWIB 1PAMA 4HSQA 5I30L 3QPXH 2LQRA 4F7MA 3QDGB 1EHLL 4WU7A 3HB3C 2A6JA 4DZ8A 3P73B 1J05A 3FCTA 3G5YA 4DUXA 2D4DA 4J4PC 5ICXB 3U79A 2OJEB 1CICA 5J8OA 1NL0L 1G1YA 4JDTL 1K3IA 1JPSH 1PG7W 5ALBL 2W60A 1YYMH 3REWB 3KYOA 3DARA 4H26B 3VFSB 2GCYA 4MA7H 1JGLH 4JZJA 3GBNL 4GLRH 4H20H 3OKEA 5LQBH 3QRFM 4NQEB 3TIEB 4DKEH 4KKAC 4XC3L 4IIQB 2MQCA 3OKKB 4AEEA 4KJYB 3RWJA 4D9RE 4UILH 3QDGD 1J11A 4L8CA 4ODWB 1YNLH 2XY2A 2FB4L 3LD8C 1JWSA 2B2XH 2XXCB 4F7TA 2NXYB 3CZFA 5IT2H 1XGQA 1BECA 4N5UA 2D0FA 4YEFA 2F19H 2V7NA 2E9WA 4NP4H 4PJAE 4O58L 3I6GB 2XKUA 5DURD 5J1TC 3N9GH 1G9NH 3BSZH 3ME0A 4JANB 2E7LC 5F89A 4G80A 4GW5A 3OXSB 4HDIA 3QO0A 2ZPKL 1MCWW 3PNWB 3STBA 1NC2D 4XTRC 4C55A 4F9PC 3TO4D 2YKLH 1Q72L 3RI5F 4PGDA 3MQIA 3GJFB 1A6UH 2Y9RT 4PLKD 4PP1C 5FYKD 1M4KA 1EMTH 3NIDF 4CVZB 1ZT1A 3IYLW 4ZTPL 5CSGA 5MHSE 1A7PH 2ZNXA 4JO2L 1HXYB 4YLQT 3TO2A 3Q48A 3TBSB 5BZDB 1NFDA 5C07B 3WFCL 4ODTL 5TH2B 3D87B 4MJ2A 4P3DB 3V52L 4PJEE 1S5IL 1KPRA 5EU3B 4MZ2A 1C1EH 4PY8I 3KXFA 5CLTA 3ROOA 1M6OB 3PE9A 5F21B 3SN6N 3WE6A 3I02A 4V2BA 4O2FA 4YBLC 4WFFD 1JF1A 4OB5L 3F7VA 3LEXA 2VMFA 1RZ8A 4IJ3C 5I1HL 3REVA 5JW3L 5EFIB 5JO5A 1B0GA 2K3TA 4DVBA 12E8L 3BEWA 3NGBB 2CKBA 4FNLH 3G6DH 2CRZA 2N56A 1LK2B 1LO4L 4QRUB 4MNGB 2VSDA 3VXNA 5GGSY 3RI5K 2JJSC 1BBJB 1BHGA 1GGIL 3OBAA 3HMWL 2WINA 2VN7A 5EC1B 4W4NA 5TE6H 3P9MB 1DEEB 2HT3D 2XTJC 4KHXH 5EH1A 4OQ1A 2LAGB 3S5LB 1AR1D 4MJ5B 2J4WH 1NMBH 4OLYL 4LCCA 3S4SG 3SCMC 5IV2B 3HLAA 1CU4L 4Y4KC 2CD0A 1X6LA 4N8VG 5CJQH 1T22B 1NCNA 3VXPB 4X8XA 4D94A 3V0VA 2ZG1A 2EYRB 1U42A 3MLRL 4ZD3L 5DD6A 2HFFA 1XGPA 2Z4QA 3UJIH 4F8TA 3VXQA 3G6AA 4RMRA 4XXCA 3OG4B 3EO0A 1KYOK 2ESVB 5FECA 2BOBA 4DJMA 1IJ9A 4U1SA 4QT5A 4JZOB 3IB4A 2PETA 4HJ0D 5EA0H 3SE3C 3MJ9A 1RIUL 2A9ML 2J5LC 2I24N 4JHAH 4D0BA 2VXSH 3RWEB 3GSWB 3NFPB 2E9JA 3TFKC 3G5ZB 1Z3GL 2EECA 3OKDA 3T2NH 3PGCB 4FQJH 2W9DL 5TE7L 3VXRB 3FTGB 3V9FA 3LIZH 4NRYA 2AXHA 4QXTA 1MJJB 1QSEE 2HRLA 4PJAF 3GSVA 1DCLA 4WV1B 2AXGB 4Y4FB 3EHBC 1HH6B 1F90H 1D5XA 3OKMA 5CMAA 3DWTA 3PWNB 5GS2D 3C6SB 4PRIE 5GS1B 4RAHA 1UM6L 3OAZH 1CZ8H 5ADPH 1S7UA 1V7NL 2EE3A 2RHEA 1YA5A 3QJHB 4EBQH 1RHFA 1DQDH 1H3XA 4X6CA 1EUTA 4U1HB 1ES0B 1PBYA 5CIPA 3RY6A 2VLRE 4UAOB 1W0WA 4N8CH 1S7QB 1UZ8B 2WQ8A 4WGVB 4CDHA 5D4QA 1K9TA 1OAUL 5D1XB 1S7XB 5E24E 5IROC 4WNQA 4Y4FD 4LCIL 5L8KB 4ORGB 3IVKB 2DN7A 4YDIL 2F58H 3PUCA 1N7ML 2DDQH 1CGYA 3DHMA 1JWMB 4PJEF 1D9KA 4KK9D 3BI9X 4OKVA 4YK4C 5CWSB 3NCYS 4X4XB 5DVNA 3IJHB 2ZUWA 4KUCD 3W82A 2DLTA 1X4YA 2F5BL 3EOTH 4O51A 4LLMB 1KBGH 5IMOB 1X5LA 2ZZUT 4ONFL 3UBXB 3NABL 1JCKA 4XT1C 5JPNA 2VDNH 1SVZA 2X9YA 4M6NH 5D1XD 2HT2C 3G6JB 2YD4A 3QUYA 4ETYA 5JXEC 1AQDB 2A6DB 3BWAA 4HWBA 3ET9F 1G7HB 3MJ7A 1WISA 3OZ9H 1I4FB 3BPOB 1RZKC 2I27N 1EO8H 4HS6B 4MSWB 5IR1B 3HZVA 1E28A 1JBJA 5IKCB 3KPQA 2ADJB 4X5LA 4JO4H 5F3BA 5H94B 1RZIA 2DM4A 1LEKB 1MCPH 1FO0L 2IAMB 3QB7C 3VRJA 4GMSL 1K8IA 4ZFFB 1AQKL 1FFPB 2VAAA 3Q3GA 4ONHA 3TT3L 4YGVA 1CICC 4M62L 2DIJA 1JYVA 3MBEA 1PKQE 3KPSA 1A6ZB 1NGWA 5EZJB 1NCAL 4UMGA 2H2PD 5BOPA 1FZKA 1OL0A 3KR3H 4JZJC 4XPAL 4PG9B 4EOWL 3DX6A 3L5XL 3L6FB 3VXMB 4IRSD 3KYMB 3IKCA 5BS0A 2IAMD 5EBGA 3BIKB 2XTLA 3LRHA 3R1GH 1U0QA 4WW1A 3RUGB 5JOFB 4LSSH 3FFCB 1KUMA 3D3VD 2QQNL 4HF5H 3IAGC 4ZO6A 4K9EH 5BMFH 4JJHA 1IEAB 4FP8L 4Q6IB 3H9SE 4M48H 3PWUA 3T08A 1G7LB 5E9DA 2HFEA 4LGPB 2YXMA 4J1UA 4KRPD 2P48B 2W07A 3TCLB 4OFYA 3O2DH 3HAEG 3KXFD 5HHOD 2DQCH 1W8NA 2GTWB 3M45A 1KJMA 3MLVL 5BXFB 1QSVA 1KB5H 4YZFF 3IU3A 4HK3N 3D1MC 1IM9A 4I2XA 3QXTA 1NGXA 2DWEB 4HD9A 1DEDA 5H35A 4IOIB 5F7HA 4PS4L 1R3LB 3TBTA 1IGJB 3QNZB 4MJ6B 1VGKB 5GS2H 3RA7L 2ZKHL 5GGSA 3LEVL 2Y06L 1DN0A 5C0CB 3VFPB 1GPOH 1Q9OB 3FFCD 1EAPB 4OZHA 1I1AA 3LKOA 4PRHB 3F58L 1IFHL 3SEPA 1WBXA 4KAQL 4TUOA 4D0CB 1IC4H 1M71B 4XX1G 4ZS6C 5MP6L 2C1OB 2UYLB 4FFVD 5CILL 4WI5A 1V7ML 2BP3A 3G5VA 4LVOB 4E5XA 5JR1H 4F57L 2KQNA 4NQSA 4G8FA 4BZ2L 1JPFA 4YHKL 5HHNB 5D2LA 3QRGH 2CIKB 3OHXB 1KJVA 5C0CD 3B8SA 4HIEA 1W8OA 1NPUA 2W65B 3G5XA 1JGDB 3GMLA 4JFDA 3NPSC 1RVFH 1N3NA 2EYTA 4W68A 1JYXA 5C2BL 3BPNC 1JYWA 3MACL 3SE9H 1HEZA 1MAKA 5TDNB 1BM3L 3PV6A 4L5FH 1C16B 5I71C 1QR1A 3GFUA 4OZGA 5GHWL 1R5VA 5AUMA 1S9WB 4QHLB 2GT9B 3BGAA 4LF3A 1V3LA 4S1QH 3GHBH 4R4FH 3QXAA 4J12A 1H9VA 1YJDL 1B6UA 4UDTB 5I66A 2Q20A 4ZSOA 4YDJB 5EOTA 5JNYB 4LCCC 2AKRB 4X5WA 3HCVA 4AK1A 5J57B 2KH2B 3VWJB 4EEEA 3O6FB 3GB7A 5IBTL 4KVCH 3O45A 3U7WH 3QEQA 1C5CL 3R0NA 4G6MH 5B22A 2OS7A 2PKDA 3MV8A 2F74B 4Y5XC 5DJ8B 4XXCC 1FL3A 5DSCA 4KJPC 5DUBB 4HX1A 3OJMB 2FEEL 4V1DE 4G6AD 2P5EE 1QEWA 3KPMA 3RU8H 5F8RC 4PJ5D 1KYOJ 4JCLA 2BDNL 4AEHL 1G7MB 3F5WB 2G2RA 4OGZA 