2L7EA

The structure of a domain from yeast
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
123
structure length
123
Chain Sequence
b'MVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor TFIID subunit 14
molecule tags Transcription
source organism Saccharomyces cerevisiae
publication title solution structure of Taf14 YEATS domain
rcsb
total genus 8
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l7eA00
2L7EA 5HJBA 5IQLA 5IOKA 4TMPA 3QRLA 5D7EA 3RLSA 2NDGA 5HJDA 2NDFA 3FK3A
chains in the Genus database with same CATH superfamily
3AUVA 1Q38A 4R4BB 4YDMA 3R8QA 3VTTA 4IRSA 1EVUA 4JG0L 3CSYA 5DRXB 4B9ZA 3S5LB 4LKXB 3IDGA 4AQAA 2HKHH 1IU1A 4YHIB 4WUUB 1XMEB 1MHEA 5I5RA 4P3CL 3FQXB 1G9MC 1ESOA 1TJIH 2XWEA 4N2KA 4U1IA 4WJG3 4FA6A 3WTVA 4PGJA 4BGLA 1N9PA 3BAIA 2BY3A 5KVDH 1BFSA 2ZKHL 4EO5A 1D6EA 5FHAL 1PU0A 3LSOA 3SQBA 3QUZA 3BFQG 4JPSA 5IW6B 2E4TA 2JI1A 4UM8A 3NIGF 5DVMA 1HINL 2VQ1B 1IAIL 3BVDB 3DIFA 3FB8B 4DTGL 1JPFB 5F89B 5FGBC 3OHXC 1HXYA 4FEMA 3BPOB 4NRXB 5C08D 4NQEE 1N4XL 1K72A 5LNDA 3IJEA 3RBGA 2FD6L 4BFJA 4KNUA 5C0RL 4PY8I 4TLUA 3IJ8A 3RPIA 4PG2A 1CBVL 1NPNA 4M6OH 3TF4A 3PREA 2DYSB 5LB1A 2PW2A 4X8JB 2JCWA 4PVNA 5C9JB 1ORQA 3FFDA 1G7QB 3H7BB 3PLYA 3LKQB 4MQSB 1DO5A 4PY8J 3WO3B 4G5ZH 3OC8A 4LP8A 5LDSA 2ID5A 4WGKA 4NJ9H 4QT5A 1BZEA 4S1SH 5BVJB 1UGKA 1L0PA 4FKKA 4DF9A 1E7VA 3P40A 4TVUA 1KBGL 1F8TL 5FA4B 4GYBA 1X7SA 1Z5LB 4NHCH 4U1LA 3G5XA 4KX8A 2DTMH 4NOBA 3WLWD 5MERA 4JZJA 5CZRA 3VWJC 2GUOA 3FTSA 4JMXA 4YN3A 3WY1A 5FO8B 3S9DB 1MFDL 3OLGA 4PJCE 2BNQB 1HH6A 2ZCHL 3MLYH 4NQSB 4UF7C 3RTQA 4DQAA 2XN9B 1YYMH 4F7TB 1TKWA 2ZX6A 5L9DH 2X9YA 3F84A 3O3BA 4CC4C 2JKJA 2EXWD 3FOLA 5KYYB 3CZFB 3WFCH 5ITFB 4M3KB 2P8LA 2GITB 2VCOA 2XKUA 5DT1H 1A6ZA 3TV3L 5JPMA 2J1KA 2AAVA 1CE1H 4CKVX 3NN8A 3IAQA 1D7BA 2ENYA 3TLRA 2YD9A 4XCEB 1MJ7L 2F5AL 4XN9A 2ITCB 3SGEH 5ICYB 1BP3B 5KYXA 43C9A 1ZOXA 4R2GC 4X4XB 2OFQA 5BO0D 1OVZA 4ZAKC 4JRFA 4UIKH 3FB7A 4FNUA 1ZLUK 2OYKA 3WELA 3D6GA 2EIZB 1WWAX 2K0RA 4Y16B 3IM1A 4JAMA 2ZNWA 1HXKA 2Z8WC 5EEVA 4N2LA 1AI1H 4HBCL 3FSAA 3MJ9L 1FV1A 1TYRA 4IOSA 3LS4H 4NFDA 3LNDA 2F6AA 4DGWC 3E2HB 1MVUB 3PJSB 5TDPB 1DTUA 1IBDA 1ZLVK 2A83A 2WP3T 5K93A 1MW3A 4F9LA 5LVEA 4QRRE 1LL1A 4Z78A 2OL3H 5L0QB 2X6AA 5E0QA 3FH5A 1JI1A 3UYRL 1ND0A 1UZ8A 2I60H 3EOYG 2GBVA 1FFTB 5GZOA 5FYJH 2ZCLH 3OGOE 4LF3A 4NQDD 5DJAB 5E8DH 1A6UL 1BJ1J 3DKHA 4PW9A 1FH5L 2R2HA 3VU2A 4JFEE 2A3TA 4EEEA 1I82A 5FF6B 3AMLA 1OW0C 1SF5A 2PXYD 3PAVA 1UXWB 3OKEB 2DAVA 4WFEE 4E9SA 3BW9A 1X5LA 3O41B 4XPHL 5DUML 5D7LE 3OKYA 1A6TB 2ZKWA 3QJHB 5AUMB 3CBKB 3GZPA 5ANME 4FCAA 1XX9C 1MNUH 3A6BL 5HSFA 3CIQA 4FYRA 1I7RB 4XPAL 4DUVA 1TZAA 3GJFA 4KXDA 1TVHA 1T04A 1HOEA 4XN4A 4B95C 1P69B 3M46A 2ADYA 2N01B 4K71B 3X13B 1BIIA 3V0IA 1P84J 1QNIA 2V17L 5DJ6B 1PW3A 2AZUA 4XOEA 3RY6C 3ARGA 5IEKB 4DVRH 3BPCB 3APMA 2QR0B 5C0JA 1BXVA 4JJ5B 5GIRB 1NCIA 2KERA 3O8XC 3IMBA 1G7HB 3I6GA 3NP3A 3DIDA 4B5ZA 2Y72A 3A4AA 1WC7A 4ZOAA 5FUOH 3QCUH 4PGBA 5DTFA 4LLYB 1HXMB 3PGDA 4KQ3H 4NJAH 3DYOA 3OJVC 1CU4L 1A8JH 3B9KB 4G6JH 5IMMA 4KTEL 3VXQA 1AXTH 5D7SL 4MNGE 4W9ZA 1UM6L 2AI0H 1L0YA 1HSAB 4Q89A 4PRHD 4ELME 3S36H 2HLFC 4DPRA 5CGYC 1DQDL 4Q4EA 2G60H 4ZUWA 1XH0A 4QGYA 2ALWA 1D2PA 5E8EB 5LAXA 1MJJB 4F9LC 1ZMYA 4I1PA 1A7NL 2Y7QA 3PGFL 2EEBA 1JZIA 1TQBB 1NGQL 1JHLH 2DL9A 3ISRA 5HPMB 1NAKH 1EMTH 4JFDD 5CZKA 4MMZC 3K8MA 1RUPL 4O4YL 5I5MA 5J8OA 3VJ6A 1ZTMA 5TTRA 4MJ6B 1E28A 1TTGA 4PP2A 4E42B 2J4WL 1KGIA 1QO3B 1NDMA 3AREB 3FMGH 4NRXA 2PP7A 2XOTA 4LCUB 4M7JL 3ZKND 4UAOC 3U2SA 2AK4B 3RWIA 3UYOD 3MLVL 4DZ8A 2YAOA 1RZQA 4G7SB 1NCDL 3EDKA 3OAUL 2F8VA 3FT1A 5EIIB 5EC2A 5SWSD 3HZMB 5GS2H 3IRPX 5F1NB 3AQXA 1RUML 2O5YH 4ZXBC 2Z9TA 4RWYL 2F9BT 4JG1H 5CNHA 5FOJA 1KG0A 3QQ4B 1DL7H 1E3XA 2NX5B 1CI3M 3BWZA 5E4EC 4UQIM 4TQEH 2I25N 4D9QE 5FOBA 1N68A 4DAGL 5ESVB 1L0XA 5KZCD 1NCAL 1QR1B 4HOMA 3GLEA 1J87A 1B3IA 4PVLA 3ZX1A 1HWHB 5IBTL 2FBOJ 2UZIH 2ZCKH 5DHYA 3L1GA 4E5XG 4G8FB 2YPLB 3U0TA 4YR6A 3SGKC 1WAAA 4YHYB 5D6CB 1BAFL 2ZWZA 5HGBA 3HPLA 2XG4B 2VXQH 1D5MB 1L0QA 3DHJA 1CBVH 1S78C 4HFWA 3MUHL 4JDVB 4NRZA 2EDWA 3QZNA 4UWQB 5MP6H 4RZCA 4MA7L 4KKRA 4Y4HB 3KG5A 3POCA 4EN2A 1RJZB 2Z31C 2O5ZH 5C70A 1UCBL 1L9OA 4U6XB 2YMXL 1QBLL 4ZXBD 4LRIA 4BFRA 3LNFA 4LARL 1I4FB 2AJSH 4PRNB 1KDJA 1CBJA 4OY9A 3U9PH 2VKXA 1P4IH 3VXSB 4S2SA 4QI3A 4N22A 2DN7A 3IF1A 2IAMA 1DANT 4GLRI 4X2UA 3AG3B 1IM3B 2R8SH 4RAVA 1G7LB 3CX5J 3BIBX 3WY2A 1UWXK 4MMYB 1GYCA 3CQFA 1J0JA 1PSKH 4KO9A 3CXHJ 3V0AC 3TBYA 2OPCA 1Z3GH 4PRDA 4Z7NE 1C12B 1OSPL 1UXLA 1QFUL 1J5IA 2AKRA 4YE4L 3LKRB 4B53A 4ODHH 2DMGA 4MD5B 4BE5A 4YZFF 4J28A 3H2QA 1UT2A 3PHSA 4M1DL 4NQDB 8FABB 5I19L 2H9GA 2VN4A 4HOWA 1HHJA 1KYAA 2IG2L 3PS6A 1SMOA 4G8IB 2FYYA 1PVHA 1T89C 2O6DA 1Z32X 1KXVA 3NIGB 1RMFL 4Q58C 2F15A 1PY9A 3SBWA 5B3JF 1DR9A 1NWOA 3GLZA 3LN5A 4HIJA 2CHDA 2H0EA 3VD2A 1HI6A 1I7RA 3HG5A 1AZNA 4GH7B 4BFNA 1ZLDA 3MZGB 3V4LA 2CKBA 4P23B 1MXDA 5J7CC 1PMYA 4ABVA 3L6FB 4Y4FA 5J13C 4FZEH 5AG9A 3GI9L 2EDNA 4XNXH 2A9ML 5EU3B 2IPTL 3N6YA 3Q7JA 3QUXA 3RL2A 4DEWA 1CYXA 5I1IL 1M4KA 4JJ5A 5JQ6H 1PL3A 1A7BA 