3MMEB

Structure and functional dissection of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
211
Chain Sequence
ALTQPASVSGSPGQTITISCNGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PG16 HEAVY CHAIN FAB
total genus 41
structure length 211
sequence length 211
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeB02
3QO0B 2DBJA 4Z77B 4M7LT 1BFOB 2Y07H 2FBJL 3FHAA 2CRYA 5ADPL 3RWCA 3C60B 2IG2L 3QHTC 1UM6H 3HE6A 2DBLL 3QIBC 1GL4B 5IWLA 2E7BA 1FSKB 3D25A 3WLWD 3NBNA 4M5ZH 3UPCA 1IGMH 1NMBH 2YK1L 2Z93B 4LCWD 4XPAH 3GHEH 1VA9A 2X4QA 5T5FL 4GAGH 2AXFB 3N9GL 3KXFA 4Z7NE 3WD5L 3EFFB 5EZIL 1A1OB 2AV7B 3BPOB 4Z7QF 4TSAL 1RVFL 3NFSL 5FAAA 5DC4B 5EU3B 3MJ7B 2C1PB 4Q9RL 4OLXL 3LPFA 4LHUG 4M03A 5D1XC 5J9PA 5SX4I 1KLFA 3GHEL 3MACH 1MREH 5EBLB 2KBGA 3FN0H 2IBBA 4H26A 3LN5A 1C5BH 5FA4B 3REWA 4BFBD 4OZIE 5IESL 3A6BH 1HXYB 2DQCL 4M7JL 3FCTA 3H9SB 3M1BA 3QUMB 5CIPA 2GKIA 4POUB 2GYSA 4UV7L 3ALXA 1M71B 4YXHH 4P99A 4GG8A 4XRCA 1JWUB 5DJAA 4EUPA 3SKMA 2BDNH 5IR1A 1XCTB 5D7LB 3U7YH 3WUWG 1K8IB 1FL5A 3H8NA 3MLUH 4APQB 4MWFB 1JRHL 4NCDA 3SJVD 4P2OC 1MJUH 4APQD 4E41A 5LKNA 1NLBH 5E2VH 4OFPA 5CCKH 4KK6C 2DQCH 2NPLX 4XXCC 3BHBB 3OXSA 4P59H 4HS8H 1NGQH 1BEYL 1IM9B 2AQ1A 3K1KC 1TZGH 4MSWB 4OZFA 1YECH 1XF5A 4I0PC 4JANB 4M5YL 4MVBD 4AYFA 2I27N 1QR4A 4Y16A 5TF1H 1EHXA 5GGUA 2NR6D 2HT3C 3K74B 4Y5YA 1OT1A 4NHUB 1EXUA 3RKDC 4Z78B 1CD1A 5HGAA 3QUYC 4M62L 3LKNA 1A4JA 2BNRD 3B2UD 4O4YL 2VL5A 5HVFB 2W07A 2DLEA 4F80A 4IJ3C 3TFKC 2NX5D 2VLKA 5DJDB 3UDWC 4RWYH 1YEFH 3FQRA 4HH9B 3QULB 5FGSA 5DFVC 3TCLB 4UAOB 3BYYA 3UTOA 3OHXB 5DMGC 1HILB 4LOUC 4QXGL 4U49A 1LO3H 4BK5A 3SDYL 3HAEA 2VKXA 4WENB 3IVKA 5H37G 5DD5L 3CCHB 5EC2A 1Z3GH 4JJ5B 1MWAB 1A3QA 4M93B 3RRQA 4ZMAT 1QRKA 4OZGB 3ARPA 4JJ5A 4WFEE 4KY1H 5L8LB 3GIVA 5JXEC 3O8XA 4H5SA 1UKQA 1T2QH 5SX5H 5J8OA 4YXKH 4WW2B 4ODVH 3GSNL 2P8LA 4KROD 3HAEB 4QY8B 4NQEB 1FCCA 4Z6AT 1CFSA 1UJTA 4NZTH 4MJ2A 4S1SH 3BGMA 1L6ZA 3OKKA 5DVOA 4LEXH 2R23B 1YEIL 3EOYG 1BQLL 2OXGA 2V6HA 2YD9A 4OFYD 1EAJA 1YQ2A 4HG4J 4EVNA 3PJSA 5CEZD 3LN9A 5ID0B 2XQBL 3W5MA 3P73B 4L8CB 1T2QL 2PTVA 4FXKA 2VL5B 2H2PD 5E6IB 2XPGB 2WIMA 3ARTA 2GQHA 2WBJD 2O26U 2F19L 2FECL 3PDDA 4NHUA 3GKWL 4ODSH 3UTPE 1G7LA 3TVMC 1JCKA 4HXBL 5E00B 3QDMB 2IADA 3EBAA 3FO9B 1X6LA 4X4ME 4PY8I 4Z7UA 3LZFL 3KS0H 3MA7B 1CICC 4JFED 3LB6D 1C5BL 3GZKA 2HWZH 1RJYA 1NL0L 1HSBB 4EJ1C 1IKNC 1RZGB 1Z9OA 2JF1A 4PRHA 4ELMB 3D3VB 2WM0A 5CGYD 2ZOKA 3PL6A 4FZ8L 3WDHA 3EOTH 1JTPA 4DCQB 3FRPA 3H3KA 3MRCB 3T65B 4K3EH 1XIWD 2XA8H 5IKCA 1ACZA 4XCCL 5D5MB 4MQXC 4EKXA 5D1XA 5F71A 1I7ZA 1X7QB 4NWTH 4AT6A 3GNMH 5DD6A 1OARH 5L8KB 4QRRA 4LIQL 4EUPB 4HBQA 5JW5A 1AI1L 4WUUD 5ICZA 2OP4L 4HC1H 4QT5B 4P2QB 2V2XA 4LARH 3OKOB 3SDAB 4PJ9A 4QRUB 2IAMA 5DRZA 3V4UH 4RBPK 4TOYL 3QUMA 3ZT5A 4U6XB 3BZDA 5E1HB 5B39A 1T89C 1KPVB 3O0RL 3EYSH 2XN9D 4PV9B 2VR5A 1H3PH 2YA2A 3TFKD 4YNYB 3RWHB 5C08D 3HTLX 1PX3A 3P9LB 2RGSA 4WNQB 5JR1H 4WJ5B 4GG6A 4ZUVB 2QADC 4JN2A 4IHOB 3ULVH 5IVNA 4WO4D 5M95B 3ZE1E 3MGTB 5GGRY 3RTQC 1Q8MA 2C9AA 4X5LA 5CEXA 3STBA 2VO5A 4WEMB 4RMVA 1WITA 4Q58C 3D2UA 4MCYA 5TH2A 1A9BA 1S7SB 1JNNL 4KUCF 5D1QD 1G7HB 4OZGF 5HVGB 2BC4A 5I18H 3T3ME 1DBMH 1O7SA 3OKMB 1J0ZA 2QL1A 4IOIB 4ORGA 3CPLA 1J1PL 1J87A 3HS0B 4MYWB 2NZIA 3S34H 1FRGL 2AXGA 3ULVL 2XRAH 5IW3A 3HFMH 2R2CA 3MYZA 4OLWL 4Z77A 5IWLC 1J9CT 3UTSB 4LPCA 4MJIB 5BQ7A 1Q1JH 1JNHA 5L2JA 2EYSB 2GUOA 5SX4H 5FEBA 3OKEB 4FQLH 3RGVC 1IM3A 2ZOLB 5D1QC 2D0FA 5EPMB 4ENEC 4MZ2A 3TZVC 4PRPA 3L3JB 2A9MH 5T33H 3J8F7 3C6LB 4TVPH 1U8JB 3MRNA 1MREL 1JJUA 4X98B 5I1DA 2QQNH 5IB2A 4QRPE 3UTPD 3EYQD 5E7BA 5EU5A 3TH2T 3MRFA 3BXNB 1Q9OA 3STZB 3ARFB 3BYTA 5DA4A 1V3MA 5CMAA 4WW1B 7FABH 1GC1C 4CJ0A 5HHPB 1MNUL 5HYQB 4PREA 1LE5A 3GK8L 4G6KH 3C5JB 3ULUE 4ZXBA 1ZKAA 2A83A 1RUPH 3DV4B 2QQQA 2XI9A 2P24A 3WFDL 1H8NA 3UTQA 5IHZA 5ESVB 1AGDA 1RSFA 1F6AB 4H25B 4LSDA 1TZIB 1FYHB 1D9KB 4FP8H 3AMKA 3BAEL 5FYLH 2QADD 2ZCLL 1CDUA 1FGVH 3WBDA 5HI5D 4QTHA 3QXTA 4BFIB 2PYED 3O4LA 4WFFD 4HPYH 1H3GA 1MLBA 1S9YA 3UTZB 5DMKB 4N9GA 1U2HA 3GK8H 2YSSA 3DX6B 1OARL 1MHEB 3NCFB 3OJDA 4WCYH 1CTNA 4MD5B 4YGVA 3ARVA 4JFQA 4NWTL 3WJJC 3MLXH 3FOMA 5TGBB 1OTUD 1RK1A 2OL3H 2HFFB 4YLQT 4MD5A 4YGVB 4I3SH 1CT8A 5DSCB 4PGDA 2IH1A 1B6DA 3BP4B 1A7NL 4PJAE 1S7XB 2L7JA 3O6KL 4PJHE 1RZFH 1HINH 2HT2D 4IRJC 1MLCA 1FNEA 4M48L 3FB5B 1QKZL 5MI0C 1XR8B 1R3IL 3VMPA 4QHMA 1XGYH 2BCKB 4TPRL 1I8MA 4M7LH 1PG7X 4IDJH 3QIBB 4NQSB 2UWEB 5LWYH 5I2IA 1HKLL 1MCNA 5HTSA 4BM7A 3L5IA 3BOVA 1QSZA 3BGFB 2UYLA 35C8H 1ZT7A 3NH7L 4L8SC 4HCRH 3SGDI 2DQEH 2DKSA 4V1DA 2BFVL 4PREB 1LE5B 1I1AA 2CLVB 2FECI 3EZJB 1AHWA 2YRPA 5CMAB 3BWUC 3T0DA 1JHKL 4N0YL 1DE4B 5GGRA 1FLTX 1BFVL 3K3QA 4HBCL 1R5WB 4TUOA 3VWJB 2OZ4A 1QBLH 1UA6L 1OTTD 1X5FA 1QSED 3GO1H 1YECL 4KJWD 5FKAB 4G8IA 3FFCD 3MBEB 3MUJA 3ALWA 2AS5M 4M6NL 2H1PH 3EYUL 3FFCB 5FKAA 2Y5EA 4CMHC 3OKEA 5A2JH 2DQEL 3ZDYE 3RVWD 2VQUA 5ISZA 1QBBA 2F54B 5CJXA 5JXAH 3BZFA 3VWJA 3MODH 4LSTH 4RMUA 3QCTL 4MAUH 2PW2A 3AREB 4PJXF 2XZCH 5GGRB 3OB0H 5HI5C 1NCUA 4KDWA 3UTTA 4U4BA 2YRZA 4OFIA 4YJZL 