3MMEB

Structure and functional dissection of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
211
structure length
211
Chain Sequence
ALTQPASVSGSPGQTITISCNGTSSDVGGFDSVSWYQQSPGKAPKVMVFDVSHRPSGISNRFSGSKSGNTASLTISGLHIEDEGDYFCSSLTDRSHRIFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG16 HEAVY CHAIN FAB
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 211
sequence length 211
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2010-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mmeB02
2OTWB 2WZPD 3VD9A 3LMJL 1M7IB 2OBGA 4AG4H 4U6XA 1KCRL 3EOAA 3F7YB 3NIDE 4MCYB 3NCFB 3RAJL 4R97C 3BQUA 3BESR 5L88L 3QUYD 4XMPH 5CGTA 3T8XB 4FHBD 2BHUA 1UXWB 2ICCA 5F7HA 3Q48A 4PTUA 4A6YA 5BVPL 5E0QA 4KKNA 2I25N 1CCZA 4H20H 4KK8D 1UVQA 1BVZA 1BM3L 4X6DA 5JHLL 1B88A 3LD8B 5CLTA 5DFWH 2YUVA 3PG2A 4XTRC 4GW1B 1PBYA 4P2RE 5I8KL 5T1KA 5A2KH 1U3HA 5E8PB 5EBMB 5ESVA 3EZ8A 4TVPE 5EOCH 5BJTA 1BJMA 1A5FL 3MYJB 3NFSL 4NKIH 1HHHB 3MLPA 3WJLA 2DD8H 3BT2L 1WAAA 4M7LT 4PJBF 5C1MB 1CWVA 4KTYA 4NNPL 1ACYH 4O51A 4M7ZB 2X1XR 1Q9LB 3SDCC 1ZAGA 5IWLA 1UEMA 3UTPD 1DQLL 5IB2A 3VMNA 2GJ6E 3ARGD 3VFPA 4NN6C 3WJJA 2XZCH 4QWWC 3MRKB 2BX5A 5CSBA 3HZYA 2EO1A 3U4BH 3PWJB 2AXGB 1RI8A 3VJ6B 1I7ZA 1ZT1A 2UZIH 1Q94B 1ZE3C 1R3JA 4JM4H 5KAQG 5FYLH 3WDIA 1NGXA 4TSAL 5IGXH 3BKJH 2EEAA 4FQCL 2HJFB 1BWMA 2OI9C 2OQJA 1DUZA 5DUPL 1VHPA 1DL7H 5BV7B 3WXWL 4HH8A 4YPGB 3W5MA 4NQSA 4UILL 4QCIB 3TJHC 1P7QA 3V4PL 3P4MB 5JW5B 3E0GA 3THML 3ILQD 3NZHL 3U0TB 4YO0A 2VDLL 3EYOA 4PJHA 1LD9A 3FAXA 1B4JH 5DMKB 5FGBA 3BDBA 5I8OH 4IDJH 5GSRB 5D6CB 1BD2D 5KSAC 5I8EA 1OLZA 4LU5L 3H9SD 2E9JA 4IDLA 4Y19E 4P2OD 4YHKL 3CVHB 3SKOB 1CE1H 2QTEA 2UWEA 2YD3A 4JHZA 1NAML 5B3JF 4OFYD 4ODHL 4U31A 1X4XA 4DKEH 4N0FB 1BJ8A 4PRAB 3DBXB 3FQXA 4EN3C 5J0BA 1SEQL 3PE9A 1HKLL 3CJJA 3F6IA 3QXTA 2FECI 3X12A 4LVNB 1WTLA 5LKNA 4OJFL 1IC4L 1D9KC 1E4WL 4OZGB 4M3JA 5D2LB 2SEBA 3X14B 5HTSA 4HJGB 5I74B 3VG0L 1S9YA 1LILA 4P4RB 3D6GA 5E9DB 4K23L 5HGHB 3T3ME 4WEBH 3OSKA 3QDJD 3J8F7 3R8BB 4P3CH 4S2SB 1A7PL 5GRXG 5J12B 4DEPB 4HWBH 3MQIA 4HUUB 3G5ZA 1FL5B 1T7XA 5B39B 4QXTA 5I18L 3JTTA 4YJZL 1ACZA 3FMGL 4LCWE 5HDQL 3S35H 4NZDA 1DBKH 1F02I 5KANI 4XVUD 4Y16B 1UENA 5J1SC 4XMKH 1E6JH 4WDIB 1FBIL 3DRQA 1I3VA 3MV8B 1MJ7L 4I0PA 1SJEB 1SJVA 4JG1H 2ZSVB 3KPTA 4NQXA 3KAAA 1JE6A 4NN5B 3QIWC 4WWKB 2UVFA 3VXNB 5C0NC 1A1NB 2WBWB 4JRXD 2XTJC 5JPNA 4Q74A 3RZCB 5BS0A 2Z8RA 3C6SA 2B0SL 1YEGH 2YKLL 3K4ZA 4M5YH 1B0GA 1MAJA 1MI5B 4NRYB 4ZS7H 4FQJL 1URLA 5EH1A 5I76B 2MQ0A 3T0EB 3QQ4A 1IQDB 5SWZA 3VFTB 1FFRA 3DXAA 3NCYP 3SQOH 4CVUA 4XCYA 1UB5A 3EO9L 4YE4H 2H41A 5GQBA 1GXEA 2HJLB 2R9HD 5J6GB 2PCPB 4RGMB 3V4UH 1U2CA 3EKCA 5D7SH 1MHPH 4V1DD 2VAAA 4PJ7B 3KDMA 1F4HA 3PWPB 1F6AA 3WUZA 4HG4K 2EDNA 5DURB 4GBXB 3TNNB 2CLZA 4KKBD 1OP3K 5J13B 2X70B 4QRUA 4WO4B 3PQYD 3GKWL 4F37K 5IQ7H 1CQKA 3SGKA 4D0CB 3FT4B 4HC1L 2A38A 4O9HH 1VA9A 1TQCB 4MJ4A 3WFCH 1TIUA 4FQ2L 4P5TA 1J86A 3QUZA 4JR9L 4XX1G 3MO1A 1J8HE 5EC2B 3ROOB 4H5SB 1SVZA 4PRBA 8FABB 1A7OL 3OGOE 1V8HA 5B4MD 5EC1A 4CMMA 4ZTPL 5I1IL 3QNYA 4G6MH 3HA0A 4HKBA 3FB6A 4Z0XB 3PHQA 4GS7B 4LEOB 3S37H 3Q1SL 4LLWA 5JLZA 5DD3H 3OJDB 2I26N 1CICC 4MMZC 4OM0L 5HYQB 1YNTB 3NIDF 3HE7B 1U8OA 5B8CB 2KZ1B 3FFCB 3GJFB 4OLVH 5IVZA 2W9DH 4I0CC 5DO2C 5FYKE 3QFDB 1T7WA 1CGVA 2Q6WB 5ID0A 2W0FB 2MKWA 1UKTA 5DJ0B 3VFRB 2NNAA 5IJVB 2CKBH 3VGAB 3UZVB 4MB5A 4YXKL 4CADB 5T3ZD 1H8SA 1N6QH 3JWDH 4NQDD 4HWZB 2HFTA 3AREB 5DA0B 3OAZK 4LHJB 2DLFL 4JKMA 1DJSA 2MNUA 2P24B 4G8EB 4Q9QH 2GJ6B 2AK1H 4DZ8A 2LU3A 2MJWA 4Q2ZA 3QPQC 5BV7L 3NOIA 5SX5H 3V52H 3KYMA 1V5JA 4DGIL 3FN0H 2V2WB 4WI7A 4HUVA 1PD6A 2G5RA 1DDHB 4O2CB 4Z7NF 5JDSB 3I3BA 2FX7H 3ZYOA 5JA9A 5CZKA 5C0IB 1U8JA 1F4YL 5ALCL 2R0WL 2ILLA 2Z93B 4MAYB 4JFEA 5KSVB 5I1AB 3GNML 1KGCE 5C0CE 2FL5A 3VFGH 4S1QL 4TNVK 4C83A 3D0VB 2HT2C 1XR9A 1E4XL 4BZYA 2MCPL 5SX4H 3D39A 5SX4I 1I85C 3CVHL 1C08B 2XWTA 4I9WE 1CLYH 1GZPB 4PJAE 2PF6A 2E7HA 1FC1A 4P4KC 1NCAH 1I1AA 3MRCB 5KTEL 4UV7H 2GK0A 2PKDA 2C1PB 1BEYL 3BEWB 1IAII 1A6AB 5IB5A 5ANMA 4YQXL 3S36X 1QLRB 4M6OH 2R1WB 4BZ1L 2XXMB 3HC3L 4QHLB 3UAJC 2JIXA 3MRBA 4OF6A 2VN4A 2Y6SC 3O4LD 3MBEB 2XN9E 3LKPA 4FXKB 25C8L 3DV4B 1MJUL 1Z9OA 3ARBA 4R7NB 5H2BA 3PJSA 4PJ8C 3O6LL 4J3SA 1HILB 4F7PB 4I0KA 1K6QL 3WUWG 5E5MB 1YUHA 1OWWA 3GSQB 4L4TB 1WWCA 2XQYK 3L5XH 2VXTL 3QDGE 4HKJA 2X6MA 3W0WD 2HH0H 2GKIA 5IR1A 1CFNB 3DECA 2APVA 3IDXH 2OR9H 1MLCA 1KJ2H 1T1XA 4WUUE 3VFUB 2H2PC 4FABL 1OSPL 3WE6B 1LE5B 2WINB 4U1IB 3NPSB 4PV8B 3OV6A 3HE6B 5E6IB 4OZIA 2FYYA 2XOTA 3TPKA 4LPXA 4QF1A 2YWZA 5C0EA 1AQDA 5EA0H 3Q6FB 4DFHA 2J2ZA 1CDGA 2YZ8A 5E2VL 2YN3A 1UB6A 5CWSB 4LCWB 3IXTB 1LP9B 3D2UA 3X3GH 2PO6A 5A1AA 3T3MF 4JN2B 4OKDA 5E8NA 4LVOB 3BJLA 1IM3A 1AD9A 3U2SA 3SKNA 1XAUA 1JPSH 4JFXA 1YPZA 2B4CH 2IGFH 3LD8C 1R0AL 2D31A 1KB5B 3ARRA 2I07A 1XGYL 1P84K 3CFDA 3LN5A 4O02L 2PTTA 3LKNA 1L7TH 1LDPL 2QQKL 1LEGB 1MAMH 1OGTB 5HYJE 5JNYB 2A74A 2YRLA 3GHBH 1ND0B 4M7ZC 5DEGA 4XX1E 3QA3A 4LCUA 4LLDA 2BRRL 4WI9A 3K2UL 5TH2A 5F70A 4N0CD 5DK2B 1K3IA 3U7YH 3P9MA 1D5ZB 2ZKHH 1U8PB 2BVOA 3ARSA 3TH2T 4RA3A 5FA3A 