2WTOA 1LJMA 3UZVB 2Q5BA 5I0DA 4NRYB 3ZKXC 1OGAE 2IO5A 3CFJA 4HIEA 1BEYL 2X4QB 1R4XA 4ZFOB 4RMBA 2ICCA 3PXJA 4G7RB 5T3XL 1GY2A 1NKOA 1UM5L 4XPHH 5DUMH 1D3CA 3BZ5A 4TVPH 5GRJH 2E5EA 1FORH 3SPVA 2OMWB 1FVEA 5BO1H 4IMLB 1Z66A 1R5WA 2DQFB 5E2TL 3R7QA 1QFWI 3BWUC 1P1ZB 4DT2A 1WLHA 2YJLA 3VRIA 1F1GA 5KTEL 5KVFH 4YO0B 1AGCA 1YEHL 2XWXA 3DPBA 2OXGA 3QWQB 4F58H 1IGTA 1MRFL 2C9RA 5ANHA 3WNPA 4KZEL 4X6BA 5DJ2B 1AGBA 3MLVH 5PCYA 2YO3A 4PJHE 3G6JA 3K4DA 2WNGA 3AREA 2XWBA 5DEGA 5DYOB 4LCUA 3EJTA 4JFOA 4JGMA 4NXKA 1PKQA 1FNFA 4H0LC 4Y1SA 4EXPX 4DZ8B 8CGTA 3RGVC 2V7HB 5CN3A 4D9LH 2O6FA 4NAJA 4ONGL 4R2GD 5EIIA 5ISZA 4XCNA 4Z5RA 3FN9A 3SO3B 1BD2A 1DL7L 4G71B 3MJ7A 5JTWA 2WZ0A 4WU7A 3BZ4A 4GAYB 1N8ZB 5I26A 3NPSC 4PLOB 1EJ6A 2VE6A 3CSBA 3MDJA 2LLGA 3BDBA 3QRLA 3QQ4A 5IG7B 5IVNA 4YDNA 4R7XA 1VEMA 5EN2B 3S37H 3S88L 2FEEL 4MA3A 3EGXB 4HJTA 5DHEA 2EXWC 3KS0J 3NA9H 4OFVA 3RTQC 5EUOB 5I23A 1GJUA 4ZDHB 3MGTA 2VR6A 3PHAA 1DQML 3T3MB 1RPUA 5HHME 1WWWX 4NWTH 2BVUA 4C56D 1CE1L 1KNOA 3WEAA 1UHVA 2IEPA 1BVLB 4TOYH 1WIPA 3H9HB 3DK2A 4EAEA 5HXMA 5B39G 4QHMB 3QIUD 2RB8A 3AABA 3KPOB 4K2UH 5DRNA 4YXKL 1FIEA 1D5MA 3CN4A 3NJXA 4TLSA 2IQAB 1HZLA 1GZPA 1DN2A 4OCRL 4PJFE 1LDPH 4JE0A 5ACMA 3ARDB 2ZXAA 4WZ9A 4QMEA 3S3DB 3AXLB 4MAYA 1CDJA 3UDWA 3RZCD 3L3KA 4U6XA 5EPMB 5AAMC 5BZZA 5BXFB 5D1QE 4DEPB 1P4LB 2FH6A 1WE5A 1RFDL 3CHRA 4J3TA 2Y36H 3HFFA 3TZVD 1A21A 3NPSB 1M53A 5E7BA 5GGTL 2VXSH 2HWZH 4JN2A 1ZTXE 2BS71 4XBEL 3RJDA 5ABZA 1D5XA 3KDMB 5I16B 4F24A 4EIBA 1K4CB 1BD2D 25C8L 1K5NB 2VDRB 2WXOA 1ORSA 4KITB 1J1OL 1E90A 3SZKC 3BHBA 4M3HA 5I6NA 3G5YB 3OKLB 3ABZA 2YUVA 4LCIH 4IYKA 1C8PA 1T7VA 4OCSL 3TBYB 3ULVH 3OTTA 4X5RA 1ASPA 3EOAB 3L4CA 5KSAC 1E5CA 1HYRC 2OXHB 4NN7B 5FLVA 1U21A 2Z4QA 4NO3A 4X80H 2CM6A 3DGGB 3IEAA 3L9RA 3P11L 4GP4B 4QRPA 3MCLL 4YC2C 3QQDB 5C07B 3QIBB 4GI9A 5HI3D 3MOBL 3RX7A 1TCRB 4RRPA 4FC3E 3FO0L 4NZRH 3BZEA 3VW3L 1CLOH 5DUPL 2YSSB 3DLQR 3DNKA 3QBTB 2WXPA 1YJDH 1GC1C 1IJ9A 4JVWA 3VXRB 3AT0A 4BFGA 3L4VA 1HCZA 4KJQD 4PJGB 4HCRH 5ETUA 2CO6A 3GMQB 2P28B 4Q52A 2IQ9L 4D0DB 1RJYA 3UMTA 2OX5B 3R1GL 3UBHA 2J2ZA 4QF1A 2RTTA 1TZHB 4H2AA 4X5WB 3X11A 1HK6A 2DB8A 1DFXA 3RDTD 3O0RL 1QTYT 1MLBA 5FA3A 1ZXQA 3ZKSD 3P4MA 4POUB 4OD3H 4ZMPA 1N64L 2IPKA 5B1JA 3CDZB 3D12B 3F5WA 4UDUB 3O2WL 5TH2A 1VZIA 3V6OE 4PJ8A 4M93C 1QTPA 3SO5A 3RL2B 1OLLA 2FE0A 4QRFA 5I6LA 3CH8A 4KO5A 4QKXB 4F33A 2Y1ZA 4M8QB 2DH3A 4MXWL 1XEDA 3VFMB 3U1QA 4AKPA 1XD0A 2QKIA 2Y7MA 4PRBA 4AMKL 3EJJX 5EDXA 3UAFA 5M95B 4YNYB 3DVFA 4JY6B 1MCFA 3TO4D 3TV8A 3MLTB 1HCVA 1M7DB 1OV8A 1UA6H 3EKCA 3FU7A 3IDIB 2HKFH 2J71A 2OMWA 4MAYD 1G43A 4HUMB 3WNNA 5T5FA 1X5YA 1JXDA 2NY1B 3AXIA 4LSVH 2X6UA 2X89D 4BA8A 5CLXA 5E99L 4N90E 2CCWA 4U3CA 3ZKMC 2W65B 3LQZA 2YWZA 1XGYL 5DS1A 4KRLB 2X87A 2A6IA 5E9DA 1KEMH 3RTLA 4R4ND 4HS3B 3U7AA 4HJJH 4BH7A 4WV1C 5J6HA 2ZOKA 1N18A 2BXZA 2DD8H 3BUYB 2IH9A 3AS0A 4N28A 4AYFB 1EUUA 4JY4B 3CZGA 4FNLL 2WMPA 1J9QA 4OB5L 4N90D 1WBXB 4XP5L 4QJ4B 2C34A 4W93A 5FCUL 2BJMH 3BESR 4O00A 3X12B 3HI6L 4OAWB 3VXUE 1EZUA 3IRCA 1NCOA 4WI3A 1IBFA 2WV3A 3RX8A 1SY6H 1WSST 4OI9A 2BSSB 4HUVA 1Y6MR 5LXGH 2B1HL 3MJ7B 5HYSB 1S7UA 1OGAD 1N8ZA 1OAQH 3N1PC 1SQMA 5B8CC 1GZQB 2X1WL 1G0XA 3GSRA 4OR1A 5EBMA 3G6DH 4C56E 5I6MA 3QIBC 4P5TC 4C4KT 5EN2A 2G3MA 3SDCC 4KI5D 4MA3B 4B9GA 3QDJB 2KKQA 1BYNA 1S6NA 2H32B 3LZQA 4H88H 4BELD 1NGZA 3QO0A 1IE4A 2F1BA 5JHDB 1RU9H 4K7PH 3V0VA 2VLRE 5AKVA 4AG4H 4W9FC 1ZRUA 4NEHB 3TWCH 3HAEG 3WCYA 2DKSA 3UROR 5JW5A 2BIHA 3BRGC 1UD5A 1NH6A 1RZGA 5EZJB 1PDKB 1OAKH 4QCIA 3AU1A 4G8GB 4IM8A 4LVOC 4QRTB 5E1AB 2VW6A 2P5PA 4JFWA 4OSUH 3BIKA 5DDHA 3HG2A 4N2DA 1BQHG 2ILLA 3OHMB 2QBWA 2AJUH 2WLLA 3EOBA 3J8F7 4DEPC 2Z8VC 3NCJH 3ULUL 2ZKYA 4EF3A 2BNUA 3ARVA 1KJMB 3DWTA 2YRPA 3ABKB 2YAEA 1E7UA 1NC2D 4HHWA 5CINH 3VRLF 1FL6A 4B9PA 1E4WH 2CDGB 4XMZA 4J3OC 4C56A 2XIIA 4LBEB 4JN2B 2GK2A 4U6YA 4XP6L 4JO4L 1SOSA 5IP4A 1D5XB 3KDMA 5I16A 4WK2B 1MDAA 1KTKE 5EFIB 4S0TD 1E4XI 5I19H 1HQRB 1U3HC 4PJ5E 5E6IB 5KJRH 1K2DB 2NZ1A 2ZUWA 1WPCA 5J6SA 5GS0L 1IIIA 2W9EL 4PTTB 4YMPA 4QIRA 4ZFFB 2C9PA 3S8FB 1IBGH 2NYYD 2ATPB 3CHPA 4IOSD 4WEBH 5ENWB 1M2VA 1U30A 3FULA 5EH1A 3VFVA 5GRVL 3EFOB 1OOWA 2GCYA 2DF3A 3ROOB 3HC3L 2D7NA 3DGGA 3DSFH 4OUOA 3QORD 4MQXC 3QUMH 1TCRA 3CFUA 4EI5A 5I6XB 4NENB 4KKCD 3WBDA 4RMVA 3I3DA 4JG5A 5DK0A 1DBKL 1SF3A 3ZHFA 1ZHLB 4EOWH 3LN9A 4WFGE 4GB9A 3SKJH 1CXLA 2XV0A 3LDBC 1UJ3C 3MUGA 4PJGA 4LCVA 1I3RB 4HWUA 1B2YA 1DE4B 3VVWA 1FHNA 2DTSA 2WJ7A 1C5DA 2GSIB 1WF5A 2QV2A 1PG7X 3OZKA 5FGCE 4GP5B 4KXAA 1ETB1 1XZ0A 1CXFA 3BSZL 4K8RC 5CLZA 3IU3A 2HTLC 4MJ5A 3ZE2E 1MCKA 1MLBB 4G42A 1H3UA 2A7BA 5D2NE 4I18B 4PMEA 4C83B 2AHIA 1U91A 3OZLA 5E56A 4I4WA 3BH9B 1X7QA 3GD1C 4PUBH 1PZDA 4AC2A 2DS4A 2L3BA 1KELL 4HX1A 2EUZA 1J8HE 4BK5C 3EHBC 2XWTB 4BKLB 5CHNB 1ZVNA 4QRUB 4A68A 2QDWA 4M29A 1AO7B 3FUJA 4UBDD 4BSVA 4M6ML 2PXYB 1D6EB 2R7EB 2C7UB 5LCVL 4Y9GA 4ZOBA 1CYGA 4WJ5A 2QKIB 2JK5B 4HDIA 3FB8A 3GLDA 3RI5K 3Q6FB 4PRPB 4H20H 3K72A 4ZOEA 2EEDA 4EVNA 3OMZA 2JJUA 2VW7A 2IXQA 3TYGH 3IDIA 2NY1D 1J48A 2BOBB 3CZLA 3DURB 3FU9A 4L8BA 1HQ4A 3GI9H 