3MMEB

Structure and functional dissection of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
211
Chain Sequence
ALTQPASVSGSPGQTITISCNGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG16 HEAVY CHAIN FAB
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 211
sequence length 211
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeB02
1KELL 3HZMB 1IKNA 3B9KA 2DBJA 1BBDH 2O61B 2IGFL 4Y0GA 1C5BL 4LSUL 4PB9H 4OF6A 1A7NL 4Y16D 4FFWC 2YD6A 4Y1AE 1MQKH 2CRZA 2G9HB 4IMKA 2PXYD 2VDNL 1CFSA 4TVPE 4FQCL 3K4ZA 3WNOA 5LWYL 1T20B 3FCTA 3HPJA 5JHLH 2FGWH 1IILE 1AH1A 3O3AA 5SX5H 3QO1B 2C7UA 4XP9L 3RTQD 2AXJA 1JNJA 3EBAA 1HHKB 3FFCE 4P4KA 1WBYA 2UWEE 2D7OA 5DJYA 4KROC 5JTWA 4F2MA 2HKFL 2A6IA 4KZEH 3WFHA 5D2LE 2FX9H 3QG6A 1FV1B 5TE7L 4XNXL 5DUMH 4DN3L 5GGSB 3T0BA 2EYRA 2AKRA 1CF8L 2OTWA 3PABB 4FFVD 1K8DA 5DA4A 3ARSA 4QHNB 4OIIL 4HUXB 3MRNA 4QRTA 4OT1L 5MEQB 5F72S 2HT3D 4PY8J 3A6OA 1KJ3H 5D7LD 5ACLA 4HJGA 4HK0B 4LLDB 5C0FB 5TF1L 1NL0L 1MH5B 4C54A 3S9DB 2DIBA 5EN2B 4MNQB 4P2RD 3IS1X 4HS6A 4WWKB 1S7WB 1CD0A 2N4IA 3ARGD 4MA7H 3FOMA 1GJIA 1DUZB 2VC2H 3EKCA 3TIEB 3WUWB 1NMAH 1JGUH 5F7DA 4XP4L 2FO4B 2D9QB 5EUOB 4Z95L 5GPRA 3LMJL 2F15A 2P8LA 3Q48A 2R0KH 1MNUL 4LP4A 4XCCL 4UTAL 1FVDB 3IDYC 4K9EC 1FZMB 4RMUA 5IQ9A 1F5WA 2ZUXA 3B9DA 4Q74A 3C87A 5ELIA 5C09B 4QHLB 2YMXL 3BKJH 4NO3A 1IRAY 3IAGC 3WJLA 4PJHA 1SYVB 4WUKL 4XMKH 4LGPB 3QDAA 1NLBH 5T3ZD 3IVKA 5IB1A 3S5LG 3A67H 4KAQL 4Y5VC 4UDUA 2B2XH 4YPGA 5BVJA 2EH7L 3O45B 4G6AC 3SY0B 5JORB 2W0PA 2HT4C 5I1KH 1IQDB 3BP6B 2E3VA 1DEDA 4P46C 1KJ2L 3HA0A 2XRAL 3GMOA 4PTUA 4WW1A 4PGEB 1F42A 4P5MB 2VXTL 3CH8A 3GHEL 4LFHD 4BK4A 3FAWA 3L3DB 4OD2A 3P9MB 4HGKC 4J8RA 3O2WL 1Z3GH 2XZQL 3MBXH 3P0GB 4RNRB 1IARB 5T1MB 4YHML 1T03L 3ES6A 2WLYA 3MODH 1F2XK 4XPTL 3VXUE 2OJEB 3GRWH 1HK6A 2Q8AL 3BZDA 3RUGE 4DVBA 1RIVH 4M1CD 4NNPH 1KB9K 5E8EB 1G6VK 3HC3H 1I3GL 2GCYA 4M1DL 4PJ8A 2IFFH 5K9JH 2LTQB 4ZTOL 1OTTC 2UY7A 1RZ8A 5C0BD 3TH4T 4DWHA 5CINL 3U9UB 4I2XB 2CLRB 3S35H 1I7ZA 3BDYH 2OM5A 3HB3D 1YMME 2YPLB 5IJKC 3D2UB 3PIQB 4EI6B 4ZAKC 4MJIB 4DKAA 4YHOL 3I2CL 3FMGL 2YD2A 3GGWA 2GJZB 1KELH 3L3KB 3TJEL 5DRWA 2IGFH 5E94B 5KSBA 2O93L 1C5BH 4GKZB 4LSUH 5EBLA 1A7NH 1BQHG 3ARDB 5E56A 1ZLVK 5HVFB 4IJ3B 5FO8A 1DL7L 3F7RA 1U3YA 4QHMA 4TUJA 4JO1L 4FQCH 2R2EB 3V52L 3X3FL 4Y19E 3P9WB 5I17B 2WNGA 3LZFH 1J0ZA 1RZ7L 3VXRA 3DI3B 1DQJB 4JKPL 4XP9H 4Y5XC 1RZKC 4AEHL 1QO3B 4YBHA 3WIFA 5IVXA 1HYSC 3D0VA 3JVGC 4OGZA 5FHBL 2Q76B 2J8UB 2CRYA 2HKFH 2PCPA 5I8EB 4E41A 1IZJA 4GKSB 1K5NB 5FDYA 4LOUD 1JNNL 3D39A 2PW1A 4JLRB 5TE7H 4XNXH 1HEZA 4DN3H 3HHRB 5E2VH 1UZ6E 4XCFL 1DBBL 1WV7T 3RZCB 4JQXC 1CF8H 1U8KB 4UNUA 1JPFA 2HN7A 4M6AA 2XWJB 4OIIH 4PJFA 1UB6A 4OT1H 4RFEB 4PRPA 4YNYA 3V9FA 1BBJB 1T5WA 3SE8H 1QUNA 4LIQH 4G9FA 4P9ML 1V7NL 1NCBL 3RPKA 3EYFA 5TF1H 1NL0H 1JV5B 3BX7C 2WWMC 3TJHC 1CXFA 1EAPA 1F6AB 4ZUWB 1LK3L 3BMWA 1R5WA 2DKMA 4MB4A 3T1WA 5C08D 3L7EA 4JFDA 1KSRA 4JREC 4GW1A 2E7MA 4YAQB 2FJGA 4BQ6A 2DWDA 5ENWB 2WM0A 4XP4H 5A2FA 4Z95H 3LMJH 4JZJB 5HHVL 5MI0C 3QI9C 1MNUH 4P57B 3SDAA 5IMOB 3MRKA 5ESQB 4WGWB 2HVJB 1R5VA 3OJVC 4XCCH 4UTAH 5I6XC 5JHDE 1HNFA 4JRYB 3VGDA 4G80A 3B9EA 1DQLL 2YMXH 1W0WA 1V7ML 2PYFB 1FORL 5HYIA 3QJHB 5IG7A 3LY6A 4WUKH 4QHUB 4PLJC 3RIAF 1P84K 3MV7D 2YZ8A 4ZFZA 3UJTH 5KSAC 5F7MC 2R1XB 2XWTB 1VHPA 3CC5B 5CP3H 3QXWA 3MNVB 4RMSA 1A1MB 5C0CD 5SWSE 4OZHA 3GB7B 4G8FB 3RVVD 4EEEA 2DQDH 3HZYA 4Z7QE 1KJ2H 4S1QL 2I9TB 2ZUYA 4CKVX 3ULVC 2SEBB 5BO1L 5EC2A 3IFOB 2VXTH 2IQAA 2HVKB 2CIKB 4F15C 1SMAA 3DRQA 3GHEH 2X89A 3ZDZE 4GAJL 5C1MB 2MSPA 3O2WH 3ZE1E 3EO0B 4HWUA 2XZQH 4PJDB 4PRHA 4GH7B 2P42B 2BFVL 2PXYB 4YHMH 1T03H 4JFEB 2AJYL 4XPTH 3GJEA 4WFFD 3MLRL 1UG9A 4ZPTA 1VGKA 4C56B 3PV6A 2EIBA 2WUBL 1UKTA 2DQIL 3MV9A 5INCB 5SX4H 3OKNA 5FM8A 3FFCD 3SO3C 1I3GH 4OKVB 4M1DH 3HLAA 3RTQB 4BH7A 1MI5A 4ZTOH 4ZUUB 3D3VB 2EE6A 3M45A 1A4JB 5CINH 7CGTA 4X99A 3CFDA 2VLRB 5GGRA 3PG2A 1NKOA 2C3WA 4LPTA 2F74B 4YHOH 2MJWA 3I2CH 5CWSB 5DZLA 4LEOA 3FRUA 1YY8B 3PUCA 3IAQA 2AAVA 3TJEH 1Q9WA 2NY0D 1HZHL 1QEWA 1XAUA 4EUPB 4OGYL 3IFNL 3P4NA 5IESL 3RWFA 3PXHA 1FGNL 1DL7H 2ICEA 5ANME 3QFJB 3GK8H 4Q9BA 1MOEA 4JO1H 3TH2T 3V52H 1NC4A 2FX8L 3GI9L 3JTTB 3X3FH 5D7LB 4GXUM 1J0JA 4BFEA 4RFOL 1RZ7H 4U3HA 5DK3A 3FQWA 4AEHH 3QHZH 1MRFL 4Y4KD 4JFHE 1CFNA 2EE2A 4RWYH 4G8IA 2RHEA 4IM8A 4LARH 2DRUA 4ZXBB 5B3JF 2GSIB 1CFBA 1K4CA 4BQBA 12E8L 5F1SA 1JNNH 1ZWIA 3BEWB 2Q6WB 2IMMA 2NZ9D 4XCFH 1DBBH 1CGYA 3I75B 2GFBA 3TBTB 3QXUA 1G0DA 3DUSA 1I1AD 4MA8H 5E95B 3LHPL 4EN3B 1QVOA 3BUYB 2OL3A 3U0PA 4NOFA 4Y1AA 3WLBA 4DEPB 3BRGC 3IDGB 4PP2B 3CK0L 4P9MH 1KB5A 1NCBH 1V7NH 1CE6B 2KPNA 3QCVL 3SPVA 1RZFL 1OPGL 2MHAB 5HHPB 4OI8A 2P8PA 1NANI 2P5EE 3MRLA 2HJLB 4PJ9C 4ZTPL 1SM3L 3VWKD 1XCQA 4RAUA 4PGDA 5JO5B 2UWEA 3QDJA 1JRHL 1NAML 4F7MA 4JY5L 4L8SC 3SDCB 2YEZA 4JCMA 5CSZB 5HHVH 1JIBA 1F3DJ 1YJDL 1WFOA 2WINB 4ZDHA 5CD5C 5H37H 4U6YA 3VXUD 4HJJL 1OB1B 1DQLH 5FGBA 1V7MH 1VFBB 1HXYA 2XN9A 1ORQA 1U9KA 1FVCB 1PDKA 4KKCD 2P4AB 3L3JB 3UTTE 4KK5D 1KYOK 5C0BB 1YMMD 3CIQA 1LE5A 5F89B 1OP5K 3L9RB 4C57C 