5MEOA 1NAKL 3H3BC 3CFJB 4M62H 3G5XB 3AXLA 3MV7D 3IFLH 2BCKB 4PRIA 3UTQB 3CC5B 4KK6C 4OQTL 3RHWF 5T3XL 1ZA6A 3VFSB 5E8OA 4OGAD 5I8CB 4MJ6A 3MOAL 5BV7C 1OAQL 5FOBA 4XBGB 1FLTX 3EDFA 5T1MB 1XGTB 2V17L 1J8HB 2BVUA 2EZ0D 1MCDA 3OZ9L 2OL3A 4KI5E 3BP7A 3WEXB 4AT6A 2BDNL 2UV3A 4R26L 3QDMB 4W70A 3BYTA 4UIKH 3LN4B 5IROA 2NY7L 2BVYA 3MX0A 5CEZH 5J7CC 5EBWB 2QBWA 3RL2B 1S7RB 1NJ9B 4NJAL 3RPKA 3DMMD 3OF6A 5AD0B 3W2DL 3M1BB 1KJVA 4JHWL 2ARWA 2AGJL 4UV4L 4DN3H 1JGUL 1X4YA 2CR6A 4P9ML 1FLRH 4DVBB 3DURA 1C16A 3UPRA 4RWYL 4FXLA 1BOGB 2XQYG 4LVNC 5FUOH 2PTUA 3IDIB 1PGRB 3IRPX 4ODWB 4YBQD 2P48B 1T1ZB 3BH8B 4CU6A 4M43L 1W0VB 3QFJB 1G6VK 1ETZB 1HH6B 1G84A 3KPRD 5I74C 2Q8BL 4JY6B 1TTUA 2NZ9C 1RFDH 1VDGA 3FQWA 3OXRB 5KAQF 1EXUA 2V2TB 4LARL 3EIFA 3GMRA 1JUFB 3I75A 1JPGB 3BVNB 4QO1A 5EZLA 1G6RB 4HSQA 3CFKA 5J12C 4AJ0A 4DEPC 2B1HH 1S7XB 3MYZA 1BFVH 4O4YH 4W6WB 4YHLL 4AY0A 1T6WA 1M7DB 1Q0XH 1X5AA 4ODXA 5F72S 3I3DA 4DN4H 2I5YH 1CDUA 4NOBA 4I5BA 3MREB 4J1UA 4WW2A 3FQUB 2V9QA 2WMPA 4Z7WE 1CXLA 1XMWA 4Y16C 2IH3B 2ZWLT 3WIFA 1QSED 5JIPA 3WLWD 1V7NH 4M93B 3UBXA 3U9UB 3V5HA 1F90L 4LKCA 4XP4H 5C0CB 3BZEA 1KTDA 4JDVB 3J7HA 5FHAH 4AEIH 3L3GA 1BAFH 4J8RB 1MFEH 4NN5C 4WWKC 2YPLA 4NBYB 3JXAA 1VFAB 3LIZL 5F9OH 3RZCC 1OT1A 3QJHA 4NKOB 5F7EH 3IJSA 3UYOD 1ZTXH 4LASH 3PGCB 4KTDH 2EYSA 1EVTC 2CO6B 5L2JA 1AY1H 4LEXL 5TF1H 3T0EC 3WDHA 4NZRH 3GSNB 3CPLB 3SDYH 4GKNB 4PJAF 1TJIL 4PG9B 3MRQA 4DKAA 2DIAA 1CXFA 2YSSA 5FCUL 4D0DB 5CZVH 1RULH 4KQ4H 1L0QA 5FDWB 3RU8L 2P8LA 4RGMC 2R56L 5GGRA 3RWCA 3SE8H 5HHQA 1U8KB 2R1XA 2VWEE 4JFOA 4LIQH 5SV3A 3GSUA 1MLBA 4GBXC 1KBGH 2EDLA 1I3UA 5J13C 3ZKMC 4WGVB 4WO4C 3QDGB 4X4MA 5T1LD 4HX1B 2R2BB 3MJ9L 4U7KA 1F3DJ 1KN4H 4OV6F 5FF6B 2W0LA 2DBLH 3OHXB 3IU4L 3RTQB 5IFHL 1RD6A 2CK0L 4N1HB 4D9QE 4LSTL 4ZS6C 4NQEE 1FP5A 3QXDB 3VWKB 1TQCC 4BSVA 1K9TA 2WBJD 1ZHKA 2FJHB 3ARZA 4JFPA 4KHTH 3V5DA 2FLRT 4CNIA 2PXYD 2VH5L 4UZGA 4GW4A 1AGCB 3B9KA 1T5WB 1KB5L 3Q5OA 4WEMB 1ZHBA 4JZNB 1WIPA 1G7JA 4S0TD 1QBMH 1S9XA 4GS7C 1PJ9A 1XF1A 1C5BH 1MH5B 3HE7C 2XA3A 4TOYH 1QO3A 3FRPA 3PL6A 3QUMH 5GS2H 5B8CC 3N1PC 3ARQA 12E8H 1OTSC 3N85H 3MZTA 1Q0YL 2OJZL 2UYLB 1SEBA 4Z5RB 1PG7W 2ZUVA 4F7EA 3Q2CA 4HG4J 4OZFH 2BZDA 3SY0B 3MLXH 4ZSOB 3TBSA 3CH8A 4HBQA 4S10A 4X6CB 4HCRA 1T0MA 5FECB 2MQCA 1HINH 1KEGL 4Y5VB 1TETH 5C0BA 4WHCA 3VGAC 4NO2B 2P5WD 1AO7E 3RNQB 3EO1A 4LNVA 1FORL 5ILTH 4F8TA 5SV4A 4FQIL 4RFNB 1VPOH 1R6VA 2Z4QB 3AREC 3RI5K 3C5ZB 3OJ2C 2GTZB 5AG9A 3MJGX 3N50A 4OCNC 4XC3L 2H3NA 4HFWB 4OFVA 2W38A 2YK1H 1AGEA 2OR7A 2VO5A 4YHOH 4CW1A 1NMBH 3RA7H 4LNRB 2AJXH 3EJYC 3TJEH 1YY8A 4MJIA 3OKOB 3QDHA 1SY6H 3HTLX 2EXWC 4G80B 1MF2H 3MUJA 1YQVH 3VCLA 5DHYB 1PKQE 1VGKA 2BHZA 2NXZB 1XCTA 3CAFA 4MAYC 3L5WB 5CEXA 3TPUA 1AQKL 3BKMH 4OCWH 3X17A 4FFVD 3OKDA 1NCDH 2DYPD 2V2XA 4XPTH 2BVPB 1IGCL 5MENB 3C8KA 2A1WL 1N64H 1GGCL 2YPKA 2Z91A 1MRFL 1I7RB 2VDNL 4TSCH 5D5MF 1QLEL 3BGMA 5FYKL 3QG7L 1FIEA 4U1JA 4FTVB 4FXGB 1G7MA 3STLA 5DMGD 1IEHA 3KNBB 3CDGA 2VQ1B 1IC1A 3A6OA 5D7KE 3SPVA 1E4KC 1YZZA 3DVNA 5IBUG 1MCRA 4GRMB 5JHDA 3MBEC 4M7KH 3U1SL 4KTEH 4POZC 3KR3L 2NMSA 4E9LA 3QWOA 4KI5F 1U6AH 2FWOB 3RKDD 4M7JH 3GDBA 1JTPA 5L6YL 5I1KL 4YX2H 2F5BH 1WJ3A 4X98A 1G6RL 1MUJA 4BZ2H 2DOCA 1Q1JH 3QCUL 4YDVA 3D1MC 1CDIA 3OGCA 1LO4L 2OJEB 2CDGA 5F44A 4RAUA 4UT9L 1KTLB 5F9WB 2RR3A 2HTKD 2DMCA 4BSWB 1NUNB 3X13A 4RGNB 2VZUA 5INCB 2CRIA 5KVEH 3NPSC 2F54B 2P8PB 3DGGB 3HE6C 3NMEA 2OSLA 3AROA 5E6IC 1E6OH 4NO3B 2QQNH 3K46A 1F00I 2Z0BA 4NHCH 3VI4E 5GGTL 5A16A 1R5IA 4NBZB 5F3HA 2Q8AH 5H94A 2RFXA 3CMOH 3L3OB 4LPWA 5D7JA 2Q87A 3QWQB 2FGWL 5EOCJ 4OLWH 1DLFL 1Q9KB 4Z7WB 4H1LG 5F71A 4LVOC 2V5YA 1LVEA 3ZE1F 4DUXA 3VI3E 3C2SA 3WUWB 2A83B 3GSNL 2CDFB 5IFAL 3V0VB 3BW9B 3RIFF 3DUHA 2PYEA 5BZDB 5CUSH 4HKXA 1P1ZA 1HWGB 2FIKA 2AXFB 2X4TA 1RJZB 4Z7UE 2EKJA 5GZNC 2GY5A 1MRDH 2C9AA 2J7LA 3OAUL 1MCLA 4XP6H 1W2KT 2W65B 4I48B 4P23A 1ZT7A 1VGEH 5LBSH 4LLQA 3MRNA 3RKPA 1O0VA 4JO1L 3UTPE 1JZ5A 3O2VL 1VEMA 1MFDL 1QSVA 1OGAA 3MR9A 4OF0A 4HXBL 4ZMAT 2AVGA 5I17A 2VLKB 2IADA 3DPBA 5KZCB 5T33L 4OCLC 3MCKA 2HAZA 3MPCA 3VXMD 3PIQA 3MROB 5DFTA 3LKSB 2RHEA 4M6AA 3GRWH 3VFOB 5GSVA 4UTAH 4NBXB 1IGML 3QQ9D 5DS8B 1RK0A 3HZVB 3G9VA 5C6TH 4GKSB 1X6NA 3M8OH 1ZGLM 3PWVB 1WIUA 3BIKA 1WV7T 2D03H 3TNMB 4NNYB 3O3DA 1EIBA 4O2FB 4YHPA 3VE0A 2XKNB 5DUBB 1G0XA 2ZUUA 1CN4A 5IB1B 2CLVB 3G9AB 4M1GH 2PW1A 2QQLH 4QHMA 3RDTB 2VN7A 2Y5EA 3QH3B 1EGJH 1DFBH 4M00A 3ZL4L 3W39A 4N68A 5DMJB 3PGDA 3C6LB 3BUYA 4LSQL 4LGPB 1FO0B 4L4VE 2E27H 2LFGA 2J6EL 5K9QG 4UOJA 1SJHB 3BWAB 4YR6B 5AAWA 4OCRH 2GAZB 3VFWA 4B7IA 3ALWA 3C08H 1A4JB 3L6FB 2L0DA 3CZFB 5DT1H 4NO0B 3F7QA 5F8RC 5I71B 4NWTH 4WU5A 4PTTB 1NCTA 4CVZB 1JRHL 5D71H 3CLEH 3EJZC 1JPST 1DR9A 4ODUA 5JUEH 4ODVL 4PREB 1AO7B 2XNAB 1J1PH 2DWDA 1FNLA 4F80A 3ZKND 2VIRB 5DD5H 1F58H 4DZBA 5DHXB 2YC1A 5CIPB 4TQEL 4AEFA 4MNHA 3QDJE 3HUJA 3PWNB 3SCMB 1EBPA 2DQDL 1T0PB 1ROWA 4IOSD 3HR5A 5MI0B 3VFMB 3FO2B 3BH9B 3W11D 5HHOD 4JPVH 2DI7A 3GHEH 3H42L 4Z0BL 3CSYA 3IU3B 4NUJA 5F88B 4AENB 3VFVB 4J4PC 5IM7A 4X0KB 1P4IH 5HI5C 3C87A 4LSRH 4C4KT 4S0SD 1MCCA 