3O2WH 4QYOB 3JV6B 3GSNL 3VWKB 5E8OB 4DOHB 3ULVF 1J0HA 3D3VB 4GAJH 3RKDC 1NEPA 3FUMA 4IIZA 4UB0H 1J5OL 3MC0A 4JZJC 3BGFC 1ZK5A 3BQUC 4PR5A 3TVMC 4E9YA 1JYXA 1IEAA 1HKLL 3QI9C 1MFDH 5CKGA 1L7IL 1NFIA 1T4KB 5I75C 1TFPA 5GGTA 3GGWB 2CO2A 1U2HA 3PY9A 4X4ME 4O5LL 1G7JB 3A24A 1XBRA 3UEQA 4F3FB 1JYNA 1XMWA 2EDEA 4Z7VB 5CFHA 1UH3A 1FE8L 1BIHA 4WHYG 2YEVB 4JZJB 2YRBA 5AW1B 3RE0A 1XF3A 4BEIA 3OGCA 4UQ3B 5HGHA 1LO4L 1HJCA 5H8DA 1XXDC 3QUYD 3Q2VA 4NQEB 2DBLH 3UO1H 4F7TA 3VXPA 4U33A 2J8HA 5CEXA 3RWEA 4X7SH 5DS8B 4HH8A 1JS4A 3SOTA 5ITFA 5EEXA 2F54D 4I2XB 2NY3C 3COOA 3NRPA 2G3NA 3L16A 4X6EA 3BDYL 3ZTDC 5J89A 3H3PH 2OP4H 5FWQA 3V0VB 2EDHA 1FNGA 3LQAL 3NH7L 1F6FB 4PV1C 5K9OB 3IFOB 5FO7B 3F7LA 4LL9A 5EU7C 1F8TH 3A5VA 3FB7B 4M7KH 4JK0D 3BPOC 2AERT 1EIBA 4Y2DA 5IW1A 2NZ9D 5I15H 3OPZL 4IU2B 3T71A 1LE5B 4JS7A 5ID1B 2VJXA 4JHAL 3MLWH 4LP5A 1FV1B 2ZKHH 4DP0X 1C9SA 1FZKB 3GI8H 4KPHH 3CN1A 5C09A 1FP5A 2CO1A 3CU7A 4FFVC 3VSVA 5TDPA 4HKXA 5B7EA 4ELKB 4XNQB 5LXGL 3KWUA 2C9VA 4P5KB 1KIQB 3LZLA 3U7WH 5CMAB 2OJ1A 2H3NA 3DV6A 4AGOA 4E9WA 2BOCA 2GIYA 3K46A 4MVBC 4H8PA 5AYUL 4YX2H 4Z7NF 1YAZA 3B9AA 1A4AA 3DV4B 5C3TA 2A73B 3O2DL 4L4JA 3W11C 5K69A 2CPCA 2ESVB 3BQUA 2VRQA 2AQ1A 4NHUB 2G0KA 4R0LA 3L4WA 3QUGA 5GS0H 1GGIL 3WENA 4DGIH 3F3HA 3FBQA 1NOLA 3WJMA 4M56A 1AKJB 1TSRA 3CDFA 3QNYA 1CIDA 4ZMQA 2A9DA 5A2KH 4AVJA 3P2BA 4DKTA 1ASQA 5DCCA 2R51A 3BP5A 4NLHA 4MYPA 2UWEE 3D2UA 3KWWA 1IARB 2P5WB 4QHNB 5C0NC 5AW5B 4MNQA 2ODIA 2HJFB 4FP8L 4IOIB 1EDHA 3K4AA 4POZC 2EO9A 3MRJB 3NJGA 4FOMA 4EI5B 1O6SB 1CUOA 3N85L 4BZ1L 2JQAA 1KGXA 1ZHLA 4OLYH 5EZLB 5J12B 3Q5YA 3L7EB 3ARGB 4WWOA 1JYVA 1BZ7B 4OZGE 4GEIA 1CLCA 2J8UA 4M3JA 1CYWA 4U1GB 3SQOH 3EFFA 1YN7B 3QP3A 1R3LA 3EJYC 4J3OD 4WI6A 3TFBA 1ED3B 1DEDA 1QATA 3ARDD 2J12B 3EFDL 4FI7A 1AP2B 5GISH 3VFPB 4KVCL 4Y1AB 1NDGB 5FGBA 3VXME 4LOVA 3SPCA 2XPGA 4YHOL 4AZ8B 2HMID 5E2UL 1NAKL 4ZS7H 1AQKL 1MWAH 2EYSA 4IOFD 4G9DB 1HSAA 1I7UA 2XACC 5CP3H 2VZ1A 1TJHH 1XB8A 1MI5E 3OZ9L 1VFMA 1X7QB 3W39B 3N44F 2YLKA 1NC2B 2YWYA 3RQ3A 3KPNB 5JW4M 3IJYB 3OSKA 3VDAA 2RQ8A 3HG1B 1JXKA 3K4ZA 5EO9B 1I1RA 1RHHA 2DICA 1KYOK 4N8VB 1GGBL 4ZBJA 2PXYA 1NCWL 1MPAH 5DRXA 3DBXB 4D7PA 2R7EA 9PCYA 2WNXA 2R0WH 4HXBH 1SN2A 4XBPB 2VXUH 5EBLB 4L4TB 3SD5A 1SBSH 4I0PC 3TURA 4JDZB 4X9FA 5CSGA 4JFHD 3V9CA 2VAAA 1XCQB 2IGFL 2JJWA 3VXRE 2G2NA 3QWRA 1FH5H 3RGVA 2F19H 3UBXB 5JIPA 2Q20A 2XLLA 2W80C 3DUHA 4F7EB 1M42A 3MV8E 3NAAL 3T4YB 4PG9B 3HVNA 4LQ1A 1V7NH 3DURA 1I3VA 2XKNA 3ZZQA 3DO7B 4FN0A 4HIHB 2K6WA 1VFUA 5IOKA 5C0AE 3KYKL 2JTDA 5ID0B 4JM2C 1V7ML 2RFXA 3LH8A 1OB1A 1X9RA 3BWAA 1F4YH 3IJ7A 3US0A 3JWNE 5I30L 4ELMB 2ZCKL 2B39A 2R4RL 4H1LH 3ZZ1A 4YGVB 3S3SA 4P57A 2E7DA 1SY6L 3TO2A 1NFIB 4ORGA 1QBML 3NACL 3T77B 2R2BB 1USQA 3O6FB 4HOZA 1TETH 3ARZA 1TYJA 2DIAA 3QUMB 1ORQB 3P69A 4NUMA 4GSDL 2CLZA 3B2VL 3LKQA 2VLKA 4Z7VA 2XXGA 4JJHA 4CMMB 5I1EL 4ODTL 1B9ZA 1BLIA 1F5WA 2E6QA 4BM7A 2K4AA 2VM4A 1JE6A 3BDYH 4UQ3A 1A6AB 5HGHB 1KJ2H 3QZPA 2OJEA 5I66A 1SXZA 5HHOA 3ZKMD 1E2ZA 3Q1EA 4NBZB 1E8YA 1ZIBA 2EE2A 1JNHB 3C8KA 3WMPA 4LRNL 2HLEB 3MV8A 2WUCL 4H25B 2HRLA 2WOBA 3TH4T 4MAYC 2GSGB 3UDWC 3WKML 4QTHB 1A6WL 1JCVA 4KROC 4NDMB 3FQRA 5LBSA 4J3WA 3NJMA 1JV5A 3DVNB 3WD5L 4H8WH 3K80A 5AVWB 3PUCA 5C9KA 2Q86B 4GXVL 4X6DE 2G60L 3RZWA 5BW7C 3FOLB 5KYYA 2P4AB 1P7QB 3IFOA 4S2SB 5KBMA 4L48A 5TE4H 1IKFH 4PJCB 4WI4A 3WU1A 3IMWA 4FFZL 3ZTNH 4E0RB 1JGDA 4UQ9A 4F20A 3Q8AA 3ULUH 1UOWA 1T5WA 4L1TA 3VNYA 4M6MH 5FX3A 3DECA 3APCA 4ZS6C 4PJ9D 4ZMTA 1XIWA 4PH8A 4CU8A 3CVIL 3TV3H 3LZNA 1KUMA 1HNFA 3GRWA 1EO8H 1O7SA 2O5ZL 3SDDB 5HGGS 4Q0XL 3KJ4C 2VZ3A 1MCIA 1W72H 8FABA 2HFEA 3EH4B 1SLXA 4XVTH 3PJLA 4Z7WF 1BZ9B 1G5AA 2EACA 2P8MA 2Q87A 1Q1PA 1XEUA 1EXGA 1OCWL 2OMUB 3UL4A 4B7IA 1F11A 2X6CA 4YLCA 3SGEI 4FJYA 1A14H 1FGVH 2J6EL 3HI1B 4EQ3A 3ASWA 2GI7A 4C55A 1IT9L 3QDMD 2C5DC 4KTYA 4XXWC 5HI3C 4NO0D 4JFDE 3HLAA 2OMVA 1V5JA 2EIBA 1KN4L 2GFBA 2JJTC 2YAMA 4OLXL 1ZWIA 2CALA 2R2HB 1J12A 2B20A 3DARA 2R29A 2IVFC 2VC2B 4JRXE 1LK3H 3GSWB 4HJGB 2WZPD 2YZ1A 4JO2L 5EU3A 2YAFA 3H2WA 5E2UH 5AW3B 5AOZA 4NN6C 2K9UA 4JRYE 2AEQH 4X7SL 1XCWA 1FPTL 4KVCH 1DVZA 4B9YA 4M7LT 2LTQC 1SUHA 3KJ4B 5ANMB 1PD1A 2BVQA 1SJEA 3G9VA 4YLBA 4GUQA 1OTUC 3KPMB 1JVOA 3VFSA 4KMQA 1W6WA 4WI9A 2LFEA 2H8PA 3NIGE 4LLMA 1U8OB 3CMOH 4X6DF 5E70A 4WTQA 43CAB 1KN2H 2VL5A 2JH2A 5IFHL 3CDYA 2JLPA 1H3WM 4I5BA 4OT1H 3N41B 4H8VA 1VFAB 2PP8A 4DP4X 4GW1B 1XGZA 2IADB 4G8EB 4IU3A 3UC0L 3UG3A 2APXA 1HU8A 3VRIB 2YOCA 1GSMA 5KZCB 1EFQA 3ZYZA 5EO9A 4IBLT 4HJIA 5GJTL 1JJUA 1SYSA 4TUKH 1DEEA 2O6PA 1AGBB 3ZOAA 2B1AH 4LEXL 4L4TA 4J4PD 2R56L 3QCUL 1MJJA 4IDJH 3QXAB 3K6SB 2XWBB 5DEGB 2APSA 3RTQD 4JB9L 4M6AA 1ZHNA 1JPEA 4LCCB 3QXTA 4LKCB 5K33A 5ACLA 3BKCH 4PJ9A 4KJWC 4B9JA 1L3NA 2CA4A 1Q9WB 3L3OA 3MRGA 4HZLB 5HHMD 2ATKB 2HSIA 2DEXX 3GSNA 4N3UA 4P2RB 2BP0A 5IR1A 4M5SA 4NQQA 1ZVSB 3UZEC 3ELQA 4P3DB 3FT0A 3GXFA 3LX9A 2VE6B 1I9EA 1AC0A 2J1WA 4F37K 3UTZB 2VDRH 3U2SB 4X9YA 1SFHA 4QKTA 5I5JA 4AUJA 1WS7A 4WFHD 2EDLA 2Z35B 4Q4IA 1EGJA 4N0UE 3Q01A 1N19A 4PW4A 3RUGA 1AZCA 3ECUA 5KVGL 3PJNA 4M62H 3OPUA 