2BXYA 3Q48A 2HG5B 4BKLB 3VFRA 4KHTL 5C0RL 4A6YL 3SDXF 1AD0A 4OQTL 4U1NB 4UOW0 4JDVB 3H3PH 1K4DA 2H1PL 4DAGH 1S7SA 1KB9K 4MCYB 1YYMH 3BZEB 1MFCH 4GMSH 2EEDA 3FT3A 5CGYC 1K9TA 4FQ1H 4R0LC 4HLJA 1I1AC 4MB5A 5C07E 3I2CH 4APQC 2X89D 1HHIA 4PJFA 2GJZB 1XR8A 3BGAA 1N64H 1FZKB 3L7EA 3EYQC 1C16B 2YWZA 1QRND 3WO3B 1JK8B 4HPOL 2DMKA 1I3GL 3U82B 5F88A 1JNJA 4P4KA 3P9LA 4F7CB 2V7HA 2P1YA 1IILE 2VDNL 5TGBA 1Y0LB 4JFQB 3TT1L 4PJAF 1MY5A 1MHEA 1FLRH 3GSWB 3OJDB 3DX6A 4O02H 5EZJB 3QWQB 5IBTL 4BFEA 2W0LA 4MNQD 4UV7H 3ORJA 4PJ9B 2K7PA 4QRUA 1MF2H 3UTZA 3FQNA 2N7AA 4E9LA 5GGTL 4KU1A 1VFUA 4OCYH 3GMQB 1KB5H 2FZ3B 1X7QA 4AT6B 1UACH 5D1XB 1IEAA 2OLDA 2N7BA 2AEWA 4MA3B 3H6JA 4RQQA 4IJ3B 3OMZA 3FQWB 1KOAA 1RUMH 1AGDB 3ARWA 2P24B 4U3HA 5I71B 4ONFH 1HKLH 1DBBH 2NXYD 1S7RB 1RJYB 4ZXBB 4I2XE 5C0DB 1A5FL 2QSTA 4HGMA 3U0PA 4QHUA 4G5ZL 3AB0B 5HHPA 1L0YA 3IDYB 1HDMB 4K9EH 4NKQB 5I1AB 3OKDA 2BRQA 1Q9OB 4IRJA 5DUPH 1G7JB 1MHHA 1LO4L 4KJPD 5EU5B 3ULUF 4PJEB 3EYFA 5C07B 2FLBT 3CFCH 3S37H 3WMSA 3C6LD 4C4KO 4LSQL 5H94A 1INEL 5HDQL 1Y6KR 3TJEH 3CNKA 4UOW1 4CADB 1YEFL 5DXWA 4M7KH 3KPQA 3R1GH 4JKWA 4CNIA 5KJRH 1IM3B 3VWKD 4BH8B 4HMCA 2HN7B 1N59A 3UZEA 3KLAA 1X5XA 2CIIB 1VGEL 3BGMB 1DTUA 1JNHB 5L2JB 4MVBC 1KPRB 1DQQB 5L0QB 2W0PA 1FE8H 1U8LA 4Z8FL 1NBZA 4AIXA 5T1LB 1S9KC 4U05A 4JFYA 1D6VL 3QG7L 4KK6D 4F7PB 3HS0A 3CMOL 3CPLB 4MQXD 4S1DC 1T2JA 3O6FA 5EU7E 4ORGB 1NDGB 1F45A 3ULVC 1KSRA 3O2DA 5CLTA 5D1QB 2HT4C 5CJQL 1A9BB 3OHXA 4XC3H 3BI9X 4MDIA 2X1PA 1XMWA 4P2RB 2Q7YA 2RCSL 3FQRB 4HH9A 1MCLA 2CK0H 1QACA 1UXWB 5DJDA 4W6XB 1OGAD 1X6NA 3BPCA 4RZCB 3FKUS 4ZUTB 4G6JL 4I2XB 1GGIL 1OL0A 3SDCC 1EMTL 1DL7L 4TRPL 4AZ8A 2EXYC 1NUFA 4N8VB 3RWGA 1J8HD 4H88L 5B38B 3BFOA 3LEYL 4Y4KD 4GG6B 4BH7B 2DYPB 1EZVX 4WNQA 1INDH 1NGPL 4V2BA 2B39A 5GGUB 4RDQF 4MXQC 4R8WH 4Y8DC 5L9DL 1JZ3A 1U42A 5I74B 1YMHB 4DN4H 4OCNC 2EC9T 3BHBA 1AY1H 2FCBA 3OKOA 3CFIC 3SDAA 1LEKA 4Q9CA 2PO6B 4QT5A 3HC4H 4XZUB 3MOBL 3TM6A 5DMIL 1EEZA 2IANB 1WBXB 2C7UA 1DZBA 5GIRA 3DBXB 2P42B 3EDDA 5HDLA 1WBXA 2C7UB 3V6BR 3GJFK 3ZE0F 3MOAL 2L0DA 3MGOA 5DJAB 4GG8B 5GGTH 4BK4A 5GS1B 3X13A 4ERSL 1I9JL 4PLJC 1IZJA 3SCMD 1YMME 3GM8A 4OKDA 5MENB 5I1GH 1HSBA 1GC1H 2EO1A 2FJHA 1VFBB 3H9SA 4R97C 2VDPL 1AH1A 3HMXH 3U7WH 5B4MD 5IESH 3G6JE 4ZS7H 3WNLA 2CH8A 5L2KB 4DQOH 4M8QB 3NCMA 1KFAH 2ZNWA 2DYPA 5J57B 3N1FC 1JV5A 3VG0L 1MIEL 3LH2H 5B38A 1GGBL 5F7YC 1VPOH 4G6AC 2C3WA 5T5NG 4GS7C 4JJHA 4HZAA 3EOAA 3FB8A 4FXKB 5E70A 3D9AH 4LRNH 2FO4B 3IJSA 5BMFH 1OTTC 3MV7E 5EU3A 1VESA 3RAJH 4M6NH 1UXWA 1JFQH 2Q7YB 3HRPA 5BS0B 3QUXA 1I8LC 3BPNB 3OKKB 1CDIA 5E2VL 5CCKL 1G6VK 1W72L 2OTUA 3DSFL 2EXWD 1TNMA 2XTLA 5F3BA 2X4QB 4QY8A 4WW2A 3CVIL 4I48A 2QJDA 4RNRB 5C6WH 2KQNA 1UKTA 2X9YA 5D5MF 4AENB 5GHWH 5F7LB 3HE6B 4WI3A 4DGYL 2CDGB 3WNNA 2X70B 5DYOB 4JFYB 3QIUA 4JO2L 3IDGB 5I8CA 3LD8C 1T2XA 4IRZH 2DWDA 3DVFA 3VXTA 5IMMB 3MV9A 4JRXA 5L7XH 3NH7H 5LVEA 1KPRA 2QHLA 1FYTD 1KJMB 2CIIA 1HQ4A 1RUAL 3JV6B 4XBPB 5J6HB 5TFSL 4G9FD 3S5LA 1N59B 1HWGB 5AEAA 1U91A 1DSFL 1QRNE 4YHIA 3VA6A 3WIFA 4JM2F 3ROLA 2PNDA 1VEPA 4F3FB 3H9HB 4GLRH 4LMQI 2JELH 1BFTA 2FB4H 3FQTA 1HH6B 4OF5A 4MA8L 2WBJA 4PJEA 3F7PC 5HGAB 2IG2H 2AK4A 1MHHB 4IRJB 4AL8H 1XEDA 4XI5C 4D8PB 1JF6A 1HDMA 4FQCH 3VMNA 5K59E 4FZEL 1NAML 2HRPL 5DVNA 4JANA 4PD4J 1CGSH 1Q0YH 5EOQH 3WHE0 3LV3B 3L3IA 4L1HA 5IW1A 1T80A 5GGVY 1SM3L 1KCSL 3GJFH 4GMTL 2BVEA 2J1KA 4GRLC 4ODVL 3VFTB 4B7IA 4E41B 3L9RA 3FQWA 3EO1A 3S35X 2VIRA 2HVJB 1DQJB 3WUZA 3D3VE 4NRYA 5D7LD 1NGWB 1TVBA 3TH4T 3GRWL 2FZ3A 1JIBA 5BV7B 4XMLH 4L8BB 1JWUA 3MXWH 3R8QA 4NC1C 4G6FD 5CIPB 3EYOB 5EN2A 1L9MA 3IRPX 1MCOH 1RZKH 3MTRA 3EGSB 2BHUA 2FBJH 2O5YL 1KB5B 1PAMA 1XF4A 2V17L 4MMZC 2V7HB 4YXLH 3REWB 1PD6A 2DKUA 3FO1B 3P0VH 4R4FL 3MLUL 1JK8A 3DHJA 1J86A 1G1YA 4E0RB 3B43A 2DTSA 2G5RA 1A6VH 5F7UA 5EZOL 4DTGH 4EN3D 4GAGL 1U8QA 2N1KA 1NFKA 2DN7A 3LVEA 3GRWA 5INDB 4PJFB 4TNVK 1KXQE 1TQCB 1NGZB 1GIGL 2W92A 2OR9L 1MELA 4F58H 1XF3A 1TJGH 3V5HA 5A3IC 4MCZA 1A1OA 1NC2B 4ZXBC 4KV5E 3ULUD 3RGVA 2VZ3A 3WFBL 1DLHA 4M6AA 4FQ2L 2NY2C 1B90A 5TE4H 1IT9L 2F53B 1ZLVH 1QQDA 3RDTC 3RY6C 3VG9C 1I7TA 3C60A 3S97C 3DUUB 1T4KB 3QUML 1GVIA 3GMPB 4P9MH 1LMKA 3AREA 1NC4B 2PW2B 3A6CL 2QQLL 4W4OA 3H2WA 4I18C 2R29H 5E94A 3U7AA 1CE1L 4FABH 4JO4L 1IVLA 4MXVF 5T3XE 1K85A 3JZ7A 1X5ZA 5IMOB 4Z7WA 3U0TB 4WTZG 4ZS6D 4ZAKA 4LVHC 1OTUC 5IHLB 2VDRH 1ZS8A 3QNYB 2DTML 1RZFL 5GS0L 3KAAA 4X8JB 43CAB 1MWAH 2GJ6E 2LU4A 4ODBD 3R06B 4TUOB 2CKBL 5SWSA 1DE4A 1MFNA 4OKVA 1PKQB 1RK0A 5TE6L 4HUXA 3QUYA 5IQ9A 4P3DA 3S34L 5CWSA 4J7RA 5EU6B 3LDBC 4Z5RA 5F7EH 1I1AB 4GW1A 2C3XA 1WICA 3CZFA 1CU4H 4E42B 2W91A 2ZWLT 1YMMA 4QLRA 1CFBA 4PB9L 3TN0D 3ZKMC 4UUJA 2NY4B 3UEZA 2D7QA 2J7LA 3HNTL 2VLJB 1U95A 4HFWA 5HI3C 3MUZ1 4QOKB 1DBKH 4JKPL 3I2CL 4OCWL 5I2IB 3QIBA 4NQSA 3MRRA 4DKFL 2E7LC 1KCVL 2X1QA 1FZOB 2IGFL 3VXSB 1MFCL 3QDAA 2BCKA 1HZHL 2Y07L 1T22B 3TNNA 3GSRA 1IAOB 4NM8H 1HIMH 4NQXA 1V7NL 4DKAA 3P0GB 4M6OH 1SMOA 1U8KB 4HPOH 4PB9H 3I02B 3KPSB 1FFOB 3BP4A 4UU9A 3BP5A 2LU3A 2Z8RA 4IEFB 4ZQKB 5H35B 3RA7L 3SE4C 5DJZA 