3ZTJH 3TO4D 4QHKJ 3GBNL 2ADGB 1IE5A 1LO0H 4PIRF 4X4XA 1FFOB 3GMOB 3GMLB 1PKQB 2HWZH 1DUYA 4OCSL 4M93C 4G43B 1GPOH 3WHXA 4OD3H 1JPFA 3GKZA 4G3YH 4W4OA 3SJVB 2FNBA 2F58H 4TNWF 4JRXE 4WNQB 5E2UL 5J3HD 5F1NB 3QBTB 3NZ8A 3EYVA 2VDRL 4P48A 1YEHH 3LS4H 3F5WB 4KMTH 4KVNH 3IETA 4RMTA 3NIFE 3VXOA 4IMLB 5C0RH 1UYWL 4Y0GA 1P7KA 2X9YA 1D5IL 4RQQA 4CMHB 1CS6A 3QCTL 4RBPH 4WTZG 5CBAA 2E8YA 2AXJA 5K9OA 1RIVL 5E2JA 1TZHB 3P30L 4LHQB 1LO2L 3V7AE 1CGXA 3SE9L 1FVEB 4K7PL 3EJJX 1YMMB 1BJ1H 1WCQA 3LV3B 3Q6GL 5LXGL 4V1DE 5I1LB 3H9HA 2VABB 3S36H 1XGRB 4XP9H 3WFBL 3S96A 5CP3H 1T2JA 3DV6B 2E9WA 1CLOH 3OXSA 4KHXH 2AJVH 5C09A 5D7IE 2R29H 3GMNA 3LEYH 5HPMA 3QEQB 4P59L 1IM9D 3QEHB 1X7QB 1EEZA 3RTQC 5DMYA 3MUGA 1MCBA 4K3JH 4ZUSB 5FO8A 3WIIL 1HIMH 1OPGL 5EBLB 3DIFB 3VWKC 5I75B 1MRCH 5ITFA 1K8DA 1H5BB 4ZQKA 3L9RB 5HYSA 2QADB 3QIBD 2Z35A 1ZLSH 5D93B 1EO7A 1WICA 3QR2A 4MA8L 5CHNA 1ZHNA 3QUKA 1C12A 2XZAL 3CGTA 1HCFX 3EAKA 3PDOA 4ZD3H 4JAMA 5IB4B 2W91A 3P0VH 3MLZL 3VI4F 5IEHA 1J5OL 1YYLH 2C3GA 1S7SB 3NFPB 1YEFL 5E2TL 3TC9A 1G7LB 4K94L 3FO0L 1QRNE 4OF7A 1FZJB 2X44D 4Y5VC 1CI5A 2MQ3A 4OKVA 2B39A 3RBGA 4N9GB 5T3ZE 4HK0A 3VI3F 1NL0H 2V5TA 3PNWB 5T5FH 4X83A 4NQDE 1MY7A 5EIIA 2XWBA 4RFNC 3EDJA 3BHBA 4KXZH 4KXZI 4NWUL 4FQLL 3C5ZC 5AG8A 2YEZB 2RCSH 3RWEA 1EFXA 1WITA 4Z7UF 5ICYB 5AAMA 1K4DB 1BF2A 4F57H 2WWKO 4URTB 5ETUB 3U6RA 4J3WA 5JTWA 3RWHA 1CE6A 3NH7H 3CCHB 4QRPB 2NXZC 1G0YR 5L2KA 1LNUB 2QEJA 1FO0L 3OJMB 1GCFA 2R69H 3HMWH 1MSPA 4ZPTB 1ONQA 4X4YB 1FCCA 4I1NB 3KPOB 2FR4A 3L3DA 4N5UA 2XRAL 4R4ND 3EDEA 3R0MA 4G7YL 5BVJB 4HJJH 2DQUL 2YUXA 1B0RB 2GK2A 5E5RB 4KI5C 3GSRB 4JFDA 5IMKB 1VFUA 2XIDA 1NGPH 3ARDB 3KWWB 4I18B 3NCMA 4DK3A 1BMGA 1IC5L 4L4VB 4P9HL 3O4LE 1FVDA 4XAWH 1KIPA 2HKFH 1FQ9C 3C09B 2LE9A 1SYSA 3L3HA 4P2OB 2EEBA 4JGJA 3BP4A 4GAYA 3O6FD 3P11H 2XZQH 3G6JA 1JI2A 2BNQE 4LHUG 3ZTNH 5DC4B 2VXVL 4R96B 4RMVA 5HBBA 3E6FB 3KPMA 4IHOA 5C0JA 2VR4A 32C2A 2D2OA 1B90A 1NBZB 2X4OA 1A6WH 3DO7A 4O58H 2VNCA 1TXKA 3TWCH 2GEEA 4XZUB 4C54A 5D72L 3EOTH 5DHVB 2EC9T 4HWNA 3BWUC 5F9WC 2JJUA 1OT2A 1EBAA 1NSNH 1OCWL 3LRSA 2CRYA 1AH1A 2DD8L 2QQQA 4AL8L 4XTRD 5E03A 4RGNC 5E4IA 1MCSA 3T4AB 2P5EA 1P2CA 1YEEL 3PGFL 3WL9B 4HAGA 4NOFA 3A6CH 1QLFB 5EUKB 2WNGA 5L7XH 2JB6B 3TA3A 4DCQB 5EWIH 1NGQH 4L8CA 3SDCD 1J05B 5IBUB 1FNEB 5MP6H 2AK4D 1M7XA 5CKGA 1FL3B 1TVDA 2EE9A 3QNXB 5EBGA 3V7MA 1LEKB 5DA4A 5JW4N 4QWWD 3QIWA 3PWUA 3KPLB 5D9SB 3MOBH 1ORSB 3UTOA 4LSSL 1WF5A 2OZ4L 4ORGA 1KF9B 2EXYC 5FYLL 2YUWA 1QKZH 5HVHB 4OZHA 3S34L 5IGXL 1A0QL 3BKJL 1BFOB 3OG4B 5C07D 3C5JB 5EU5A 1KLUB 1Z9LA 3MNVB 4PRPB 1EUTA 2QSTA 2V7NB 3MRFA 2XY1A 1I9JL 2F74B 1ES0B 4M6NL 5D1ZB 1DEEB 2ESVD 4OD1H 1AGBB 5E1AB 1R3IH 5B38A 3V8OA 1LGVA 2AJZA 3Q5TA 4JQVC 5E8DH 1K2DA 4ODTH 3UCRA 2DM2A 1VACB 2CIKA 5MEQA 5LWYL 2E8ZA 4OT1L 4GAGL 3PHOB 5ICXA 1F3JA 4PGDB 3VXSE 3NBNA 5ALBL 3Q5YA 5I8OL 3MLTB 4EUPA 2LABA 2VDOL 4OLUL 4QTHA 5C08A 3NIFF 1ZLUH 1MHCA 4K94C 2VDQH 1IEAB 4V1DB 2H1PH 1K5NA 2FDBP 1MWAA 5IT2H 1UH2A 1H3UA 3D3VD 4H1LB 5KSAD 4QHUB 5CILL 1D7FA 3MV7E 4JFDD 1H3VA 3TVMA 2ZG2A 5JORB 4L29A 2BVQA 5GGVL 1BBDL 2FECL 5I19H 1JGDA 3FT2A 2YRPA 3FOLB 43C9A 2X9WA 4EN3D 4QRRB 4WI5A 4HIIA 5TE6H 1ZS8A 2PUQT 1XF5B 4DAGL 5IMOB 2AW2A 4KRLB 1D9KD 1GZQA 4X5WA 1KPRA 3MRRB 2DMKA 5D7IF 3RDTC 1CICA 4X7CC 1NBYA 3C6LC 1RUMH 2QJDA 4PJGA 3AFLA 4G8GD 1JGLH 1B3JA 4I2XE 3WXVL 1L6ZA 1T80A 1ERNA 4WVRA 3WNPA 1REIA 4MNGA 5INDA 5BQ7A 2P43B 4AK1A 3GIVB 1PKOA 3S5LA 4C56D 4JFHE 1DANU 4ONFL 5IV2B 2DI9A 3QAZB 2APBA 1HSBA 5DK0B 3UC0L 5I71C 1B2WL 1RJYA 5JQ6H 3ZMRA 4XMKL 2AJYL 1MREH 2FX8H 4P46C 1TTFA 5A2FA 3R1GH 4ZAKA 4YAQB 1QRNB 2CLRB 4FZEH 4YDKH 1UXSA 5I73B 5EN2B 4NP4H 4XB8A 3OKEA 4P9HC 1FFNB 3O3BB 3OKKB 4YHMH 1KJMA 4PLJC 3D25A 1RZKH 1C7TA 1PVHA 1I3RB 3LRGA 3ROLA 1FVCB 3OAYH 3JV4A 4XPAL 5GRJL 5DJAA 3KPNA 1VCAA 1TPXC 1YEGL 1TCRB 3G04A 5C0ND 3RWDA 5E95B 2R23A 2XTLA 2XTJD 1J1XH 3SCMC 2DQJH 4AIOA 4L3EE 3DNKA 1S9VB 1O7SA 3WYRA 5MI0C 4Z76A 4PP1C 3HI6L 3SDXA 3BPLB 3SQOL 4KUZL 3KPSA 3VWJC 1PFCA 3TESA 4XH2A 1BBJA 5SWQB 4YEEA 3O9WD 1MOEA 1MQKL 4NRXB 1NGWA 5HY9A 4N0UB 4AYFA 1QYGH 4HS8H 5CP7B 5D1QB 5D7SL 3UTSD 5HDBE 5F7DB 3BD3A 1G9MH 2HFGH 5ID1A 1PYWB 2Y72A 1RQ5A 3LKQB 2A9ML 3ZHDA 1U8HB 1QPPA 2ATKA 4FNLL 3VXTA 5FM4A 1J9CT 1C5CH 1NMAH 4F7MB 4F33A 1FSKB 5I16A 4FRWA 1JWMA 3UTZA 3TO2B 1OP9A 3WD5L 4LSPL 1BZ7B 1HQRB 3CXDL 5IQ7L 3UXFA 3WHE1 5IFJB 3INUL 3NABL 2IBBA 4X9BA 3MLYH 3MBXL 1EA9C 4FFYH 2BFVH 5HGDB 2XWJA 2Q7NA 5GS1A 5JXEC 2D4DA 2VKXA 4CMHC 3LQAH 4HWEL 4PJ8A 1WCBA 1NGZA 3O4LB 2YD5A 2DDQL 3IDJB 3HI5H 5EU4A 2HVJA 4XRCA 4RRPG 2UZYB 4IRSC 4EVNB 4IOFD 1K8IB 2BNQB 2NX5A 1WZKA 5DD3L 3SDAA 4BQCA 4JN1H 5FXCH 5M7QA 4ZYKA 2ZUXA 4PJFE 4N8CL 1CICD 5KSBB 4HHAB 2OTWA 2VDPL 1S9WB 1QEWA 1EFQA 1QQDB 4NHUA 5DO2D 1EMTH 3MUHL 5DGRA 4GMSL 3HN3A 5DC9B 1OAUL 3GMQB 4BH8A 3WS6C 3MLVH 1LO3H 5C7XH 5TGBA 5AWNH 3FO9B 5I75C 1H5BC 3LSOB 4HK3J 5ESAB 2QADC 4PJBA 1YNKL 4KKLD 4U6VH 5D93C 3V52L 3ARFA 1RK1A 1E28B 5FKAB 2F19L 5IJKC 4UOW1 3QPQD 4NQTA 1TJGH 2K3TA 1I8MB 1LQSR 4XNMB 2FX7L 4QHNA 2Y06L 1GH7A 1YN6B 3MYJA 5DJCB 2A0LC 