5DI8B 4WUUE 4G7VL 4M5YH 2NR6D 3O9WA 3PJSB 3VWJD 5IQ9B 3IDMA 1MNUH 4NKQB 3B6SB 5GRUH 1MJUH 1QVOB 1QNZL 5C0DA 5E8OB 4POUB 5MI0B 2K7PA 4HFUH 4IEFB 4KVNL 1OAQH 4J3OC 1YEEL 2B7DT 4AL8H 1T0NB 4PPTA 3VFUA 1I3GL 1IGTB 2CMRH 4BQBA 1PLGH 5BVJB 4NO0B 4R2GC 5MEQB 4NM4L 4AENA 2ORBL 3D39B 2AP2A 1UWXK 5D1QB 2J6EH 2VZUA 5HGHB 3WO4B 5E2VL 1BQUA 2YR3A 3P9LA 4BZ1L 2OP4H 1CXFA 4TSBL 3TNNA 4EUPB 3VGHA 4XH2B 3NIGE 3ZDXE 1JHKH 4DKFH 5BJTA 4GOSA 5GRYA 2FSEB 1BQSA 3QIBD 2UVFA 1DQQB 4KK6D 2C3VB 4HAGA 4RRPG 2XOTA 3RY6C 2EDWA 4XNUH 3THMH 1FYTA 4NO0D 4QNPE 4MCYA 2ZOLA 4U05A 1BVLB 5DLML 1QR4A 4YE4H 3U2SB 1UACL 2ADIB 4OZFA 3H0TB 1NAMA 1D9KC 3EW3B 1FP5A 3FB8B 4N8PA 4XAKD 1OSZB 2FJHB 4MQXD 1VHPA 2VISA 1QPPA 4P2QE 1IVLA 1U8JA 1VACA 2BFVH 3PGFH 2EYSA 3VDCA 3KPRE 4XP6H 3DI3B 3DV4B 4MCZA 5E0QA 3QUYC 3EDJA 2P8LA 2XN9A 4L4TB 4X6EB 2BVQB 2P7TA 3VW3L 1SY6H 1JFQL 4L4VB 2AQ2A 2H9GA 3EAKA 3WNNA 5IB2B 4X83A 1NMCB 4NFDA 2R2HB 4PJHA 1XZ0B 3MGAA 4ODVL 1ZEAH 4H8WH 5C92A 1TZGH 3WO3B 4ZNCD 4Y5VB 1MUJA 4PJBA 4ZXBC 1QFWH 1TMCB 2BNQE 1JTTA 4N9GB 2I9TA 1K8DA 1BWMA 5FA4B 4QHUA 3IFNL 3P4OB 1R3HA 4KJWD 4PTUA 4JAMB 4MVBC 2RCSH 3B4NA 1Z0NA 3MPCA 4U1KA 4KI1A 4L4TD 5GRJH 3EYFB 3MBEC 3CMOL 3FB5B 1DE4B 4MXWH 1FVDB 3UTOA 5C2UB 5EU6E 3FN3A 3SO3C 2HJLB 2VABB 3OR7A 1L6ZA 4KPHL 5ESQB 5CIPH 1ACYL 3BN9D 4EZMA 3RJDA 4GG6F 2RJMA 3C9NB 5LKNA 5L2KD 1F00I 1HHKB 1RUAL 1MF2L 3HC3H 4NNXA 1EZVY 4XP4L 4OLEA 3BPLC 1J0IA 1HHIB 4HFWA 5ALCL 2QADC 4APQB 1NSNH 1A6WL 4NIKB 1QLRB 3FB7A 3V8OA 2GJJA 3VXUA 4GMTH 5GIRA 5D6DA 4LAJH 4FXGB 4K3HA 2WBWB 4FQ1L 1D5BA 4LLQB 4X6BA 1T0MB 5A2JH 4M8QA 3HNSL 4GQ9L 2R69L 1QSFD 3MRGA 4ELKA 1RK1B 5IMKB 5JHDE 2RIKA 5C08D 2A9NL 3IAPA 4HPOH 4N0UB 4WEBL 5IMMA 2BERA 4Y19E 3RWGA 4K7PL 5DRZA 1I1AC 5EWIL 1X5IA 1CBVL 4WO4D 1PQZA 3L95A 1UT9A 4TTDC 5CHNA 4OGAC 5DK2B 5FB8B 1KGCD 1HINH 1TETL 3M1BB 4QYOB 5E5MA 5DS8B 5D7SH 4O9HL 5DMYA 3BKJH 4QNPF 4RAUB 4U7MA 1CDJA 3FO2B 5A2KH 5DR5L 1K5NA 3INUH 1ZHNB 4HXBL 3HMXA 1IZKA 1UWEL 1MRDH 4QHKI 4EUPH 4M4RA 4JM2D 1RIVH 2VWEE 3WUWB 5E8DL 1MI5B 1OVZA 2UUDH 4NYLB 3WKML 2DQGL 3PP4H 3BZ4B 5LCVL 4J3TA 3GIVA 1IGMH 5CZXD 1PFCA 3LS4L 4E41E 4M1DL 4LEXL 5AYUH 2ED7A 2QTEA 1UJ3B 3S3SA 3DMMB 2GK0A 2C9AA 2CR3A 5TQ2L 2YRZA 3QNXB 4U0RB 3L7EB 4JFFB 4Z77B 1KN2L 3UTZB 1QYGH 5SX4H 3RX8A 5D2NE 5BV7B 5D5MB 4BFIB 4JO3H 4Z95H 4GKSB 2IALA 3NAAH 4HT1H 5KW9L 2NY0C 4HGWB 4OLUH 1IAKB 1MI5D 5K33A 4Q9QL 1A1NB 5K9JH 1J0ZA 3QUMA 1DBBL 5HYJA 2D0HA 3O8XA 5L0QC 4OF8A 1NCUA 3LMJH 3MR9A 1ZLSL 3GO1L 2XWBB 4JY5L 3DVGA 1ZHBA 2OL3A 2VJXA 5IOPB 1WVZA 3C5ZB 5HHVH 4HC1A 4CNIB 2GITB 2H2SC 3BVNB 4GRLB 1ONQA 3K4AA 5EO0B 3P4LA 3U36B 4G5ZL 4JFFD 3SDCB 5KSBB 1DDHA 3MV7A 2OYPA 3NN8B 2HT4C 3QDJE 4XVJL 3T2PA 1LE5B 4Y2DB 1YDPB 4RFEB 5F1OB 4LOUC 1DP0A 3ULUE 4B53A 4KUZH 1YEJH 3TV3H 1JPTH 5E8EA 1MFBH 5D71L 1KNOA 1JTOA 4UTBH 4H1LG 3KYNA 4FQXB 1P6FA 4LKXA 4M6AA 4Z0XA 1FN4B 5BRZB 2NXZB 3O9WC 1I9JH 5ICZB 3GUTA 2H32B 1HI6B 2VXUH 3EYQD 3C5ZD 1B2WH 2X4QB 3PXHA 4EI6B 4GRLD 3SDYH 3BXNA 4NKIL 3H2WA 3MBXH 2FRGP 4WFGD 2X1PA 5MENB 4NQTA 4O2CA 4P59H 1YYLH 1UVQB 4NO2B 3ZE1F 4LIQE 2D9CA 1PKOA 3OB8A 1CXLA 3BW9B 4HKJB 2OTUA 1LO0H 4XVUD 5F6IC 4B41A 1GRWA 1PX4A 2EZ0D 4U1GB 2QKIB 1OTSC 1GHFL 3GIZL 2YA1A 3KS0J 2V2XA 4HW6A 4ONGL 4Y4HA 1OP5K 1N5YL 5TE4L 4FQXD 1ZWIA 3H7BB 1ULVA 2R0LL 4KK8C 2CXGA 1VEPA 4DVRL 3EOBA 4FTVA 2YUZA 3P0YH 3P73A 2P49B 5MEND 4XNXH 1UGNA 2NX5D 5ICXA 2OJEA 4JFPB 3B2UD 1F11B 3LH2L 4CVWA 1P2CB 1RUMH 5LGHL 4Q9RL 1MFCH 2QQLL 3OAUH 1RULL 3GKWH 3MYJB 3O3BB 2UWEF 1U8NA 4H26A 4LLYA 5IQ7H 1EXUB 4NQEA 1TJHL 1S9YA 2DLFH 1GGYA 2CDFA 2DQEH 3U83A 2FX9H 4YWGH 4ODWA 4FZEL 3PHSA 5JPMB 3ZKMD 4NN7C 1RUPL 4EVNB 1XGYH 4LIQL 1Q1JL 4OCSH 4LNRB 3BE1L 3GM8A 2NPLX 43CAB 3MLWL 3O6KL 2XWTA 3GKZA 1U58B 4N9OB 2HKFH 4Z7WE 2A1WH 5FHBL 4NCDA 3CLEL 5F7YC 1EVUA 4QRTB 1ZA6B 1R3IL 5EIIB 5C0NC 4JANA 1BOGB 3UTSE 2YMXH 2DJSA 3OXSA 4UIKL 1RZFH 2WZPD 2WWMC 1QHPA 3A6BL 4U6VH 5I1EL 4O5LH 2ZUUA 3FQTB 2Y4SA 3LB6C 1MLBB 5E1AA 3SBWA 3BX7C 3QDAA 3QI9B 3TZVB 3UJJH 3GJFA 1ZLUH 2VUOA 4XB8A 4R4ND 3I3DA 3K2UL 3OWEA 4M5ZH 4CVZA 5HI3C 4UB0L 5BV7H 5I18H 3T0BA 1MHEA 3RNKB 1M7XA 1G9MH 3OAYH 4K3JH 1R3JA 4FFZL 2ITCB 3TBSA 4HJJL 5C07A 3ULUF 4HLZG 4C83B 3T65B 2R2EB 4P3DA 1LO2H 5EU3A 4XC1H 3WIHL 3PG2A 3DSFH 1WAAA 2J7LA 1X3DA 1HK6A 4ODSH 2UY7A 4URTB 5I1GH 4ZFOL 4UV7L 1AO7A 4YFLF 5D6DC 3OL2A 4P46A 3NZ8B 2O93L 3VFVB 1LK2A 4MNGA 4F15C 1LP9E 1OGTB 3R06B 2OZ4A 2VZOA 1PZUB 1GZPB 5D96B 1BBJA 3L5WA 4YC2C 4GW4B 3TBVB 3U1SH 1VERA 1CD0A 5IHZB 1I7RB 5C0IA 5MEOA 2ITDB 1AGBA 3S5LA 3ZKSD 2IBGA 1LNUA 4RMSA 2PCPB 2A74B 2H32H 5SWSD 4MJIB 5IV2A 