2L7EA

The structure of a domain from yeast
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
123
structure length
123
Chain Sequence
MVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription initiation factor TFIID subunit 14
publication title solution structure of Taf14 YEATS domain
rcsb
source organism Saccharomyces cerevisiae
total genus 8
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l7eA00
2L7EA 2NDGA 5HJBA 5IQLA 3RLSA 4TMPA 5D7EA 5IOKA 2NDFA 3FK3A 3QRLA 5HJDA
chains in the Genus database with same CATH superfamily
1IM9A 1XT5A 3P4NA 4AQZA 2EEAA 5F3BA 3AWFA 1ETZA 3DNKA 4BD4A 4WI5A 1PF3A 4YDIH 4MMZC 1KIRB 3HNSH 1OSEA 2DWSA 1VENA 3RX9A 4BFBD 4D8PB 5JHDA 4Q4IA 4QIRA 4JQIH 4MKMA 2C1PB 2JELL 3ZE0E 2PW2B 1BG1A 4K9EL 1DL7H 1W9XA 1INDL 3O41A 1I8LA 1YEKL 1OTTD 3JXAA 5DRNA 3C5SA 4B9YA 4I48B 3LKPA 5AW9B 4UAHA 1A7RL 1L9PA 4DPCX 3V8CA 4PP1D 2ENQA 3RUGA 1Z66A 4ZTOH 1HL5A 3DUHA 3WS6C 1TZAA 4AQ8C 1CL7H 2JCCB 4JY4A 3UZVB 4GG6E 4J1UB 4AGPA 4Y1AE 1AO7E 5DRXB 1FZJA 2J8UE 1HQRB 1MVFA 1PYWA 1KPRB 1CTNA 5E5MA 5DMKB 1BEYH 4OIAA 4QRFA 4MMXA 4XBPA 5I1EL 1AGEB 3OG4B 2IAND 4ZAKC 3HNTL 4JHUA 3VFMB 5AW5B 2VLKE 2OZ4H 5E1HB 1BMZA 1NMAL 3FCTB 1I4FB 4EE2A 1QR4A 2H3NA 1JV2A 3CE1A 2YBRB 5DFVD 2NNCA 1ODAA 5D7LB 3ARDC 3IGAA 1H19A 5IK3B 1CGWA 9CGTA 5TGBB 3INUL 3UJTL 3GHBL 2AEIT 3MBEC 5T33H 1JIBA 5JHDE 1JTPA 1NSNL 4TULL 2V2WA 3CC1A 3AB0B 3V0GA 5CIPB 4GRMB 1JHKL 2CO2A 4AGNA 2WKOA 2A77H 2PNDA 1QX1A 3BLKA 4G8GB 4EO5A 4JUTA 2BSRB 4LEXH 1R5IA 1JWSA 1QHOA 1EJOH 2FQDA 4QRTB 5I19H 2Z7UA 4N68A 3WI9A 3ZRSA 4U4BA 4BFFA 4XXWA 4CJ1A 3BKYH 5EO1A 4FLRA 1F3DH 4APQD 3GFUA 2X42A 5FW7A 4TVPH 1U0QA 1MRCH 3RUGE 3UH8A 4HOZA 4AH2A 4H0HB 3AQYA 3U7WH 2X0VA 4YVUA 1U8CB 5K9QI 1TXKA 2YOCA 4UQ3B 3VFNA 1T1XA 5I0VA 3ABLB 4O02L 5KW9L 3FO1B 1UH4A 4FFYA 4J3SA 5HHMB 2BNRD 3A4EA 5JO5A 4HK3J 1CQKA 5DHEA 1IIKA 4RGMB 4J3OH 4ZO8A 1SYVA 3W3BA 2K1MA 4MJ2A 4NQQA 3MRIA 4KQ4H 5L88L 5DVPA 5E99L 1E6OL 4Y4KA 2TRHA 1WITA 1WPCA 3I6GA 4QCIB 2EXWD 3L81A 5HDWA 1NBZB 2C1PA 3IN0A 3MRQB 1VERA 3X1EA 4BK5C 1WZLA 1IC1A 4EN2A 2OL3H 4PVMA 2FEDC 1YA5A 1UYWH 2PCXA 5FOBB 4YGAB 5DD3L 5JUEL 2DD8L 5JR1H 4R0LC 1G6RH 2OQJB 2WN3A 2W65A 3GT6A 2Y5EA 2WQUA 3A6BH 4X8CA 2Z34A 3P2DA 5LXVA 1JBJA 3PXHA 3B34A 3CX5J 1E8YA 3MTXA 4XC3L 3ZUCA 3LV3B 2OV0A 5F0PB 3AG2B 3OC5A 1RUQL 5DMIL 3DX7B 1FNLA 1X5FA 4JFZH 4DKFL 2CUMA 2JCCA 3D8MA 4PVLA 1JD7A 3UZVA 3ZXAC 3ZHDA 3OTTA 4NHCL 2CDFA 2Q7NA 1HQRA 1PLGH 3HZYB 4UT6A 3EJTA 1KPRA 3NVQA 4G3YL 1DVQA 1AGEA 1SHSA 4XPFH 5DD6B 3GJEA 5TF0A 4FEMA 2HKHL 2EECA 4WJ5A 2HJFA 3VFMA 2J4WL 3L4ZA 1DBBL 3L8QA 4X6EA 1NDTA 3FCTA 1I4FA 3CHSA 2CSPA 3BKML 1AG6A 1FO0B 1LO4H 3I6LE 4L4VA 1Q72L 3TTSA 4HX1A 1BBDL 3GTVA 4PLJC 5EWIL 3UAEA 1UM4L 4BQ8A 5IK3A 4Z7NF 3RL1B 2OJZL 3LCYA 4HPYH 2LGNA 3OKKB 4NO3A 3WY1A 3U4BL 5BUAA 2UXGA 3RDTC 5AL8A 1HXMA 2X3AA 4OLYH 5CIPA 3VYOA 4GRMA 1UTDA 4ZNCD 4Y4FB 1PAMA 3BQUD 5DEJA 1YZZA 3JTSB 3QDMD 4G8GA 3HI1B 5DVMA 4QRTA 1EVTC 3CFDB 3IMWA 1SOSA 3Q05A 2CCWA 4F58H 5EHFA 1WUNT 4FQLH 2CLRA 1TZGH 3Q2LA 4NKIL 4KK8D 3RNKB 1S7RB 3T0EB 3B9KC 1HYSD 1GZHA 2BO0A 3FU9A 2JCCE 3DIVA 1EEYB 2N7SA 3WU1A 3GZQA 2ATPB 3ULVL 4DNLA 2ZUQC 3SO3B 1PIGA 4N0RA 3LNDA 5SWZD 2G9HB 4AYID 3SE3C 3BVUA 4M9OA 3PDDA 4IMKA 4XNQB 2YPKB 4S2SB 5IG7B 4XPAH 4WUUB 1XGTA 4I0PC 3UDWA 4MMZB 1BZEA 4L4VE 5HYJA 1BIHA 1S9VB 5FYKU 3GB7A 2YEZB 4MCYA 1AY1L 2YGNA 2YKLH 3QS2A 5KN5B 2NMSA 1CPUA 2IV8A 3K1KC 4HAGA 4UQIM 3JWDL 5FOBA 5JXAL 3H55A 1R0AH 4YHML 1HL9A 4RRPA 4HBCL 4QJ3B 4G6MH 2R59A 3JTTB 2QGEA 4G8GE 2C26A 3V4PH 1FWXA 1X3DA 2EYSA 4PJGB 3QG7L 3QQ9C 1H3PH 2QHLA 2VLRD 2YLKA 1KLFB 5ID0A 2J6WA 3LV3A 4IRSC 5A7EA 4MB4A 2WV3A 2ZKXA 4LLVB 4ZPTB 2OMTB 5AOKA 3P3TA 1MHEB 4ZAKB 4G82A 1AIZA 3X3FH 5I8KL 3HZYA 4FYTA 4LNRB 2XFXB 1UGNA 4QRRB 1D7CA 3MRNA 3N3EA 4X8JB 5KS9A 4P2CG 3A4AA 3OWRA 1QSED 3JVFC 1AIFA 3QORC 4NQCD 1AI1H 3S5ZA 5HHME 3HC4L 1SY6A 4F7MB 2AQPA 1BYPA 1QYGL 1WIUA 3RKDD 3RIKA 5T5FA 3EZJB 2D31B 3O2DL 3ARDB 4NO2A 4H5SB 5DEGB 1H8OA 4S11A 3AZUA 3K2KA 5DQJB 2GSIB 3GSVB 5HYJE 1ZT1B 2DEXX 3C5ZC 3M17B 2ZNWA 4D9LH 3BH8B 4EIUA 2GBVA 3KYMA 4ZRGA 3ILQD 4YHLH 4K23L 3MV8B 4WUKL 5AZ2L 4G9FD 4Y4FA 2W60A 3A21A 2JIXD 1WZMA 2HX8A 3JTSA 4Y19D 1CMOA 1HL8A 3VXUD 4FQIL 1N8ZB 4R97C 4FQ1H 2WWNA 3V6BR 2J1ZA 2A38A 1R3HB 2VQTA 2AP2A 4W9IC 3SPHA 3NEEA 1PZ3A 1D9KD 1O5PA 1Q90A 4P2QA 5F3FA 1X4XA 1U42A 2F53A 1ZT4B 3OAYK 2YO3A 