2J8UF 4MA3A 3LKQA 5HHXH 4XMPL 4KUZH 4MLIA 4S1QH 2P1YA 5BV7L 3CXHJ 5BO1H 3RX7A 5C6TL 3GMQA 2YBRB 1A5FL 3O9WC 2NXYC 2BSED 3BWAB 4GAJH 1MQ8A 3TBYB 1YY9D 5A3ID 4YDJB 4PJBE 1OLLA 3ZE2E 1XF5A 2BFVH 3HRZA 4Y19D 1IGYB 5BV7B 2AJYH 3MLRH 3BKYH 4KTEL 3BD4A 5GSVB 1G1YA 4S0TD 2DQIH 1V5JA 5B38A 1N6UA 2X4PB 5C0DA 3GMNA 1IBGH 2AEIT 3BP5B 1LD9A 3W0WA 3QIWA 1VFAB 3KPSE 2FATL 1X5XA 2D9CA 1FO0A 1LO5A 4IOIB 1S7RB 3DVGB 2BSTA 3IB4A 4DOHE 5F88A 1P4LA 1MCRA 3JUYA 3DURB 3F7VA 2QSCL 2ZSWA 1G9EA 3D25B 1G7MA 2X09A 3WFCH 5DJCA 2VITB 4OGYH 5I1HL 1FN4A 2OTUB 3LQAC 3QUYB 1RHFA 5D6CA 5IESH 3SCMD 4OV6F 5JNYB 2VDLL 4OGXL 1TPXB 1N5AA 1BFOA 2ZUVA 3UDWC 3MRFA 3GI9H 2FX8H 3QNZA 1DLHA 2V9QA 3SKOB 4RFOH 2OZ4A 2EDKA 1LVEA 2DMKA 1DR9A 1XMWA 1RK0B 1MRFH 3O3EB 3DSFL 3GZKA 4J3XA 2ARJB 3RBSA 4I18A 2YK1L 4ISVB 4HIHB 1Y18B 2B4CL 4QXUL 5C08B 1IVLA 2DDQL 1G7HA 1LP9A 3MV8A 5CLTA 12E8H 1JHKL 3N1GC 5DA0B 3HUJA 4LIQE 2BRRL 1R6VA 5JHDD 4Z78B 5K33A 3L6FB 1A2YB 3MOBL 4X8JA 5EZJB 3LHPH 2X4SA 4JZOA 3HRPA 2ZOKA 2VN4A 3H7BB 3UPRA 3SE4C 1PVHA 5I15L 3LN5B 4LNRB 3TH3T 3BRDA 3CK0H 3LEXA 1AO7D 2ZUTA 1T0NA 1RZFH 1OPGH 3TA3D 1DBML 5SWSD 5DVOA 1ZSDB 3RHWK 3G08A 5AD0B 5C0CB 1S9YB 5T1LB 2VZVA 4ZTPH 1SM3H 1QFWI 1MWAL 5DHYA 2VUOA 1XGPB 4CJ0A 3EYQC 4YHNA 1JRHH 1NAMH 4OZFH 4JY5H 4WUUA 1CDGA 4Z7UF 1BLNB 4O51B 4HK3N 1IL1A 5J4MA 1YJDH 5B3JE 1OP3K 3Q6FA 4GRMB 1NCAL 4LHUB 1WFNA 4HJJH 1MWAB 5HHOA 1Q8MA 3S5LA 3V5DB 1QLRB 2DYPD 1QD0A 2AEWA 1DBKL 4BSJA 5T5FL 4OCLC 5C07E 1FNLA 4X6CA 3FFCB 5EU6A 1ACYL 1KTDB 4QOKE 1G6RA 3GIVB 1IGML 3NIDE 4HAGA 5BW7C 2Q20A 1IAMA 3NCYS 1U36A 5D2LB 4XMPH 5CJ5A 5CIPH 2D7NA 3H3BC 3L3GB 5BV7H 5C6TH 4BQCA 2CLVB 4L4TE 5EO9A 2NW2A 2YPVL 4NN5B 3WXVH 1T66D 2ZZUT 3QEGL 4AY0A 2BSRB 1A5FH 1C7SA 1A7RL 2QV2A 1NUGA 1P7QD 5B8CA 3FN3A 5GS2H 4P2QE 3RDTB 4NN6C 3ZKXC 2X4TB 1J5OL 1DCLA 5IJVB 4KTEH 5DGRA 2R29L 2VLME 4AQOA 1A3QA 3OKEA 3EZJB 4MZ3A 2NY5C 2F58L 4XVTL 1E28A 4K3DL 4JFHD 2QADC 3TCLA 3S37L 1A6VL 1CXEA 3UPCA 4Q2ZB 5F3HA 5I1CH 2DJUA 2FATH 4MNGB 1TZIB 3BOVA 1GGCL 1FNFA 4Z0XB 1S8DA 1QSEA 3CCHA 3F7PC 2ZG2A 3FQUA 3FO9A 4N1CA 4AH2B 1BF8A 3OTTA 4HW6A 2QSCH 3OAZK 3KVQA 3WHXB 2A6JB 4O00A 3FO1A 2YHGA 5DC0A 5E6YA 5C0ND 5HYSG 4GXUN 4OGXH 4WTWA 2G5BB 4PJEB 3UTZB 4OV5B 2QQKL 1VEOA 5I75B 2ILLA 2P5ED 3IDXL 4B50A 3VMNA 4N8CL 4WTZG 5EZOL 1I1CA 1ZHNB 1U58A 1KC5L 1MVUB 1Z5LB 2B4CH 4QXUH 3KPRD 5K59F 5D7JD 1W72L 2DDQH 3VWKB 4FXLA 2DQCH 3Q3GB 4R4BA 1JHKH 1WGOA 1YN6B 2BRRH 1KNOB 3B5GA 2VQUA 3K4AA 4YPJA 4Y5YA 3BEVA 5CEYA 3MOBH 5B4MC 2A83B 3DHMA 3RUGB 4APQD 4C4KT 1BQSA 4OI9A 3OKKA 4GBXB 1EMTL 4U1LB 5I15H 1PYWA 2X1PA 1MJJA 1BOYA 5EO0A 2OS7A 2ZUSA 5ANMA 3UTTD 4KVCL 1HHJB 1PKQE 1N6QL 4NIKB 5H2BA 4E0RA 5DQ9A 3VXME 3VFWB 4XHJC 1CFQA 2R9HC 1KF9B 3GEWB 3KHQA 3CFEB 4YZFE 1MWAH 3IJHA 2VJXA 4ORGB 4D8PB 1YNTB 2R56L 3PGDA 3RGVA 2X4OB 1TITA 5FUCE 4M8QB 4MWFB 1WJ3A 3QRFM 5JIPA 1NCAH 3MV11 4FQHA 1Y6MR 1U8LB 2E8ZA 5TDNB 5TDOA 5IBUG 2W0KA 4OTXL 4Y19B 3VDBA 1J1XL 4HUVA 1DBKH 1XIWC 3OHXB 1CLYL 5T5FH 4Z76B 3BW9B 4XWOD 4RAVB 5JZ7D 1ACYH 1DBAL 5HGDB 3KPSD 1NSNL 1JGEB 3S7GA 4N90E 3N85L 1JFQL 1LE9A 3C5SA 3PWLA 1MCNA 3BZ4A 5BJTB 5EU7E 4KKNA 2IPKB 3K0WA 2R4SL 5E4EC 4H20L 2RJMA 3DMMA 2YPVH 3BISA 4LCIL 4LRIC 4OZFG 1EFXD 2CUHA 3QEGH 2Y07L 4F58L 1AQDB 4ZUSA 1T1ZA 3IU3B 5F21B 3G5YA 4OCSL 3DECA 4POZD 3SCMB 3CFKA 3LKOA 4PREA 3RNKA 5E4IA 1J5OH 3MJ6A 4DUWA 2Z91A 5DJDA 2R29H 5AUMA 4MD0B 4XH2A 4QF1A 2XOTA 5D1ZA 2F58H 4XVTH 3MGOB 4K3DH 4UUJB 1SJEB 1L6ZA 1JGDA 1A6VH 4C4KO 4JM2C 1I9RL 1ZLVH 3QSKB 3MRDB 1GGCH 4X4ZA 1I4FA 1S5IL 3FONA 3M17B 3NCBB 4PTTB 5AWNL 5GJSL 4WHTA 1D5BB 3MNZB 4CUCA 3U4EB 3O3DA 1WBXA 2FWOB 4PGCA 4Y2OA 3EO1B 3MRJB 4LCWB 5E1AB 3CFJA 2DWEB 2C3XA 4L8BA 3GRWA 4ZUVA 1CG9A 3N1FC 1IGJB 1AXIB 3ZL4L 1I7RB 3U7YL 4CN1A 1KLFA 3TVMA 4PJBA 2QQKH 5CJQL 3B8SA 3IDNA 3X12B 1CTNA 5HI3D 4FG6D 3HZMA 2FLBT 3IDXH 1AO7B 4HUUB 3TA3B 1WTGT 1JN6B 5SWSB 3GKWH 4N8CH 2H6PB 4G8EB 5EZOH 3QWRA 3MRCA 1KC5H 1OCWL 4IRSD 4RFNC 1W72H 1BF2A 1T20A 2H32B 3E2HC 3UTPD 2BVQB 3X17A 3H2WA 3QO1A 4YHZL 4IDLA 5TDPB 4QCIB 4NUGL 4UV4L 3GFUA 3L5XL 5IGXL 4X5WB 4UQ3B 2XIDA 3MBEA 4P23B 1UCTA 2KQNA 1RPQA 5E24E 3D6GA 3NIGF 4X4MA 5C07D 1EMTH 2DYPB 3VRIA 4JPKL 4QOKD 4MNHA 5BZWB 2MQ3A 3Q0HA 5GGSA 1LWRA 4KVCH 3SOBH 5CEZL 4OZ4A 4YGVB 3F58L 4Y89A 3RL1A 3PABA 1H3TA 2J7LA 1BVZA 4QHNA 2BMKB 1TZHA 4TQEL 4HZLB 3CVIH 5MEQA 5ALBL 5BS0E 4YHLL 1FG2B 4LLDA 2YD9A 1FH5L 4LSVL 2R56H 2X5PA 4HMEA 3W39B 5EN2A 3VXPB 4MNQA 3PE9A 1YN7B 5IW1A 1P7QB 1EBAA 1DUZA 4LPCA 4QO1A 2FGZA 3RKDD 4PJEF 2R8SL 5GS0D 4OTXH 2VLMD 2LE9A 1T89A 3MGTB 4OUUB 5C0JA 1LGVA 3UYPA 1P7KB 5HDBF 5DDHB 1CLYH 2DKUA 3VGHA 1TQBC 1DBAH 3S36H 3TPUA 2XA3A 3HTLX 4NC2B 1NSNH 4ZOAA 3P77B 1FZMA 1JFQH 2JK5A 3AAZB 4HS8H 7FABL 4QHLA 5EBMA 3GSXB 2R4SH 1SYVA 4H20H 4X83A 4H1LH 1INEL 4ZPVB 2A1WL 1WT5A 4LCIH 5IW6B 4HEME 4WV1B 2DKSA 43C9A 4F58H 2Y07H 4YBLC 2X9XA 5DT1L 4UDTA 3SY0A 1QPXA 2J4WH 3HG1E 4OCSH 2EH8H 1AR1C 3TO4D 5FGCE 1MUJA 1CDIA 5GS1B 4AYFA 4P5MA 3SKMB 3JWNC 2LU7A 4LLMB 4RGNB 2NY6C 2ATPB 2AEPL 5CP3A 2P5EB 3O41B 2V5TA 3P9MA 2V9RA 5DF0A 