4U4BA 4ORZC 2WM0A 1NC4B 3QCUL 2PW1B 4MYWB 4PJ9A 1T22A 1D6VL 4X7DC 1RJLB 2KZ1B 4OIIH 2EYRA 2AJXH 3EOYG 1CGSH 4XMLL 5CINL 3NA9L 1NEZG 3NTCL 3O8XD 4Y1AD 5TPWH 1H3VA 4YDVB 2APXA 2H6PB 1QBLL 3LSOA 3QHFL 4PGCB 5FGSA 3BAEH 3GMNB 4NRZA 2Q7YA 4JZOA 3DOSA 5CP3A 5IW3A 2CGRL 5LXGL 1ZLVH 4PV8B 3NFPA 3R8BB 3MRJB 4LVHB 2IANE 3I9GH 5JW4M 3PGCA 4IM8A 4Y2OA 4JPKH 3VXRA 3FTGA 2NY5H 3VXSB 4GUPB 2B1HH 5IVXB 2Z91B 1MJJA 1NBVH 1QLFA 1BMGA 4Z7WF 2R39A 2HLFC 1MCBA 2AJUH 4GW1B 3CSPA 1P7QB 2F53B 2XTJE 2IMNA 5DD1H 4KTDL 1GGUA 3C6LA 2NY4C 3MRPB 4M7ZC 4PJ7E 4Z7UB 5FYKE 2VC2H 4RGOL 5I9QB 5GS1A 1MVUB 3B5GA 2NW2B 4JFXB 1CF8H 2WLYA 3WIIH 1FIGL 3P11H 1L0XA 4QO1A 3UTTE 1EERB 3QJHA 3FAXA 3QWOB 4HV8A 5T33L 3MUY1 4PRPA 3VXSD 4U1HA 1RHHA 4I18B 4DEPB 1HILA 1UZ8A 1T89A 4X7EC 4JG0H 5F97E 5T1MA 2NY6D 3O6MH 4WFFE 5E6ID 3LKQB 4FTVD 4EKXA 4YQXL 2F53D 5A2FA 3IVKA 3IDYC 1MCWM 1P4LB 4EQ2A 3SDDA 4FG6C 4HMEA 4BUGA 3GSOB 1NLDL 1QBMH 1QTYT 1JWMA 2YZ8A 2LU3A 5CWSA 4NJAL 2CLZA 4QXUH 3ZTNL 3IJHA 5CGYC 5EOCJ 4EIGB 3U7YH 5J6HA 1OP3H 3ARDA 1Q8MA 1CD1B 2NY3B 5IEKA 1K4CA 2ZUSA 3LCYA 4LLMA 5IMOA 3H6JA 1G1CA 3SGKA 1DUYA 3RWHB 3E6FB 4NWUH 3G6JA 4YDKH 1VKXA 3GSNL 3LKSB 2A6DA 2FDBP 4IOFC 5CBEB 1LP9F 4XI5D 4PIRF 4X6DA 4M03A 1QOKA 5FYKL 5D72L 4XMKL 2AXJA 1G7HA 1BZ7B 3HUJB 3E2HB 4NQDE 2ICWI 4DCQA 5IR1A 1N6QL 3LN5B 4B7LA 4MXQC 1XF1A 4Y4HC 2ADJA 5H94A 1YY9C 4N90D 3J7HA 4MQ7B 2MMXA 3HZMA 4LLVA 1LEKA 1MCOH 2XZAH 3ARPA 3MV9D 3N1FC 2DLGA 2NY3D 3NIFE 4Y0GA 3RGHA 3LAFA 3ES6B 4ZFFA 3MRLB 3DV6A 2C4XA 3K1KC 3GSXB 5B38A 4IRJD 3ZL4H 5DYOB 1U93B 2R2BB 2MQ0A 5AZEH 1CLCA 3S6CA 1YNKL 2HTLC 3U6RB 3V7AE 2N7BA 3L3DB 5EZJA 3NZHL 1RJZB 3QDMB 5DFTA 4M6NL 1I8MB 1T83C 3BZEB 1BF2A 1NCBL 3GSRB 4PG9A 1FVCB 3VXMA 5DJYB 3KYMA 4FQHB 4P4RA 2E8YA 3HN3A 3TWCH 3H9HB 4K3DL 3RUGA 3X3FL 5JOFA 5E2UL 3EO9L 2DTSA 1U3ZA 2NXYC 3LRSA 1Y6NR 4NQXB 3V4VH 1ORQB 4JO4L 2Z0BA 4LSTH 1IEAA 1IAIL 4GRMB 4Q6IA 4XCEB 5IW6B 1G7LA 5DFWH 2WV3A 3MRFB 2YPKB 5I1DB 1IKFL 2PYED 1J12A 2YSSB 5BXFA 2FGWL 4P9ML 4UV4L 4NWTL 4LSRL 1IGJA 4LDEB 3IFLL 3N0PB 2R1XA 1AO7D 2CK0H 3IS0X 3VFPA 1EJOL 3LDBB 4JY6B 1Q9OA 5IIEB 1EAPA 4I4WA 4PRHA 1D5IH 3SBWC 3N1PC 3MOBL 5HBBA 3RBGA 4GSDH 4NZJA 4OLWH 1M71A 5D7JB 4HUVA 1KG0A 4OF7A 3AAZB 1N4XH 2C1OA 2UYLA 3RWIB 3E3QC 4HWEH 3ZDZE 5JHLL 4HBCH 2XACC 3VFTA 4PJ9D 5HHNA 1CGUA 4ENEC 1BFOB 2CDEA 2DAVA 3OHXA 1FAKT 1CDYA 4UT6L 5SWZA 2F8XC 1VGEL 2HVKB 1QQDB 1Y18A 2XZQL 3OAZK 3EYSL 1SJHB 1BVKB 2VDPL 1N8ZB 3F62A 5GS0D 1GC1H 2HKHL 1JGDA 1AE6H 1VADB 2EXWC 4A6YH 4JY4A 5EBMB 4FFYH 3GMPB 4YXKL 5HHMD 4XNZB 4XNQB 2XRAH 1F8TL 1TLKA 4K8RD 4NKMB 4G8GA 5TDNA 4P46C 3AREA 5EOQL 2HMIC 4K23H 4CMMB 5D7KE 1X5GA 3KVQA 1S9WA 1H15B 2GT9A 3EFDL 4KZEL 5IB3A 4ZODA 3V0AC 1LQSR 2JB5H 2XZCL 5F88B 4WI9A 1AGDB 4WW2F 1YEHH 3VD7A 4UDTA 5A3IC 1KTDA 4YDJA 4PJIA 3I6KB 2AKRA 2H8PB 3BMVA 2R29H 5JW4R 2FECI 4WI7A 4PBXA 3SKOB 3O6FA 4HS8L 5DA0B 2XQBL 4ZDHB 4JRXD 2EIDA 5J3HD 2YEZB 1TJGH 3IFPB 3RP1A 5IESH 3S88H 1FNGA 4OF0A 1OAXL 2F74A 2W9EH 3D3VE 5DJ8A 3HRZA 1Q9WB 1Y6MR 1MEXH 2F8VA 1R5WB 4WI6A 4NQVB 1JNHA 1NFDE 4PRPD 2XNAA 5GGVY 1JNNH 3NPZB 3BGMB 3V5DB 4FOMA 5IBUB 3S37X 3B5TA 5HHOE 3KXFE 1G7MA 2JIXB 1D5MB 1FNFA 1X5AA 5CEYA 5DI8A 3T0EB 4JKPH 2IG2L 2IPUG 4JRYA 5IQ9A 4HIJA 4LHUB 1RIHL 3ARZA 4NHUA 5DD3H 4RGMB 3B6SA 4HMDA 4MAUL 1IEBA 1LVEA 4HK0B 9CGTA 4M1GL 3IDJB 1NDGB 2NY2B 2KZWA 4BKLB 5IB5A 3ZYZA 1P7KB 5DEGB 2ILLA 3SOBH 1RK0B 1WQVT 3HFMH 1J5OL 5BVJA 5MEQA 3HPJB 4JFEB 4KC3B 5EU4B 3D39A 1QKZL 1JWUA 5HGHA 1SQ2N 4LVEA 3C6LC 1EEQA 3I75B 1FDLL 4XPHH 3T0ED 1OT2A 3UJTH 3HI1B 5GS1C 1BFSA 4XP9H 5DD0H 3WNKA 2AABL 1MY5A 3MREB 1P84K 1DSFL 3BD5A 1GGBH 1U8KA 2FSEA 4WTXA 2W0FB 4F7PA 4MD4A 2NY2D 2JJTA 3ILQC 1C12B 5I8EB 2C3VA 4HUXB 1HIML 5I75B 4EI5B 1EZVX 3VWKB 2WQRA 5HPMB 3BRFA 1A5FL 4UAOC 3TP4A 1LO3H 1MCRA 1BBDH 1M7DA 2D9QB 5H2BA 1T89C 4L3CA 4JFED 4NC1E 2VITA 3ARRA 3NCJL 2IBZY 5GRVL 2R1WA 5EUKB 3T0XA 3V7AG 5F7EH 3RAJH 2VAJA 3MUGB 3SDDC 2WWKO 4AMKL 4ODXB 5C70A 3H0TA 1Q94B 5GS0H 4IDJL 3FB8A 4HJGA 1OSZA 2FJHA 3ULVC 2Q8AL 1ZANL 4RGND 3S36H 3UDWA 4CRPA 2CKBL 1NGQL 3QO1B 5HY9B 3MGOA 3ARDC 4FQLH 3LRGA 4EI5D 3VWKD 4K8RH 3NCMA 3SGKC 3B9KD 4QRPB 3DV4A 4FABL 1I7UB 5CZVH 5ESAB 5KVGL 1GIGL 4P5TD 1A7RH 1FIEA 4L4VA 5FKPB 1WEJH 1JNLH 5IB2A 2I9LB 4UQ2B 1U8IB 1OPGH 1XZ0A 2Q6WB 4JQXA 4LLUB 4XPBL 4Y5VA 3QG7H 2X9XA 1PEZA 4GG8B 4F8QA 3BKYH 4CJ1A 2VLJB 3RDTD 3MRBB 4FMFA 1A21A 4OD2B 4S1RL 3P4OA 2FEDD 4PJ5E 3JWNC 4W81A 4POYA 4YHNB 2Z9TA 2LU4A 3W11D 4RWYH 1OP9A 4PJXB 5HSFA 3FB5A 1DE4A 1AH1A 4OM0H 1DQJB 3MJ9L 5EORH 3KLAB 5C6TH 3P4MA 4TRPL 3C60D 2HJLA 1NFDF 2H3NB 1F6AA 2DTML 