1KIQA 5A6IA 4ZD3L 1UM5H 2DOCA 3WNIA 4FNUA 3NFNA 4FHKA 4OQ1A 4TOYH 1CLYH 2VZVA 2ATPA 4G43B 3SQBB 4F2MA 5L8KB 2CBPA 2LFGA 3U1SL 2XIBA 2FL5B 2G9HA 3C2SA 3RNQB 1BZ9B 4ZS7H 3IGFA 1L7TH 5JOPD 2YQGA 2XV0A 1KDIA 2LLGA 2YPKA 5IG7A 4MS6A 5DRWB 4J3BA 4TNWF 5AEAA 1LNUB 5E5RB 1NCOA 1K8IA 1MXDA 1S9VA 2CLVA 3P77B 2BS71 2MKWA 3IKKA 5D70H 2R8SL 1X5ZA 2KH2B 5AVVB 4K3DH 4IU2A 3FQNA 4IOFD 4CMMA 1XZWA 4R0LB 1YRKA 1HNGA 2QZQA 5DT1L 4UCFA 2DQGL 1HEHC 3EJUA 5T1KD 2QLVB 4BH7B 1OK8A 3JTTA 2EKJA 4EKJA 1OF0A 4YK4C 1C5CH 4KZ0A 5FYJE 2F74B 4PJGA 4NQXB 4KTEH 3WS6A 4AQ8A 5I15H 1OTTC 3SBRA 5FWQA 1PL3A 4ISVB 5TE7H 2ZCHH 3QQDB 1HZKA 4P2QE 4PP1C 2CKNA 2XG4B 3F7YB 2OKMA 2BNUB 3ZTNL 2FO1A 2F53E 2AZAA 4WKXA 4TUUA 3LIZL 2CPUA 3RTLA 2B3RA 2EYRB 2V6HA 1MHEA 4ZAKA 4DN4H 5CEXB 2DI9A 2P3YA 1B3JA 1L9OA 5F7AA 4ZQKB 5DHVH 3TCLA 4PJEF 4X8JA 2D7QA 4F2ME 3CZLA 1TMCB 3EOAA 4MAUH 1SEQL 4UT7H 4PGCB 5L2KB 3WJLA 4JFQB 5DJYA 3DX3A 4W1TA 3TM6A 3CFUA 4OZHF 4L1DA 4BUHA 3LZOA 2I5YL 1QSZA 2IH1A 3ARDA 5DCCA 1X5IA 4H5SA 3ERXA 4UMSA 5F88A 1ED3B 3MBEA 3FTSA 3O8XA 4PS4H 5DQJA 4TLSA 1QVOB 4NZJA 2JV6A 5SX4H 3RDTB 4Z7OF 1ZT1A 3WJMB 2D8KA 3M17A 4GMTL 4ZFOL 3BH8A 1J9SA 1IGYB 3GSRB 3L4WA 2AABH 2OW6A 5AG8A 2H2PD 3GD1C 2NW3B 3U0WH 4QXTA 3OZLA 1ZLVK 2Y07H 2CG9X 2MOVA 3ARBD 2CA3A 1A65A 5HTSA 3RHWF 2XWJB 3TO4A 3UACA 4PJGE 1JXKA 1KTCA 4FLSA 1REIA 2A74C 4A7GF 2GSGB 3B9KB 4XNYL 2WXMA 1YY9D 3ULAB 4XN5A 5HP5A 3RVWD 1MHCB 3K72B 4HC1H 4Z7NB 2C9UA 4APQC 2IQAB 2GEQA 2NY0D 2P9RA 4GAAA 2GQHA 1UT9A 1CZ8L 3D87B 3HE6A 2ZUQB 4WGVB 1WV7T 4S1QL 2EC8A 4KKZA 3MACH 4G43A 5EUOA 2VUKA 1KCUH 2XTLA 1M71B 3T3MF 5EMYA 2FL5A 1AE6H 5D96C 1OAJA 3BSGA 3ZTJG 3H54A 3TV8A 3MOQA 1PPIA 1QFWM 4CKQA 3MLUL 1BZ9A 5F0MB 3O4LB 1VSCA 3CFNA 4I0PB 2C9PA 5C07D 1ETJA 5IR1B 3L9BA 3UTPD 4JUSA 4OLEA 1LNUA 1J12A 3GMOA 1T20B 1MVYA 2I9LA 3P77A 2BVTA 2AW2A 3C5JB 4JG1L 4K5MA 4FABH 4Z77A 4FNPA 4I9XA 5A2IH 1JPTL 1HHIB 1GA2A 3S97C 4JR9L 3TX4A 4HCRL 3B6SB 3BQVA 3WKNA 2EXWC 2CM6A 5DQ9A 1RZJL 2XIIA 2Z93B 2EDQA 1SM3L 4ZMOA 4JPSA 2BSBA 4H1LH 1YY8A 4TLUA 3WN6A 4IRSB 5DMYA 4NQXA 4U1SB 3K1DA 3UZQA 4AEFA 2XA8H 3CPLA 2G30A 4WIQA 4HH8A 4ISVA 3GO1L 1A6AB 4N2MA 4N6RB 4Z78A 2XG4A 3F7YA 4NBXB 3V5HB 2F1AA 2XWZA 3SE4C 3GXUB 1XAKA 1HINH 3QORB 1PZ2A 4MB1A 3P4MB 4ZQKA 3NEOA 4OIFA 1WISA 4UM9A 2W0LA 2AEWA 2O6EA 15C8H 4HWBA 2G2RB 4PGCA 1IAIL 2BCKB 3OC8A 3FQ1A 5DD0L 3LQZB 3DVIA 2DIAA 2LQRA 3ARZA 4QYOB 3KCPB 3MQIA 1PLCA 1NCGA 3C5ZB 2XV6B 4BFOA 5CP7A 1T0MB 1CGSL 1E9OA 3HC0B 8FABB 3G9VA 4Z5RA 3U82B 5EOTA 4EBQL 3GSRA 4WVRA 3BZDA 3FT3B 3CFQA 1MFEH 3VD1A 4Y88A 4PGEB 1IBYA 4ODUA 4R97B 4FJYA 4X5PA 5C08E 4JPIA 2NW3A 1Q0YH 3K0YA 4IOSD 1DVFD 3P30H 5IZ7A 4R4ND 3HAEG 2OMVB 3KBHE 5C0IB 2GJRA 2EUXA 1YQ2A 2XWJA 1XTMA 3BQUC 3Q0HA 4XPTL 2EAEA 2FZ3B 4V1DD 1IV8A 2DJMA 4OM1L 3GK8H 5CM1A 3ASNB 1ZVSA 3L3DB 3RX5A 3L4UA 4K8RH 1HILB 2DBJA 1J0JA 4OM0H 2GJZA 3IBEA 3NQKA 4MD5B 3A23A 4OD1H 1AOHA 4ORGB 4OCYH 4U1MA 1XX9C 4ZFZA 4XTRD 1EX0A 1QRNB 1TVBB 4KK8C 4N26A 3MRGA 3MLZH 5AYQA 4XCYB 3QIBD 1HYSC 2JI2A 5DFWH 3U2SA 2J55A 2IAAC 4ESKA 4LIQH 3GLEA 2Y6SD 2N1TE 5CINH 1AD0A 3O4LA 4MNQD 4YDIL 3TFBA 4I0PA 4BFNA 5IJCC 2EILB 3ISRA 4KMLB 4A38A 1XGRB 3LIUA 2PR4H 4JQIL 4P3DA 5E4EC 2F8OA 4YHYB 1NCBH 4LKCB 3VD4A 2NOYA 5MP6H 3ALWA 1G4RA 4G7YL 3OLGA 2LE9A 1QLFA 4NO5B 1DL7L 2NR6A 1BXVA 3C5JA 3H3PL 4K94C 2K4WA 4WDIB 2VQ1B 1FJ1B 3RWIB 1HHIA 1U58B 4LARH 4H8QA 2VJXA 4XP5H 4YK4B 2I07B 3B6SA 4JDTH 3CBRA 5C6TH 2V8LA 5JQHC 1CL7L 1U8KB 4XOBA 4BFJA 1DO5A 1SYSA 2HX7A 1MCOH 3O6KH 3FB7B 2Q6WA 2I9TA 1W8NA 4U1SA 4F57H 1IEHA 5EORL 4J12A 3FMGL 1V54B 1A25A 2FUTA 2A9AA 3PPEA 1A6AA 3BLPX 2BHUA 3C60A 4FX5A 4WLCA 2ZG2A 1YDPB 4FA7B 3KAAA 4HDIA 4IMLB 2IANB 4FMKA 4AT6A 2NNXA 1G1KA 2WXLA 5AVZB 4M8VA 4EN3D 4HGKC 1OWRM 2G2RA 1R75A 2AQQA 3HAEB 5J5EA 3O4LE 2DLGA 3V0DA 1RZPA 3BXNB 3SY0B 5C86A 3CH8A 4WFGD 4QYOA 3BPNC 2KUTA 3PWLA 1CK0H 1LO2L 4ZXBD 3RKDC 3HN3A 2NT0A 2H32A 1O9VA 4Y9EA 4DWHA 4LEXL 1DQJA 1EJOL 1YMHB 2VR8A 2IGFH 3MJWA 2LAGB 3ZZ1A 3QO0B 4J4PD 5I75C 3BKYL 3LQMA 3BCFA 4LEBA 4JY6A 1OAYH 4PJEB 4FI6A 4YO0B 1LQSR 2X4PB 2VUYA 1CDCA 4TVPL 1MRCL 3FQ2A 4LLDA 1QI3A 3HI5H 2A74B 1ZA3B 1JTOA 1TEFA 3U7WL 1F18A 3IF1A 4OZHB 4BFEA 2ZOTA 5C0IA 4ETQA 1SVBA 5FFOA 3CDZA 5FHAL 4APQB 1X9RA 2VDKB 2YR3A 2ZP0T 4GINA 1MAMH 5E24E 1HZHH 3NABH 3ESMA 1NC2A 1KTLB 1U8QB 2D3LA 3QJSB 1NH6A 2ZOWA 5F71A 4Z8FH 5FF6B 3QNXB 1EUTA 3OHXC 5D96B 1QRNA 