3SKUD 3X1EA 2NNAA 5DRWA 3MCG1 4ZSOA 3VD4A 2PCXA 3ARXA 4GRWB 3D9AH 1BEXA 2WLKA 1KNOB 3QYNA 4ZMZA 1U8IA 2LU4A 1WD9A 3S36X 1WS8A 3VRJB 2NY7H 3ZY7A 3VUAA 1A6AA 5I66B 3R06A 1UA3A 3KYKH 1IVLA 2VUOA 4EI6B 1O7VA 2FWOB 4HS6B 5K1JA 3D18A 3B1UA 5ALBH 5F7KC 2A0LD 4QTHA 1KTDA 5CR8A 5IFAL 3NCMA 3AS3A 4XNDA 1NUDA 2NQDA 2XWJB 2Q86A 3OG4B 4Q9QL 1BZ8A 1AG6A 3WTWA 1BZQK 1CDGA 4Z76A 5L2KB 1KYFA 2DQDL 3ESMA 5IESL 3RRQA 3ML8A 3G5ZA 1U3HA 3LHPH 2GUYA 1J1PH 2DQEH 4OD2A 3SY0B 4ZX4A 1SN0A 5DJCB 5KSVA 4AYBA 5ILTL 1MIEL 4LDEB 1YMMD 4JO5A 4DH2A 5AWNL 2L8AA 4LLUA 3KVDD 4GW4A 3JV0A 2W0FA 3L3HB 2LAAA 3OJDA 1MZYA 2ODHA 2WUCH 4MJIE 1A3ZA 3L9RB 4QRPB 4ZPTA 5A3ID 1FJ1B 4PJAA 3K74B 4M8UA 4D9RE 1DBAL 1RUAH 2O4EA 1JZFA 2HFEB 2CK0H 3ZDWA 5AB1A 1JGUL 3BOVA 2V8LA 3CHXA 1BMGA 2FCBA 3IXTB 2OLDA 1UM4H 1C12A 2QQNH 3DX6A 2Y25A 3RVVC 1NBVH 4FQ1L 2WAHA 2WO3B 3BN9C 5DQJB 1C5BH 4K9EC 2OJZH 4HD5A 1JMXA 1B4LA 5B1JC 1W16A 1QPKA 1HHJB 3C6LB 1X3DA 2Q6WA 2GFBB 3PHOA 4MHHG 1YUHA 4XP9L 3P3SA 2KPNA 4G8IA 4ZW6A 2FL5B 3SDDD 5CN1A 3MA7A 4KU1A 2ZONA 1A1OB 3VXOB 5EU6B 2P5WD 1QLEL 1FVCB 1ZLSL 5EEWA 5E9DD 2M2DA 3CDZA 3NUKA 3STLA 1G6RH 3IFLL 1JOIA 3T8XA 5IJVA 3HA0A 4JQVA 3EYSH 4DGIL 4L3AA 4PJ5B 1ITBB 5D71L 2CE6A 5FW6A 4MCYB 4UTCA 4F93B 1Y0LB 4GINA 2Y7NA 4KDWA 5DLML 3B2VH 3SDYL 2Z7UA 1J10A 3JT2A 3M1OA 4LP4A 1SMAA 2IV9A 1QI5A 2J1ZA 4G8AC 5KTEH 2V8MA 1XVSA 4W4OA 4ZX3A 1E27B 2Z31D 4NWUH 3RY6A 3T0EB 1O6TA 2QFRA 1G7MB 1TR7A 1RZJC 4NNXA 5A1AA 1IZJA 3QB7C 2QPUA 5EU5A 4DUXA 4UINH 3MACL 5I1IH 2YIHA 4HIEB 3PP4H 3N42F 3NRFA 1D7DA 3MREA 1TEGA 5DHMC 5E9DB 1UJTA 5A2LH 4LCIL 4BH7B 5E5LA 3TJEL 4RH4A 1QA9B 5AVYB 3H0TB 2PYEE 1CO1A 4MA8L 1NCHA 3SGJA 3EFDH 3QZWG 4XB8A 2E27L 1F2QA 1ULVA 1PF3A 4MAUL 4BSJA 3PWUA 3JVFC 2Y6SD 3C2AH 1G9HA 1AGCB 4YC2B 4CL7A 2XN0A 3CN3A 3MV9A 1MCQA 3FTYA 1WBZB 2AJZB 1Q9WA 3BISA 4PG2C 4FA7B 3MCYA 3CVIH 1JZ5A 4ZXBB 2UY6A 1IBZA 3R7RA 1CR9H 3U4EB 4DETA 2HN7B 3PWVB 3MQIA 3ECBA 4WKZB 4OLZL 1FFQA 2K1MA 4QRPD 5DSCB 4XNAA 3HG4A 4LEOA 2E76C 3VM7A 3X3FH 1YZZA 1GA2A 2WLNA 1NBCA 2B2XL 4OQTH 3QO0B 3ZKNC 1HHGA 2PWGA 4BQCA 3VXUA 4ZFQA 3QDHA 5SWSE 2VDQL 4CDHA 3MRIB 3HKZA 1ET7A 3FTGB 4ATWA 1QEXA 3ULVD 2NW2A 1SXNA 4OIFA 1AS6A 2COQA 5ACZB 1EJOH 4JQIH 3CVHL 4ODUA 3N04A 4GG6A 2YPVL 1THAA 4BCXA 2NY4B 2JI2A 3PWLB 1I8KB 5L4IA 3N0PB 4AQEB 1P4BL 2BCKB 4HPOL 1HN1A 5DDHB 4YIQA 3HN3A 2HLFD 3QO1B 5DJZA 2Z31B 4UQ2B 3UH8A 2BO0A 4F8TA 4L1LA 1BVLA 5LBSL 2MCPH 5CZVH 2B4CH 3H9HA 5DRNB 3QRFM 1K3IA 3V0FA 1YMME 3WXVL 2Z93A 1GZPB 2CDGA 5I8KL 4C56B 2YKKA 4N5ED 4CBPA 4Z76B 2MHAB 1U93A 1T2JA 1E42A 2R27A 2GJ6D 3GRWH 2W07B 1U8QA 3ULSB 5H4ZA 1KGYE 1K2DA 4AQOA 4UZSA 3MRDA 1RLBA 3A47A 2AFNA 4FFYH 4D9RD 4IGBC 1JNLL 5KG9A 3PXLA 3HNVH 4LAQL 2ATPA 4FXKC 1WVZA 1XF2A 5A16A 5L6YH 2Z0BA 1NMBH 5EZIH 3HFMH 1UEYA 2VC2L 5FO2A 3WJJA 4PJDB 1EERB 4DUWA 5AAMA 4AKOA 4JFTA 1JFHA 1CL7I 1F58H 1KCUL 4UDTB 1RD6A 3BHBB 4NPYB 4A6YB 1HTYA 5HI4C 2AEPL 4OI8A 2RCSH 4ZUVB 4AYSA 4ISVB 4XBEH 4AL8C 1MCOH 2J88H 5SX5K 5LUMA 5CM1A 2XWDA 2NLJB 5ISZD 2Z4QB 4NO3B 1NBYA 4GUPA 2JB5L 3HPJB 3W2DL 3F05A 5D5MA 4CAGA 3MJ6A 4XNYL 3EG9A 4CDGC 3QIBA 4FQXD 3V4PL 5C0BE 5DK2A 1W0VB 1WFOA 2WGXA 4KGLA 4M4PA 4Y89A 4MFHA 3QYMA 1EGJH 1MJ7H 2DM4A 3ZYOA 5EF2A 3V5KA 3VXRA 3QQNA 4ECNA 1NBZB 1QFWH 3MA7B 4OQ1A 3GHPA 1XIWC 1F6LL 1FVCA 4TV3A 4XB7A 2UYLA 4TN9A 3ARBD 2WSKA 3GZKA 3LCYA 2X41A 2IWKA 2OZ4H 1PAMA 5DEZA 1TZHA 3X11B 5I82A 2L7QA 4XMKL 4GRLC 4F2FA 1Z6JT 4MB4A 4DO4A 5KSBA 2DTML 1ZE3C 4K5OA 1FO0H 3NFNB 4I0PA 5I1CH 1NBVL 4FQ1H 3S48A 1LMKA 4TXVB 4QJ3B 2XA8H 2X0VA 2IFGA 5I6OA 1CU4H 3QJFA 1QFHA 3ME0A 4I48B 3VFNA 5D5ME 6FABL 1ZPLA 1TPXB 3FQYA 5IWLC 4IKIA 5AB0A 3RIAF 3ATDA 1G6RB 2Z7YA 5DT1L 1AXTL 2N7BA 4IQHA 3WHXB 3VGHA 4YNYA 3IE9A 5IGXL 3RFZB 2FH8A 1U4FA 4MWFB 4WO4A 4Y16C 5D55A 5H2BB 5AAWC 5INDA 2JCCA 4FQXA 4M4RB 4UOW0 3SYPA 3KEDA 4ANVA 3ZL2A 4MDRA 2JIXB 4KI5F 1B3JA 1EHNA 1JPGA 2F58H 2FBJL 1AQHA 1GYAA 3IDUA 2D8KA 4NO0B 2J20A 4OJEH 3TO4B 2NDFA 2PPFA 5B3JE 2PABA 1EQWA 2GJRA 1N10A 4G7YH 4ODSH 3GJEB 2V2WB 1OWRM 5IB5A 3A67H 3BRFA 1F6AB 4NNPL 4PB9L 3S5YA 5CJBA 1YC8A 1JZ6A 4PVMA 2WKOF 1GJIA 3JWOH 4K3JH 1T66C 2X9ZA 1ZXKA 3KNBB 4I18C 4XPBL 3HG1D 4JG1L 3H9SE 3QDGD 2DD8L 2ARWA 2WTPA 3HI5L 3P77B 3HC3H 4YSQA 4YS4A 2OMZA 2RALA 5I0XA 1RLWA 1NFDB 2R0KH 4MS8C 4OZ4A 1O7DE 1EHLL 1OOAA 2YXVA 4QXUL 4ZTOH 4GLRH 1XF5B 4W70A 4HULB 5GZNC 3IPBA 1G9NH 2WLJA 5JIKA 3RFZC 4M48L 3KXFE 1U95B 4YDKH 4LLQB 2OYLA 5DZJA 1A7RL 1A02N 2UVFA 3BXNB 4Y5XC 1BSIA 2D2OA 4FXGA 4AYID 3PP3K 4CVXB 2Y24A 5F8RC 4N9OB 3BFOA 5FYKL 1OTSC 5C2UB 5DGRA 4ELKA 5EEYA 2ICEB 3QORB 4J3BA 1PZ2A 4YDJB 4X5XA 1CCZA 3MR9A 1RZGB 4TSCH 2XX1A 3T65B 5FGRA 1QW9A 4I1NB 4WY7L 1LILA 4LOUC 4PJGE 1B4TA 3X17A 2OULB 1XR9B 4XZUB 5SWQA 3DRTA 4FRWA 2ZICA 3GSOB 2ESVA 4YE0A 4UNUA 3IDXH 1MY7A 4PJHF 3GMMB 4YHNB 5KS9B 4NO2B 3ZHLA 4D8OA 1EX0A 1AGFB 3FHEA 1OGTA 3HIZA 2KLTA 4FQQA 1J86A 4G6AD 3TIDA 5L2JA 5GGVH 1IM9D 4B41A 3TN0B 4OZHF 3T0ED 5GGRA 3MA9H 1E65A 1MAJA 4NN7C 4LBEA 4U6YB 1SDDA 2EDRA 2ESVD 2N1KA 1SLUA 3KWWB 1PY4A 1RZ7L 2BVOA 1J8HA 3GXUB 3FFCB 3OHXA 1PSKL 4DP7X 2HFFA 3GXTA 5IQLA 