4R97B 3DBXB 1KJ2A 4RNRA 2BHYA 1I9RH 1D5XB 2XG5A 4X6DE 3KPRB 5AWNH 5GJSH 1S5IH 1BFVL 4X0KA 1N4XH 4OCYL 1OAYL 3WSQH 5C8JB 5I1GL 1VERA 3UTSE 1L0QA 5HDQL 5KS9B 2EDXA 4HDIB 4U33A 3U9UA 4I2XA 4L4TA 5E7FA 3WS6C 4LSQH 4U1JB 3NFNB 2CKNA 5HDOA 2YPLA 3ZL4H 3PIQA 2E27L 5T5NG 3S96B 3U7YH 4EI6A 2BNQD 2FJHA 1I8KB 3WEXB 3GSVB 3N1PC 5EUKB 4P2QA 2YWYA 3RP1A 5E94A 4GKZA 3RBGA 1FSKB 2DTML 5JA9A 3VD3A 4OFYD 4XNQA 2BVPB 1VA9A 4HHAA 5FDWA 3SKNB 1OCWH 1RY7B 2OR9L 2R2EA 3G5ZB 3O3BB 3OWEA 2E6PA 3REWB 3SJVB 1EJOL 2FNBA 4M7LL 4NO0A 1JZ6A 4NFCA 1M6OB 1QP1A 1DQJA 4WU7B 3EGSB 1SBSH 3RAJH 4FA8A 1QO3A 3PNWA 3RWIA 4UV4H 4PR5B 5FFLA 3L5XH 4FTVE 5DJ6B 5IGXH 4I0PD 2Q76A 5JW5A 5KAQF 2J8UA 2OQJB 2QQQA 4W68A 3G6DH 2ZCLL 3JV5A 4HZAA 2FCBA 1K5NA 3F65A 4JPKH 1NBVL 5F96L 5DFVC 3ULSB 5ITFA 3QXDB 4LAQL 4N90D 4W70A 5CEZH 3RZCA 1U8KA 3F58H 4ONFL 3PWVB 1OSZA 1XCTA 3R0NA 1FVEB 4F7TB 3F8UB 2Z9TA 3HFML 3QA3B 4HK3J 4RFEA 4DKEL 2J8HA 1OL0A 1BBJA 3ARTA 2Z8WC 1MHPL 4DOHB 5ALBH 1IEAB 3FAXA 2YKLL 4H8WC 1FH5H 3HC0A 1I85C 5SX4I 2AV7A 1N0LA 4GG8B 2Y23A 4GAYA 4ZUWA 2ITDB 1OP5H 3NPSB 4L5FL 2WANA 2C1OB 2R8SH 5MERA 3NCMA 2JB6A 1DBJL 2C1PB 5ENWA 3UJIL 1NDGA 1UKQA 3RPIA 3Q1SL 1UJ3A 3DX9B 3ZHLA 4JZJA 3GJFH 2R2BB 4P57A 3O6FD 3MRPB 2NZIA 4G42B 5ESQA 3T0EC 2HVJA 5TH2A 1J05B 5EULV 4JRYA 7FABH 1QACA 4FHBD 2AXGB 5HHQB 3NTCH 3QJHA 2OSLA 3VXMA 4QHUA 2Q87A 4U7SA 5CJBA 4U31A 1INEH 2A1WH 2APVA 4N9GB 4LVHB 2HKHL 2R1XA 2XWTA 3HPLB 1PEWA 5DT1H 1A1MA 4MXQC 5DTFB 3OL2A 1QSFE 4G8FA 2XNAA 3MSPA 3EFFA 1BQUA 4LASL 3GBMH 1RK1B 2SEBA 4X9HA 3IFOA 5JLZA 3VD4A 4ACPA 1VACA 1VFUA 2AEPH 4KRPC 1T83A 1HHGA 4G6ML 1ZXQA 1BZ9B 1BVKB 5DRZB 3WNKA 3EO0A 4XBPB 2EDQA 3EDFA 5EO1A 4WTXA 2ORBL 4NQCA 4JFEA 1LEIB 2JIXD 4IRSB 1KT2B 5F7YC 4EXPX 3OB0K 3RVUD 4C56A 5GZNC 1BFVH 4X9BA 3DNKA 1U2HA 4OCYH 5INCA 1S5HB 3FOLB 1OAYH 5I1GH 2UUDK 3C9NB 5HYSA 2ZUQB 4H1LG 4ZUUA 3D3VA 2FECL 5I1AB 5KANG 1A4JA 5H8DA 3BQUC 1E4XH 5F1NB 3QDGE 3MREB 2VLRA 4OJFL 1UH4A 1WC7B 2NY3C 5JXEA 2E27H 3DYPA 5CWSA 5C70A 3E3QE 4QOKB 5CAYB 4Z7UA 4PP1D 5D1QC 1NMBL 3RY6C 2JLLA 4MMXC 1AKJA 4EUPA 1I8LA 2DTMH 5LBSL 4XNUL 4NQDD 3BHBA 4U1NA 3FT4B 3QFJA 2VWEE 4R7NB 2OR9H 3O4LE 4IMLB 4WI8A 3JTTA 4M7LH 4GRWE 1ES0B 3DX7B 2V5MA 4LPVA 3GBLA 5FCUL 5ITBH 1A3RH 2AQ3A 3T04D 2A9ML 4MVBC 3OJMB 3TT1L 4ZXBA 1V3LA 3ARFC 3L3HB 1DEEA 3PHOB 1CZ8L 1Q9LA 1I9EA 4MB3A 1FYHB 2ZCLH 3MJGX 4H25B 3QDME 5DSCA 1A1OB 2CKBB 4MYWB 1NBVH 3BEWA 5F96H 2EZ0D 1OF2A 2MMXA 4LAQH 5D2NA 4LCUB 2W65B 3I75A 3TBTA 1OP3H 4KKLC 4ONFH 3H0TA 1BVLB 1IGTA 4EN3A 1RZJL 2VDRL 2Q7NA 1M7DB 3HFMH 3MJ9L 4DKEH 1RSFA 1MHPH 4XHQA 4PP2A 2YKLH 3VXOB 1P1ZB 4B7IA 1CE6A 5KS9F 2E5EA 5HHPA 5E5UB 3E6FA 3HG1D 4Y4HB 3PWPB 4WHYH 4NQEE 2X4NB 1OM3L 3WIIL 3QWOB 3VGAC 5HGHA 4L5FH 5D1XA 5BRZB 5IP4A 4UBDC 4HWNA 5JO5A 3HR5B 3HNVL 3OGOE 2WQRA 1FQ9C 1DBJH 2DM2A 4YFLF 3UJIH 1D6EA 4UZGA 3SDCA 2PR4L 1FHGA 2WBKA 3Q1SH 4YHPB 5EPMB 3OJDA 5KOVC 1KIQB 4WWID 4NM4L 4U1SB 4NKMB 1NCDL 2NY4B 2NYYC 1U8MA 5HVWA 1OB1A 4R3SB 1NAMA 4OZFA 1SBBA 1F11B 2Y4SA 3VXNA 2HTLC 5J1TC 1FVCA 1C12A 4TYUA 3MJ7B 3AS0A 4I0KA 3VI3F 4HMCA 2NTFB 4GFTB 2X05A 4WI7A 4O4YL 2I24N 5BS0A 2HKHH 1JNHB 5SV4A 2LVCA 5F89A 3L9RA 3G5VA 4RGOL 4HEPG 2A0LC 5IFHL 4LASH 1R5IB 2BNQB 3VXTB 4TUOB 1TZGL 3JV4A 3JSSA 5DD5L 3ARBA 1F02I 4MXVE 2ZUUA 2VQTA 4RDQF 5F93C 5EB9A 1WF5A 3RHWF 3SGJA 4G6MH 3IYLW 4NN7C 1J8HA 4WWKC 3OAZH 4YDJA 3TPKA 4Y4FD 2F53A 4O02L 4XBEL 1IT9L 1X6LA 4NKIL 3L3IB 2F8OA 1JWMB 1DQDL 4HWZA 5GSVA 6FABL 3KXFE 3PWJB 3H42L 3KPQB 3MLWL 1OWRM 4CGTA 2AJZB 2K7QA 3BESR 4GUPB 4BSVB 4WW2B 1EK3A 4FTVD 5C71A 1JHLL 3OKOB 1VFAA 2YSSA 1CICB 3MJ8A 4I0PB 2BRQA 3RL2B 4OJFH 4YDVA 4NCC1 1DDHB 1QLEL 4IOIA 5T1KA 3ZHDA 3DVGA 4U6HA 3ZKMD 4JFQB 5KTEL 2IC2A 1JRHI 4PBWD 3QEHA 4R7DA 1AXTL 1CDJA 3TJHD 3D25A 4OF8A 4OLUL 1NMBH 5L88L 4M62L 5KOMC 2OTUA 3QUYA 5LBSH 2HLAB 1QRNB 1FIGL 5ILTL 3E8UL 3SKOA 2R0ZL 4JPIA 1NGYB 3S3SA 1X6NA 1PX4A 1EO8L 3O3EA 5E6IC 4U7KA 2ARJA 2VXVL 3LRSA 2A9MH 5LJYH 2DIJA 4ISVA 3UTSA 4AEFA 3BGMB 2AXHA 2HJFB 2NXZD 5C08A 3TT1H 3PDGA 1CZ8H 3NVQA 5CFHA 4PLJD 5DO2C 3NCYP 2LTQC 4GLRI 5KSAD 3JTSA 4G7YL 3O6FB 3BKML 3L6FA 1A2YA 5D7IE 2CRIA 5EIQA 4ZSOB 4LLQB 1QFOA 3QFDB 1CDHA 5EZJA 1IAIM 1RZJH 4HXBL 3H7BA 3MJ9H 2I07A 3LN5A 3HE7B 2WLZA 4AIXA 3MZGB 1TCRA 4BKLB 3RQ3A 3LS4H 1ZSDA 1QSFD 3ARDC 5I74C 3KG5A 4IJ3C 1OM3H 3WIIH 5AD0A 1VEPA 3LPWA 2JJUA 5T1LA 3AREC 3IJYB 3HNVH 1RFDL 2FIKA 4YHYB 2PR4H 1KXQE 4C58B 2NNAB 3CXHK 1WWCA 4GRMA 4K7PX 4PG9A 4NM4H 3V6OE 4M61B 2X1QA 1NCDH 4LHUA 2GITA 1MWAA 3BE1L 3O8XA 1MHEB 3LEVL 4Q9CA 3V5DA 4H5SB 1LO3H 1S7SB 4OKDA 4JO3L 5JW4Q 5FYKL 1KTDA 5JDSA 3CJJA 3GIVA 3P0YH 4O4YH 3V7AG 4DGVL 3S4SG 2P5WE 3QDGD 2OMNA 1TTUA 4U1MB 2HFFA 1MY5A 5DJ8B 3G04A 3MV01 4WHYG 1HH6B 4RGOH 4ODSL 4Z7NE 4LSSL 5IFHH 1ZOXA 3L3GA 1TZGH 2CLVA 5DD5H 5J6HA 5CUSL 4KVNL 2BSRA 3DUHA 2BNRB 3W11D 3RWEB 2JJTA 2VLJA 4NQDB 2CH8A 4NBXB 4O02H 4XBEH 5J12C 3RDTA 1IT9H 1TJIL 4NKIH 4K9EL 2NX5E 1NCCL 1DQDH 5E8PA 3KPPB 6FABH 4HT1L 4I77H 3TESA 3H42H 3O0RH 2VZOA 4UMGA 3RWCB 3WKML 4ZOBA 2AP2A 5L6YL 3UO1L 1IGCH 2H26B 4NQTA 1JHLH 