2L7EA

The structure of a domain from yeast
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
123
structure length
123
Chain Sequence
b'MVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor TFIID subunit 14
publication title solution structure of Taf14 YEATS domain
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 8
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l7eA00
2L7EA 2NDFA 3QRLA 5IOKA 5HJBA 5IQLA 4TMPA 5D7EA 3RLSA 5HJDA 3FK3A 2NDGA
chains in the Genus database with same CATH superfamily
5A6MA 5JORB 4QYOB 3ROLB 2HVKB 4S1QL 1ZHKA 1BEYL 3BZDA 4FQ1L 3UBHA 4TLKA 4H44C 1X6LA 3FOMB 1EFQA 1YA5A 3T2NH 2PXYA 4DVBA 2V3DA 4O02B 5TF1L 2OX5A 4HIHB 3RWDB 3VRIA 3VYNA 2ZKHL 3UTZB 3WS3A 1R3JA 3CFDB 3HR5B 2EICA 1T2XA 3HUJF 1FZJB 1CE6A 2VDLL 4RFNC 5FLVA 4CJ1A 3AT9A 2OMXB 3C2AL 3MRQB 5D93B 2GJ6B 5FECB 3STLA 3EF7A 3RVTD 5EZJA 4XP5H 1ADQL 2VDKB 1WAEA 2J20A 3GIVA 4H2CA 5DHMC 3SKOB 4JZNA 2RB8A 2LU4A 3L3KB 5AAMA 3S36X 1RIHL 3T0DA 4QOKD 4NQSB 1E6OL 3O3BA 2X4UA 2ED7A 1AJ7H 4X5WA 1B4TA 4IYKA 2OA9A 4XNMB 1QNIA 1ZPUA 1F3DJ 3LMJH 3OQ3B 4P46A 3S3DB 1OD9A 3L13A 1U58A 3VXOB 1WP6A 1GY2A 3MRGB 3FT4B 5CEZH 4D7PA 4Q6IB 1F6LL 5CBAB 4S0SD 3ARFA 2OKMA 2J5WA 4J12A 2VDRB 1CLOH 4G6AC 1JGLH 2Z8SA 1AGEB 1KACB 4KUZL 1UWGL 3GXPA 1S9XB 1MW0A 3AU1B 3WKMH 4DKAA 4L3ED 5D6DC 1JF1B 5A7BA 3IGAB 2K3TA 3S4SB 3JZYA 5DJCA 4TLUA 5EIVA 3VD4A 1D5ZB 4CADA 3MRKB 4ZFOA 5EN2B 4UOW0 3IVKA 4LAQL 4LSSL 4FQCH 1A7RH 5I0ZA 3FO1A 4JRYB 1INDH 4BA0A 2YWYA 4N25A 4HETA 4FULA 5D2LE 4MZ3A 3K1DA 3QDHA 3RUGA 1VADB 3KBHE 4Y4KA 2RCSH 1L0XA 4AIZA 2ZXQA 3WD5L 2VLKD 4PYHA 2HWZH 4QRRB 3QUYB 3SE3C 4HIEA 1URLA 3V5HB 2C9RA 2NY2C 1OALA 2H6PA 5SWZB 1TVHB 3PQYE 3X1GA 3QUMB 4TPRH 1S4IA 5GS1A 1LNUA 1UJ3A 1CG9A 2FGWH 1FVDB 1RUQL 4G6ML 4JN2B 4I18C 1EEYA 3HNTH 5B7EA 1U6AH 1M1XB 2KZWA 4J39A 3GLEA 3IFOA 1CPUA 3P11H 4KZEH 4XOBA 1AVAA 1V5JA 4KROD 2X4OB 1E0OB 2OP4H 3MRIB 2YD4A 3KJ4B 2ZX6A 4XMPL 3LNGA 1E9QA 1DQDL 1Q0EA 1YSOA 2VW6A 5E9DD 3BQUD 1W0WB 3TWCH 1KGIA 4MQTB 2FB4H 2GAZB 5JNYA 5IFJB 4HKJB 1IGJB 4UAHA 3AZUA 4QRAA 4PJCB 3BCFA 3CC5A 5IUCA 1DQJA 4X6DF 3PG2A 1RPQA 4A6YB 1GYVA 5BRQA 4XPAH 3N3EA 5KW9L 3HAEB 3EDKA 3VE0B 4XPHL 3BKML 4MDIB 2MH4A 3A4AA 4FI7A 4HGMA 5LO7A 4FHJA 1R34A 1DVFB 1ASOA 5BV7L 4PJ8B 1U3JA 2J88L 4K94C 3ZHLA 3SJVD 3MCLH 4GG6F 2CDFA 3LQMA 2DM4A 3NIFE 5HHXL 4EAEA 2VQTA 1QP1A 4J4PD 1YDPB 4JAMA 1C5DA 1EVUA 1TKWB 2AK1L 2UXTA 5HPMA 4A7QA 4HOWA 2A6IB 3BW9B 1LWJA 4JQIA 2QFPA 1PX8A 1ZA6A 1Q1JL 3WFEL 4K7FB 32C2B 3QUXC 4M03A 1VGKA 1XCTA 4X6CE 2CRYA 4OM1H 4WI8A 4DQOL 4KXZI 1S7TB 4PWFA 6FABH 2FGZA 1U91A 4JVPA 3D5OF 1ZLUH 5KYNA 4PV9B 1HOCB 2CM5A 1MJJB 2DICA 3KWXA 3IWUA 4X4XB 3VFMA 2G3NA 1T3FA 1GH7A 5EU4B 1ZV5A 4Q52A 2BP5M 4LSPL 4MMXA 2VW7A 5DUML 2ZKHH 3P77A 2O6DA 4YWGL 1GW6A 5HHPB 1JNLL 4UQDA 1U4FA 1LTXA 1MAML 4A2HA 4DPBX 5IMLB 1G7HA 2VDLH 4PV8A 3EHBD 4X99A 1BD2B 3I50H 1DJYA 4CBZA 4IRSC 3GDBA 3B43A 3VI3A 3FB6B 3K6FA 3KPOB 4HCRL 4XRCA 2CO7B 2MCG1 1ADQH 2MQGA 2A99A 43C9A 4ZS6D 5HI5D 3B3IA 4WJKB 2MWCA 2NXYB 2V2WA 3N5AA 4ZI8A 3VFRB 5FYJH 3EYUH 3VSUA 1SJHB 2YQ2A 5EEVA 4KK9D 4MJ2A 4FG6D 3VA6A 3BHBB 4JFDD 3TF4A 1C8PA 1RJYA 2RJMA 1XD1A 1MCFA 2YD9A 2Q8AH 4ANKA 1M42A 4ATWA 5KJRH 2CGRL 4X8GA 5GGTA 3GBEA 2EUXA 2WSDA 5IHUL 4IMLB 3HE7B 1TVDA 4TUOB 4L37B 2Z4TA 1BLIA 4KUZH 1TG8A 1J1XH 1UWGH 1UM4L 3C6EA 5IEKA 3VXMA 5HPOA 1CIDA 3WIFA 4JZOB 3ALPA 4PMFA 1A3QA 1MF2L 4G1MA 3EG9A 3LS5L 3S98A 3X3GH 2ZP0T 4PJXA 5CGMA 1R75A 4BKSC 2H5UA 3MRNA 4LAQH 2DWSA 4KO6A 1CXFA 1MCJA 1QKZH 2FTAA 2XXCB 3N44F 5HYSB 1KYAA 1GJWA 3WD5H 5CINH 2QMJA 2V7NA 3RUGF 4H5SB 4C58B 2WLJA 3BIBX 1HSBA 1S3KH 3O8XD 3Q8EA 1ECYA 4OGXL 2MCAA 4WGKA 2A74C 2CJUL 3IM1A 2FH6A 1TJXA 1DQTA 1Y1DA 3BEVB 4P4KB 4XBGB 3BAEH 3KG5A 5DZNA 3R06B 4X2UA 4OKVB 2XTJE 5K69A 5FXCH 1XHHA 4G6MH 4PWJA 3KCPB 4R4ND 1DL7H 3LKRB 1QR4A 3F85A 1LO0L 2NY4D 2Q5BA 4R0LC 4XNXL 4OVVA 5JOPE 3EH3B 1DUYB 1JZ4A 3JUZA 1JRHI 3QJHB 2H3NB 4XMPH 1D6VL 1DQDH 1NCCH 1WYJA 4UDTB 4M1GL 5D2NE 3KPRE 2R0KL 1B0WA 4N8CL 1F8TH 1OAJA 3KYNB 1H3PH 3PAZA 5C6PB 2HT4D 1I4FB 1RIUL 4JPWH 5FUOL 2WB1A 2IQ9H 3WFBL 3NPSC 4JFUA 3FT3A 2ZYIA 1DN0B 4AKQA 1D5MA 2GYSA 3FO2B 4HFUL 1WHOA 2WXIA 5F9JA 5E2WL 5TGBB 1QMUA 1A6UH 4XPHH 2P4AB 1MFBH 3I02A 5E6UB 4JM2C 1H9DA 2BOLA 5HY9B 5FGBC 3FAXA 2F74A 2BVEA 2XI9A 2N7AA 2J88H 4BDVB 3PV6B 4XH2B 1KPUA 5E6IB 1KNOA 1YEHH 2F53B 2GCYA 2VLRB 4QTFA 4XP6L 3RIFF 4O51A 2HKHL 4YXHL 3TZVD 1NCAL 2GTWB 4LSTL 5A2JH 3VW3H 1W91A 3BSZA 4PG2C 4RFNB 2PWDA 3I6LE 1YMME 3WFEH 5DEGB 5MEPA 5DUJA 1BPVA 3ECUA 2D7TH 3UXFA 1SYVA 1FIEA 1U36A 1NBYB 3HE6C 4DQOH 3EXJA 2GY7B 3LZPA 4FQXC 1RZQA 3S5LA 2HLAB 3FH8A 4IU2B 4NP4H 1NCDL 3LZNA 4X4ZA 3SGJA 5IEHB 3IXAB 4Z9KB 5TE7L 2D3JA 3W0WE 5DK0B 4X7DC 1CIUA 3NCFB 4L5FH 4K3DL 4DP9X 4BWTA 4NO5A 3A6BL 5SV3A 1A21A 1RH8A 2BVPB 1R47A 4LSPH 4FP8L 4WNQA 5HYJB 3ETBF 3MRMB 2ZP8A 3PWVB 5KVGH 4YWGH 2FNBA 2VLMD 4QMEA 5C1MB 2NY5C 1MAMH 4XI5C 1E50A 5HDRA 5GJSL 3FUJA 1FF5A 3BKJL 2Y1AA 1PG7L 2OYMA 4W1TA 1HFUA 4AV4A 4FJYA 1HHIA 3U9UB 4X4YB 2MNJB 2YPVA 1KJ2A 5F3FA 1AGCA 2E27L 5HYFA 2RHEA 1SMOA 