2G9HA 4ODHL 2UVFA 3CFEA 3EYUH 4NQDA 2YN5A 4GRLA 3UCRA 1RK1B 5E8NA 5E99L 5D5ME 4BSWB 1FO0B 3EJZC 2C26A 1MCOL 1RZKL 2YXFA 5HYIA 4OM0H 4OCWH 3PHQA 4PJIB 4HUUB 1UWGH 2ATPB 2XT1B 5DMKA 4WU5A 4KJPC 3WFZA 1J11A 5CHNB 4KKCC 4QTHB 4TSBL 5EULV 1TTUA 2IPUG 4N8VG 2PXYB 4WHCA 1S78D 2VXVH 1F4WL 4Y0GA 4AK1A 1F6AA 5IK3A 1HYSD 3DSNA 1FVDB 4HKXB 3QEUB 2H41A 1UB6A 5ILTL 1VFOA 1JPSH 3R4DA 3ES6B 3TO4C 1EUTA 3RPIB 4Z95L 4UT7H 3U2SB 3RWEB 2CO7B 4DN3H 3DO3A 1FCGA 3DVGB 3HE6C 1RULL 4LNVA 2WSKA 4KMTH 1RD6A 3N1PC 4ZOAA 3BRDA 5KVFL 2E27L 4I3SL 5I1DB 2B2XL 1CG9A 3MLYH 1S7QB 3ZE0E 3LKSA 3A6CH 4P4RA 3NZ8A 3O4OB 3C5ZC 1T21B 3QDGE 3TPUB 4L4VD 2ARJB 1WZLA 1G7QA 1PSKH 3RZCB 5EPMA 4Z95H 3TT3L 2VLRD 4XNXH 5KSBF 2AQ2A 1S7VA 3LEVL 3TC9A 1G0XA 2DM3A 1O7VA 4G6MH 2EDKA 4AH2A 1WFUA 1XGQB 3RVXC 3FOLA 2FGWL 3L3OA 4IOIA 3OAUH 1MRCL 3IJYA 3ARSA 4GXVL 5HGHA 2YC1B 1YEEH 3RVVC 4YDJB 4NT6B 3L3KA 4KQ3H 1JNLH 1J1XH 5C0JA 2NW2B 3VRJA 2Y9RT 1F8TL 1KIQA 1NSNH 2ORBL 5CEXB 1SYSA 3LKRB 3DO7B 3PWPD 5L2KE 1I9RH 5EIIA 5E8DH 4QWWD 4XX1E 15C8H 5CP7A 1AP2A 3FQUB 4GRWE 2J6EL 3HI5H 4XT1C 3G6AB 3X12B 1FNGB 2AJUH 3GSXB 4ZSOE 2ITDB 1RFDL 1JPTH 4P23A 1HIML 1DBML 1DANT 4Y4HA 1QR1A 3QFJB 1NSNL 1F90L 3U30B 3RKDD 1XF2B 2DI9A 5F1SA 3B8YA 2WANA 2OR8A 3MLSH 1Q72L 2FHFA 2W9LA 4OLUL 5JHDA 3ULUL 5FECA 2V2XB 4J1UB 2MHAB 5D6CB 4ZFFA 4UIMA 4FQJL 4LSRH 1UGNA 1FNSH 3VD5A 4WI5A 5SWSE 4U1KA 4XCEA 5A16B 5ITBL 1AJ7L 2AJ3A 3F7VB 1OW0C 3EFDH 3I6KB 4BYHA 2YS4A 3VG9B 3T65A 4YBLC 3MRCA 5ACZB 5FIEA 1CBVH 3TBYB 1A7QH 1T0NB 2CMRH 1ZVHA 4UV4L 1CIUA 3EHBC 3QAZC 2ZOKB 3KG5A 2PF6A 3D3VA 2ATKB 1TETH 5IMLA 2UY7A 3U46B 4RGNC 5CEZL 2NY5H 2IPTH 1F4YL 2EIEA 4K8RL 4YK4C 3MA7A 4HK0A 4PRPE 4R2GB 2XN9A 1M7DA 5GGSY 3MXWL 3IS1X 2DQIH 3BEWB 4HIHA 4GQ9L 3I84A 1BJMA 1J12A 1RMFL 2R69H 3KDMA 4GAYB 5TDNA 3WUWB 2WQRA 3WE6B 2UVEA 4B41A 3FO2B 1IEBB 1N5AB 5CJ8A 3J7HA 4LPXA 5KSAA 4JQIH 4ZOCA 3WFEH 1RAMA 3FAXA 3B9KC 3I50H 1RPQA 1JGEB 3PJSB 4OD3H 1T5XB 2F5AL 1QYGH 5I0ZA 3DV6B 4CDGC 4ODUB 4O4YH 4U1SA 1NDMB 4HLZG 2VH5H 1A6WH 4LLVA 3TNMA 5BO1H 4Y8AA 2Q8AH 5I15H 1IQWH 1QBAA 1CF8L 4G7VH 3OKLA 4H5SB 4NC1E 3O8XB 4OZGA 1NEZA 2Z8SA 3C2AL 2O5ZL 5HYEA 2V2WB 1XGTA 1ZVSB 3MR9B 5EC2B 1I85C 3TZVB 4G8GA 4WI7A 1TDQA 4U0QB 3CXDH 4ETQB 1MJUL 4WDIB 2YD4A 3EDKA 5D4QA 32C2B 5DD3L 2R1XA 5HY9A 3PGCA 5KJRL 3B5HA 1KPUA 3KNBB 4QHNA 4YUEL 3KXFE 5B4MC 5IV2A 2VLKB 3QCUL 1J05B 3KYOA 4OZHB 3C9NB 5EU6D 2VLJE 3QR2A 4PJHA 2WINA 2XRAL 3QUZA 4K94L 4XNQB 4NO0D 5GGVH 5DHVH 3REVB 2COQA 4NO5B 4LF3B 3MRBA 4W70A 4Y16B 5E2WL 3P30H 1OCWH 1SJVA 4K23H 4HT1L 1ZEAL 1A7RL 1I7RA 3F62A 1DBAL 1DDHB 1F4XH 3MJ9H 3OXSB 4U31A 5IOPA 4OV5A 3SOBH 3HE7A 2APBA 3MA9L 4XP5L 5EBMB 1CZ8L 2VXSL 4YHLH 4WU7B 5ALCL 5IJKA 2E5EA 4M1DL 4X6EB 2VITB 1MCBA 1A4KB 1T1XB 2CK0L 5D7LA 2YPLB 3PHOB 2XFXB 3KPNB 5EZIH 5IR1B 4FG6C 3MRDA 1A1MB 4ZUSB 2F53D 3EZ8A 3HI6H 3K80A 4H8WL 3HRZB 3RL1A 4I77H 4JDZB 5D7SH 3FT4A 3MRIB 2JIXB 2R4RL 3MLVL 4I3RH 5CILL 4G8FA 1PY9A 1NC2D 4ZS6C 4PRIE 1E27B 3V0WL 1QHOA 2XQYG 3U6RB 3DX8A 1ADQH 4XVSL 1BQLH 1CXIA 4LEOB 5KAQG 4OB5H 1FAIL 4NNPH 5FA4A 5FUOL 2KQMA 2Y25A 4YIQB 1JVKA 3NAAH 5I17A 2AJZB 5IHUL 2JB5H 2QSCL 3TESA 2HMIC 2UZIL 3MJ7A 1E6JH 4JRYD 1MOEA 1XH3B 1GPOH 1IGFH 4XC1H 4FQ1L 3P9MB 2EH8H 1ZA6B 4YC2C 5ANMA 1OLLA 2ESVA 5TQ0H 3MBEC 1N0XH 3WO4C 2HWZL 3UBXA 2C3GA 1FYTE 1TQBB 4IM8A 1LILA 1EVTC 1XGRA 2DI7A 1GGTA 3TGXA 2X9XA 2J8OA 4GOSA 4LCWA 3VXNA 3O3AB 4P23C 1ROWA 3WNKA 3V4PH 1LK3H 5BV7L 1GPOL 1IGFL 1JGLL 1KTLB 2JJUA 1BFOA 2RJMA 2HMID 5CZXD 1DVFD 5ICYA 4XBGA 3C6SA 2PKDA 2PW1A 3VI3E 4NN6B 1MAML 4WY7H 1VPOL 2R4SL 3IKKA 3MBXL 5TPWH 3L3HA 2ED8A 5JNYA 2XNAA 2FJGB 1RU9L 1TTGA 1KB5L 3V4PL 3IFOA 1TPXB 4WHDA 1URLA 4WV1A 5DHYB 4IMLA 4YHZH 1DN2A 5FDWA 5KTEL 1EX0A 3VCLA 3VGGA 5KVFH 3U0WL 3VWKB 4KI5E 2XZAL 4HV8B 2NY1D 3RWFB 3SDCB 4U7MA 1AXTH 2H26A 3HC0A 1HH9B 1DQDL 5F7EL 4K9EL 4N1CA 5D70L 4BQCA 2VLRB 1RJLB 2OX5A 3QFDA 5I6XC 3QEGL 1ES0A 3BDYH 4QO1A 3EJJX 1YNKH 1CD0A 5GGSB 2ITCA 1GGIH 2LTQB 3EO0A 5DF0A 5E4IA 1H5BB 1A7RH 1IFHL 4PJCE 4ZODA 4XAWL 3PE9A 4LLUB 1NBYA 4YHZL 4CMHB 3VXPB 1OF2A 1INEH 3RX7A 5AG9A 1ZEAH 3RGHA 2GTZA 3LQAC 4NSKA 1FNHA 4PG2A 3QBTB 1KEGH 5E8OA 4M43H 4TUJA 5CSZB 4ZG1A 4PJDE 3ESUF 3HE6D 4LK4A 4GXVH 1T5WA 1AE6H 3V5DA 2PTUA 1P5UA 1UZ6F 3T0EA 4L29A 2PR4H 1YEGL 3GKZA 2MQ3A 1UKSA 1VACA 4IIQA 4NYLA 2IEPA 3PP4H 5C0CA 3VFOA 2IBZX 3IB4A 4GMSL 1NGXA 3GJFA 5BZDB 5ENWB 4DGVH 4NDMA 4DZ8A 5E2TH 3MV8A 1EO8H 2MTPA 3D1MC 5IEHA 5SWZE 4UQ2A 2QLVB 2HKFL 5KBNC 1NMBL 1IL1A 5C3TA 4NUJB 1BQHB 2A6IA 3HMXL 3VGDA 4K3JL 4OSUH 4U6TA 2OYPA 5I1GL 3NTCH 1KNOB 5LGHH 2XG5A 3AY4C 4L4JA 1E6OH 1RUPL 2D0GA 3HPJB 2DLFL 3G6JB 2I07B 1WEJL 5F89B 4BZYA 1IGIH 4PB0H 1CD8A 4B53A 3OKYA 1EUUA 1U8NA 1JPSL 3T4AA 4LRNL 5BMFL 1S7UB 3FN0L 4JPVL 4OM1H 4XVUD 1G9MC 1BD2D 2A74B 4LSVH 2D03H 4PJXE 5FYJL 4LCCB 5CEYB 5FO7A 4YQXL 5DK2A 5D7IF 4QOKD 1I3UA 3O2DL 4GQ9H 3TIDB 2B4CC 4MJIE 5C92A 4B0MM 4N0YH 5DRXA 3E0GA 3H7BB 3LS4L 3QQ4B 4M9OA 3DTXB 3LKPA 3U30C 1Q94B 3WHE1 4G5ZH 1H8SA 2C3HA 1A5FH 2EYTB 5KS9F 3E8UH 1ORQB 5KSUA 5LQBH 1W8OA 1F58L 1U8MA 