1ZGLA 2Z92A 4Q2ZA 3IDYB 4LKXB 5KVDL 1CT8A 1CYGA 5J3HD 1TZIA 5LAXB 3LPFA 1G7JB 3QDMD 1QLEH 1HIML 5KG9A 2GSGB 1WAAE 2WP3T 1N8ZA 1AJ7L 2AJVL 3LQMA 5CILL 5FYLE 4AH2A 4NSKB 1AXTH 1SJXA 4OLUH 2VB5A 4Y5VB 4UIMB 5F3BB 5L88H 2A6JA 1AY1L 1TVDA 5E5RB 1FIGH 1MAML 3X13A 4OV5A 5ILTH 2EXWC 4EDWL 4PJ5E 4PS4L 2AJUL 1H5BA 3FT2A 3QIUC 1AFVL 3E8UH 2R0ZH 3WFZA 1DANT 5HPOA 4Y16C 1EO8H 1ZHNA 5E5MB 2VXVH 4S11A 3QBTB 4C83A 1NQBA 2PXYC 5FGCB 4NKOB 1MVUA 3X3GH 5FYJD 1B0WA 1OAZL 5IEHB 1D7FA 1Q0YL 1VB9A 4X7TB 3Q3GA 5D7KE 3RTQC 1KNOA 4N68A 4G7YH 4L1HA 3V7AE 2DQHH 1W72A 2GJ6B 2PN5A 1MAKA 4ZO8A 5I8KL 4HXBH 4U6VH 3FQTB 5DFWH 4B7LA 4GBXA 2CDFA 2EEBA 4KK8D 2NQCA 2GUOB 5DWUL 1NMCC 3ETBF 1R3HB 4PGBB 2YA2A 4WW2F 1EEYA 2FLRT 2DLGA 3CDGA 4LBEB 4FFVC 3VFWA 1YEDB 5T33H 4MX7B 2IMNA 1MIMH 2EYSA 2HT3C 4FQPA 4ORGA 2AK4E 1RFDH 5E8NB 4P59L 4LVEA 4ODUB 2ITCB 2DB8A 4Y5XB 3VFVB 4FQXD 5FO9B 4M8QA 4MWFA 1NH6A 2OXGA 4PRIE 2IBZX 4YUEL 4NNXA 3ARGC 3W5NA 1U8LA 3LKNB 3BE1H 2WP3O 5TDNA 1A14L 4JY4A 3KXFD 4HUWB 1FL3B 43CAA 1CBVL 3MRRB 5I66B 4HIJB 2NY7L 4JO3H 4Z76A 3BW9A 5C9KA 4MD5B 4Q97A 2O5YL 4BYHA 4DGVH 4NCDA 1MCQA 1JGEA 1BWMA 4ZS6D 2B7DT 2V7NB 5ERWB 5A2JH 1TXKA 5BJTA 4FFZL 4ODSH 4LSSH 5GGVH 2B5IC 2GAZA 3CSYA 4NQEA 4DEPC 4W4OC 4GKNA 2ZG3A 4KVNH 1U93B 4CADB 1LK2B 4KC3B 4G43A 2OI9B 4GSDL 3PF2A 1JUFB 4LCCC 4K9EH 4H1LA 1NCCH 3LN4B 2VN7A 2VH5L 1ONQA 4YC2B 2X4RA 4ZFFB 2H9GB 3I6GA 3WKMH 3MGOA 3QI9B 4UUJA 5LXGL 4L3AA 5L6YH 3RNQA 5I6XB 5ABDE 2EC8A 5HYJE 4RX4D 5KVDH 1JHTA 4MQXD 4TNVF 3X14B 3CSGA 1HIMH 1D5BA 3CX2A 3MNZA 4M1CC 4Z7WB 4U6TA 5E00B 2E9IA 3ULVL 1AJ7H 2AJVH 1U3HD 5CILH 2FWOA 3EO1A 5HDLA 5KSAB 3MRJA 4LCWA 1HILB 5E1AA 1RUQL 2DWEA 3HB3C 1IGJA 5DVKA 3ZDXF 5AAWA 1NFDE 5ESAB 1UCBL 1MAMH 1F3JB 3EYQD 3X12A 4PS4H 2AJUH 1AFVH 4F15B 3VRLF 1IEHA 2LABA 1WK0A 2KKQA 4HUUA 3DO7B 3NCCB 2H6PA 3LRGA 4JKKA 5GGUA 4G8EA 2C3VB 2J6EL 1AQKL 2NY2D 3PQYE 1X5YA 1Q0YH 1CR9L 3N0PB 5C0IB 2X70B 4JAMA 3OKLB 3SO3B 5E2JA 2K3TA 1FFNA 3G6JE 4QCIA 3ZO0A 5KANI 5L0QC 3I3EA 4N0UB 4L1DA 1YA5A 1H15B 3N1MC 5MP6L 1JYXA 1QHPA 1L9NA 4JM4L 3OF6D 3CMOH 3U30C 5I8KH 3DUUB 4P23A 4NZJA 3KPMB 1HKLL 2EXYD 4DUVA 2DYPA 2EE3A 2YD4A 5HHMB 4Q9QL 1GRWA 1H8OA 1X5KA 4MLSA 4RMWA 4LOUC 5CS7A 4BQ9A 5DWUH 3O6KL 5A16B 2P5WD 4XCEA 1YNKH 3GI8L 5ICYB 3NN8B 1SJVA 1P9MA 1ED3B 4XC1L 2XQBH 4YGVA 4QRRE 5CGTA 2BMKA 5A2KH 4KHTL 4PJ7B 2EDLA 3VFNB 2DM4A 3T65B 1FG2A 1KIPA 2CDGB 4GG6F 4U1GC 2FEDD 3JWOC 4P59H 1BOGB 3WFDL 4O2FB 3W39A 2P44B 3VXPA 3EIFA 2IPUK 4HBCL 3KYKH 4IEFB 4FP8L 4YUEH 1FE8H 1X7QB 2NX5D 1VGEH 3UTOA 1A14H 5TGBA 5IHZB 3UJJL 3MGTA 4GRWB 4OUUA 5JDJA 1CBVH 3WDHA 1P7KA 2EDRA 2NY7H 1I7TB 2XKNB 2G60H 3B3IB 1CDYA 1EGJL 4RQQA 3P77A 4M6NL 2BXZA 3AAZA 2XICA 3IFLL 5IB5A 3BZEB 3R06A 4FFZH 4HJ0D 4LPUA 2YRLA 3OB0H 4OZGE 4LAJH 5FYLD 1CDBA 4DK6A 4UAOC 5EIIA 4ZPVA 2UUDH 5FYJU 4WV1A 1W0VB 3NACL 4GSDH 1XGRA 4PJ9B 3QDHA 4YQXL 3RVVC 4PJ5D 4OI7A 2WIIB 5GS1A 3V6OA 1SY6L 3SKMA 4BUHA 5F1IB 3MXWL 2VH5H 2H2PD 3PWNB 3GHBL 4V2CB 4L8SB 1M4KA 2OJZH 3GSQA 3MCLL 2BOBA 3O41A 5LXGH 2ZSVB 3BKCH 3EHBD 4Z7VE 1NGWB 4J7RA 4J3TA 1PW3A 5E8OB 1D5XA 3VWJD 3OXSB 1FZJA 5IBLD 3CMGA 3ARRA 5D7KD 4MA1C 5C8JA 1UFUA 4HSQA 5JIIA 5IOPA 4NRXB 3ULVH 3ZYIA 2DM3A 1X5AA 5KS9A 1C08A 4PJCF 2BVTA 1RUQH 2P8MA 3VU2A 1BFTA 3S96A 1UCBH 1QHOA 1XH3A 3QXTA 1I8KA 3GSVA 5EUKA 3DI2B 1IM9D 4U1KB 1AE6L 4NWUL 1TVBB 2NY0C 5CEXB 2NXYB 1KLUA 3QQ9C 3IXTB 4MQ7B 2LAGB 2J6EH 2BVPA 1F6FB 1TETL 2AK4D 3SKNA 3G5ZA 4QRUA 3REWA 3SJVA 4ODXB 4MAYA 5SWZE 1CR9H 2YRZA 1A9BB 4BFIA 4WU7A 4ODVL 3QIBD 4ETYA 4JG1L 1E0OB 2MOVA 5MP6H 4Y4KC 5DJ6A 1A4KB 4JM4H 1FNEB 2OQJA 4BH8A 1RAMA 1ULVA 1ETZA 3LQAL 3KXFB 4OLEA 5F7WC 3MUGB 1FL5A 4Q9QH 1CDCA 1AHWC 2W38A 3O6KH 4X7SH 3GI8H 4JFPA 5ADPL 3ULSA 3QXDA 4CVXB 2GT9B 4TPRH 3ZDXE 4XC1H 4Z5RB 1JPGB 4P49A 3PWVA 1I1AC 1FVEA 3MZTA 4PJIE 4GQ9L 3UYOD 3QA3A 4KHTH 3S88L 4Z7WF 3CXDL 1IEAA 4J4PD 4KZDL 2IADA 2HFEA 3DWTA 2D4DA 4LLVA 4GMTL 3WFDH 1HQRB 2W91A 2ITDA 4HBCH 2XPGA 4YFLI 2DOCA 4JM2D 4FP8H 2C1OA 5JUEH 3QUZA 1JF6A 4QHKJ 3VWKC 3ULVF 4U6XB 3S4SA 3UJJH 25C8L 1ERNA 4XCNA 3BJLA 2IAND 4LDOB 3WJJC 3DX9A 4JDTL 1JZ7A 2R2BA 3MRPA 3LAFA 4G42A 5HYJD 1EGJH 5CBAA 1IAII 4S1DD 4DGYL 3IFLH 3GDBA 2AXGA 5HHQA 4CJ1A 4KK6D 3CUPB 1RMFL 4N9GA 1U3HB 1DANU 3GSOA 4KKCC 3RWJB 2RB8A 2VDQL 4OZIE 3E0GA 3NACH 3R1GL 4KK5C 3MUZ1 4BFBD 1UXSB 2A6KA 4NNYA 5DTFA 4L4VA 4YQXH 4HV8B 5C86A 1XF3B 3D18B 1RK1A 1TFHA 1SY6H 5DLML 3MXWH 4CDGC 1JL8A 3L1OL 1VADB 2VIRA 1WEJL 3GHBH 4L4JA 4LLAA 4PBXA 1NCNA 3MCLH 3OKYA 3FL7A 4F7EB 1FFRA 5CZXC 1YY9C 4TSAH 5DRZA 5A3IC 4XBPA 3PQYD 1FC2D 4PJ7F 1LEIA 1KT2A 5IIEB 2VQ1A 4UNVA 2H2SD 1S5HA 3FOLA 3HNSL 3C9NA 3KYNB 1GZQB 2X4QB 5E03A 4MJ2A 3SE3C 2C9AA 3FT3A 1GOGA 5I1AA 1OAQL 5LG1A 5EIVA 1RZGB 4I4WB 5F1NA 5FA3B 2J1KA 1WC7A 1F8TL 2AVGA 4A6YL 1LEGB 3QXAB 3DYOA 3TBSB 1AE6H 4QRRD 3HN3A 5DQJA 3ULUE 3ET9F 4QRPA 4QXTA 3ZYZA 4HKZA 2NY5L 3P4LA 3IDMA 3SCMC 1GGIL 3WNNA 1TETH 3UAJD 1F3DH 1SJHA 4NN6B 4R7NA 4Q9RL 3KS0J 3UBXG 3ILQD 3OAYK 4FMKA 3ARYA 3DX7A 1PZUB 4ODVH 4MHHI 4JG1H 2QADB 4L3CA 1U8NB 3VI4F 1KEGL 4YXKL 4I3SL 