2EYTB 1E7UA 4XCYA 1G43A 1QUNB 1KEMH 1KLGA 4FXGA 4MD4A 3APDA 4ZUTA 2X10A 4WWOA 4L2LA 3LXAA 4KQ4L 4G8FB 5G4MA 2BNRB 1KB5L 4BH8A 5ISZD 2OAAA 1DBJH 1AS8A 3BWZA 4PI2A 3UTTD 1MW2A 5B38G 4LKCA 4HLJA 3Q1EA 2OL3L 3D69A 3S5YA 3JV0A 4PREA 2BFVH 3GMMB 5JR1L 3R0NA 3IMUA 5EUKA 1NWOA 3A6BL 5C7ZA 1CCZA 1SLUA 3ZLQC 4Q6KA 2VQ1A 3B1TA 3T3MB 1FH5H 3MAWA 4XCFH 2I07A 3UG4A 3MRDA 2JKLA 3QEHB 4QPEA 3RWDB 2HKFH 4IOFC 4JFZL 4TKWA 2E6PA 3FB7A 2G75A 1PLGL 1O6VA 4WI0B 1EA9C 2VDPH 1U2YA 4XO9A 1IAOA 4J27A 1HHGB 3N06B 3DGGA 2GC4C 2GAZB 1IQDA 5FIEA 2FDBP 4QRUA 1OSZB 5ITFB 1GGTA 1NGZB 3EFDH 4UOQA 2X4UB 1R1CA 2OP4H 2NXZD 2APXA 1QRNE 4KKCD 1UGKA 1G1YA 1R24B 3CFJA 1LO4L 1RP9A 3WEBA 3QXAB 2BJMH 1H8SA 4MXWH 4PHXA 5A16A 5EOQH 1RZIA 3FB6A 4AZ8B 1G1CA 3CXHK 4ELMB 3WS3A 2BY3A 4HPYL 1FYHB 1H6UA 3Q6FB 4X9HA 4U1KA 3SY0A 2E7HA 2WNKA 1AD9A 1EANA 2XQBH 4HD5A 4OLYL 1MDTA 4X83A 3V0EA 3ZGIA 1I9RL 2HN7B 3H7LA 5IKCB 3DHPA 2A0LD 2VXSH 1L0YA 4DP9X 1W72B 3K4ZA 3QO0A 4A6YB 2DJ4A 3NFPB 4F58L 3GBML 3RP1A 5IMLA 1MCKA 5F2FA 4YO0A 2VGLM 4Z9KB 2VWEC 2X4PA 1TZGL 4TNVK 4TMPA 1KCWA 1FFPB 2KERA 3BQUB 1EGJH 3QDMB 5IVOA 2ARWA 2VB5A 2OJ1A 4ZUWA 4AK1A 2RGSA 4JHZA 4APQA 3HBZA 2E27L 2VMCA 3ARBC 3WN5A 2Z35A 4A04A 5B38B 4OZ4A 1KTLA 1U8QA 3GIZH 3MREA 1TTFA 4AK2A 4AYFB 2NQDA 5DF0A 1HSAB 1M42A 2FAUA 4FMFA 4XCEB 1XGYL 2FWOA 5D4IA 1YY9C 1O6SA 5FF6A 1QD0A 3RVWC 5L8JB 3LS5L 2EYTA 1CE6A 2NY0C 2ZOOA 4M5YH 2ED9A 2VDRL 4HH9A 1QUNA 4FQJL 2YKKA 4LVHC 4X7TA 5SWZB 1JNJA 3T2LA 3FU8A 4RAVB 2P26A 4AL8H 1JXGA 5E4EB 1M2VB 4DGYL 4G8FA 4WFFE 3GUTB 2JJWA 3IVKA 2YKLL 5GJTL 4D0BB 1AXIB 1MF2H 1JCKA 1TLKA 3ZW3A 3W1ZA 3DPBB 3CFMA 3ORJA 3X1GA 4G6ML 1YNKH 3T1WA 2R2HB 2B20A 2V3FA 4GAYB 3IGLA 1XGPB 4P3CH 5CF3A 1H3PL 1MUJB 1SJXA 2YUZA 1RURL 3HZKB 1U3YA 4HUUB 1S46A 1IKNC 1LILA 2F8VA 2PCFB 3GKZA 1MW3A 4JJ5B 3TF7C 1WFJA 1YMMA 2GW5A 5BXFB 4OZHE 4I0CC 3CQQA 2EH7L 1ZVYA 2VLRB 3FTUA 4UYQA 3VNYA 4KH2A 1XSKA 3PJSB 3BESR 5HJGA 2ZCLH 3OJDB 4D9QD 3BW9B 1CFNB 1BLNA 5ITFA 1Q0EA 2O5YH 3I9PA 3G5YB 1Y0LB 1AC0A 2KMWA 1KJMB 1YUHB 2A1WH 1CG9A 1R46A 4ABUA 1MI5D 3ZTCC 1OE2A 1H5BC 3MRBB 2KDGA 2W07B 4JZNB 4N86A 5TDOA 1DQQB 1QSEB 4NQCB 1E4XI 3LKNA 4W6XB 3ZPDA 2HVBA 4U1LB 4ELMA 3BPNB 5IGXH 4D9LL 4U1HA 4FHBD 1JI1A 1J9TA 3EG9B 3GM8A 4PJAA 5T3XL 2ZSVB 2VW4A 3ZKMD 2EE3A 3G5XA 4XXCC 5I75B 4NT6B 2HN7A 3OXRA 5IKCA 4MNHA 5D7KD 3MRPB 4HS6B 1HIML 4FLOA 5EF2A 3GMLB 2FLBT 1XF5A 5I8CB 2PW1B 3NFPA 3B9VA 5IMMB 2O5ZH 5E8DH 3T3ME 3ZYJA 4M5TA 3SGKC 3BP5B 2IOMA 3FONB 4G9FB 4RCAA 5B1AB 2JIXB 1FFPA 2G0KA 3ATEA 3BQUA 3B3IA 2B1HL 4Y19B 1TUPA 3QXVA 3DK2A 5JIMA 3O3UN 3VXUB 3F01A 1J8HA 2B1AH 1YMME 2VDOH 3O11B 4TOYL 1CLYL 4N8CH 2WZ5A 1DVFC 4R4NC 1F8TL 4KQ3H 2F1BA 3EH5B 4XN7A 2LV4A 3F05A 1D9KB 3OHXB 5J9PB 4ODTH 3AQZA 4ODVH 3JWOC 4NBZB 5DWUH 3SDYH 4AYFA 3NIDF 3O81A 2K7PA 2PPDA 3CVHL 3SKJH 4DZBA 1L7TL 2BOCA 4JN2B 3DTUB 5DJXB 3D4GA 2VKWA 5E6SB 1N4XH 4PS8A 3VYPA 5SWZA 4JAMA 3WBDA 1TU2A 3QIBC 3DKHA 1KEGH 1M2VA 1M56B 3EGSB 3LHPH 3QIUD 4JANB 1RJYA 1S6NA 1A3ZA 4DK5A 3T0BA 4ELME 3L5HA 4K3DL 4LGPB 1HCZA 4B96A 1UQSB 3BPLC 3L13A 3DPBA 4PJAE 4HJSA 4NQUA 5ESAB 3GS4A 5DHXB 3GLZA 4OZGF 3LJ3A 4TV3A 5DO8A 2A83B 3OKNB 4RFEB 2R2HA 2NY5C 3N1QC 4GAYA 4LPTA 2YXVA 3AM8C 3PG2A 4MQTB 1QSFD 4MAYD 3WFDH 2YXFA 3WEMA 4I3RL 2FX7H 1XD1A 4E42B 5GRUH 1K72A 5I15L 1X9QA 3F00A 4GKNA 1SXSA 5CP3H 5EU3B 4H8VA 1CB4A 1LMIA 2ZCHL 4OD3H 5E5LA 2R69A 5T1KB 5TE7L 4XZUA 4NC1C 2VUOA 4FG4A 3SYOA 4ZYKA 5BXFA 5L9DH 4J3VA 3TVMA 1O9ZA 4F93B 4DN4L 1UKTA 3CAFA 1SJHB 2WLYA 1IM3D 3AU1B 1FZOA 3PJSA 3PGFH 4MAUL 4RX4D 1D5BA 1CFNA 1NLDH 3U4EB 5BRPA 2WB1A 3G5YA 5F89B 4O51B 1W0WB 1Y0LA 1E5BA 1YUHA 2Q1EA 3LNFA 4NCC2 4PLOB 2V3EA 3EAKA 3QR0A 2QR0B 1MWOA 1S3RA 2W07A 1SXAA 1DQQA 2V3DA 4PS4L 5SWZE 1X7QB 3UJJH 3ZZSA 2OTWB 5HYSG 3QUKA 1DTUA 2AXGB 3IT8D 5GGSY 3D05A 2RA1A 4U1LA 2Q86B 4XP9L 3EG9A 1DQTA 5I0XA 4EN3C 2D4FA 1RZFL 1UXSB 2ZSVA 2E74C 3P3SA 4FLHA 5FYLH 5JTWA 1DBMH 3SKUD 3ETBJ 2IJ0C 3U0WL 4KI5E 2WWOA 2Y07L 3LKRB 3P2BA 4XBGB 2VDLB 5I8CA 1B4TA 1ZTXH 4U3SB 4ZXBC 1RIHH 1AFVH 2VM9A 2J2ZB 4N9GB 2PW1A 3ULVD 4G83A 5DSCB 4PWFA 5IMMA 3B3BA 4J4PC 1PY0A 1QEWA 3BP5A 4Y9GA 1MCJA 4HC1L 2MTAA 1E9PB 1A3LL 1KTKE 3ARBB 3S0PA 3UBHA 3VXUA 2ADJA 3T2QA 3O11A 4WW2F 4P07A 3NIFB 3UAJA 3MACL 5CR1A 1IBFA 1KCUL 4UTCA 4J3TA 1M6UA 1VF5C 3QWOB 5DTFB 3ROLA 5KVDE 2NY0B 4UQ2B 5I8EA 1F1GA 5EC1B 5FM5O 4LVHB 1JNLL 2MJWA 4JN2A 2VRKA 4GJTB 3QXWA 