1I9RH 3MRMB 1UXSB 4S1SL 3C9NA 2DBLH 5E94B 1HHKA 5T5FL 4U7SA 3VFMB 5I1JH 5ACZB 4OLVH 3DXAB 1VDGA 3RL1B 3ZHKA 3EYVB 2FEEI 3B9AA 4I3RL 4APQA 4MA1B 4P4KD 2D03H 1X5FA 4Q6IC 2C3HA 1G7IB 5SWZD 1LGVA 2VXVL 4K55A 2EDKA 1YEKL 1YC7A 2BVPA 4FXGA 3WFEH 2VRAA 2I07A 5ILTH 1I1RA 2Y36H 4LLQA 4MNQA 1D5ZB 4OFPA 4ZUVB 2AEWA 3WXWH 2J3SA 2VDQH 2XIDA 5GGUB 1B0RB 3ARBB 4BH8A 3UCRA 3VMPA 3IU4H 1G7PB 5JA8B 4ODHL 3DX8B 1TTGA 2Y7QB 1RK1A 3UEZA 5FOJA 5IMKA 3V7MA 4PUBH 3OJDB 3DXAD 2D7OA 1IZJA 1E4WL 1S3KH 1Z2KA 3TBWB 1UQSA 1XF3B 3IDUA 4OD1H 2DICA 4WU5A 4PB9L 1HDMB 3BP4B 4J3WA 5IM7B 1F42A 1NGYA 3M1BA 4QYOA 2VDKL 3IFOB 3RZCA 3CXDL 5IVNA 5DS8A 1XF5B 1ZT4B 4LVOC 5DMJB 3TJEL 4RAUA 2DKSA 4U6HB 2YUWA 3ARBD 3FO2A 4DN3L 1CLOL 2AK4A 5EZIH 2QLVB 1XR8A 1ZHNA 3HR6A 5I1IL 3OMZA 5I2IB 4MJ4A 2YUVA 5E8NB 3BGFB 1EO5A 3MCLH 5BS0E 4M4PA 2DD8L 2VDRL 3WMSA 1FBIH 2CO6B 2NYYD 4ZTOH 3OPZH 5T1KA 5I1AB 3UMTA 4LGSB 5IVOA 4DK3A 4WHDA 43C9B 5I8KH 4OAWB 4YBHA 3EBAA 4HWBL 3JWDH 4KI5C 4HWUA 5EUOB 1CR9H 1HKLH 1UJ3A 3DMMA 3AREC 4GAYA 5IMLB 3S4SB 1L7TH 1UWGH 5D7IA 2D3VA 3QNXA 4I2XE 4G7YH 4JRYD 4Z77A 4N8VB 1E6JL 2BNRB 3UTZA 1VSCA 3QIUA 5HI4D 5BVPL 4GKSA 2C7UB 3FFDB 5F1KC 4OQTH 4K3EL 5KSUB 4HGWA 4WEMB 1IAKA 2HRPL 4OZHE 4PTTA 1E4XL 1FZMA 2LV4A 1A1NA 4X7SH 4GKOA 4IDLA 4K2UH 3T2QA 3LY6A 2DQTL 2XWBA 1RIVL 3VA2C 5DMKA 5F7WC 3D85A 4HULB 1A2YB 3O6FC 1GSMA 4HEPG 2DI8A 5IOPA 3MODL 4CNIA 5L2KE 3BVNA 4KRMB 3GRWH 3U36A 4MQTB 1PYWA 2M2DA 1OGAB 5I76A 4OCXH 5KOVC 2R1YB 3SDCA 5KSBA 3MRHB 4OZIA 3NCBB 1PG7X 1FFQA 3NN8A 1MWAB 5D2LE 3I50L 1REIA 4KQ3H 4Y2DA 4Z76B 2WNGA 5E56A 4XAWL 2P1YA 1YDPA 5C09D 4RFEA 1WIUA 4LQFL 1C5DA 5KSAD 4XCYA 4NBYB 1A02N 3VXTB 5K9OB 1AC0A 3WFDH 2JK5B 5C0RL 1FN4A 5ELIA 3FZUD 5BRZA 1A6TB 2MPAL 1QSFE 3NACL 1HI6A 2RQ8A 1NLBH 2A38A 2OI9C 5FYLE 4EI6A 4HIXH 3EYUL 1KIRB 3JWOC 3OB0H 3IF1A 1ADQA 1KTRL 5C08E 3E8UL 5MI0C 4W4OA 5JTWA 3G08B 3MRKB 3QH3B 4NO2A 1KCUL 4Q7DA 4OZGE 2ZCKH 3W2DH 2Q3ZA 1P6AB 2J1KA 2K9UA 3BW9A 3ZE2F 2WSKA 1T66D 5D1QC 1LO5B 1KGCE 2DYPB 3WO4C 3C09C 1RV6X 1I8LA 2QKIA 1C08A 2RB8A 5KAQF 1QBAA 4NN6B 2XQYG 2BRQA 4ZSOE 4DKAA 5TFSL 3ZMRA 3A0OA 2L7UA 1I85A 3TLRA 1CDBA 1ERNA 2PW2B 2YD9A 5HI5D 3K4ZA 1NCCH 3FMGH 2JJTC 5FDWB 4PB0H 1P84J 4ZAKD 1KB9K 5DRWA 1L0QA 3MV8E 4G3YH 4NUJA 5D1ZB 1W0VB 4OD3H 3SDYL 2G60H 1T80A 1R5IB 2DIAA 3HZYA 3MYJA 3O3BA 4ZQKB 3B9DA 3CC5B 2DYPD 4WTZA 3VD4A 5EOCL 1UA6L 2XA8H 3BKML 1SYVA 4U33A 4M6ML 4QY8B 5FYLL 3UDWC 1OAYL 3QUZB 5JPMA 2X89A 1FSKC 4PJAB 4YHLL 3MSPA 4XVSH 1AY1H 2VXQH 3L9RA 5HHXH 3QWRA 5FCSH 1N5AA 1CWVA 1BD2D 4M7LH 3DUHA 2I5YL 43CAA 4D9RD 1U58A 2G5BB 1R0AL 1U6AH 4QRTA 2D0GA 4LLWA 1F3DH 3TYGL 4LRNH 3HG1A 3V6OA 5HTSA 5EIIA 1BOGA 1WBYA 1K6QL 3RPKA 5JZ7D 3WD5H 1MOEA 1NMCC 4GRWH 3DUSB 2UUDK 4OZHF 4GS7B 3A6CH 2GTZB 4JQXC 2WIIB 4KKCC 4Y5VC 2QQKH 1MHHA 2OMNA 1EGJH 1IAMA 3A67H 2NY7L 5FHAL 3QI9A 5AZ2H 2DQJH 4JM4L 3TZVA 5E4EC 2B1AH 4LHQB 4MWFB 2OR9H 5AD0B 1FYTE 4LSDA 4UDUB 4G9FA 4PJEB 1H3GA 1G7JB 3KJ6H 1ED3B 2MHAB 2MWCA 2X4NB 4GBXD 3DYMA 4JDVB 4GXUN 3MUHL 5D2LF 2H26B 3RNKA 1T04B 3OGCB 5T5NG 3K8KA 4WI8A 3O4OB 4XCNB 1MCKA 5I30H 1SEQL 2ITCA 3CCHB 1T7YA 3T65A 3C8DA 2R2EA 3P30L 5DVKA 4PV9A 1T3FB 2JCCE 3T0WA 2FO4B 1B6DA 3ARXA 1FPTL 15C8L 4QHMB 3T8XB 1AIFA 1I8KB 2KL6A 2NCMA 5F6HJ 4APQC 5HDLA 3NA4A 1NL0H 4Z7VE 4JDTH 2X40A 5DUPL 5TF0A 3DI2B 4JKMA 5ALBH 2VZSA 3FQUB 3VFVA 3UX9B 3GBNH 5FK9B 1SMOA 3R06A 4XC3H 1GZPA 5T1KD 4YPJA 1KC5L 3HE6D 1EEZA 3TBVA 5J6GA 2NX5E 2JKXA 2FB4H 1F58L 5IHZA 4PY7B 1I7RA 1RUKL 1ZHLA 2ITDA 4FQPA 5CBAB 5JW5A 4DGVL 4PJBE 3TT1L 4X4ZA 2PCPA 4Z7NE 4MJIA 1HHHA 1QRNB 1NC4A 1N26A 4XCCL 4NM8L 4O58H 1PY4A 2C3WA 4H25B 3RZCC 1S7SB 4JM2F 5E00B 1MQKL 4DOHE 4UINL 3GI8L 5TQ0L 1NAML 4LPWA 4YDVA 4YEEA 3HZKA 2ZPKH 5F44A 4PGCA 4LLAA 5ITBL 1JK8B 4TTGA 5EO1B 1F5WA 1AKJB 4H88L 2E6QA 4XBGA 4U2YA 3RX5A 2VE6B 1Q72H 4L8DA 5IG7B 4PV8A 4Q6YA 1CFVL 4LNVA 1OARL 2IF7A 3MRJA 3FO1A 1QSEB 2J88L 3NCFB 1KJ3L 4NFCA 2IADA 3D69B 5JOPE 2EO9A 3VXUE 5HYIA 4ZTPH 3QAZB 2OXHA 4GUPA 1UJ3C 3ZKQD 3DMMC 5IVXA 2Z91A 2XT1B 4ZUSB 5HVHB 5CD5D 2HA1A 1KACB 3WFCH 4XZUB 4ODTH 5DJCB 3V52H 4I13B 5CP7B 5EZLB 1S5IH 4P2OB 3QIUC 1YC8A 3IDIA 5BV7C 1P7QA 4LSVL 1G9MC 4Z7UA 2W38A 3QEUB 3QXVA 4MAYB 1K4DA 4OB5H 4D9LL 2VLRB 5I1HH 1QSED 1U41A 1AGCB 5JW3H 5D5MF 2CUIA 12E8H 5DJZB 3QWOA 4WWKD 1LO4H 1GOFA 2F54A 1B3JA 3MRNB 4ODUB 1GGIH 1OLLA 3HMWH 4PRID 1SBBA 3SDCC 3BHBB 1YY8A 4R4BB 4HMCA 5DA4A 5IK3B 5KSVA 4LEOB 1A14L 4TSCL 1S7RB 4Y2DC 4BSWB 1I1FB 1T7VA 1P4LA 4OLYH 4ZPVB 1FG2A 1JUFB 4XVUC 4MAYD 2JCCF 1CU4H 2EDHA 4R0LA 2R9HC 1FL5B 2BC4B 2ICEB 1KJ2B 2NXZC 3R0MA 3MLRH 4P3CL 4ZD3H 