3I2CL 4LLUA 3KW7A 3VI3F 5KVEE 3HZMA 3X17A 1YYML 3FOLB 1UXWB 4X8CA 5GRXG 4OUUA 1GPOL 3BE1L 3FCSA 4FFVC 5EC2B 1I1RA 1KCWA 4ZTOH 4IRJD 3UBXG 1KXVC 4XPBH 3T04D 2P5WB 4KO7A 4NQEA 2CGRH 3GEFA 2EH7H 1MFEH 1CFQB 1H0DA 5FEBA 2F7OA 4OFPA 3WE6A 4RMWA 1DO6A 2NY2B 5IHUH 4U1KB 2ZE0A 4E9TA 4KBPA 1S5IH 1Z0NA 4HLJA 4P06A 4MZRA 1CGYA 3C8KA 4MD4B 2OMNA 4OZGA 1KJMA 4RGNE 4AIXA 2C9UA 1P0SE 3HG5A 1MF2H 2IF7A 2VABB 2R1YA 4WWPA 3TYGL 1MXDA 4UQ2B 1NGPH 1UYWH 3EJJX 1O9WA 1LO2L 2WHVA 1MRCL 3P9LA 1A9BB 3GMMA 1QLFB 3GJEA 4PJXF 4XCCL 4GSDH 2JELL 3T4YA 1BAFH 4PJFB 4TOYH 3UAJC 2NOYA 1CWVA 2BSBA 2EC9T 4KHXH 2X44D 1OM9A 4J1UA 4MASA 4EI0A 4AY0A 4XC3L 4JFEA 1IGTB 1K8IB 2X6BA 1TZOA 1WC7A 2ARWA 2C9SA 3T0VA 1ZVSB 4HX1B 5J9PA 3KXFD 2H45A 1JK9A 4KTYA 4F8OA 4HKXB 1MREL 3ULUD 4WFHE 3ZT5A 2AQ2A 1R5WB 4WO4D 5FKPA 3MQIA 3TCLB 2BW5A 4ZOEA 3AQXA 2RGSA 4XGZB 1BAWA 3GLZA 3AITA 1D5XB 1JL8A 1LO0H 1FRGL 3ASOB 4LEBA 3VRLF 2P8PB 1B0GB 3A5VA 2Z34A 4D3CH 2V3FA 2BS71 3U0WL 1I1FB 4IMKC 1D6VH 4Y2OB 5C0EB 1HWWA 3QUXB 3GUTA 4N6RA 1SXSA 3ARPA 3NZUA 1TU2B 4N8CH 3K71B 5F96L 3PAYA 4M7KL 1D9KD 1ZWIA 2VXUL 1L9RA 1CGWA 5DRZA 2Y6TE 2VAAB 4HFUH 2VERA 2ATKB 1R3IH 2KI6A 1FFPA 1F6AB 5TK4A 2AQ1A 3H6JA 4QTHA 4N86A 5DZAA 3DLQR 1KJ3L 4KFMA 4HZLB 1A1OB 1FNEB 1KCKA 5DCCA 5T3XD 2A77L 3S37X 1INEL 1BGXL 3OMZA 1KYDA 5KBDA 2HKHH 4L4TB 2GIYA 2WOYA 3GGWB 5I17A 4RMVA 1NCAH 5CCKH 3PWPA 1EWHA 5E5LA 1I8LA 4N90D 1I7TA 2X6UA 4IRSB 1NGZB 4XX5A 2W38A 1HZKA 5L2KD 4CKVX 3KPRD 5E94B 3PCYA 4P5TA 1RZIB 2J8UE 5DMIH 1YY9C 3L1EA 2BJML 5D7KD 1DVZA 3QA3A 4FTVA 3BO8A 3RTQD 4PR5A 5EFIA 2AQQA 3HBQA 3IPBA 1EBAA 2HXAA 3HJ0A 4OD1H 1AR1C 2CE6A 1TZIA 3TA3B 2YEVB 3OBAA 4OT1L 5DVNA 4X9FA 3RDTD 1L0YA 4OJYA 2BZDA 2YGPA 3RB5A 3VFUA 1BQLH 1W72H 1KBWA 5DO8A 3VX0A 4LLYA 1QFWH 1TXKA 2PYEE 3GSOB 3MUGA 1PNDA 5HGBA 3BX7C 4NZRL 5FK9B 4WWID 5MEOA 4U1NA 3S35X 2BVQB 4DH2A 2FEDD 4ZUSB 1U8LB 3NJGA 4D8OA 5FM5M 3GMLB 2UZXA 2BSSB 3QHZL 5GJSH 3NFSL 1CVSC 2G9KA 2VNCA 1R3HA 2N3JA 3NMEA 3CPUA 5ESAB 5AZ2L 1IAIH 4LRNH 4TLTA 1G7LB 4ZT1A 2E27H 1HDMB 4DAGL 4ZYKB 5K9KA 1C5CL 3GYRA 2FX9L 3ARDC 4N28A 3WIIL 5I1LB 5IOKA 1E67A 4I13B 5IGXL 5JHLH 3D33A 4BKTC 4JPVL 1TYJA 4YBHA 4ZW7A 3MYZA 2VRKA 4X9BA 3VWKC 5LCVA 2E8YA 1AS6A 1JGEB 3R4DA 2DM7A 2HFEA 3ARZA 4I0KA 2K7PA 1VESA 3G7TA 3TCTA 2X88A 3AS1A 1WK0A 2PLTA 2DQHH 2A74B 1INQA 4FL4B 1BM7A 3OWRA 5B3SB 4OGAC 4UU9A 2EO1A 1WJ3A 3QH3B 4JPQA 1UADC 2ZYHA 1MRFH 4BQBA 1P2CB 3HZKB 1X3DA 4OJEH 3S36H 3WEOA 1B4LA 3CDGB 2P9RA 3AXIA 1UG9A 2E9JA 5EO9B 1RZ7H 3MLWL 4JY5H 4MAUL 2D7PA 5CGTA 4HJGA 1QTSA 1A1NA 3P0YH 4R0LB 5H94B 3MRBA 4OZGF 2B1AL 2QZ5A 1T4WA 5E5MB 1IKNC 4RWYL 4OI7A 3KHOA 1M53A 3SD2A 2DMHA 2PW1B 4ZMVA 2NXZB 3KNBA 4XCCH 5C6WH 1F56A 3GO1H 2G2RB 3C9NB 2BFGA 3GDCA 2Z93B 5DC2A 5CJQL 4F8QA 1OQXA 5CCJA 3B9KB 4I77H 5IOPA 4JKMA 4MNGB 3FUIA 1OPOA 1UKSA 2VL4A 4HS8L 3NPSB 3VQ1C 5DQDL 4HXBH 3MRLA 4ZFGH 1J8HE 1I8MA 2OSXA 4DO5A 1G9HA 3MNMA 1S78C 2FE0A 4NYLA 1J5DA 1NCIA 3JYBA 1CICC 1GW0A 1TO5A 1MREH 3GHPA 3ILEA 1WBYA 3W5NA 2XKNB 3R0NA 1R24A 4B53A 3BUTA 1UVQA 2F8OA 5DZPA 1KPRA 2CHWA 2IOIA 1N5YL 2CIKB 4ODVL 4YFLF 5DJAA 1Z5LA 1WUNT 2HN7B 3PJLA 2IXQB 3ARGA 4PVNA 3QHFH 2IPTL 1KG0A 3MRJB 3TM6A 1IC4L 5KG9B 3U0WH 1F13A 2I07B 2GQHA 3TLRA 3GSRA 1RZFL 1RQ5A 2DQIL 3TO4C 1Q0YH 1NFIA 1XF3A 3IFNL 4Z7UA 2ZF9A 3HE6B 5F96H 5IBLD 4FQXB 4BZ1L 1LEIA 1NL0L 2K6WA 3DK2A 3QJRB 2GBVA 4HAFA 4M7LL 2VXUH 5CJXC 4QI3A 3RGHA 4GUPB 4Y1AD 3RU8L 2ENQA 4EIUA 4OM0H 3FW6A 2O6PA 3PYCA 4G42B 2W9EL 1MVYA 1G1OA 1M7XA 3EJZD 3MLPA 4NWUL 1J1PH 3C75A 1EHNA 1A9EA 2ZNXA 4XMLL 3F5WB 1KJ3H 4WFHD 4W4OC 1QA9A 1P7BA 1BQ5A 2XG4B 3HC3H 4MHHG 2YS4A 2WXGA 1BGXH 3I74A 12E8H 3BLKA 3ARVA 2WWOA 1G9NL 3UO1L 1X4XA 4Y19D 5JHDE 3SDXA 3RWIB 2WQUA 2XZAH 1E4KA 4YHKH 4CN6A 3ULVD 1CURA 3JVGC 4WFGD 3CFBA 4QHKI 1KIRA 4V1DB 1HTYA 3HS0A 4JQVC 4RAVA 1D2OA 4PPTA 3FUHA 1PLBA 5K1JA 4CVUA 3UYOD 5FO8A 1DSFL 3HG1D 4B60A 2XZCH 1A7OL 3OF6A 5F89B 2CBQA 3RVUD 5KVEL 1RU9H 1FVCB 1Z9PA 1N6UA 1HCYA 3DSFL 4HLZG 3ZTCC 1EVTC 1KY6A 3H8NA 3M17B 4NUJB 4WSGA 3SOBL 3GMQA 4GT0A 3X14B 3WHXA 4BQ9A 1SBSL 1DBKH 3LKNA 4GQQA 3NABH 4XX1G 4EI5D 2B9BA 5I16B 4YBLC 4I4WB 2FL5B 3ULUH 1GAFL 4GKNB 5BJTA 4NZRH 3TN0C 4U6XB 1J0HA 1AZVA 1EQWA 3DO7B 2Q7AA 1UB5A 1AGBA 2XV6B 3O0LA 4XXCA 5T1DL 2X4PA 3MOBL 3QHZH 5B1JA 2GK2A 2O1AA 4Y5XC 1PZ3A 1ED3B 1S9VB 1V27A 4UILH 4N8VB 4K8RD 4UTAL 3JUYA 5L2JB 4HJSA 4CKQA 3FQTB 3FSAA 3VXRE 4FZ8H 2C26A 3DXAD 2FIKA 1C5CH 3MU3A 4O00A 3VXQB 3WUWA 2DIEA 4K5LA 3TEUA 4AGOA 4U4BA 4KWUA 4HBQA 4WEUD 3WJLA 2LE9A 5IGXH 1PD1A 3GXTA 3IGFA 3PIQA 4JPVH 2I7SA 4GW1A 4JO4L 4UOW1 2A73A 1J0YA 4MXQC 1JG9A 3NZSA 5HJ3B 1IJNA 1PW3A 3FSWA 3MJGX 3OLDA 2IQAA 3BUBA 1HKLH 4GIAA 2ADFH 3HS8A 3UTTB 1OP4A 3LNDA 4R3SA 4C56D 1NICA 3F05A 5HI3D 3LHPL 2EDFA 5KVFE 2CSPA 4FQJH 5FM5O 4NRXB 1OLLA 1NGQH 4LCWA 1IM3D 3GINA 3MLWH 3P73A 3W5MA 2WWKO 4Z7WB 4U3XA 4KROC 3TH3T 1XEDA 4RGOL 2F58L 5A3ID 2NW2B 2B1AH 2EEFA 4RWYH 4AK2A 3TVMA 2VXTH 4UZGA 4E41E 3BQUC 5DSCA 4CRPA 4AQ8A 4PWEA 5LGYA 3RKDD 1NAKL 2AV1A 1YEEL 1IRAY 5CJQH 1TVBB 1ULVA 3V6OA 2DWEA 2EZ0D 4HHWA 2ZKYA 4ODHL 1ZGLB 