2YA1A 4EI5D 4PRDB 4RAVA 1WC7B 2A6JB 2MCG1 1QVOA 1PZ5B 3CFKB 4GKSA 5C0IB 3QI9D 4IRSC 3CDGB 5EZLB 2X4PA 1YEEL 4J3TA 4HUMB 2Y72A 1YN6A 3QRGL 3CLFL 5DDHB 2NX5E 1V3LA 4RRPA 1S5HA 1WAAF 4F15C 5IJKC 2R1WA 4P2OA 5I76B 1CXHA 1F02I 5JA8B 5JW3L 2VLME 3VDCA 2VZOA 5DD3H 3G08A 4ZUUA 3CSPA 1MFDL 2VWEE 4MQ7B 4MNHB 4JDTH 3QEQA 1EAPB 1FVEA 4UNVA 4H0GA 3OZ9H 4NNYA 2G60L 1CFQB 3IDMA 3TT3H 1BF8A 1UEMA 2DLHA 2FX9L 4KHXH 2H6PB 4PJBA 4JG0H 5GHWL 1GOFA 1FG9C 3MRJA 1EGJH 1QFOA 3ROOB 5J89A 3U4EA 5KZCD 4XMPH 5GSRB 2NYYC 1LEGA 3RWDB 4PJ8A 4NRZA 5GSVB 1F3JB 2DL9A 4KTEL 3X11A 4PP2A 3QH3B 1KJVA 3P9WB 1YUHA 2IGFH 5HGBA 2IF7A 1D5ZA 3GGWA 1IBGL 4MHHI 4L4TB 4P2RE 4RDQG 1SEQH 4LCYB 4PR5A 5FKPA 4YHOH 3VFPA 2PYEB 4HDIB 2GTWA 3WS3A 3HN3A 2NXYB 3GJEB 4F7EB 3IXAB 1YPZE 1Q38A 4YHMH 3KYMB 3LEXB 1F13A 4NWUH 4X6DB 3RWIA 4AEHL 3F7RA 1A6AB 3IAGC 5E8DL 5I9QC 1A3LH 4MD4B 1NAMH 2HRPH 4LKXA 5K59F 3HNSH 1HHHA 3ILPB 4X99B 1JUFB 4LRIA 3GKWH 3MLTA 1G6RA 3MRGA 4ELKB 4DUXA 1I9JH 1KELH 4WUUA 3CMGA 4XP1H 4D2NA 4EN3A 4U2ZA 2AKRA 1VDGA 3AAZB 4LVNC 5DJYB 2QSQA 1CL7H 1FDLH 5I8OH 4HWZA 1VSCA 5F7MC 3N06B 4Y4HC 3NZHH 1NUGA 2BVYA 2O5XH 1N3NB 1A6ZB 1J7VR 4GUPA 3DX7A 1A7NH 3NCCB 3BUYA 3X3GH 4L3ED 1OGAE 2VXVL 3GSOA 1K8DA 1YY9C 2QQLH 3BQUD 5AAMA 1U58B 2J88L 4UINH 1KV3A 3HUJF 2VKWA 3HZYB 5F7HA 2YPKA 4IDJL 5C09D 1V8HA 5T1KB 4PG9A 2O61A 3PV6A 1AGEA 1CGVA 2NX5A 4S2SB 4HS6A 1A3RH 1JMXA 1OAKL 4MJID 1A9EA 1EO7A 2XKUA 3T3MF 3GB7B 4HC1L 3BKML 3HR5B 1BD2B 5HYSG 4OD2A 4XAKE 5EORL 1W72H 3KLHC 1A6PA 4OGZA 4RGOL 5DQJB 3WIHA 5C0CE 1L6XA 1MCJA 3OXRB 3F5WA 4OFYA 3X3GL 2D9CA 5KSVA 3WL9A 4D3CL 3QEHA 1XZ0B 4WTXA 4UT9H 2R9HC 2Y7QA 3RUGB 4KKLC 3D48R 4XC3L 4F7MA 5KN5B 5IBUG 4F9PC 2GY7B 1QO3B 1FFRA 4HIJB 4KWUA 2IBZY 4TYUA 3OGCB 4NFCA 5AZEL 3WSQH 1I4FA 1I8KA 4RGMC 1A3RL 1QA9A 1ZSDA 5JHDD 2GAZB 4LL9A 1SYVA 3O11B 5LBSH 2VJXA 2FATL 2VDML 5I30H 3BRGC 4JFPA 2FX9H 2XWTA 4KHXL 5EIVA 1SY6A 5F9OH 1FZJB 3PWJB 1FQ9C 2ZUSA 4JKMA 3VD3A 5JUEL 5DC9B 3PABA 3KYNA 3FRUA 4N68A 4WGVB 4HJJH 4LCCC 4OZ4B 5EO9A 2JB6B 1FRGH 3BEVA 3BPLB 5D2LA 3TIEB 3PWLA 1YY8B 3BH9B 2HH0L 1RQ5A 5DLML 3TO4A 1C1EL 5D72H 1TVHA 1OY3B 3IU4L 4ZTOL 2Z31C 2MFNA 1SVCP 5BVJA 3W82A 1B2WH 3DXAA 1RI8A 2D7OA 2VXQH 4QEGA 3NIGF 3FB6A 4ODXA 3RPKA 3MMEA 4FFVC 5DD1H 1SM3H 3DIFA 2LQRA 4D0CB 4ETYA 5T33L 2V9RA 4RGND 3QIWB 4OZHF 1ERNA 3LMJL 2Q6WB 1L7TH 1AQKL 2D31B 1YEDA 5E1AB 3IDNB 3VXOB 1NMCC 4JHAH 2EDNA 4R97B 2LFGA 4JO1L 4L3EA 3VFNB 4ODWB 4HQQL 2IAND 2CKNA 2QKIB 4IOFD 3DMMD 1YEJH 4LCIL 2OJEA 5KZCB 4QRQB 1YPZB 4FZ8H 2YUVA 1OB1B 3SDCD 1U6AL 4G3YL 1B6UA 1JYXA 4YHPA 3RY4A 5IROC 2ICWA 2X1XR 3HI1A 3NMEA 4G9FE 5E6ID 4JZJB 4GBXC 3A0OA 4KRMB 3TYGL 1MF2L 3P4MA 2CLZA 5K9OB 5DJXA 1OAXH 3STLA 2DQJH 4G9DB 4OCXL 3CSGA 4NZUH 1KJ2L 4PJGB 4YHYB 2BNUB 5BXFB 3D39A 3G5XB 3TEUA 5JLZB 2G2RB 2OQJB 4YDKL 5IFAH 4CVXA 1XFPA 4PY7B 1B0RB 4MQTB 1L9NA 1RUQL 5HHMB 2BSTA 2EDDA 5J11C 1TJIL 2R4SH 5ALBL 2XXCB 4GRWF 1C12B 5IJVA 1Z5LB 2R15A 3G5VA 1LEIA 1GAFH 1P4IL 3T09A 4Z7VA 2EECA 4BQ9A 2X10A 2W0FA 4WWKB 1ZT1A 4FTVA 1KGCE 1BOGA 4JFOB 3P11L 5EOCJ 5HXMA 1A14H 2BXZA 4ZOBA 4AEEA 1F11A 1KN4H 1TITA 5DK3A 2DM4A 3RU8H 4PGCA 5IFHH 4YDVA 1IGTA 3AXLA 2BJML 4PJAB 3NGBB 4BSVB 3GMMA 3JTTA 2FL5A 4HZLA 4I13B 4ONHB 5FB8B 3FFDA 3GNML 5EFIB 1CFTA 4JLRB 2ADIB 1GHFH 1PY4A 2GFBA 2WLZA 1UCBH 2NY7L 4L8DA 4P46A 1F58H 3E3QC 4Q2ZA 2X05A 1YYLH 1BGXH 5KS9E 1A7PL 4FFZL 1P7KA 5DJCA 3TO2A 1GZPB 1PJ9A 5MHSE 3F7YB 2CIKB 1FNLA 4NQCB 3DURB 3LD8B 4EI5A 5ACMA 1JE6A 1IC7L 5HHXL 1JWSB 3BO8A 2CUIA 4R0LB 5EUKA 2JCCF 5HYJA 4NJ9H 5FK9B 4NKOA 4QRTA 1IGML 4HGWB 5GGVL 4NRXB 1JZ6A 4HK3J 4K3DH 5F7FA 1BOYA 5CJOL 1OP5H 3GSUA 3TVMA 2ERJB 1WBYA 1CIDA 1M05A 4RMTA 3LY6A 2DJUA 4PV8A 3S3SA 1Z3GL 4HUVB 3B9KA 5FYJE 2WUBL 1E4JA 3KPOA 5JDSB 5TFSH 1E0OB 4MJ6B 3KHOA 1YEIH 3U1SH 4YBQD 2BOCA 1CZ8H 4H1LB 5AWNH 3O6ML 1EFXB 2DQUL 2VLLB 3AREC 3GSNA 5T1MB 2YMXL 4QHLA 2DQGH 1BQUA 1MQ8A 3MRPB 2AK4E 1D5BB 3PP3H 5INCA 2VAJA 3QEGH 4YZFF 1IC4L 4C83A 2IQAA 1EEYB 1N4XH 5C08B 4JCLA 5FHBH 3SDXA 2IH3B 4ZAKC 3EJYD 5JOFA 1B88A 4M3KB 4HIXL 1KF9B 4H1LG 2NZ9C 3CXHJ 4LAJH 1XT5A 2Z9TA 5KS9A 2AK1H 1HXMB 4KRLB 5H2BB 5IIEB 5CEZE 3VXQB 4JRXE 2ZUWA 1BX2B 3OPZH 4GKNA 1WIPA 1W0WB 4H20H 4AIZA 3IAPA 1AGCB 1MI5B 1UZ6E 1IAKB 5D6DC 4AM0A 4AIOA 3TZVD 1FAIH 5FUOH 3TBWB 3RX8A 4Y5XA 4NO3B 4XVSH 1I1AD 4QRSB 3VFSA 2HA1A 5AYUH 5GZOC 4YO0A 1WFTA 1CICA 3C60D 5ESQB 1KFAL 4CGTA 1MCCA 3ECBB 3EDFA 4QXTA 2GJ6A 4RWHA 2PYFA 3C09C 3NCJH 1OD9A 3LSOB 3ZKMD 5DJ8B 4DGIL 5MEQB 4C56E 1IARB 4RFOH 4G7YL 4PS4H 1NFDE 1FV1A 5CEZH 4LNRA 3GSVA 2OP4H 1XGUA 5HGGS 5CP3A 4JVPA 1T0PB 4X7TB 1RULH 3NCYP 1OSPH 3QWRD 4HIIA 1SY6L 4KVCL 5F7DA 1MHCA 1I3RA 3JTSB 2ZSVA 4YPJA 1W8NA 2YBRB 3VGAB 4L4VA 3UJIH 1ZLSL 3CFBA 5C0GA 1XGUB 5AAWA 5EA0L 1MJJA 2OMNA 2X89A 3MREB 1QSEB 3MLWL 5CUSL 3G6DL 3O3BA 4RFOL 3SJVA 3C8KB 3HHRB 3PWUA 3QHFL 3F12B 2NTFA 1SEBB 4I0PB 4K8RD 2LU7A 25C8L 1KN2H 4UTAH 3KYKL 1HQRA 1Q9LB 4N8CH 3G5YB 4CRPA 3L7FB 2ARJQ 2ID5A 3TBWA 5DURD 5HHVL 3QIUC 4NO2A 3U36B 5J3HD 5KSBA 1W0WA 4AIZB 3I9GH 4X9HA 1WFNA 5F21B 4KKNA 2NY0D 