1NC4D 4IIQC 2X6CA 1GS8A 3K81A 1WUZA 3S98A 2L7QA 2XNAB 2CXKA 3GI8H 4TXVB 2A73B 2WBJA 2CA4A 5TDNB 4NQCE 4GXVH 2UVFA 3Q01A 4DHLA 4FABL 5DS8B 1E3XA 1FFOA 1MLBA 1LO3H 5C07B 2WMPB 3DOIA 5JW4M 3X1NA 4WW2C 5ESAA 4JBSA 1ES0A 4Y8AA 2E5EA 3U7AA 1TYJA 4BJLA 1S3KH 2WVTA 2YARA 4WEMB 5EU5B 3ME0B 1OLLA 3Q1SH 4WWKD 1CFTB 1Y07A 5C09D 3OR7B 5C08A 2Q7YB 5I5MA 4AIXA 4LEOB 4F91B 1N0XH 32C2A 4E42A 2C1OB 1V8HA 2GHZA 2X9ZA 4XNAA 2Y4SA 1E2WA 4NQVA 3L08A 4PJFA 2Z0UA 3VXRA 3BUDA 1EMTH 4XN8A 4W9CC 5HYSB 4Y19E 3VXUE 1G7LA 5CD3A 2IH3B 5D6CB 3QNYA 4Y1SA 4YZFF 2O5NA 4PAZA 3OWEA 3JUZA 4HALA 3S2AA 5IJKC 4Y8DC 5KYWB 4FULA 3ALXA 1UB5A 2FSEA 3BEWB 5LBSH 1H5BB 4H0GA 2GK0A 3LXUX 1W0WA 2VN4A 3K2IA 1LK2B 4GKOA 3NN8A 2ALWA 1XSOA 2QR0A 3IFOA 3Q5TA 2NXZC 1EDQA 2K3HA 4KKCC 3UABA 4POYA 4E9YA 3EJQA 4QKXB 5HJ3A 3I9AA 3ZMEA 2Q86A 2X88A 4LP4A 2UXTA 1HAWA 2XPGB 1UXSA 4OJYA 3TV3H 1RIVL 3ZTEA 4LB8A 2CXGA 5HJDA 5LCVH 3P30L 4OF0A 4JQXC 3A3YB 1BJ1H 4N9GA 2A4EA 2J2ZA 3L4YA 1B88A 2IDQA 3NIGB 5F8RC 2A0LC 3QW9A 2XXMB 3FN0H 3V4VL 3QUMA 3T4AC 1P7QD 4K8RL 3MXWH 1DVFB 4PJFE 4OD1L 2UX6A 3ARBA 4OCYL 3VXRE 2X41A 3MLZL 4V1DB 5E8OB 1GZQA 4NAMA 3WDIA 4PCSA 1GZPB 4LIQL 1YEHL 5DTFA 3MRKA 1UWXH 4N85A 3WIHH 4UQ2A 1JUFA 1HT6A 1FNAA 4NUJB 4WRLA 3TA4D 1UOVA 2MQ0A 2EXTA 2PR4L 1P7HL 2ENJA 3QIBB 4F9PC 1NCBL 4LCWD 2VL5A 3WTVA 4OSUL 1ID2A 4OF8A 5MP6L 4UWQB 3AABA 3FT9A 1HOCB 4YXKH 3NBNA 2XNAA 1BX2B 2FX9H 3BPLB 5IY5B 2A73A 2B4CL 1JK9A 3OKMA 3QDJA 5TDNA 4MNQB 3N50A 2CQVA 3QUXD 1K4CB 5INCB 3W11C 2WMPA 4LARL 4UTAL 2F68X 2ED7A 1HDMB 3VYNA 1EO5A 3NIDB 1Q4NX 2MCPH 5C6TL 1SMAA 1E4HA 2C4FT 3JVGA 5EU5A 2R4RH 4DQAA 3G6DH 3ME0A 4LU5H 2I60H 3O6KL 3VXPA 1MFCH 2X6AA 3OR7A 2Q7YA 4KPHH 3FHEA 4BSJA 3H8NA 4F57L 1EHKB 4RRPM 5IBTH 4G2AA 1E8ZA 2W9DL 5D1QD 2C1OA 1MRFH 5C0GB 3VFSA 4JM4H 2FIKB 2OJEB 3C2AL 3Q3GB 2A6IA 3SDXB 5D4JA 1FUNA 4GRWE 2FH8A 1SBSH 1N0LA 1FL5A 5HI3D 3NCXA 4WTZG 1WC7B 3PAZA 3NIFE 4OZGB 3SCMA 1BDYA 5IVNA 2YEQA 4FKHA 1D6EA 1EK3A 1KCBA 2ZPKH 3ARSA 3FT0A 3RDJA 5CN1A 3FOMB 3OKEB 4NWTH 3HPLA 1H5BA 2BZ7A 1LK2A 3CN0A 3L17A 1LO0L 4LOUD 4I3GA 5KSBA 1TCRA 2IPKA 5GHWH 3RX8A 4EN3B 3UBXG 1PNCA 3QDJE 4XXCA 3ESUF 1OAYL 3MCKB 2IVFC 3O9WD 3S3BB 5B3JE 5LDSA 1U8JB 3LN9A 3SJVA 3L1OH 2J1KA 4GEJA 1X4YA 5A2LH 1BLIA 4ZXBB 3C08H 4QAMB 4AQ1A 5J6GB 1GJUA 1X44A 3HI5L 2DDQH 3G5WA 2LOEA 1QW9A 2O5XH 1E4JA 2YD0A 3SGKA 2Y25A 3VACA 5CSGA 3GSOB 3RGVD 1TETH 1MAML 5AB9A 1HZHL 3NABL 1BJ1J 3TH2T 2D03H 4XMXA 3S3PA 1BM3L 2FGZA 2QKIA 3LN5B 1P2CA 4XE5B 3X12B 3MMEB 1HKLH 3L3HB 3OF6D 2QTVA 3OQ3B 4I9WD 2O93L 4Z8FL 1J0ZA 1DEEA 2H3XC 5F3HB 1BXUA 1RULH 1TO4A 5EN3A 1ZLWK 4GT7A 4NFDA 3TN0A 4R96B 3HRZC 4QHKI 4YE4H 3WE6A 1KJVA 2F18A 1V27A 1JWUB 2Z91A 2BVQA 4IIQB 3VXQB 1G9NC 1DBJL 4RMQA 3VRIB 1SJVA 5H94A 2NYZA 2VR6A 2FJHB 2F5AH 3HB3D 4B6ZA 5KSBE 1EHNA 5GRZA 4A2DA 1JF6A 4X4YA 1WSST 1NBVH 2B59B 2ZKMX 4WW2B 2QSQA 3L4XA 4KV5F 4MNQA 5ISZB 1AR1C 3NCJL 1MOEA 4F27A 2IWGA 1KCVH 1U8HB 3WENA 3KVDD 1UD2A 5I1LA 3UTTB 1NEZG 3QIUC 4XCFL 2FO4B 3SJVE 3MV9A 3C8KA 3OR6A 4NIKB 1DHKA 2HKFL 3ESOA 1AQKL 3RJDA 2WC7A 4AQEB 2R2CA 4AVIA 4JPVL 2QHRH 1CFSB 1HXYB 1PZ5B 3QT2A 5ICXA 2GB2A 3LZPA 3NIGE 4N1CA 5E00A 1BECA 5C0GA 1F6FB 1P6FA 5IHBA 4MAYC 4PVNA 3Q3GA 3DROB 3SDXA 3QJUB 2YJQA 2PKDA 5M95B 1TSRA 2XIDA 2NY6D 3UBXB 1WEJH 4JFFD 2R0WH 2OP4L 5C9JB 1FE8H 4QRPD 1A4KA 2K4AA 4ZQTA 3WDJA 5C71A 4R7VA 1DDTA 4MXWL 2BJML 2Z1KA 1YQVH 4HLEA 3H2WA 3KMDA 3ZKXC 1AG0A 1E9QA 2DQHH 1CD1B 2EIJB 4F8LA 1BVNT 1BV8A 3IXAA 2XQBL 2NXZB 2VXQA 5IJDC 3ULVF 4W4NA 4WI7A 1XVSA 1RJZB 3CZGA 3CXFA 4N3UA 4EUPH 5DS2A 4LSVH 1DN0B 4POUB 1O0VA 1EHLH 3QPKA 1KGYE 2B3IA 2VXSL 2OMXA 1E28B 3TZVD 4WU5B 4MNQE 1UWFA 3K7UA 4YSRA 1R5WB 1U8JA 1G5GA 4M7KH 1VFBA 4X9GA 2OSLB 3MV9E 1EGJL 2CLZA 3NIDE 4GKZA 1I7UA 1FQ9C 3SDAA 5F93C 3SY6A 1WTGT 4FQHA 2E9WA 1U4EA 1EEZB 3T4AB 5IFHH 5I1CH 1YNTB 3FDWA 2OR9H 2WLMA 3GSOA 4OT1H 1RJCA 1WGOA 3MUZ1 5ID1A 3GIZL 1JGDB 3FU5A 3RY6C 3ULVC 2VT0A 5DZLA 3ZRFC 2CKBA 4MJIA 4KBPA 4V2BA 1RFDH 2VMEA 1M1XB 4X6CB 3SDXE 3GSQB 1J9QA 2VMDA 4M5YL 1V55B 4UUJA 4U3HA 1NEZB 1WD8A 1ILSA 3RIFK 1JWUA 4AL8L 4L29A 5KANG 3T8MA 5F97E 1I7ZB 2GSMB 3VXQA 3EW3B 1MF2L 5KVEH 4M56A 4NSKB 4PUBH 3MV7A 5LUMA 5FS5A 3VRIA 5IREA 1MCCA 1JGEB 4L8CA 3OXSA 2LU3A 2X4RB 4LLQB 1DVYA 1TJXA 1YNKL 1TJHL 5ERWA 4NM8H 4PY7A 4AENA 2UZXA 4G7RB 1ZSDB 5ANMB 5ISZA 4P3CL 2DM7A 5F1OB 2XKNB 4M5SA 1JSYA 1Q9KA 3BVNA 4UIKH 1U8IA 1P6WA 