3MMEB

Structure and functional dissection of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
211
Chain Sequence
b'ALTQPASVSGSPGQTITISCNGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG16 HEAVY CHAIN FAB
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 211
sequence length 211
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeB02
1C5DA 1E28B 3O2DH 1E6JH 4H5SA 4JM4L 3RDTB 2OMNA 4MD5A 3RPIB 1Z0MA 2H32H 4HIIB 2F19H 4JFOB 1AXSA 5DD6A 4YXLL 3WL9A 1OY3B 2JF1A 1M4KA 4YZFF 5LAXB 2C9AA 5I9QB 5DVOA 2JKXA 3TPUB 1KEML 4N9GA 3ZYIA 4K94L 5LQBH 2DJ4A 1WQVT 3UBXG 2EKJA 3SO5A 1S7VB 3RA7H 2BHUA 2HVJB 4DZ8A 5L7XL 3LPGA 3GSOA 5EUOF 2VNCA 2AK1H 3AXLB 5D2NC 5CJ5A 1ACYH 1A1OB 3BT2L 2D7PA 4HZLB 1NGXB 1CGWA 4LF3A 1R3JA 5I18H 3FN9A 1EMTH 1AGCB 1ZLVH 3MRLA 1PQZA 3TWCL 1H3VA 5DD0L 4UIMA 4AQOA 4NNYA 1E4XH 5IB5A 4PJHF 2Q87A 2YUVA 2I9LA 3D85D 3DUSA 3TZVD 3EO9L 5B22A 4NN7C 2SEBA 3QH3A 5IHUL 4GKZA 3HC3H 1RVFL 3MV7E 2AJXL 3F7RA 4Z9KB 4HUWB 1NCUA 4WHYH 2DQGL 5TQ2L 3B5GA 3RWHB 2C4XA 3WIHL 1W8OA 4MJ6A 3CK0H 3MJ7A 4WDIB 4RSVA 1JPST 5B39A 3QQ4B 4QLRA 5FAAA 2XWTA 5DGRA 1A3QA 4HH8A 1HZHH 2Z8VC 4RGMB 4APQC 1AQDB 3ILPA 5T1DH 2V2WB 5BS0D 4ODVL 5D1XD 3RY6A 1KCLA 3QUZC 2NW2A 1BFVL 3D87B 1BX2B 1R0AL 2EKSB 4DQOH 3LEVH 4JRYD 3GMQB 3RWIB 1CDIA 1PZ5B 1T1YA 1I1YB 2CLRA 4YXHH 4OZGB 4NM8L 1XGQA 3AU1B 3P11L 4JFED 3MJ9H 3SDAB 5FO8B 1R5VB 4P2RA 1YEJH 3DGGA 5EUKB 3VRIB 4YX2H 4J7RA 2J1KA 4KK8C 4R2GC 3R06B 1R3LA 1PW3A 1J0JA 3KXFD 3U9PH 1DLHA 5FYLL 5TF1H 3TCLA 3JTTB 1DQLL 3PJSA 3EDKA 4YFLI 2WLYA 5FHBH 2XZZA 1LO3L 4IOIA 3D85B 4XPBH 1HIML 1SQ2N 3NN8B 1WBZB 1WZLA 3V0VB 5F3HB 1DUYB 4YUEH 5DHYB 1WCBA 4R96A 5HI3D 3ZHDA 3WFBH 2FD6L 2GSIB 4M48H 3BP5B 5TDNA 3MZGB 32C2A 3REVA 3AGVA 5GRYA 1P1ZA 5DJ6A 2VDRH 1NUNB 1HQRA 2WK2A 4L4TD 1NC4D 1CF8L 4FQPA 1NGQL 3Q6FA 3NFPB 5EBWA 5D7KE 4XI5C 1VPOL 5HYJD 3L95A 1EERB 3PWPD 5DHXB 4UOJA 4UNUA 1JVKA 3LB6D 5FYKU 4NQVB 4X8XA 1F90H 2GJ6E 4LCWD 3LS4H 1N5AB 2KUTA 3QP3A 5T1KD 1ZTXL 4JRYB 2NY2D 2VABA 1KIQB 5DUML 1PLGH 2CH8A 3LRHA 2ZP0T 3EFDH 1CD1A 2VWEE 1MHCA 2E6QA 2W92A 2DMCA 3NCJL 4JZOA 4F15B 4KDTC 1HNFA 3M17B 2VLLB 3LPFA 4KUZH 2CDGB 5IFHL 1BOYA 3RU8H 2FECI 3O81A 3ISWA 5C0GB 35C8L 3KXFB 3RP1A 1GIGL 2ADJA 3WUZA 1XF5A 5C0CE 1PBYA 4NKIH 2Z93B 1CFNA 5D2LA 4AIOA 4FHBD 4BYHA 5GS1A 1NMAL 1T6WA 5EO0B 4ZFOB 5EC2A 4H26A 1VGEH 1DEEB 2R15A 2Y5EA 3QCUL 5DJ2A 2XA8H 3KR3H 2Z31D 3UPCA 3HMXL 1CE1L 2HFFA 4HC1L 2YEZA 1HQ4B 5C08B 4P3DA 1ZT4B 3DRQB 5B3NA 3GKZA 1T1XA 1KPRA 3TCXA 4Z7VE 4P59L 3VFRA 1Q0YH 3AMLA 4P2QA 3OKKA 4Y8AA 4I8DA 4MJIE 1ZS8A 4E5XA 1MVUB 4PRNB 4WFGD 4X4MA 1MRCH 1CU4L 3D0LA 3IJSA 4LCWB 5EIIB 4ZXBD 4K7FB 5LVEA 3ARBB 5T1KB 3IXTB 1EXUA 1ZK9A 3G6JE 2F53D 5E2TH 5GZND 3MV7D 4YLQT 4HGWA 5F1IA 4NO5A 4LDOB 4E0RB 4JDVB 2XFXB 5AUMA 1IM9A 5ALCL 4HUXB 3LKNB 1DE4A 5I71C 5J3HD 3MFGB 5DRNA 3TVMC 2F5AH 4HWZA 3UZVB 4FMKA 3RGVD 1HH6B 3STBA 3QXUA 3FKUS 4P9MH 1MJJA 4DEPB 2Z0BA 2VTFA 1OB1A 1QKZH 2IAMD 3HG1A 3GSWA 4LSQH 1LEKB 3CVIH 2HT3C 3L5HA 2DQIH 3UTPE 5E24E 1FZKA 1K8DB 4Z7VF 5GGRY 2IANB 2VQ1A 5J6GA 1U9KA 3W9EB 4DN4L 5D72L 1UCBL 2R4SL 4MCZB 1RUKL 4MVBC 4U1KA 4G5ZH 4WRLA 2Z31B 1K5NB 2Y06L 1CZ8L 3N1FC 3T0XA 4ETQA 2CKBH 2B8OT 2VE6B 3RAJH 4JO4H 1LE5A 4YPJA 4ZPTB 5GISH 3MRIA 5F88A 4Y19E 3K4AA 1OF2A 1T5XB 2NW3A 1FE8L 1UG9A 3BD4A 3N85H 4EDWH 1A7RH 3L3OB 3T77A 4JFFE 2D03H 3K1DA 2DMBA 3FB6B 3MJ6A 2WIIA 4MXQC 4OLUL 1A1MB 1J0IA 2F53B 3EYQC 2R1XA 3ESVF 2EXYD 3BPCA 3E6FA 3BKYL 3DECA 4PJFE 4NSKB 5DQJB 3QNZB 1A3RH 2DQEH 4F33A 1C1EH 3RVTD 3HNVH 5C0IB 1FYTE 1OP5K 1GOFA 2A83A 1TETL 2LFGA 5DQ9B 3RUGA 1Q9OA 4Y7MA 3RGVB 3FCTA 2H1PL 2ZUWA 3VXQB 1IGFL 4RRPA 5HHXH 5D7KD 5F3BB 1V7ML 4XMLH 3HNTH 3IDMA 3VXNA 1HCFX 2GJ6D 3GM8A 3O6KH 1IC7H 2OJZH 4NQUA 3TYGL 3MGAA 4JO1L 5ITFB 6FABL 4HQQL 5D1QA 5EU3A 2J8UA 1JNJA 5D5MA 4ZTPH 4K3GA 2MQCA 1IAIL 4HWBA 4XBGB 5I19H 2DQTL 3GSXB 5IKCB 5AZEL 1RZGA 1IGTB 5JQ6L 1P4IL 2NY3C 5IGXH 1TJIH 4PGBB 3MRJA 3LD8C 1XZ0B 4LAQL 1KPVB 4PJBE 5ACZB 1RAMA 4PJFF 2DN7A 1FP5A 4GFTB 4RAUB 4IHOB 4OLXH 5CGMA 1EVTC 3QYCA 4XT1C 3HE6D 3VXUE 4XNZB 5C0CD 2OTPA 5C09E 4Z7WA 4OF7A 3CVHA 5DJCB 1M05A 3FHAA 4XAWH 1DBAH 5SWQA 1U8OB 4ODUA 1H8OA 3CSPA 4UU9B 1MFNA 4U1MA 4NKDB 3IRZA 5IG7B 1DEDA 4NO0B 3FRPA 1KJ2B 3RWFB 1OSPL 5BRZE 4WEBH 1JN6A 3GMRB 3TJEL 5DJ8A 3FOMB 3WFEL 5J12C 3H9ZA 3VXRA 1EGJH 3MNWB 5MP6L 1CLCA 7FABL 1Z9OA 4DKFL 4MJID 1VKXA 3G6AA 3FQRA 1CN4A 1YEKH 4I48A 1G7LA 2YPLE 3MUHL 3E6HA 3SE3C 5D96C 5DJYB 4JR9H 2EE6A 2P8LB 4W68A 3MRMA 5DYOA 4G3YH 4J6RL 5I76B 4RGNE 2GK0A 5E2UL 2QSCL 4Q2ZA 4RFOH 4PJBF 5LBSL 3ARGD 3J8F7 3RX5A 1VA9A 1Q94A 5JXEC 2APWA 2VDLH 3KYMA 3OX8A 3SDCA 3QQ9C 3FQUA 3PWNB 2HKHH 4O4YH 3AY4C 3LN4A 4U33A 2YD1A 3QJFB 3ALWA 4TTDD 5FECB 2WUCH 2JJTA 5IK3A 3BWAA 1NAML 4ENEC 3GI8L 3HHRB 4N5UA 4JY5H 3CSGA 2NXYC 1O0VA 3HE6B 1M7XA 3A6CH 3DX8B 3F6LA 1UCTA 3TBYB 1U91B 4LCYA 2C3VA 3KYKL 1IT9H 4U1LB 4MXWL 5L88H 3CLEH 2EICA 1WWWX 4ONGL 5CP7B 2BXZA 4OF3A 3F7VA 1AI1H 3WNLA 3TO4C 4O5LL 5DTFA 3EYOA 2BOBB 2APXA 5A40E 3ES6B 3O41A 5JIPA 3NPSC 5F1NA 5FOBA 4IOFC 5I66A 2F58H 4XX1E 