3SKMA 4F3FB 4MWFA 4UTBH 2AKRB 4D9RD 1TVHA 2OMNA 2EIDA 1NEZG 4BFBD 4PYHA 4W6XB 4HS6A 5D2NE 2XQBL 5EZIH 1T21B 4PY7B 2P5WE 5IHBA 5I1DA 4WJ5A 4LBEA 3AM8C 1Y18B 1PG7X 4XBEL 3CDFA 4X7SL 1CR9H 4HWBA 2J3SA 3SGDI 5CGMA 3RUGE 3V6BR 5KVFL 1IAIL 2AI0H 3VXSB 3PWJA 5TQ2L 4M5ZH 1ZV5A 2AXGA 4P4KD 1NFKA 4HUWB 1IKNC 1KB9J 5EU7E 4Z7VE 4OFPA 1DQMH 1U3ZA 3I6LD 4FG6C 1DP0A 3B5TA 1XF2A 4OAWA 2B2XL 4WUKL 6FABH 3UAJD 4JM2B 1QSFE 1X5HA 2Y6SD 1S7UA 4U6HB 4NQCD 2GJJA 4TRPL 1S7VA 2GJZB 2VL5A 3D85B 1AIFA 4PJ8D 1INQA 1PZ5A 1YEDB 2WV3A 4FP8H 3V0WL 1AI1H 3QEUA 1C7SA 1CLZH 5JW5A 1XF4B 4PRHA 4JFYA 1QBLL 3IDXL 1R3LB 2JB5L 5DJYA 3U0TA 3SOBL 2DS4A 5DF0A 5GIRB 5IHUH 3EO0B 5GSRA 5IW6B 5D6CA 4KPHH 4U1HB 5HVFB 4ZTOL 4U1NB 5C0GB 4DKDC 1JVKA 1JN6A 4H8WH 3ARDC 1RIHL 4I18C 4M1DL 4I2XB 4U1MB 3WS3B 1MY5A 2A6IA 5T3ZL 3C09C 3DBXA 2BNRB 2ZCLL 3OTTA 3GI9L 2DQGH 4P2OC 2V6HA 4DGVH 3B2UD 1UKSA 1R24B 1NC2B 5JW4Q 5IF0A 4YBLB 1B4RA 3VRLE 4JFQB 2BXZA 5ERWB 5CBEA 3QHZH 4JHAH 2FSEB 2B4CL 4HJGA 3LAFA 3BN9C 4UB0H 1V05A 3X11A 1KIRA 4NM4L 5C2UB 5ELIA 4AMKH 3AY4C 3H7BB 4OCXH 1CG9B 1NGYB 4HZAA 3OKLB 2AV7A 4WY7L 4OGXH 3NFNB 1L7TL 1F11B 4GRLA 1FL5A 1XIWB 4Y5XB 5FYKU 5B39A 4ZDHB 5LAXB 2J4WL 2O93L 1EDQA 4M9OA 4L3EB 4Q6IA 1CIDA 4JGUA 3QO1B 5LCVH 4LMQI 5C0AA 1JFQH 3EOBA 4KJPC 3REWB 5CZXC 4ETQA 3U7YL 1N0XH 1N5AA 3EFDH 3CFCL 3DX6B 1BIHA 5EORL 2ZSVA 4XVUC 5GRUH 4QY8B 4LHUB 4FQQA 4MQSB 3RPIA 4KK5C 2D7TL 3HRZA 1FE8L 2X4NB 3CFIC 3QSKB 1GGIH 4YUEL 5HVHC 4RAVA 5TDNA 5DEFA 3QUXA 3SDDA 2FJFB 4ZFGH 3ARTA 3T0EA 5D1ZC 5HDBF 3F7VB 2W0KA 4KVCH 4LLMB 4KK6D 5FV1L 2XT1B 2EDKA 4PJIB 2YHGA 4WHDA 5T5NG 3TBVB 3T4YB 2KQNA 3LS5H 3OB8A 2H6PA 5J6GA 2ZUYA 1T04B 4JDTH 1KPUA 2HN7B 4Y89A 1MIMH 4JFFA 4IMKC 5GGRY 3DX7B 4UIKL 4WV1B 3IAQA 1HHGA 5ACLA 2BERA 5DJXB 4HPYH 1FAIH 2R4SL 1ZWIB 4WFHD 4CRPA 4U0QB 4XCNB 3VXME 4YDLB 3VD4A 4LRNH 4PY8J 3OAYK 4KI1A 4M4PA 1XGPA 4EXPX 1WT5C 2MCG1 2IF7A 1UA6H 3O11A 4JLRB 1JYWA 1XF3A 2ZNWA 4BELD 2R0ZH 4JPKH 4RMWA 2D3VA 2IALA 1KCVH 4G9FE 3UZEA 2WWMC 4H5SA 4JGMA 1CT8B 3FONB 5K9KB 2WBJB 4XXCA 4BFGA 2CMRH 3D69A 3CZJA 4PJFF 1ULVA 4ISVB 3H2WA 4HWUA 1RFDL 4DFIA 4OSUH 4MD4A 1FYTE 3CX5K 5HYQA 1YNTA 1PY9A 3HE7A 5E9DD 1INEH 2B1HL 1R5WA 2HRPL 2FBJH 4HIXH 2J8HA 2VDKH 2F8VA 2Q6WA 2W0FA 1LWRA 4P2RA 4OF3A 1RZFL 5KS9E 1UWEL 3RY6A 1FV1B 1RZJH 1KACB 3QAZC 3X3FL 1OP5H 2F5AL 1KJ2A 2X89A 2ADJA 3ESUF 3HB3C 2EYRB 3HAEG 4HWZA 5MERA 1CVSC 4Y16D 4AEIL 5I73C 1BAFL 3JSSA 5DRXB 1UZ8A 2FB4H 3BIAX 1MFEL 5IIEB 2HTLC 3QWRD 1UWGL 4ZFFA 1ORQB 2DQEL 1MFAH 3MV8D 4MA1B 5L9DL 4K8RH 4RNRB 1KIQA 1QG3A 5F9OL 5IKCA 2D7NA 3RUGB 1G7QB 5F7EL 4WWKD 1S7QA 4X9FA 3IS0X 4KTDL 2I60H 1HH9B 3RZCD 1AY1L 1DDHA 1J7VR 2Q86A 2B4CC 4UT6L 5HHOE 1HQ4B 4JKPL 4XPGL 2MSPA 3BPLC 4P0DA 5C0IA 1BQSA 1MI5D 2XACC 4UQ3B 1MPAL 3M17B 1P9MA 4GAFB 3KXFB 1QSFB 1X3DA 1A3LH 3RUGF 4G6AC 2OL3H 5DYOB 5D1QC 4ALAH 1ZOXA 1BPVA 1IT9L 5ICZB 4MQXC 3OMZA 2ARJA 4X5XA 3VXUB 4CN6A 3PP3K 1C08A 1UFUA 4ZODA 4NM8H 4Z7VF 2CKNA 3QIUA 3KPQB 1PSKH 3MRCA 4QXGH 3PWPD 4TUKH 4ZUUB 1FSKC 4OGZA 5DURD 4GBXD 3H3PL 3NCEB 3LPGA 3JVGA 1VEPA 3Q0HA 3IDUA 3ZKMD 4WO4D 1E27B 2G5BA 2X1PA 4TN9A 4UDUB 1E4KA 1N59B 2R1WA 3ZT7A 5I66A 2J1KA 2DKUA 5GRVK 1SMAA 4N90E 1CFQB 4PJ5A 1OAKH 2R2HB 3DV4A 4Y19A 4ZS6D 4NDMA 2JJVA 5ESQA 4DOHE 4R7NA 1CFVH 1MHEB 5JOFB 1HILA 4F7PA 3HNSH 1JNHB 3B83A 5DD1H 5E5MA 4HH9B 1QBML 3RWFB 5TF0A 4JFZH 1JNNH 1YN7B 1A14H 3EDKA 3MV9B 4HPOH 2Y07H 4PRNA 1MVUB 3WFHB 1UM6L 1WZ1H 5T3XD 4NKDA 4ZFOB 3RWIA 3VH8A 12E8L 4XNXH 4KRNA 3EOYG 3ILPB 4OLEA 1A9BB 3V6ZB 5F1IB 4HS3A 2ED8A 3L3JB 3FFCD 2MTPA 4O2EA 5FK9B 2CJUL 1WFTA 2Z31B 4OUUA 3TIDB 4L1HA 1RZ7L 2YN5A 3U79A 4MCZB 3HLAB 3VRLF 3Q6FA 5ILTL 1XGUB 4XPHH 2HT4C 3SBWC 2AABL 3UBXI 1G1CA 4BH7A 4KMLB 5C8JA 2DRUA 3SKJL 3KJ6H 4O5LH 1IAOB 4RMRA 4NNXA 1BQLL 4XC1L 4OQ1A 3S9DB 1I8IB 1TZIB 1VFOA 3WV0A 3ARED 5CJQL 5HHNB 3SGEH 3SGEI 2Y7QB 2GJ6D 5I1GH 4MA3B 4MQ7B 3K1DA 2ICWJ 3MA7A 3RA7L 5I0ZA 5IG7A 2LTQB 2FH8A 4UUJA 5FB8A 1XR8B 4E0RB 4EIGB 1KJ3H 3DROB 3TT3L 1CXEA 5JNYA 1OGTA 3EJYD 2R4RL 1X5JA 2EXWD 3IJYB 1CDHA 4HIEA 2ZOLB 4LK4A 1Y6NR 3HS0A 1TQBB 1BX2A 1FZOB 4MAYD 1A1OB 1N64L 4G8FA 4QYOB 2H32B 2EKSA 4TSCL 5DK2A 3CMGA 4S1SL 4K7FA 1Q72L 3W9EB 3I84A 2CIIB 3GSXA 2B7DT 1LDSA 1A6ZA 2EO9A 4YGVB 5E7BA 3MRHA 3IKCB 5AUMA 2F8OA 4RFOH 3SGJC 2JK5B 2C1OA 4NRZA 2OK0L 1LO5A 1JNLL 2XPGB 5DQJB 2DI8A 3L7FB 5D6DC 4M7KL 5GGQH 2YMXH 1FIGL 2DB8A 5L0QB 3CC5A 1AHWA 2NLJB 1U6AL 4JM2C 4Y4HB 3WFDH 4BQ8A 4M7JL 4MHHG 3MBED 3VFSA 1YEJH 3TZVA 3BIBX 4ERSH 1JK8B 4POZD 1M4KA 1GC1H 4XBGA 4PJXF 1M71A 3GK8L 3MGTB 4G9FB 3RVWD 3I02A 3MRGA 3NCJL 1J8HA 2YZ1A 1BIIB 5GJSL 1NEZB 4PD4K 3FB5A 2KUTA 1MCFA 4GOSA 1NFDB 4L4TD 4MNQE 1I7TA 5KVEL 2EZ0C 1C1EL 2IJ0C 5EBWA 1JPTH 5F21B 1IGJA 5E24E 4WGWB 5KJRH 1J1OL 2AEQL 1FYTB 4HCRH 3O3AB 2P7TA 3B8SA 5FHBL 1J0IA 1MNUL 3V4VL 4Z8FL 3HE6D 5E6ID 2A6DB 5F9JB 1EHXA 4C58B 5DWUH 3BSZL 5KS9B 4U3HA 1U8IA 4OLWL 1BOGA 4YBLC 3WN5B 4LCWD 2WQ8A 1UWXH 1V7ML 3BH8A 3NA9H 1T89C 1AE6H 3I2CH 1BGXH 2GCYA 3LH2H 4JQIL 4JY6A 3UDWA 4MJ5B 5FO7B 5TQ0H 4YBQC 3PF2A 1JUFA 1BECA 5KS9F 2BSSB 3OWEA 2E9BA 4IRZL 4WI3A 