4LEXH 3MCKA 5LUMA 1AD0A 4G9FD 1XGPA 3KGTA 1ZSDA 1L9SA 3KPPB 2B1HH 4FC3E 3X3FL 3QIBD 1TZ8A 2BSRB 2CJ3A 4N2IA 1VB9A 2CMRH 4J4PC 4PJBE 2Q3XA 3IBEA 3V8OA 1N5YH 4RLDA 1U8NA 2UY6B 5DJ2A 3MGOB 3B2DC 3KGUA 3DURB 5I76B 1XL6A 3EGXA 3BSGA 5EORL 3PWLA 6CGTA 4L0YA 4LLMB 1X5IA 1IC4H 4LQFL 3FTSA 2Y7MA 4WDIB 3BT2L 3AU0A 2B8OT 2X2IA 3QWOB 4R26H 3X12A 4P0DA 2DQIH 4KITB 3IFNH 3RI5F 2ATAA 3OB8A 4YGVB 2I27N 3FK3A 3QEQB 3OG4B 3HI5L 4IHOA 15C8H 2X0WA 4Z7UF 3C08H 3ESUF 2DAVA 4NN5C 1II4E 5EZOL 4LGPB 1T03L 3GMOA 3BGMB 2YQGA 4PJIB 4TQEL 4A2MA 1L6PA 4BKLB 1AR1B 1N9PA 2XKUA 1KIQB 2JKIS 3RJOA 3O41B 3UTSD 2ARJA 1E5YA 3MTXA 4G80B 1VIWA 1WZAA 1CFVL 3LH2L 3QJUB 4XCEA 2OYPA 1QBLH 2G2PA 3SHSA 3RWEA 4P8QA 4OF8A 3EHBC 3ES6A 4AV5A 4J2QA 5B8CC 1TITA 3BZ4A 1CI3M 4UT7L 3D2UB 5ANMB 4Z0XA 3D6GA 5D7HA 2PWGA 3SDXF 1BG9A 2VR3A 5KWYC 4JL2A 4JUSA 1G6RA 4W9JC 4ZS6C 4DK3A 1BVLA 5IB1A 2AF2A 5KVEH 1A7OH 2BSCA 4GKSA 3ZDXF 1T0PB 4LKXB 5K9JL 1HL5A 1KBPA 4PP2B 3P40A 3ARDB 5T5FL 3FPXA 1JGDB 3S37L 3U36B 1RZGB 3SOBH 4C4KT 4YSAA 2E7BA 1ZJBA 3VWKB 3LJ3A 1SBSH 1HH9A 3OKKA 2ORBL 3UJIH 3HG0A 1AO7B 4FQIL 4LCCC 4PREA 4D9RD 4PGEB 4YPGB 4P49A 1GAFH 5IVXB 5F9WB 5KN5B 4FKKA 2GJZB 5ICXB 5L4JA 3PJSB 5T1DH 4M7LT 3KLHD 2ZUXA 2AKRB 3VXPA 3O4LA 2X10A 1XCWA 5GGRY 3U1SL 4UTAH 5CFAA 4PUBL 1K5WA 4FNLH 5DHVH 4ONHB 4WI2A 4WUUE 5E99H 2GSGA 3MACL 2VMDA 5BS0D 2PUQT 3W38A 1F1DA 1SNRA 3M07A 3MRFB 6TAAA 4LLWB 3IKCB 1OTTD 4XC1H 3TIEB 4F8PA 5KSBB 3RWFA 5FUCE 1R5VA 2EE9A 1CB4A 2D73A 1RI8A 3HHRB 5DQ9A 1FL5B 5BZDB 3S35L 4FX5A 3F7PC 2O4EA 2HRPH 3I9AA 3O8XC 2VSKB 1JHTB 4XNZC 1CGXA 4WU5B 1G43A 1TFPA 4XP9H 2CHXA 4U6HB 1GL4B 1PZ2A 4FN0A 1X7TA 3EOAB 4EE2A 3LHPH 1K5NA 2LT9A 4LARL 3UJTL 3NEEA 5E95B 4AYEC 1CTOA 3HHSB 4R4NC 5IBTL 4KRLB 3QORA 1A4JA 5I30L 2FZ3B 3ULVH 1HJBC 1OT1A 3MJ9A 1DQMH 4QHLA 2ADJB 2X3AA 4LHUB 4RDBA 4WHYG 3QIWA 5E7BA 4OAWA 3NEXA 1BF2A 1NSNL 1XSOA 1NBCA 4DVRH 4N2KA 1SBBA 2LFEA 5J6SA 1NAKH 1UH3A 3TO4B 3UACA 3WEXB 3ME0B 1YEEH 3V9CA 2Z92B 1GMEA 3PGCA 3MV9A 3C6SA 3FYIB 4IS6A 4PJ5A 4GQPH 1ZHLA 3O3EA 1KB3A 1Z3GL 4ODHH 3VH8B 4IW4C 4O2CB 3DRQA 1J0ZA 3GHBL 2BIIA 5JO5B 3BUYB 1H3VA 3L3DB 4FFYA 3U46A 4GI6A 3EYOA 4BGLA 3MRPA 4LSQH 1A3ZA 3TX4A 4HV8A 2VDOL 3MV7E 2VM3A 2TSAA 3G6DL 4G5ZL 2YZ1A 2EJ1A 4RFOL 3D4CA 5C0JA 4DSYA 1C08A 3W2DL 4X8XA 1TLKA 5E2UL 4KPHH 2GC7C 2R7EB 3K3QA 2X70A 1E4WL 2UUDK 3SPVA 5K5YA 1EAPB 2I9LB 1EUUA 1OB1B 1E30A 5DD3H 4E41D 4NDMA 3FSOA 4M1DL 4CVWA 2VH5L 4M4RB 1KXQE 4FLQA 3KPSA 2CZNA 5LQBL 3K5SA 4DUXA 3CHOA 4QOKB 4NQDA 2LW3A 3F58L 1NKGA 1SGKA 1F2XK 2ZOLA 4Q4EA 5D1ZD 25C8L 4OB5L 5CJ8A 4BQCA 3T0WA 1S7XB 1KF9B 2D31B 4MWFB 1E4JA 3OZ9L 1T83A 2Z4QA 3MLTA 3ZDZB 3M1BB 3WY3A 3CFIC 1AS7A 2CLZA 4NLHA 3DUSA 2R4RL 4YBLB 1CFVH 3DSNA 4CDGC 2FX7L 4RAHA 1YEJL 4WV1A 3PDOA 1XGQA 1VLXA 3UGXA 1A7PH 2XT1B 1A6WH 1WISA 4O58H 4HWBA 1SVZA 1RL1A 2X1WL 5F88B 2UY7B 2CALA 3HFML 1RSFA 4N2CA 4GQRA 4NEHB 4UT7H 4ZNCD 2EE0A 4HF5L 1IC5H 1A14L 1NBZA 1I7UB 3ZDWA 4XZ4A 2EINB 1V3JA 3QDMA 4OZHE 4NQCA 1WSST 4QEGA 3BVNB 1NC4D 3BVDB 3FUKA 2FSDA 3SD5A 3FB7A 2C3GA 3OMIB 5C0BE 2AGJH 2HFGH 5AVUB 5T5FH 4PRHE 3ROLA 3WENA 2QVKA 1FFNA 4DP0X 4UMSA 4HBCH 4RIRA 4IRJC 5E00A 1R3KA 3QCUH 4OCSL 3S37H 2VLKB 5B4MD 3UOAB 3VGEA 2CXGA 2D7OA 3CPLB 3FFCA 4XO9A 3CXDL 4LBEB 1IFHL 3BH9B 2F54E 1ZLVK 3QJZA 3RWDA 2WANA 1RUPL 3BKCH 5A2LH 2EKSB 2EDBA 3QPKA 5F21B 5SX5H 2JB6B 3HR5A 1FZMB 1VPOL 2ZOWA 1PQZB 1A4KB 1RJLB 2NY6C 3QISA 2LOEA 1KYOJ 3L5JA 5EU6E 4DEUA 2E9IA 2OMXA 2GJ6A 1QSEE 5I1HH 5ABZA 3AB0C 1ZANL 3BZFB 1SQMA 4LOUD 4KROB 2IGFH 3VX1A 5I1EL 3L3KA 1OD7A 5E9DB 3BQUB 5GJTL 1BPLB 3MACH 3SE9L 4NRZA 4Y5VC 1JGIA 3IDUA 4XO3A 3ZUNC 3N0PB 3VYOA 1QRNA 3QXDB 4RFEB 2YN5A 2NLJB 4HD5A 1MWAH 3LKPB 1EPFA 1A6ZA 3T6XA 5E4EC 3VXOA 2K1MA 5ES4B 1BV8A 1MFNA 4RMSA 1BIIB 1TZHA 5CBAA 5JW5B 1UUSA 4FLHA 3JZ7A 1U30A 1NANI 3ECBB 2AEPH 4HUWA 3RNKB 3ULUC 1AGEA 2CBMA 3AG4B 2QKIC 4WO4C 2HP4A 4JANB 3SGEI 3DJSA 2AITA 4JR9H 3RE0A 3SJVB 2OSWA 3IDIA 4FLRA 4M8UA 2OZ4L 4ZMYA 3TBSB 3ZKSD 3PS6A 5JIPA 1TR7A 1AGFB 5IBTH 4YHLL 3TTSA 5I30H 1UKTA 1HHHB 3H9HA 4LGSB 2TSBA 1UFUA 3N1GC 4HUCA 4LCYB 2CUIA 4FTDA 2FJGB 3LXUX 1NSNH 4KNUA 3OJDA 4P46D 2UXGA 1C12B 5HYEA 1RCYA 4WUUD 1L6XA 3MXVH 4BE6A 4L8SA 2DB8A 3ARFD 4GP8B 4WW2A 1HIMH 5JYLA 5HJGA 3SGKC 3QUYA 2FECL 1WAPA 1Z3GH 4JGJA 3SY6A 2XG5A 5DUPL 5IM7A 3FT1A 3GHBH 5F6HJ 4JDVA 4NN5B 4OLEA 1H6EA 1CJYA 3E6FB 3FT2B 4QTIL 1ACYH 1U8QA 4CMHC 1HNGA 1MCBA 2WP3O 4Q2ZB 1JZ3A 4X4KA 1OP5H 3LZFL 5C6TH 2VDOH 1UOVA 5AW0B 4AXWB 1O5DT 2XTJC 3B5HA 3G6DH 4G5ZH 4JN2A 5ID1A 3HEIB 2ZTBA 4B7LA 2IFGA 3KLLA 9CGTA 1M1XA 2QL1A 3NACL 2UWEB 2YXMA 5E2UH 5TE6L 4G8IA 4XN2A 3EHBB 1TZGL 4Y4KD 1G0XA 1W8NA 2JI2A 4NO3B 5B8CB 1AP2B 1TEGA 1W0WA 1P4BL 5G4MA 3J2PA 4J3UA 1ODAA 2VH5H 5D2NC 5IFJA 4Q0XH 4HKJA 3ZTEA 2CNZA 1IGJA 5LQBH 4OD3H 2ZOKB 1M71A 4B0MM 3NDZE 2CO1A 1JF6A 1FGNL 3UBXA 3QAQA 4DN4L 1F4XL 4XVTH 3F58H 1ADWA 2F7QA 3HAEA 4NPYB 4JFDB 5CWSB 3F7YA 3SPCA 1KUMA 5CO1A 3RFZA 3OAYK 3N42F 4XBPA 2Q1EA 4ODXB 5H2BB 2R2BB 1A3RL 4FG0A 4Q9BA 2YK1L 1YDPA 2FX7H 3WLWD 2PCFB 2XNAB 1F11A 5GRUH 2J8HA 3BW9A 3N43F 4XMXA 3M8OL 