4KI5E 5T3XL 3KPLB 5EBWB 3CDYA 2NX5B 2E7BA 3MCKA 3L3HA 3PHOA 1Z9LA 1FLTX 4MCZA 3LQAH 3KGRA 3MC0A 3ZKSD 4H25A 3GSNL 2DLIA 2Y6SC 1G7LB 3B2UD 2Y9RT 4DN4H 5E9DA 2YUZA 5DURB 5ADPH 3MOAL 2DN7A 5ACZB 5F7NC 1BVLA 3WFEL 4GQ9H 1M7DA 3S88H 2A2QT 5GGTL 5J1AA 2YZ1A 4WO4A 4J23A 4H0HB 1RULL 1P1ZA 4JFFB 5CHNB 1O7VA 4GMTH 3TA3C 2CMRL 4Y4HA 3PWPA 4ZMAT 2X4NA 4LF3B 3MJ9A 2J88L 2FECI 5FGSA 4OM0L 5BRZA 4JFZL 5HJ3A 1X5LA 3KLAA 4X8XA 5C0EB 25C8H 4R0LA 3RIFK 2X6MA 4PRDB 1WQVT 4YHPA 4JDTH 2F5AL 4FOMA 1KIQA 3CH1B 1IGFL 5GGVY 3T0XA 4U1SA 3QCUH 4NKMA 4DGIL 2XTJE 5GRWA 1DQQB 5HI4D 4ZFOL 1UYWL 4DGYH 1CN4A 4R3SA 2VABB 1F6LL 2PYEB 1KLGB 3VWJB 5CJXA 1F11A 5KSUB 1ORSB 2ED8A 3H9HB 3STBA 3MJ7A 4R90H 3WIHL 1RMFH 2G75B 4G8GE 2H8PB 2P24A 5ECJE 2VDQH 5TQ2L 4D0DA 3R1GH 3WE6B 3OG6B 2VTFA 2RGSA 2VZTA 3G5XB 1UH2A 3QAZB 1HDMB 4TUOA 4BQ8A 3IFPB 1WEJH 1T66C 4Z6AT 4NZUL 2X7LB 1CXHA 5D93B 4YFEA 3ROLB 3C5ZD 5SWZD 5LCVL 1NBZA 3L3IA 1II4E 1JWMA 5DK2A 1C5DB 4ERSL 5JMOC 3THML 3PWJA 2FHCA 4V2BA 3HNSH 2AJZA 3M1BB 3DXAE 3PWUB 5BCAA 1R3JA 3QIBB 4GUPA 4FZEL 4P5TD 4WW2A 2O5ZH 1MELA 5I2IB 5IHLB 4L3EE 1A22B 5B39A 5I1DB 1VKXB 1OAQH 4B53A 3RGVC 3ROOB 1CICA 5FUZL 4JRXE 3RL2A 3PL6D 1BD2A 4DW2L 4A6YH 5ID1B 1JGLL 4NT6B 5DJZB 5F9JB 2A74B 2A73A 3LOWA 4ETQB 2FB4L 5CBEB 2NY5H 1CQKA 3C6LD 4EI5D 2HLAA 3UCRA 5A1AA 3WNMA 1QRNA 2ZKHH 4UQ2B 1GGIH 2B1AL 5C0NC 1L4IA 1FL6A 5L2KE 2DQTL 1YPZE 4JHWL 3OAUH 3SDDA 3FO0H 2HA1A 1NGYA 4P9HC 1ND0B 4KH2A 4Z7OE 2G5RA 4R97C 4HGWA 2VAAB 1KEGH 4I3SH 5T3XH 4JM2B 3BGMA 2HJFA 1T21A 5D7JC 1Y0LA 5EU4B 2DJ4A 3U9PL 1A02N 3GSNH 2IANB 4CW1B 4RAHA 3HI1B 5J1SC 3B43A 3MOAH 1AC6A 5HYJB 5FIEA 1T3FA 4LLQA 3HE6D 3WFEH 1PZ5A 4APQC 5JOFB 4P5KB 1KJVB 1TQCC 2LQRA 2YXFA 5GGTH 3K4DA 1WVZA 2CPCA 3HE7A 3K8MA 2D3VA 4PJGF 2ENSA 2VR4A 4BKLA 2IBBA 4KRPD 1P7HL 5HTSA 1JK8B 1Q9KB 32C2B 2CMRH 3C8HA 1DJSA 1NLDL 2J88H 1MCIA 1NFDB 2E7HA 2FR4B 2Q8BL 2FH6A 4AIOA 1MRCL 2V7HB 4RFNB 1GCFA 4JFZH 4ZQKB 2RFXB 3E2HB 4V1DB 4D3CL 2I25N 3PXJA 3O6LL 2MPAL 3IRPX 3GSUB 2VSDA 4QY8B 2F5AH 5DJ2B 4YHIB 1IGFH 5JR1L 4DGIH 4M61A 3ZYOA 3BH8A 4K7PL 4JJHA 1UYWH 3TZVC 1NBYB 3MYZA 3FTGB 3WIHH 3TBWB 3U2SB 4XWOC 1X3DA 2PO6D 4NJAL 4KHXL 5TQ2H 3QWQB 3SEPA 5FO7B 5DJ8A 2VLKE 5HY9A 1HH6A 1DVFD 1U92B 2D7TL 1OHQA 2M8XA 5JXAL 5I16A 1T22B 4B5EA 4L9LC 3OG4B 4WGVB 3KDMB 4PJXF 3BD3A 3MBEC 4OBRA 5KBNC 3ULUD 2EYTB 4NZUH 2BOCB 5C7XL 2BNRA 3SDXF 5FOBB 4BK5A 3RRQA 3KWWB 4MJ6B 4NQDA 3NPSC 4P3DA 4POZC 4HMDA 4UU9A 4JANB 3EJZD 5LCVH 3KPOA 1FFPB 4K3EL 3AM8C 4ERSH 3KPPA 3THMH 4XPFL 2IQ9L 4OLVL 5IFJB 3RWCA 1QFUL 1TQBB 1KB5H 4FZEH 4KI5D 1T2QL 2H26A 5IB2B 2VO5A 4CMMB 1NJ9A 4EJ1C 2GJJA 5FUZH 1LDPL 2IH1B 2DLFL 1G7JA 4PBVC 2GSGA 3WDJA 4DW2H 3O11A 4GG6A 2A9NL 4NSKA 5F3BA 4YBLB 1UACL 1P2CB 2FB4H 1Q94A 5LQBL 3VRJB 3IKCB 4M4RA 1WIPA 3LIZL 3OV6A 1G7QB 2B1AH 4L8DA 4OZGB 4P46A 1VDGA 3DOSA 3VFTB 4HUNB 3WCYA 4NKDB 2DQTH 5DRNB 4JHWH 4X5XA 5I76B 1KCUL 1YEGL 3OSKA 2I9LA 1F4WL 1MJ7L 5JOEA 2N56A 3TC9A 4XX1G 3MLXL 2FBJH 4KFZC 5E5MA 4FXKB 4IRSC 1BGXL 1OQXA 2R2HB 3SKJL 1JMXA 1Y6KR 3TCXA 5IEHA 5KW9L 4D9LL 3K2MC 3U9PH 1B4RA 2DQJL 2ZUQC 3H9SD 4E42A 1GOFA 2E7LC 1MAJA 5SWQB 3WL9B 4K3GA 3QHFL 2GJ6A 1S7XB 5FK9B 2V5SA 3EJJX 3OPZH 3P3YA 4NQVB 4D0BB 3CFCL 3V5KB 3DRTB 1ZLWK 5IJKA 1WBZB 2YOCA 2DQEH 4ZAKA 1KFAL 2GUOA 1R3HA 3U82B 5F7LB 4KV5F 1GYAA 4KJPC 3ZTJG 1B0RA 1NLDH 3O4OC 1HSAA 1PG7H 2Q8BH 1MRCH 5DUBA 2V5YA 3CVHL 5KSBE 1K85A 5ICXA 4PLOB 4D3CH 3O6LH 1VCAA 2MPAH 3M07A 3EYSL 3QZWG 2J12B 1ZHLB 3O3UN 2F54A 5E8NA 1OSPL 2YD1A 3BPCA 3C5JB 4WCYL 5DHVH 4PY8I 5JR1H 2AS5M 3MLYL 2VLLA 3ZSTA 4PJCA 3OZ9L 1YQVL 3K80A 3RX8A 3LKNA 2OTPA 3JVGA 5ETUB 3RKDC 3VXRE 5A43C 5GS0C 3D85B 4OQ1A 1FL3A 1BPVA 2BSSB 2CDEB 3MRRA 2OBGA 3Q6GL 5I66A 4HIJA 3DXAD 4U0QB 1A7OL 1U3JA 5IVXE 4PGZA 3QUMB 4MD5A 3NGBC 5DZNA 5EZIL 4L3ED 3SQOL 3VFRB 4H8WL 3GMRA 1DUYB 4P5TB 4BSWA 1AGFA 4KHXH 4K71B 3V4VH 4JRXD 4JQXA 5MEPA 4JM2F 4IRZL 5ERWA 2Z31D 3D39E 1MHHB 2D7TH 2ADIB 5JXAH 2ZCKL 2I5YL 5EU3B 1ZGLP 1DFBL 1U93A 4PJFE 4CADA 1LK2A 2HWZL 4XXDB 5C7XH 2DQUL 1PEZA 2EDBA 4XX1E 2Y72A 3LDBB 3C6LB 3NAAH 4EI5B 1JUFA 3P4MA 5L2KD 1BJ8A 2DQFA 3KLDA 3TO4C 2Y7QB 4G9DB 3MFGB 3LN4A 1KPVB 4Y2DD 5AYQA 5IROC 4K3EH 4XPHL 5IV2B 4XPFH 4DCQA 5MHSE 1CGWA 4ZFFA 2H9GA 3QNYB 4NHCL 1MCBA 3QI9A 5FF6B 4JGJA 1QFUH 2EDHA 3VXSD 2CIIB 1EHNA 1T2QH 4EQ2A 4M43H 4QRSB 3IXAB 4G8GA 1LDPH 1HWGB 1TTFA 2DLFH 3X14A 2ADGB 4QTHA 2IF7A 5E00A 1E27B 2R2CA 1VSCA 3DROB 1X4XA 4XNMB 2A9NH 1QQDB 1FFOA 3EYVB 4WU5B 5KSAA 2B1HL 3E1F1 3CU1A 3UBXA 1UACH 2AV1A 1A3LH 5LQBH 3VFMB 2EIEA 4DKDC 3LIZH 1TJGL 3ARED 1QFHA 5ESAA 1C8PA 5C2BL 1WWAX 1ZANL 3DIFA 1N2RB 1DLFL 1KCUH 2FBOJ 5DD6A 1ZT1B 1YMHA 4OZHE 4KRPB 4F8TA 1F4WH 1N7MH 5C3LD 1MJ7H 3DO7A 2BJML 3MLXH 2VYRE 3B9KD 5DJAB 2ED7A 3PGCB 1DN0B 4EVNA 1OGAB 1BGXH 3SKJH 3P4OA 4W4NA 1BECA 3FB6B 1MF2L 4D9LH 5H94B 3W2DL 5FUCC 1IGIL 4PRHE 3OKLA 2DQJH 3MCG1 3LCYA 4K7FB 2J6EA 4WI9A 4N0UA 1H15A 2N7AA 3BQUB 1ADQL 3MRBB 3QHFH 3T8XA 3MV9E 3RX5A 4I0PC 3EYOB 5I19L 3DUUA 3ARUA 3R4DA 4P4KD 1MI5E 2NY3B 3KPMA 5CJ8A 1KFAH 3MUHL 5HPMB 5A16A 5ICYA 3NN8A 