3MUGA 2NW2B 4IYKA 4WFGE 1YEWA 1JRHH 2B9BA 2FJFA 5CLZA 4YGVA 4QWWD 1CDJA 3FJTA 4KKRA 5I74C 3FC8A 4XP6H 2BW4A 3IRPX 2F0CA 2HWZH 3D25A 4PRHD 4G7VH 4NO0D 1CFSA 3AACA 3GJFA 2EIKB 4IHOA 3X3GH 2ZUYA 3BPOC 2PYEA 1MCSA 3QNZA 4WWKC 3JWNH 1AMYA 1N64H 4GRLD 3ARQA 2ZCLL 2EACA 4I1NB 2BOBA 5CEZH 3DROA 1FC2D 2RH0A 1WFUA 5ICZA 1WIOA 2AI0L 4MJIE 1N6VA 3KVPA 1WHOA 2O5YL 3UBXA 1ADQL 4HKJA 1JZGA 2YBGA 3K2UH 4LGSB 5GGVY 3W38A 5IJKA 5E4AA 2IG2H 3GS7A 4XVTH 2FT8A 5F96L 3LEXB 1A0QH 4XH2A 1QZNA 1UG9A 3HOGA 3NCYS 4L2YA 1Z0NA 3SGDH 4UT9A 1EJ6A 5IGXL 2BRRH 4N8UA 4KHTL 1QW8A 2ICWB 2AJZA 4OTXH 5FO7A 3V9EA 3K6NA 3MV7E 3NCEB 4PB9H 1CI5A 1MI5B 5BCAA 3VA2C 2BVYA 3UYOD 5CCJA 2CO7B 1DN0A 5FKAB 2IGLA 5IROD 2F9BT 4KO7A 4WU7A 4ANKA 4DP0X 5T3ZD 5ISZE 3MO1A 1R5WA 4NYLA 5D7EA 2CALA 1NL0H 1D5XA 5E8DL 1E6JH 4N28A 4IM8A 1RSYA 1BQRA 3T71A 3EBGA 1JZ7A 2B1AL 4WI8A 2ZUTA 4J3OD 4N8CL 4PYHA 4TLKA 2GG1A 5JIPA 3QYNA 1YNTA 3BGFC 1WFIA 5DURD 1Q38A 5FKPB 1QR1A 1FF5A 2PYEE 2ZUSA 1FBIH 1JGDA 4ODTL 3POHA 5DDHA 4RNRB 1JP5A 5DWUL 1YEIL 1XB6A 3HRZB 3CFBB 1M1XA 4X6CA 3CBKB 1KXTA 1AGFB 5E6YA 2HUEA 5FPIA 2OX5A 1XQ4A 4YSEA 2SEBB 4CUCA 4YSSA 1N4XL 1QPPA 1M1SA 3TBSA 4Z7AA 4XWGH 2R0KH 1PX4A 5TTRA 1LWHA 4RGOH 5BZXA 1I8IB 2DQEL 4H44C 4F9PA 4GMSH 1I7ZA 1N67A 4WTXA 5CGTA 4OV5B 4FQ2H 1S7VB 3BYYA 1SUHA 3E9UA 3V9CA 1UKSA 2WXFA 3DBXB 3D12B 5GGVH 4DEPC 4ZZFA 2GUYA 1ZDQA 2RIKA 3E3QE 4LLQA 2X4RA 1KFAH 5ECGA 1QFUL 1MY5A 5KBKA 2MH4A 3ECUA 1XF1A 2OTUA 3CZEA 1UATA 5KOMC 1ZSDA 3QIUB 5ANMA 1KEGL 2XKNA 3WFDL 1B3IA 3VMNA 1NGXB 3Q2VA 5D2LB 5GRUL 5HI4D 2NTFB 3T77A 4N25A 5ABZA 2PXYA 2WTRA 3U9UA 3QUXC 5CWSB 2AXFB 4JMXA 2ZWNA 5A2KH 3KNBB 3X1BA 1VFAB 1GAFH 2I24N 5IVZB 5L9DL 4OFVA 2H1LM 4N2LA 4ZOBA 3UYPB 2J25A 1QSFB 4MAYB 1Y1DA 4U1NA 2CM5A 4YVNA 1UJ3C 1BZQK 5K9OB 2APWA 1GOHA 4KZEH 1IAMA 3LPPA 1E67A 4P5SA 3RB5A 3PGFL 5CLTA 4IK6A 1U92B 3LN4A 1AKJA 5D1QC 5I0WA 1NLDL 1QFOA 4X6CE 5AZEH 5DJCA 4M1GH 5DI8B 1QO3B 4NQSA 4BIKA 5TF1L 3ZKXB 3EXJA 4Y16D 1EJFA 2L3BA 2AF2A 1NM4A 1A1NA 1QBLH 5HI3C 3GXPA 3AUVA 3LEXA 4C83B 3GXDA 1F1DA 3D2TA 4NZRH 3UJJL 5I6MA 3OGCB 2ZX8A 3FTGB 5EZPA 4OZIA 1QWHA 3FSAA 4ALAL 2ICWA 1GC1H 1RAMA 4J8RA 2ZONA 1SF5A 4EI5D 3KJ6H 1DBML 2X1WL 1IKOP 1YN6A 3BKJL 5AB1A 5KG9B 4LOUC 1TTGA 3I50H 2R56L 4F2FA 2G3XA 4N0YH 5FW8A 1ZTXL 1RUML 1RIHL 5ANME 1AFVL 4ILDA 4DP8X 3SQOL 3ZYZA 3VXTB 4BM7A 3RA7H 2YK1H 1SXBA 3O9WC 4OJDH 5EZJB 1NQBA 1Z9SA 2E7LA 5CHNA 1F6LL 5I71C 35C8L 2Z3FA 3HG4A 3WCYA 2YGOA 3U9PH 4OLUH 4KK6D 4O02A 2XJKA 5IW6B 1A5FH 3NP3A 3DIFB 4F7CB 2R2BA 4KKBD 4PCYA 3RGVC 2FBJL 1CIUA 1XEDA 3FHAA 1AGFA 1ONQB 3V5KB 3U6XA 3T0AA 3MRLB 1FVEB 3RQ3A 4Y5VB 1OP4A 1URZA 4RBPH 1SUJA 3GWJA 1QFWH 3GI8L 3FQUA 5AVQB 3DPDA 4ELKB 4GXVL 4QGTA 1AZUA 1LO3L 4HSQA 4OZIE 2F15A 4PRAA 1NC4B 3CFIC 3KPTA 4KDTC 3ARXA 3BVTA 1S9WA 4Z3HA 2BSSB 5IB2A 1J5CA 1EHAA 4DP7X 2R1XA 3L1GA 3W5NA 1VLXA 1S3KL 1KV3A 2VITA 2OW7A 4MQXD 3N40P 3OGOE 2E76C 3HB3C 3DVGB 3Q1SL 4ABQA 1RZJC 2IDTA 1W0YT 1FGNL 3LKQB 4QOKA 1EO7A 5D2LA 4CNIA 2G4EA 2NTFA 5I74B 1YEFH 1PLAA 1U3HA 3DRTA 3H4HA 4AUJA 1A9BB 4JEGB 4UNVA 1WAAF 1K4DB 1I8AA 1EMTL 5D7KE 3BPOB 4WWKB 5C09B 4UM8B 3CZNA 4HJ1A 4JO2L 1QSFA 2X28A 1HSBB 4NOFA 3CFKA 2D4DA 1Y18B 5GRWA 4JKLA 4WF7A 3QDGD 3HE7C 1BGXL 4N2KA 4GG8B 1QTPA 5DC9B 2BIIA 3NJFA 4D9RE 1CGUA 3IN2A 2WPGA 5T3XD 3MBWA 1QO3A 5DI8A 5IHHA 1SN0A 3OPZH 2R83A 2NY6C 1WK0A 1N3NA 4OGXH 3GKWL 3MX0A 4C83A 1QA9B 4QD2E 1D3CA 4RX4A 3SB3A 1H8NA 4H8PA 3WKPA 2CIKA 2YGQA 5FUCC 4HT1L 5FUOH 3FTGA 2NPLX 3QJXA 1PKQB 1MN4A 1SEBA 3BRFA 4GAFB 3Q5OA 2NQCA 1NCJA 5I82A 4J6RL 3I2CH 5A6MA 3E80A 5ADOH 5LCVL 3OBAA 1Z9PA 5IW1A 4DGVH 2F61A 5IB1A 3PGDB 3QFJD 3CZFB 5I76B 2G3MA 3CPUA 3SO5A 2H26B 2V2XA 3PP4H 4JQVC 1QLRB 2EUZA 2DEWX 3G6AB 5D2LE 4PJ7F 2YHGA 3OAWA 3GRBA 4NC0B 1TQBC 4OJCA 4X5WB 3TZVC 4BFIA 1IRAY 2XG5A 4DPAX 2AXHA 3MR9B 3MXWL 1NANI 4TL5A 3MRJA 4FJZA 5C3IA 4AY0A 43C9B 3BGFB 3I3BA 5BZDB 1WQVT 4NI3A 5EU7C 5JXEA 3WUWG 5C97A 3LB6D 2VAAB 1YC7A 1QSFE 3S9DB 3SGJC 4GKLA 1FZKA 5IW6A 1P7QB 4F7CA 3ZHKA 4FQXC 4ZDHB 4TYUA 3WIHL 5BV7L 3MNVB 3DX6B 4JN1H 4MHHI 4EZMA 4JFSA 2MEJB 1BEXA 1ZANH 2BY0A 2IMNA 4X7SH 1GGCH 2E0PA 1FVEA 2G2PA 3DV4B 2EUWA 2ZX9A 1CE1L 1QPXA 1UWYA 4YXKL 1JVOA 5BVJB 3PS6A 4DEPB 4ELKA 2LW3A 4WY7H 2EO1A 2V37A 4M8RA 1NC4A 1G94A 3LZQA 2ZF9A 4LCWB 2DYSB 2BSSA 4YDMA 4PLKD 3EFFB 3TBWA 5J6SA 3S37L 3G6DL 4GP5B 2I60L 2YQBA 3NJMA 1KYFA 1R3KB 2FIRT 1MFCL 4HIEA 