1AD0B 4XP6L 1IZKA 3UYRL 1XIWC 4Y5XC 4Y2DA 1VGEL 5LBSL 3I6KA 1KT2B 5HHXL 4XXDB 3QYCA 5GZND 1GGTA 3CFEB 1HZHL 2CPCA 5DZLA 4HGWB 4MD5A 1CK0H 1RZIB 3MREA 1CD1B 3K8MA 4Q0XH 3QUMA 5BXFA 5JPMB 2AK4E 3GSWA 3TO4B 1EO8H 4JKWA 5IHZB 1CFTA 5C0CA 2ARJQ 4Y4KB 3S88H 4OZFA 1QOKA 1U8MB 1OAYH 2ORBH 3I50H 4I4WB 4IS6B 2ADIA 3MRLB 2VLRD 1MCNA 4PJAA 3PUCA 4R90L 1D5MA 4K3EH 2VLLB 5C07E 4L8SA 5F7WC 4NKOA 1OAXH 3T0BA 1N5YH 5GHWL 4AH2A 3PGCA 4PJDE 2ESVE 1GGBL 4ZXBA 1H15B 2DL2A 3QULB 4DW2H 2XN9A 4ZFOL 4M1GL 3MCLH 3IB4A 3MUZ1 3QPXH 1FNAA 4U1KB 4DOHB 2VE6A 1CFSB 1I8KB 2NY4B 4D0DA 3CFBA 1S5HB 4DGYH 3A0OA 3PP4H 2AJ3B 4PJHE 4WV1C 2ZNXA 3P0YH 2ZOKB 1IFHH 4MA7L 4X8JB 1T5XB 5ADOL 1JZ2A 4KROB 1RU9H 1WISA 1T03H 3QDMD 2JKXA 4YDLC 2F9BT 4MXWH 5EZOL 2FX9H 1UM4L 3IFOA 3MMEA 3D3VE 4WUUA 4AIZB 2DWEB 3OHXA 4WFED 3KGRA 1DVFA 3ULSA 5GJTH 3ZZ1A 3OL2A 4TSBH 2BOBA 3CUPB 4F9PC 3U0WH 2FJHA 3HNVL 2YRZA 5EO0B 1OAZH 3A6BH 4LSDA 5FYKD 5JUEL 5KVGH 2C3VB 1RHHA 1T5WA 3MRPB 2WBJC 2N7BA 3SE4A 4I3RH 3MTRA 3CXHJ 1QVOB 2HVKA 5DD5L 1F58L 4WCYH 3UO1H 1TLKA 1RMFH 4OI9A 3QFJD 1QPXA 3C60D 2ZSWA 1CD0A 4DKFH 43CAB 1A1MB 1EEYA 3O45B 1SYVB 4G8GE 1KG0A 4L8BA 3UZQA 4QRSA 2UYLA 1C5DA 5EU3B 4XNUL 5ITBH 1KYOJ 3RGVA 3WKML 3CLFH 4EXKA 4LSRL 4L9DA 5BRZE 4C56E 1HHKA 2WIMA 4J4PD 4Y5VA 4KY1H 5I1CH 5HI5D 3GI8L 4D2NA 5HYJA 4BJLA 2BOCA 4P57A 2HG5A 1BVLA 4CKVX 2WANA 4PJ9A 3JV6A 3R4DA 5CJ5A 4JY5H 3ULUD 2BNUA 3HCVA 1RY7B 2NQCA 1KGCD 4MA1C 5FA4A 4KGJA 3LS4L 4OCYL 4DVRH 1TCMA 3BDYH 3MRDB 3GIZH 2EDDA 35C8L 4JO3H 3BP5B 2XTJE 3AC0A 3F12B 5EUOF 1G7IA 4LNRA 2ITDA 2ZPKH 3OKOA 5EU7C 4WHTB 3CX5J 3OB0H 2MPAH 5D5MA 2IAMB 1PG7H 5J1AB 1HHJB 5KSUB 5JW4M 4NSKB 1H3GA 1MFCH 3RWJA 1N7MH 3L5WA 3N1MC 4Y2OA 1EZVX 4G7VH 3S36L 1NFIB 3LCYA 4XP9L 4DK6A 5E00A 5E5UB 4Z9KB 3VXRA 1KCSL 3S4SG 3IYLW 2R29L 4Z78B 2VC2H 4GKZB 3O41B 3TT1H 5FYJE 4UNTA 5F3BB 5C70A 3RIAK 2VQ1A 5E08H 2G75B 2FHBA 3QDGD 4MNQB 1EERB 1JJUA 2F8XC 4OLYH 2WQRA 4D8PA 4U6XB 4GRMA 3EOAB 3RTQD 3GB7A 1Q8MA 5DMGC 4LRIC 5JR1H 1NCNA 3O2DL 1N4XH 3BQUB 3VWKD 2FWOA 3DRTA 2DQHH 2VQTA 4FQXA 5IBTH 4X7DC 4PGEA 1EHLH 3GRWA 4R0LA 4XPBH 1ZLSL 2COQA 2QKIA 3DTXA 4PTUB 4D9LL 3O6FB 4A6YB 5DJDA 4BA8A 3JBG7 4LCIL 4KJYB 4PJCF 3P0VL 1UVQB 2X4SA 3GMMA 4X6DB 3CNKA 3QI9A 1YYLL 2R0LL 1TNMA 3EYUL 4OGYH 3VDBA 1T3FA 1P53A 2P8PA 1I1YB 1JF1A 5T1KB 1U3HB 2Z31C 5ESVB 5BJTB 4W4NA 3S3SA 2HTKC 4HF5L 1ZXQA 5JDJA 1EAJA 4O51B 2E6QA 5I15H 5T1DH 1WBYA 2W0PA 4LDEB 5IB2B 3G5VA 1IAKA 5F89A 2IBZY 2K7QA 3VFPB 2R8SH 2DN7A 3WUWA 1ZVHA 3C5ZD 4E42B 3HZYB 5F1OB 4IIQA 1U93A 1ZT1B 2ZCHL 1Z3GL 4XBPA 1R3JB 2LTQC 2VXQH 4HDIA 1RJZA 1NCBL 1KEMH 1NGXB 4D9RE 2DQIH 5DI8A 3F58L 2OQJB 2R69L 2NY2B 3OPZL 3VXPA 4PJDB 2ESVB 3O8XD 1VSCA 1WEJH 4HQQL 2NXZD 1TQBC 2NY1D 4CVWA 1YEIH 3EBAA 3MODH 1EH9A 4XCFH 3MCG1 1P7QB 1RUAH 5JW4R 1SBBA 1QNZH 5MEND 2VXSH 4PGCA 4YO0B 1NQBA 3EYOB 4PJHB 1LD9B 4PJDF 1AKJD 3MOQA 2JJTC 4FTVD 3I6LE 3HZVA 1RZ8A 3RVVD 3E8UH 1RAMA 4LDLB 5L0QC 5FO9B 4L3AA 5CMAA 4X6EA 4Q9RH 4Y4HC 3VRIA 1A6VH 3AS0A 4NQCE 1F13A 1KV3A 4NQEA 3FQXB 2RB8A 5DUBA 3QEGH 2GFBA 2ADFL 2V9TA 3IDYB 1FNGA 1PEWA 4O58L 1OD7A 4OI7A 2NY5H 2XKSA 3T1FB 3RDTA 3TWCL 3L1OL 3QH3A 2SEBB 4OV5A 4H26B 1YMHB 1S9YB 5EOQH 3I85A 4RMSA 3O0RL 1BLNA 4M02A 5CCKH 4LGRB 2CGRH 2OTPA 3T0AA 1A7NL 2EH7H 3HG1A 1MIEL 4JHBA 4YR6A 3MJ8A 3D9AH 4C57C 5I1HH 1XGQA 1ADQA 1GYAA 4FZ8H 1YECH 4RGND 1GIGL 2E7LA 2F54D 4NO0A 1EAPA 4F2MA 3HMXL 2P45B 4QXTB 4NT6A 3JTTB 1K4CA 4L9LA 4P46A 2WUBL 5BRZB 4C56B 4L5FL 4CVZA 3O3EA 4FQPA 3HC4L 2IBGA 3WN5C 1AO7A 3AMLA 3LQZA 3DRQB 3KHQA 4G5ZH 3U4EA 4I0PB 3FFDA 3VGGA 3RQ3A 4NQXB 4UT7L 1SQ2N 3HNTH 3DUSB 5EB9A 3CX2A 2EXYD 2ENSA 3SCMA 5JPNB 3ZKNC 3ELAT 3VFMA 5BS0B 5GGSA 3C6SB 3VWJA 4M48L 2P44B 1GAFL 3B43A 3VFVA 1B0GB 5E8DL 4ODTL 4NQUA 1T22B 4NKMA 3DXAB 4EI6A 2F53D 5DTFA 1R3KA 4ZO6A 4XCYB 3MNZA 1UB5B 1PKQA 1YY9D 2LAAA 4ELMF 1OQOA 2N56A 3O9WB 5IK3A 2MFNA 5CJBA 4C55A 3TO4C 3BRGC 4Y4KC 1B0WA 3FRPG 1J8KA 3NCYS 2VAAB 3KDMB 4LCYA 4MSWA 4B41A 1F6AB 2YPVL 2CLZB 2VLKD 3NAAH 5KZCD 5DVNA 2ICWA 4QRUB 3GFUA 4A2MA 4KQ3H 4PRIE 1X5IA 4JANA 5CINL 1J0KA 5E99L 4U1SA 5JXEA 4A6YL 1NPUA 4E41A 1HI6A 3QRGH 5ABDE 3HKFA 3OR6B 2PN5A 4P5TB 4YHYC 5DRNA 4D9QD 5TPWL 4IRSA 5KVDH 4ZOBA 1X5GA 1TVBA 2NY4C 1W72H 2VDMH 1ZGLP 4CMMB 1JGVH 2VXUH 2HMIC 3QNYB 1TJHH 2Z8SA 5F96L 2EDRA 3FB6B 3PHQB 3RX7A 4LLWB 4WFHE 4Y1AA 5JLZB 4KROC 3C6LD 3UJJL 1U8OB 4PB0H 4CGTA 5IVZB 2PR4L 2Q3AA 5ID0B 1DCLA 3H7LA 4BFIB 3WS6A 5C6PB 3E1F1 3LMJH 1X6LA 3DIFA 2VZ1A 3MA9L 2NNAB 1UJ3A 1FZMA 2O26U 4WI6A 4GG8A 3RBSA 5C71A 3QUYA 4K3DL 5L88H 3NN8B 4JRWA 1MCPL 3PDGA 3U4AA 1U36A 2LVCA 4B7LA 1RUKL 1S3KL 3GMPA 3ZSSA 5BVPH 5I1EL 3KLHC 5K9JL 1JZ3A 2O5XL 4DZ8B 4XWGL 5HVGB 2DQJL 1IL1A 5E9DE 3T0XA 1BM3H 2L4OA 4J23A 2D7MA 3KYMB 4MVBC 2G60H 1ZHLB 4HUVB 5I8KH 4BSJA 4KZEL 4PP1D 1G7LA 4U4BA 2NTFA 4Z77B 4Z7UA 3OKNB 1A5FH 1INDL 2HFGL 2I24N 1U8JB 3NFSH 4N9GA 3A67L 4JFEB 1L4IA 5KOVC 4NNPH 3WLBA 1C5CL 2FL5B 1NMAL 5ACZA 5SWSD 4C83B 1IKFL 4NGHL 1XR9B 2IAND 1NCWL 5KG9A 1DQLH 3D39B 4MDJA 3ARGA 1DN0A 2YEZA 3NACH 2WM0A 4FFWC 4PJEF 1IKNA 4EOWH 1RIUL 1I1AB 4XVSL 