3S5ZA 3MNZB 2WUBL 5JZ7D 5GJSL 4X99B 2UX7A 3V4PH 4NPYA 2V3DA 3EJQA 2ZX9A 1KBBA 2EYRA 4JY5L 5BVPH 5K9JL 3K5SA 3I3BA 4ISVA 1WZMA 3WY3A 5J11C 1EXUB 2NLJA 2Y06H 2JIXD 4YWGL 2HP4A 4A55A 5F9OH 2A5UA 1CTMA 3FCTB 4LARH 1BVKA 1TQBC 1PZAA 1E9OB 4XO8A 2LT9A 3WYRA 3ZYIA 1IFHL 1F86A 4R3SA 3W5MA 1I1FA 1WZAA 3UACA 5IKCA 4XRCB 4U49A 1L5GA 2LU7A 1J0IA 3P3RA 5FYKD 5LGHL 1NMCC 1I7UB 3U30B 4L8SA 3GSUB 3C5XA 3QYCA 5CZXD 3LKSA 1XL4A 1WT5A 1U8CB 4GXFA 4HUXA 5EWIL 4HWBA 3WN5A 4KY1H 1I8LC 2GVYA 3WO4C 2XI9A 1L6PA 2CJ3A 2ZG1A 5EOTB 3GB7B 1H6EA 3WNJA 4XNUL 3I6KB 1C5BL 1RY7B 1IGYA 2HVKB 5AOLA 2FZ3A 5HHQB 1W6LA 4JDZA 4HX1B 4V1DE 2NY6C 4N8CL 5E8DL 1EJOL 3AT8A 4JQIL 3HN5A 1O9ZA 4ALAC 4F7EA 2XUWA 3N1FC 4OTXL 4X4YA 1T6BX 3UJTL 1AQKH 4E9QA 5GS0D 2DL2A 1VRSA 2YPVH 1SJVA 3OD3A 5D8JH 5T1DL 1VKXA 4PRPA 4G6FD 2ZKMX 3BWAB 1AZRA 1BM7A 4D9QD 4CSZA 2VXTH 1VA9A 4MBOA 1DANU 2BOBA 2R1XB 4X9BA 3TO2B 3RDJA 3QT2A 4UQBA 3EJZD 3IETB 3CFNA 4L8CB 1OKEA 1KCRL 2BH0A 4P2OA 3T0WA 4BIKA 3RY5A 5IB1B 4WU5A 3S3JA 5J4MA 3CVDA 4BZ1H 4PJ8C 2ZSVA 1VPOL 4XMPH 1I8MA 1CDYA 5E2JA 1FFNA 2DYPD 3T3PE 1SM3H 1UG9A 3KBHE 3UTQA 1G7PB 1QBLH 2FJHA 2O93L 1G9NL 1KCSL 5IMOA 4HLZH 4PU2A 1F4YL 1UASA 3D4CA 3E7JA 4RAHA 3RJOA 3MV8B 4G6JL 4QXUH 2G9KA 1MFEH 1SXCA 2CWRA 2FHCA 3CTTA 3QHFH 5IREA 2VC2H 4NDMA 4FLHA 2X88A 1BQKA 3JWNH 4APQC 4JZOA 3DXAD 3LD8C 3CFEA 3F85A 3TT3H 2X9XA 5DURB 3RWDA 5HJ3A 3N40F 1M71A 1TU2A 4FG6D 1LEIA 3MROA 3FN0H 3VB9A 3L5XL 4NUGL 3B6SB 3O9WB 3QFJB 3KL5A 1Q1JL 1OARH 3QRGH 1W8EA 4D8PB 2KZ1B 5F9WC 3L5WA 3L3JA 3HRZA 3UJIL 2ICEA 3QORA 1FNGB 5D7IA 2WQUA 5LJYH 4GSUA 1N5YL 2B77A 3PQYA 5FO7A 2FYVA 2W9LA 4AQZA 5G5DA 3T8VA 3RAJH 3GNML 4JUSA 5HHVL 1EWHA 4ZUSB 1R3HB 1TO4A 2X28A 3GSOA 3QUZC 4FFYL 3X14B 1BLNA 2LE9A 3PAYA 2Y69B 3GMMA 5KS9A 3LB6D 5TDOA 4KRPB 5MENE 1XH1A 3APDA 4G59C 2PN5A 4L3CB 5D7JD 4HGWB 3DV4A 1NPUA 1B6UA 2H4EA 3D39D 3R4DA 5I1DB 1BBDL 3FT4B 1D7FA 4OIIH 1A9BA 1IV8A 4TNGA 4MB5A 4LSPH 4NHUA 2LAGB 3QXUA 4KJPC 4OLYL 4AIOA 1QTSA 2BVOB 2MCPL 5CZVL 1CFQA 4OIBA 4UANA 2BIQA 4N2AA 2C1OB 3C09C 2JB6A 4P9MH 3CFBA 2YLHA 4K8RL 4W9JC 4X98B 2V2TB 4YXKH 2P5ED 4HGKC 1E6JH 2R59A 3FO2B 2VDPB 2NXZD 4I85A 3C60A 4R7NB 2FEJA 2NY2D 4IRSB 4HETA 2YKLL 1WIOA 1YECL 3GKZA 5BS0B 3BC9A 2XHNA 3B1TA 3US1A 1U8MB 4JQXC 1YEFH 3QS3A 3X3GL 2BVQB 1WZLA 2BZ7A 1I1FB 3FQXA 3ZZLA 1NZRA 2PO6A 3RWCA 3HBGA 3MHZA 4LVHB 5CWSB 5KWYC 2EVIA 3WFDL 2H8PB 2L7EA 4GKSB 4ZQKA 1GPOL 5B4MD 3KLHC 4WI2A 4L37B 3N85H 2J8UB 3C60D 2BFVH 2EC9U 3O4LA 3EFFB 3QUZB 3GM0A 3N43B 1XAUA 1I9RL 4N2CA 4YBHA 3PAUA 3T3ME 2Z8SA 4Y2DC 1MQKL 2CDEB 3EJPA 3IPFA 1T0NB 1GW6A 4BQBA 3SPHA 4NGHL 3SYOA 2EDTA 4LGPB 3TM6A 3ECVA 3QJXA 1JN6A 5JOEA 3IDGB 4AQAB 4LCWA 4TSBL 3CLEH 4QHUA 1XSOA 2ZYRA 3SYCA 1CLOL 5C9JA 5I1LB 2M83A 1G7IB 5D1QD 3UZEA 2C9AA 3G9AB 4D3CL 1OM9A 3N50A 4X7DC 3P3TA 4KKBD 4OGXL 1RHHB 2XN2A 2WP3O 3DTXB 5DMYA 3TN0C 5JUEL 1FYTA 5D7HA 2HXAA 4M6OL 5C0BB 4XBPA 5EBLA 1GOGA 3VFTB 1MRDH 3J27A 2VQUA 2BIOA 1KMGA 4P3DA 4R26L 5FKAB 4OV5A 2E3VA 3IJEB 3KJ6H 4UQAA 3VD3A 4HUWA 5FHBH 4L4TE 4FLSA 1YSOA 4JCLA 4WHCA 2GSMB 1TLMA 1SVZA 5I1KH 4PB9H 3LZFL 3SDXA 4HXBL 1ZLUH 4BHUA 2CNZA 2R0LL 2PW2B 2XYBA 4GKOA 1FNLA 1VPOH 5F3HB 5L8JB 4L8CA 4XH2B 3O3BB 35C8H 4PBXA 2LHAA 2JLLA 3GFUA 4XGZA 1FF5A 3I6SA 4OB5H 3KAAA 4ODXB 4XP5H 3GO1L 5CIPB 4P3CH 3L9BA 1X5ZA 4QT5B 2H45A 2NW3B 4JPIB 4GXVH 1I1YA 4HAFA 3NN8B 4CN6A 1I1AC 1JF5A 5HVHC 4KKAC 2CAKA 5C07E 4KO6A 5FA4A 3B7YA 2CLZB 3MLUL 4HCRA 3WUWA 5I8CB 1Z5LA 3MRHA 1ONQA 3OKOA 5C09E 3NIDF 3VGEA 3MRMB 1HYSC 3HE6B 3HCVA 3TEWA 2BP3A 3X2QB 5JW3H 1YNKH 3WSQL 2DJMA 5KYNA 3S88H 2VR9A 3OC5A 4QHLA 1HH6B 4J4PA 4NQSA 3HB3D 3OM3B 1P7KA 1T2QL 4W81A 3NTCL 3SKNA 2CJUL 2E8ZA 4JCMA 3TYFA 4BRVA 5FUZH 1JNHA 1RP9A 3DTUB 3ZQ9A 4TL4A 3RKPA 5DVOA 4GG6F 1TU2B 1HHHB 2X2UA 1AGDB 4CVZB 5E8NB 1KCRH 1NCTA 1XV8A 5B3NA 1UKQA 1X5MA 3G5ZB 1A4JB 5F97E 3K6FA 1DQQA 1MAML 2PYEA 2H26B 4TSCL 1RK1B 1LQBC 4AYMC 4DEUA 4P4KC 1UWEL 5DJYA 1NM4A 3V6BR 1BFTA 4TLKA 1SXAA 2A6DB 2CBQA 3V6ZB 4WUKH 1O5PA 2R1YB 3HUJF 4P8QA 5K9QG 5F1IA 3SY6A 2PCYA 4PJCA 1U33A 4D9LL 4PYGA 5FF6A 1O9WA 1TIUA 2WQRA 4ZPTB 3G6JF 4MRCA 2APBA 2Z1KA 2DWDB 2PPEA 1TZ8A 3PP3H 4UCFA 5DZNA 1PGRB 2CHXA 4Y7OC 4NO5A 3DX8A 5GXBB 5TQ2L 1KCKA 4ABWA 3IGFA 3LVEA 3EGDB 3QNZB 4OF3A 3NFPB 3SDDA 3VMPA 4XE0A 2R83A 4M93B 3X1GA 25C8H 1RIVL 2PPCA 4G11A 5D2NC 3IWUA 5IVXA 5J6GA 5DQJA 2KPWA 3TFKC 5C92A 1ACCA 2W88A 3NCXA 4NOFA 1BZOA 1LEKA 1UB5A 3D69B 3CLFH 1PIFA 1CG9A 2AZAA 1J8RA 5IVOA 5AG8A 2OMUA 2WCGA 1OSZA 5LBGA 5KVFE 1HKFA 3QQ9D 2B5IB 4XC3L 1G7HA 3LKNB 3QIWD 2VMCA 5KUKA 2G30A 2CLRB 1B4JL 2I9LB 2NUPA 4OCRH 4ZAKB 5T3ZL 3F01A 1S5HA 1CXHA 1NL0L 1KDIA 2HT4C 2CJSA 4XPTL 4U1GC 5SV4A 5GS3A 5HYJB 2JCCE 3H56A 2NNFA 2P5EA 4NC1E 4ERSH 1YMMA 3GHBL 4D0CA 3QQ3B 5LAXB 5HDBB 2HRGA 2PO6B 4PTUB 2NX5D 3T2NH 4ZQKB 1E4WL 3OR7A 3PWNA 5MEND 2QR0A 1GGTA 4UV4L 2ZG2A 2GBAA 3V4VH 5JXEC 3QDJE 3CLWA 3HN8A 3N55A 4ZK8A 1YQ2A 3OKKA 4C4UA 3KM2A 4ENED 3T4AA 1QFWM 3V7AG 4XVUD 1RQ5A 3KYMA 1QHOA 1T0NA 5IMLB 4WO4C 3W0WE 4B6ZA 4HJEA 3BAWA 5I18H 4JEGB 3REVA 2VLME 3H53A 5JOFA 2YGVA 1LO2L 3ZE1F 