3RWCB 3FUEA 5KBPA 4LPUA 1M05B 5E1QA 4HF5H 3KBFA 1A14H 3C60A 1UH2A 2Y9RT 1O7SA 1IKFL 1NDMB 1P5UA 1BWWA 5H4YA 4WI9A 1LMKA 2HFFA 3EJSA 4PV9A 1NOFA 3QXAA 4R7NA 4X8JB 5CF3A 4WU7B 1S7QA 4X4XA 4OCSH 1JS4A 1MIML 4CMMB 1QUPA 5EU4A 1T4KB 3CGTA 5D1XE 3L6FB 3VH8G 3GSUB 1NAMH 4NFBA 3SGDH 3O8XB 5DEFB 1CFTA 4XNZB 4LFHD 2O6FA 3P3UA 4JFWA 2QQKH 1W72B 3H9YA 5EBMA 1F4YL 5DD5H 3L4VA 4H0HB 5I1GL 5KVFH 2VXQA 5F3BB 5I9QC 5IMLA 2FR4B 2ENJA 4BK5C 4QLWA 1O7DC 3T0EE 3SDDA 4O5LH 3LCYA 3IDYC 4KI5F 2NY4B 4ZW6A 1CGSH 1MAJA 3OKLB 2CO7A 3W57A 1HK6A 4UBDD 5J1AB 3PU7A 4DO6A 4XVJL 4ZUTB 2PKDA 1C16B 1WWWX 2RQEA 4LLVB 3WI9A 4BRJA 4U2YA 4WHTB 3EXLA 2A9NH 3KYOA 3PNWB 2ZCLH 5DMYA 4H1LH 4K2UL 1WFIA 4ANUA 3Q2NA 3VDAA 1UZGA 2KBGA 1ID5I 4HS6A 2X6AA 2ZG2A 1EXUB 2WO2B 5AVZB 4NAMA 1YNLH 2WXOA 1UTDA 4IMLA 4UQEA 3ZE1B 3VNZA 1DR9A 5DZ9A 3ZKMC 1D6EA 1SXNA 5I6PA 1RZKH 3CVHL 3GSNB 3OB0K 1SRDA 4JZOA 5CLZA 3UIYA 3ZYJA 2DWDB 3MO1B 5EUOE 4N20A 5F44A 4Z5RA 1YLBB 5IFAH 1G7JB 4GI8A 4FABL 4ZOCA 3S3SA 1D3CA 3CLFL 2EDKA 2HUEA 4U1LA 5IW1B 4CA4A 3RY6C 2X09A 2VXSH 3K4DA 3SPHA 4G11A 1EO5A 3TIDB 5CIPB 2CQVA 1KIPB 1VF5C 1XV8A 2IG2H 3DPBB 1XIWD 2NQ3A 5IBLC 4CJ0A 5HYSA 4GKZA 2D4FA 4MQXD 2KZ1B 4UQCA 4ERSL 2X1XR 4H5SA 3EOTH 3UMNA 4WW2F 4RA3A 5DUPH 4J8RA 3VXMD 4ZFZA 1CD1A 4RMRA 3KLDA 4WEMB 4JFQA 3LZFH 3SODB 4G6KL 4WCYL 5FDYA 2E7CA 5HDBF 1YEGL 4PI0A 3KBPA 3D05A 2I24N 4N0UB 3OHXC 4RVBA 3GMRB 5PCYA 1ICTA 3BLPX 4XXWA 1YPZB 3WJJA 4D8PB 1M6OB 2KQMA 4KKQA 4QRSA 3ULVC 3DX9B 3QJHA 4JUTA 1TZGH 1FN4B 3VMNA 3LPFA 4UDTA 5DJ0A 1XH1A 3U4BH 1WD8A 2YD8A 4MXVF 1P4BH 3CXHJ 1X6NA 3KYNA 3PAVA 2IH3A 5C0FA 5AOJA 3RVUC 2CHZA 4A7SA 3TEXA 1FGNH 1IARB 1LO4L 3MV8E 5D7LA 5EF3A 1BF5A 4PJEE 1WA2X 4F37F 1HN1A 2YA1A 4MB4A 4DN4H 1F4XH 2EIBA 5TGBA 2YMXH 5TPWL 1BZ9B 1A4BA 3AUVA 4IRJB 3MAWA 2FJHA 2YXWA 3QJTB 1KXHA 5EOCL 5JIIA 3T0AA 4EKJA 1E8YA 4EI5C 1MQ8A 1NBQA 1P7KA 1WV7T 3HR6A 4CSSA 3EYFB 3FO9A 1OAZH 5EN3A 4U1IA 5KYUB 3PV6A 3QDJE 4NENB 4XH2A 1A3RH 4F57L 1AZNA 4P5SA 3V8CA 4WNSA 2F53A 2VLRA 1G4MA 1T7YA 2W07B 4CNIA 4KX9A 4DCQA 4G8GE 2HPTA 1JGUL 2D7MA 3Q0HA 1XR8A 4YXLL 3L4ZA 3F64A 1CFNB 2Q3AA 3D9AH 2WLMA 5KTEL 5DEGA 2WKOA 1TCMA 1WTLA 5HVHC 1OCWL 1T7VA 1X5FA 3AB0B 1NBYA 5HP5A 3L7EB 3NK3A 4IRZL 1IKFH 1NFDB 2HLAA 3PPEA 4G8FA 2XN2A 1T7XA 1TZAA 3FCUB 2IVFC 3VFWA 4JHVA 3JV6A 1MVUB 4UIMB 1UD8A 2YJLA 4Y5VB 4WFEE 3TNNA 3V0FA 1MIMH 4O4YL 3HZVB 5DVLA 3BDYL 3STZB 2BVPA 5E4EB 1P4UA 4U1JB 3DIDA 5F7DA 1NPJA 4GY4A 2IBBA 2OL3H 4G43A 3KXFB 3DK0A 3GKWL 1F4YH 3B7UX 1CTNA 4JDZB 1ZT1A 4MMZC 2YEZB 4F15C 2HG0A 1UT1A 2QKIB 4WO4B 1FO0A 2CA4A 3VB9A 1HHJB 1SLWA 1FI8C 5D6DA 5BOJA 2F5AH 7CGTA 1N0LA 4J3OD 1JNHA 5A3IC 4X4YA 3WS6A 3T1FA 4G7VH 3PUUA 3NIGE 4MDJB 3DX0A 2C3VB 2BPBA 2XICA 3BIKA 4XVJH 3RKDC 3FOLA 3SCMC 2VLLA 4ICXA 5EC2A 5J6GB 4K2UH 4HOMA 1YQ2A 1OGTA 1D9KB 4OU3A 1WF5A 1MRDH 1ETZB 4HCFA 5FYLE 3V9EA 1JGVL 5IVNA 1EAJA 5C08E 1MVFA 1I9RL 2ICWI 4U1KA 4CMHB 3S88H 4L8CB 2ALWA 1D5IH 3ARWA 2BERA 3AQZA 4M3JA 4I18A 5IHWA 3KVQA 2VN6A 1OAUL 2ZYRA 3T8VA 5EBWB 1JUFB 4GW5A 2JJVA 5KBKA 3GPSA 4J23A 1OAKH 3VM7A 5DU7A 3U25A 5BOZG 2BWDA 4QCIA 5TQ0H 4Z7NB 4QRTB 5AUMB 1L9PA 4K9EL 5L2KB 1C5BH 3KPRB 2QQLH 5D70H 4JS7A 3EGSA 4QNPF 1Q1PA 1PS3A 2Y06H 3QCTL 4ERSH 2AQNA 2XPGB 3NRQA 5DD6B 5TQ2H 8PAZA 3RTQB 2VT0A 4MJHA 1K8IA 3QDAA 5HBBA 5JIDA 4MJJA 1R17A 1ZVSA 1H6UA 4NJ9L 2XWJB 4FG2A 4GKLA 4Q7DA 1FH2A 1J87A 4AKOA 3RDTB 4ELDA 4H88L 1UT2A 2BH0A 4D9LL 4TSBL 1OZTG 4G6KH 1GSMA 3TCLA 4OJAA 4XGZA 2AP2A 3VJ6A 3K6NA 3IFPA 4KVCL 2CR6A 2JCCE 2J6EH 1ZMYA 4E2OA 1IGMH 1BAGA 2P8PA 2EECA 1I1FA 1IX2A 2YC1A 4HIXL 5ALBL 1KBVA 4Y5YC 3VAEA 3PF2A 3ELAT 3FCBA 1KJVB 2DBJA 2VC2H 3LZOA 4WUKL 1MCOL 1YEIH 1XT5A 5IW6A 5A2CA 2IMMA 5CLTA 1LO4H 4IEFA 4NQUA 3VGGA 3I6KB 2VAAA 3DI3B 4FQLL 2R4SL 4MA1B 2B4CL 2V2TB 1F6AA 4NLAA 1DZBA 3ZE0E 1E7VA 1LQSR 2WCGA 1XH3B 5GGRB 3CFEA 2QV4A 2GJRA 4PWKA 1X5HA 5GRYA 1E5ZA 1RUKL 4I85A 2CA3A 2VO8A 3DGGB 4WKZB 1J5OL 2QFRA 2YKLH 1ET7A 2FQGA 3EFFA 1YJDL 3AQDA 2IH1B 3L95B 5I9QB 2A5UA 5JW4N 3KLHC 4V33A 4YXLH 1NKOA 4FQ2H 4GXVL 3W3BA 3K6SB 1OCCB 1U8CB 5KTEH 2W80C 4IRSA 1OCWH 3IDYB 1HNFA 3LEVH 3NCWA 2WKOF 2FEEI 1UH4A 1TQSA 3HC4H 4OLZL 1X5JA 5GGTH 2Q6WB 1HI6B 1YUHB 3U6XS 4AX3A 1AQ8A 5ESQA 3NCYP 2JLLA 3MLUL 1XH0A 5JPMC 5I6MA 3AG2B 3AADB 4I2XA 5AB1A 4OCMC 3PWPD 1T0MB 3FFDB 3VXUA 1ESOA 5LNGA 3FU9A 2CKBL 3DX7B 1KCBA 5DQJA 5DHEA 1G84A 1V8HA 2G0KA 2MHAB 5I28A 4C83B 1VZHA 5GGQH 5IJCC 3GK8H 5D5MA 5C09E 1H8LA 2DH3A 4G8GD 3UC2A 4P5TD 4RSYA 1Z5YD 2G5RA 5KVDE 5ESAA 4TTDD 4IOFD 4E9VA 4FQQA 3DX8B 4ZYKA 4NIKB 3ZE2E 2QHRH 5FAAA 4X7CC 5DHVB 1TTCA 3QEHA 3IRPX 1EXHA 1A2YB 4EZJA 4I3SH 1HOEA 1XXDC 4WFED 5FW6A 1RHHB 2GKIA 3U0TA 4JRXE 1YEDA 3C5XA 5FFLA 2VW4A 1KBKA 3QDGA 4M48H 4NM4L 4Y1AB 4W93A 5AW7B 3CJJA 3GJFK 5JYMA 4HHGA 1TJGH 1MUJA 5GRWA 4LU5L 4FNTA 1I9RH 3H3PL 2DLGA 3RPKA 2AK4A 2X9WA 2CCWA 3REVB 5C92A 2DQFB 4CW1B 5G5DA 1N70A 5IMMB 2D9QB 4JKWA 2AJVL 2Z65C 3DTXB 1MCEA 3CDGA 3HNVH 4P2OD 1N3NA 3OHXB 4AQEA 5FB8B 2D0HA 5FO9A 1ZVYA 1J8KA 4Y19B 5KANI 1S9KC 3KJ6L 3FRUA 1QBML 1J11A 3V0VA 3EDJA 3KL3A 4U4IA 3TBTA 2YD5A 