1ED3A 5D1QB 3I02A 3C60A 3O2DL 1NC2B 1B90A 5EU7C 1YEFH 4PJ7A 1UZ8B 3U79A 1DVFB 3UBXI 3I3BA 3VFNA 3T65A 3CVHH 2CDGA 1RJYA 5DYOB 2VAJA 2ADJB 2XWBB 1P69B 1WCQA 2JCCB 3ZSSA 4O2FA 5ISZB 3TF7C 3NABL 4WCYH 1EEUA 1RURH 3JBG7 4PD4K 1BP3B 3MLYH 4X4YB 4KUCF 1YQVH 1X7QA 4NZTL 1O7SA 1Z0NA 1IZKA 3ARFB 5IHZA 2IPUG 3QEUB 3OKMA 3WXWH 3RWGA 3Q6GH 1SYSA 1A7OH 3T1FB 4KTYA 2XKNA 5I71C 3QRGH 4OLXL 3B3IA 4U49A 3ABZA 5EZIH 3SQOH 3MLSL 4H8WH 3RWHA 1A6ZA 3L7FB 4IOFC 1I8MA 4IRZH 5B38G 4PRAB 1PBYA 4I8DA 4I48B 2VL5A 3UROR 1MCWW 1NEZB 5JW4M 4XRCA 3T4AA 5FUOL 2ZCKH 2ESVA 5D7SH 2I5YH 3QIUD 1U0QA 1EGJA 2PTTB 1DFBH 1W0VA 4F9PC 1MFCL 2HWZH 4OLYL 2DQUH 3IETB 4PJ9A 3VGAB 5GS3A 3FO2B 4M5YL 2W60B 4H88L 3F12A 2WIIA 3OJ2C 3BUTA 3KYAA 4YHYC 4HKXB 3FN0L 3PWNA 4GW5B 5KN5B 1FJ1A 3JV6B 4L8SA 4XPHH 1JWSB 3HCVA 4NHCH 1FBIL 4JHZA 4OF5A 1IC5L 3QDJE 4JR9L 4X7CC 4FN0A 1SY6A 2GQHA 4FQJL 3H3PL 4YLQT 5I1IH 1G7PB 3MA7B 3RVUC 1RZIB 5F7UA 2BHZA 5L2JB 1OTUD 3QQ4B 3TT3L 2VLKA 3OAYH 5D1XC 1P53A 1R24B 2UYLB 4X9GA 3H9SB 3V5HA 2B1HH 2XN9E 4NO5A 1YC8A 3V4PL 4PJ8D 1D6VL 1Z6JT 2GTWA 2C3HA 1HHIB 1TJGH 5C0AB 2R0LL 4XAWL 4QNPE 5E2UL 4LMQI 5C2BH 4X98B 1ZANH 2HFGH 1DLFH 5JW4R 1YUHB 2GTZA 4U1KA 2QR0B 1HXMA 1TVBA 2BVUA 4PP1C 4ZYKB 3TO2B 3B2VH 2NY1D 3O9WA 5KZCB 2BJMH 3BO8A 3IXTA 4NN7B 1QZ1A 4MQ7A 1ZVSA 4PY7B 4OIAA 3W9EB 3FFDA 2Y5EA 5CMAB 3BIBX 1FYTB 5IM7B 2VR9A 2X4UB 3PHQB 3KYMA 5D5MF 5CP7B 1B0GB 1MF2H 4RISH 3W2DH 3GIZL 1IGIH 2FRGP 1EPFA 4P2OA 1CLCA 1F45A 3ZE0F 5F6HJ 3QUXC 4F7CB 3VXRD 4PV9B 2Z8SA 1ADQH 1A4KA 3S34L 5I19H 2F9BT 4MS8C 4PJAB 2AJ3A 1ZT4B 1GGBL 3VH8B 1FAIL 3MUGA 4GJTB 3W0WE 3DXAB 1YYLL 1YEJL 4KU1A 1JF1A 2EZ0C 4E41D 1AGCB 3QH3B 2GT9A 4ZD3L 4CVXA 4NHUB 4Z5RA 5IBTL 4UT9L 1T80A 1H3GA 3D39D 3IGAA 4JRXB 3O2DH 4LVOC 5GGRY 1OAUL 2MFNA 4CVUA 3QJFB 3BYYA 5D71L 4UOW1 1T0MA 3BAEL 5MENE 3UZVB 3UDWA 1MFAL 1IQWL 5H35B 1OQOA 2BVOB 3RJQB 4YDLB 4PRPD 1TIUA 1D9KA 4Q6IB 1HQRA 4G9FD 1E4KC 3NABH 5HHNB 1UENA 2Q3ZA 5E6IB 1LO0L 1OLZA 2EDJA 3NIFF 3P40A 1OT2A 5L2KB 2EDOA 1YPZB 4NZTH 4U6XA 1CD8A 4Y2DB 3MTRA 5MHSD 3V2AR 5F70A 2EIZA 5IR1B 2A77L 4JFDD 4MMZC 1YDPB 2VISA 3U46B 3KJ4C 3MLSH 3VXSB 1J8KA 1LP9E 4AG4L 3MV8E 4CVZA 1MJUL 1P6AB 3I9GL 4RX4A 1BQLH 4K3HA 3SDAD 4GAFB 1KTLB 3DO3A 3HUJE 3SE4A 1R3LA 4K94C 5FUOH 3MRMB 1UVQB 2Q86B 1P4BL 3CUPA 1XGYL 5FKPA 3RWJA 2VXQL 1UQSB 1JPSL 5EOTA 1MFCH 4OLYH 1EH9A 1HKFA 5I74B 2OK0L 2DJSA 3VG9C 1REIA 5IKCB 1FNSL 2VDNH 4LLUA 1U91B 3AREB 4M5YH 1XF3A 5LWYH 1AIFA 4K07A 4N8VG 3FN0H 1VADA 3BZFB 4H0IA 2WZPD 2L0DA 3GM0A 1FBIH 4F7EA 4KKBD 2P43B 4BJLA 4Y4FC 1IC5H 4JR9H 2X89D 4WUUE 4NQXB 2YA1A 1GC1C 4FQJH 3H3PH 5B22A 3TBVB 3C8DA 4YXLL 3RIFF 3T08A 1X5IA 1J9CT 1AP2B 4PRHD 3C6SA 4ELMF 1KB9J 3TT3H 2JCCF 4PJGA 1GZQA 1J0YA 5HHOE 3WLWC 3IF1A 3HPJB 3DJ9A 3MV9D 2DLEA 3MLUL 5BW7A 1GAFL 5DHXB 3T3ME 4XB7A 1MJ8L 5FA3A 1D6VH 1MI5D 3OF6A 4X6CE 5DC9B 1ZVHA 5EU6E 4JY6A 1KG0A 2R0LH 3IJSB 4P4KB 4XAWH 5J56B 5E2UH 5FV1L 2HG5B 5DJYB 3ZKMC 5D6DC 3LKRB 3BGAA 4J3SA 2A6IB 3WFHB 3QG6B 2OI9C 4KGLA 4RGMB 1KN2L 1PQZB 2W9EL 5K9KB 1JZ2A 5J12B 1RJZB 4A6YA 4OGAC 4DFIA 3GMLA 2AKRB 5D9SA 1L9MA 5ALCL 2DI8A 4UILL 4QRTB 4YC2C 3GIZH 1NC4D 4HJGB 2XTLA 1RV6X 2VRAA 4HD9A 2D2OA 4HIIB 5EBWA 3S98A 2NXZC 1AD0A 5IB3B 5T1DL 3S34H 4JDZA 5CGYD 2E7CA 3DGCR 1GGBH 1FAIH 3V8OA 1MCFA 3FOMB 4PJXA 1YYLH 1YEJH 3MRGB 1U8JB 2HLFD 4KAQH 4ZD3H 4IHOA 5IBTH 5ACZA 2EH7H 3RY5A 2X10A 3SDXA 4UT9H 5EC1A 1QSEE 3QZWA 1OAUH 2C4FT 3GSNA 5D71H 2R15A 2XRAH 4ZO9A 1L0XA 3BAEH 4IIQC 3E6HB 3ZT7A 4JFFA 1MFAH 1IQWH 2X9WA 3QIUB 5CHNA 2QBWA 4LRNL 4MSWB 4NO3B 1KXTB 1T1WB 4K8RD 3OR6A 4ODWB 4Y1AD 3MFFA 3AU1B 4PJHB 3REVA 4Y16B 1CXKA 4O58L 4TVPD 3ZZ1A 3BH9B 2X9YA 1LO0H 4I9WE 5GGTA 5D5ME 4YPGB 4UDUB 3V79C 5F7KC 1WCBA 1XF2B 5C0EA 2Q8AH 3QXVA 1PGRB 4NQSA 3S97C 2V2WA 2A77H 3QT2A 4Z77B 4XP1L 3LD8C 3MRQA 3CH1A 4WW1B 3QDJD 1BWWA 1DQQA 2W9LA 3HS0A 4AG4H 2CUIA 5JW4N 3MO1A 3I9GH 3GO1L 2VABA 2PYEA 1KLGA 4J8RB 5IMKA 5EUOF 3FMGH 3AS3A 3AS1A 3BYTA 1P4BH 3ES6B 1HHHB 1NMCB 3UZQA 1XGYH 2X1WL 2H8PA 2XN9D 2VXQH 1JPSH 4WHDA 3P73B 4E5XB 5JMRA 4Q6YA 4ZFOA 3QQ9D 3RY4A 1I3RA 4JE4B 3G5XA 4XVUD 4PJ8B 2OK0H 1BM3L 4PJAF 4HIXL 1FNSH 4AEEA 1AI1L 1RZ8B 3E3QC 4FMFA 3WIHA 2IAMC 3IFPA 3EOAB 3WUZA 1KENL 4JKPH 2X7LA 5F8QC 3CSBA 3W11C 3GGWB 3ROLA 1ROWA 4P2RB 2E6QA 1M71B 4U0RC 2VWEC 1ZA6A 4TUKL 2HH0L 3ARGB 5FHBH 1D5IL 3LH2L 3BPNB 3MACL 1C5DA 1TDQA 4GAGL 3P9LB 5C0GA 1CI5A 5FO8B 1XIWA 4O5LL 3NFSL 3M1BA 4M03A 3FQXB 1XT5A 2QJDA 5KVMC 3PWUA 4TUJB 4X7DC 4HWBL 1I3VA 3PV7A 5T3ZL 3MLUH 5I1DA 1VKXA 2DI9A 2VDKL 3ROOA 5GRXG 3VXRB 4ENEC 1MJ8H 5J3HC 4NCC2 3W0WD 2B5IB 3VG0L 3QIWD 1ZS8A 3D0VB 3EJYD 5ID1A 5DJZA 5F9JA 3B6SB 4LRIA 2LU3A 4E41B 4ETQA 1VEMA 4IRJC 5CBEA 3V7MA 1XGUB 4YBQD 1LK3H 2PW1B 5CZKA 3CSPA 1HEZB 1TMCB 4LCCB 2KZWA 4LQ1A 1ZLWH 5ALCH 4L29B 4PJFB 1UB6B 4UILH 3H9YA 4PRPB 4YNYB 4RMRA 1J1PL 1ND0A 4PRNA 4G9FB 2VKXA 2VAAA 3EYFB 5EDXA 4OD3L 5HYFA 3U6RA 1J12A 4ESKA 4ZG1A 1EAPB 4GW4A 4KDWA 5GQBA 1FORH 4OB5L 2UY6A 3TYGL 4JFDB 4U2YA 4CW1A 2LV4A 4XAKE 3WUWG 3MV8D 3T0AA 2DWDB 4XXCC 1JMZA 4X7EC 4NKQB 2VXSL 2DIAA 