3O4LB 4QHKI 1SJVA 1TJGL 1KTRL 4FQCL 4G7VL 5L2KE 3QPQC 1EVUA 2BVPA 2YD4A 1VACA 5JDSA 1JHTB 4PRPB 4JFFD 2AV7A 1WT5A 5FV2A 3UJJL 5E8PA 3S98A 1AGEB 2IC2A 3Q1SL 5KVDL 3QFJA 1MF2H 3TIDA 5DC0A 4UT9L 3GJEB 5C0AA 3U48A 2O5YH 3T4AB 1FYTD 3QIUD 1LP9B 5DMKB 5IWLA 3VCLA 4IMKA 3FQXA 4XHJC 1HYSD 1IJ9A 2R8SH 2ZG2A 5DD5L 1U41A 2FIKA 1U8PA 1QA9A 2R2EA 4KK5C 1I8IA 3QEUA 4K71C 1F2XK 2J5LC 1Q9LA 1LDSA 1ORSA 2ENSA 5JHDA 3B2VL 3IU3B 4MQXD 4AH2A 1KB5L 1T03H 2R0ZH 1RIVH 4IDJL 2W07A 1MFDH 4IS6B 4KZDL 1RMFH 2AJ3A 4HWEL 5B38B 4MNGA 3QSKB 4D9QE 1I8MB 1KGCE 4LFHD 3VE0A 4YQXL 1JRHH 1CWVA 4YIQA 3C5SA 1LVEA 4YXKL 4BH8B 1YYMH 5K9KA 4NN5B 5EZOH 1MCDA 1AO7D 1MFBH 3MRRA 4GJTB 4UZGA 5GGVH 3KHOA 4MD4A 3O6FD 1AD9A 1OHQA 3VXUD 3S35X 5D70H 2X9WA 1WUNT 3PGDA 5C09D 5H2BB 3S35H 3NZHL 1BIHA 4HXAL 2ZKHH 4U6VH 4NZTL 3TA3A 4LNRA 1XGPA 1ZHNA 4GRMB 2VXTH 2UWEB 4FQ2L 1NGYB 4JFDA 3KLDA 5FUOL 3OHXB 3QWOA 3QIUB 1IEAA 4LSVL 1YN7B 1A9EA 4IRSA 1ROWA 1YUHB 2YD5A 3HFMH 2G60L 3VH8G 3HR5B 3GGWA 4MX7A 4JFYA 4TSAL 2FCBA 1YPZB 3ZDXE 4NBYB 3B9KD 1NLBH 2YPLD 4MDIA 1LEIB 1SYVB 3TIEB 3OXRA 4OCYH 1EJOH 1UVQA 5IB3A 1KLUA 3DX7A 4NQXA 3IDUA 4RGND 3DJ9A 4FFYH 4Y1AB 4FTVA 4GOSA 1OVZA 3ULUE 4RFNC 3F5WB 1H3UA 3JWDH 1VDGA 4NNPL 3RNKB 4NC2B 1BQSA 3PHOB 4N0UE 3TNMA 3VDAA 4NP4H 1T89C 2FRGP 1F58L 3LDBB 4Q9RL 3ZO0A 3LQZA 2FO4A 3K7UA 4A6YB 4F9LC 8FABB 1HOCB 1A6VH 1M7IB 1RZFH 4Y16D 4X4YB 4CU6A 5DMYA 4NHCL 3MV11 3KPNB 3OAUL 4JANB 2FH8A 3O6MH 4YR6B 3BPNB 5HHNA 1AO7B 1HILA 3JVGC 4FQHA 3QCTL 2V5SA 4CN4A 3R8BB 4KRMB 5HD8D 1B4JL 1XCQA 4Z5RB 1PKQE 4XXCA 1JF1A 3KYNB 1QSFA 1F6FB 5E94B 4Y4KD 4WY7H 3ZDXF 3TZVC 4ZD3L 1QLRA 2FJFB 2HTLC 1NGPL 2D2OA 3DUUB 1NC2D 3DX9A 3ECBA 1EO8H 2D4DA 5MI0C 1B2WL 4BA8A 3ILQC 4TUJA 3IDXL 2EEBA 5JUEL 4JY4A 2BXYA 4LLUB 2NNAA 2WP3O 3ULUF 3LRSA 5GGVY 5DJ0A 1NCTA 4MZ3A 3TJHD 4K94C 3GI9L 3ORJA 1GC1H 5L2KD 4O9HH 1VESA 4XVSH 1P7HL 2X4NB 3PE9A 5D1ZB 1MY5A 4Q9BA 3DARA 4I0KA 3T2NL 4NDMB 3DV4A 4ODWB 5D1XC 5TH2A 1W72A 1RZ7H 1TFHA 1NSNH 2FJGB 4F7CA 2Z35B 1YEIH 3HI1B 1A6AA 1JPSH 4OKVB 3V4VL 1BVKB 3KPPA 4QT5A 4MJ2A 3PL6B 1X5YA 3BO8A 4MNQE 1FNFA 5E00A 5IHZB 3IYLW 1BD2E 4FFZL 4K3DH 4L29A 1LO2H 1JGUL 4YDLC 4P23A 5GZOD 1JBJA 4NC1C 3RKDD 4TSCH 1MIEL 4Y4KB 3H3BC 1FO0H 4XCFL 4HJGB 1M7DA 1OTTD 1YECH 3MV8B 5TDOA 1MRDL 5HI3C 4D9QD 1KGCD 4NRXA 1BBDH 2ZOKB 1H3PL 1WIOA 3O45A 3TBTA 2OTWB 4HH9B 4YGVA 5H35B 4NFCA 4XCYB 2BX5A 1WBXB 5FF6A 4DOHB 3ULUL 4TQEL 1DBJL 1NEZB 1S9WA 3VWKA 2H8PA 4X6FB 5KAQF 3MUZ1 5CD3B 2H3NA 1U3HD 1X44A 3EJZD 2UZIL 1FDLH 2P42B 3PGFH 1JNNH 5C07A 3LB6C 5B38G 1NFDE 1YMHA 5FGCB 2VH5L 3VFNB 2IADA 1TCMA 1WTGT 2FX9H 3TN0D 2NY2C 4R26L 3VD4A 1A7BA 1U8NB 2GTZB 3G5ZA 5I8KL 1KCSL 2OP4L 2Q20A 4OUUB 4CNIA 3WXWL 1P9MA 4N8VA 2A73A 3HZKB 4B50A 3EYVB 1G6RA 4LLYB 5D7SL 2EH8L 2I60L 2DQFA 3GHBH 1GGCL 2IBBA 4PJ8B 3G04B 4HJJH 3R1GH 3CFDB 2VN7A 3GSNL 4ZQKB 3WEXB 1SYSB 4GRWH 4WI4A 1R3IL 2AXFB 4Q6IB 4F37F 2AXGB 3D39A 1BZQK 2A1WH 3ULUD 1CXIA 1FFOB 1I8KB 2VZSA 3FB8A 3K46A 5IFJA 4EI5D 1YEGH 4YO0B 2I24N 3X14B 3FT3B 3MLYL 4K9EH 5E0QA 4M43H 5C2BL 3VWJA 5EBLB 2BOCA 1XCTA 3IDYB 5CP3A 4ORGB 3DROA 4OBSA 1AHWB 1NFDF 3O2VL 2P44B 3V6OE 4OTXL 1BQHG 1L0YA 2XXMB 1D5ZA 1X5ZA 4V1DB 2XOTA 4OLWH 3QUMA 4ZUTB 4WO4D 1U3HB 4TYUA 1D6EB 1N6QH 2Q3ZA 1X5KA 2ARJB 4FXGB 5D8JH 3ZDZE 1A6WL 4EUPG 1B88A 4LGSB 2IPUG 4HMEA 3TNNB 1KJ3H 3OTTA 4LFHG 4ZXBC 2JIXD 1Z9MA 3P0YH 1OAKL 3FRUB 2R2BA 5EZJB 3U6RB 1OW0C 5GZNC 4LNVA 4NWTL 4MA1B 4PJ7A 4ONOA 3IAQA 3UP1A 4GBXB 1YEFL 1FNSH 5IW6A 3QI9B 1YDPB 1V3LA 2OL3H 1P7QD 3FN0L 3QDGA 5FHAL 3NFNA 5FUZH 5J3HC 3OG6B 3MLTA 3BXNA 4BZ1H 3EDDA 2AJZB 4JDZA 4LVNB 4PGZA 3MBEB 3SEPA 1XH3A 3QFDB 5TFSL 5JIKA 5K9QI 1SY6A 3ARDB 3UTQA 3Q6GL 2ZG3A 2BC4B 3EZJB 3U4EA 1NBZB 4FQIH 5H37G 3TH2T 4YHZL 5F9JB 2IAMC 3FFCE 5B8CB 5JO5A 4C58B 3TYFB 4I5BA 1YMME 1ZLUK 1CD8A 1HHIA 1QSEA 4EI5B 2R9HD 4P2YA 1C12A 3Q5YA 4ZDHB 4KJYB 1FZJA 4CU8A 3ARXA 4OD1L 4O2CB 3EAKA 4GG6B 4YDJA 5FDWB 4Z8FL 1CGUA 5CMAA 3MRBA 3QQNA 1BD2D 1K4CA 1TZGH 3B3IB 3UZQA 3QDHA 4WO4B 5K93A 1KFAL 1CL7I 4APQA 1D9KD 1ZVYA 5I74C 4Z78B 4FMFA 4H1LA 2QADB 4PV8A 1OARH 1QYGL 5GHWL 2WNGA 3QUZA 4H0IA 1AGDB 4PRDA 4BQ6A 5FKAA 1ZGLM 1FZOB 2XTJB 3T08A 3EHBC 4RGOH 1JK8B 5HGAA 1HI6A 3FQTB 2ZUVA 5C9JB 5ISZE 5IJKC 1P7QB 4JPKL 3RVTC 3BQUD 4R3SA 5HHQA 2ZWLT 3OKMB 3KWWB 3GSRB 1IGCH 3MRNA 3MGOA 3QZWA 2X1OA 3O2DL 1E6JL 4OGXL 5I1EH 4UTBL 3FN3A 4FABL 4Z0BL 2AS5M 4K3EH 4X8JB 4DKEH 3MCKB 3L6FB 5MERA 1JHLH 3OKNB 5C0DB 4HS6B 1JI2A 3C9NA 1P7KB 2KZWA 1CGSH 4HKBB 4M6ML 1TZIB 3PABA 5CZVH 3X11A 3EO1A 5F6HI 1QVOA 4HKZB 1AE6H 4OIBA 4J8RB 4P4KB 5LQBL 1EEYA 3SE4C 4C4KO 5MEPB 3S4SA 4AMKH 4X9BA 2VWEC 4MSWB 5I30L 3TBSB 2DIJA 4HMDA 3RWCB 3UTSA 3O3EA 5ETUB 2XN9E 4NJAL 1EH9A 4L3CA 4UINH 2L0DA 3MRKA 5JHLH 4GW4B 3SCMB 1TVHA 3L3JA 2ATPB 4NQCA 3FQWA 2CXGA 1D9KB 4LSUH 4OLVL 1BF8A 1T5WA 5E5RB 2BJMH 1E4XL 4NQDA 2BDNH 4GUPA 3QQ3B 3P9LB 3OSKA 2GFBA 4LVHB 3QIWD 4I4WB 3S88L 1QNZL 1G9ML 3EO0B 1B0WA 1LDPH 3Q3GA 5JNYA 4KMQA 4KROB 4PJIE 5IEKB 1ZEAH 3V79C 3HC3L 2OI9B 4J4PD 3FT4A 3V6ZB 4LSRL 2YWYA 2WWKO 4KDTA 5TPWL 3IGAA 4D9RD 