1CD1A 1ZLUK 1FJ1B 4Z7VF 1UKSA 4J3XA 1U2CA 4C57C 4OI8A 3RWHA 3E6FA 4W4OC 1TJIL 2EKSB 3L5JA 2X4SB 4OCWL 5SWSE 3K74B 3OAYK 1IQDA 4OCNC 1EO7A 4AJ0A 1BZ7A 1RIUH 2VN4A 3HAEH 2A9MH 3QWRD 4M3JA 3N1GC 3RWDB 4U1GC 1I8LC 3O6ML 5FO7B 2E6PA 4UNUA 4NKDB 5T1LB 3JV4B 1Z3GH 4UT9L 2QSVA 1IL1B 5HYJE 4MQ7A 2W9DH 4Y1AE 4LCWD 4NO5B 4PJBF 1JRHL 5TE7H 4BQCA 2V5YA 1PKQB 2ZG3A 3HG1D 3VE0B 4ALAH 3ES6A 1CYGA 3ZE0F 1TVBB 1XF4B 2X4TB 3GSXA 1DL7L 4GKNB 4HWNA 3SKMB 1U93A 2LTQB 2ZSWB 2NY5C 3HMXL 1YQ2A 4MD0B 3L3DA 1ITCA 3DPBA 1RJZA 3QDMA 1KB9J 1B9ZA 3EDDA 1P1ZB 1EV2E 1I8MA 1F6LL 1EVTC 1OQXA 4S2SA 3BZEA 1UM6H 5T1LD 1FVCA 3H9SB 4HCRA 5DJYA 2H1PL 4FQHA 2EDLA 1V7NH 3FOLB 1F4YL 3H9HA 3QUXB 4M3KB 4OZFG 1U92B 4WJ5A 1QFOA 3TF7C 4N5ED 1CD9B 4GRMA 5IW6A 4XRCB 3C8HA 1OAUH 5AWNL 4C4KO 3IRPX 2JB6B 5I1DA 1S8DA 4LCIH 1A4JA 1CXKA 2YSSA 4YDIH 4U1MA 3K4DA 4YHOL 1N7MH 2AVGA 4BFBD 4DFHA 3QUML 3V6OC 1U8PB 3JV6A 2XYCA 3O81A 3MCG1 2YS4A 1S78D 1ZLVK 3QUXD 2OL3L 1T2QL 4JY6A 3MZTA 2F5BH 4UT7L 3WFZA 4HC1L 4X9HA 1XGRA 4MXVF 2R4RL 3Q6FA 3SQOL 4XPFL 4FTVE 4ONFH 5L9DL 2WP3T 3NABH 2EC8A 3EOAA 3IDNB 3QI9C 5D7JA 3TZVC 2VKWA 2V17L 3SGEI 3AAZA 3RWIA 1QACA 4YX2L 3RGVB 4YO0A 3EGSB 3T09A 2Y5TB 5KANG 2PN5A 3KJ4B 4HLJA 2F15A 1BFOA 1EFXD 1OB1B 1JGUL 4KJQC 4MDIA 2IPTL 1ZK9A 1FO0H 1QQDA 4Q0XL 4GMSH 2GJ6D 4KDWA 2EDJA 1SJHA 1BVKA 1MCHA 1N8ZA 1T5WA 2FWOB 3GBLA 5BO1L 4HEME 5EBMA 2F8OA 3GMPA 3TT3H 4CAGA 4M62H 1T6WA 4MGXA 1BLNB 4XNQA 2YN3A 4JN1L 2VDMH 4NKMA 1NCAH 2PTTA 3O3EB 3S37L 4UZGA 4XXDB 4N90E 3GGWA 3HE7B 3KLHD 4U6XB 1AXIB 3EFFB 3GMMB 4XNMB 4CMMA 4RX4D 3MA7B 4L8SB 4XPAH 4HS3B 3AC0A 1WCBA 5INDB 4EOWH 5D96C 1ZLWK 3VH8A 1H15A 3L5XH 1BPVA 2GSIB 3JTSA 5F88A 3ELAT 1AGDA 3CVHA 1BEYL 4GFTB 3MNVB 2QQNH 3SDAD 3QEGL 5B4MC 2X2YA 4R8WL 4FP8H 2IBZX 3I6KA 3HI6L 1OP3K 4QOKD 1T1YA 4NGHL 2ZG2A 1WWAX 1S5HB 1QG3A 3SKOA 3EJZD 3UYOD 2Q76B 3MLVH 3CX5J 4ZDHA 4NNYB 5C0JB 2IPKB 1FNSL 3E3QE 4P3WA 5K59E 3HE7D 4PJ8A 1NDMB 2EDBA 4V1DB 2P5EB 2YEZA 3IFPA 4GG6B 2CUHA 4PS4H 3BD4A 4JGMA 4HIHA 3QQ9D 2ZKHH 5DD5L 3LEVH 3RA7H 2Y06H 2ZCLL 3GSQA 4NQVA 3N1MC 1P4BL 1KCRL 3PWLB 3B9VA 3BGMA 3U4AA 1UWXH 3F58H 2XKNA 3BESR 1IFHH 1D5MA 1FQ9C 4KKBD 1WAAE 4KAQH 1FZJB 2HG5B 1ZSDB 4LVHC 1ZTXL 5I17B 4LHUA 5MP6H 5CILH 3TJHD 4XWOC 1PW3A 4HK0A 1V7MH 3IDJA 2DLIA 4V1DD 1AO7E 2P5ED 4BJLA 4F57H 4BZ2H 1P7KA 2RFXB 4YHKH 4R96A 1RK0A 2FIKA 3PWJB 3CFKB 4L3ED 1IAII 4WUUD 1OQOA 3HPJA 5EU4A 3HI5H 1NUNB 5C0GA 1OTUD 4NQCA 2Y6SC 3I75A 1SMAA 2FHCA 1T1XA 3ARFD 3MROA 3HI1A 5I9QC 4ETQA 5C2BH 2W9LA 4G6JL 4OTXL 2ATKB 3MACH 5DJ6B 2W91A 3C2SA 3MREA 3QSKB 1CFQB 5EU5B 3B83A 1BM3H 2WBJD 2Z8VC 3BO8B 2NLJB 1JN6B 1CLYL 3PL6B 4QLRA 4FMKA 3WXVL 1C12A 4TVPD 2BY3A 2VQTA 5GHWH 4HUXA 4Q9BA 4LFHG 3GBML 1CT8B 4EN3A 5F9OL 5F9JA 5JA9A 2P44B 2VH5L 1YJDH 4U1JA 4YIQA 5DZLA 5EUKA 1V8HA 4P2QB 4YJZL 3MUGA 4ODXA 3QIWD 1Q94A 2HP4A 2NMSA 4R0LC 5HGBB 3RTQB 3DGCR 4YGAB 3KPRB 3H7LA 5IBTH 1J1XL 4JFOA 5C0BA 3QO1A 1C5CH 1CDGA 2EC9U 4PJGA 2OZ4L 1MHPL 3RWFA 3TN0D 5EO9B 2W1NA 4E0RB 3BH9A 4QRPA 1N6VA 4CBPA 1ZAGA 1A8JH 1I7UA 5ESAA 3DLQR 4YXLL 2BVYA 4Z5RB 1DBML 2MFNA 1KLGB 2BDNH 4AEHH 3OF6A 5CS7A 4CDGC 3E2HC 2EDXA 4JRXE 3W5MA 5HYSA 2BNQB 2X10A 2O5ZL 4G7VH 4CADB 2I9LA 2FX7L 4UQ2A 2G9HA 1U95B 4G6KL 3VD3A 5DHYA 1BVZA 1QRKA 4LLUA 2DKUA 3FO9A 1QNZH 4GG8A 3FT3B 4KVNH 2VLJA 4PRPE 3MRBA 2ZCHL 2VQ1B 4OD2A 1HXMA 1HN1A 3B2VL 1KLUB 1YEEH 4NKOB 4RNRB 1I3GH 5EU6B 5K59F 4HQQL 4XWGL 2YBRB 3MRIB 5DJ2B 4NM4H 5LGJB 3O2VL 2ORBH 2DLEA 1CQYA 5DDHB 4PJXA 1SHMA 2VTFA 5E2VH 3DGGA 1DQJA 3AXLB 4BZ1H 2BY1A 4TSBH 2BNQD 2H3NA 3M8OL 5CZVL 3MRMA 1UXSA 1A6VL 2PR4L 5EPMB 2NQCA 4OIBA 5E94A 3VFMA 4ELMA 2J2ZA 2O5YL 5ACZA 3RWCA 3FOMB 1WAAF 2AXFB 1RURL 4D2NA 3QJFB 3SE4A 3EYVA 5IVZB 4BELD 2IQAB 4P23A 3T4YB 4KROB 1G7IA 4MD5A 4LBEB 2IH1A 2CSPA 1AGFA 3G6JE 5DLMH 5J9PB 3RL2A 1H5BB 4Y8AA 2ZUXA 3RKPA 3SPVB 4X6DE 5ID1B 1UACH 4X99B 4Y19B 2HYMA 1MCCA 4LSQL 4UNTA 1XIWD 4JFYB 3MJ8B 4HZLA 4L4JA 1B0RA 2P8MA 4YHIB 1G7PA 2ATPA 3DX8A 3DBXB 2Y7QA 1HNGA 2GQHA 2CLVB 3OJDA 3LDBC 2P43B 3RVVC 1H3PL 1DBAL 1LEIA 4JDZB 3RVUD 1XF3A 5I1JL 5LBSL 2NNAA 4NQUA 2PXYB 2UWEB 3BP4A 1NJ9A 4I5BB 4TVPH 3SY0A 5IM7A 3VFNB 5D7JC 2DWDB 4J4PA 5JHDD 2E3VA 3LN9A 4FQ2L 3QPQD 3VW3H 1XF5A 4PGBB 5M7QA 1ZT4A 1JFQH 4MHHG 4HUNB 1WV7T 4HZAA 1BZ9A 1JGVL 1L7IL 5DRNB 5DTFB 5TDPA 5IF0B 3ULVL 2VZ1A 3BUYA 2VOTA 3WV0A 5DMGD 4C56A 1G6RH 2Y36L 4ODVH 4U3XA 5GS3A 5JQ6L 5I2IA 5E5RB 1FCGA 4HUWB 1DVFD 4JVPA 3WS6A 4E41B 4HH9B 3RUGE 3BZDA 1WC7A 2ADFL 4PFEA 3VFRA 2VLME 3IFNH 1PG7L 1B4JL 3BFOA 1AGEA 5I1AA 4I9WE 43C9A 1QLEL 3VG0L 3CFDB 4RDQF 4XNZC 3CMOH 1H0DB 4H1LH 