1YPZA 2OBGA 3FOMA 4G8GE 4JDEA 1JCKA 3SE4A 5E8EA 3ZDYB 4G8EA 2YEZB 2EIDA 1RCYA 2Q2EB 2X2IA 5J3HD 3OLEA 4U1KB 1OAXH 2P5EE 2ZQKA 4HV8B 4O9HL 4PEEA 3BH8A 1XF4B 5EF3A 1S9YB 1SYSB 4DKFH 5CCHE 1A9EB 1QI3A 2SEBB 1GAFL 4PWFA 2R29H 3ALPA 5CUSH 5T1KA 1KB9J 3BO8B 2YK1L 4LVEA 1C08B 2DQIH 3E3QC 5A2IH 2EXYC 3UC0H 2IANE 4MDJA 5CP7B 1MHCB 2A6JB 1R5IA 2BPBA 4S1SL 1ZHNB 3VMOA 3N1GC 3P9MB 4HSCX 1F90H 5GSVB 5JMRA 2ICWJ 1KBGH 1IVTA 4XXCA 3DI3B 1HHGB 1NLBH 2I27N 1LHZA 5C3IA 2WYTA 3GXDA 1U92A 1A22B 2D3NA 3DO3A 4NCC2 1AZUA 1MRCL 4EIGB 2P80A 2WVVA 1QUPA 1KG0B 2CXKA 3LRHA 2NW2B 3CFMA 1JTPA 2CH8A 3PU7A 2P24A 5ICUA 5I24A 1EANA 2VMEA 3ZR5A 1YNTB 3OKDA 3KW8A 3QEUB 2VH5H 1I4FA 2F68X 4J1UA 1RK0B 3TF7C 5DRWB 4O2EB 5E6IC 2FJGB 2BMKA 2ZXQA 2ZUSA 2UWEB 3MRMA 1QLEH 1MW1A 4AEHL 2CGRL 4BCZA 4JFSA 1OP3K 3RNQA 1T6WA 1EK3A 2JJSA 4NKIH 2ED7A 2CBPA 4HS6A 4NN5B 4RZCB 4X4ZA 4FQJH 5AVZB 3HC0A 3HS8A 1GOHA 1N67A 1TMCB 4A7GF 3UAEA 5CILH 5D93C 3C6LD 1EFXA 2VITA 1WAEA 4NQDA 4BD4A 1HKLH 1M6OB 4N4YB 2FT7A 2AF2A 2Z6FA 2DWEA 3OMIB 4OBRA 3V6ZA 1XF2B 3K0YA 4KZ0A 5LWYL 2QELA 2VR7A 1BVOA 2FYYB 4NN5C 3MJWA 3P4OB 3OXSB 2DQCH 2K3HA 4M9OA 1A47A 2BDNL 2ED9A 4K3GA 1GTNA 5DD3L 2DWDA 4UDTA 4M6NH 4HHAA 1P2CB 5FM4A 4Y5YB 2M8XA 4EBQH 4NO5B 1HHIA 1HI6B 3F7PC 1R3IL 1CICA 4HWNA 4L23A 5F0PB 2I9TA 2KZKA 4MSWA 4NUPA 4IRZH 4Q2ZA 4F57H 3QUYB 1MCCA 2ADFH 3FCUB 1JWSB 4NQED 1BFOA 1MJ8L 1OALA 3S34L 1RMFH 3WTSA 3BP4A 3QHTC 3FFOA 4DKEL 5HJGA 3QDMA 5BZWA 1A7NH 3PGFH 3OG6B 3VFWB 3ARWA 4JDTL 1QRND 2CDFB 1LP9A 2Q9OA 2EDOA 2YPKB 2X4NA 3M8OH 3D3VE 2AJSL 5EUKB 1G6VK 1EDYA 2F1AA 1J5OH 5EA0L 4FFTA 2V2XA 2L7JA 3RIKA 1VEPA 4EDXA 1NKGA 4P46C 2ZJSH 3VI3B 3BJLA 1NL0H 3I50H 5JXAH 2XX0A 3OMNB 4FF9A 3RIFK 4NUJA 3QCTH 2HG5B 1KSRA 4E2OA 3WIFA 5E5MB 3WL9A 1EEQA 4XX1E 7FABH 4NT6B 1Y07A 4AY0A 1OE3A 4QHKI 2Z3FA 2FL5A 4OF5A 1TSHA 4FULA 4FCHA 4FNSA 3PGCA 4U6HB 5C71A 4D0CB 2HTKD 4ZO8A 1IQWH 3F58H 5IM7B 1FWXA 4RRPM 4NYLA 2JTYA 4HT1L 4QHKJ 1KIPB 4YX2L 3NZHH 4YO0A 5FXCH 4UAHA 4IKKA 3WJLA 5LNEA 2NY0C 4HC1L 3EDEA 3WXVH 5I1AA 3ALWA 4HH9B 5DFAA 1M05B 1XGTA 4L3ED 1G6RA 1LP9E 5I6KA 2ZOUA 1QWUA 4JHVA 4XX5A 2FECL 2FGWH 2BIPA 4FABH 2WBWB 2V37A 2B0SH 1L6XA 1PKQB 3LV3A 4OZGA 5DHXB 5JUEH 3LZOA 5SWSA 1ETZB 5TE7H 3FQTB 4FQXB 4WTXA 4I8DA 3SPVB 1IM9A 1Q9KB 1XL6A 4NNXB 2BVEA 1R5WB 1OAXL 3M1CA 1R3JB 1YPZB 3HNTH 4WAFA 3SE3A 5IIEB 2AEOA 4RNRA 1DJHA 1FFPA 5IF0A 4IBQA 4NFBA 2GJ6A 2BLFA 3MBXL 4WW1A 3PYCA 2RA1A 3RVWC 5F1KC 1ES0A 4UU9A 1BQHB 4X6BB 2E46A 5DR5H 4DKAA 1Q9LA 3KHQA 1TNMA 4YZWA 3MV7D 5AENA 3VG9B 4AJWA 1B2WL 4FG4A 3K2IA 3U1PA 4MCMA 4GEJA 4N8VG 3TA3B 1JRHI 3LRSA 2XTJD 2W0KA 2A9NL 2P44B 1R5VB 1KPVA 3H8NA 2AI0L 2ZYIA 2GT9B 1ZA6B 2HJKA 3VH8A 5JDJA 3O9WD 3QFJD 2ZWYA 4N86A 3UMNA 4N2IA 3PWVA 3LH2H 3DSNB 1GJWA 5AYTA 3WTUA 5AL8A 3FB6A 2KDGA 3PPSA 1IKNA 1CF1A 4HIXL 1RUQL 1FFOA 4FNPA 4GAGH 3V0EA 2XKSA 5BV7L 2BRRL 2D03L 1KJ2L 3ZKXB 2MKWA 5ISZE 4FG2A 2DH2A 1DQLH 3O6FC 4BBWA 3KPLA 3QG6B 1BD2E 3VXMD 4NBXB 3WFZA 1QLRB 4XOAA 2CQVA 1OK8A 1G9ML 2FAUA 2O30A 2PTVA 5F6HJ 3H9SB 4XAWH 5SWQB 3VG9C 4X0KA 4LPVA 4XCYA 3ESVF 4DGVH 6PAZA 4F5CE 1R0AL 4JL1A 5DJZB 1BEYH 1FZMA 3F8UB 1NMBL 3KLSA 4QYAA 1P5UA 3L3KB 3QZOA 1PG7W 3MLRH 5I30H 2VSKB 1YG9A 2HTKC 1MCBA 4H1LB 4IBYA 4KO7A 1XCTB 3BZEB 4HUCA 2VLMD 2UXVA 4BQ9A 3RX9A 3DRQB 3NESA 4L1HA 2I85A 3I9PA 5EF0A 1F3RB 1I9IH 3P4OA 1MAKA 2W07A 3W9EB 4Q0XH 3MNZA 1U6AL 3U1SL 1FNEA 3ZSSA 4CC4A 3V6FA 3GMOB 4NNYB 5IOPB 2XN9E 4NPJA 5KSBE 4Y5YA 3T09A 2J2ZB 2CR6A 3OKLA 4P46D 4UTBH 1YAIA 1D5ZA 1MIMH 2FBRA 2MNUA 4NN6B 3BVNA 1XGUB 1AR1D 1YDPA 2J44A 4JE4B 2W81C 4PJDA 1JWSA 3AJ7A 4YSRA 5CLWA 15C8L 2VN6A 3U4KA 4BDVB 3BP4B 4EJ1C 2Q8AH 4J2XA 1D5IH 5IT2H 4LDOB 4L2YA 4ZUVA 3D0VA 2BHYA 4IGBA 3FB5A 2GEEA 2EH7L 3ULUC 3CZUB 2YSTA 3ASNB 4HQQL 5CUSL 1DJYA 2CO6B 3VI3A 3EW3B 2YRLA 1ZSDB 5DD1L 3RI5F 3MRFB 5HY9A 4JFYA 3NA9L 4XPGL 3JUYA 1K9TA 2A9AA 3BEVA 5JLZB 2R9HC 1HCFX 2GK0A 5AOJA 4JFXA 3BEWA 4DKEH 5I1EH 5B22A 3P54A 2EE0A 2UYLB 1KBPA 3VCLA 2ERJB 1FGNL 5IROD 1MJ8H 2HVKA 1EO7A 5TH2B 5MENA 3G5VA 1S9XB 4J8RB 3UGUA 3HEIB 1NQBA 3FT3B 1ZKAA 1B0RB 2VTFA 2ENSA 4HS3A 1QSFE 3D7PA 1JZGA 4PY7B 1NA8A 5DUPH 3ORJA 1HVXA 1JZHA 5C0GB 1CC3A 3ILPB 3MV9E 1U8LA 1DVXA 5CJXC 1CICC 4CJ0A 1SDAB 4X5QA 1NCUA 2MKLC 1LWJA 2ZUTA 1CI5A 2CBOA 1YEKH 4MJ2A 5SWSB 5BS0E 1LDSA 3MLTA 5PAZA 1UD8A 4ZFGL 4OZIF 3KXFA 3SGDI 1CT8B 4M1GH 4M61A 2CRMA 1NFDE 3JWOL 4K3JL 5HPOA 3DMMC 1JG9A 5F3FA 4IBVA 1AFVH 1GZQA 1X5HA 5D6DC 4WEEA 3UBXI 5LGJB 3RWGB 4KX7A 3D85B 4OGZA 5EBMB 4YWGH 5KSUB 5MEOA 1A1MA 4XTRD 4EUPB 1V27A 1A6VL 5HVWA 1G84A 1OAYH 3OAYH 2C9QA 2B14A 4TUUA 3MBEB 2YA0A 3WIHH 3F7YA 1Q94A 4R5TA 3GSXB 3MRQB 2IDSA 2QADB 5D2LB 3ZMRA 1D5BB 5DC0A 3EBHA 1J9SA 4KH9A 5C6PB 4YDVA 3MRPB 1ECYA 1WBYB 3VVVA 3L95B 3QWRD 2BSSA 2EDFA 1EO5A 4HUVB 3HKFA 2FD6H 2PO6D 4JZOB 3SE8L 2F58L 2FBJH 3ZIYA 3MGAA 1DSFL 3CC5A 3PL6B 5DMGD 5T8IA 1IILE 4K3DH 5C2BH 4TOYL 3H6AA 1JMZA 5FFGA 3HG3A 3DSNA 5LG6A 3LEYL 2XV6B 1CGUA 3BKML 3RY4A 4DP9X 2WBJD 2VDKL 2OAAA 1FI8C 3AWEA 4HWZB 1QHPA 1NFDA 5GSRB 2D3JA 2DM2A 3IKCB 3Q05A 4WNSA 1KJMA 2XXFA 4KTDH 5E8PA 