1S3KL 4L4JA 5KSUB 3CK0L 3HAEH 5FGBC 4HPOH 4WGVB 4XP9H 2DKUA 3WNMA 1KCVH 3VXSE 5HVHB 4DK3A 4O02H 4XVUD 2NY7L 4X98B 1HZHL 1AIFB 4S1RL 1CT8B 4PRAB 1KELH 5IMOB 1AGBB 1J8HE 1NDMB 1N64H 3X3FH 3ARGC 3VFUA 5M7QA 5CSGA 4DQOL 4F3FA 1DBMH 3DPBA 1A14H 1JCKA 3UO1H 1FAIH 4Y4FC 1TQCC 5I1KH 2IBZX 3DVNA 4FQ1H 2R4RL 3I6LE 5SX4H 5E5UB 4DTGH 4BFGA 1G6RH 1HHKB 1ZT1B 4TTDC 4F7PB 1V7NH 4U1SA 4JZNA 3W0WE 3MO1B 5E95B 2PYEA 1YEJL 5FGSA 4YX2L 3DHMA 3A6OA 5E8EA 1FVCA 1CDYA 4PJIF 4JZJC 3JZ7A 3D2UB 4ZTOH 4D0BB 1INDL 1S7WA 4LPXA 4JKLA 3ZHLA 3C6SB 1YMMD 3U9PL 4BSWA 5FHBL 1FVEB 3VA2C 1CFTB 3P4MA 4XPBL 5I73B 3X12A 4F7MB 3T04D 4MQ7B 4RAVB 4RMTA 3KPSA 3WFBL 3N1GC 4M48L 3IETB 4JM2F 1DQDL 4KY1H 5F71A 3TVMA 3PNWA 1VGKA 5L6YH 4HDIB 4QCIA 5ECJE 5HPMB 5KS9B 1KCRL 2Z91A 4Y89A 5IVXA 3NCBB 2DTSA 4JLRA 3MA7A 4LCUA 2K1MA 5KW9H 4RQQB 1LO4H 2JCCB 3IKCB 5E8OA 5C3LD 5TQ0H 4AYFA 4F58H 5CS7A 3BSZH 5GGTL 2IALA 2A6IB 1H0DA 1PGRB 4QHUB 1F90L 5EPMA 2NY6D 4RDQF 2YBRB 1JPFA 4UT6H 4HSQA 1BZ7B 3G5XA 4OZ4A 3Q5OA 5FB8B 3BGMB 1A4JB 2IH3A 2CMRH 5ISZD 1JL8A 3M1BA 1TNNA 2EDKA 3EFDL 2UZYB 1U3JA 4HIXL 2VJXA 1RQ5A 4N0CC 3KPQA 3NVQA 1J1XH 2XQBL 1T2JA 2AAVA 4JRXD 2FNBA 1RZIA 3VD7A 4ALAL 2QQNH 3RFZC 2ESVB 4ODXB 1GXEA 3OJDB 1K9TA 4O58H 2Q8BH 2I27N 3RVXD 2FYYA 4NKOA 1SBSH 1A6TB 2LTQC 3I6GA 4XRCA 1GPOH 5DMJB 5F7EH 1KC5L 5I8EA 4N0FA 3DNKA 3LKOA 3JWOH 4NKIL 3ZYOA 5I1CH 2CDEB 3TM6A 4YHYC 2WBJB 5ENWB 4HBCH 1VGEL 1NDGA 2IBZY 2BSRA 3CZFA 3HZYB 3PG2A 3KR3L 2B5IC 3NMEA 3F6IA 5EBMB 1WFOA 5EG6C 1P84J 3UBXA 3MPCA 3LEXB 3MCLH 1S9XA 1RJYB 1RIHH 5EN2A 3O6FC 3KJ4C 3O9WB 4RMQA 3EDJA 3OKOA 5T3ZE 5GJTL 2JK5A 2WQRA 1QZ1A 3A6BH 5KAQG 1DZBA 4HPYH 1MWAB 4M7ZC 5C2UB 1C08B 3BP4B 4OKDA 5GS3A 2NY6B 4P2RE 3H2WA 1J87A 4XP1L 1CDCA 2VDOL 4YDVB 4F8QA 5CJOH 3L5IA 1FCCA 1I3GL 3JUZA 4ZAKA 2VXQH 5JW5A 1RJZA 4WI7A 2IPTH 2ZSWB 4OLYL 4JRXB 3RRQA 5BMFL 2F5AL 1PG7L 1Q38A 2G5RA 3AUVA 4Z95L 1I9JL 3L3KB 3RTQD 4N0YH 2HH0H 3B9KC 4P9ML 1Q9KB 2PO6D 4JM2D 1T04B 4ESKA 2ORBH 1UZ6E 4P3CH 1A7NH 4LSQL 2AI0L 4P4RB 3BPOC 3H9SD 1IAKA 4GXUM 4P9HC 4YBLB 4RGNC 4B7LA 1XGRA 5J9PB 4TVPH 4CUCA 4EKXA 1IQWH 3P30H 3QEQE 4IEFB 1E6OH 4W81A 1M71B 2XYCA 2Y07H 4ZNCD 3I6LD 1I7UB 2HAZA 2FB4H 1H3XA 4PJ9D 4G5ZL 5GGSB 3FT2A 5INDA 5KVFH 1P4BH 2F15A 4Y16C 4I18C 1CLZH 1YJDH 2HG5B 3LZFH 5DEGA 1G0YR 2CD0A 3W0WD 3T0EE 3RAJL 5ABDE 1UWGH 4JO4L 4KJQC 5JW4M 4LARH 3UPRA 4OV5A 1HINL 3C5ZD 2LU3A 4LRIA 2VXVH 3V7AE 1LK3L 4K7PX 3T65A 4K7PH 3L9RA 4DVBB 1MCLA 1N6UA 3SE3A 3U30B 5HD8C 3VMOA 1A7RL 4N5EC 1F11B 4PY7B 5EIQA 3QXTA 5CWSA 1E4XI 3OV6A 3CXDH 4MZ2A 3TBWA 4XP6H 1E27A 5JXEA 5C0ND 1HSAB 4U0QB 3CFBB 5E08H 1WICA 1IC5L 4N8CH 3AREB 2HJLA 2DQEL 1C1EL 5TE6L 6CGTA 3AY4A 2AABH 5JIIA 3MRGA 5D2LE 1JZ8A 1UXWB 1QLFB 3RTQB 1QR1A 5I8CA 3VI4F 3TJHC 4U31A 2X9YA 3O3BB 3WO3B 5MEQA 4G8IB 4I2XE 4AQ1B 3MRQB 3F8UB 3MA9H 4JM2B 2PO6B 4LDLB 3NBNA 3P40A 5IUSA 1UJ3A 9CGTA 2ICWI 1B9ZA 5ID1A 4JG0H 3H9SB 4QEGA 1QACA 1CVSC 3UX9B 2DLIA 3IFPB 1GL4B 5IMLA 3U7AA 1IC7L 1B0GB 4X6BA 3NIGE 2NY4D 4K55A 5DVNA 2J8OA 2QQQA 4U49A 2BERA 1IFHH 4TNWK 3BP7A 3MYZA 4JQXC 4OFYA 3TO4A 4N8PA 2C1PA 1NCWH 4HLZH 5T3ZL 5LGHL 1RK0A 4HK3N 3N0PB 4PP2A 4WTZG 1QRNA 3FQNB 4R97B 5D7LA 1ZHBA 5IGXL 3C5ZB 4U3HA 1RU9H 5H94A 3U1SH 2PTTA 3NCMA 2GSGA 3MREB 3B6SB 4UAOC 1U8IB 1FPTH 2B4CL 2YSSA 4LEOB 4OLXL 2HLFD 3VDCA 3KYOA 5LGJA 4AEHH 5GZOC 3RKDC 1S7UB 4L4VE 1XF3B 1RK1A 5T5FL 3C6LB 4FQLH 4NQEB 1OTTC 3H9HB 4UBDD 3HNSL 5CJBA 3HG1E 3KLSA 3QPXL 5D9SA 3MR9B 3MLXL 1BOGA 1T1ZB 3SDDC 2P1YA 4PGDA 5CUSL 3WNNA 4QXGH 2ATKB 1IL1A 3NIGF 3OXSA 1EGJL 4WHYG 4XGZB 5C86A 4K7PY 4LIQH 1JPTH 4C56A 3QDMB 4O51B 1E28A 3DTXB 3RDTA 2PW2B 1U3HC 2EYTB 3EJZC 5C71A 3RPIA 4NT6B 3V5KA 1GZQB 3H0TA 5F9WC 2JJSC 3MRFB 1SMAA 4PJEB 3L3GB 5KANG 5LAXA 2QQKH 1EX0A 3DVGB 5EU4B 1I85C 1R3KB 3HUJB 2NCMA 5I16B 3TN0C 4MGXA 4QO1A 3ARQA 2H6PA 3SY0B 3IXAA 1G1YA 3ZL4H 1S7VA 1QOKA 4GLRH 5D4QA 3SE9H 2A6KB 2HVJA 4X99A 4AEIL 5HHOA 2AJUH 1QFUH 3D18A 2WUCL 1A1OA 1IRAY 1DDHA 1P84K 1KV3A 4PJDE 1MUJA 1AGCA 2VRAA 4NRYA 3SKOB 1PX3A 3A6CL 1MREH 4M5YH 1LE9A 1OTUD 1FNHA 2BSTA 4CGTA 2OS7A 3WS3B 3CIQA 5F7FA 1JZ4A 3KJ6L 3ULUC 1CXEA 4KUCF 3QEQD 4GKOA 5HHME 1PEZA 2MHAB 1QFWH 2Y72A 3GZKA 4MA8H 2W0LA 4MJ5B 4Z7UB 1JWUA 2XV6B 2J7LA 2AV1A 3CD4A 4NPYA 3RWHA 5CBAB 1T20A 3JV6B 2ZCLH 3VRJA 2R23B 1MHHB 5BV7H 1UEYA 4JGUA 4RA3A 3OGCB 4P57B 2FL5A 2R0WH 5DFWH 1PG7W 2WUBL 4WO4C 3V6FB 3DX6B 4XB8A 4UILH 2L4OA 1AQDA 2F54B 3S97C 2V2WA 4X6CF 3VXTA 2L7UA 1I7ZA 5KZCD 4K23H 2CK0H 1KXQE 1MF2L 2AEPH 1NGWA 4PJDF 2EKSA 5I1IL 4JFXB 3KG5A 5IQ9A 1I1YA 1MRFH 5IJVB 3MXWH 4F7EB 5F1KC 4EN3D 4X5WB 3D69B 1J05B 4Z7WE 2VKXA 3WKNA 5EDXA 1IGML 5HYQB 3KPMB 1G7QA 2N7BA 5EUKA 1FHGA 3SE8L 3WHXB 3R06A 1PSKL 4KI1A 3RQ3A 4LKCB 4AM0A 4DVRH 5B21A 3D85A 4NCC1 3TZVA 1T03L 1OL0A 4EDXB 1RIVL 4D3CH 2B20A 5DRWB 4PJGA 2ED9A 2Y5TA 3L7EB 5E8NB 3FO1B 2V7NB 2QKIA 1OPGL 3U2SA 4C83B 3MUGB 1GGTA 3V7MA 1MJUL 2OM5A 2NY1C 4OCRH 3AC0A 1U8KA 4ELMA 5GRXG 5IR1A 1YZZA 1YYML 1F02I 4A2MA 1MHPH 3DV6B 1U95B 1CYGA 5EZOL 1BJ1J 5GGVL 4Y5VB 1I7TB 2XKSA 3K81A 3QXDB 5CZKA 4HS3B 5EORH 