1RVFL 2EDDA 2HP4A 3SDAB 5JOFA 4P5KA 2E8YA 1KJVA 1S78D 4KK8C 4G80B 4LDEB 1UJTA 1NBQA 4LRNH 1W0WB 3LV3B 4U4BA 5I9QB 1JK8A 32C2A 4HGMA 5IG7B 4MJ5A 4TULL 5CZXD 4O58H 1V3KA 2A6DB 5DS8A 1KULA 1T7ZA 2RCSL 3BVNA 4ZFZB 3MLPA 4ZQKA 3UTQB 4M4PA 2P49B 2RFXA 4V1DA 1IFHL 5GSRB 2WUBH 2IH3B 4JPWL 4OZHB 4QY8A 4XP1H 4HFUL 3MPCA 4FQXC 5L0QB 5ADOL 3VCLB 1BZ7A 5EC2B 4WUUD 3FQRB 4QXWA 4WFGE 1MHCB 4EUPH 3GO1H 3U30B 1U8IA 1NBYA 3NA9L 3FTGA 5HHOD 1GXEA 3FB5A 1WICA 5DHVA 3MRHA 4NOBA 3TBWA 3GJEB 3U2SA 1JJUA 5FXCH 1VGKB 5MENA 1HZHH 3JWOL 4X4ME 1LILA 3OKNB 3IFNH 4LSRL 4ZS6C 5EU6D 5F9AC 5FO7A 3ZMRA 2CLZB 1QSZA 1BM3H 1FGNH 1U92A 4HIXH 4IS6A 1AI1H 4J6RL 3K7UA 4YWGL 1GPOL 3CFDB 1MY7A 5IK3B 4U1GB 4MGXA 3NZ8B 1KENH 1E4JA 2BOCA 2K9UA 1GHFL 4LEOB 4MJ6A 3FRUB 5C0RL 3I50L 4TUKH 2HH0H 3BP7B 2K1MA 4JANA 1D5IH 1FFPA 3LH2H 4YX2L 2JELL 3MACH 5HD8D 4GAGH 4MNQE 4X9IA 2Y6SD 4O5LH 3NFSH 4MJ4A 3TNNB 5DXWA 4DKFL 4HWBH 4MD4B 3ZT5A 1NC4B 1NGPL 5EU5A 3WO3B 1MCJA 5B21A 4PJDF 4JG0L 5T3ZH 2VDKH 1I1FB 4G6KL 4JRWA 3ZDYF 2IH1A 4MQXC 1PY4A 2ICES 2QHRL 1CFNB 3VG0H 4LSPL 4G8IB 4QTIL 4TRPL 2B39A 4UAOB 3MV7B 5C09E 1U3HC 3BN3B 3QCVH 1U6AL 4F9LC 4WRLA 2FD6L 1QSED 4NP4L 3VRJA 3I84A 4GRLA 3HAEB 3IKCA 3V0VA 4QYOB 4UV7L 1G7QA 4TVPL 3VFTA 4NKDA 4CDHA 3DUSB 3H6JA 4GMSL 4LVNB 3BT2L 5I76A 4R96B 2VXUL 2OMBA 3L5WB 4Y1AB 3WLBB 1J88A 1J1PH 3D69B 3SPVB 3NH7L 4OD3H 5IHUL 4GT7A 3RFZC 2Y25A 2NY2C 2R2HA 1S9XB 1CGSL 4OB5H 4WNQB 4MA1B 4HKBB 3TYGH 1RI8A 4CVWA 1XCQB 4PGDB 3V6OC 2UWEB 5D8JL 1IC4L 2P7TA 5SWQA 1U41A 1S7VA 1CTOA 2PF6A 3WS6A 3BRFA 1J87A 1S7XA 4D0BA 3V5KA 4NDMA 3DRTA 1RVFH 1WBZA 2X41A 3T09A 3BD5A 3DPBA 2BNUB 2EXYC 4U6YB 5ESVB 4I2XE 5TPWL 4GLRH 1KCLA 1X5HA 2YPLE 1HXYB 2XN9B 1RQ5A 1ORQB 2NY0B 5EZLB 4JDVB 4TULH 4MJIE 1CS6A 4TOYL 1NDMA 2RCSH 1WIOA 5GHWL 5H37G 5HGAA 5FKAB 3D1MC 4M9PA 1LE5B 2Y5TB 5DEFA 1IFHH 4NRYA 4MA3B 5TF0A 4JPWH 2FEDC 4LKCB 4R9HA 3MMEB 3WN5C 5K93A 3C5JA 1H3PL 4HFUH 5ADOH 1NCWL 1WISA 3GMQB 2D7PA 4Y4KB 3RGVD 3PP4L 3F6LA 5IVNA 3CVHA 2Z93A 5ETUA 5GRUL 3D85A 4ONHB 3NA9H 4N0CD 1GSMA 3P0VL 4LGSB 1XF5B 3HRZB 5ICZA 1J0KA 3KLHC 5JPMA 1AHWB 3D9AL 4JKWA 3VFRA 2J8UE 1DUYA 2VOTA 1LEKB 3JWOH 1FO0L 5I1HH 1RU9L 4N8VA 5C0DB 1I1AB 3GMNB 4MCYB 1QRKA 1MHHA 2VDLH 3NA4A 4M1GL 2ADIA 1AXSB 1FPTL 4HJ0C 1WLHA 1X44A 2R1YB 5MEOB 4J6RH 1CIDA 2WIMA 1GPOH 5GGSY 5D5MA 4XWGL 4S1RL 3V95A 3DX6B 1I85A 1XGQB 4HWEL 3T3PF 1FO0B 2YUXA 1N3NB 4XXDA 3QEQA 1A6TB 4M02A 4JFYA 1U8OA 3ESVF 1VESA 3G9AB 5F88B 1EO5A 2X1XR 1GHFH 1P4LB 3DMMD 3DSFH 5C0RH 3I50H 2YK1H 4OQTL 1DE4B 1G7MB 1NUFA 4N0YL 1QBML 2Y7QA 4G9DA 4M7JL 1QA9A 1KPVA 1QNZL 2JELH 4YX2H 4EUPG 4HUMB 4DVRL 2XYCA 15C8L 1V3JA 2H2PC 3QNXB 5K9OB 3RVTD 5DMKA 3C2SA 4DKFH 2BX5A 3EHBC 3QNZB 1NGPH 3T0EA 1FNAA 4JG0H 4QRSA 2R69L 5D1ZD 2C4FU 3VXUB 4G6KH 3TNMB 3HAEH 3VWJC 3SBWC 5IBLC 2QHRH 4LSPH 4FNLL 1E27A 4TRPH 5BZDB 4KK9C 4XAKD 3QUZC 1QQDA 4JRYE 5I0ZA 1G7HB 1U6AH 3STZB 4YEFA 4WU5A 4HH9B 2FD6H 3MV8B 4NP4H 1DBMH 4ZNEA 1YMMB 4XZUB 3VFMA 4C59B 1S7TB 1C16A 3DTXB 4UV7H 3QAZC 2P48B 2R1WB 4X8JB 4GMSH 5E08L 1EIBA 1VFOA 4JZOB 2ZOKB 1YECL 2VXUH 4XP5L 1LO4L 3UPRB 3FRPG 5D93C 3TVMD 3Q5OA 1V05A 4G6FD 1KTRL 2X40A 1T0PB 3B5HA 2OYPA 2XZCL 3NH7H 1KOAA 1T0NB 1J18A 1DN0A 2AABL 5IHUH 1OGAA 3TZVD 2DS4A 1CGSH 1EJ6A 1T7XA 3QWRD 2YUVA 35C8L 4OF3A 5H94A 1ZHKB 3GBNL 1T04A 3ALXA 3QIBC 4NQCE 4JFEE 5D8JH 1IGMH 4WFGD 1IC4H 4YHNB 4K55A 4C56E 2VZUA 3BQUA 3MRBA 3CFIC 1IL1B 3QQNA 3EYOA 4LFHG 2VDPL 1GIGL 1MLCB 3ARWA 4QWWD 3D3VE 4RCAA 3MBED 5TPWH 4PV8A 5CZVL 3S5LB 2VLRE 5D1QA 1ADQA 3W9DB 2YC1B 1A7RH 4M7KL 4OCXL 1NC2A 3GSWA 4TOYH 2ENYA 4X6CB 4KPHL 4YK4C 2Y36L 5GHWH 4Z7UE 1YEIL 2KH2B 3FQNA 4D0CB 4J4PC 5GZOD 5DYOA 5INDB 2ADJA 1XZ0A 2W59A 4ELMA 4ODHL 2JCCA 1NGXB 3O2DA 3QCTL 4NC0B 5ISZA 3QFJE 1H3PH 3S37H 5D7LE 4X4YA 3PP4H 5GIRB 5L9DL 1EFQA 4YDIL 3ARFA 4MNQD 5GRUH 4N5UA 2BY0A 5F44A 1EDQA 4ELKB 4ALAL 3P0VH 4QRQB 3D9AH 2APWA 3CLFL 2Z8VC 5JHDB 1IM3A 2KL6A 5J6GB 2IG2L 5DRXB 3OKEB 1Q9OB 2UZYB 3B8YA 1RU9H 2WBJC 3MRIA 4S1DC 5IB4A 4OF0A 4M1GH 4KRLB 3SHSA 2D4FA 1FPTH 4PRBB 2CGRL 5F3HB 5D2NE 5DR5L 5C6WH 4KK6C 2YD8A 4P2CG 4XWGH 4S1RH 5I0DA 2PTTA 2UWEF 2O61A 1B2WL 4H0GA 1T7YA 4HWEH 2V6HA 2XFXB 1S8DB 3CCHB 1BQHB 3WD5L 3IETA 2JTDA 2G9HA 2ZP0T 4X5LA 3HMWL 4OQTH 5D2LF 1G9ML 4N0YH 2W60A 1QBMH 5T3ZE 4M7JH 1QNZH 4YEEA 2QL1A 4DVRH 4EKXA 3MA9L 4HKXA 15C8H 5KN5A 2QQLL 3JV6A 1JWSA 1HHKA 4WO4C 2WK2A 2R69H 1IJ9A 5TQ0L 2ZNWA 1G7PA 5L2JA 1RZIA 2H2SC 4J3OC 3FB8B 1U58B 1FV1A 3PGFL 3SO5A 4FNLH 2UYLA 5EA0L 5JHLL 1N6QH 4PG2A 1XF1A 4KJPD 4F37K 4R4BB 4G3YL 5JQ6L 3BP4B 4HUXA 1HHIA 3U4AA 2M1KA 5C0AA 5BVPL 4Y5YB 4L4TD 4KDTC 5JIKA 4HK0A 5IWLA 5C0FA 4X98A 5C0BE 1JZ8A 1IC1A 1H3UA 2YPLD 1YUHA 1J1OL 4M93B 1MH5A 2QR0A 1YECH 1TNNA 4XP5H 1LO4H 3TO2A 4ZYKA 1MEXL 5K59E 4WWKA 1S7WA 4P2QD 5ANMB 2Z8RA 4TNWF 3W9EA 1OD9A 4HG4J 2NR6D 2XZCH 3UAJC 2AABH 3TIEA 3WUWA 4E0RB 1FYTA 2E6JA 5DQ9B 5I18L 3KPNB 3ILQC 35C8H 1B0GA 1J1XH 1J8HE 2FO4A 5EUOA 4TNVK 2F19L 1CFQB 2F53E 3GBNH 5IVOA 1KJ3L 4NO0D 4P4RB 5I8OL 1DZBA 4F7CA 4RSVA 1FVDA 3N85H 4TVSa 4Q7DA 5C09A 3RGVB 3R8QA 