4ZNEA 5J6GB 4JPWL 4NP4L 4FXGA 3T0EE 4XPHH 5KS9B 3B3IA 5A2KH 4X4XA 5IG7A 5FYLD 4CL7A 1BBDH 4OI8A 3AU1B 1HHJA 2IH3A 1T83A 3IJHA 1QRNA 4MDJA 2BVQB 3QG7H 3SKUD 3HI6L 4C83B 4G6FB 1WFOA 3DYPA 3OTTA 1F90H 1FO0L 5DURB 1HHGA 1RFDH 3OGOE 1P84K 3DETC 5CD5C 5TDOA 5C6TH 4E5XA 5TE7H 3QXDA 1LO5A 4R3SB 4NQEE 3L3DA 1V7ML 1NPUA 4MD0A 3PWPB 1ETZA 3QAZB 4M7ZB 1U92B 3CC5B 4K2UL 4Z18A 4JRXD 4PYGA 4OF3A 1HI6A 5F1NB 5EOTA 5C71A 1LO0L 1GGCL 4NRXA 1YJDC 3CUPA 1K3IA 3DNKA 1R24A 4NM4L 4UOJA 5FK9A 4UBDC 2MOVA 2V7NB 2HT3D 3S4SG 3SO3C 2GK0B 3V6FB 1J10A 3IXTA 3CJJA 2J8UF 3OAZH 4GW5B 4XCNA 5TQ0L 3VFMA 3QDGD 3WS6A 5SWSD 4ZO7A 1OWWA 4HS3A 2NY5L 2NXYC 3HKFA 4RMQA 4XP6L 4JFFA 3VGBA 4U3XA 4I77L 5DJCB 3QYCA 1KBGH 1LNUB 4JZOB 4NN5C 2NY4C 5D7IE 3ARRA 4KDTC 4ZAKD 3MGAA 3LHPL 1HYSC 2EDTA 2RR3A 3DECA 1U9KA 2DIBA 5EDXA 1BP3B 4JY6A 2UWEF 5EFIA 1CWVA 4GKZA 2F5AH 4I0CC 4HZLB 3KPMB 3RI5F 3GMRB 1AIFB 4YEFA 4W81A 2HP4A 2D3VA 1KT2B 2NXZD 3SKNB 3DUSB 1MI5D 3UTTE 3S37L 3UPAA 3IDIA 2IWGA 4D9LH 2OI9C 1FLRL 5IBTH 1LO4H 4GRMA 4R7DB 4N1HB 1U3HA 3MRMB 4RAHA 4S0SD 1ZT1B 1ZHBB 3HNSL 1NCCH 4F7TA 2DJ4A 4OD1L 5DJ6B 2ZUTA 5D2NE 1BD2E 2X4SB 4PJCA 4ZFOB 2AQ3A 5AZEH 3WSQL 4OZIA 2KZ1B 5JPMB 4JKKA 1JGUL 4I4WA 4IOSD 2GSGA 4U1HB 4ZTPH 4BUHA 4UQ3A 4XXDB 3Q2CA 2R2HA 5FCSH 3IFPB 3T08A 1CLOL 3T4YB 5HDOA 2BNUA 4UILL 3QUZC 5F9WC 4CMMA 4L1DA 4CVZB 4KRPD 3T0WA 3DSFH 2D7NA 4TNWF 1P7HL 3VFVA 4JG1H 1KJ3L 4KK9D 4KJYB 4JZJA 4WVRA 4IDLA 1ZT4B 4X6CE 2EE9A 4PJDA 4YHPB 1UH4A 2VDOL 4J3SA 2OK0H 3RI5K 1GGYA 1A6UL 3GBLA 1QLFA 3R0MA 3VXUA 1N8ZB 4LHUB 4XWOC 2XZCL 4RGOH 2GSIB 1F00I 4L8SB 1P9MC 4XBEL 2Q76B 4JDTL 1BVZA 1ZANH 2ZUXA 5CZVH 1H3WM 3V6OA 5K9JH 1AHWC 4PJ5E 4FFWC 3VFNA 1BZQK 3VXSD 3QG6B 3MRLA 1EHLH 1T89A 3X14A 1I7UA 1L7TL 1WWWX 2AXHA 1U93B 1KJ2A 3N50A 1S9WA 1S9WB 3OB8A 3NN8A 4CJ1A 4D0CA 4ZFOL 3MRLB 3DRTB 3L6FB 3MMEB 5T5NF 3TN0B 3PHSA 4KQ3L 3KHQA 3CAFA 2EE2A 1CXLA 2EDHA 4RAUA 4PRIB 4QCIA 3ILQD 2DQIL 4O2CB 5JOPE 3B2VH 1QLFB 1I85A 3MNZB 4Q9BA 4WWKC 3V8CA 1ZVYA 1Q0XL 5E0QA 3U9PH 3D69B 5D2LB 4Y4KB 2JB6A 5I16A 2DQGL 1ZT4A 2GIYA 1REIA 4KJYA 3WFEL 4RRPG 4YHOL 3QI9A 1U8HA 3PWJA 4R26H 5D7JB 4M6ML 2VE6B 5IFJB 4I5BB 1JPGB 5ACLA 5EG6C 5IROA 3BP7B 5ITBH 4JPIB 2GAZA 1Q0XH 1A3LL 1P7QA 1ND0A 3FFCE 3LS4H 3Q3GA 3GI8H 1F97A 4UMGA 4M8VA 2BVPA 4LKCA 4PLKC 4HJGB 1HK6A 1JL8A 2B7DT 4HIJA 3GHBL 1AR2A 3THMH 4MGXA 2JJSC 5DUBB 2X4SA 3T1WA 3L1OH 5DTFB 2A9NL 4YXLL 3QEHB 5I66A 4DN3L 3DI3B 1GGUA 3DYOA 5DTFA 3OXRA 1FN4B 3ESVF 3L95B 4P4KD 5DUBA 5DQJA 4B7LA 1JHTA 1T7YA 5EU6E 5JW4R 3ZKNC 1YJDL 4OD2B 2P46B 5IQ7L 1E6OL 1TCRB 4OIBA 2BVPB 4LKCB 2VLKE 4UB0H 4PS4L 1LHZA 3C6LC 1B0GA 1JGVL 3CVHH 4HS6B 1AGEB 5GJTH 4P57A 3V4VH 4OTXH 3LCYA 3RWJB 3V6ZA 4EDXA 4F58L 5T1KA 3A67L 3HZYA 5IFJA 2A6KA 1MUJA 3U4BH 3CSYB 3GM0A 3BUYB 4PJBE 4C55A 2JK5B 4KJQD 1MJ7L 2XWBB 4YWGH 4JFFB 1RIHH 2VN4A 4M7ZC 4QYOA 4Z76B 3VU2A 4M7KL 3PGDB 3IXTB 4GW5A 4X5WA 4UT9L 2R2EA 3D5OF 2WUCL 4QTIH 3WJLC 4HC1A 5F96H 5LCVH 5GRJH 4RAUB 5IF0A 4HF5H 4U6YB 1CFNA 1ONQA 1I9IL 3WIIL 4H0IA 4X99A 3U79A 4X9FA 2CJUL 1A47A 2VDRL 4MLSA 4LKXB 1S8DB 3FB7B 3PP3K 5LJYH 3RWIB 1EHLL 3PIQA 5IT2L 1BPVA 4Y19E 4NHCH 1QLRA 1ZANL 4NM4H 3FONA 3QXDB 2CDEB 4HDIA 4HUNB 5FA3A 1UZ8A 1ZGLP 1KCUL 1SEQL 4MB4A 1DUYB 5F9AC 3MV7B 1FL3B 1T04B 2RB8A 4XHJD 1QRNB 2ADGB 3B2VL 4MDJB 2QBWA 4YHML 3ZKQD 5EBGA 2GEEA 1LEGB 3RWDA 1OOAA 4M1CC 2HFEB 4OQTA 3QEQE 1YEHL 2O93L 5GSRA 3VH8B 4YC2B 4CMMB 4CVZA 5DR5L 4J6RH 4DZBA 3ARGB 2IALA 3MUGB 4UDUB 4G8GE 1P6AB 2BSRB 4XVJH 4FQQB 4NZRL 2A73B 3T4YA 2J12B 4RFEB 1E4KA 5C2UB 1P4BH 3HCVB 1RZ8A 1JYNA 2HKFH 2DQHL 5B8CA 4KVNH 5GRUL 4CBPA 4LLMA 3S35H 3U83A 3EYVA 4U1HA 1A64A 4ZFGL 2GSGB 3VW3L 1FFNA 5EO1A 4WUKL 4Z7UE 3L7FA 5JPMA 4HPYL 3WNMA 2YD7A 4FQIL 3MFGB 3VRIB 1OHQA 5C09B 5T1KD 4XTRD 4RBPH 3B9EA 4Y4KC 4N0CD 3UPRA 3TA3A 4ZPVA 5K93A 5C0NC 1FNFA 2OR9H 4S1QL 1RV6X 2FRGP 4F2MA 4HXBH 3O4OC 1U3HB 2NY2D 3ZE2F 1OAQH 3G5ZB 4OUUA 1DQLL 3QZWB 1MJJB 4X6CA 5DK0B 4OIAA 4FTVE 4PLJD 3SCMC 3O6KH 3MBED 4JVWA 3CDGA 2XZQL 1AIFA 3L3GA 5CBEB 4BJLA 5T1DH 1I3RB 1CDCA 3D18B 1JZ5A 5EU4B 1W72B 5D1ZA 4NN6C 2UUDK 2P7TA 4DVBA 4F9PA 2M8XA 4X83A 4X7TA 3ZSTA 4JFEE 1UM5H 4RAVB 4XCYB 1CLZL 1GOHA 1U8MB 4JZOA 2VABB 3GSVB 2F74A 5ALBH 5DRWB 5FGBC 4KZEL 5IVZB 1P9MA 1QPXA 2XZZA 4HS3B 2E7LA 3LSOA 4TULL 4Y5VA 5ETUA 5FOBB 3QQ4A 3VFWA 1GRWA 4PJ5D 4QXTB 3VGHA 2ZCKH 4YBHA 3TVMD 3SCMB 3CX2A 4PLKD 2V7NA 5FYJU 2B2XH 4Y5XB 3CUPB 4HBCH 1UQSB 1HNFA 3UC0L 1B4JL 2YPVH 4NKDA 2XTJD 2CUHA 2YUXA 4PBWD 3I6LE 3HMWL 5F1NA 5DQDH 1U8NB 3T4AB 2H2SD 4EI6B 5BRZE 1MFAL 1TXKA 3S36L 5AG8A 1ETZB 2AJXH 2YOCA 3KS0J 1H5BC 4JPWH 4YR6A 2HFTA 4HWEH 4R3SA 4MXWL 4Y2DD 4JRYA 5L7XL 5GZND 1LO5B 1EJ6A 5T3XL 2OTWA 5TDOB 4JHWH 3WJLA 4X4MA 3PWNB 3U0WH 3UC0H 1MJ8L 2W60B 2AEQH 4TSCH 3MSPA 1FO0H 5C8JA 2P43B 1ZGLA 1TZGL 4XPGH 4FHBD 5ITFA 5C8JB 2BVQA 3MRPA 1YQVL 4HS8L 2BY0A 4UQ2B 3DOSA 3MV8D 4QHLB 2FX7H 5T1MA 1AXTL 2YXMA 1RUKH 3S36X 3QHFH 4ZD3H 4MA8H 5JZ7C 5ANME 1D9KD 4FXGB 1OVZA 1BZ9A 4QNPF 3B9KB 3PNWA 1VACB 1KCSH 1M05B 5C0ND 3EJZD 2GITB 2VZUA 3RY5A 4OF7A 3QQNA 2AJVL 3FT2B 