2ZZUT 3SJVD 1H8NA 3TM6A 1K4DA 4KDTA 2BFVL 5D7LD 1DQQB 2E6JA 1JP5A 1WTGT 4J7RA 3MRBB 4AZ8A 4RCAA 1HYSC 1ITCA 4X4ZA 3HI5L 3LKPB 4QRTA 1MI5E 2IAMC 4TSAH 5JXED 2OLDA 4WHYH 3FQTA 5D7KD 3ARBB 1QFOA 5FYLD 4FQCH 5H2BB 1LK3L 3PJSB 1FNHA 3P4OA 4NCC2 4ZPVB 4MYWB 5DUPH 1MEXL 5FUZL 4RMUA 3WXWH 2R2EA 1OSZA 1YUHB 2FEEL 4UILH 1YMMD 4LSVL 5I9QB 1B0RA 1QA9A 4PJ7E 5BO1H 3PWPE 3V4PH 2E7CA 2JELL 5DUMH 4KJWC 5J6HA 3THMH 3GSRA 3NZHH 3EYSH 1T1XB 5IMKA 3O6KH 5KOMC 3UJTH 4I18A 5EO9A 2IPUK 3G08B 1BD2A 2CRMA 2ICEA 3QEQD 4ZO8A 4Z7OE 5C7XL 2FO1A 3VW3H 2FYYB 3H9SA 4LU5H 1Y0LB 3CK0L 4P2OA 4B5EA 4QF1B 3JTSA 4YHKH 5C0EB 1QP1A 2JCCE 3S8WA 1AQDB 3BEVA 3BQUC 1CDBA 3LPFA 4OFYA 4QT5A 1NAMH 1ZANH 4R96A 1W0YT 1UB6B 1HCVA 3E6FA 1SEQH 1T2QL 3D2UB 2PO6B 1HKLH 5FGCE 5E2WL 2LQRA 2QADD 3O6FC 2O5YH 4OJFH 1GSMA 1IC4H 1E4WH 1IM3B 5T3XE 3SKNB 3U2SB 1TJGL 2Y25A 4JFXB 5DHVA 5FOJA 3VG0H 1KXVC 4K23H 1N8ZA 2D31B 5J89A 1HNFA 3FFCE 3HC0A 3S4SB 2E6PA 3QDJA 3BGFB 1U3HC 3CFDB 5C6WH 3LN5B 2A0LD 3BP6A 4TTDD 4P99A 2PTTB 1A7PH 3LKNB 2JB6A 5DQ9A 2ZJSL 4DCQA 1RUQL 4LVHB 3WJLC 2X10A 3RY5A 2A74B 5I18H 1CR9L 3DVGA 2EH8L 3FMGH 1J05A 1S8DA 1FNEA 5DEGB 5IWLC 1CGSH 4XPFH 3QNXA 4LCUB 4LLDB 1T20B 4RZCA 2CQVA 5TH2B 1ZGLA 5FYJL 4YHIA 3WJJC 1FBIH 2A73B 3KLAA 2EDTA 1MJJB 3P9MB 1MJ7H 2VOTA 1DQML 2BVOB 4UQ2A 1A9EA 5H35B 4MQTB 4HXAH 5FA3B 3C5JA 6FABL 5MEOB 3TBYA 4JRXA 4HZLA 3AXLB 2Y4SA 4YFLI 5D1ZA 4FG6D 1ZEAL 1QBAA 2HJKA 4PRIB 4K2UL 2B0SH 3TV3L 1OVZA 2YKLH 4FP8L 1JHKL 5J1TC 1ZA6B 5BOPA 3ARVA 4FQJH 4R7DA 2NY2C 1VACA 5GGUA 2MOVA 1S7TA 2DLGA 4IMKA 3WDJA 4QRPD 3PHOA 5FOBB 3FZUC 5DLMH 1I3GL 1FN4A 3EO9H 2ZUSA 3BUTA 3IDNA 5HDLA 3BP7B 4AT6B 1IEAA 4EI5B 4V1DA 5GRYA 3VA2C 5DK3A 4NO5B 1WWBX 4FFZL 4EBQL 1A7RL 3PQYA 1S5IL 3DUUA 1IARB 4PG2A 5D7IA 5LQBL 3ARDD 4DGVL 1UCBL 4L4VD 5DQDL 2Y23A 2E5EA 1KJVB 3N0PB 3LZFL 3FOLA 2C4FU 1OWRM 4CVXB 4FQ2H 2I9TB 2V7HB 2UVEA 1XF5A 3DURB 3UPRB 4JR9H 1P4BH 2WIIA 3HZKA 3U30B 4UB0L 3IDYC 2Y9RT 2ZCKL 1OARL 2B1AH 1A7OH 1U0QA 1XCQA 2JJWA 4P3WA 4ZTPH 5I1IH 3BN9D 4L4TE 3BKYL 2IPUG 2VLJD 1EXUB 4V2CB 3Q1SH 3P4LA 3NTCL 4MAUL 3GMRB 2QLVB 4OM0H 3DETD 5EZLB 4DTGL 3GIVA 4XMLL 2NCMA 4NYLB 3T09A 5IV2A 5DK0A 4CDGC 1UZ6E 1BQHG 3UEZA 1A7QH 2IMMA 3OBAA 4FS0A 4OZGF 4I5BB 5D2LF 1A6PA 3S97C 4YAQA 2CLRA 4KJPD 4WW2B 5GRUL 5CZXD 3WIFB 5IESL 1IGFH 5EPMB 1LP9E 3UBXB 3V5HB 1T83A 4NQDA 3BZEB 1KTDB 4GMTL 5CJXA 3L3GB 4KK5D 2DLFH 2YPLB 1FPTH 1AP2B 4NC0B 2BSRA 5C92A 1S9VA 2A6JB 3QJHB 5BV7H 4PRPD 3IJSB 4QHKI 4DGIH 5D1ZD 5BW7A 5L2JB 4K55A 2JJSA 5ADPL 1IVLA 1MIML 3H9ZA 2HLAA 3QT2A 5CJOH 3V5KB 2NW2A 1F4YH 1OGAE 5ALCH 2R0WH 3LKQA 3ORJA 4GQ9L 3MRQB 3O9WC 3FHAA 4HPYL 4LRNL 5IP4A 3RWCB 4F7MA 5HHQB 4S1QH 1UH4A 1WGOA 1L7IL 1EJ6A 3VFNB 3QXAA 3GSUB 1E4XH 1MLBB 1XT5A 6CGTA 5JOPE 2MCPH 4FQHA 1BZ7A 1HQRA 5BZWA 3FO1A 4HW6A 3CVHH 4PP2A 4XVTL 2VLRE 5HSFA 1KFAL 5M95B 3HPLA 5TFSL 5KTEH 2MMXA 4RWHA 4AEHL 5H37H 2A9NH 1BEYH 5HGDA 3SGKC 3MGOA 1M6OB 3V6OA 1U95B 4BZ1H 3HC3H 3QB7C 1ZHKB 1JTTA 3O4LA 2CMRL 1PZUB 4JFPB 3DYPA 4P5TC 5M94B 3V5DB 2DKMA 4CNIB 2D0FA 2WWMD 25C8H 3MRJA 1MJUH 3DX8A 4GW4B 3B9AA 4PJ7F 4QRRD 2JCCB 3B9KB 1K8IA 2BNQA 1JF6A 1U41A 1XH3A 3O6LH 2Q76A 5DR5L 1K6QH 2RBLA 2L7UA 1INEL 1ZHBB 2X4QA 5TE4L 1G7JB 1Z2KA 4R3SA 1JGEA 4EQ2A 5FGCB 2GSIA 4HIXL 1CL7H 4IOFC 3QDME 1CL7I 4Z7OF 1S9WA 3W0WA 1QQDA 4ORZC 1QO3B 3PL6B 4MZ3A 4UU9A 2JCCF 2IQ9H 3D0LA 1UC6A 4WFEE 4FABH 4S11A 1SEBB 3W9DB 1OSPH 2GITA 4F7EB 1IC7L 4OI8A 3GMQA 1FDLL 3TBSB 2YBRA 1ED3A 3TFKC 2LV4A 1T0MB 1NCCL 3AAZA 4ONHA 2FB4L 3GSVA 4RDQF 1Z0MA 1QFUL 2YXFA 5F1SA 5J9PA 3EO1B 3HB3D 4LKXB 1MFNA 2DQFB 3FOMA 1QRND 2D0GA 4TYUA 3KHOA 4K8RL 4XVJL 4GXVH 4TUJB 2HTLD 2A77L 4PUBL 5MEPA 3QFJE 2LVEA 3GJEA 4I77L 1J12A 1JV5A 4Y4FD 3MXVL 5HHVL 2H3NB 4KKLC 4XNMA 4C4KO 1AGEB 2C7UA 5GS0L 1KN2L 1WK0A 5IEKA 1DTUA 5C9JB 4CW1B 1I75A 1R0AH 5D1XB 4HD9A 3LKOB 1YY8B 4MJIB 4HLZH 1ZVSA 1J0ZA 1HXYA 4O02H 3VCLB 1VGKB 2E7BA 4D0BB 1LDPH 2QQKH 3BRFA 3C8HA 1XCTB 3FTGA 4G6AD 3T65A 3TPUB 5CEXB 3ULVL 5D1QD 5MHSD 3OKDB 3K2MC 4MQXD 2V2XB 2VLMD 1JNJA 1KCKA 3TN0D 5GISL 3ULUE 5CEYA 3C8KB 2BRRH 2YPKB 4WW1A 3VXSA 2Z91B 1T1YA 1J18A 4R8WL 2DM4A 2EDXA 5LGHL 2R1YB 3SGJA 1W8NA 3VD5A 1I1AC 2OMBA 5I1JL 2EDWA 4J3XA 4U1JB 2C3XA 5D6DA 3RY4A 4GRWE 3C2AL 3MSPA 1YC7A 1G7MB 4KU1A 5CLWA 3QJFA 1CZ8L 3SPVB 2X1WL 3FT3B 1NAKH 3DVNB 3MV7A 3JV5A 4RMQA 1FNFA 1RZGA 1KENL 2GJZA 4OQTH 3ARBC 2VYRE 3QWOB 5T3XH 1YEDA 3I6GB 2HT3C 2BSED 2IFFL 3UP1A 5DXWA 2OYPA 3REVA 1OAQH 4X98B 1F4XL 1II4E 4XNXL 3L5JA 4XP5L 7FABL 2BNQD 3VDAA 4YDVB 5D70L 5I9QC 2V17H 1I1RA 3EFFB 5C09E 3EO0A 1NANH 4RFEA 5IW6A 1NANI 2AJSL 2FLBT 3OZ9H 1KPVA 2BDNH 2GUOB 2CDGB 4R26H 4KAQL 3ARXA 4RAUB 2ATPB 2C3WA 5B38G 3X13B 15C8L 2NY7H 4TVPH 4U1MA 4Y7MA 2OSLB 4NJAH 1DBAL 2YD8A 2W9EL 3T77A 3DMMA 3P2TA 4OB5L 1FHGA 2HT4D 5A16B 5F3HB 1UACL 3W2DH 4KRPB 2P4AB 4EUPG 4JHWH 2JTDA 4X6FA 1FH5L 1PAMA 2AGJH 4UV4H 5ERWA 1T89A 2RFXB 1JGUH 3B2UC 2MWCA 2PO6C 1NUDA 4IRJD 4P9MH 4RWYH 1JCKA 2OP4L 3P73A 1IGYB 3FRUA 4GXUM 1KLGB 3QDAA 3KG5A 4DQOL 3JWOL 3ZDZE 3ZYIA 5HHME 1NGYA 4X6BA 1WQVT 3KPRA 4Z95L 1RURH 1UZ6F 2PYEB 