4KPHL 4X99A 4XCCH 3QUXB 4JKWA 4MJ5A 5IBTL 2OSWA 4DGUA 4NZDA 1EAPA 3OB0H 4PFEA 3PHQA 3WFEH 4JM4L 2Y2YA 4Q9QH 2C3GA 1A9BA 5FYKD 3JT2A 1NCWH 3QI9D 1UJ3B 1SBSL 4P5KB 5INDA 3KPOA 4ZSOB 4QWWC 3AW5A 2GBTA 3MLRH 1HSBA 43CAB 2R27A 3ULVE 3P0GB 5D1QB 5IT2H 4KKLD 4Y1TA 2N7BA 3LH2L 4DT2A 2ZPKL 1MHHB 2D7TH 2IALA 5T5FL 1ZAGA 4XP4H 3FOLB 4GG8A 4IBYA 1WJ3A 4NWTL 1RK0A 3SBWA 4U7SA 3UL4A 3P73B 4GRLC 3K0WA 4B3EA 1IGTA 2BZCA 4DQOH 1WAPA 3I3DA 4BA0A 2GBAA 2ADGB 5GHWL 3CN2A 3FQWA 2NY1D 4IJ3C 1KIUA 5JHBA 2X05A 3L2NA 1E65A 5DS1A 5H37H 3L5WA 1JZ5A 1NFKA 3CK0H 4KAQH 3MYJA 1PKQA 1USZA 4FMVA 1FDLH 4NZTH 3WUWB 1MFNA 1N59B 3FQTB 3L1OL 5F7LB 3PFUA 4MA1C 4X5RA 1MW1A 2F08A 3JYCA 2DDQL 1DJWA 2X87A 1W91A 2VW7A 4HF5L 4GB9A 2HP4A 3KL0A 5DLLA 1K6QL 1IAKB 2O5XL 2DPKA 3CZFA 3THMH 4BSWB 3QIWA 4YR6A 1D5IL 3O9WB 1QLRA 1TETL 5IROC 1ZK5A 5D7JA 1TZOA 4FG6D 1TJIH 3B8YA 4MYWB 3WYRA 5L2JB 2WUBH 1T89C 4X5WA 5GISH 2WWKO 4TTDD 1T7XA 4C58B 5I71B 3MR9A 1HKLL 3KLKA 5IW3A 3VD2A 1U41A 4M4PA 2ITCB 1JYVA 3HUJF 3RVUD 1Z5LB 1RULL 2V33A 4GXUM 5FWRA 3MLTB 3L16A 2APTA 5IV2A 3QYMA 3RGVB 1F00I 3ETSA 2Z8RA 1JDAA 4W9EC 1F13A 5BQDA 3K6DA 1AOZA 4J3OC 4HAKA 1NPUA 3MNVA 4HKBB 5D9SA 2AQ3A 3HZVB 3V7MA 1UOLA 3AADB 1HK6A 4A2MA 1ZHLB 5IB5A 3A4FA 4O2CB 3N44F 1KWKA 5LVEA 1N26A 3FO2B 3D0VA 2F8XC 1KGCD 1NBVL 1A7BA 2B9AA 2C3VB 4KKNA 1HH6A 2XN9D 5F7DA 1KCVL 1B0GB 1PKQE 3T8VA 1KF9B 1T0OA 1KCRH 1Q9OB 4LCWA 3HB3B 1G7IB 5DA0B 1BD2D 3CV5A 5DVLA 3QULB 2F5BH 3BEVA 3H9SD 4H8WC 1DP0A 1JGVH 4XX1E 3RGHA 4GBXD 4ADJA 4JZJC 2CRMA 3P0VH 1GSMA 3FUKA 1GH7A 4W9LC 3KPQA 2EDYA 2EQDA 1PQZA 4BWTA 4MZ2A 3VJ6A 2EDJA 1JGLL 3GI9H 4DCQB 5HI4C 1IQWH 1KCSH 4JFUA 1WEJL 3LIZA 4BFRA 2C5DC 2R0WL 1FE8L 4MDJB 3ES6B 1T7VA 5BRZD 5CLWA 3QRGL 1M05A 3UTZB 43CAA 3KM2A 4LPVA 5D1QA 1G0DA 3ELAT 3CSGA 3CVDA 4PJXA 2J20A 1MHHA 1SF3A 3EH3B 3FOLA 1JK8B 4QRQB 2NY6B 4PS3A 4JFFB 4QRPB 2X7LB 3F6IA 3QZNA 2WSDA 2VR9A 5JHLH 2WUCL 2J21A 4XNZC 1EHLL 1OO2A 4Y16C 2Y7QA 2H9GA 3AXLA 3DXAD 4RFNC 2H3KA 4EIGB 4ZFOA 4Z23A 2N1KA 3WUWA 4M7KL 1P7KA 2X4TA 5C0FB 5F7NC 4LCWE 3L3KA 3S3DB 4P48A 4K8RD 5DD5H 3RBGA 3ZMRA 2A6DB 3BVDB 1I1YB 5JA9A 1KWGA 4DERA 3BRDA 2XWBB 1MHPH 3MJ9A 4EI5C 4BQ6A 3L2LA 1IAKA 3TZVB 1TQBB 1I7TA 4ZW6A 5IFHL 1N2RB 3X14B 5I1CL 4HUKB 5I9QC 2OR9L 3NFSL 3F2LA 3WIFB 3GMQA 3ZHNA 5KYYB 1ZEAL 5KBPA 1ZGLB 2EINB 4HS8L 2OXHB 3CH1B 4HCGA 5KVFH 1G6VK 2EIMB 4WQOA 5D1ZD 3GXIA 2BHFA 2ITCA 2K8MA 5BOJA 1BMWA 1A8ZA 1Z5LA 5IHZA 3MLTA 4FQXB 4XGZB 5GGRY 3DJ9A 2L4OA 2RFXB 4HIIB 4MCMA 3MXVH 2HRPH 5D1QE 2MFNA 1KG0A 1B4JL 4PJXE 1T04A 1BAFH 5IHUL 3JV4B 4HKBA 3HZVA 3U6RB 2R7EB 2V7HB 4U6YA 4OKVB 4PJ7B 5KVEL 3KLAB 4D94A 4KKBC 4ABVA 4E9VA 1ZHLA 1OGTB 4PS7A 5DJDA 2VIRB 5IIEB 4NM8L 3OSVA 5CZXD 1OM3H 4KY1H 2GC7C 4KDTA 2C3VA 2OMWB 4J3OG 4ADIA 2H8PB 4RMTA 4X4KA 5TDPB 1EXHA 1B0GA 2NYKA 1JXJA 1OW0C 3L9RA 4UIKL 4HCRA 3B2PA 4RAHA 4E5XA 1MCPH 5C6PB 1G7IA 1JRHL 4P2AA 4CVZB 2XX1A 3AT9A 4OAWA 4ZI8A 2ID5A 2HAZA 4XP6L 2HJKB 2HWZL 1IVLA 2C8NA 4BQCA 4G7VL 3UJIH 2DMHA 4WI3A 1B9ZA 2WVVB 1EZVX 2FATH 3G04B 4MQXC 2VCOA 3D0LB 3VXMA 3N04A 5EBWA 1AP2B 5B1BB 1KXQE 1N64L 1LE5A 5CEZL 1SHWA 4DCQA 3Q2NA 2UXVA 3WJJC 3X2QB 1PDKB 3G5ZB 4PRHB 4YX2H 4GH7B 4E36A 4NO0B 3HE7A 3L4CA 3J8F7 3K2UL 3UTZA 4JJOA 1J11A 2IG2L 3NA4A 4PU2A 1UA6H 4XVTL 1ZHBB 3RJOA 4GRLB 2A9DA 4XN9A 1KIPB 2GBUA 4FJ6A 5I6OA 1JK8A 5D5MF 3ZL4H 2YRLA 2BRRL 3MNZB 1XXDC 4I9WE 3W39A 4G80B 4P5TA 3IMTA 1TYRA 2Y2WA 5LGJA 2CUIA 4OTXL 4OLZH 4QRPA 4IJ3B 2Y6TE 2FO8A 4PB9L 4BYHA 1XR9B 5IHWA 3KLHD 3F83A 2BY2A 2ARJQ 4NLAA 1J8KA 1N7MH 3MTRA 1G0YR 4BK4A 1IEAB 4FQQA 2VLMD 3VQ1C 1QNZH 4MA1B 4P8QA 3KPPA 3OKOB 1A7NH 1G7HA 5FGSA 5I2IB 1E6JL 1KULA 1RZ8B 3R4DA 1KB9K 4I1PA 1L9TA 5DLMH 3WHE0 2A6DA 1I1YA 5E0QA 4JQVA 1NLBL 4FFZH 3AT0A 4QYAA 1IKFH 2E9IA 3R0MA 4NQEA 3D4CA 5IP4A 3DI3B 1N2RA 2JQMA 4JK0D 1B6DA 5KYYA 4IS6A 4OIIH 3VXME 2DZEA 1ZGLA 3BZFB 1FCCA 3WL9B 2ZWLT 3I3EA 4IEFA 1GJIA 1MW0A 4R7DA 4Y5YA 5HHXH 2AS5M 4JFDA 4TQIA 1WAEA 3DX9B 3QISA 4QXUL 4MNGB 4FQXA 4XGZA 5D7SL 1DUYB 1OB1A 3ISYA 2RFXA 5DURB 4EF3A 4TF4A 4XWGL 2KLRA 2R0KL 3H7BB 5DFTA 2H45A 1A1OB 3LB6C 1GL4B 3FPXA 1BAWA 1J5DA 4JKNA 1NEPA 4RGOL 1IJ9A 1KB5B 1PFCA 3JV4A 4AM0B 4GMSL 4JO3L 4PJCB 2FEJA 3U6RA 1ESOA 2R7EA 3DJZA 3FRPA 4JQIA 1G87A 5GGVL 4QRPE 4P46A 5FO8A 5EC2A 3IDXL 1OGTA 3UBGA 1KFAL 2DTMH 1I1CA 3EYUH 2VIRA 2FJUB 2HPOA 2WBWB 1WAAE 4N3TA 4WFHD 4X5QA 5FUCE 5IIEA 4IBVA 4BZ2H 1J88A 