4RBPK 5I6XC 5EO0A 1OSZB 3QULA 1E5BA 3LSOB 2Z93A 3UDWC 3OX8B 4E0RA 1ZS8A 2Z8RA 3BOVA 2EDTA 5KSUA 3FQXA 4FA7B 3T2LA 4KY1L 2QGEA 5A6LA 1JV5B 2PETA 4XVSL 4H13C 4ZX5A 2Y7QB 3B3BA 4L1DA 5FOJA 4TVUA 4DP7X 1RLBA 3GI9H 4FYQA 5C08D 4JM2A 4KHTL 4PP1D 5KUKA 1V54B 3VG0H 5EPMB 5FGBA 4EI5B 4D9LH 2RTTA 3CZFB 3OKYA 1LO5B 4TSBH 4HQQL 4PJ7B 3FH7A 3L2MA 4PY8J 5E8EB 2VUYA 2JLPA 1OTSC 1RZKC 3HG3A 1AZRA 3D3VE 4OY9A 4L05A 4YR6A 5L6YH 1PZDA 2HN7A 2JJSC 4NUPA 4LB8A 1J9QA 2BM3A 4PG2A 2K70A 2DI8A 4J3OH 3V4VH 1PIFA 3NJVA 1BYPA 4F24A 1Q94B 1N18A 5JIMA 2QTEA 2R23A 5HVHB 2P28B 5I19L 4KZDH 3L16A 5AB0A 4DUVA 3ZTJH 3HE6A 2WAQA 2ICEC 4LPXA 4L2LA 1AG0A 4PQXA 3DXAB 1P84J 3RKPA 2JMRA 2QDVA 3PXLA 2AV7B 2VERN 4M8VA 1LQBC 4QXTB 5J1TC 2ODIA 5B4MC 2XCMC 4L3CB 3NIDF 5D7JC 5E8OA 1IIIA 4FQLH 1DJZA 4MD5B 3TT1L 5EB9A 1U9KA 3ARGD 4R9HA 5IB5B 3ZQWA 4C56B 4HAGA 1MFAL 1DJGA 1MCKA 2YOCA 1RUKH 5KJ4A 1BOYA 4MMZB 3EADA 4UT9A 2IANA 2X7LB 5DC9B 3RWIA 1BQHG 2WGNB 4LPTA 1I9EA 2XYBA 3UH8A 2X4NA 4K3EL 3B37A 3HMXL 2KPWA 1IM3B 1PMYA 4CC4C 3NCJH 5FV1L 4LOUC 1KEGL 4DPAX 4JKLA 4Q74A 4PGDB 4DF9A 4GBXA 4KMQA 3OKNA 3L5XL 2J43A 3GXIA 3K72A 2AEQH 4U1MB 2OCCB 4DP6X 4OLZH 2YPKB 4PS3A 1FVCA 4AL8L 3V6FB 4M93C 5LG6A 3BAKA 3CSYB 4KUCF 3M17A 1SHSA 4LRIC 7TAAA 3FT9A 1KXVA 2DQGL 3IDMB 4XCNB 5DDHB 5FYLL 3IDJB 4XMTA 2DWXA 2O61A 3LVEA 4YSOA 5I16A 4KMLB 4I4WA 3L4XA 5ESVB 3MRDA 4G9FB 4GQ9L 3TP4A 1HHGA 4LDLB 4HEME 2XPZA 5AW6B 2CKBH 3VTAA 3L9RB 4U6XA 1OPGL 4F3FB 3QIBB 5DYOB 2JJWA 3QVAA 4F2ME 4HXAH 2EDOA 1R9FA 1DVXA 1EK3A 6PAZA 3OF6D 4PTUB 1KLGA 5BCAA 1ED3A 2W9DL 4G70B 4LLDA 3BJ91 5D5MF 4OIIH 1V7NL 1ZVHA 3D0VB 4BE5A 2PF6A 4M5ZH 2Z91B 4RISH 4XPFL 5L2JA 3OHMB 4K7PX 3W11C 4WVRA 4Z77A 1I1CA 2OR7A 1VGEL 3ARFC 3B34A 3BH8B 2AXGB 1ANUA 1AS8A 3P4MA 4I48B 4KY2A 4XVUD 5FUCC 3UAJA 1BWMA 3MJ7B 3G5ZA 5ITBH 2AI0L 1MWAB 4Z7OE 4DGIL 3DRTB 3P4OA 1CL7I 3Q06A 4HWZB 3FTZA 4O2EB 2Y3NA 1UA6L 4D0CA 5BO0D 4KKCD 3LAFA 4Q9RL 1PFCA 5C97A 2GEQA 4DETA 3WTVA 1FNFA 4YHIB 4M7ZC 3TCXA 2KHAA 3UTSB 1JZIA 2Z1PA 2TAAA 3B9EA 3OXRB 4CSZA 4DK6A 1QFPA 3NJHA 4D94A 4WEBH 3BRGC 5EA0L 1MFDL 4ZSOE 4HIJB 2J71A 2X28A 2ZCKH 4Y4KC 3ETTA 2YA2A 3LEYL 2X40A 4P5MA 4KZCA 3I6GB 4ZMPA 3WLBB 4IMKA 3LIUA 2L04A 4Y5YB 4ZUWB 4TM9A 3WFDL 1T5WB 1TVBA 1NMCC 2VR8A 3R1GH 4JO1L 1UA7A 1VHPA 4K3HA 1MLCA 1ZGLA 1UJ3C 3VGAC 5F7UA 3LRGA 4QWWD 1CDUA 2BS8A 3C5SA 4W9IC 3ZL1A 4QIRA 1UCTA 2QPFA 4WKXA 1SDDA 5E1IA 5GRJH 1BMWA 2QGDA 3KVPA 2PO6D 5AW4B 1SDAB 4LCWD 4KHTH 4NUGL 3CK0L 2F18A 2ZX7A 5MEQB 5FUZL 5C9KA 1GKEA 4JM2F 1U8JB 1KB5L 1MNNA 2UY6A 1CDBA 4PRAA 2R56H 3BI9X 1DQKA 3RIKA 4JPSA 1NEZB 3ILPB 4MJIE 4UM9D 1IB5A 5HHQB 2ZOTA 4OLVL 3LIZL 1A7QH 3VSQA 1NEPA 4NCC2 3U7YH 3TURA 3OKOB 2H0FA 4HUKB 3SKJL 1KGCD 1KCLA 3DVGA 4YL4A 4YGVA 3IYLW 1ORSA 2EH8L 2KC0A 3VFSB 2IALA 1EUTA 5BS0B 1BG1A 1L3WA 2F19H 1W0VB 3PWUA 5IMOA 4A7GA 3HZYB 4PJIA 3CZEA 3NCCB 3HUJB 3ZL2A 1BQUA 5CSBA 5DHYA 1I31A 4BKLA 2PABA 1DO5A 4I7ZC 3RI5K 1KIQA 3TT1H 4A7TA 3S8FB 3L3OB 1S8DA 2YPLA 3EO0B 2O5ZL 3O41A 4UWQB 5FCUH 4DO4A 1E42A 2A83A 5DFTA 2V0AA 3TO2B 4JVUA 1JWSB 2XQYG 1VFBA 2FUTA 3L1OL 3U82B 4UTBA 3ZK0A 4WY7L 2KKQA 3WTYA 3ZO0A 4A68A 4UM8B 3QK0A 2V9UA 4R96A 4KKBD 3SYCA 1D5BB 5BOPA 1TCRB 3CQPA 5KVDL 5DVOA 3ZRSA 3HB3D 4UBDC 2BHZA 1RXLA 4G2AA 1ORQB 2EIZA 5LCVH 1W6WA 4BQ8A 1CI5A 3QNFA 1TO4A 1PL3A 4RH4A 1BFVL 3NFNA 4MMXC 3D48R 4TS6A 2IJ0C 2R8SL 2WQSA 4WIQA 2X6CA 3KLKA 5F2FA 3SDAC 4BFEA 1J5CA 5J11C 1E27A 1NCOA 1RLWA 3E3QE 1IC0A 5CN1A 2N01B 1NAMB 1AO7A 4AEEA 3IU4H 3NJLA 4PGEA 1FE8H 3IJHA 5DZLA 5IVXA 4HUVB 4HWNA 1OPGH 1OV8A 5DURD 5ICXA 1QZ1A 1PGRB 3I6SA 3UZVB 4XXDA 3IMBA 5IB3B 2E4FA 3GS0A 4OZIE 1NGYA 3C8HA 2I25N 1V7NH 4MSWA 5AG9A 4M6ML 2YRLA 4JY6B 4XPFH 3INOA 1ADQA 4E41B 5L4FA 2GK0B 1XIWC 1RV6X 4PWIA 5I6XB 2B39A 1B9ZA 3IKCA 3MXWL 2OCJA 4MQXC 3NESA 2NTSP 2FX8L 3V0WL 2HJFB 4X7SL 2QZQA 4H1LB 2EUWA 3LB6D 1PDKB 1WFNA 3DIFA 3K46A 3VXTA 2VN5A 4KJPD 1T1ZB 5D1ZB 1HESA 3LKOA 4FXGA 1X44A 4WWKC 3ILDA 3V4PL 3TEYA 4Q9RH 1CICA 1CXIA 1VEOA 3PPSA 4LSRL 3C6LD 4PRDB 4KTEL 5ITFB 2VDPH 4UI2A 1B2WL 4JB9L 1FHGA 2ADGA 4JDTL 1LEKB 3FSZA 4PJBB 3UGEA 2IAAC 2FZ3A 1MFDH 4MB5A 2H3XC 3L3GB 2ADJA 3S34L 4F7PA 1SJMA 4MKMA 3LEYH 5H35A 3QPQD 1E9OA 2R59A 5HVGB 4KV5F 3BPCA 4N24A 4J6IA 4JFPB 3BP5B 3TO4A 4JHAH 4XPTL 3ME0A 4JHZA 2Z92A 3OKDA 5K59F 2YAHA 2ICEB 3DUHA 1NC4B 4JO1H 2VE6A 1WFMA 4MNQA 3AXHA 4NKOB 3VH8A 4O2CA 4DZBB 5LVEA 4Q58C 2Z1KA 2LU5A 3UPRB 2AXWA 3BUYA 5A16B 3MNVB 5DGRA 4P2QA 3BYYA 1MCRA 3MLYH 1E6JL 3QORD 4NUGH 3CK0H 2DS4A 2IADB 3LQZA 3G5YA 3LRSA 1WDAA 5FUZH 1R46A 4PJGA 4BFGA 3ALXA 1TJHL 4X6DE 5BW7A 3QIWD 4W4OA 5SWQB 1KB5H 3WNOA 4ANWA 4FE9A 3GNML 4YXKH 1MLBB 3B6SA 2CUAA 4OV6F 1UWYA 1B6UA 2KT6A 1EAPA 2I9LA 2XLLA 4XZUB 4BV1A 1OB1A 2WMPB 4K23L 3JVGA 1HQ4B 4PJ5D 4HSQA 4A1RA 1N0XL 4GG6E 1RP8A 4JQVA 4EIZC 1ZHKB 2H8PB 1EEQA 2DQ6A 1JK8A 4HJJL 5A2BA 2OX5B 5KS9E 3VRIB 4M93B 1L9TA 3WS3B 1R3JB 1YHPA 3V95A 1AZCA 3KPNB 5D96C 4A7GF 2WUCL 4PJIF 2P49B 5JOFA 4N6QA 4YZFE 1NGWA 4NFCA 2ZWNA 2AZAA 4I89A 4Y9BA 1IC7L 3K81A 3L3JB 4EO5A 4UQAA 4WI7A 1XD0A 3TYFB 3TN0A 4OLXL 5EZJB 3GMPB 4YIQA 