2ITCB 4PB9H 4U7KA 3F7YA 4KVNL 1KTDA 2DLFH 4L4VD 4HUUB 5CJXC 4BUHA 4U1HB 3WD5H 1YN6A 4U6VL 5D1XA 5BS0A 4HMCA 4OLEA 4TOYH 4J2XA 2E7BA 1N5AA 5ICYB 4JRYA 2VXTL 3C09C 1T0MA 4RDQG 5AWNH 4LPUA 3I75A 4EN3B 3W2DH 4UTAH 1ZGLB 4OZIE 4JFEA 4AT6B 3BQUC 5C9KA 1MI5E 4KUCD 5JLZA 2G5BB 3M17A 4XMPL 4M7KH 1NLBL 1DLFL 1DFBH 1JWMB 5CBEA 4TTGA 3KXFA 5AZ2H 4K2UH 4KKCD 4JHAL 3WIHA 2LU4A 1H5BB 5E4IA 1JFQL 3IFNL 1F4WL 1FC2D 2WANA 1UC6A 2DWEA 5I1DB 3WNKA 1KACB 3HI6H 5EO0A 5DVKA 2ZSVB 4HWBL 4AIZB 5C6PB 3ULVH 5HGDB 1Z0NA 2Y36H 2Y7QB 3NABL 5JOEA 4LASH 3MUJA 3NZ8A 2ZCHH 3GK8H 1VADB 5C0RH 3CCHA 3QFJE 2P8PB 4L4TA 1NC4A 3LKRB 2AQ1A 3U7WH 5C0AE 1ONQA 3B4NA 5E9DE 3P77B 2BNQE 5HYJA 4Z7QF 1U8QA 3PWPA 3EGSA 4KKLD 3UTZB 4RNRA 5EUOA 5EIIA 1PYWB 4JFHE 5F8QC 5C0BB 4K7FA 4E42A 4WY7L 5T1KA 1CGYA 1G7JA 2J2ZA 3QIWC 3BVNA 4TUKH 4H25A 3OB0H 1OGTA 4E0RA 4JDVA 4GRWE 5JORA 2X4UA 3LKNA 2DDQH 3CSBA 3BP6B 3CDCA 4PJHA 3V6OC 3KPOB 3KPRE 4A2LA 3GKWH 4KTDH 4WW1B 4I3SL 2DICA 4JN1L 3FB5A 4D2NA 4O9HL 1TXKA 4Z7OE 4QRPB 1VFAB 1AFVH 2J6EH 15C8H 3FZUD 1Z9LA 3RL1B 1CG9A 3V5DA 5IM7B 5F9OH 1VENA 2VDNH 5L9DH 3QXWA 5IBTH 3D5OF 4NRZB 5KSAD 3W9EA 5GS2H 4YHPB 2OLDA 5CCKL 1SM3H 3LSOB 5EU5A 5IV2B 3NFSH 4KFZC 4M1DH 5SWZB 1JPSL 1MJ8H 2Z31A 3QULB 1LO5A 2DKSA 4TN9A 1JF5A 4X6CB 4WJ5B 2FATH 2GT9A 2Q76B 3S9DB 5DUBA 3U7YH 4G8GB 4M7LH 2NXZD 4H8WH 3F62A 5HGHA 1U8HB 1MCRA 1T5XA 4K3DL 4WV1B 1T2QL 1OAZH 4OI9A 4WU7B 4YNYB 5JPMB 4X5XB 4ZXBA 1D6VH 2E7CA 3C60B 1A1MA 2F53A 2P7TB 1RUQH 3CGTA 2DKMA 5LXGL 1F4YL 1OW0A 3AAZB 3I9GH 3MV7A 4ZOAA 4DFHA 2IQAB 2PW1A 3MRPA 5C0IA 5EFIA 4Q0XH 3GSQB 3G5YB 3RGVA 3CC5B 1NL0H 3HPJB 5DURB 2HJFA 4PB0H 4FFWD 5F3BA 3JUYA 5CGYD 1BWWA 4HAGA 3SBWC 4S2SA 1WEJH 3HMXA 4AEFA 2IAMA 4G9FE 3PGFL 5IQ7H 1JNNL 4CW1B 1CDBA 3DYPA 1QLEH 4BH7A 2XKUA 1PD6A 4OI8A 3HTLX 4GMSH 3RHWK 2J88H 2XWBA 3V7AG 4ZS7H 3GSXA 4WENB 3OR6A 1MI5D 1BIIB 1IGTA 1WIPA 1KB5B 4R4FL 4DAGH 2W0FA 3GHBL 3KLHC 4Z76B 4HJJL 3R1GL 5ACZA 3S96A 5BZDB 1ADQH 4OZFB 4X0KB 3VH8A 1T66D 3O6LH 4RAUA 4IHOA 1TIUA 2PTUA 1Q9WB 1NKRA 2XTLA 3RVXC 2E27L 3QAZB 3KYAA 4G6KH 1J5OH 3K74B 5DI8A 1XGYL 1U42A 4S1DD 1U8OA 4U1IA 1MCBA 5IJKA 1BJ8A 4M43L 4DZBB 2G9HB 3G5VB 3O4OB 1QHOA 1DVFB 2XPGB 3VJ6B 4NWUL 3P73B 3HI5H 3MLVL 3FONA 5F7DB 5E9DD 4OLWL 3QG6A 4B7IA 5D8JL 4OCWH 2E9IA 3CXHJ 4BFIB 3WDIA 3FTGB 2GJ6A 4HFWB 2DQHL 4JFHD 3EOYG 3QEGL 4WEUD 5JW3L 2ILLA 2LVEA 5E03A 5FO7A 3HC4L 3WIIL 2I26N 5JZ7D 4JEGB 4MAYB 5ESQB 2F74B 4YAQB 1FH5H 3P0YL 3B43A 3P3YA 4P5KA 1UKQA 1EK3A 5F9AC 5MEOA 4KZEH 1QTYT 3MXVH 1FNSL 2A38A 3KPRD 3SKNB 5FUZL 2IQ9H 4WU5A 5MENE 2XXCB 3V4PH 4U1NB 1HEZB 3BI9X 3MRCB 2PN5A 3RX8A 3BH9A 4WI3A 4XC3H 4U6XB 1KJMA 1L0QA 3HE6A 4XNQA 4BQCA 5C0CA 1F4XL 4FQIL 3TBYA 1FNLA 1SJEA 3WFZA 1BQUA 4WUUE 2H26A 2ITDA 4YK4C 5HVGB 2V9TA 3F7QA 4PREA 5CAYB 4JFPA 1FORH 4G9DB 1U93A 2E9BA 4BQBA 2B1AL 4PJ9C 2FGWH 4FZEL 1JMXA 4X7SH 1NMBL 4ZSOE 3G08B 3KNBB 2VSDA 3QUKB 1BJMA 2P5WD 5FA3A 4Z7VA 3I2CH 4NKMB 2ZOLA 2BY2A 1RHHB 3DBXB 5FGBA 4MJIA 1FLTX 2QHLA 2MOVA 3OJ2C 5ESVA 2OK0L 4H0HB 3IFOB 3EYSH 3JV4A 1I1AD 5FCSH 4PJAE 2NZIA 4GKNB 1MJ7L 1OARL 4LCCB 2A6DA 4ZUUA 3DIFA 2P4AB 4U2YA 3GSVB 3ARGA 3K80A 2X40A 1AXTL 4MCYB 4RGOL 4Y4FA 5E70A 3PWUB 3N1MC 3T4AA 3D48R 2HVKB 3FO2A 1D5XA 1J9CT 4HK0A 5HI5D 4DGVH 2RR3A 3E2HB 5DJXB 2Y4SA 5E1HB 3VRLF 4HV8B 1MQKL 4ERSH 1XF2A 4FP8H 1IGCL 2NY0D 3WMSA 2IPKB 3VGHA 2I07B 4P5MA 4G9FD 3U9UB 4K3EL 1I3UA 4PV9B 2BVEA 1JHLL 3HMWH 3NACH 2HLAA 1W72L 2NY4C 4LU5L 1CGSL 3RZCD 1OD7A 3QO0B 1CDHA 5B38A 1I9RL 4YC2C 1WFUA 1UKTA 4PJAF 1OAQH 3EFFA 1DP0A 4GW1A 4AMKL 2DBLL 4JY6B 2P5WB 3M8OH 1JHKH 4LHUB 4UINL 5ESAB 2P48B 5CSZB 4C57C 1GCFA 4F9PA 1BLNB 5FYJU 5JOFB 4PTTA 3X3GH 2OL3B 3BIKB 5D93B 4E41E 2DB8A 2HLFC 1I1AB 3QDGE 3QEHA 3SJVD 4GRLD 4JFFA 1XR8B 2EDYA 2EC8A 1RZ8A 1NAMA 1OSZA 4OCNC 1GAFL 1OTSD 1KENH 2HYMA 4X6DF 4PJFA 2A0LC 2YD9A 1LDPL 4UBDC 3IDJA 1ZEAL 1FYTA 1C16A 1A7OL 1R24A 4NQSB 3RY6C 1YY9D 1Q72H 4K8RL 5C6TH 4QRSB 3D6GA 4PTUA 1QSEE 2OSLA 3EW3B 2C3WA 1YQVH 3EBAA 1F2QA 4HPOL 3A0OA 4WWKD 3OQ3B 1KCVL 4IBLT 3O3DA 3TIEA 4O02L 1FVDB 1WWBX 2BVOA 1BQHA 4ZOEA 3K0WA 2EYSA 3PQYE 5DJZA 1KELL 3T0DA 4M93C 3RZCB 3RKPA 4ISVA 1WWCA 1N64L 5IVOA 4EUPA 2XZQH 4XCEB 3UO1L 1ZSDA 3VGDA 5I1KL 3MV9E 1HOCA 1M7IA 5MEND 4DTGL 5JIHA 1G6RL 3D9AL 2IMMA 4QHLB 3BEVB 4XNUH 1V7NL 1A8JH 3NAAL 4PJBA 1ZWIA 4DK6A 1AO7A 3O6FA 5J57B 1EBPA 3VXUA 3WO4B 3SKMA 2OTUA 5C09A 4LCIL 4GRLB 3SJVB 4ZTOL 2YUWA 4XVTH 1CXHA 1OTUC 4WUUD 4JPIA 1ITBB 2MKLC 2PCPA 3P4OA 4XNYL 5CLTA 2FX7H 4QTHA 4ZUVA 4FXKB 1JZ5A 3OL2A 2EH7L 2GHWB 2P24A 2P8MA 2FJFA 4U1JB 3CFJB 1B3JA 1KJ2H 3T09A 3BN9D 4OQTA 3T0EC 4PBXA 4FQJH 4TVPE 5B3JE 4HX1B 5KJRL 5L6YL 4NZJA 4RBPK 1WITA 1G9NH 3NCCB 3B9KA 1GZPB 2YPLA 1VB9A 1ZKAA 1AKJD 4WWKB 5CD5C 1LO4L 2X4NA 5ITBL 4JHZA 5TQ0L 3QJHA 3VGAB 1D5BB 3BSZL 1H9VA 4KKAD 2IFGA 5IB4A 4M7JH 3FB7A 1G1CA 1BFOB 1MLCB 1EA9C 1JTTA 2FJGA 3LQAH 1UM6L 5T1LD 4Y16A 4Y4HC 4I18A 5EC1A 2EDQA 1J1XL 4Y2DD 5EO1B 2EDDA 5IB2A 3SDYL 3N9GH 2IFFH 1F6AB 2QQNL 1SY6L 2VLRE 3RWEB 4NUJB 4O58L 2W0PA 4PJ5E 5C0FA 1SBSL 4R7DA 4JO2L 5D7IE 4R8WL 