4J7RA 5D2NB 5DK0B 1H3WM 6CGTA 2X4OB 5FXCH 1Q9KB 5KN5B 2C3XA 4KPHH 4MA3B 2X4RB 4MA8L 3QEHB 2B0SL 2BNRA 4Y16A 3BP6B 4GT7A 4X6FB 1RUAH 1U36A 2UZYB 1MF2H 3U4EA 1IMHC 4PJFE 5L7XL 2C7UA 4XP4H 3UZEA 2E7LA 3CK0L 2E7BA 4XHQA 2YPLD 1NAKL 3FQNB 3FRUA 5KSUA 1NEZB 5ALCH 5DXWA 3LQMA 2BVUA 4QWWD 4RMTA 3ZTJG 3GEWB 1CDUA 1A6WH 1RJCA 5GGRB 3O6LL 1P7HL 3S5LG 1I8IA 3L3OA 2R23B 1FNHA 3BQUD 4L29A 3QDJB 4NO3A 4PBWD 1A2YA 4FQ1H 4JHZA 4OT1L 2HN7B 1IT9L 4PJ8C 4F37F 1OGAA 3G04B 4X80L 3HNSH 4GQ9H 1NEUA 2R1YA 2R69H 3MRHA 1VB9A 2VO5A 2BNUA 1MWAA 4OJFL 3N1QC 1W72B 2A9NH 1MFEL 4WEBH 4Z76A 1KT2B 4K7PH 5SWZE 4WEUD 1N0LA 2DI9A 4WCYL 5EWIH 5J13B 1CBVH 4RBPH 1IC5L 4JZNA 1IGYB 4G42A 5K9OA 3UYRL 3DVFA 2A0LC 1INDL 1TETH 4OLZL 4QXGL 3OGOE 3L3IA 4YDLB 3KPOB 4FQIL 2PO6B 5KVDL 4G8GE 3VU2A 4O9HH 1KIQB 5FFLA 5IWLC 4F3FB 4WI4A 3MRKA 3QH3A 3S35X 5DR5H 3WEXB 2CJUL 4HXBH 5IBLC 1I75A 3MFFA 4C58B 3OKNB 3MRQB 3WBDA 1LO5A 5CJOL 4F37K 5K9KB 3EDFA 3KPPB 4F80A 5E8DH 3V5KB 5F7MC 3RPIA 3WKMH 3PWPA 1YMMA 3L5IA 5HGAA 2DQGH 4YR6B 4PJIE 5LCVH 2VB5A 4CW1B 1R24A 1J8HA 5AAWA 4HGKC 3V0WL 3LS4H 4M1DH 4ERSL 1DLHA 1BFVL 5TQ2H 4U3HA 4LHJB 2X41A 3P9WB 1LE9B 5I75C 3LQAC 3PQYA 1KPVB 3VWKC 1MHCB 3JWDC 1KN2H 3K7UA 4L9DA 2O61A 2HTKC 2W92A 5D1ZA 7FABL 5EZOL 3VRIA 1NH6A 4DN4L 4EN3C 2HJFB 1XGTA 3CC5A 1RZJC 5KW9H 5B39B 5FOBB 1NBZB 3RVWD 1T6VN 5F1NA 4OCYL 4Q9QH 1NFKA 4OI7A 2Z93B 1DBBH 2FHFA 4AT6B 5KG9B 5CGTA 3LEYL 4TYUA 1ZLSH 3GO1H 2APTA 4JY5H 1A1MB 1AD0B 5GSVB 1YEFL 4JRYE 3QUZA 3GSUB 4HLZH 4Z7WB 3TA3B 4Z78B 2IC2A 3MRDB 4ZFOB 4G5ZH 3QCVL 2X4UB 1XMWA 1AD9A 4XVJH 4GRWE 5CFHA 2PYFB 3D2UD 1S7WB 5CCKL 1M7IB 1XH3B 4KRLB 5FO8A 1EBAA 3X11B 4UIMA 4R6UA 5D71H 3NOIA 3UO1L 4MZ3A 4PJFF 3VXOB 4JFQA 4GKZB 2P45B 4F33B 1CVSC 2UZIL 5C9JB 3FQWB 5CEZE 4XMPL 2WIIA 4NKIH 4CMHB 2GEEA 5JIPA 5C09E 5F71A 2YA2A 4OZ4A 1E4XI 3UTSD 2BSRB 4MWFA 5AD0A 3I6LD 1G7JA 1ED3A 2MHAA 3QQ3B 1G0DA 5IROA 3X17A 3DRQB 4G6FB 4JDVA 1GHFH 3GIZH 3HB3D 2H26A 4ONGH 1N5YH 5TE4H 3DYPA 3W0WA 1TENA 1F02I 4PRNB 4MS8C 1IBGL 2L7JA 1T3FA 2R0LH 4LRNL 4QF1B 4DVRH 2FO4A 1T1ZA 3JWOL 4WHCA 1A7OL 4R97B 4QHMA 4NOBA 1I8KA 5SWQA 3WS3B 3TBYB 4P23C 4WFED 3WFHB 1LP9B 3LH2H 5LGHH 1FVEB 4NSKB 4Q9RH 3DX7B 2J8HA 4KKAD 1OOAA 2QQLH 2RBLA 2R0KL 1GJIA 5DFVC 5EBWB 5I1KL 3BP5B 4NBXB 5C7XL 4NC2B 5JXEA 5FK9A 2HJKA 2N1KA 2V5TA 1T20B 1TJHH 2B4CC 5C0FB 2YWYA 5MEPB 5CEZL 4YFEA 2X09A 4PRBA 1NMAL 3MNZB 4FZEH 4P5MB 1M05B 4PY7A 4DW2L 2JLLA 1RUPH 5CBAA 4LIQH 1Q1JH 1CS6A 2DBJA 5FGCE 3BE1H 3FT2B 3LN4B 1J0KA 1QRNA 3OB0K 4TPRL 3MLWH 2BSTA 3O6KH 2DL2A 5FYJE 5FHBH 3ZYJA 2YD3A 1RUQL 3CLEH 1I3VA 4TUKL 3TEUA 4H25A 1S7SA 3IKKA 1R3IH 5I74C 1QA9B 4XTRD 3VGEA 4ISVB 1T2JA 4QCIA 1P69B 4UIKH 3P2TA 5J0BA 1F2XK 3A6BH 5I1EH 1JK8A 5DURB 2IANB 1BD2E 1AKJA 4C59B 5E03A 3RBSA 4PP1D 3WS6C 3RY5A 1OTTC 3QULB 2AV7B 5IG7A 4IMLA 5KVFL 3K8MA 1NC2B 3O4LA 4Z7QE 3JTTB 3T3PF 3TO4B 2D7TL 4M7JL 1T21A 4PJCA 3K2UH 2AK1L 4XGZA 5GRXG 4HXAL 1BIIB 1VEOA 5ENWB 4UB0H 4P9HC 1JZ3A 1K2DA 2XTJB 4GRWF 5DQ9B 4ZUSA 4MNQE 4PJ7B 2R8SL 3DETC 4FFZH 5DHVB 4HJJH 5DJCA 4L1HA 2VR5A 4Y16C 5EZLA 4P2OA 2IAND 4HIIA 3WIHH 2GYSA 2D7QA 4Y4KB 3QUKA 4P99A 5EUOF 5FO9A 3MA9L 1E0OB 4QHNB 4JB9L 3UTTB 5IEHB 1A4KB 4BYHA 1MREH 2AJVL 4UOW1 3QEUA 1ZA3A 4KHTL 4CKVX 1FRGL 1JGEB 5LVEA 3QFDB 5FYJL 4YHPB 1AGCA 2R0ZL 1GXEA 1DBKL 5DVOA 4UV7H 4U2ZA 1LEGA 2OQJB 1HSAB 3QCTL 1DN2A 4XHJC 3MRNA 2XTJD 5EDXA 4ODUA 2LABA 4LASL 5F1SA 5I73C 2P42B 1O0VA 5SX5K 4ZNEA 3BHBA 4R4BA 3SCMD 2J5LB 4Y4KD 2AK4E 3BYTA 1S7RA 3SKNB 3UTTD 4BSWA 1I1FA 4ZPVA 1WGOA 1JUFA 3FT4B 2D2OA 3ROLB 4JN2B 3CVIL 3QCUH 2AJ3B 1D6VH 5IFJA 1N2RB 3DRTB 2QEJA 2YC1B 1KJ2A 1FFOB 1F4AA 1TTFA 1RJYB 2C3GA 5HGGS 3C08L 4XMLH 5CINH 3NA9H 1FJ1A 5HI5C 3NTCH 4U1IA 1HH9B 1TCRA 3CFIC 4NQDB 3M17A 3LKNA 1FZOA 1QBLH 2X4SA 1BP3B 4WW2B 3QHFH 5D7IE 5CJXA 1BQLL 4XBPB 3TFKD 2KPNA 5GJSL 3DTXB 2CGRH 5LXGH 1IM3B 3IJSB 4NKDA 3CPLB 4NN6C 3JV4A 8FABA 1H8SA 3F8UB 1IL1A 4NO5A 5C0EB 1H8NA 1A3LL 2WLZA 2IH3B 5D7LA 32C2B 3VGGA 1PKQA 4XX1E 3MGTA 3VE0A 3EHBD 4YPGB 5J4MA 1FGVL 3T04D 2X4TA 4NQDD 1WZKA 2XPGB 4M61B 4ZYKA 4NDMB 4K07A 1JTPA 2PTVA 2QR0B 5HDOA 4OZIE 2XG5A 4I48B 5D1ZC 2DMBA 5EU7E 4OCRL 4P2RD 4P48A 4YK4B 4Y5XA 4KTDH 3RQ3A 1SEBB 1KB5B 5GGVL 4KZDL 1P1ZA 3GMOB 3QXDB 4RGOH 3SGEH 3AUVA 3CFJB 1UCBL 3RVTD 1FIGH 3H9SA 3KPLB 5ISZA 5J56B 2CKNA 2VKXA 3HNTL 5I6XB 2MKWA 5DQJB 4E42B 5T33H 3JVGA 3QUZC 5DJDB 3E6HB 4OCMC 2BSSA 3UXFA 4R7DB 4CUCA 4S1DC 3WHXA 4UUJB 5GSRB 4HUKB 4U49A 2LVEA 2P5WD 1CI5A 2JB6A 3DUUB 4ALAL 1KSRA 4YQXH 3MZGB 4ZFZA 2OJZL 2OTWB 4UQ3B 3VJ6A 1NLDH 1MFDL 1LDPL 2L0DA 4JFZL 1A3RL 1U8PA 2EO1A 3PABA 