4WENB 4K3EH 4Q58C 1DUZB 1C12A 4R5TA 4E9TA 2XBDA 4X9BA 4OV6F 3IDMB 2H8PA 3DX4A 4JFED 3T0XA 4GO8A 3UTSD 4AXWA 3PREA 1MRDL 4JZJB 5MEOB 4A2EA 2Z1PA 1XGQB 4LLMB 1CXIA 1GAFL 3GHEH 3K71B 4M93C 4PLKC 1OOAA 4R4FH 4NQEE 3N44B 3TNNB 3FFOA 4KVCH 1SVZA 3OX8B 2DBLH 1A14L 4DESA 2AVFA 1AP2A 4WI4A 4FA8A 1KENH 4KZEL 4B60A 5EU7E 2CWRA 3ZDYE 2X1OA 3OHMB 4CVWA 5C92A 2C3WA 4LCCC 2OZ4A 2ESVD 1G7QB 2YSSA 5CXPA 2K45A 4AITA 3QI9C 4JFDE 5KS9F 2VQUA 2DH3A 4UQ9A 5IQ7L 2R4SL 3H42H 5B7FA 4NZRL 4ZUSA 2VN6A 3LXCA 3NZ8A 3KS0H 1S7SA 4KKLC 5JW4R 3G08B 3TEWA 4Q52A 2AMGA 3BSHA 1GC1L 2GY7B 3KPSD 4XNZB 2GT9B 2XQYG 4Y16B 2HMID 2EE0A 4RFNB 3STLA 4HEMA 5C0DB 9PCYA 2WXJA 3O6FD 1MCHA 4DP6X 1PG7H 3PQYD 4N0YL 1IEAA 4IBLT 1BZ7B 2IADB 2NY1C 3VGGA 4OFDA 5C0CA 3CVIH 2HJLB 4JKMA 1S7QB 4EI5B 3TASA 1MNUH 1W8EA 1F41A 5I9QB 1RUPH 2M26A 4K5PA 4Y2NA 1DJIA 3MOBH 5HYQA 2V2TB 4RISH 4LPUA 4I2XB 3UAAA 5A40E 5JZ7D 5HDOA 3Q8EA 1T1ZA 5DJ6B 3U9PL 4OLUL 2JI3A 4KU1A 3VI4F 1BZDA 4KNUA 5JPMA 1BOGA 2BDNL 1A5FL 1AVAA 3WL9A 2FQEA 3VFWB 4TSBH 4FG6C 3EOBA 1U3JA 4PJ8A 3IETA 2VOTA 4TTDC 3TU6A 2R2EB 3HJEA 2VDRB 2Z7YA 2VZSA 3MGAA 2IXQA 3X1FA 1DUYA 3B5TA 1NAKH 3RVUC 1WO2A 2D0HA 4LOVA 1E4XL 2JKIS 1A1OA 2WAHA 4Z7UA 3QC6X 1I9JH 2PO6D 3QHZL 4X9YA 2ATKA 5TJWK 4PJCA 5AG9A 3OQRA 3HHMA 4NKDA 3J07A 1KJ2H 3K8LA 2UWEF 4KXZI 1KXVA 4UOW1 1KGJA 3LSOB 2OL3A 3ECBA 3T6WA 2F6AA 3RG1C 4WAFA 4HEME 4JDVB 1DANT 2XSKA 5IB4A 3D85A 3IDMA 2VW6A 4P06A 1N70A 3F7VB 5C0CE 2GK2A 3U30C 3NCWA 1FL3B 3FB8A 5MEOA 4TVPE 4RAUB 2QZ5A 1XGUA 1BYOA 1NDMB 3WE1A 4A7UA 5GIRB 3FU0A 2GEEA 3R4RA 4GO6B 1JPSH 4QLWA 1USQA 5I1DA 2WXHA 1GRWA 3NRQA 4GBXC 1P5UC 2WLJA 4E0RB 1OK0A 2IOOA 2V5YA 3P3YA 3CDCA 1WFOA 4DK6A 3NG5A 2KI6A 3I02B 4JZOA 2UUDH 4AE0A 4F7EB 3Q06A 1G7QA 4OZFG 1RU9L 5B22A 3SDDA 1UXWA 2EKSA 4HCFA 1BQSA 4YEFA 1RZ7H 4GXUN 5CBEB 1HZLA 3V6ZB 3H0TB 4W70A 4OLVH 3QDGB 2XC8A 4RA0C 3UMTA 5FUOL 4IQHA 4EIZC 2IH8A 4PJCE 3KS0J 5EZOH 2XXGA 1GYCA 1BXXA 2GT9A 3JV6B 4Y1AD 5DZOA 1DVUA 4GY4A 1A4AA 2DQCL 4W6WB 4ZMZA 1BQKA 5C0DA 2Q8AH 4DGVL 3QFDB 3QAZC 1JPFA 1FAIH 4FFTA 3QJTB 4UIMB 4YPGA 1A64A 3PP4L 5JW3H 1UC6A 2AV1B 5J0BA 3H85A 2HJLA 4GKSB 4EI5A 2P52A 3FRUB 4XC1H 5E2WH 1OCZB 3O3AA 4WHYG 1H3VA 1NKRA 4J28A 2XZQH 1ZV9A 3BAEH 4Q56A 3T6QC 3QFJB 1NM9A 2X4QB 3LHAA 4K8RC 3BE1H 2YWZA 4X5XB 4XO4A 3D4YA 3LRSA 3SDCA 3TNMA 1I3GH 1E4KA 2DAVA 4CVXB 5DJ6A 3V6OC 2FWLB 4TNVF 4Y2DA 3V0WL 3CSBA 4Z7QB 3VFTB 7FABH 4W9HC 4OFPA 1OTSD 4UDUB 3CVHB 3VFWA 5F9JA 2A7BA 2BY1A 3QO1B 1ZANL 2R2EA 1I8KB 4JL2A 3TPUA 2P46B 5D1ZC 3BD5A 4PGDB 5KSUA 4QJ4B 1FNGA 1T5KA 4XB8A 2UZYA 2EIEA 1ZLEA 4FI8A 4WY7L 3DJRA 5K59E 2F19L 2P7TB 2AQSA 5FGRA 5I24A 1SLXA 2F7RA 4A7TA 2RALA 2B4CC 4NNXB 2J88H 1L6PA 2A99A 5I1AA 4I13B 1NGPH 3LSOA 5HGBA 1JZFA 3AXHA 4MZ3A 1CQYA 3OKYA 4AVKA 1IC4L 4DETA 3F65A 4XCCL 3T0WA 3HIZA 1FN4B 4WW1A 1MCIA 1RVFH 3NJLA 4OZFB 3WFEL 2VKXA 4W9FC 4Q9QL 4M93B 5DK2A 2F7QA 3QHFH 4PMEA 1NCWL 4RAUA 1EO8H 2WHVA 1F4YL 2BWIA 4GIAA 5JDSB 3PHOA 3DO7B 4WNQB 2XFGB 5GIRA 3S35H 4PRNB 3MLRL 5TE4L 1RD6A 2Y7LA 5IT2L 3V0VB 4KUZH 2XQYA 3HNVH 4LCCB 4EPSA 3TBVA 2D7TL 1LQBC 4XP4L 5B7EA 5CMAB 3ARWA 5EU4A 1HN1A 1JN6B 2XDHA 3QI9B 1TEGA 4YL9A 3HMWH 5EG6C 2CO6B 1F4AA 2ITDB 4XNUH 5GS0L 1R3JB 3HN8A 3OLEA 1WYJA 3DHUA 3WNNA 2P8PB 3W56A 3PHAA 2FX8L 3IJEB 5DVOA 5CKAA 4XMLH 4TUKH 4WJG3 4YUEL 1QAWA 5ABAA 3UIYA 1BA9A 4FL4C 2PTTB 2Q3AA 3CK0L 4KAQL 2QELA 1FGVH 3QRFM 1FDLL 2CNZA 4CC4A 4BRVA 1RCYA 2WN2A 1TTAA 2XETA 2AQNA 3DOSB 3DUUA 2OMUB 5FCSH 1SY6H 1TFPA 2JJUA 4G9DA 1E27A 2NY1B 3II2A 4OI7A 3QFDA 1OE3A 4RWHA 4JS7A 4TUOB 1FO0H 2JKXA 3O3DB 4JHBA 4JE0A 3WNOA 4BUQA 3THML 5KS9B 3KLHC 1A1MB 2DIJA 4B27A 2YZ1A 3BIKB 4NBYB 1HWGB 4YHIB 1TJIL 4TM9A 1YHPA 4QRAA 5LNEA 2WUBL 3FRUA 5LAPA 3W57A 4KRMB 5GISL 3I6LD 4PJIF 3CJJA 1FVDB 1OP3H 2OI9C 3H2PA 1EFXD 1M7UA 3BX7C 4MA3A 4JDZA 3W9EB 3DARA 4Y4KD 5FYJH 3U36B 1HHHB 3EYVB 1U30A 4K55A 4FQCL 2X09A 1JFHA 3GXFA 4DKDC 2NY4D 3FL7A 4M7LT 3VFTA 1ZVNA 4PPTA 1DZ0A 2G60L 2RR3A 2Y7SA 4JM2F 4FE9A 4WNJA 2PF6A 1QI5A 4P57B 3NPSC 3ZHLA 2FE0A 1I8KA 3KPMA 3ZL1A 2Y3NA 1XXFC 2W94A 3S3CB 4L1TA 5LN8A 5G2NA 1CYGA 4F3FA 1WZ1H 1NGWA 5K69A 2DQJH 3KYAA 2BP5M 4AKPA 5DJZA 3QDGE 2A6JB 1FI8C 3WO4C 3S8FB 1RPKA 3FQRB 4HUMB 2M1KA 3HPJB 1K9TA 2DN7A 2FHFA 3VI4B 1KCRL 1PD0A 1UEYA 3B37A 5T3XE 3IMSA 3KBEA 1I3RB 2F5BL 3BFQG 2ICCA 4G1MA 2EDNA 5MEPB 1JGVL 2O4EA 3FCBA 2VISA 3U30B 2P8MB 2J6EH 3P0VL 3WLBA 1DE4A 