3M17B 1J0HA 3GMOB 2HRLA 4M43L 4AY0A 5FOBA 4NUGL 4JZNB 4EI5B 3C8KA 3EOTL 2IFFL 4LLUA 1KC5H 3QUKB 4IRSD 4RA3A 3EO0B 3VD7A 4JM2C 5DRWA 4HUKB 5IQ7H 4X4YA 4K07A 2E9WA 5FUCC 4M00A 1UJ3C 1AKJB 3CFBB 2GFBB 1W0VB 3KLHD 2ADIA 3O9WC 4JLRA 3NIDE 4L4TE 2XA8L 1CFTB 3UO1H 4NQUA 1HH9A 3OX8B 2Y06L 1C5DB 3OPZL 1DN0A 1YEJL 4EBQL 5DK0A 5MERA 1UYWL 5E9DE 4LNRB 3WN5A 4DOHB 1ZA3B 5SV4A 1SJEA 5DJ8A 2AXJA 1G9ML 2ZSWA 3NCJL 4ZPVB 2DJSA 4FTVD 4ZO6A 5K33A 3S9DB 2J4WH 4P3CL 3G04A 1LEIB 5ESQA 1OW0A 4P46C 1IRAY 4TULH 4YO0B 1Z5LA 1INQB 1KCRH 4O51B 4XVUC 5IJVB 1T7XA 1T83C 3L5HA 4XNUL 3RVTC 1I9IH 3RX5A 3RHWF 4K7PH 5EO1B 3C6SB 1FFNB 3RIAF 4LLMB 1EBPA 5D1XD 3PWVA 3BZ4A 3HCVA 1X4ZA 1IT9H 2B4CL 3JVGC 1HCVA 3G5XA 5BXFA 2FEDC 3O3AA 2RFXB 5T3ZH 5MP6H 1A21A 3HMWH 3ARGA 3MUGA 2XKNA 4UDUA 4R9HA 3S37X 4JQXA 3T0AA 1UENA 2DQFB 1NBVL 3P4MB 2DDQL 1AGBB 4H0HB 4R4NC 1AGFB 5D71H 1T7VA 3WDIA 3T2NH 3MJ6A 3F65A 3BT2L 4MS8C 3QEQD 4GKOA 2Z31A 1YPZA 3IDYC 1H3UA 3AMLA 5IBLC 1CL7I 1DUYA 2AJZA 1CE6B 1EFXA 2VLLA 4NKIL 4NN7B 4PJFF 1XIWC 2BOCB 4H1LA 4U1JB 2AEQL 4J4PD 4MJ6A 1RIHL 2FEEL 1T0MA 4HJJL 3B8SA 4RWYL 3VGFA 3IKCA 1OD7A 1VFAB 1V3JA 3ZDZF 4TTGA 4JO2H 1YNLL 4G8FB 4NJAL 4GW4B 1JTOA 2AERT 3TVMB 3JUYA 2PR4L 5C0BB 3HB3D 2JIXA 3SGDH 2D9QB 4JDZA 1RZIB 3LPGA 4QRTB 4NKOB 3VXUD 1ZAGA 3HRZA 1K4CB 3CXHK 4LCUB 4PG2C 4X0KA 2APVA 4A6YA 5GJSH 2DLTA 3DXAB 3M45A 1OAYH 3R0NA 5IF0B 5HYJB 4PGBA 1A1MA 1A2YB 3OR7B 2R2EB 4XH2A 1EHNA 1EMTH 2VITA 4WI2A 1MVUA 3IFLH 3MCG1 2CIKA 2VXSH 4ZNEE 2ZPKL 2FGZA 4MXVE 1OP3H 3QJHB 5I1EL 3RKPA 4YH6A 3GI9L 5CJ5A 3BDYL 2XWTB 1CTOA 3VFUA 3QHZH 1FH5H 3VRLF 1EV2E 5I73C 3A6BL 1SYVB 5ECJE 3HZVA 5FB8A 5FYKU 4W6YB 4P57B 1FFQA 1B0GB 4HCRA 4ODSL 4PJAA 4FNLL 3MLVH 2VZSA 4Q6IA 3OGCA 2R4RH 3CLEL 4XNQA 3GBNH 4PGCB 2HJLB 3HPLA 4KI1A 5ADOL 1SVZA 3N1GC 4ZUWA 2DQJL 4FTVB 3DGGA 3TV3L 5KSVB 3GMLA 3LQZB 5I66B 5ABDE 5BJTA 2AP2A 5HY9B 1YDPA 5A2LH 3I6LD 3AS1A 4N0UB 4KMLB 4WDIA 1BD2A 1A7OL 3HR5A 4O2FA 5T3XD 4HUWA 3UAJD 4HJGA 1A9EB 4Q9RH 5JIPA 4WHTB 2NX5B 2BOBA 2WQ8A 3Q3GB 1K6QH 4RCAA 4YHNB 4JPIA 1GZQA 5I19L 1QFUL 5JHDE 4M7LL 2YEZA 1JPGA 3BAEH 2ERJC 3W9DA 1KN2L 4PJGA 1CCZA 1P4LA 1FC1A 1K8DB 4YEEA 4CVWA 1U8HB 1BREA 3PF2A 3TNMB 4PGEA 2WK2A 1MCHA 3QFJE 1ZMYA 1IC1A 3DX7B 4LDEB 5HI4D 1Z9MA 5I16B 2VQTA 4CN4A 1X5JA 1R3HB 3D69A 5E6YA 1ULVA 1RUML 3Q6FB 4QRQA 5FUZL 5IB4A 3MNZA 1WEJH 4O2CA 3B6SB 5TPWL 4IS6A 2YD3A 1WJ3A 1NQBA 1QSFD 3D0LA 1C08B 1FHGA 1LD9B 3MRHA 3MFFA 5ERWA 2BVOB 2IAMD 5JIHA 5C0BE 2VUOA 5K9QG 2H8PB 1GCFA 3L6FA 3TN0A 5DVKA 1H0DB 2YKLH 3O9WA 2YD1A 2D31A 5E1AA 3TBVB 4TVSa 5JW3H 3VMOA 1U93A 2W9DL 4HK0B 4QF1B 4OI9A 4DVRH 4D3CH 3LRGA 4DKFH 4PJ7A 3BPNC 4JG0L 1CD9B 1FGNH 4ODXB 3GIZH 2Q8AL 4F57H 4EOWH 2Z91B 3RHWK 2P4AB 2A6DB 1D5ZB 4A6YH 5JZ7D 1YUHB 5HGBB 3I6KA 5AUMB 3PWLB 5A16A 4U1KB 4XCEB 3ZKXC 4U2YA 5CJOH 2ED9A 5EO9B 2Z92B 5FFLA 3VFVB 3U1SL 4TNWK 3BDBA 1IZKA 4K94C 3MRJB 4LSUL 3BRFA 5I30L 3TYFB 4H1LH 3DVNA 4U1LA 2E6JA 1R5VB 4UQ3B 1CFQA 4XMKH 2MJWA 1KTDA 1CGUA 3GO1L 1I8KB 4JFDE 2BMKA 4OIIL 3RNKA 3IDXL 4OLUH 1JZ7A 1BFSA 1BLNA 4OZGE 3VXSE 3QO1B 1MCDA 3P77A 1UB5A 2VXTH 4G6JH 3O3DB 4ZFOA 4ZUUB 2BSSA 2VQ1B 5EIIB 1WK0A 4JY4B 3RUGA 3NFSH 3AS0A 4K71C 1A7QL 3MJGX 3WL9B 4G8EA 1T20B 1ZHBA 3U9PL 3T04D 1MRDL 1QOKA 1ZHKA 5ALCH 3BE1L 1KGCD 3VXRB 5E2UH 2FBOJ 1WUNT 4WWID 4P5KB 1V7MH 2HLFD 1BQSA 3QDJE 3VRLE 3W39A 5C0AD 4W6WB 5C08E 1N6VA 5EZLA 3UJJL 3UYRH 4KH2A 3KPMA 5FGCE 4OSUL 2O61B 1EH9A 1UG9A 4GKZB 4GKSB 3VI4F 3ARDC 4WO4B 5LGJB 5I74C 1FORH 1YYML 1PQZB 4IIQC 3JXAA 1PZ5A 3H9SE 2Y23A 5C9JB 5JQ6L 1I9EA 2JE8A 1P84J 2GT9A 3MLZH 1ORQA 5ELIA 2Q20A 1J0YA 1UWGL 5JXEA 1U3HD 2NY2B 4P5TD 4ALAH 4KUZL 5DJ2B 3HAEG 3VWJD 2B0SH 2C5DC 1UCBL 3OR6B 4HKJB 4OD3L 2X40A 1C8PA 4HWZB 5MEPA 3BPLC 5DJYA 4O2EB 4U1IB 5CGTA 3VWKC 4J2XA 1B3JA 4LSQH 2IQ9H 2AKRB 3AAZA 5D7IA 3ZDZE 3DXAD 2OJZH 4WUUB 3FRPG 1R24B 1G7IB 2R0WH 4LCCA 1G6RB 1QBMH 4XWOD 2A74A 1Q9KB 1U0QA 2EDEA 4P48A 4QWWC 3WFCH 1N0XL 5C2BH 1KJ3H 4UI2A 3QSKB 3N1MC 4UILH 5EO0B 1HKFA 4MX7A 4ZDHB 1HI6B 4GJTB 1OAQL 1AXSB 4JFHD 2ED7A 1J1OH 2EZ0C 4PP1D 4S1RH 1A6AA 5F89A 4WI6A 3KWWB 1U92A 1S9XA 4NCC1 4X7FC 4ZFZB 3KPRB 2QR0B 3X3FH 3HPJA 35C8L 4GBXB 3QQ9D 5L8JB 3CFDB 3WKML 3WS3B 4E5XB 4N8PA 2YKLL 5L88L 1JHKH 5IK3B 1KNOA 1HHGB 1NCTA 5K9JL 5HHVH 2X44D 1MJ7H 1U8OB 3ZTNH 2E7HA 1BQHA 2Q87A 1M6OA 1CQYA 2VSDA 3QQ9C 3B4NA 5C2BL 4PJ8B 4KTDL 1OM3L 2I9TB 2PCPB 3BD4A 2EZ0D 3PXJA 4HUUA 4X4XB 1NCDL 3C08L 4QXGH 4XGZB 2X4NA 2VZTA 5DFTA 5D7JC 4BSWA 4HAGA 3D87B 3MNWA 2DQTH 4NQDB 4LAQH 4NQED 1CLOH 5DJZB 2Z31D 4IMKA 3RUGE 3LKQA 4JFXA 1M1SA 1RUAH 5DZOA 4Q0XL 3CFJA 1U8IA 4MQ7A 4PUBL 4UV4H 3GSNH 3HB3C 4S0TD 5C6TL 4P5TC 3GSRB 1AR1C 1T22A 3TNNB 4H20L 4P2YA 1DEDA 3RBGA 2HKHL 2DLGA 4I0PA 3VXPA 3T0XA 3ZT6A 1ZXQA 2WLYA 3OQ3B 2IPKB 3BH8B 2OSLB 4XMPL 2ITCB 4NBZB 3CH1B 4LP5A 1CK0L 2DL2A 3KLDA 3RVXD 4L4VB 3CZFB 4E42A 5B38G 2VLRA 2YD8A 4GW1B 2YBRA 5C0IA 5I1EH 5IUSA 1RHFA 2Y06H 1PKQA 1RK0B 3SJVE 3NIDF 4GFTB 3I3BA 1CDHA 2N4IA 3SDCA 1UEYA 2NNAA 5SWSB 2WMPA 1FVCA 43CAA 1NL0H 1BF2A 3IRZA 5JMOC 4IMLB 1E4WL 5JQ6H 1J0IA 