3JWOL 1IKFL 2OXGA 5B3JF 2YA2A 5I1CL 4Y4KA 4MNHA 1RJLB 2VLJE 2NMSA 5I75B 3L3HB 2NX5B 4HJGA 1ULVA 1EJ6A 4XMKH 3SKJL 1NC2A 4IMLB 1YNTA 5EOCL 3PWJB 4OZHE 3VFPA 4NOFA 5TE7H 5DRXA 5INCA 4YH6A 4LSSH 4HH9A 3P0VH 1WSST 4YHKH 1X7QB 2G2RB 1WBXA 5L2KA 3QIBB 1D5IL 5IVZA 2EYRB 1NGZA 1RIHL 4E41D 1W0VA 3STLB 3OBAA 2VKWA 3HRZB 3KGRA 4GAJH 2VL5B 3A6BL 4HF5L 4HPYL 4Y5YC 2ZUQB 1CLOH 3LKSB 4I0PB 2OR9H 4QWWD 4DGIL 3UJIL 3CX5K 1TCRB 5CJOL 4JQXA 1EHNA 5DHVB 3IVKA 2EDEA 4PR5B 2AK4B 5EU6E 2OBGA 4R7NA 3MLSL 1CTOA 4R0LB 1RIUH 4OFPA 5HJ3A 2IPTL 5D7IF 4Y2DB 5FA4A 1HH9A 3WIFB 1JGLH 3EYVA 3BKJH 2UY6A 4I13B 5F97E 2R1YB 4CMHC 3MLZL 4X6DB 3W82A 5LKNA 2DWDB 4N0YL 2HH0L 5I2IB 5LCVL 4OZHF 4QHKJ 1AP2B 4LPVA 1JV5B 1A5FH 1PJ9A 1UZ8B 3PQYD 2V2TA 3MSPA 2AXFA 1Y6NR 1ZA6B 3O8XD 2AXGA 1ZLSH 2OZ4A 3SO3C 4F57L 1MLBB 4KKCC 2Z8SA 3GNMH 3Q5TA 4TVPL 5IVXE 2DQDL 4G43B 5I15L 1I8KA 4LIQE 3P30L 1QBAA 2B39A 5DSCA 1FL5A 3RBSA 2CSPA 3GSUB 3MV9D 3FT3A 5AD0B 4WGWB 4OD3L 2FB4L 4YGAB 2AGJH 5KVFL 5EBLA 1FG9C 4R4BA 4NM4L 4JREC 1UWGL 3SOBH 5C7XH 4LARL 1QRKA 2EDJA 2EZ0D 4L8CA 2VXVL 3BYYA 5E6ID 1HHJA 2A9MH 1U3HA 1D6EA 4W6YB 2PTVA 1C5CH 3VG0H 1XR9A 4FXGA 2ARJA 1XMWA 5ADPL 1BVLB 4ODHH 2RFXB 3IDGB 1KTLB 1MCKA 3FFDA 1T80A 2LV4A 4KKLC 5I6XC 2JJSA 1NJ9A 5BQ7B 1I85A 4WTWA 4XH2B 2UYLA 4MD0B 1OP3K 2Z9TA 1N6VA 4XP6L 3TN0A 1RFDH 1YEDB 4N90E 5DRZA 3FRUA 3LOWA 1BZ9B 5EZJA 1LEGB 4UB0L 1LD9B 5E08L 5GIRB 4N8CL 3DVFA 5JOPD 1QEWA 3ARRA 4M61B 5EH1A 1YDPA 1DBKL 4F7TB 2OQJA 5CZXD 3RIAK 4M5ZH 5IW1A 2VXUH 1MELA 1JGDA 5FYKE 3GMNA 3WUWG 1HSBB 4UV7H 1WBYA 3MA9L 2BC4A 4PP1D 3FZUC 4WNQA 2X4RB 4QYOA 8CGTA 1KT2A 3V52H 1IC4H 4CDHA 1HKFA 1QBMH 2HJKB 3BD3A 5HHVH 4KXZI 5C0JB 4HS8H 2BNRB 5KSAC 4QRQA 3SKUD 1IFHL 4EI5A 4AENB 1RHFA 5DDHB 4KGJA 1JP5A 1ED3B 4A6YH 2P5EB 1F45A 3HE7B 1DJSA 2R29H 2W60A 1UA6H 3T1FB 1NFKA 1TQBC 4OJFL 2J4WL 4LBEB 3DXAB 3V95A 2VLRD 2AXHA 4TPRL 1FL6A 1G7MA 1F13A 4KI5D 5E6IB 1JZ6A 2JJUA 5IIEA 2NXZC 4PJ5D 4WO4A 5HY9A 4K3JH 1FN4A 1PKQA 2UVFA 5D6DA 1KIPA 2FLBT 3QA3A 2X4QB 4L3EE 4AEHL 4Z78A 1XIWD 3D0VB 2VLJD 5T3XH 3LCYA 3F12A 1BP3B 1JYXA 2JIXA 2IH1B 3ZDYF 1AGDA 2XNAA 2YXMA 1GC1C 3PP3K 5A2FA 5EWIL 3PHQB 1FFNB 1FZOA 4XCNA 5GS0D 1DUZA 3MBXL 4TULL 3FQTA 3WXVH 1JNLH 2IGFL 4FQQB 3GRWA 3OKEA 1IZKA 2DLEA 3BIBX 3HLAB 5JXAH 3BW9A 1CICD 1MEXH 5EZLA 3GSRA 4B0MM 3TLRA 4LIQL 3SDCC 1I4FB 3D25B 1FZMA 3O3UN 4XPAL 4FFWC 3JV0A 3HAEG 5CGYC 3BZFB 2GAZB 3I50H 2JJTC 1O5DT 4LLQA 4ODTH 1YY8B 3MCKA 2IG2H 2UZXB 3BDYH 5C0DA 4HS6A 1XGTA 2QQKL 3GB7B 5FIEA 3VGGA 1M6OB 2BHZA 4HKBA 5GSVA 3QG7L 3CFEA 3UXFA 1TZIA 1T3FB 2VZTA 5EU6D 4UNVA 5K9OA 3RIFF 1UKSA 2NLJB 4X9IA 1JYNA 1IM3A 4HKZA 3T4YA 1GOHA 5E4EB 4F2MB 1YYLH 3G9VA 4MSWA 5F7WC 3BGFC 5T33H 4ZNEE 4N0RA 1MCOH 1NBYB 4MNQA 3W5NA 4LLDA 3FJTA 4ZFZB 4QRRE 1BD2A 2ATPA 3VFOA 4C55A 4YHIB 2C7UA 1MREL 4TNVK 3Q0HA 2H9GA 2ADIB 5FO9A 3B83A 5CJXA 3IDIB 1KUMA 1F3RB 1XIWB 1NCDH 4D0DA 1OAYL 3ARPA 4JQVC 5ICXB 5F7HA 1A3LL 4LRNL 1CFSA 5EA0L 5CLWA 4S1DC 2KZ1B 1U92B 1P4LB 5FYKL 3TPKA 3GJFA 4MA8L 2LE9A 1I1FB 3O3AA 4QXWA 5ERWB 5KVEH 3BQUA 1R5WA 1MCHA 4LVOB 2YK1H 4HKJA 4XNMB 2FX8L 2ZCLL 3SGEH 1YA5A 5BV7L 2GITB 3DURB 1KCUH 1CBVL 1IARB 3EYFB 5IWLC 5FM5O 5FKPA 4JJHA 4UILL 1QRNE 2CIIB 3EOAB 1NFDA 1Y0LB 3HPLA 4PRAA 4G8FB 4NZUL 5D7LE 3JBG7 4MMXC 1I9IH 2HA1A 4PGCB 1AGBA 1E4KC 2GI7A 4K23L 3RJQB 5JZ7C 1NDMA 2AEPL 1GOGA 4MD5B 3CSYB 1MRFL 3GHEL 5HDQH 1AXSB 5DD6B 3WL9B 4N1HB 4JO3H 3FO0H 1TMCB 4WI5A 4ZO6A 3IF1A 4MHHI 5ANMB 3QDJE 1MIML 2HFGH 4K9EC 1BQLL 3N06B 4D0BA 4DZ8B 2YKLH 4U1GC 3GSOB 3SGKA 1AXIB 1L9MA 5F21B 5DQDH 4DVRL 3OAYK 4CVXA 1KN2H 3QUXD 2D7QA 2B2XH 3QIWA 4LF3B 4F7MA 1R3JB 5AAWA 3O2DA 1BFSA 4FNLH 4MQ7A 3UPAA 4R9HA 2H32A 3MRLB 3ULVF 1PQZB 4HCRH 3HZMB 4UIMB 4J4PA 4KTEH 4NNYB 5DK3A 3L1OL 3V6OA 2I9LB 3L5JA 2SEBB 3C08H 3LH2H 3QH3B 4GKZB 5DLMH 2ZPKH 3ZTJH 3EZ8A 4WTZA 1FFRA 1INQA 1JGEA 4IRSC 4PUBL 1DQJB 4L3ED 4Z18A 2E8ZA 1I1AC 4L8BB 2EE3A 1J86A 3CJJA 2BVQA 4FOMA 1FIEA 3MNVA 3WD5L 4TRPL 4D0CA 4TOYL 4M62H 1CVRA 3MJ7B 2CLVA 5B39B 1BZ7A 1P2CA 5DMIL 2XWTB 1A4KA 3IFLH 1E4WH 1WC7A 5ID0B 1CDJA 3W2DL 1UACH 2X4PA 3MGTA 3HN3A 4EIGB 3H42H 3GMMB 2HFEA 4OUOA 3LY6A 2O26U 4XP4H 4BSVA 3VU2A 4OSUH 4GKSA 2NY0C 4M7KL 4OF8A 4ODXA 4Z0XA 3OJDA 1CTNA 1XGQB 4S1SH 3IJYB 1YMMA 5AZ2L 2DL9A 1X5LA 5DD1L 43CAA 2AEQH 2CDEA 1U6AH 3MLRL 4OM1L 2ICWA 3HI6L 5J13C 3HZYA 1R3LB 5IHBA 1J0HA 4BKLA 3OF6A 4XXCC 2Y36L 1DLHB 2HKFH 3TCLB 3UAJD 3MOBH 3PJSB 4IOIB 5TGBA 1QBLL 5D7JD 3UYOD 4QRRD 4QF1A 4OCSH 1WCBB 4R96B 3U7WL 2BP3A 5DUPH 5CJ8A 3OMZA 5FV1L 5C1MB 1RJYA 4OT1H 4OZGE 3ZT6A 4EVNA 3SBWA 5TDNB 1NAKH 32C2B 3REVB 1SEBA 5F7MC 1P1ZB 3MJ9A 1EBAA 2MSPA 5DJ6B 2AJVL 2VISA 1V05A 2D7TL 5C3TA 3ZKQD 3CFCH 3VFMA 2DQUL 3I6KA 3FOLB 3WSQH 3Q6FB 4W4NA 1JYWA 1OTSC 5EBWB 3W11D 2R1WA 1TENA 4QXTB 1S7TA 1QPPA 4HIHB 5ISZA 4ZFFA 3L95B 4MYWB 5DD3L 5KTEH 3TBVA 2DDQL 1YY9C 2AEWA 3GKWL 4P5TD 3MMEA 3L3KA 3WJLA 2P47B 1HHGA 4KK9C 3ULVD 3E1F1 1CD1B 4C59B 2Q7YA 1CFBA 1N59B 2VAAA 4TSBL 2J6EL 4XBPA 4GXVL 1MHCB 1W0WB 4JPVH 5F6IB 4XCCH 4JZOB 4O00A 5DR5L 2VDNL 5L9DL 5HYSG 2R69H 2M2DA 