4HUNB 4HT1L 4HKXB 1CTNA 1P1ZB 4LARH 2FIKB 4D3CL 2X4TB 2I9LA 3BGFC 3G6AA 2OXGA 1U3JA 4ZSOE 3ZDYE 5HGAA 4GSDH 3NCCB 1LP9F 4LVHC 4YHLH 4X6CE 5EOTA 4P23B 4LLQB 3MRNB 2QHRL 3PV7A 3IFNL 4YDIL 3TGXA 4JJ5A 3DX9A 4H0IA 2EEDA 3VRJA 4NCDA 1I9RL 3T3PE 1U8LA 4QY8A 1QSEA 1OGAB 3M07A 1DE4A 2ZP0T 3ME0A 3MR9B 4LHUA 5I17B 2IADB 1VKXA 4QNPE 3MCKB 5FCSH 3VXSD 5GGQL 3PIQB 2KH2B 3PV6A 5F7NC 1J0YA 1P5UA 5BOZG 1G7HA 1E0OB 5GSVB 2EDBA 4JO2H 2VLRB 3ES6B 2ITCA 1YEJL 2VZOA 4K8RC 1RK0B 5HXMA 3F7VA 3N1FC 3D87B 3LIZH 4NJ9L 1GC1L 2ID5A 1LEIA 4JM2D 5ISZD 4APQD 4JB9L 1KXTB 4ZO9A 3TYGL 5J11B 1LHZA 2YD7A 4JCLA 4LEXH 3O3DB 4OLXL 4YHPB 4LLUA 4QRQB 4XCCL 4Y8AA 5HI3C 3VE0B 5GS0C 3VXQA 3D85D 4WV1A 1F5WA 4AM0A 2PW1B 3L3IA 1YEKL 1TJIH 4QHMB 1OL0A 5FCUH 5MENE 4DUVA 3RU8H 4QLRA 4XCNA 3W39B 2R56H 4EI5C 3PGDB 2X9XA 2NY3B 3BUYB 1T1WA 5IROC 4JG0L 5HVWA 1WZLA 2IG2L 3MJ7A 4JLRA 4FTVE 4PJFA 5BMFL 3ULVC 3KPPA 1TDQA 5T1LA 3EGSA 1CVRA 5DWUL 3G6JE 3IU4H 4U1GB 2CK0H 1TNNA 4LSTH 2IPTL 1A3QA 2BNRD 3IDMA 3FONA 4WU5B 2WBJA 1BHGA 1AE6L 4JFHD 1YC8A 1NC2D 4Q97A 1L0YA 1CF8H 1CBVL 1YYML 2PXYA 3U30C 2VH5H 1MJ8L 3ZHKA 1UADC 3NIGE 4X7TA 3WFEH 1HHIA 3TIEA 1KB5H 3C5SA 4U2ZA 4MX7A 3C9NA 4DZBB 3LEVL 2YC1B 1YNLH 4AEEA 4YHZL 4N9OB 3QO0A 3C60B 1N3NB 1BFSA 4ZFZA 4RGNE 2F54E 1XIWD 3LOWA 4ONGL 1Q0YH 2OJZH 3CSYB 4NUJB 1KCUH 3RNKB 2IQAB 4L3ED 2DQCL 4JRYD 5I30L 3UTTE 2EYRA 3S88L 2EYTA 3GUTA 1KEGH 4X4XB 5D2NA 3LEXB 4WW2C 2P5WA 3BFOA 5IIEA 3BZ4A 5AZ2L 1EV2E 3BD4A 4NFCA 1N26A 3WHXB 4YXLH 3CVIL 4RNRA 4FQIH 4QOKD 4OZHE 1JPFB 4IOIA 4LHUD 5IQ9A 2HLFD 4N0YL 3RUGA 3V6FA 4M8QB 3BN3B 4RGOL 3NZ8B 3EYVB 3WSQH 2GT9A 4XC3H 4OF5A 4F15B 2DIBA 5JXAL 4Q9BA 1ZLVH 4Z7VA 4GRWB 1HQ4A 4HV8A 4RX4D 3MCLL 1P7KB 4UQ3A 3JWOC 5H8DA 2RAMA 4MB3A 2F53E 5CBAB 3ULUF 3DVFA 5K9OB 4NIKB 3MC0A 1KC5H 5ICZA 1AXSA 4OLZL 4LP4A 1DBJL 1UEYA 1BQHB 3BAEH 1T03L 1AQKH 3T2NL 2DYPA 3H9HB 1IQWL 5EU6D 3T1WA 2FX9L 1AC0A 2I27N 2VLKE 5K33A 2A1WH 2WP3T 1GGCH 5E8EA 1FRGL 3OXSB 1E27A 1MRFH 1Z5LA 2AEPL 1QLEH 5C09B 5FYKH 1NLDH 3QG7H 2FATL 3IGAB 3LKRA 4LRIA 3A6BL 1EEZB 2ZUTA 5FAAA 1T4KA 5FO8B 1V3KA 1DEDA 2Z92B 5JOFA 4I3RL 4PLNC 5SX5K 3MGAA 5ITFB 3U1SH 1K8DB 4X7EC 4ZQKB 2YR3A 3KR3H 4KKAD 1RMFL 1AFVL 3B9KC 1YN7A 4XWOC 4HGKC 4PB9H 5KANG 2P8MA 1UJTA 4DKFL 5I1KH 5L6YH 1GC1C 2Z35B 4WU7A 1LK2B 1G6RH 1YJDL 4PGJA 5CHNB 1A2YB 2VITA 4JZJB 3ALPA 3FJTA 3QUKB 1A9BA 1C12B 3CLFL 1CGYA 3PDOB 1LO4H 4JAMB 2DLIA 4LLYB 3TBTB 3PL6C 5HHMB 5IEHB 4UT9H 4KY1L 1JYNA 4KRMB 2P42B 4MCZA 2AERT 1D6VL 1KELL 4G9DA 1Z9SA 2VR5A 2VSDA 4N8VA 4XAKD 1TZGL 4OKVB 3WBDA 4PR5A 4HUXA 5EIIB 4M7LL 1TZIA 3Q3GA 4DVRL 1GHFL 3IDGA 3BDYL 2XWBB 4JO3L 3BHBB 1EJOL 5HHNA 4RRPA 2FGWH 4DWHA 3H8NA 1DLFH 4MA3A 1SM3L 2PETA 3RWEB 5F9DC 1AGDA 1EFXB 4WRLA 4XNYL 4GG6E 2W1NA 3ZDYF 1XR8A 5IFAH 3GSNH 5IB3A 1PG7L 5IMLA 4E0RA 4X6CF 3QCVL 4RAHA 5AYUL 4MB4A 4PBVC 4XGZA 2DM3A 3U6RB 3TYFA 5IW3A 2J5LB 1N7ML 4GUPA 4JDZA 5D1XC 2VISB 1DBML 1IBGL 1Z6JT 4LPYA 3RWHB 1CE6B 4G42A 3T3PF 4JPIA 3OAUH 1NBVL 1FZOA 1A1OA 3KXFD 2AV1A 2H32A 1QSFD 3TCXA 2J12B 4QNPF 1MHHA 5HD8C 5SWSE 3OR7A 3O8XB 4ESKA 2CR3A 2VC2L 1ONQB 2IANE 4JO1H 2CIIA 2NY1B 5F7MC 3VXUD 3L3DB 1NKRA 3O2VH 4YGVA 3RJQB 4GAJL 1AR1C 4HFUL 1CGWA 3ZKXB 4HXBH 5HJ3A 3VMPA 4PJXA 3SJVE 5T33H 3L7FA 3MLSH 3VXMA 1S7WA 5D7LE 1GRWA 4LF3B 1N4XL 1G0DA 2NLJA 1AKJB 4Y4HA 1FVDB 1IGMH 3L95A 4UBDC 1SYSB 1OW0A 4NFBA 1JK8A 4ACPA 1QD0A 5FYLE 1UQSA 1RJLA 3G6JB 5EIVA 3MGTA 3MFFA 3WO3B 1BIIA 1NEZA 3KPMB 5ENWA 4IHOB 5C0JB 32C2B 1YMME 4L3CB 2X4OB 1JHTA 3CH1A 2A6KA 3MV9D 3RVWC 3DO7B 2PYFA 1ZK9A 3ZL4H 1JI1A 3KYNB 4X9HA 3O3AA 4LSQH 3MRIA 1NUFA 4YGAB 2P5EB 3QEQE 2J6EH 2M1KA 2Z31D 3MXWL 5I15L 4WI2A 3QXVA 4R2GB 3TA3B 2CRZA 5KS9A 3NIGF 3ULUL 3IVKA 3DGCR 3IJHA 4KRPC 1FZKA 4P2QD 5JW3L 3I3EA 4L8CB 4PJBE 1Y6KR 3UTTB 4F9LC 2B20A 1JRHH 1JRHI 3ZE0E 1WIOA 3O2DA 1EUUA 3PWUB 4ODVH 3NCBB 4UNUA 1P4LB 4ORGB 3B6SA 2BSSA 1KEML 4OZHB 2JLLA 1RUPL 5GGSY 5EU5B 4UDTA 4TQEH 1FJ1A 3ECBA 4ZOCA 3MRFB 2CDEB 1I8LA 2H26A 1O5DT 1WEJL 2DQDH 2Y36L 3U7WL 3MLWH 3JUYA 1YJDC 4U6TA 4YIQA 5HHOA 1RZIA 1YEIL 2MHAB 2EDJA 5B38B 3H42H 1CD1A 1RV6X 4EDXA 1FFQA 4P23C 1K2DB 1NC4D 4XT1C 4UMGA 4Z7WF 5MEQB 3TO4A 2G2RA 3GO1L 5IHZA 3GBNH 2F53B 1F3JB 1NDMA 4I4WA 4OCSH 5DD6B 4EUPB 4QTHB 3MRLA 5C08B 3RGHA 1MHCB 1DANT 2YD1A 4NZTH 1K5NB 1MWAB 4FQ1L 4F37F 3BZFB 3U0PB 5EZJB 4YDJA 3QQ3B 2E3VA 2XA8L 1A6VL 5E2UH 4LQFH 3IFPA 2VDRH 3TVMB 3KLSA 3DYMA 1UM5L 1MCEA 1UYWH 3QEGL 3OG6B 4H0GA 4Y4HD 5E94A 3RL1A 1U2HA 1JGDB 3FT2B 2BK8A 1WFUA 43C9B 5J11C 1D5IH 2NY5L 3QCTH 1I8KA 4PRHE 4QRPE 4HIIB 3RHWK 1ZS8B 4UINH 1DBBL 1I7UA 1RIVH 4P3DA 1MCOH 1NLBL 4EJ1C 4G9FD 3P30H 4OM1L 1LO2H 4PY8I 4X5WB 1KPRB 5F9AC 4I3GA 3Q6GH 5LXGH 1IJ9A 2FGZA 1A64A 4LOUC 1NBYB 2BVTA 2NY3C 4PJGB 5FYJU 3WFBH 4JQXA 4AIZA 5CKAA 2DWEA 4PFEA 1KTRL 1U91B 3MLUL 4X99B 4U3XA 1FYTD 4MNGB 4B53A 4F7TA 3QXWA 5BQ7B 1G9EA 3CUPA 2KQMA 1N2RA 3S5LB 1ZLVK 1IM9A 4P59H 3B3IB 1A6UL 1HSBB 4F58H 4U1GC 1RJYB 4HUMB 4LCCA 4ENEC 1JIBA 3WIIH 3MRPA 2VZSA 4G5ZL 1NDGB 2RGSA 1WBZA 1OPGH 5F7LB 4EKXA 2LU4A 4E5XA 3EHBC 4ZAKB 2R0KL 3K3QA 3HNTL 4JZOB 4YNYA 1OP3H 