5MEQA 3UAJC 4F9LA 1PYWB 4Y16C 3DTXA 4ONOA 2V5RA 4QXUL 5FUZH 1NMAH 5JDJA 4XVTH 4XB8A 4L3CA 4Z0BH 3A67H 5BVPH 4N0RA 3O6LL 5SWQA 1VEOA 4QRSA 4U33A 2EDQA 5KG9A 3RAJL 1X5GA 2VB5A 2PXYD 1U2CA 5FO7B 4D94A 1TCMA 2ADFL 5I1LA 1NC4A 1XF1A 1S7TB 2AEPL 4Y4FB 5HGDB 4Y19A 5EZOH 1OAUL 2HTLD 3LRSB 3NZHL 3P0VL 4R4FH 1L0QA 4F8TA 5IIEA 4XP4H 5H2BA 2ADJB 4PJ8D 1ACYH 2WP3O 2I07A 2C3VB 2FD6L 3O2WL 1XGPA 4WY7L 1K6QL 5CIPH 3MJ9A 3S88L 1N5YH 4HK3N 1IAIM 3SO5A 5C70A 3MROA 1T1YA 1NEUA 4Y4HD 1CYGA 3V0VA 3V5HB 5I1HL 4MAYB 3LS5L 5C08A 2Z8WC 1NGZA 1OAKH 4GBXD 5ID1A 2C1OA 5INDA 1D5BA 5INCB 5F8QC 1U3JA 4YIQA 2QQKH 1T1ZB 1IKFL 4J8RA 3O2DH 4Z7NF 1UM4L 2EXYD 5HD8C 2LAGB 5CBAA 4HWBH 1ZK9A 4XP9H 4HIEB 3SDXE 1X5KA 3K1DA 3DI2B 1F4AA 1CR9H 4K3HA 4PJXA 1ZLSH 4YDLB 3FQXA 5C0CB 2FYYB 1FYTA 3EGSA 5EH1A 5DMYA 4FQXB 1J1PH 2XTJB 3EYOA 1I1YB 3FT4B 3T0EB 1OSZA 4X7SH 1X5AA 1RURL 2XTJE 1CGWA 3V5DB 1EGJL 1IE5A 1KLGA 3MRQA 3O3EA 1ED3A 4TUJB 5CSZA 2XFXA 3NABL 2M2DA 3PHOA 1IAIL 3IFLL 4FN0A 4UT6H 2VIRB 4NQCA 1MCPH 1JBJA 3DXAE 4U1GC 3EO1B 1GZPA 2BNRE 3QCUH 3SDDD 5EBMA 2NQCA 3QXWA 3MX0A 5SWZA 1RURH 1I7RB 4LVEA 5E7FA 3GI9H 3QFDB 4MNQE 1MNUH 5EWIH 1KENL 1AC0A 4KK8C 3P4OA 3FFDB 1UJ3B 3VI4E 3KGRA 3SDDB 3VE0B 2FL5B 3ZTJH 3OZ9L 4MJ5A 4KY1L 4KKBD 4PY8J 1QLEH 2AK1L 3RWFA 2AK4B 2JJTA 5GZNC 4FOMA 5FM4A 3VCLB 3VA2C 2WINB 3LN4B 3W0WB 3H9HA 4KUCD 5T3ZE 4KI5D 5J11B 3S6CA 4JO1H 4KROB 4R8WL 5KVGH 4WWKA 1KPUB 4QHNB 1DQLH 4FQCL 5IV2B 3KJ6H 2FJGA 4BELD 2NW3B 3S5LB 3K46A 3V52L 3W5NA 2GCYA 1HQ4B 1K2DA 3TBTA 32C2A 1ZHLB 4ENED 3RTQA 4JFHE 4POZD 1FG2B 1GXEA 5GS1C 3ARBB 3IYLW 4H8WH 3FHQA 1D5MA 3PQYA 1KTLA 1B0RA 3QIUB 3ZLQC 5HVHC 4DEPC 1LK2B 5GRYA 4CVXB 5IVOA 4ZFGH 1L4IA 2AV1A 5CZKA 1ADQL 5D9SA 3O8XD 1WVZA 4NOFA 4RNRA 5HVWA 2DD8H 4O58L 3AROA 3FO0L 4NQCE 5DJXB 4NFDA 4B50A 4XPAL 2DRUA 4PJ7F 5E56A 1G9NC 1FIEA 4GAFB 4P5TA 1LDPL 4PGZA 2KZWA 4ODUA 3Q0HA 2R39A 4XC1L 4LQ1A 1T5XA 1XH3A 3ZHLA 1LE9A 3PDOB 1N5YL 2D2OA 2BVTA 2UZIH 4NZJA 3IJSB 4U3CA 1RZ7L 1GAFL 1PKQE 2LTQC 1UACL 1I1FA 3IGAA 3IU3B 1IEBA 1N5AA 3FO2A 1JV5B 4NC2B 4LEOA 3MACL 4OCYL 4YWGL 4GAYA 4DK3A 1O0VA 4YX2H 5E8EA 1LK3L 1E27A 5BV7H 5AD0B 3SPVA 2P5WE 4R2GD 4WUUE 3EOBA 1LDPH 4M7JH 5LBSL 2EDRA 5MENA 3QDGA 1QSVA 3HG1E 2ZKHH 5CJQH 2RAMA 3X13B 1NAKL 2UZYB 3QNXB 1LO3L 1LP9E 2OXHA 3MGOB 5ISZD 5ACZA 4IRSA 3TWCH 3KJ4C 2YPLA 2DF3A 3TO4B 1F3RB 5BZWB 3BH9A 3TIEA 3BWAB 1EEZB 2C4FT 3FN3A 3NABH 4XZUA 1CS6A 1IGYA 2MHAA 1BBDL 5D6CA 2QHRH 4LASH 3TLRA 1E4XI 3HE7B 5SWZD 4LMQE 4YDLC 3BP6B 2EH7L 4AEIH 5HI4C 4U1MB 2LVCA 1KLUB 3JV4A 5DQDL 1Z0MA 3ZYZA 3RVTD 3DWTA 3UBXG 3MCKB 2ITDA 5E6ZA 1ZSDB 1WIOA 4WEBL 5E8PA 5F1IB 3REVA 3G6AA 1D6VH 1E28B 1MJ8H 3QUZB 5DD0H 1QFWM 1QSFE 2FWOA 4MAYC 3FQUA 3MJ8A 4I2XA 1H15A 3BPCB 2VDQL 1J05A 3KYOB 5JW4M 5DFWH 4OF0A 4NZDA 3NVQA 4GG6F 1JPTL 1G7PA 4XX1G 2NW2A 3VRJB 4XPGL 1WF5A 5LAXB 4GXUM 4KVNL 1IKNA 4MDIB 3W0WD 4IBLT 1KLUA 3JV4B 5FHAL 3CVHA 1UCTA 2A9NH 2KDGA 4M4RA 2DQUH 3OG6B 4Q7DA 5DWUL 3IJYB 3BIAX 1JGDB 3TZVA 3QWRA 3I85A 1Q72H 2ICWI 1J0KA 3L3OB 4R4ND 3QPXH 4X7CC 1FJ1A 1NEZB 1RUQH 1AJ7H 5DA0B 3BWAA 4PJ8C 1ADQA 4KK8D 5BZWA 1DQQA 2FIRT 5HHOA 3DUHA 2P8PA 1OTSC 3BIKA 4GUPB 4Y2OA 4L3EE 3FO0H 3RBSA 1N3NA 5FHAH 2DICA 3NOIA 3RZCD 1G7QB 2UUDH 3INUH 5E5UB 1UXSA 1JGEA 2VC2L 3BVNB 4PJ5A 1WZ1L 5I8EB 3NZ8B 1N6QH 4M1GH 5H94B 43C9A 3EOBB 1S7QA 3CDFA 4NN5B 5KSAB 4B5EA 1T66D 3EYFB 5KVEH 3DVIA 3TBSB 3T0ED 2W65B 3RDTA 5BS0E 3OKDB 4XNXL 4Z7VF 2BP3A 3KDMB 5MI0B 4HIHB 1UM5L 3B2UC 4O5LH 1I1FB 2P5WD 5GRXG 1RZJC 4I9WE 3T2PA 3WHXB 3U9UA 3LEXA 1PLGL 4RMWA 12E8L 3U46A 1HSAA 4NKMB 1JF1B 4OGAD 3PDOA 3GJEA 4F7EA 3UJJH 2GTWB 4KAQL 5B39G 4OGYL 1ZLWH 4L4TA 4P5TB 5BO1L 5JW4N 4UIKL 1IAMA 2YD6A 1HHKA 4XP4L 4OBRA 5SV3A 2VAAB 5DRNA 4AMKL 4JFDD 1F3JA 4UTBH 1UVQB 5D9SB 2AV1B 4Z7WE 1TJHH 1J18A 1GGBH 1X5HA 2ORBH 1W2KT 5JHDB 3U4EB 2EICA 4KKAC 2OL3B 5LQBL 1KYOK 1P2CA 2AJXL 5I75B 1Y0LA 5IFHL 5E8NB 4LGPB 4PJBB 1Y6NR 1QR1B 5D93B 1K2DB 3IDMB 1BJ1J 2VDMH 3RGVD 2FEDD 5BRZD 2NW3A 1MI5E 1FVEB 1U3YA 3UP1A 1FFOA 4OFDA 1R0AH 1QBLL 3P2TA 2EDXA 4X7EC 3DHMA 3A6OA 2JJTC 1AP2B 1PBYA 4YFEA 2IFGA 4PJCF 3IFNH 1BFVH 3ARFC 1TJHL 4KQ4H 5T1LD 4DEPB 1MAJA 2R1WB 4P2OB 3OB0K 4WUKH 4MJ5B 2YD2A 3L3KB 5FO8B 1U95B 1A7PH 1UJ3A 2VLJD 1CK0H 1IGJA 3P4OB 3ULUH 2YC1A 1JZ2A 5JO5B 5HHQB 1YN6B 4S1DD 4JDVA 4LPWA 2NXZB 1AD0B 4U0RB 1YMMB 1DQTA 4HT1H 4L9LB 2V9QA 2BNQB 5GRVL 3NGBC 4P3DB 4PGJA 5IQ9B 4KTDH 1J8KA 2BSED 1XGQA 1DFBL 4X80L 1BIIA 4N9OB 2FNBA 2A6JA 2F5BH 5J12C 2F54A 4Y1AB 1IQDA 1ED3B 2IMNA 1TZHA 3WIHH 4LPYA 4YHKH 3FFCA 2ARJA 1OSZB 4G8IB 2ZPKH 4BA8A 3TPUA 3WXWL 1IBGH 1GH7A 4Q9QL 3MLXL 1TJGL 2DAVA 3FN9A 4FQXA 4NZUL 2FYYA 5KVGL 2UY6A 5E94B 1AFVH 4LVOC 3FQXB 4LDOB 1ZLUK 4TSBH 4MLIA 1T3FB 1HINL 1CDYA 1RIVL 3MLSL 3UDWA 5CBAB 4D0BA 3W11C 1NUNB 1DANU 1I7TB 1F4HA 3K4AA 4YDKH 5IFAL 1AHWB 1QYGL 3PUCA 2F53A 4OLEA 1FORL 1OP5K 4L4TD 1QSFB 4L5FH 4XCCH 1E6JL 2F8OA 3SGEH 2QSCH 4X5XB 4YHKL 3NACH 1ZT7B 4JQVC 1I1CA 1T7ZA 4TVPE 3AM8A 5F7KC 1QEWB 3KPRE 1NC2A 5E9DD 3QDJA 3MYJB 3S96A 3V0VB 3MLZL 4F9LC 2NY3D 3FJTA 3CIQA 1CLYL 