4OFIA 3E0GA 5F70A 2D3VA 3HRZB 3K8LA 1JDDA 1WEJL 1FZOB 4HKZB 4LEBA 3W56A 4YSEA 4U1MA 2OL3A 3G04B 2YR3A 5ESAB 4F2MA 1XHHA 5CJXA 2E86A 4OCNC 4GRWF 4E9VA 3C09B 2FHFA 2N7SA 3GHEL 3D39A 1GYWA 1HH9B 2IANB 5JXED 1ACYL 3IGAA 2YHGA 2FSDA 2PCFA 3BIKB 4ODVH 5JORB 1I3UA 2VM9A 2ZX8A 3MMEA 2OKMA 2X4UA 4WI8A 4PLKD 4FLQA 3MR9B 2WLYA 5L0QC 1GRWA 3VXTB 1KBWA 2K8MA 12E8H 4Y5XA 2BNUB 1P6WA 3WV0A 4ANUA 1I8UA 1J1PL 2DQEL 4L4VD 1A9BB 1HHKA 3WGVB 3SE9L 2GC4C 1ZT4B 3SGDH 3DETC 5AWNH 3SSGA 1PKOA 1CFQB 3EJSA 4IBWA 1MIML 2FIKB 4H0HB 5E6IA 3QPQC 1N6VA 2WGNB 5FIEA 3ELAT 4LCYB 4S0SD 3TA3C 5ITBL 1S7SA 3MOBH 3S3CB 4X98A 2V2TA 2DWYA 4H0IA 5IVZA 3ROLA 3FO1B 5IVXF 2X3CA 1I8LA 4FQHA 3GIVB 3QEQD 4E41D 1YDPB 5I8OL 5IQOA 4OF8A 2DLEA 1ZDQA 2KLRA 4Z7OE 3IGLA 4B3EA 4X99A 4XVSL 2A74C 4K5MA 4HA1A 5I76B 4K0OA 1JGEA 2CSPA 3VX1A 1E50A 4PJIA 1W0WB 4IGBB 5K59E 3LNGA 4U6VL 1OE2A 2EC8A 5JQIB 2YS4A 7FABL 4MA1C 4MJIA 5JA8B 4BSVB 1HS6A 3DIVA 3G6DL 3MO1B 3WEXB 1OHQA 1H15A 1YQVH 2E47A 3IJSB 3JWDH 2VMDA 1OZTG 3IS0X 2BC4A 5L88H 2EKSA 1XZ0B 1KB5H 2WANA 4IMKC 4U2YA 3HUJB 1QBAA 2NT1A 5C0IB 3D34A 4MJ5B 5KAQG 3WG7B 2Y5TB 2N0KA 2IAND 4P48A 4AITA 4I4WB 3HMWH 3GZOA 4JBSA 2GAZB 2J57A 3DJZA 5KANG 1UUNA 2XWTA 3TP4A 1KBVA 5C6WH 5LDUA 2OTWA 1UADC 1EV2E 4N1EA 4Z77B 5IHUH 4AI7A 3GMPB 2YAQA 3LH2L 4ANKA 3GTTA 1U8LB 2JI3A 4GQPH 1DQJA 1SHSA 1F0LA 5BRZD 2WLZA 3DDGA 1F4HA 3HB3C 2YOAA 1QACA 4NQTA 1IC4L 3Q6FA 5DD1H 4TUKL 3FT2B 4LCWD 4U7KA 4AV0A 4ETYA 4OV5B 4OD3L 5K9KA 5HYJE 5MEPB 4EVNB 4X9HA 1JPSL 2XQYA 1SM3L 4FFYA 4P5SA 2V33A 1K8DA 4HKBA 1L9RA 3U83A 1TFHA 4PMFA 1OGAA 4UILH 4BWUA 2P1YA 3E80A 1Y1UA 4KKAD 4B9KC 3O3UN 2BM3A 1I1AD 4L05A 4KK9D 3WAKA 1PLCA 4GFXA 1F41A 4OLUH 4LU5L 1LLAA 1XH2A 5H37A 2A4EA 1NWPA 1Z9SA 3D85A 4MXWH 1KCLA 5KSUA 3X1NA 1HEZB 5AVTB 2FO4A 4JG9A 5FWRA 1S7TB 2CD0A 2Y9RT 1NC4B 1AE6H 4K3DL 2NXYC 4EE2A 1U58A 1YEDB 4OI7A 4J3UA 4Y4KB 3Q43A 3SDAA 1MRDL 2V17H 3MRPA 1KTRL 1QSFD 1T1YA 4Y2DB 5IW1B 1E6OL 4N5UA 5KS9E 1IEHA 1ZHBA 1LE9B 2X53A 1J0KA 3DOSB 3KPPA 3PP4L 5B21A 3BSZH 5ILTH 3PL6A 4KAQL 4ZMAT 2J3SA 3PUUA 4KUCD 4Q6YA 4XP1L 1K4DA 3CZNA 2EDKA 4U1JA 5ABDE 2ZPKH 3LXUX 4WW2C 1YLBB 2ALAA 4FZ8L 4F7KA 5KVGE 5I15L 3FO9B 3HZKB 2DLFH 4AQ1B 3NGBB 3UTSB 3K6NA 2MNJB 3GTVA 2VLJB 1L4IA 2QHLA 4UOJA 5FCUH 4HKZA 1KJ2A 2OL3B 3G04A 1KYUA 3MROB 1URIA 4MD4A 5BMFH 3REWA 1RIUL 5K9QI 3WIIH 1ZTXH 3BMVA 3TXAA 4X7EC 2JKLA 1HH9A 3FCBA 5JO5B 2VXQL 3GUTA 3FN0L 1O9VA 1HNYA 1PCSA 1UD2A 5F88B 5JORA 1YEEH 4NQVB 3TT3L 4XNQA 1OCOB 1PQZA 3AG4B 2R4SH 3L1FA 3HZYB 3QEQA 4Y9CA 3LXCA 2HRPL 2CO7A 1BG9A 3MBWA 2BWIA 3CLEL 3MRJA 1KFAH 2BS9A 2OW7A 4R96B 1NJ9B 5D96C 2J72A 3HOGA 5KVGH 2A73A 2D4DA 3FU3A 5I9QC 4N8UA 4LVOB 4IRJD 4AM0B 2H32H 2B2XH 3LKPA 1BV8A 4S1DC 5TGBA 1ZT4A 3IJ9A 2ZNXA 4LPUA 1YY8B 3ABGA 1OY3B 3QNYB 2DI9A 2V7NB 1YN7A 3QR1A 4Z9KB 3C9NB 5I2IB 5JPNC 4JFFD 3FZUD 4AH2A 4A2LA 1EEYB 1H3VA 1OO2A 5IWLA 3MOQA 1O5DT 2G3ZA 3JV5A 1EEUA 3Q8FA 2XPGB 1GXEA 5CCKL 5FAAA 5L7XL 1I1AA 4O02L 2NT0A 3NMEA 1IKOP 3Q13A 3ULUE 1SN5A 3U9WA 5GRVK 2ZSWB 1LP9F 3O4OC 4LKXA 1MH5B 3HS0B 3ESUF 3VD9A 1U41A 5D7JC 3CFBB 3IJYA 5IHZA 3KPQA 1DCLA 4L1DA 1GSKA 3KWVA 3WFCL 4LDCA 3ZPDA 3VE0A 4QY8B 3E8UL 1WZ1H 4P9ML 1Q0XH 3GBNL 3QUZD 1NEZA 4OLZH 1S9KC 1XCXA 1ZVHA 2BX5A 2XXCB 5IW6A 4RIRB 3DIFB 5GGSA 1HXYB 4OJFL 1M1XA 4LLWA 3WIHL 5CJQL 2MQ3A 4F7MB 3RWCB 5F96H 3UZQB 4H8QA 5GGUB 4XPAH 5MEQB 2NY4C 1AQ8A 2X38A 1U8NA 3MRKB 3NJNA 2G75B 1MUJA 5F0MB 4F8QA 3O4LB 3L17A 1YY9C 4R8WH 5SWZA 1N0XH 2RCSL 5ID0A 4I9XA 2ZUUA 3GWJA 1SOQA 4GQ9H 1R3KA 2J8UE 2CDEA 1UEMA 2YGOA 1N59B 2F19L 4PV9B 4X4MA 3BWUF 4HV8A 4BH8B 1WRFA 4PBWD 4BWWA 3E1ZA 2XU9A 4E41E 3QXWA 4BE6A 1WFNA 1A9EA 2H47C 2SEBA 2I07A 1F3DH 5I17B 3BUDA 1JN6B 4U3SA 2I60L 3A23A 4LCWB 1FL5A 1NLBL 3KD4A 4YPJA 4KKNA 3NRQA 4NGHH 2VAAB 5CJOH 5H4YA 4MNGB 3W0WA 2R23B 5MEPA 4CMMA 1N3NB 3RILA 4I9WE 1NMAH 3QJZA 5MERB 2K3TA 4YBQD 4AIZB 4CGUB 1IGFH 5D70H 2XWCA 3AROA 2OJEB 5HHOB 1ASOA 2Q2LA 1JK9B 4G43B 1GC1L 1PG7L 1TKWB 4IK7A 4YHLL 4PJEF 2RFXB 3KYAA 1U92B 3GBDA 4CBZA 4O5LH 4EQ2A 5DQDL 2WVVB 2QVTA 5CCJA 4F27A 4TPRL 4JKNA 5SWZE 4ZTPH 4ANXA 4YGVA 4G6FB 1NEUA 2CJUH 5EG6C 4U4IA 4FQ2H 3EJZC 4M7JH 3ZHKA 4OD1H 3T77A 2DQIL 3TBBA 2YMOA 5FK9A 3WTTA 2AK4E 2AQRA 1GAFH 4H2CA 3FUDA 3TH2T 4XODA 4F15B 3SDAB 3NA4A 1IC4H 2EYTA 4OQTL 1C16B 4E0RA 3UP1A 2EIZA 1R24A 4JPIA 2NW3A 4X6CE 1FNSH 1AACA 2B1OA 3TBTB 1LE9A 3N43F 3DOSA 1CPUA 2PCPA 1AHWB 2X4OB 4OM0H 3PJSA 1RK7A 2P9RA 1A3RL 2WYZA 3NJIA 3MN8A 2XG5B 1WEJH 1GYUA 4H25A 4H7VA 4RAUA 3S37L 3HE6A 3CQQA 1I8AA 1FQ9C 2H0JA 1L7IH 4U6TA 5D2NA 4ADIA 3SKNB 3DTDA 4ZO7A 2BP8A 2VRAA 1X44A 2JKRM 5CCGE 4HF5L 1CTOA 4OZFH 3PWPB 3F04A 4ZW7A 2EKJA 4YE4H 2WBKA 5T1LA 1H5BC 1A9VA 3WLBB 2YUXA 4S1DD 4Z0BH 5IMKB 3WGUB 4F58L 4IRJC 2ENJA 4X9GA 3WOVA 3DHPA 3FONB 4GKNB 4GMSH 3EYVA 2JSFA 1P2CA 3NZ8B 1S9VA 4LASL 1OD7A 4PRIB 4QXTB 5KBLA 1PLBA 1HHIB 4N8PA 1PQZB 5B1AB 2DQUH 2DQTH 2I9TB 2FT8A 5GS2D 1T1XA 4BKTC 1T04B 1P0SE 2E59A 3RWJA 5F6HI 4N25A 1FAIH 4R96A 1PYWB 1KIUB 1P4IL 2V5YA 1TOXA 4A2DA 5J1SC 1BIIB 4WO0A 3L13A 4M7KL 1AD0A 2DKUA 4H5SA 2YPKA 4TNFA 4ORZC 4HHGA 