2A6JB 3NCYP 4HGMA 2WW8A 4NJAH 5DJAB 2Z31A 1QD0A 3ZTNH 2NY1C 3FCTB 3G5YB 1K3ZA 3DIFA 2HT2D 4GS7C 3QZWB 3U9UB 1VEMA 4HWZB 5GZNC 2V9RA 1TPXC 5HHQA 4PYGA 3RX7A 3VI3E 4JZJB 3GSNH 3U0TB 3C5JA 2FZ3A 5JUEL 5FYKH 5D72H 5DHVH 4R3SB 3RGVA 1IGIL 4XMKH 5KANI 1ZGLM 3EGSA 2MCG1 2P24A 3RWJB 5KOMC 4Z7OE 1CIDA 5A43C 5TGBB 1CE1L 4PJDE 1N6QH 4X8JB 5BOZG 1HYSC 4JE4B 2AI0L 4QRSB 1JWSB 4CN1A 3O4OC 4TUJB 3MLSL 1XGQB 1U91B 1CICD 2VIRB 1MJ7L 2OBGA 1EIBA 5AAMA 1ADQL 3HNVL 1YN7B 2FWOA 5HDBE 5C0AA 3KPTA 3UC0L 3WNLA 2O5XL 3WIFB 3CLFL 5DRXA 2EIEA 4WI3A 5E70A 1J87A 3OXRB 1YNKH 1BLNA 2DQFA 3STZB 4OF5A 3CMGA 3NZHH 5F89B 2YRLA 4U6XA 4HDIB 4XNMA 4LCWE 1CTOA 4Q2ZB 1NCBH 4GXUM 3HG1E 2A6KB 3V6OE 3FL7A 2GSIA 4IMKA 4X9FA 1PSKL 5M95B 2HFGH 4K3DH 2FECL 3X3FH 4MB5A 4PGDB 5E2UH 3EO9H 1CGVA 4AIZA 3Q1SL 1DTUA 1IAIH 4IRSB 1INQA 1UB5B 1MRFL 3ISWA 1DR9A 1QUNA 3FQRB 5D7KD 4M43L 5L88L 4JHBA 4ZXBA 5EB9A 1ZT1B 2VLKA 1S5HA 3D3VB 1IKFH 3B5HA 4A2MA 4NUGL 3TO2B 5I8OL 2FGWH 1NFDB 5LJYH 1NDMA 4C4KT 4G9FE 1JRHI 3U30B 5MERB 4P9MH 3PP3H 2O26U 4UV4H 4KRPB 4GG6A 4NWTH 2AJYL 3OKOA 3KXFB 2GUOB 5HHOB 2VDML 1ZGLA 5CUSL 1P9MC 4LSRH 4F7EA 3IFLH 3ROOB 2DMCA 1E27B 3CFBA 3WE6B 3FRPA 3I02B 4J8RB 4Z8FL 1EJOH 4O2FB 3NPSB 1N6UA 3PWLA 3BEVB 4ZS6D 5JO5B 1V3KA 1B0GB 2Z8WC 3MOBH 3UAJC 1A7QL 2Y07L 2CKBB 2X4PB 1FZJA 1EAJA 1ZSDA 2IEPA 3WDIA 4N0CC 3WUWG 3VDAA 1X5XA 3VXNB 4NOFA 3ARGA 5JHLH 2AV1B 1HCFX 3AB0B 3MLTB 1X7QA 4QTHB 3V5HB 2EDNA 5EIVA 3QAZC 4OF6A 3CFKA 5ERWB 5HVHC 4UT6H 1VGEH 4LCCB 1RFDL 1IRAY 5CKGA 2XZQH 4KQ4L 4P2OC 3EYSH 2VDPH 4AEFA 3HLAB 1JPGA 2HKHH 5J12C 3X14B 1I9IL 3MMEA 4NZUL 4YXKH 1BFTA 1KN4L 2YHGA 4O02L 3AU1A 3CH8A 2Z4QB 5DJ6A 1F8TH 1G0YR 1HWHB 1RZGB 3MO1B 3G6AB 2CK2A 5EU5A 3SJVA 4BH7B 5EOQH 2NLJA 1JN6A 3CGTA 3PL6A 3VI3F 5AYQA 3WDJA 4B5EA 4BA8A 5FECB 2BOBB 2C4FU 2GJ6E 2V2WB 1C5BL 1X5JA 3EFDH 3V4UL 4KZEH 1CT8A 1CTNA 4Z7OF 4L9LA 2XZCH 4ACPA 4JFHE 4PJDF 3S96B 5L2JA 1F3DJ 2EXYC 2DKMA 4L3AA 4NN5B 3OKDB 3BT2L 4JHWL 2XA3A 3HI5L 3QWQB 4NRYB 4BK5A 4QXTB 3RTQA 3PHOB 4HS8H 2MNUA 2XQBH 3KPRA 3ZO0A 4KJPD 4R2GB 3TVMA 3K46A 4EDXA 1OAXH 3CD4A 1IC1A 1UZ6E 5EO9A 5CMAB 4E0RA 5IFAL 1U3HA 5CJXC 2BHZA 2Z35A 3BIBX 3K8LA 4XB7A 4NFBA 4QOKE 1T7WA 4IRZL 5K93A 1S7UB 5E99L 5IW1B 1CVRA 1FE8H 4YFDB 5GGTA 1P4IL 2B8OT 1XAUA 1HQ4A 2IG2H 4CADA 3JBG7 1TZHB 4MB3A 5CIPB 1RIHH 4PJ5B 4U6YB 1W0WB 3LPWA 4MAUH 4JVUA 3FO0L 4M1GH 4R2GD 4I0CC 3AGVA 3FT3A 2ED9A 3DSNA 4WNQB 1I3UA 2VQ1A 2PNDA 2F54E 4N5EC 4NKOA 4J3SA 3BDBA 4RNRA 1J5OH 2YD2A 5EU6A 3CFCL 1OM3L 2YBRA 5LGJA 1J0JA 5DEZA 1YQVL 5A2LH 1QKZH 4PP2A 3MLXL 2BY0A 4OKVB 1Q9LA 4MMXC 5BW7A 2AERT 3AXLA 1FDLH 4JJ5A 4PLJC 5IHLB 4LCUA 4WTZG 5EPMA 2AABH 2EDEA 2FIRT 4O51B 5IB4A 4RCAA 1DSFH 4Z9KB 3FOMA 1U8MA 2AXFA 4L3EE 5JPNB 3JVGC 3QJFA 3FHAA 4X98A 2BRRL 3QUYB 5IVZA 1WZ1L 1HIMH 3KHQA 1A5FH 3PHQB 4P5KB 1R3KB 5FM8A 3QIBB 3MJ7B 2AGJL 2MTPA 3GMQB 3KPNB 3NCJH 2EH7L 1D9KD 1T4KB 4BFEA 4JGUA 2ENSA 1H5BA 1E28B 3SPVA 3RKDC 4X99A 5F3BB 5ID1A 1RZIB 4Y19A 3VFOB 4AMKH 1FLRH 5J7CC 1E4JA 3MJ8A 3VRJB 3SGDI 1K8IB 4FQCL 4IDJH 4TVPE 1YEDB 3DBXA 5B21A 2Q8AH 1ZANH 2MJWA 1YJDC 2VAAB 2Z31C 3Q3GB 2CKBH 1NGQH 2CLVA 1UM4L 3MX0A 5IFHL 4TSAL 4YGVB 3QUYD 3HC0A 1YUHB 1F3RB 4JDZA 2PXYA 2UWEA 4I5BA 1FZKB 1JNJA 3IDXL 2J8UE 4FABH 5EULV 3SO3B 2DWDA 4H0GA 5KVGH 1GIGH 5LWYL 4I0PA 2JE8A 3EJYC 4KY1L 1CIUA 3EYOA 3RGVC 2OX5A 2DL9A 4MHHI 4PGBA 5KTEL 3IKCB 3MCKA 5HD8C 2APBA 3KLHC 5BS0B 2EDQA 3KJ4C 3V4PL 5DRNA 5ABDE 5DTFA 3MLUL 1FORL 5CSBA 1JZ4A 1YPZE 1W0YT 4XPBH 3PWUB 4MVBD 3QFJA 4E41A 4J1UB 3MBED 2Q7NA 3DVNB 3KPSD 8CGTA 4S1RH 1YEGL 3I85A 1VENA 3IU3B 3W39A 1IM9B 3I3BA 4I2XB 4G43A 1NGXB 1F4XL 4H0HB 3FB6A 5H35B 5I8CB 5J06A 3ZKXB 4POZC 1UZ6F 1FV1B 2ICWJ 5D2NA 3UP1A 4PGEB 3MJ9H 5DHXB 1EFQA 1AHWA 5DK0A 2GFBA 3HE7C 4TVPL 5BS0D 2X4OA 4TRPH 5KN5A 5GZOC 4L8SC 2DTMH 3WLWD 1NGPL 4M6OL 2X4RA 4OZHB 4D3CL 3QEHA 2D7NA 2QADD 4S1SH 4ZO8A 4IMKC 5T5FH 4U1NA 3VGDA 4GAJL 4XPGL 2X70A 1WBXB 4TUOB 1OY3B 5E9DD 5CEXA 1I7ZA 4I3RH 4OFYD 4AH2B 1KFAL 3S35L 1G6RL 2A73A 5EN2A 5L2KB 2DQUL 5KJRL 2DQHL 4LK4A 4ZFGL 1IM9D 3B43A 2VXVH 1YEKH 3CSYB 3J8F7 3QDJA 5F3HA 3T1FB 3OKLB 25C8L 5D2LB 5LG1A 2EDTA 2HN7A 1UC6A 4Y88A 3G04A 4HIEB 2HVJA 5HVGB 1I1AD 4M7KH 5INCB 4HCRL 4ODHH 1XR9A 4TTDD 5I16A 4OGAD 1A47A 1W72A 1KT2A 4LSPL 1E4WH 3H42L 1N3NB 3WYRA 4GH7B 1QSFB 1VPOL 3C8KA 2NW3A 1HEZB 2DB8A 5D70L 5C08B 2QSCH 1IGYA 5I1LA 4PB9H 1CFNA 1XCTB 4KKLC 3ZHDA 2CPCA 1KV3A 1QR1B 2VDKH 4OZGB 3CXDH 4WO4B 3ARGC 2PO6A 1PZ5B 4HG4K 1KIQA 3TJEH 1N59A 4ZG1A 4LF3B 4F3FA 2ZWLT 4DN3H 4FN0A 1CLOH 2E7HA 3WEXA 5I66B 1JZ8A 4ZSOB 4RSVA 3LS5L 4DZBB 5I1IH 3IXTB 