1EZVY 4CKVX 1XGPB 3FB5A 1TQBC 4KDTA 1MLCB 4XPFH 4UTAL 3F6LA 4H8WC 4HWBL 1S7XA 4E0RA 3T77A 5D96B 1AO7D 5HGDA 1NGXB 3GJFB 4Y4FA 3CLFH 1YQVH 1FO0A 1D5IH 1NCNA 3LIZH 2YZ8A 4RX4A 3FOMB 1VADB 4RGNB 4GRLB 1P69B 2CJUH 3MRKA 5IVXE 1EK3A 1YZZA 3I50L 4UBDD 3UTSE 2GY5A 1PYWA 3EW3B 5HBBA 1JYWA 4NQXB 5CKAA 3BW9A 4ORZC 2G75A 1IQDB 3WKMH 2P44B 1ACYL 1NJ9B 4Y1AA 1GJIA 2HTKD 5DI8B 5LWYL 1FC2D 4NRYB 3VXUE 4HULB 1U8PB 3T8XA 4EQ3A 4FRWA 3N1QC 1T7WA 3SQBA 1D5IL 3LIZL 25C8H 4LFHD 3JSSA 5I1HH 4UNTA 3VWJC 2A83B 3C08H 1MRFH 4L9LA 3QXAB 2AGJH 15C8L 1RJCA 3C5JA 1O5DT 5H37H 2H32A 2VTFA 4I9WD 4YFDB 4JCMA 5HHQA 5JO5A 5EU6A 2IPKA 4ELMF 5E24E 3K2UH 5FO8A 2OS7A 4D8PA 2H26B 3T8XB 1U8PA 3BXNA 2R0LH 2VRAA 1NJ9A 1HH6A 2V5MA 5CZVL 1U8JA 3MRNB 2G75B 1J8HE 5FDWB 2A9ML 4POYA 5DHYA 1DFBH 4PRPB 3ME0A 4AQOA 1U8IB 4YHIB 1MCKA 4XMLL 4D9RD 4JFXB 2OBGA 4XP6H 2WBKA 3U0TA 3WFHA 3TCXA 3O45A 1KJMA 1VADA 1CVRA 1CGTA 2EYSA 3VXTB 2XXMB 5IMMA 4YFLI 4UZGA 4FNLH 3UTSA 4XBGB 3GMPA 4DGVL 5I8CB 4RISH 4DUVA 3IDGA 1T4KA 2E8ZA 2OL3A 4PJIF 1WT5C 1F3DJ 2X70A 3QUXC 3T77B 2CDGA 4E41E 1PFCA 1VEMA 4FFYH 1UVQA 3VXNB 1NCWH 3OKMA 1HCFX 4WTZA 2B1AL 2KPNA 3UJTL 4LPVA 1M6OB 2AW2A 1G7HA 1HHKB 3DETD 4HW6A 2AAVA 4PJGF 3IDXH 3UBXB 1A7OH 3QDJB 4MCZB 3QUXB 5D7SL 2LABA 1QEWA 4K55A 3P9MA 4WIQA 1IC5H 3OSKA 2KKQA 1HSAB 1OPGL 1WZMA 4YZFE 4ZFZA 1R6VA 3TPKA 3MGTA 5DZNA 3U9UB 4EQ2A 3KWWA 1DBBL 3PL6D 3JUZA 1MEXL 5JOEA 4DK6A 4D0BB 4WJ5A 3FO1A 1P6FA 4ZTPL 3DX8B 2W65A 2DB8A 1KBGL 4JQVA 1G7IA 3O2VH 2LAAA 5D7IB 3BN9C 5LG1A 3F8UB 2FD6H 1V5JA 4HXAH 5I8KL 2XG4A 4AG4L 1VFBA 2ENYA 2FJHB 2MCPH 5EN2B 5ILTH 2J4WL 4P3CH 1UXSB 2IAMB 5DRZB 3OR6A 4P2QA 4OF6A 4TN9A 5J1AB 5ICZB 1TZHB 3EDEA 2ZKHL 4ZUSA 5JW5B 3E8UL 2V5YA 4Y1AD 2OK0L 3OG4B 5HYSB 1NGYA 1T1XA 1LQSR 1I75A 5I71C 4DCQA 4MA1B 4DTGL 3CZJA 3VXMD 4TTDD 1MQKL 1RZGA 4OV5B 5EC1A 1DDHA 4QGTA 3S7GA 1YMHA 5IW1B 2ICCA 4NP4H 3W39B 1F42A 3CVHB 1ZOXA 3VXRA 3FO9A 2IADB 1J1OL 4S1RL 1ZHKB 2V5TA 1T20A 2PN5A 2XPGA 4JY4A 1MFDH 1H15B 5DD5H 4PJHB 3O3DA 1C5CH 1FAKT 1MRCH 3MJ8B 4JN1L 3ROLB 4OZHA 1T66C 5E8PB 2CO6B 3PGCB 5F1IA 1KACB 1PX4A 1KTDB 4KGLA 2NXZC 4XBPA 3MCKA 1A02N 2P5EA 5KVDH 5EUOF 1U41A 9CGTA 4DW2L 5D1QA 4NQEA 3MV9B 3F58H 3TYFA 5HHMD 4KXZH 2XQBH 4HGKC 3DX9A 1NDGA 4BQBA 2BY2A 1XGTB 1ZVSA 3MR9A 5T3ZD 5CP3H 2YD5A 1F2QA 1IGYB 2Z92A 4JFZH 3SEPA 2EE3A 5T1LA 2WZPD 1RMFH 2DMBA 4FZEH 2DQTL 1NBZB 3IVKB 4I48B 3DMMC 2PO6C 5DRNB 2VAAA 5F3BB 1P4BL 2OTUB 1J0JA 2L7UA 4PRNA 3GEWB 4NZRH 1EPFA 5FYKD 4BH8A 1PEWA 3O6LH 3KPQB 4OCSH 1KTKE 4NKMA 4CADA 1AO7E 3O81A 3WHXA 3B5TA 1WZ1H 1FH5L 4J23A 2XY2A 1A4JB 3TBVA 1I3VA 3O9WB 3ZYOA 3RDTB 4LPUA 3TBSA 5L2KA 5ERWB 4K3GA 4MQSB 1LD9A 2J5LB 3IGAB 3IU3A 4GAJL 1MEXH 4MSWA 4OZFB 3QIWD 4QHUB 5JMRA 2R0KL 4OFKA 4ZXBD 5I8EA 1H9VA 3VFGL 1QFWH 5IB4B 2WWKT 3BVNA 4PJ5B 4Z9KB 3Q6FA 3ALPA 4OCSL 2EKJA 1CGYA 1WLHA 4MWFA 4P9HH 3TBYA 4RQQB 2R0WL 1WCQA 4PRNB 2P8PB 5HHOB 5KSAC 3F7VA 4GAJH 5GIRB 5F96L 4NCC2 3OWEA 4RSVA 3MZGB 4XRCB 1WQVT 1NEZG 1M71A 2YEZB 6CGTA 1IGIL 2GHWB 1FJ1B 3TP4A 2FH8A 1GZQB 4PPTA 2VR9A 1LWRA 4KPHL 3CFCL 3DX9B 3WFBH 5EZJA 1MIMH 4K7PX 4WRLA 4HUWB 4NKIH 5EORH 4XWGL 2EEBA 4P23B 2P5EB 4F7CA 3U7WL 2GCYB 1IGCL 1B4JH 2YPVL 2FGWH 5DZLA 4JO3H 3QRFM 2DKMA 4ZUWB 1JGVH 1MHPL 2BVUA 4XAKD 4FMFA 2GJZA 1MIML 2HJLA 4M02A 1EJOL 1SYSB 3LKRA 3DO7A 3FT3B 3MOQA 2XV6B 3BZEA 4NT6A 4AL8L 3KXFB 1MCQA 1K4DB 5EWIL 1MWAL 4JHWL 4GMTH 2Z93A 5AWNL 4XVJL 3VFUB 1UM4H 5KVDL 4U1MA 5EC1B 3BP6A 1AE6L 2HG5A 1UT9A 4HG4K 3HE7D 5SWZB 3CX5J 4Q0XH 2NY3C 3FOLB 5JOPD 2OTPA 3V0WH 3S35L 5F6HI 2ZUQB 2RBLA 4OCRL 4C4KT 2XACC 3ARED 5L6YH 1NGYB 1F6FB 1U8LB 1HN1A 5HYSA 2F54D 1IC4H 1DR9A 2NLJB 4IRSB 5ISZB 4WEBH 2NY5C 5IHUH 3QNXA 1DL7H 2FJFB 1B2WL 4HWUA 5J1AA 1IM9D 3PG2A 4LCUA 4S1QH 3RZCA 2DIAA 2WBJC 4PIRF 2CMRL 4GXUN 3QUYD 1LGVA 5C0BA 1V3KA 3QCTH 1RVFH 4GW4A 4Y7MA 1FPTH 4NZTL 4ALAL 2PXYC 3SPVB 5AD0A 3DARA 3IKCB 4XXCA 1R5WA 3C5ZA 3WCYA 3H3PL 4HIEA 2CUMA 1T0MB 5LGHL 3DVGA 1OT2A 4K3DL 5HDBE 1DQML 8FABA 1T1ZA 2IFFH 4HQQH 1HOCA 1CE6A 3U0PB 4V1DB 3W81A 4KKBC 1S7RA 4Z0BL 1UB6B 1QUNA 2FR4A 2WNGA 5ID1B 2VZ1A 3WO4B 4FFYL 1FIGL 4MAYA 4OGAC 3ZYIA 3V7AG 1OP3K 1AGBA 2YRLA 2R0KH 2UWEA 3QIBD 5E2UL 3T3PE 4OLYH 1I8MB 3Q1SH 2X4TB 2AJYH 4MA7L 4HAFA 5GRUH 5IB3A 2C3VA 1RIUH 4LLYA 5CHNA 5IW6A 2Z8VC 2ADJA 3V52H 3FQNB 3TJEL 5M7QA 1H3VA 5I15L 2ATPA 2ZJSH 5GJTL 4XPBH 5GGQH 1D5MB 3PQYB 3GSWA 3VJ6B 4LIQH 2XY1A 3ARBA 4TPRH 5DMJB 1OPGH 3RTQB 5I1CL 5KG9B 5SWQB 3TBTB 1TFHA 4GT7A 3LS5H 3O45B 2E6QA 4P4KB 3WFHB 2G9HB 3HC3H 3BP5B 3K0WA 1CDGA 5D2NB 4HCRL 4MXQD 1A0QH 1FZKA 3L7EB 3LN4A 4J3VA 3WN5B 1HHIB 2J2ZA 2YPLD 5HD8D 3EO9H 5MERB 1DVFA 1L7IH 4MMXC 5FYKL 3VXSA 2AK4D 1NKRA 3LDBB 3MRRB 3F7QA 3BX7C 3ULVE 4H25A 3SDDA 5ESVA 1PSKL 3VE0A 2X1OA 1CQKA 3BT2H 4FQ2H 5JUEH 4JQIL 4MS8D 3L5WB 3T2NL 3V95A 2H32B 3HR6A 5KTEH 3QXAA 4L4VE 3VFRB 3CH1A 4I1NB 4BKLA 4K23L 4X4YB 4DOHE 2OSLA 4KROC 5IT2H 4WW1A 3LPWA 1C1EH 4HUXB 4LVHB 4HFUH 1CXEA 1JTTA 3JVGA 3BZFB 1L7IL 5DI8A 5FYKH 5FM8A 2ZUUA 3BKYL 5IB2B 2CK2A 2NMSA 3BW9B 2R0ZH 2ZG1A 3MRQB 3O3EB 1KLGB 2WWKO 3L3JA</