1SEBB 5EUKA 2DWSA 3MCKB 3QIUB 4KOCA 4NAMA 1KN4H 4J5VA 3MXVL 1IAKA 1QEWA 1IM3D 2VB5A 3M6DA 2BY0A 4JRYD 4EIZC 4A63A 2DEYX 2W60B 1NGXA 4HG4J 2LLLA 3CDCA 4AH2B 1EEYA 2Z92A 1E5AA 5F1SA 1KULA 3H4HA 1MI5A 4IIQC 4ZG1A 2QPEB 3BVWA 1QHQA 1IC5L 1I1AB 3STZB 1CG9B 4R83A 5MHSD 3K5RA 4AVHA 3RNKA 4TQPA 2EDJA 5ADOL 3ULUF 1BA9A 4I5BB 3PRZA 3NIFB 3MLXL 1DUYA 1NUGA 2VLJD 3E38A 3NZUA 5JIDA 2FUTA 3FSOA 3T5WA 1CDBA 5I18L 5MHSE 2IFFH 5CGMA 2X09A 5EA0H 3BWSA 3PE9A 4HH9A 3IK2A 1M05A 1NIEA 2HFTA 3CSGA 3VJ6B 2X9WA 1IAIM 4B9FA 2FR4A 1X9LA 3BT2L 1UKTA 1K85A 3BT0A 4FQLH 4LOUD 1NDMB 1ZT7B 4XMKH 4YXHH 1QD0A 2F53E 4RVBA 1IIKA 4UQEA 4BJLA 1L7TH 5E94B 3RWHA 4ZUUB 3MA9L 1HWWA 3FXIC 3R0NA 1OTSD 1IL1A 3IMUA 4A04A 4UZGA 3WDJA 2HZHA 3GRGA 2IH8A 1CF8H 4GW1A 1RZFL 1ZVSA 2VERA 3FU0A 4IU3B 4L5FE 3GLAA 4RSVA 5GHWH 1CFVH 2G0LA 1R3KB 4M6NL 1P84K 3RJQB 1A6WH 4UT6A 5HVFB 3UABA 1W72A 3OJMB 1SLVA 3MLSL 1QFUH 1ES0B 4OFPA 4P04A 2EZ0C 3QFJE 1KLGB 3UJTH 3D4GA 2Q3AA 2R0KL 4K23L 1GC1H 1SXSA 3AY2A 2NNAB 2B0SL 3UJJH 2FEDC 1RURL 1AJ7H 1YJDL 2UUDH 4MS8D 5EC1B 4EPSA 4ZI8A 4KKLC 3K71B 3FO0H 4NZRL 3T6QC 3VW3H 1XF4A 2YPLA 4GQZA 4PJ9B 2ICWA 5KN5A 3TPUA 1ZS2A 3LMJH 4MYWB 2NY6B 5DRZB 4KC3B 2ZUQB 5T1KB 1OF2A 5ICXA 4V1DA 1JK9A 3VH8B 1SZNA 2FK9A 4P9HL 5FDWB 2J6EH 2WTRA 3CXHK 2VIRA 3VFGL 5GRWA 2VKWA 1TJGL 1ZEAL 4RDQF 2UX6A 4KAQH 2PWDA 5DC4B 3VAEA 2H7WA 3TBCA 1T7WA 4HJJL 1SBSL 2AJXL 4YGAB 1KZYA 1VHPA 2IPTH 2YD6A 3UGEA 3VFUB 3CZFA 4DGVL 3HC4L 3AC0A 5L4JA 2JVUA 4JPVH 2IAMB 4OD2B 2P24B 4HU8A 5JPMB 5FYJE 1QLFA 1RKRA 2IJ0C 3TBTA 1QLRA 5T33H 4L0ZA 4F1SA 5F9OL 1DDTA 4PP1C 1WISA 4QXGL 4ZNEA 2XG5A 3L3HA 3P9LA 4Z8FL 3L5XH 1NIDA 2O5NA 4URTB 2P49B 5GS1A 4W9LC 1IKFL 1MHPH 2E8YA 3BI9X 2AW2A 3NSYA 4Y4HC 4AQ8A 5T3XD 5IY5B 3EJCA 2MPAL 3SBWC 3BPNB 4H1LA 1MVUA 3QPQD 4JGUA 1DJIA 2A83B 4KJYA 1BHGA 1KEML 3EZ8A 3FQ2A 2MTPA 4GRLD 3BVVA 5L2KA 3KGRA 1E30A 1PEWA 2DMBA 3NSXA 4PRAA 3AITA 1JGLH 3JTTA 1DUZB 1AIFB 4CJ1A 5GJTH 1WH0A 3V0GA 1RAMA 5IOPA 5EOQL 2HVJB 1S9VB 2VABA 5J12C 1XIWD 3KCPA 4WUUE 1MCJA 2DKMA 3NABH 4LF3B 5DJAA 1D5ZB 5T5NF 5E24E 3SPGA 4G83A 3IDXL 1NTDA 3OJDB 1CXIA 4TRPL 4KTGA 2IQ9H 1NLDH 3OXSA 4BDVA 3FAXA 1FVDA 1QPPA 4AK2A 3DHUA 4XBGB 1VF5C 4KK5D 1ZCRA 3O3AA 2MJWA 3QIWB 4HHAB 1FC1A 3GIZL 1NANI 2OV0A 1JV2B 4OGYH 3NOIA 2WLIB 4GG8B 5FLUA 1FL3B 3H9ZA 4WQOA 1QEWB 1ROCA 4JVPA 2DZEA 4DP6X 1HAWA 2CNYA 4JUTA 5HI4D 1TTFA 4A2EA 3VYNA 5BZWB 3VFWA 5HGAB 2IGLA 3CMGA 2CR0A 2DQMA 2WBJC 3STZA 2QGBA 4YQXL 2EDMA 3T0VA 1HSBB 4N1CA 4CUCA 2AEQL 2Q3ZA 1AHWC 4AK1A 1QSED 1KEGL 5DUBA 1H6TA 2R2CA 3VWJB 4FDWA 4PLNC 1YPZE 4GXUN 4FABL 1AZBA 5E5MA 4X5PA 1A14L 1FGVL 1NAMB 2XZQH 4LLAA 5EULV 2OSWA 4PY7A 1FNHA 4TQHA 3K2UL 2VR8A 4CMHC 1F02I 1WK0A 1Y0LA 3I9IA 3WEOA 4BGDA 2CR3A 4P46A 1ZV5A 1E4KA 1KWKA 5IM7A 3BVXA 2HH0L 3NIDB 4P05A 3RDTB 3WL9B 4JFOB 4CW1B 5J1AA 5KVDE 4AT6B 1JTTA 1XGRA 4XTRC 1D9KD 1DBJL 3FUNA 1E27A 4L5FH 5TQ0H 4PJ7E 1J8KA 3RVTC 2PUQT 1HE7A 3F6LA 2W9EH 1KCSH 1AY1H 1D7CA 4FTVB 1W8NA 4RA3A 2ADJA 2DQGH 2VT0A 1TQUA 4NI3A 1AH1A 4H8HA 1CMOA 2AJVH 4IJTA 3F6JA 3MI6A 4PREB 4G9FD 3E2HC 4GT0A 4PJDF 2WZPA 4JZNB 2YZ8A 1QYGL 3B37A 5E2VL 5E0FA 1TQCB 3CFTA 4L3FA 4APXB 4RCAA 1MFBL 4X8XA 3V9EA 2NYZA 1UACL 3W1ZA 4KXBA 1UA6L 5KANI 1Q94B 3FTGA 5IF0B 2GJ6B 3JYCA 3B2UD 1IX2A 1MELA 5ACZA 2UZYA 4GSQA 1VGKA 3OAUH 1CZ8L 2DLIA 4A2FA 3Q48A 4DKDC 4LBAA 4MCZB 4PV8A 5JDSA 5EBGA 2CG9X 1VFBA 3LPGA 2HN7A 2JQMA 4V2BA 1KENH 1CF8L 2R9HD 3VSUA 1NOAA 4WKZA 4JFDA 4G8FA 4E68A 4A7QA 2Y6SC 1CE6B 4LEOB 5FGSA 1KCWA 1OAJA 4YR6B 2R0ZH 4PVBA 5D9SA 1CGYA 4XMWA 1P4LA 3UG4A 1DJSA 3VD7A 4I0CC 3EF4A 4F92B 4DZBB 4JRXD 1TDQA 3DOIA 4Y4KD 2OMNA 2PWHA 2IDUA 1V3LA 2NY5H 1KXTB 2FUQA 3DOHA 1OAQL 4XAKD 2OMTB 1U3YA 2HX8A 4A2MA 3D39B 4AYDC 1P7BA 5I0WA 5KG9B 2DQDH 4YHLH 3T1FB 4Z7VE 1KOAA 3N44B 4M1CC 3TZVB 4F9PA 1F18A 3DUUA 4KK8D 3WNOA 3F7QA 3K6DA 4M43L 4R90L 5DS2A 2X4UB 2WINA 4PGCB 1XGQB 4EN3D 5GS1B 4XCFH 3FUFA 4G70B 3KPLB 3QG6A 3L4TA 4RAVB 1KTLA 1CD9B 4XVOA 2JV6A 2NDGA 1RZKL 1ZEAH 2K6ZA 2RQEA 5JPNB 1R9FA 1K6QH 1KACB 3SYQA 4OFKA 3VI3E 3WNMA 4O2FA 1JZ7A 3O8XA 3AADB 1RXLA 1AG0A 2QSQA 4HD9A 4L9LB 4ZUTB 1WCQA 1NBYB 3I74A 1LWHA 1FSKB 1U8QB 3C5SB 1I75A 4GRWH 4OF7A 4XP4L 1DVYA 1T2XA 5JA9A 3GDCA 2FIKA 4P5TB 3BVTA 4QF1B 4TVSa 4DO6A 3S35X 3QCVH 4JHAH 4R7DA 3SDDC 1UWFA 1KXQA 3GXMA 4ZMYA 4KDTA 2IDCA 2OJZL 4FTVD 1GCYA 4Q6IC 4RMRA 1MFMA 3OAZH 3PV7A 3WKNA 4IKNA 1DVFD 1CLZH 3Q3GB 5I76A 3BN9D 2B4CL 3KYOB 4U1NA 1AO7D 2GY5A 2H6PB 4J6RH 4WGWB 4UM9A 1I9RH 4PJIB 12E8L 2DJ4A 2WLIA 4GG8A 2XZZA 4NQXA 1FL3A 3KS0H 2LW3A 3O6FD 2FT6A 1TQCC 3BVNB 4WF7A 1RZKC 4X6FA 7TAAA 2B16A 3HPJA 4Z0BL 1RIHL 2OTPA 3L6FA 4Y4FB 5KBPA 1QSEE 2XZAL 5A6LA 3EG9B 2X70A 1E6JL 3PDOA 2DMHA 2VLRD 4TVPD 5T3ZE 5A3IC 1NUNB 3E6FB 4WUKL 3OJ2C 4GSRA 4Q9BA 1SUJA 4KUZL 2ZWLT 3KWTA 2FECI 2VZTA 3BLBA 2ZUQC 3MNWB 3BCFA 3CE1A 4ZYKB 5D72H 1I7ZA 3BT2H 3F12A 3V0WH 4KH2A 2NX5E 4LPTA 1WGVA 4AXWA 2ZOLA 1UD4A 4NRYA 3O9WC 3W38A 4TVPE 5D5MF 2Q8AL 1S3KL 4YDLB 3WHXA 1L7TL 3VWJA 5EU6D 2QQNL 3CFKB 3PHQA 2O5XL 2GAZA 1BJMA 4NZ8A 3IS1X 4ZW3A 4O2CA 5EO0B 2AJUL 2XTJC 5K1VA 5J56B