4JFDD 4HUUA 3HCVB 1AP2A 2DD8H 2VDRH 5FYLD 1RPQA 1RU9L 4K94L 3MXWL 1SYSA 4YR6A 4NJ9L 3W81A 1HKFA 1KENL 1A9EB 4JM2B 5FGBA 3ZLQC 2R2CA 3MV8B 1FC2D 2Y1VA 3NIGF 4HWBH 4PD4K 3ZDXF 5EIQA 2H45A 5DSCB 4HX1B 3PL6C 2J8UF 5BZWA 1LE9A 3GNML 2VDLL 1QEWB 2NY0D 1IGCL 1E6JH 2LU7A 2EE6A 3IETB 4WHTB 5BVPH 2G2RB 5F8QC 1GH7A 4L9LC 4L1DA 1KLFA 3D48R 2HJFA 5GXBB 4NRXA 4K3EH 5B39A 5FOBA 3O9WB 1NBZA 2HRPH 4OBRA 4RAVA 1E4XH 2Z93A 1YPZF 4N68A 4AT6A 3KYKL 4X4YB 2H2SD 5JOEA 5DC0A 3QEQD 2EC9T 2DQTH 5FA3A 3MV8D 3D18A 1AD0A 5GSVA 3RTQC 1YEIL 5F7LB 5DQDL 3VFUB 3MODH 3O3AA 3TA3A 3TVMC 3OQ3B 4Z78A 4AENB 1JZ5A 3MRDA 4LOUD 2BOCB 2X4UA 2YPLE 1A22B 3P9LB 1U3HC 3I50H 3CVHL 4XAWH 4GO6B 1VFMA 4LQFH 4HKZB 3O9WD 1JHTB 5KVMC 3SGJA 5BJTB 3RVXD 3HHRB 4NQCE 4S0SD 3VXOA 3AS0A 4F33A 5C0RH 5C9JA 3FQWA 3KAAA 2BVOA 1BQHB 2MPAH 3FKUS 3ESVF 3NACH 1ZS8A 1D6EA 2E27L 3EYUH 1FYTB 4I0KA 3E8UH 5C3LD 2ZOLB 3T3ME 4QRRA 1KCUH 2JJUA 3HKFA 5CLWA 5D9SA 4XP5L 1UFUA 5K9QG 1JMXA 2BSRA 4OI9A 3JUZA 4I3GA 4RISL 5IB1A 3U0WL 1NAMB 2JCCB 5BW7C 3DRQA 4JR9L 3B8YA 4KK8D 1J1OL 1KIUA 2VISB 3AROA 3C5SB 5TFSH 4KK5C 2DM3A 2E9IA 3O2WL 3U9PL 1U8JB 1VACB 3ZT7A 5TDOA 1WUNT 4Z7VB 4QF1A 4LKCB 2D31A 3WJLA 1FYTD 1U8OA 4ZS7L 5C0BE 3TBYA 3PGDA 3WFHA 4PJGE 1KTLA 2P7TB 4KROC 4NSKA 4UBDD 1JHLL 4QRPE 1DQLL 2Q8BL 3QFJD 5EBWA 2WK2A 4U7KA 2NX5B 1H5BC 2CRYA 3IXAA 1EX0A 2CDGB 3K3QA 5EOCH 5T3XL 4I3SL 1MY7A 3L3GA 4PJBB 1UA6H 1UM5L 3BKMH 4RBPK 5FYLH 3PDOA 4M6MH 5HDQL 4JLRA 1K8DB 3MNZA 5JIHA 1OAYH 1LD9A 3LKRB 4QHUB 1TCMA 5T3ZE 3D9AL 4YHLH 3N06B 4QXWA 3LQAL 4U1KB 5L6YL 2OR8A 2XN9D 3QDGA 1S9KC 4I77L 3FT2A 4WTWA 1A1OB 1A0QL 2VLJE 3C2AL 4DOHB 4LRIA 2I5YH 1ORSB 1U2HA 2PXYC 4OFDA 3ABZA 5C0ND 3V95A 1WTLA 3W9EB 1R0AH 1RZJL 1GOGA 4I0PC 4R90L 4LQ1A 1GGTA 3TYGH 3HRPA 2WWMD 2ZUYA 4FQQB 4KMLB 1ZMYA 2YPVL 1RAMA 3LB6D 5E2JA 3S34L 1QA9A 4ISVA 3REWA 4PYHA 1K6QH 3VFSA 3KLDA 1DBJL 1DFBL 1T83A 3TIEA 5F7NC 1NKRA 4NHCL 1EUUA 4IIQA 4ELME 3VXUB 3OKKA 4KJYA 3QULA 2ICES 3STLB 3MXVL 2NY7H 5FHAH 4JM4H 1MCEA 1JVKA 1D5BB 1NC2A 4TOYL 4X6BB 4JGJA 4NBZB 3TO4A 4M8QB 5FUOL 2JELL 6FABL 4YC2B 2NZ9C 2QL1A 5D2NC 5ENWA 1WIOA 1AHWC 2AJZB 5DQ9A 1K85A 2IJ0C 4JO1L 3RWGB 1SEQH 3I6GA 3ZKNC 5DRZB 3P30H 1MIML 2J12B 5T3ZL 1U3JA 1PQZB 3L95B 4AIXA 2X1QA 3ILPB 3VH8G 1NBYB 1FPTH 15C8H 3CAFA 5JOPD 3VXUD 2AAVA 4D9QD 3I6LE 2BY2A 1T03L 5C1MB 3QFDA 2EKJA 3PNWA 5DUPH 3VGAC 4BQ6A 3CSGA 3IGAB 1IQWL 1F13A 2OQJA 3T3MF 1HSAA 2ARJB 1K5NB 1T2XA 4OUUB 5KS9E 4ESKA 2HWZL 3ULUC 1KC5H 4B0MM 1FAIL 1WT5A 2WUCL 1LK3L 1F58H 4WFEE 4C56E 1RUKH 1HXYA 5IGXL 5BZDA 4DGVH 4WHYG 5TH2A 3TT1H 3CU7A 5J13C 3S97C 2QBWA 2VDOL 3FT4A 4QRQB 5JQHC 5F7KC 4XCCH 2AJ3A 5JXAL 2GHWB 5IBUG 2CRMA 1M6OA 4J3VA 5F1IB 1MREL 2GSGB 2YC1A 4NM8H 5DF0A 5DO2C 2LFGA 4YDLC 1FFOA 5DVMA 4D0DB 1RJYA 5I19L 5SWSB 2PO6C 3KDMB 2ZOKB 1MQKH 1UYWL 2B4CL 4LHUG 4UINH 3VMNA 3GI8H 4OZFH 5EFIA 5TQ0H 1YMHB 1NAMH 2IALB 3WSQL 3DO7B 3P0VL 4WW2A 4OLXL 4OM1L 1WWBX 1L9MA 4QRUA 5ITBH 4XBPA 1CLZL 5ITFB 2FL5B 4H88H 1TFHA 3O8XB 5HYJB 4Y1AB 4S10A 1R6VA 1MQ8A 4XPTL 5EC1A 35C8L 4LAQL 1LDSA 3P9MA 1IM3A 1DEEA 1XEDA 2OL3B 3GI9L 1CFVH 1GGCL 1AJ7L 1OARH 3CIQA 3CPLA 4D8PB 5T1DL 3RNQB 2J88H 1KJ3H 3BH8B 4MJ5A 4A2LA 1RD6A 3TH4T 4OFVA 2HLFD 5FGBC 1DDHB 1S7VB 1CL7L 4YPGA 4CL7A 5TF1H 3VXPA 5FDYA 4PD4J 2XPGA 4M61A 4NDMA 3VA6A 2NY4D 2QR0A 4EDWL 4I48A 4HKBB 4O00A 5HYJD 1INEL 3O2DA 1YECL 4LSVH 3TH2T 3ORJA 1KB5A 4LKXB 4Z0XB 2ESVA 3SDXE 4D9LH 3CFJA 1H3UA 4LFHD 2NTSP 3U82B 1IAOB 1G9NC 4MLIA 2IQ9L 3F65A 4O2CB 5DQJA 4E42A 4P9HL 3MV7D 3RWEA 3GSWA 3QDHA 3E6HA 3G5ZA 5DMIL 3TA3C 1ZGLP 5GSRA 3BDYL 4YNYB 2XY1A 4EQ3A 1A14H 4TSCH 2V2XB 2F5AL 2GY5A 2OTWA 5CGYD 1SBSL 4UQ3A 4WV1A 2AXGA 2OMBA 1NUDA 2NY6B 4Y4FA 4HKXB 5ANME 1HH6A 3SGJC 5E6IB 3EOBB 4FTVB 5F9DC 5HYEA 5DJAA 3PWPE 1YMME 3PWNA 3WHE0 1NCTA 4JPVL 3C6SA 1XFPA 5HYSG 1J8HE 4TQEL 4P3CH 1T1WB 5JORB 4IOFD 3GK8L 3QZWA 3U9UA 4HWZA 4CMHC 4NZTL 2YUXA 1TJIH 2Y72A 1U8NB 4A6YB 4LLYB 5E1HB 1MWAL 4OCWH 3PQYE 3U0TA 3IRZA 1ES0A 1CE6B 4MXQD 3MLYL 4Y4HD 1S9YB 5KS9F 4R3SA 3PXJA 4OSUL 1YY9D 1S7QA 2CDFB 3O41B 3IAQA 2EDRA 5D1XA 1S7XA 2CH8A 5TGBA 3KYAA 4X8JA 4PLOB 4QRSA 4ORGA 4J6RL 4TUJA 4UT9H 4JPWL 1ZLWH 1VA9A 1V3MA 1U91A 1JRHH 2VIRA 3LKPB 2GW5A 3WJLC 4FFWC 3MC0A 1YN7A 2HTLD 4R97C 1NGZB 2AW2A 4NCC1 2WP3O 4X4XA 2XWTB 1DL7H 3WIFA 3IJYB 3MV9B 4NQED 3OXRA 3HMXH 1I1YB 3STZA 3UBXA 1TVHB 4IRJB 1B88A 4OV6F 3O3DB 3CUPB 1F4WL 1AQDA 4Q2ZA 1OWRM 2CR6A 2A6KA 2NXYD 2H1PH 5E1AB 3MV11 3ARSA 1JV5B 1F4YH 1FL6B 1I4FA 1QFHA 5I15L 4HS6A 4MSWA 4OIAA 4QKXB 1JZ7A 5IKCA 2D7MA 4JQIL 3SE8L 4IRSA 3GM0A 1UB5A 4P2RE 2DMKA 3FQRA 5AWNH 2IAMA