2Q8BL 2ZYSA 1FG9C 1S7VA 3GIVB 5F88A 3NZHH 2VXVL 2G60L 4K71C 3G5WA 3FTVA 3QIUC 2FLRT 2HTLD 3NZ8A 3MGTA 2EDYA 4J3OC 3SGJC 4ANXA 1O75A 4ONGL 4Y5XA 4IBZA 3O3BB 2WXNA 2Z6FA 3K2KA 4G7YL 1FBIH 4X5WB 1CE1L 3GXDA 4XMKL 1T1YB 3WNPA 4P46B 3I75B 5TF0A 1BFVH 1U58B 3BLBA 4WUUB 4BK4A 5IJDC 5LN8A 3ARFB 4E5XG 2VLKA 1ZV2A 3CPLA 3UTQA 4JO5A 5ISZA 2WTOA 4EDWL 2FWUA 1CLZH 2WQ8A 1FPTH 3H9SA 1GY1A 5CSZA 2DPKA 3BPLC 2XN9A 4L1HA 2EKSA 1BQSA 5CGYD 3O2VL 4ZTPH 4HUNB 1KULA 2OL3B 5DJCB 3SBWA 3TNMA 4CADB 1IQDA 3IVKB 4QY8A 5TTRA 1AD9A 1USQA 1A4KA 1M3JA 2Z31C 3QDMD 4L1SA 4M7ZB 5B39G 3O0RL 3RL1A 3N44B 3FO1B 4NQCD 4YHZH 4PJAA 5IVXF 3T0EC 4DGVL 1K4CA 3CE1A 4J6RL 3BZFA 2DL9A 5MERA 4DESA 2WSKA 3UPCA 4XWOC 3RUGB 4JMXA 4Y4KB 4AIZB 4F8TA 5LNDA 5ECGA 4RZCA 2DLFL 1PD0A 3FFCD 3BQUA 4HFWA 3LPGA 3VMPA 1AH1A 2BHFA 1K8DA 4HIEB 1YC7A 4UOJA 5I1AA 3K6OA 3U9PL 1KBGL 2A38A 2O5XL 3QXDA 1DFBL 1NMCB 1XXFC 2NLJA 1C7SA 4FNPA 3QFJE 5GS1B 1LNUB 1L7TL 1UJ3B 4MZ2A 3VGAB 1CG9B 3U0PB 4XN7A 4KI5D 2ZUVA 2XWEA 1LWRA 1IBZA 3RNKA 3V4PH 3IFOB 4FMKA 2IC2A 4GAJH 3FBKA 3MODH 5EU3A 2XPYA 3SJVA 3LZRA 2E7MA 4Y0GA 3TBSA 4FQPA 3VDCA 3OAZK 1E9QB 2QV2A 1B2WH 3POCA 3JXAA 3P0VH 1Z1WA 5EF0A 1GXEA 4N26A 2ZXDA 1T0NB 1H15B 1CYXA 5I2IA 5JNYB 5T8IA 2R83A 5A2KH 4EBQH 3S34H 3E38A 4NPJA 1QRND 4NI6A 1DQJB 5EDSA 1IZJA 3EOBA 5D7SH 1WFUA 3L2LA 5TFSL 2X2YA 3L17A 1HJCA 2EYSA 2WBJC 4X9IA 1JRHH 5AB9A 4PY7A 1E9PA 4HCGA 1ZDSA 2WLIA 5CCGE 1PLGH 4MVBC 2QADD 3UP1A 2CDFB 1YVLA 3FT2A 1HE7A 4NNYB 2HX7A 5EOQL 2VMFA 4JAMB 1TJIH 1MI5A 1C5DB 5I18L 4H25A 2DTML 5HPMB 2R0WH 4AXWA 3KWUA 4URKA 2BP8A 1TJHH 3CDZA 1ZA6B 3ULSB 1G6RH 1XCTB 1KTLA 3VFOB 4PJGF 2A4ZA 1IBBA 1MCNA 4QYAA 3SO5A 4GO8A 5I0DA 3FU8A 2WCPA 3QRLA 5CU5A 2Q10A 1J1OH 3DVNA 1U91B 5B8CA 4PJDE 1QSZA 4ZMQA 1GS8A 1N0XH 2NX5D 1S2EA 3E80A 4XBMA 1DFXA 4L4VE 5CP3H 1NBVL 3VFMB 3U79A 2VC2B 1JZDC 2X9XA 1TQVA 3FTXA 4LIQE 2N1TE 4JO3L 4HJJH 2JVUA 4MMXB 1JZJA 2I7OA 1IAKA 1GYWA 3P77B 4G3YL 2WYIA 2OMWB 4HIIA 3RWGA 2G2NA 5AL0A 4PSPA 1LE5B 2XA8H 3WG7B 1DBBL 2V7HA 1CZ8H 4LDOB 1CU4L 3FPYA 2IBZX 2WUCH 5J11B 1AOZA 3RIAF 4NI3A 1G7HB 3QQDB 4PV8B 4C59B 1CTMA 1IC7H 4W81A 1XF1A 3IB4A 4YDJB 4LCCA 3VI3B 1JN6B 4RX4A 4JDEA 2Q8BH 43C9B 1CDJA 1BA9A 3FO0H 3B3IB 2G60H 1KXTA 2V2WB 4AC2A 1BZQK 3REWA 4BWUA 4ONGH 5FX3A 4TTDC 1FAIH 1VFMA 4IOFC 1ZDQA 1BBDH 1NPNA 2Z7WA 1G9EA 3QE5A 3TJEL 1NDMA 2PR4L 2VTFA 1PD6A 4XMKH 3BJLA 4PLKD 4N2LA 1TTGA 2OSYA 5I15L 3BAJA 3F3HA 4E9RA 1XIWB 4YVNA 4QHMB 4LCIH 2M1KA 1C9SA 1OW0C 2XIDA 5GGVL 1ZLWK 2WQWA 3L6FA 4EDWH 2C9AA 3O8XA 5DEFA 4PG9A 3WY2A 4ELMB 1JHKH 3O45A 3VXMB 1WZMA 2MSPA 4NERA 3WIFB 4HKZA 3O2VH 1JFQH 4WWKB 4G1MB 1EGJL 3C60D 2O6EA 3NN8A 4PJXB 4HUMB 4QAWA 5SX4I 2R29L 3B8SA 1WTGT 3MRNB 4P9HL 4P2OC 4BH7A 2ITCA 4UT6L 3SKMB 3BVVA 3UMTA 4UQ9A 4Z8FH 1H8OA 4HD9A 4IIQC 1MEXL 2JTDA 2Q3ZA 4PJAF 4Y1SA 5JXAH 3T1WA 4WSKA 2ZSWA 5EEZA 1NCGA 2C34A 2KL6A 2X4TA 2DQJL 4WAFA 2QKSA 4ODSL 4LLVA 1C16A 5DZJA 2WVUA 4Z3GA 1FYTE 4WHTA 3MUHL 4BZYA 1HSBB 4FFYH 3ZU8A 4WTZG 5D2LA 2WTRA 2CGZA 1KBGH 2QGCA 1ONQA 4HPHA 5E8DL 2XWBA 1SHWA 4AYID 5ALCL 5MENE 3BKYL 1Q9WA 4ZNEE 3QWRD 1EXUA 4JQXC 2R0ZH 2R1WA 2NY7L 2ZJSL 3GIZL 5CILL 3KM1A 4XN1A 5HYIA 3SDDD 4K07A 2FCBA 3PQYA 5AVWB 4LKCB 3B9DA 2DWTA 4Y4HD 4ZTEA 1AE6H 2Q2LA 3JT2A 4K7PH 3OPZL 5DA0B 4PW3A 1YUKB 1QBBA 1G7JA 2XQ0A 3JTTB 2OQJA 5I1CL 1PLAA 2C3XA 1WEJL 1AI1H 4N9GB 5LBSL 3QUHA 5LXGH 3EYSL 3N85L 4YQXH 4XX1E 3S3CB 3FT3B 4AZ8B 5EZPA 1D5MB 1KIPA 5HJDA 4NN7C 4JKPL 4JHBA 4X5LA 1NDTA 3LDBC 4L9DA 3UERA 4AZUA 2F74B 2UVEA 4KZ0A 5GS0D 4M6NL 2NT1A 1ZT4A 1KPUB 1TQCC 3WNIA 3WEMA 1KNOB 2GCYB 3LN5B 2KDGA 1K2DA 1KC5L 3QP3A 4O51B 5I18H 3H2QA 1ZLSL 2BXZA 2DTMH 2WXLA 5D96B 4ETQB 3ARGC 2P26A 1QNZL 4A37A 4ONFL 1LD9A 3R7RA 3GMRA 4ODUA 4UUJB 4DEPC 3FSVA 2G0LA 3L81A 1PKQE 2DTSA 4W68A 4PRIE 5I5IA 4LOFA 1SHXA 3S5LB 3AQYA 2MNUA 4K71B 2NR6C 1TFHA 4HHAB 5EC1A 2W92A 1MHCB 3V4VB 1K4DA 4X6CA 2QVTA 1RAMA 5G2NA 4K7PY 3WKPA 3ESVF 4NZTL 2J1YA 5K1NA 1DCEA 3HZ3A 2F8IA 1TSHA 4JJHA 3QG6A 2YMOA 3BVWA 4JFZL 3EBAA 3N40F 4WNQB 1BQRA 5FOBA 4L1TA 1RFDL 4IQHA 1EO8L 4N0CD 2P42B 1DBBH 4GAYA 2X3BA 2WUBH 4APXA 1CU4H 2H32H 1PAMA 5KYUA 2WLKA 4NO2A 3M86A 3KEHA 4ISVA 1R33A 3OQRA 3IJ8A 4TTGA 1XBRA 5TH2A 5ICYA 1HHIB 4BCYA 1KJ2B 3ZUCA 2VWEC 1AGCB 1VERA 1UZ6E 2UX6A 4LLUB 4OLYH 2W0FA 4NKIH 2OJZH 3HZMB 5D7LD 4JY4A 2BVUA 5AZEL 4OUUB 1EFXA 3DYOA 3TV3L 3TJEH 2IAMC 5GRVK 3ZX1A 4OF7A 3I3EA 4JFVA 1MVUA 1NMAH 1H0DB 4XVUC 3RHWF 1R5IB 3HZVA 4BCXA 5I8OL 4WI3A 1M56B 3GF8A 3K8KA 1PIGA 4ZFOL 2G9HA 1P5VB 1WFTA 3FT0A 4U6VH 4KKCC 5B1JC 4AYFB 4OZGB 2DYSB 4BYHA 5BQ7A 2BY1A 4JDZA 1I85C 4UV4L 1U92A 1EHLH 4F8LA 4JFFE 2R1YB 1EGJH 2QKIA 4NKQB 4UOQA 5DK2B 3E7JA 5IK3B 1HHJA 1LXMA 5F9OL 2W59A 1W0YT 2QT6A 3DV6A 5CSGA 1FGVL 2ESVE 2IV8A 1FNLA 1HHKB 4ZRGA 1N8ZA 2QVFB 3GMMB 3RA7L 1UD5A 3S3JA 4IDLA 2F1BA 3WJLC 1DJWA 5EUOB 3T4YB 1SQ2N 1U8OB 1MEXH 1CXKA 2CM6A 3CMOL 3B9VA 4ORGB 4MDJA 2C3VA 4WTXA 2DBLL 4Z1PA 3POHA 1AKJA 1FL3A 1AHKA 3TS8A 3FF8A 2DQJH 4GXUN 1JWUA 1QVOB 1J12A 4J1UB 3COOA 1RURH 4KOBA 4XOAA 3D08A 5AEAA 2WBJB 4KNTA 1WC7B 2Y2TA 3HKZA 4NN6C 1NMBL 