5JR1H 5IBTL 1G7HB 5F89A 5M95B 3ET9F 2W1NA 3SQBA 2XWJA 1SM3L 1TPXB 3NFSL 3DUHA 4M1DL 1XF5B 1X9QA 4MJ4A 4HLZG 4QXUH 5DK0A 1CFNB 2XN9A 4GLRI 5GS1B 5GGRA 3OGOE 1CGTA 4JRYE 5EC2B 3QDJD 2I25N 1YQ2A 5DJ2B 4M7LL 2H2PD 2V7HA 4M6NH 1I1RA 2X70A 3TESA 2HFFB 4MDJA 1FJ1A 4K8RC 3K8KA 4P3DB 1NUDA 1T1XB 1OAZL 2K7QA 3OB8A 3GUTA 3VFRB 2APBA 3OKDB 3OR7A 4IJ3C 4P2QB 3BZDA 3OKKB 3MLUH 4WUKH 1OOAA 1ZS8B 3ZMRA 3JTSB 4PJIA 1HSAA 3I9GL 5DA4A 5L8LB 3CFBA 1BPVA 1MY7A 3ZYZA 1S5IH 3KXFE 4KPHL 5KG9A 5F6HJ 3D0LB 3IJSB 1UWXK 3NOIA 1EXUB 1Q0XL 4UT7H 2X44D 4LK4A 5GS2D 3RTQA 3UBXI 1DL7H 4Y0GA 2GKIA 4KRPB 5AUMB 5DJDA 1IM9B 1DE4B 2PO6A 4JM2A 1HWGB 2RQ8A 1OQXA 1WEJL 1S5HA 2EEAA 5DRNB 2ERJB 3H9SA 1BAFH 1J8HA 5C08E 4U6YA 2IPUK 3BKMH 5F96L 1QLEL 3JSSA 4GMSL 5HYEA 1MJJB 4OAWA 1K2DA 5ILTH 2MPAH 3B9DA 4PJ9A 1FGVH 1L7IL 5IEHA 3VW3L 3VG9C 1A0QL 4L8SB 2C26A 2I5YL 1FZKB 4LCWE 3W0WA 1A7QH 2VQ1B 4O2EA 3P4LA 4J3OC 3BAEH 4DAGL 3C5ZA 3PDOB 1KSRA 4NUGH 3MREA 2XA3A 4NN6C 1U58B 4U1KB 4BZ2H 3VWJC 4KVCL 1KBGH 4ETQB 1NKOA 4G6JL 2DI8A 3VD5A 1LE5B 1ITCA 1J5OL 2VERN 2W65A 1N7ML 3MRIB 5F88B 1MH5A 3BPLC 2HP4A 1OF2B 4HD9A 2NW3B 2QJDA 3GBLA 3BUYA 3MR9A 3T77B 4PRID 1CK0H 2VLKD 1TJHH 2IANE 3UYRH 2WIIB 1MVFA 3WYRA 2IJ0C 2R1XB 2AJSH 3HI5L 3BPCB 4UQ3A 4F33B 1ZLWK 2PKDA 2CKBA 3SDAD 4OCWL 2Z8WC 1DN0B 1GZQA 2FEEL 2HT4C 2Y23A 3RUGB 3VXRD 3FCTB 4HFUH 2EO1A 2B0SH 2VSCA 3L3GA 4QWWC 3W81A 3DVGA 5EU4A 3MRDA 1WZ1L 3S34H 5BJTA 1NMCC 1FH5L 1MFCL 3MACH 3WFDH 4WFGE 4GMTH 5CEXB 5I17A 2MTPA 4M6AA 1GHFH 3IDMB 4W6WB 4YPGB 3VXNB 1QSVA 5HHPA 2C5DC 4KZEL 3JWOC 3MXVL 3TH3T 2I9TB 3HB3C 2IQ9L 1GGUA 1WAAF 5D1QB 5CINL 5EU3B 2F53E 4DUXA 2J8UB 5D5MB 3PGCA 2CGRH 4XC3L 1BFTA 2VDQL 4PLJD 2FDBP 4IDLA 1HCVA 4CADB 1RZGB 3LMJL 3O8XC 5ADOL 4UDTA 5L0QC 1KLGB 5E2VL 2AXJA 2VDPH 3MRJB 2EDRA 4J3SA 3ULSB 2K7PA 4ZFOL 5KSVB 5ALBH 2MHAA 4QOKD 2VUYA 1FORL 3ARFD 1UQSA 4W4OC 5ICZA 1S9YA 4PRIB 4QGTA 1WFNA 2VLKB 4I3RH 4X7SL 3E8UL 2YRLA 3CVHB 4X80H 1M05B 5SWQB 2EDLA 1GSMA 1XT5A 4JB9H 4ODUB 2R23A 3NH7L 2EZ0C 4W70A 3VMNA 3BX7C 2F5BL 5E6IC 1KF9B 2OYPA 5F7UA 3DX6A 2AKRA 3IAPA 1JN6B 5DJ8B 1MWAH 3VXRB 5DFTA 1N4XH 4JPWH 1VKXB 5A3ID 3FQRB 4I48B 5CEZD 1G7LB 4JM4H 1DQML 3V5HA 3N50A 5IMMA 1WJ3A 1CR9H 4X9HA 4GQ9H 4F7EA 4YXLH 4QRUB 4X5WA 3MRMB 3RWJA 4XNXL 1IAOA 2GK0B 4DGVL 2V5TA 3S5LG 5CZXC 4WEMB 1KEMH 1Q94B 4ERSL 3S3SA 3H3PH 3HKFA 1T0PB 1LK2A 3KYMB 1J1PL 3OX8B 3FQUB 3V4UL 5FM8A 2R0KL 3LN4B 5L7XH 5C08D 1YJDC 5IK3B 1EGJA 3BWAB 3BT2H 3HMWL 3UDWC 3QEQA 4QOKB 5IHLB 3ARFB 3R8QA 3TWCH 4YBQC 3FO1A 5DD0H 2C3VB 1ES0A 2V7NA 4Z77B 4C83A 4KQ3L 3T0EA 4S0SD 5CGTA 3ARBD 3M8OL 3TT1H 3EO9H 3SN6N 5J4MA 1QFPA 1FC1A 3F7VB 4IIQC 4RA0C 2UUDH 1YC8A 4YHLL 3EYOB 2AJXH 3QXDA 1FBIH 4KV5E 3X3GL 3BRGC 4HS3A 4XVJH 1EEZA 3O41B 4XPTH 2DQGH 5F1NB 5FOBB 4HUUA 4QHNA 5I66B 2B1HL 1KYOK 1RUMH 3C8HA 2BVPB 2W91A 1VACB 3IS0X 2A74A 5JDSB 3U4AA 3PWLA 1B6DA 5IBLD 4Y4HA 4EN3A 2AV7B 2OCFD 5E8PB 2IAND 1I1CA 2Q86A 3TA3D 3FO9A 4KGLA 1R0AH 3ARUA 3TIDB 3ZKND 1G7PB 1CICC 3PV6A 3A67H 4I2XA 3CDFA 1IGJA 1YQVL 3LHPH 5L8KB 5GJSH 4LSPL 3DSFH 5IBUB 3UTTD 2Q1EA 3VCLB 2UV3A 4EQ3A 1JWMA 4HJ0D 3ZLQC 2YN3A 4UI2A 3ROLA 2MCPH 5A2LH 2FJHA 5F1OB 3DMMC 3O4LE 5FM5M 1IVLA 1UWEH 1U8PB 1QA9B 2R2EB 1I8IB 3QEUB 4KV5F 5EB9A 3G9AB 3CDYA 3BEWA 5HGDA 1Q9LB 2Y7QA 1ORSB 2X6MA 1IBGL 4PRPE 5JHDB 1D3CA 5FYLH 4AH2B 1VFBA 3DLQR 1LO3H 4FTVD 4POZC 2KBGA 5JA9A 2DQCL 1TTGA 2FD6H 2FLRT 1UB5A 1FYHB 4MNGB 3MNZA 4L5FL 5IB1A 2O5ZH 3LV3A 4XAKE 1LP9E 2X4OA 2F8XC 3ZE1E 1S7XA 4YIQB 4L4VA 3C5SB 4Y5YA 3UTZA 4OGZA 2NR6C 1IQDA 2BVTA 2X89D 1CF8H 2FX7L 5K9KB 1NGQH 2A2QT 4MD4B 2J12B 5GGSY 1S7SB 1CIDA 3PGDB 1AGFB 5A16A 4ONFL 3TA3B 4LNRB 3TT3H 3QUYC 1XGPB 1HHHA 1ZTXH 4OIAA 3VGEA 4HW6A 4WW2F 1NANH 4XZUB 4WW1A 4JFDB 1X5XA 2ZUUA 2V17L 5DC9B 1IEAB 3UTTB 1U2CA 1A9EB 5IMKB 4MX7B 3GGWB 2EIZA 5DFVD 2FEEI 1KIRA 4NRZA 4M7JL 4MDIB 5L2JA 5IFHH 5AEAA 3ESUF 3OXRB 3LSOA 5IB3B 1UVQB 35C8H 1LP9F 3MJ8B 3ZE1F 3RZWA 1GIGH 3DX7B 4NQXB 2XZCH 1L6XA 1INEH 4FTVB 4X6CA 2HT2D 4WJ5A 5BO1L 1FSKC 4Y5XB 1DQQB 1NMAH 4YJZL 2OXHA 3H9YA 1J10A 4L3AA 2UWEE 3N9GL 2Q76A 2IFFL 3CX2A 4PJDA 3PV7A 3QCUH 3LQZB 2FO4B 4NO0D 3STZA 2O93L 3NTCH 4HC1H 3KPTA 4MB5A 4H20L 4WU7A 1WV7T 5EZIH 4YNYA 4BK5A 4X5XA 5HHNB 4P59H 3AB0C 3QUXC 4FQHB 1YPZE 1JGVH 3GJFK 4ZO8A 5BV7C 2DD8L 4OFIA 5J11B 1LQSR 4F37K 1S9KC 2CXKA 2ADGB 4XMKL 3EJJX 3T2PA 1XCQB 5TE7L 1CU4H 4P46C 5SX5H 1JF1B 1FIGL 1QSFB 4Y1AE 4LSSL 5EULV 3P0VL 1V3JA 3WE6A 4YHKL 3G5YA 4ZAKC 3DX9B 3ROOA 5AG9A 2X41A 5ALCH 1QFHA 4TUJB 4JY4B 3LRSB 5DJ0B 2GCYB 1AO7E 1CLOL 2UWEF 2OR9L 5KSAA 3VWKD 3ZYJA 1X5HA 2VIRA 3FMGH 3QNYA 3I84A 3VXMD 3K8LA 3QO1B 1EHAA 1F4HA 3DV4B 5TH2B 1GYAA 1MPAH 1JGLL 5T3XE 5I8OL 1YPZF 3D3VD 3QDAA 4LLAA 2PYFB 4XPHL 5TDPA 1SVCP 5D72H 1UCBH 2Y6SD 2R4SH 1MNUH 2ARJQ 1OLZA 3NIDE 4PJXF 3GMPA 3RI5K 2WINA 2X5PA 5BZDA 4HAFA 3KPPB 4Y2OA 1D7FA 1U8JA 1A47A 4KKNA 4QT5B 2PUQT 3QHFH 5CKGA 2GUOA 1ZLSL 5F6IC 4CVZA 3WN5C 3GNML 1KB9K 4LRIC 3O4LD 3BO8B 1BGXH 4WIQA 4DW2H 2QSTA 3RVUD 4L29B 1T7XA 4PRPD 1G84A 5DA0B 4P23B 3UAJC 4DZBA 4UQ2A 4M1GH 2BVYA 3T1WA 