3QIBA 1KJMB 3D25B 4J6RH 3FHQA 3QNZA 2FJGB 1CD8A 1SYVA 3KPNB 3HFML 1HXMB 2VLJE 3NA4A 3E3QC 3G04B 4MA8H 2XFXA 1WVZA 2R23B 3RWDB 3T04D 1U92A 2XZAH 3C60C 2FD6L 1CDJA 3U46A 1JYVA 1HEZB 4GG6B 4F7CA 3MLZH 5C0AE 1J5OH 1IAMA 1H0DB 4BM7A 2PW2A 3EYFA 1U8QA 1YEFH 4XNQA 5LGJB 3K4DA 1NGWB 5HY9B 1F6FB 4K94H 5EUOA 3FO0H 4TNVF 3VH8G 2AJUL 1U3YA 3HMXA 5AZEL 4LPVA 4WEUD 1AC6A 2BSTA 2FO4B 3WIHL 4Y4KD 2O61A 5SWSB 4F33B 3MRDA 2IANB 1JWMB 3UTZB 1T0NA 3E6HB 4NCC1 4NWUH 4W4OC 4FQLH 3ULUC 3F12A 3KYOB 3BPCB 4F15C 4BUHA 3RX8A 4PRPE 5I2IB 4ZUVA 5D7LB 5J1AA 4KDWA 2XWJB 3BKCL 1Z0NA 3BE1L 3KYAA 5GS1B 5KVDL 1CU4H 4HLJA 4KDVA 4M61B 4U05A 3H0TB 3STZB 1WCBB 2Y5TA 2VDML 2QSCH 3QHFL 4Q9CA 3UMTA 4N90D 3DSFL 5EU4B 1HSAA 4XRCB 2CUIA 3OAZH 3CDCA 2NY4D 1FO0H 2NX5B 2HMID 3SDAB 1D6EB 5FUCE 5GXBB 5HHPA 4Z78A 4U1LA 3PWLB 3HAEA 4OIIL 2Q3ZA 2XRAH 3R8QA 1ADQH 4Q58C 2H8PB 4KROD 5A43C 4G7YH 4R4FL 4KZDL 1T2XA 2DQUH 1QEWB 4M6ML 1FCGA 4XCEA 3MLRH 4NHUB 1X9QA 4PJCA 4G8IA 4BH8B 3GSOA 1IC5H 4K3GA 3BO8B 4P9HH 4FA8A 1CDYA 3AU1B 5TGBB 1IGIH 4QRRE 4NZUL 3O6FA 1TENA 5CIPH 2X09A 2VXVH 4H88L 4KJYA 4QEGA 4PJBB 1XEDA 5IOPA 1KB9K 3UJIL 3KLHD 1AJ7L 3ARFB 2P46B 1RK1B 2G60L 4JZJC 2NY5C 1BP3B 3CSGA 1JZ7A 1X5YA 1NMCB 1JYXA 1I1YA 3BISA 1IGTA 5D72H 4QHNB 4MVBD 5C0FB 1OCWH 3SKMB 3I9GL 4MWFB 4AL8H 1GJIA 1XFPA 3P0GB 4J12A 5FIEA 1YEEH 1RVFL 3PGFH 1TVHB 5DJZA 3GGWA 3KYKH 5JIKA 4HS6B 2WUCL 3ZE0F 4Z7NE 5I1DB 1QZ1A 3STBA 1MWAL 4WJ5B 4LBEB 2WLYA 1SHMA 1JHLL 3NACL 3L3KA 1DSFL 4LAQL 2QHLA 3SDCA 4EOWL 2AK4A 2ICWI 1N0LA 1IEBA 4JY4A 3ZYZA 5DJ6B 3DOSA 4E42A 4FFWD 1QSZA 2EIZB 3MACL 5C2BL 4KMQA 2Z8VC 4ELKB 4LSSH 2OZ4H 4K3HA 5F6HJ 1OTUC 5TDOA 1M05B 1DQDL 3S34H 1XF2B 1A0QH 5C07A 4OAWB 1QR4A 4H25A 5D8JL 2J5LC 1HYSD 3G6DH 1I9JH 1S7UB 2IAMD 4M6NH 2RQ8A 4PJDA 2ESVA 2NW3A 5EO1A 1VADA 1S7VB 2X4RB 4XHJC 1W0WA 2Q7YA 2QSQA 4BKLA 2VL5B 4N0UE 1AIFB 1INQB 1PZ5B 3FQRA 5MHSE 3UPAA 3L5HA 2H9GA 3QEUB 5BO1L 4C59B 2IWGA 2VLME 3U9PL 3O8XC 3CU1A 4MMXC 4JFYB 4PRHB 5DUML 5LWYH 4OT1H 2NY1C 3GM8A 3EYSL 4GAGH 4HEME 5DJYB 1ZA3B 3O6KL 2Y1VA 3UJTL 5ALBH 2BC4A 3ZKXC 2VDOH 1I9IL 4KJWD 4OLUH 2X7LA 1MFBL 5JQHC 3VW3L 4ZUWB 5F6IB 4PJ5E 5C3LD 1JN6B 4MNQD 3BRDA 3D3VA 5FO9A 2BY2A 4AG4L 5KSAA 5CILH 3TBWA 5LGKA 2A6IB 1ZANL 4MXVE 1X44A 3QG6A 4U6YA 1FG9C 4OZFG 3RVVC 3BQUD 5GGVH 3WNKA 1BBDH 4GW5A 4XMPL 2HFEB 2O5YL 5IF0B 3ET9F 4PS4H 2UZXB 4EN3A 3T1FA 5CBEB 1Q9WB 3HR6A 3SHSA 4DAGH 1U58A 4H26A 1YMHA 1D9KA 2GTWA 3ESVF 3T0VA 3X11B 4H20L 1KIRB 3FN3A 3R06A 4P5MA 1DQTA 5IVOA 4YK4B 3L7EA 2AV7B 2UUDH 3ZT5A 5KSBE 2FZ3A 2YA2A 4G8GA 2VRAA 1H3XA 1W72A 3IRZA 2VLJB 4GRLB 5KN5B 4BYHA 3WXVH 5T1KD 4P5KA 1U3HD 5EOCL 3VG9B 4NKIL 5CEZE 4Q6IB 5BRZA 4C56A 1CGSL 4XPFL 4R2GC 3TA3C 3BMWA 4ONFH 2RIKA 4XHQA 2YA0A 1ZVYA 5C0AB 5CD3A 1ACYL 5FM5M 3EOBB 3UC0H 4G6FD 1B2WH 2AJYH 2DQTH 4ETQB 3D5OF 3QZWG 4ZUTA 1N5AB 4JPWH 4BQBA 1WBXB 4NKQB 1I1FA 2EDFA 5DRZA 2XZCL 4HXAL 3DUSA 4FQQB 3RPIB 1EEQA 3B2VH 3HRZB 2CKBB 2R39A 4ELMA 5EFIA 1BVKA 3U4BL 5CD5C 2NPLX 4XPAH 5GRJH 4RAVB 2CH8A 5TDNB 2UZIL 2HP4A 5DEFB 2BHYA 4JM4L 1IZJA 3QUXB 5HPOA 1ZSDA 4PRDA 3SDDB 4WFGD 5JZ7D 3RIFK 1T22A 2BY3A 3HI6H 5DLML 1A21A 4KUZH 5IMMA 2X1QA 2NY2D 2H6PB 1R5VA 2X40A 3O9WA 1MCWW 1CYGA 1DL7L 1MQKH 1R3HB 1KPUB 3FZUD 4JFFB 3UTSA 5EDXA 3AMKA 1YY9C 1HHGB 1P7QD 3VA6A 2A9MH 3P9LA 2KDGA 3T2QA 4FNLH 1MCHA 3P4NB 1B4JL 1OF2B 4HBCH 1XGPB 4L8DB 4IDJL 3WD5H 4LSPH 3CXDH 3O11B 1XF3B 3AB0B 3INUH 3NABH 3PXJA 3OR6A 2BXYA 3TVMC 1CE1L 5ISZE 2IALB 1WFNA 3MBXH 2NZIA 5F8QC 4NQVA 1P4BL 3BPNB 4DKEL 4OZ4A 2EDOA 2B1AL 2H2SC 4HWEH 1PQZA 3D69B 2DDQH 5DHVH 5DJ8A 2VTFA 4LLVB 2VQUA 4MD4B 3BPOB 1HWHB 1A6TA 5TDPA 1R5WB 4WEBL 4LIQE 4N8CH 4LL9A 1A7QL 4P3CL 4BFIA 2VDPH 4HWBL 5CAYB 4P2RB 2IH1B 3WNLA 5B3NA 4GMSH 2BNRE 1IGFL 1QR1A 3S35L 1KJ2B 1OAUH 1U8NB 2ADJB 4X80H 5BRZD 1DBKL 3NN8A 4N5EC 3M45A 3G5YA 4PGBA 5MERB 4R4BA 4ZAKC 1Z9MA 3RI5F 4UIMB 1E6JL 1UZ8B 2W9LA 4RBPK 4ZFFB 4I0PD 4V2BA 1FPTL 1L6XA 4JG1L 4X9IA 1KIQB 5IKCB 1YNKH 1NAMA 5DRWA 2GSGB 1S7QB 2X4UA 3DWTA 2F19H 3QHTC 4Y4FB 4RIRB 3P3YA 1ZHLA 4BQ9A 5BS0D 1JBJA 2Q86B 1ZT4A 3VMOA 2D9QB 5CJOL 3OKMA 4Z77A 4M5YL 2J8OA 2Y06H 4PJEA 3OKNA 1PY4A 4ZS7L 3PABA 4TULH 4TUOA 4JRYE 5SWZD 1X5LA 3DXAD 3P77B 2OTUA 4QXUH 1FG2A 2QR0B 2XQBH 4YE4L 1DLHA 5CSZB 4X5XB 2ARJB 1XZ0B 4HMCA 4XBEH 3V4UL 4X7SH 3U36A 1MHPL 4H1LH 2CXGA 3QIUB 4QOKE 2WSKA 3TN0B 1I85A 1FL6A 5A40E 5E4EB 2A9NL 3LPWA 5KVFH 2DM7A 1IAIH 4L1DA 5TQ2H 1DQQA 4P4KA 2G5BB 1G7PA 4U7SA 2CK2A 5I66B 3EYQC 4TNWK 5FYJD 4WTWA 4POYA 4PJ5B 4O9HL 5GS1C 4Y19B 5C0DA 4NDMB 2B2XH 4WUKH 4ZNCD 5ESQB 3WFCL 4PJIE 4P5TD 4ZPVA 1I4FA 3QUZD 5L8KB 4NQCA 1Q9OB 4TRPH 3HPJA 1HNGA 1CL7L 5FDYA 3V0WH 5EU6E 3SDAC 4PRNB 1TMCB 4G6ML 4N1CA 3QRFM 1G9NH 4DJMA 1QBLH 3N06B 4NKDB 3RWIB 2JB5H 3VH8B 3S37L 3SOBH 2IQ9L 3NGBB 3ARYA 3B5GA 4MXVF 4HS3B 4LVEA 5TJWK 3G08A 5HGBA 4O2EB 4OLVL 4MS8C 4RSVA 4OUUB 2W9DL 4ZTOH 1EEUA 1Y0LA 1CXHA 1UG9A 1RIHH 1M7IA 4M1DH 4HJ0D 3TFKD 1WC7B 3RVTC 5T3ZH 3F7YA 2CKBL 2ZCLH 2NY0B 4MCYA 4BH7B 3UROR 5C8JB 4GXVL 3GI9H 4NNXB 3ZTJG 1N6QL 3JWDL 4YXHH 2YA1A 3T8XA 1UXWA 5KSBF 4HC1A 4IRJB 3FQNB