4MS8C 1JK9B 1X4ZA 3D4GA 3ISWA 5E7FA 4ZDHA 4G6AD 5D2LF 2Y6SC 2PO6C 1QHQA 1TQBB 2NY7H 2ZJSH 3FQUA 5CILH 2OYKA 2VM4A 3H55A 1MNUL 4KJWC 5CHNA 5A2FA 3IAPA 4L8CA 3OAYH 1WWCA 1WG3A 2HA1A 1RP9A 1BQHA 4EZLA 3O2DL 3ZE1F 1KB9J 4HC1L 3MYJB 3NGBC 4NZUH 3GHEL 3RNQA 4HOXA 3GUTB 5EBWA 4N6RB 4HSAC 1JUFA 5G4NA 3LQAL 4BFNA 3V6OC 5I1CH 3A4EA 1NKRA 5LBSH 2XETA 2BOCA 3CU7A 4AUUA 1ZWIB 4OGZA 4QLRA 5AUMA 5D2NA 1FYTD 2DQTL 1F58L 3KPRA 3ILQD 4HEPA 4JFYA 3T0XA 2L4OA 3WNJA 2JCWA 3GSWB 1ZVNA 1FFPB 4LIQL 4TQHA 5T3ZE 2VGLM 2XPGA 2F5BL 4QTHB 1WH0A 2BVOA 4M6NH 5MEND 3RDJA 5F3HA 4JQIL 5I0VA 1FVEA 2XWJA 3VD2A 3IWVA 1F45A 2HJKA 4N0RA 5DTFA 3LV3B 3PHSA 4ADGA 3EO1A 5I17B 2I9TA 2OMYA 3PWPB 5HGHA 1U93A 4ONFH 2G4GA 4AEHL 5FW7A 1I7RA 1NDGA 1ZLDA 5CFHA 3QJFA 2X1PA 2YXVA 3KGSA 2FO8A 3QUZC 1DLHA 2GUYA 3N06B 5E8NA 2Q86B 3NIFF 4G8GB 2OMBA 4OJFL 3V7AE 5ACMA 4P5TB 3ZYOA 4DKFH 4XP1H 4MCYA 3QA3B 3BO8B 5EFIB 1AHMA 4JPKH 1AACA 5FYKD 1OCOB 1TZIB 4NZTH 4X6CF 1AIFB 4TRPH 5B38G 3ORJA 1NJ9A 5J13B 3VFUB 1F4WH 2EIMB 4I8DA 2EO9A 4POZD 2SODB 4LLYB 3W0WA 1RFDH 3MUGB 2XWDA 5DS8A 5F7WC 5HGBB 4IIZA 5MEOB 4U1NB 5HXMA 3UG4A 1KOAA 5I6KA 2BNUB 2A9BA 2H3KA 5FFOA 4MXWL 4RMQA 5GGRA 5IJBC 5L88L 3IS1X 2Y3AA 1PTZA 4HCIA 1R3HB 5KBMA 3HW7A 2BWIA 5J57B 3T3PE 2WLYA 4M4PA 3FTYA 3W39A 2ZUQC 3LNFA 3QBTB 4FTVE 4BK5A 4OIFA 1OM3H 3KM2A 4OCWL 1V10A 4P2OB 3UZEA 1U8CA 1MJ7H 3SOTA 4M7JH 4IIQB 2C9QA 3TV3H 4D0BA 5LLIC 3W56A 2KS0A 1AMXA 3S48A 2HFEB 2CUMA 1CD0A 2Y1VA 4PJHE 1YAIA 3US9A 4IM8A 2YAFA 5KSVA 3MGAA 3BN9C 5L8LB 4TNEA 4JFHD 4URTB 4RDQG 3LB6C 1INQB 5GS0H 4UU9B 5FHBL 3HCVA 3LVTA 1QLEL 1T0MA 3FFDA 5C7ZA 5C08B 1MWOA 2J4WL 3N41F 2MHAA 3C6LC 4UV4H 5I6LA 1A1NB 1UQSA 4U1HA 5IHZB 2C4XA 1ZTMA 3MRBB 3ZDYB 5F9OH 2Y22A 4ILDA 4KUCD 4NT6A 3GBML 3QUKB 4QKTA 3KNBB 3RA7H 3GMNA 5BVPL 3E1F1 1NIBA 5KYYB 2ITDA 2BNQE 3QC6X 5ILTL 1L7IL 3RY6A 1QSFE 3LOWA 4P2RD 3F6IA 3IJ7A 4H8UA 4IOSA 4UTAA 5IOPB 2AXJA 2H26B 4G6FD 5F97E 3MROA 1A2YA 3VXUD 4NYLB 3L4CA 1HC1A 4M62H 1UM5L 4J2XA 1QHOA 1KCSL 1VDGA 4IDJL 1CK0H 1JYXA 3IN2A 5TD4A 1UVQB 1BFSA 1KPRB 1TQCB 1X5AA 3PFQA 3QORC 4TL4A 5FV2A 3SQOL 3V4UH 1MNUH 2VKWA 2XQYA 1U3YA 4HSCX 3REVA 1ZK9A 5DJAB 1Z5LB 4KQ3L 3ARGB 5C0RH 2CDGA 4WQOA 2L3BA 5AB2A 2EVFA 2ZKMX 5L8JB 1BVNT 1FCCA 3GSRB 2VDPB 4PFEA 4DEPB 1BJMA 1AOHA 2BSEA 2BVYA 3K2UH 3LQAH 3MJ8B 1NFIB 4QRPD 4AWJC 2JCCB 5DR5L 2W0PA 2YBRA 5INCA 1WZLA 4HT1L 3QDGD 1J8SA 1ZTXE 3LSOA 2YAPA 4MFHA 4PTTA 5AYUL 2DQTH 1F58H 1JZ6A 1ILSA 4TSAL 4CVXA 1RZ8A 4LIQH 1Z6JT 1MCIA 2AK4D 2IOMA 1A9EB 3V55A 4AQ1A 1OGPA 4WGVB 2Y7QA 2PTVA 3V0EA 3F2LA 4AM0A 5JIQA 4OSUL 3FQWB 5D8JH 4FXLA 5SWSE 2NCMA 4B9YA 3CZFA 4IKNA 2GEEA 3SDXB 4I1NB 1XTLA 4YDVB 2EDLA 3CFBB 5LAXA 3ZDXB 3HN8A 3JWDL 3RILA 4KU1A 3IK2A 5FO8B 3CN2A 2HTLC 4OJFH 2NMSA 3PWNB 3QCVL 2NTFB 4MRBA 1Q94A 3FU0A 5C0DA 3D8MA 3AT8A 2OMTA 3JV0A 4D0DA 1CO1A 2WIMA 2YMTA 3X13B 3UG3A 2IAMB 3GMQB 4JM2D 3WHXB 2J8UA 5EZIH 2AV7A 4TUKL 4QXTA 4UCFA 3M45A 4P5KA 2XBTA 1SM3H 4HJUA 1FO0H 4M6OL 2A4EA 2WO4A 4CN1A 1VRSA 3NH7H 2BXYA 1UB5B 1AGBB 4I9WD 5CGYC 2A1WL 1DN2A 1EANA 3IF1B 4OJCA 4TF4A 1B4RA 5I23A 2CH8A 2K4WA 5AOKA 1IBYA 4FADA 3AC0A 3MA9H 5IF0A 2V33A 3ML8A 2ILLA 3BAIA 3T3ME 1GGCL 4OCWH 1Q72L 2FIKB 3QNXA 3T6WA 3WUWB 5C07E 5CN2A 2HZHA 3BUPA 1NCJA 4M29A 1CDCA 4R90H 4PGDA 5DRNB 4PBXA 4BK8A 4G5AA 4GW1B 5HDOA 5C0CE 1ODUA 2A73B 1IMHC 5ANHA 1NIFA 3WFCH 4YN3A 3PGDA 5C3TA 2YPKA 3DROB 4HPOL 3ZSSA 2IQAB 3SCMA 1A64A 2GI0A 3SDCD 5EF1A 3WN6A 5EU5A 5T5FA 2UYLB 3O2WH 4HAKA 2BNRE 4R3SB 4NN6B 4NP9A 5DJ8A 3ROOB 1OE1A 4CC0A 2VQUA 3GXFA 4FKEA 5FHBH 4NNXA 2DQCL 2IAND 2OI9B 1G1KA 2PO6B 4GW4A 5I0XA 5JMOC 1OT2A 4LCWB 1BSIA 4ZO7A 3SZKC 3P73B 1UEMA 1YQVL 2J4WH 1OT4A 3BVUA 4MS6A 4GBXD 2ZUSA 3KYMA 1FNSH 3AWEA 3NGBB 1RMFL 3BCDA 2WCSA 5I73C 2FDBP 4A66A 3T5WA 1YEFH 3D0VA 2AV1B 5AZUA 5JPNC 3CFJA 2Z91A 4JLRA 5ILTH 2A6KA 3X2QB 1UFGA 2DWEB 2XY1A 1KY7A 2Q7NA 3DA0A 1SXCA 3B2VL 3B2XA 3WYRA 4UM9B 4Z0BL 2F8XC 4MCMA 4B9JA 2AXGA 1XGPB 3EKCA 4I48A 5CZKA 2HVJA 3MJ7A 5T3ZL 2VN4A 4IHBA 1UM5H 2UZIL 2Y07L 1LP9E 2DLTA 4K9JA 1MIEL 8CGTA 1MWAA 4X80H 1A7NH 1KCSH 2JTYA 3DKHA 3CIQA 3Q6GH 4HWZA 3UJJL 5F7FA 3G5XB 1J8HA 1F00I 1U8NB 4WJ5A 5DJ2B 4JGNA 1ETA1 1DQLL 2NNRA 2WLZA 3EO9L 2IBZY 4OGYL 5DFVD 3WSQL 1OKEA 1OOWA 1JBJA 2Q9OA 3NBNA 1BM3H 2NDFA 4A2EA 2NYYD 4HIJA 1P7QD 1W2KT 4G71B 4RMUA 3X12B 4IBWA 2QSCL 4UV7H 2EDRA 3FN0H 3DBSA 4ZZFA 5DR5H 1XH2A 5IUSA 2FYVA 3I6GA 3UAJD 4XN8A 3WLBA 3GBNL 1SMDA 1QSFD 4Y5YA 2WYTA 3HB3B 4HT1H 2G30A 5IW3A 4Q14A 5C2UB 2YQBA 3QR2A 1P6AB 4E5XA 3OZKA 5IJVB 1RJZA 4TSAH 2ZZUT 3OKEA 2BDNL 2AJYH 2JXMA 4H7VA 2HFTA 1K9TA 5JW4R 4QF1A 2VLJE 5IR1B 4ATTA 1MZYA 2ARJB 4XCEB 2GBUA 3MREB 5FYJU 5EU7E 2VJ0A 3GS4A 1DTUA 1DQQA 3RWEB 3UABA 1FH5H 3Q8AA 2RIKA 2GTQA 5B39A 2W5PA 5DLLA 4DW2L 3BZ4B 1OSPH 4Z0XB 2E75C 3JV4B 3N6YA 4HMCA 1C8QA 4L4JA 4P4RA 4ZO6A 2J1WA 1IM9A 5DURB 1GIGH 1G6RB 1Y0LB 3BD5A 1JCKA 4EN2A 3T6VA 1BVLB 4XAKD 5LBVA 5IB1B 5JHDA 2ZUQB 3L1FA 3ILPA 4NKDA 4QHUA 2YZ8A 1OXYA 3HI6L 4AK1A 3KZ8A 1DEEA 3DPDA 1V3KA 2B7DT 2XA3A 3IRZA 1FUNA 2F61A 4PLKC 3WFHA 3VFSA 3L5WA 1QATA 4PJ9D 1HH9B 