3G5VA 4OGAC 4LMQE 4L9LB 4HBQA 5IBUG 5E5MA 4OLUH 5D7JC 4MLIA 5C7XL 1NFIB 1M7DB 3ZKSD 4NRXB 4XAKD 2V9RA 1GGYA 3O45B 3TBTB 5I1GH 5K33A 4ODHL 1TETH 2RCSH 1CDGA 2KKQA 3ZKXB 1ZLVK 3WCYA 4U6HB 1IGFH 1S9WB 4J3UA 3PIQB 3VWKB 2H8PB 3NIDF 4X6EA 3W11C 2H3NB 4R4NC 1UJ3C 5HGBA 2YC1A 2D7OA 4KU1A 3CDGA 4U0RB 3CU7A 4X7TB 2YHGA 3VXMB 4YWGL 4H88H 1CS6A 4OZIA 5C07B 1Q1JL 1MI5A 1YMHB 2WWKT 5I1AA 1FL3A 4U2ZA 1FO0A 3D3VB 4YHOL 4N68A 1HEZA 5GRVK 4P5TC 2YRZA 3VXOB 2IADB 3HA0A 3MV8E 3G6DL 5BVJA 3G5ZB 2XKNB 4U6XA 4CNIB 1AD0A 4N8VB 3TV3L 5FYJH 4M8QB 3V52L 1IC4L 4MA7L 1P4IH 1QBML 3U0PA 5JA8B 4JQVA 2DQFB 3K2UH 4WW2B 1GH7A 4DOHE 4LAQH 4GSDL 4HS8L 4CJ0A 1SVZA 2BCKA 4YDIL 1CD9B 4YFEA 1NCCH 2HFTA 1CD0A 3ZSTA 1AR2A 3GO1H 4G9DA 3D39B 3INUL 4GS7B 1SEQH 4M8VA 2R29L 5LWYH 3UC0H 1UA6L 3G08A 3KNBA 5T1MA 5FGCE 4OLZL 4ZODA 1IEBA 4NKMA 2EDXA 5E9DA 3T2QA 2BNQA 3NGBC 2H2PC 3S37L 2HN7B 4K3JL 2BOCB 3IFOA 1OSPH 1XCTB 3VFTA 2DTMH 3DROB 1Q8MA 5CHNA 3WFEH 4GKNA 4WHTA 4RX4D 2VR5A 1E4KA 5IT2L 1D5ZB 3QUMB 4XTRD 3GSVA 3RDTC 2DYPA 1L0XA 3PDDA 1MFEL 4LEXL 3X17A 3QNXA 3SDXF 4KMLB 3WXVL 1CXFA 4PD4K 4Y1AD 3K4DA 4OQTL 1B0RA 2VAJA 2QR0A 3UYPA 3KPRA 5I9QC 3QUZD 1N0LA 5JXAL 4CL7A 4IRJD 2DLTA 2R2BB 4RWYL 1EFXA 2IWGA 1AH1A 2YUXA 1K3ZA 3NCYS 7CGTA 3L7FB 3GIVA 4ZYKA 4PJ7B 4OF0A 1MCFA 2QV2A 5IW6B 2DQJH 2OR8A 2XZAL 3NFNB 4P9HL 1KG0B 1EEQA 2NY5H 3AS2A 4PV9A 5D2NB 3BXNB 1LO0H 4YDKH 1J11A 4JDZB 4YFDB 3WNOA 3GI8H 4V1DE 3RNQA 2CO6B 3N1PC 4PRHD 2FIRT 4R2GD 1PAMA 3LPWA 3OZ9H 4PJCF 3U4EB 2BFVL 1OT2A 4ZUSA 1CLYL 4NO3A 2D4FA 4I5BB 3KYKH 4MXWH 5FK9B 1YYLL 4DGYL 5T3XD 1V5JA 5T33L 3BN3B 1HHIB 1MCOL 4NN7B 5CEYA 1NEUA 5ESAA 1C12B 5JPNA 2VOTA 5IVNA 5CSZA 1BLNA 4YDJB 2OL3A 4OB5H 4JN2A 4CMMA 1I1AA 3F65A 1PFCA 1RUPL 3VXPA 1C7SA 5CMAB 3V0WL 1NCDL 5SWSD 1PY9A 3AS3A 4TVSa 1K4CB 2P45B 2YPVL 1QR4A 4PJXB 4X4XA 1TJGH 4FQCH 4CJ1A 5D1ZD 4APQB 4RGMC 1ETZA 4YHML 4JVWA 1UXSB 5E99L 4PV8B 5KVEL 3QUZB 4PRDB 2VZ3A 3Q1SH 4NCC2 4IRJB 3ALPA 1IEHA 2YK1L 4S1QH 3VGBA 5HGAB 1OWWA 1IAII 1WK0A 1HI6B 2EEDA 1Y18A 2YA1A 4G9FA 4GG6E 1FVDA 3OAZH 2EO9A 3SDAC 4R3SB 4OD2A 5HHQB 3PL6D 1JTOA 2EDBA 1I9IL 1U8LB 4U3XA 5DD5H 1F97A 3MRNB 2EDOA 3MGOB 1RSFA 3S7GA 3U0WL 2W9DL 4PRHB 4R2GB 3QXVA 1YEHL 1EV2E 4HG4J 4HUVA 4XBEL 1TVBA 5TJWK 3B2VH 3BRDA 2GYSA 5MERB 3BRFA 1E4JA 1KB5H 3BEVA 4IDJH 3MV8D 2XTJE 3PABB 3X11B 3EO1B 4KZDH 4HWEH 4OZFH 2N1KA 1EEYB 2DIAA 5HDLA 2HFGL 3VFWA 3WKMH 1JPGA 3HS0B 3S4SB 5IESL 1BBJB 4XPFL 4YQXH 3SJVA 4GRLA 2OZ4L 2YKLL 4LQFH 1T21A 3UTSB 4RISL 3O3EB 5SWSB 3WUWA 4L3CB 5DQDL 5IFAL 3MRKB 3IU4H 1KN2L 1TVHB 3L3JB 4X4ZA 2B2XL 4G80A 1C5BL 3ALXA 4NQCB 3FQWB 1P6FA 5KN5A 3LEYH 4GG6F 3ARFC 5KOMC 3NZHH 1T5WB 5E1AA 3ABZA 2PR4H 3WS6A 2ID5A 4NQDB 4NZTH 4GUPB 3X13A 1UM5L 2CJUH 4G6AD 5HDOA 2GFBB 2RAMA 4FQ2H 3Q3GB 4HHAA 1UYWH 5FUOH 4HZAA 2XICA 1OM3L 4WWKA 4BK4A 3FT4B 2G60H 2KL6A 5H8DA 1RZKH 4R90L 4F15C 4PJ8D 4LLMA 5JMRA 3IGAB 4TSAH 3PWVA 4F8TA 4M62L 1HDMB 2E6JA 5KSBE 5C8JA 4JKPL 1YC7A 5AYUH 3IFLL 2HT3D 4GAGH 2GEEA 5F1SA 2JB5L 5MENA 1CDUA 4WI9A 4NNPH 5GRJL 4XP4L 4BJLA 3VFUB 4F3FB 4OI7A 2HRPH 1F6AA 4Q9RH 3C2SA 1WZKA 3SDXB 2A6JA 1JUFA 3DVNB 2E7HA 5C0EB 2CR3A 3O0RL 5DGQA 4NHCH 4WUUA 4U1SB 3OAUH 2ZUYA 4JZNB 1MHEB 5IF0A 4V1DD 2AEQL 2PYEB 3HAEA 1RJLA 1HKLL 2X7LA 4J3TA 5E8EB 1FVCB 1FFQA 1CL7H 2XRAL 3BESR 4AY0A 3O11A 1IILE 2X1WL 4IMLA 1S7WB 4WFHD 3PWJA 4X83A 1I8LC 1L7TH 4ZSOA 3KHQA 2HKFL 3BH8B 4BSWB 3EJYD 3P4MB 3ARBC 3X12B 3BDBA 1JTPA 1V3KA 4MXQD 4OCSL 4PS4L 5KSBF 1X7QA 5DUPL 3KPSB 3WFCL 1Z3GH 5A2IH 2PXYD 1AKJA 4PJCB 2D31A 4OT1L 2DJSA 4GBXD 1XGUB 5I71B 2UVEA 3QI9D 1NAKL 5DMGD 3STLA 2BMKA 4PJAA 3IDXH 1VFMA 3TVMB 1VGKB 1Z9SA 1NLDL 5J1TC 3MBED 5HDBE 3GI9H 1ND0A 3LKSA 3ARDD 2WV3A 3BD5A 2P46B 1NCAL 1TCRA 1FFPA 2VB5A 3MA7B 4DEPC 4LCUB 4PR5A 1C7TA 5E8OB 1RV6X 1QHPA 2ZCKL 5IBLC 5T1LA 2V5RA 3GRWL 1H0DB 5KTEL 4Y2DA 1NBVH 2FEDD 1QQDA 5EPMB 2D7MA 1VFUA 1OT1A 4HKXA 2Z92A 3ZKNC 4X6DA 1T1WA 4LKXB 43C9A 3G5XB 4OZ4B 3PP4H 3DO7A 5I2IA 1A22B 2IH3B 3M1BB 2Z31C 3V8CA 3WHE0 2W9EH 4JHWL 5F72S 3RJDA 3V4VH 2CDFB 1JV5A 3KPQB 1ZOXA 4JPVL 4AZ8A 1RZIB 2YD7A 4XCCL 2NY3D 4MAUL 3TO2B 4D9RE 1MAKA 5KS9E 2R69L 3C8KA 3B8YA 4NZRH 1HXYA 4ZO9A 2RJMA 3GSUA 2JCCE 2FYYB 1U8MA 4NKOB 4NYLA 5FFLA 3I6GB 4XRCB 4YFLF 2APTA 3LKPB 5I8EB 2Z8RA 2QADD 4N0FB 3LKOB 5GSRA 2O5XH 1OGAE 4QXUL 1MIEH 2CUHA 5HDBF 3RX7A 2XTJD 3W39A 4LP5A 1UFUA 2F8OA 3LVEA 1MRDH 3K3QA 2PXYB 2C4FU 3CZFB 3T2OA 3RWGA 4BSJA 4GW5B 4E41A 4M6NL 1H3PH 1IAMA 2GTWA 2Y9RT 4HGMA 3OPZL 1BVLA 1KTLA 3RGVC 5J6HA 4ZPVA 5BQ7A 1S7RA 2UY7A 4HIJA 1S9XB 3HC0A 5J1AA 2JJWA 2ESVE 3MLUL 4WUKL 4OIIL 3LKQA 3OKOB 1LEGA 1LMKA 4MQSB 2JK5B 1IZJA 3ZKMD 4HG4K 5DT1L 3EIFA 4M61A 5TE4L 1IGIL 3RWDA 5HYIA 2X05A 1V3MA 5GGUA 2VH5H 2CIKA 1EAJA 5KS9F 1UEMA 1Z5LA 2ICCA 1JZ2A 4UT7L 3LAFA 3C87A 5HYFA 4R26H 4TUOA 4P4KD 4NNXB 1VERA 2JCCF 5I8KH 1K8IA 1OWRM 1KCSH 2OP4H 1RJZB 1G7IA 3WXWH 3PQYA 5HVWA 3O8XA 3GBMH 2NY3B 4X9GA 3WLBB 5DFVC 2I60H 3SCMD 3I02A 3LD8B 3SHSA 4ZFGL 3GSNH 1HNGA 3MV9A 4KDWA 4XNZC 5ILTL 4EJ1C 5KBNC 4W4OA 1ED3A 3RBGA 1FGVL 5SV4A 2QQLL 1IAKB 2JB6B 