4HIEB 2ICWJ 1ZT4A 2VDPH 1GIGH 3VH8A 5C2UB 1V8HA 3CX5K 2Z0BA 4LHUG 1RJCA 2VC2L 5TDOB 3B2UC 2X44D 5CZVH 2YN5A 1AGCA 4ZOCA 4NHUA 3O45A 4S1SL 4HUVB 4P9HL 4OCXH 5JORA 3S36X 3WBDA 2VZSA 1IQDA 1U95B 3RUGF 3BP6A 1A64A 4KPHH 3QJFA 4O2CB 4BM7A 2Y36H 9CGTA 1GOHA 1YEIH 5M94B 2GK2A 4PGEA 1TLKA 4Y8AA 2GK0B 3C5SB 3PWLB 5H35A 3BKJL 3BZ4B 5GRYA 3STLB 4ODHH 5F7HA 3L3DA 3AFLA 3QCTH 1F00I 1FNHA 5HHNA 3VXQB 1UWEL 5E6IA 1NLBL 4NC1E 5L9DH 5T1MA 2B2XL 4YDIH 2OJEA 5D7JB 1EZVY 4JZNB 4ZUSB 4TN9A 3OGCB 5EFIB 5IR1A 3G5YB 4ALAH 4HKJB 5E8EA 3TN0C 3CFKB 5D72L 3U46A 1T1XB 5C08E 2Z91B 3BI9X 3U7AA 3CLFH 4DTGL 1EV2E 2CLRA 2IG2H 5AUMB 1CFTB 2D0HA 5D1ZB 5HI4C 4XI5D 3D2UA 4APQB 2EDWA 1KTLA 1MVFA 4MJIA 1TQCB 2JJSC 3AC0A 2CGRH 5CJQH 5DR5H 1UVQA 2Q86A 3MODL 2GJZA 2H32H 3L3KA 3DARA 4NJ9L 2L4OA 1MCKA 3UTTB 4KRNA 1I4FB 1B2WH 1UQSA 1JYNA 4WHTB 3VXMD 3KS0H 4NNPL 2VR5A 1LHZA 1IAIL 3ARDA 3HC3L 1WBXB 2IFFL 3HZVB 4R2GD 1Q1JL 1U91A 3HMWH 4PIRF 5KVEL 2DL2A 1G9MH 4Z8FL 1ITBB 2WBWB 5EOCJ 4L8BB 4Q0XL 1CG9B 5I17A 1UZ6F 3MA9H 5CLWA 2QQLH 3BZFA 5E2TL 4YHZH 1Q0XL 3FN9A 2GEEA 4A2LA 3KJ6L 4OIBA 4PJBB 3IDNB 4NUGH 1RUPL 1IMHC 4P3WA 5TQ0H 4NQXA 3C5ZC 2PETA 3TBVA 3TZVB 3QYCA 5I8EA 1A9EB 1AP2A 4GKSA 3MRCB 3PGFH 4NQCD 4JFED 4JLRA 4M8VA 5L8JB 4NUJB 1UWXK 4C56D 3EYUL 1QFWM 1FG9C 3UYRL 5EA0H 4P5TC 4K71C 4WFFE 3DETD 3KPSB 3LZFL 4XBGB 4G3YH 5JQ6H 2XWJA 4TQEH 3D3VD 3IJSA 5BVPH 1NEUA 3PL6C 2HG5A 4NRZB 4YHLH 3ILPB 3EOYG 4L9LB 2VLRD 4LSVH 1OGTB 1J1OH 3LKRA 3MBEB 2R23B 5JXED 4F3FB 1JV5A 3L3OB 4LEXL 2WAHA 1K9TA 1EFXB 3B9AA 1MEXH 3VRIB 1F6AA 4MNHB 1PQZA 2IEPA 3LDBC 3C6LC 5ACMA 4EI5C 5K9KA 5E2VL 1RJZA 4LP5A 1AKJD 4P2YA 4OZ4B 4YAQA 5KVFL 3RL1B 5I18H 4W6XB 1TZHB 3K81A 3QFJD 2F19H 2VLJE 3MNWB 3SE8L 4LIQL 3G6AB 4IOFD 5IMOA 5I8OH 2ZOLB 4KGJA 1CGVA 2DBLL 4Z7QF 1UM5L 3NIGE 4HIIA 5C92A 4XNZC 5IB3A 1IAOB 1QPPA 2PYFA 5IW1B 1K8IB 4LL9A 3IDUA 5I30L 4ZXBD 5DEGB 3R8BB 4FQQB 3ZDZF 4AMKL 4KY1L 3MRGA 4MNGE 3ZE1F 1U8JA 5C0JB 4X80L 4S1SH 3CC5A 4P9HH 3MNVA 3RWDB 1FZOB 3HE6C 4N5EC 3C2AL 3GB7A 3TPUB 3GKZA 1S9WB 2I9TA 3F62A 4KTDL 3E6HA 2JK5B 4EN3D 3QIUA 1MCSA 2CIKA 2HVKA 4MSWA 5EBMB 5C9JB 1I7UB 1T1WA 1X4ZA 4ODWA 4K3JL 5E70A 3AU1A 4PJEE 5F1OB 4Y16A 4JHBA 1UWEH 3BH9A 1UEYA 4PJDA 2HMID 3EOBB 1A21A 2PXYA 3UJTL 3IDIB 43C9B 5HDBE 3AY4C 3ARZA 4UDTB 1XF2A 2BXYA 4R4ND 5D1XD 1EUTA 4Z77A 2DQDL 5D72H 4OKVA 2HRLA 3RTQA 1MUJB 3MOQA 5KAQG 3SGKC 4U2ZA 5HDQH 3R0MA 3CPLB 4DTGH 3SDCD 3KNBB 4HPYL 4Y7MA 4XPGL 1RUAL 2AGJL 2F74A 5C07B 4KXZH 1KJ2B 4BFGA 1HHHA 4JCLA 1YY8A 2PTUA 4NJ9H 4AIZB 2PO6C 3P73A 4E5XA 4X0KB 3U7WL 1IAIH 2X42A 3O4OB 5BS0D 1DVFC 1Q1JH 4D9RE 5KVEH 1EHXA 3ZLQC 4LHJB 4Z8FH 3LKSB 4L4TB 1EJOH 5D7LA 2EECA 3MUJA 5GS0L 4Q0XH 3EOTL 3EOAA 1F3RB 3LB6D 3ULUC 3TYFB 1ZEAL 3FZUD 5E2TH 1Q0XH 4M3JA 4RRPA 2CKBL 3VFPB 3KJ6H 2FJHB 3QUXD 3ARBD 4P2RA 1M71A 4X4XB 4P2QB 2CRMA 1RUPH 3ARGA 2EDEA 4OAWB 2GSIA 1JTTA 1PKOA 2OXHA 4ZNCD 3EJZC 4MS8D 1J8HD 3P9LA 4NBZB 1OW0A 2UZIL 5BXFB 2F53D 4XNQB 5FDWB 4HHAB 3FQXA 3GK8L 5ID0B 3NGBB 2Q6WA 3EYUH 4NO0B 3UYRH 4KI5C 4U3CA 1Z2KA 1LDSA 4LPXA 2ZUWA 3BUYA 5GS2D 3FRPA 1YEEL 3QHZL 4GS7B 1F4YL 1HCVA 3PNWB 2GY7B 3RWIB 4AQ1B 4RWYL 3IDGA 4HLZH 4LARL 4HWBA 4RZCB 4W4OA 5JW5B 3C09C 5L8LB 1O5DT 3VDAA 3LPGA 1OTSD 3B6SA 2MHAA 4LEXH 5T1KD 1OWWA 4KJWD 1XGUA 1MFBL 2HJLA 4EOWL 3VGEA 4S0SD 4KKAD 2YA0A 5ITFB 4LCCA 3AUVA 3TO4B 4JVUA 3RJDA 3WHE1 5KVFH 1JZ4A 4MA8L 3QUYD 5J06A 1OSZB 1QBAA 1XCTB 1YQ2A 4L29A 3IU4L 1JWUB 4ZS7L 1A6WL 4UI2A 5CSZA 2M26A 3SN6N 3O81A 2WINA 1BZQK 2DBLH 3HC0B 1UM5H 2AV7B 1UGNA 1KTKE 1ZA3B 2W07A 1VFBA 4GAYB 1DQML 4H26B 4HX1B 3UTSD 3JWDC 1M7XA 5I30H 4AMKH 3CDCA 4PFEA 4KY1H 3QISA 5MERB 1MPAL 4PJBF 2XTJC 3VGBA 2JB6B 2BY3A 3L3JA 5C0BA 1PY9A 3ZE2F 4X80H 4EQ3A 1NDGB 3RPIB 1NGQL 2WUCL 4CMHB 1UJ3B 1X5JA 4N0FB 3C2AH 4DZ8B 4KTDH 3GMPB 5TH2B 4LCWE 1Z9OA 2J5LB 2YBRA 1PKQB 1FDLL 2BHUA 3LV3A 2GW5A 4K3JH 4OM1L 3BWAA 3TBYA 1WZLA 2OSLB 3VXMB 2A6DA 4R2GB 2ORBH 1IGYA 4M48L 3DLQR 3UTQA 1AO7E 3T2NL 5GSRA 1T5XB 2KDGA 2IH3A 3ME0A 2X4PA 4MDIB 5HHXL 5T1LD 1E4WL 3ARPA 2XNAB 3EFFB 4P0DA 2ZG1A 4KUZL 3BP5A 3WLWD 3B5TA 3QUKB 1N26A 3VCLA 3K74B 1B4JL 5JLZB 3FQRA 1MHCA 2FHBA 4HPYH 1VACB 2DQGL 1HHGB 4XPGH 1RUAH 2AGJH 2CXKA 3VE0B 4LHUD 1S7RA 5EO1B 3O8XD 4NQCB 2XACC 3DURA 4UIKL 3BKYL 2KZ1B 1JTOA 2VITA 3F7QA 4PPTA 4YIQB 3U7WH 1A1NB 4XNUH 1IBGL 2CLZA 5JNYA 2Z31C 5HYSB 4OGAD 2QTEA 3M8OL 2R0WL 5F7EL 1OAKL 1R3IL 1T7WA 1KUMA 5DD0L 5GS0H 2ED9A 3EOTH 5IK3A 4YDLC 3NZ8A 1ZEAH 5FCUH 4KJYB 3JXAA 4Q6IC 2YWZA 3HNTL 2CKBH 1RK0A 4KWUA 1A7BA 1FC1A 3LKPB 4PYHA 4Z7UB 1XR9B 3BP7A 4HIHA 1Y18A 5CEZE 3WFCL 3AGVA 4F7PB 1AKJB 3C60C 4Y2DC 4M7ZC 5HYEA 2VLJD 2UZIH 3BHBB 3RDTD 4U1NB 3TNNA 3DVFA 5I71B 4MD4A 3WFBL 4Z78A 2DI7A 1I1FA 1H8SA 4FFYL 2VDRH 1BX2B 1X5GA 1YEEH 1F4YH 2VUYA 4LNRA 1K4DB 3MV7A 1DEEB 4HQQL 5CGMA 1Q9LB 1UWGL 4I3RL 5DSCB 1MFBH 3HAEA 4EOWH 5C0CA 1S9YA 4QYOA 4Q58C 2P47B 1WZ1L 1OF2B 5D2NB 4RDQG 1XGPA 4YGAB 3H0TB 1IGTB 5DMIL 3NIDF 4JQVC 4R96A 3IU4H 1BLNA 4O51A 4OUOA 4ZS7H 4AT6B 1A6WH 4CN4A 3L5WA 3ZT6A 3TLRA 2FSEB 1PAMA 1I9IL 3QPQD 4JVPA 4CL7A 1EEQA