3QO0A 3HZYA 3WTSA 1KFGA 3OKKB 4OQTL 3CUPB 4PREB 4GG8A 1E4HA 4Q9QL 2J8UF 4TNWK 5JPMA 1RIVL 3WELA 3PP3K 4AYBA 1BZ7B 4YEEA 3EO0A 5SWSD 3GJFH 4P3CL 2AJUH 4B5ZA 4NHCL 3VXPB 3UL4A 1JWSA 2EE3A 2QVMA 3NP3A 3C60C 5BMFL 4KNQA 3N55A 1OAQH 3C6LB 5D1QE 3VD0A 5EMYA 1Z5HA 4UM8A 5FLUA 1P5UC 2EIDA 3MCYA 4X4ME 3II2A 1W6LA 4Y9EA 1Q72H 2GSGB 1FFTB 4GIPD 1E8XA 1QFWI 3V6BR 4ZPTA 1EIBA 5A40E 1PCSA 1ORQA 2ADYA 4ZS7L 1R5VB 5D7IE 5DQ9B 1E2VA 3NJMA 3V5KA 1OIOA 4KK6D 3VXRA 4HPOH 4AOFA 1HU8A 4NXSA 1N64H 1VFAA 2YPLD 4ZX4A 5DT1L 3M6DA 5CD5D 1U33A 1IBGL 1ZPLA 4PRPE 4DGYL 4F27A 4BZ2H 5DJZA 4XR8C 1H3WM 5FO2A 4X5QA 2Y5QA 2V4LA 5CJ5A 1GZQA 1OSYA 1CFSA 3E0GA 1K5NB 1XO8A 4LF3B 1IEAA 5CBEA 3SBRA 5BRPA 1MOEA 5DLMH 2XWTB 3MRHA 5HHMD 1WBZA 3SDDC 4DP4X 5DA4A 1NLDH 1X5LA 2ZAGA 3QORB 1A4JB 2E59A 3UTPD 4LVNB 4Y4HC 4B5EA 3MKKA 4QHLB 2DJMA 1KGJA 3QIWB 1NFAA 1XF4B 3UZVA 4OAWB 4OD2B 3ABLB 3DJ9A 4H8WL 5IB3A 2AQSA 2HUHA 4MYWB 3QHTC 3SGEH 3L3IA 3D39E 4JY6A 3GTNA 2Q20A 2P8MA 3PGCB 1PJWA 2JJTA 4CC1A 1W9XA 3C6SB 4NWTH 4E41A 1G6VK 4PJ5B 4ZXBC 2FJSA 1ZHLB 5CCHE 2GK0A 1ZTXL 4TSCL 3DRQB 3NQIA 2VZSA 3U46B 4NS0A 3EYOB 2YSTA 5DVPA 5GS0C 2Y07H 4HV8B 2BNRD 4OGAD 1MIEH 4YHML 5L9DL 3L08A 2H41A 3UJJH 4ZODA 4I87A 3BPOC 5DD0L 5C0JB 1WLHA 1HL8A 1C08B 4G8EA 1J0IA 3RY4A 4OGYH 1AXTH 3VB8A 3WSQH 2LTQB 2PTUA 5I0WA 5MHSE 3SPVB 2X70B 1WS8A 2QGBA 1J5IA 2VRQA 4PJBA 5J56B 3ALWA 4PRNB 4NDMB 1IGIL 3RZCA 1KLFA 2JJSA 2QSCH 3U2SB 4BHUA 2BVTA 1QQDB 2BZCA 2XVGA 3GBNH 4YSTA 4JFPA 4MJIB 1QSVA 4F91B 1AC0A 1KWGA 2ZOLB 3N42B 5HYQA 2ICEA 1S78D 3B5GA 4LAJH 1JD7A 2BDNH 1CICD 2EYRA 4NKOA 2Z4QB 4DZBA 3EUDA 5DRWB 2CLZB 5ENWA 2R51A 3TPKA 3DUSB 3P2DA 4N0CC 1NA8A 1FCGA 2P43B 3DSNB 3N43B 5D7JA 4PS4H 2QR0A 2E9BA 5C0ND 3PDOB 1XGQB 3WJJC 5KZCD 2IADA 1NZRA 1GCYA 4WHYH 2C9XA 5K93A 2HYMA 1JZ7A 4JKNA 2QEJA 2W8CA 3QNZA 1GGUA 3IDGA 1HL9A 3IDXH 4FXKA 2JJUA 2WY3B 1ZHBB 2W88A 3NSFA 3QDMB 3LQAC 1TIUA 3PXJA 4PHXA 4XO4A 2B08A 4NQCB 4XZUA 1HQ4A 1LDPH 1PG7X 3FB7B 4MNQD 4CC4A 2ZPKH 4YAQB 2I5YH 5JW3L 1XZWA 1FFNB 5IT2L 2EKJA 2BP0A 4RIRB 5E00B 1R3KB 3AFLA 4NPKA 1JPFA 2J57A 2H8PA 4N5UA 2FNWA 3FFCB 2HT2C 3K8LA 4P2QD 4UDUA 4ZX6A 3WJMA 4AVIA 1QI3A 2J8OA 4OW6A 2B0SH 4KTDL 4BFOA 4UANA 1RPUA 4LRIA 5HHOE 3EJRA 5F71A 4Q9QH 1NFKA 2BC4B 1MHEB 1DDTA 35C8L 3KPNA 3ZTNL 4GRMB 2EUZA 1Z3RA 3UIZA 3BSHA 2H32B 3L3JA 4P3CH 1N2RA 1UB6A 3EH1A 3R18A 4M9PA 1AQDB 4NHCH 3R7QA 3TYFA 3FQNA 3GMPA 2BSTA 3DETC 4R6UA 1MCWM 3FMGL 3PAUA 2A4CA 2XZQL 5F0JB 4KVNH 2YN3A 1TSRA 5IY5B 5I73B 4I1RA 4NRZB 2VMEA 2F2HA 4L1BA 1N10A 3CMGA 5T1MB 1QRNB 1T1YA 4Z7VE 3AGVA 5L7XL 1NC2D 7PCYA 1KTCA 3I75A 1MCDA 1A6ZB 2V6HA 3G6JB 4WUUA 5DXWA 3KLAA 2ZXEB 3CG8A 1TZHB 5DT1H 3TONA 3L7FA 1Q9KA 3PP4H 5F1NA 4DGYH 1BMGA 4DHLA 4HUWB 5F8RC 1A6AA 3MTRA 1P4IH 3TN0D 3GZPA 1CC3A 2QADB 4KO9A 5D9SA 3IDIB 3WNNA 3DDFA 3RX8A 1TDQA 1YEKH 2HLEB 4KMTL 2HKAA 2MCPH 2OL3A 1A7BA 3WS6C 3MLSH 3H9HB 5IHBA 3UBFA 4QKXB 2ZQKA 2XVBA 1CBJA 5KOVC 3IT8D 1DSYA 3OJDB 4MAYC 3N1MC 1KWKA 4M5YH 4TNFA 2XACC 1P7HL 2BSDA 3A6CL 4ABVA 2AFNA 1F18A 4L8SB 1A1MA 4U3SB 1HINL 4WW2B 3NP4A 4MXQD 1A3LH 5ISZD 2NX5B 4TNVK 1ZTXH 2XG5B 4TSCH 3ILQC 5IM7B 3H9SD 1IGFH 4JDVB 1HWGB 2XN9D 5HDBB 1U8QB 1Z7JA 2A9DA 3NCYS 4IKJA 4J3TA 4DGWC 2NYKA 1NUFA 2GY5A 4YHMH 5L9DH 3U0PA 3H1ZA 2FJFA 5E1HB 4ZJ9A 5IVOA 3OXSA 5ID1B 4YDLB 3WL9B 4JRYE 1YYCA 3CFCL 4XNUH 4QHKJ 1YCSA 4XPGL 3S2AA 4G8IB 3MV7A 3BVTA 1V55B 1MDAA 2BY0A 2J5LB 2NNAA 4F80A 3CZJA 4JW3A 1T0NA 1DLFH 1H15A 2CDEA 3FHAA 4QRRE 4OLUH 3P4NB 1IGIH 3CN3A 4YE4L 3TPUB 4PJBF 2XQBH 4JJ5B 1M71B 1U3NA 4NCC1 3UBXB 5SWZE 2MIZA 4YC2C 4AW7A 2IWKA 2OTPA 3EH4B 1E5UI 1KXQA 4P23D 1OY3B 2GBTA 3FAWA 4UB0L 3F7YB 1GGTA 4ZMNA 2XBDA 2B2XL 3RFZB 3N91A 3TBVA 2VCOA 4XBPB 5GISL 4POZC 3WN5C 4OV5A 2NZIA 4NNYA 4KXDA 3RWHB 4UTBH 4QUOA 2FVNA 4M1CC 2V9TA 2AJXL 1OK8A 3O6ML 3WXWH 1F11B 3O3AA 3BC9A 4ESKA 1ASPA 4NZFA 4POYA 5FO7B 1Y18B 2AJSL 3IMWA 5GS3A 3ULSA 2XWXA 5E70A 4PJCE 3VFOA 4H26A 2G5BB 3C60B 3WIAA 1WZKA 1H19A 4PVMA 4P48A 2ZG3A 2EDJA 3TU6A 4GS7B 2I26N 2J6EA 5DFAA 1P5UB 2I60L 4FAAB 3HBZA 3ABMB 4HH8A 4NOFA 2HFFB 5EULV 4XAWH 3QXAB 4R7NB 4AT6B 3R8QA 5LWYL 4S1QH 1S7QB 1BEYH 5EHFA 4ZMWA 1WHPA 4FQ1H 4OZHA 1MI5D 4EZKA 1WAAE 5CR1A 4KFZC 2WQXA 3GZKA 5TF1H 3WTXA 1HAWA 5C0BA 4PYGA 1CFTB 5E2VL 1JDAA 4PRHA 2FEEL 2OMWA 1LE5A 1HEZA 1T04A 5EBMB 2VQ1A 1N8OE 3SDAA 4LP8A 1X5KA 1HKFA 2CO6A 1XSIA 3QQDA 1E3XA 2F54A 4ADJA 4YDJA 3PUCA 3APMA 3C2AH 4F5CA 4Y2LA 2PWFA 3SDDB 4IGBD 1AY1L 3OTTA 1JN6A 4ZMTA 1T20A 4Y4HB 2XTSA 1N5AA 3NFPB 5FKAA 5EIIG 3PXHA 3HC2A 4HS3A 2XZQH 4Q97A 2AJZB 1U8IB 5EU6A 1RIHH 4X7TA 1E6OH 3QXTA 1QSEA 2XC8A 3KYOB 1FQ9C 1QZNA 1G7MB 1AFVL 3RB7A 4IRZA 2M26A 4Y88A 4UNTA 4HS6B 4IBTA 1XIWA 4QHMA 4MZIA 2VB5A 4YOKA 4B27A 2C1OA 4UZSA 5I1DA 5I8EB 3GBDA 1GJUA 1BD2E 3FFOA 2WP3T 5FGSA 3WHE1 4F1SA 2R2CA 2F6AA 3VQ2C 4TVPE 4RX4D 4ELMA 2VDNL 1D6EB 2JKXA 1P9MC 1OWRM 2OXHB 4QD2E 3BPOB 4WWKA 2QVIA 2DKMA 2B3IA 4Z5RB 4PVBA 4ZW3A 4ZD3L 2Q76B 4FI8A 5T1KA 2NRDA 2YRPA 1T21A 3N1PC 4LSSH 4U1LB 4S0TD 3WY4A 3RGVA 2EIKB 4PBDA 3SKMA 3ZMEA 1CFBA 3ZPDA 4N8PA 4Z7QE 2VZ3A 3U2IA 1TEFA 3APCA