1XGRB 4ZUWB 3R0NA 1A7QL 2JTDA 4LBEA 5DWUH 2EXYC 4KROD 4JG1L 1CQYA 1EIBA 5E6IA 1JNHA 3H6JA 3MLYH 4BZ2L 3FT2B 5INDB 1DANU 1CE6B 3BE1L 1IAIM 2JE8A 1F8TL 5DEGB 4JRXE 5J12B 2BK8A 2X4QA 3O2VH 5BCAA 4IOFD 3D0VA 2XQYG 1G9NC 1Z6JT 3U83A 3T65B 2F19L 3L9RB 3SPVA 5D96B 1KPUA 2LABA 1QP1A 1CK0L 1AC6A 5CWSB 1TJHL 1RURH 3KPLA 3HLAA 3TBWB 1E27B 3OKYA 2D0GA 3LQAC 5CILH 4PFEA 4S10A 2Q6WA 1NEZG 2HJLB 3RA7L 4I9WD 5E56A 3FN0H 3MRGB 2AK1L 3I3DA 1ACYL 1YY8A 1OP5H 2NYYD 4J3VA 3UDWA 5KSBB 2B0SL 5I18L 3BUTA 5TFSH 1EMTL 1F3JA 5MEQB 1M6OA 2NXYB 3S34L 3D2UD 3HE6C 3MACL 2X2YA 4GMTL 2NLJA 4YHZH 5ID1B 3BYTA 5IMLB 2MCG1 3DSNA 3VFVA 1R5IB 4X6BB 2BNUA 3IDNA 4HIEA 3BP7B 3HZVA 2VLRA 3TO4B 4IIQA 2CGRL 5GRVL 4PJ5A 2NTFA 4OD1H 1RK0B 3QB7C 2V9QA 4G42B 4PP2B 5D7IA 2Q3AA 3IDIA 4WI8A 5DS8B 2VLJA 5H94B 2PTTB 1UM4H 2NTSP 3L5XH 1P4LA 4OZHA 2YSSB 4MB3A 3KYOB 5T1DL 1OGAD 5HYSA 5LGJB 3H9SE 5GHWH 1I1FA 4M7LT 4ELKA 4X80L 5J7CC 1RK1B 3LEVL 1CICA 4JB9L 3ETBF 4QNPE 4YXHL 3DURA 1G0DA 3QWRD 5D9SB 1T0NB 4OGYH 3UZEA 1JZ3A 4JPKH 1BOGB 3MJ9L 4JAMA 3ZTJG 5FYLE 3CFKA 1IL1B 2CIIA 2VUOA 4PGEB 3OXSB 2ESVD 3DMMA 4JPWL 3K8MA 5DHVH 4C56B 4OGXH 4FS0A 4K71B 4UTBH 5EU6A 5EO9B 2J5LB 4FABH 3V5KB 3MRHA 3CSYA 1CR9L 4Z0BH 5TF1L 3B9AA 4GQ9L 4UV4H 3H0TB 3QCVH 4YUEL 2WBJD 1ZA3B 4M6MH 5FUCE 3BKCH 2V2XA 5I1LB 3H3PL 4NQEE 5EBGA 5CIPH 5ANMA 2H6PB 4M9OA 3IXAB 4BQ9A 4X99B 2VDRL 5I30H 5HHOB 2EIDA 1I75A 5KVMC 4ODSH 4EXPX 3D18B 4NJAH 4ZOCA 2VQUA 2H2SD 4NN5C 4F9PC 2FBJH 1DDHB 2D9CA 4G8EA 4QNPF 3CUPA 1FG2B 1XF4A 1AQKH 2A9NH 3O9WD 2ICEB 3QDME 1MUJB 4NRYB 1SMOA 4OLVH 3U46A 1OGAB 1CGVA 3HZMA 1MOEA 1LE9B 3JV5A 3L3IA 3L5WA 3LS4L 2BSTB 4QRTA 2FZ3A 3QUYA 4PJEE 1ZMYA 3DGCR 4EIZC 1S7QA 3TT1L 1TZHA 3S88H 1QNZH 1G9MH 3HUJE 2HTLD 1IKNA 1PLGL 3MFFB 1KN4H 4NGHH 3QIUC 3ILQD 1FBIL 1GGIH 1JWUB 4XVJL 4HUNB 1DQJA 1WIUA 4LSRH 2YWZA 4XPTL 2R2HA 2AV1B 1HYSC 4NPYB 3WFHA 4L8BA 1T20B 5TPWH 3QXAA 3VRJB 4KUZL 1S3KH 2FL5B 1O7VA 1KTKE 4XTRC 3RU8L 1FNAA 2QLVB 1RUML 2NY7H 4NQTA 5DJAA 1EO5A 5BVPH 1A6ZA 4S1RH 4MQXC 3B2UD 1S9VA 5ID0A 1R3HA 3VXTB 1I7ZB 4RFEA 4RFNB 3GMMA 3BOVA 1T83C 2YD3A 2HRLA 1FLRH 1NGWB 2YN5A 4IRJC 3LDBC 3A67L 1GJIA 4J1UA 5IQ9B 3BZ4A 1AY1H 3LHPL 2XA8L 4RZCB 5GJSL 2R4RH 3DSFL 4Z7UE 1N2RA 3IJYA 4PJEF 1KCKA 2GY7B 4TNVF 1Q0YL 3BPNC 3HUJF 2MCPL 3QUXA 1G7QB 1EUTA 2QBWA 4HGKC 1UWEL 4PG9A 2WLZA 5JW4R 1INDH 1MRCL 2OJEA 1GVIA 4OCXH 4P46A 4NHUA 3ARSA 4DJMA 4KMTH 4AM0B 2F54E 3CNKA 5IOPA 2OR7A 3TZVB 4I1NB 2BY0A 5E2TL 1A02N 4PJGB 5MI0B 2Y5TB 3ARED 4ETYA 1T4KB 2W38A 1DQDH 2QKIB 3U2SB 3EDFA 5HI4D 2O5ZL 4L3EA 4LLWA 2FWOA 1J0KA 1ZHLA 1U8KB 4ELMB 5IR1B 3FOLA 1KCRH 4M02A 3BZEB 5B4MD 3ZTNH 1QKZL 1QO3A 5D1ZC 5GRZA 4HWNA 4YBHA 3C5JB 4QXTA 4Z7UF 4HIHA 3F7YB 4RWHA 3CVIL 1KTDB 2DQIL 3RY4A 1ZT7A 5GGTH 4HT1H 1FRGH 1IC1A 5BS0B 1YN6B 5D1XB 3T0VA 3TT3L 1XF1A 4XXDA 1N3NA 3VI4E 2BRRH 2IBGA 1T0MB 3U36B 3I75B 5FYLD 5DEFB 4HIXH 2CKBL 1N59A 3J7HA 3JXAA 2HTKD 4NBXB 4JFEB 2XQBH 1W0WA 4Q74A 3QT2A 3WN5A 2ICES 4ALAH 3PL6C 5GISL 5JLZB 1KNOA 2DOCA 3FAXA 1G7HA 4RIRB 1VEOA 3N85L 4EDWL 3ZSSA 1MCPH 1G9EA 2ZUXA 4YDLB 5CBEB 1KC5H 4ZNEA 2D03L 2XZCL 4Y4KC 2FHFA 1A9BB 1INEL 1IGYB 1SJHA 5D7JA 2M26A 4QRRA 2DWEB 3C6LD 4NQED 4RMUA 5CFHA 5EOTB 3MOAH 2X4SA 1A3RL 3HCVA 4FZ8H 3HNVL 3MODH 3S5LA 3NZ8B 3NTCL 1X5IA 4M6OH 4GG8B 4MA3A 3CCHB 3ARZA 3U82B 4L4TB 1NC4B 5EZIL 5HHXL 4QHMA 1KJVB 3OKDA 3QDMD 1JGVL 4WFEE 3DRTA 4ZO7A 1ONQB 3MYJA 5E2JA 4XMLL 2C1OA 2DS4A 5GS0H 3HNTL 3JTSA 4AG4H 5HYJB 2N4IA 5GJTH 1U8QB 3PWPB 5FXCH 1RZJH 4EOWH 3EGSB 3O6KL 4RNRB 5FYJE 5KANI 5EUOB 2OJZL 2O61B 4XP1H 4G6AC 4E42B 4P5TA 1ORQA 2VDOH 1G7JB 3T3PE 5A2KH 2NY2B 1ZXQA 4ZTPL 3VGFA 3BVNB 1N8ZB 1I3GH 4BQ8A 4H25B 5I19L 1DN2A 1OGTB 5JORB 1EAPA 2X4UB 4PJHB 4OLYH 1PG7X 2P43B 4L1DA 1TJIL 5BMFH 1PG7H 4PJ8C 3B9EA 2YXFA 4Z95H 1I9JH 3JWNC 3V6BR 2RHEA 4PRBA 1YEEH 3FB5B 3BJ91 1T22A 3V5DB 1CG9B 1I3VA 1I7RA 4Q6IC 3GMLA 3B9VA 2AI0H 3FMGL 5EOCJ 4XAWL 1BVZA 4L8SA 1DBAL 4M9PA 1OD9A 1MPAL 5C0BE 4JFQA 5DK2A 3PDOA 3QDJA 5EU5B 2CK2A 1MNUL 4NIKB 1F6LL 2CRMA 3REWA 1U58A 1T7ZA 4O2FA 3U0TA 4WEBL 1LO5B 3IDYC 1F42A 1AHWC 4LGRB 2VITA 3QHFL 5D71H 2GT9B 3BHBA 3IJHA 3G6JF 1HINH 3T3PF 3THMH 2X1QA 1YEKL 1BGXL 5DUBB 4JJ5B 1LK3H 3EOTH 4LLVB 4HIIA 4DW2L 5HGHB 2J6EA 4JR9L 4JFOA 4QRPE 3S3PA 2F54D 4G3YL 4M1GL 4ZXBB 4RFOL 4LQ1A 1A2YB 3EJYC 3TPUA 1WLHA 5EU7E 1J8KA 2VDLL 4B5EA 1PKOA 1AJ7H 3EHBD 3MV7B 2PXYC 1I9EA 2WIMA 1IC5H 2PW1B 4MA1C 2HKHL 4O4YL 4GBXC 5SWZE 5TE6H 3QI9C 5DMGC 3MRPB 3AXLA 5EFIB 4X6CE 5I1GL 1DN0A 2RCSL 2WAHA 4HZLA 4LVNC 1KOAA 1NGXA 1MFAH 3MBEC 1MCIA 2HJFB 4JY5L 3ARDC 4G8GE 4M00A 4XP5H 5CEXA 4S2SB 4LOUD 2IAMB 5B8CC 4J3WA 1IT9L 4YPGA 5DVMA 5L88L 4H88L 3CLEL 2GJJA 2DI9A 4BH7B 2FEDC 2I9TA 3PF2A 4EI5C 4UOW0 1AI1L 5JW4Q 4KK6D 1CQKA 2W59A 5DZOA 2XWBB 5LGHH 4PG2A 5T3ZH 4HUWA 3OR6B 5FYJL 4CADA 2F58L 1X3DA 1A6UH 1KLGA 2W0FB 3K2UL 4WDIA 4KC3B 4CAGA 3QQ4A 3ULSA 2ZG1A 3S96B 3LS5H 3GDBA 5KSVA 3VH8B 1NCCL 4DKDC 2B4CH 5D6DC 1TNMA 5I74B 3GO1L 2MFNA 5I1HH 4MS8D 2QADC 4PRIA 3WNPA 1SEQL 2VLKA 5LWYL 3UC0L 1BX2A 5DI8B 2AQ3A 5T5FH 3GMQA 2C3GA 3RWIA