3BZEB 2XN9B 4M6MH 4HWZA 3HHRB 4HUWA 1S9YA 5GPRA 1BD2B 4DO5A 3GI9L 3H9SB 4L4VD 1GKEA 1KCSL 2UWEB 4B7LA 4GBXB 5J3HD 3GXNA 1P5UB 3JSSA 2KZBA 4WNQA 4FTVA 1O7SA 1EBAA 1YYMH 1IFHL 3F5WB 7TAAA 2XRAH 1MCDA 5GQBA 2ZWKA 3QS3A 1J1PH 2PUQT 1S7UA 3BGMB 4OBSA 4Z7QE 1JN6A 2N59A 4G1EA 4YXHH 3IJHB 5J8OA 5C2BL 3WEXB 5AZUA 5BRZB 1GGYA 2DQMA 2XY2A 1JNNH 3WTWA 2YMXL 1KPVB 2GJPA 7PAZA 5JHLL 4L8SA 1OALA 1OARL 4MTMA 1BW8A 3S4SA 1AZRA 2E46A 3DHJA 1ZXKA 2PTTA 3ESVF 3MLXH 4FNLL 5IQMA 2B39A 2ZUVA 4GP8B 2J1WA 4G72B 4UZSA 1Q1JH 2DMKA 2Q7AA 1RLWA 3T0VA 5HGGS 3EGDB 3DGDA 5DD5L 2QVMA 2E8ZA 5GRVK 2HMIC 1MHPL 3P0YH 4TUOA 4NLHA 3DXAB 5D7IF 3O6FC 4GAJH 3BIKA 1L9RA 4N2BA 1DVZA 4YHIA 3V4VB 4HC1A 1ORSB 4YSPA 4GI6A 2ORBL 5F1NB 2ZWSA 1BFTA 1VA9A 4LLYB 1FVDA 3GJFK 4NNPH 4X4XB 4FQPA 5HYJD 2ENPA 3AAZB 2QQKL 4QRSB 3ULUL 1VJSA 3QWNA 3E7JA 3OAZH 3ATDA 3R7QA 4N2NA 4ZUUB 5ESVB 4YHNB 3MXVL 1SRDA 4KRPD 1BBJA 4HIHB 1JPGB 4X80H 1G7PB 4ONOA 5JZ7C 2GCYA 4L3EA 5D1ZB 5G5DB 4H2CA 4HMCA 5HPOA 4L1BA 4Q0XH 5AVTB 4PMFA 4AJWA 3CHPA 5TE6H 3RU8L 3LNEA 4QNPF 1NCUA 2JJTC 2MNJB 3MRRB 1OM3L 2VE6B 3EHBD 4KY1L 4L37A 4YDNA 2LVEA 4NDMB 1RLBA 1OZUA 1PIFA 1VIWA 2W91A 1TJMA 5DEZA 3FQRA 2NT1A 2BVPB 3C5XA 1NCCH 2V17H 2PO6C 2XN0A 3A5VA 3ABGA 3PUCA 3VVWA 4CN4A 3DX8A 1MCPL 4JDEB 5KEZA 1HQ4B 1TVHA 1NOLA 5F7WC 5TK4A 1Z3GH 5SX5K 2WJ7A 1F2QA 3ZE0F 4H1LA 3UJIL 3UTQB 3N42F 2FATL 1X7TA 5IHLB 4R8WH 2WSKA 1FFRA 4LKXB 5T1MB 3VVVA 3E8UL 1XZ0A 3H9HA 3NQIA 4R5XA 4DO6A 1CLVA 1U8OA 1KPUB 2GI7A 3DUSB 4YX2L 4KUCD 1HH9A 2WQVA 2YFNA 3B56A 4GG6F 2YAPA 3O3BB 1UA6L 5I1JH 4EXPX 4U6HA 5GS1A 4GO9A 4WK4B 2J8UF 5A3ID 1QPKA 2DWEA 1F90H 3DWTA 4MD0B 3ZL4L 2ZYSA 1LDSA 1FH2A 1UXLA 3IXTB 3IJHA 5G55A 3TYFA 3ZDZF 1I8UA 2FD6H 3ZE2B 5BRZA 3LXBA 3B4NA 3ZDWA 1NGYB 3QEUA 4FL4B 1KPVA 2XYBA 1F58H 3T65B 4F37K 2BINA 4N8VA 1EERB 4P2QD 1QNZL 1E5CA 5JPNC 1MREH 2F53D 2CGRH 1A7NL 2IWEA 4Y5XC 1J0IA 4AIEA 4LL1A 1H3TA 1MJ8H 3RWJB 5DLML 3EGDA 3PWJB 5HY9A 4FG2A 3MKGA 4FFZL 1KGCE 3NZUA 3QUML 3SN6N 3ALPA 5FC9A 2FH6A 2P42B 1SVCP 2VJ0A 2XN9E 4FRWA 3X17A 2OI9B 2OMBA 2WO4A 3V4VA 1BD2E 4YXLH 1MH5A 3IPEA 1TSHA 2ZOKA 4X4XA 2VABB 4JW3A 3V6OA 2C7FA 3AAZA 3RUGF 5EZIL 1BQLL 1SXZA 1DJHA 2XPYA 3OSKA 4GIOA 3BIBX 2Y5TA 4YHNA 1Z32X 3EFOA 4IDJL 4WV1B 1N12A 1UA7A 1N8OE 3NPSB 4HIHA 4X0NA 1XF4B 1JPGA 1G7PA 1IUZA 1A7OH 3I9IA 4ONGL 4RA3A 1U8LB 5G5DA 4S1RL 3OVUB 2E7BA 5DHMC 1OTSC 2P47B 5J1AA 3D39A 5SX4I 3K6FA 5BUGA 1R3IH 3U0TB 4Y0GA 5BRZE 4PJIB 3EYUL 2N7AA 3WO4B 3PWPA 3N0AA 3MRFB 4BZ2L 4K3EL 3PJNA 2QSCH 3WOVA 2EVJA 5F21B 5GGTH 2BC4A 3L1FA 4UV7H 4AIZB 4PIRF 3HS8A 4KTYA 3EYFB 4PG9B 4UTAA 4CN1A 1A9EA 2DIBA 5FOJA 3IMBA 5BOPA 3INOA 1H9VA 5E95B 4LHJB 5E8EB 4K2UH 1RHHB 2DF3A 3BAXA 2LT9A 2WKOF 4KDWA 4R4FL 3DXAE 3BJLA 4JFEB 4N2EA 5F8QC 1LYQA 2DBLL 4K7FA 3UTSB 1KENL 4JHWL 1OAZL 2EEBA 2ZAIA 2CR0A 3MBED 1KPUA 3O8XD 2VNCA 1S7TA 1I7RB 2AKRA 3V6OE 1F4XH 3Q48A 1KC5H 4AEIH 2ZWZA 1HEZB 1ZHKA 3MCLH 3LDBC 5L4IA 2I7OA 4LLWA 3H1ZA 4PWGA 5K9QG 4LIQE 3M6DA 1CLZH 1VADB 5DRZB 4QUOA 2XV3A 5PCYA 1CYWA 3IXTA 2ESVB 3SPJA 3CGTA 2VERN 1ITCA 4BFKA 4OF5A 3B5HA 2QSTA 1WD9A 2DRUA 4LCYB 3T09A 1XL4A 2HVJB 3TO4D 1ET5A 1PLBA 4ALAC 1WICA 1MFAH 2OCFD 3ESPA 4U1IA 3TBYB 3BSZH 4NRYB 4X6FB 5B4MD 1NPJA 4BDVB 3PWPE 3KEDA 5L7XL 1PG7L 5HHVH 2D73A 3W0WA 4CSZA 3KD4A 4JE4B 3KPSB 4OD2B 3CVIL 3HE6D 5GGQH 4BINA 5CU9A 4I7ZC 1QQDB 3RWJA 1TQSA 3KPNB 1MNUL 3RPKA 5IVXB 1HAUA 5F70A 1XH0A 2UZPA 3O6FB 1SJEB 3FS9A 5E03A 3PQYB 4WWID 3MOBL 3L9YA 4PP2B 1IIIA 3MLYL 1XTLA 3RILA 1I8MA 5EN2A 4AYSA 3SIKA 4NUPA 5DGRA 3TH4T 1ND0A 3DMMA 4Y9BA 4B50A 4FXLA 3RKPA 3MNMA 5I6KA 4TSBL 3DURB 4QO1A 3VE0A 4QT5A 5E94B 4N2GA 5AAWA 4UQAA 4S0TD 1LEKB 3SE9H 2JCCF 1NAKL 3D34A 2OLDA 1AGDB 3RVTD 2E59A 3AFLA 4NRXB 1XF4A 4Y4KC 3HHSB 1DQIA 1I9JL 3TFKD 1TQTA 1UZ8A 2HKAA 5AQ0A 3MGOB 2NY4C 3HJ0A 4IOIB 4UB0L 3HZMA 2BP0B 4XXDB 5CGYD 2OA9A 3ZE2E 1OEZW 3MRHB 5I66B 5DYOA 3E6HA 3VU2A 1N9PA 1KXHA 5KBNC 4MS8D 2PO6B 2Y3AA 1NKOA 1HI6A 4Z7VA 4KH9A 1L0XA 2QFPA 3TC9A 3W0WE 4XNBA 1TJGH 4NENB 2ZOLB 3EYFA 1SPDA 1ZSHA 2Z4QB 2XVLA 4IKJA 4JLRB 3QJOA 1RHHA 2UY6B 5IEKB 3AQXA 4UM9D 3CMGA 3PU7A 3IDIA 1XD0A 1LK3H 4LGRB 4QHUB 4YE0A 4JFEA 1JPSL 3U0PB 1AS6A 1JNHB 4QHLA 4RMBA 2X89D 4CILA 3I74A 3RLSA 1E2VA 3QQ4B 3B2UD 3T8XB 1WP6A 5EO0B 1WWAX 3K4DA 3BISA 4JFTA 1URLA 5FA3A 4KRLB 1IO4C 4DSYA 3G3LA 1JG9A 1H3WM 5ITBL 5J3HC 1HEJC 3NSDA 4HHAB 4OLVL 2B77A 4TSCH 5F7HA 3ZE0B 3GRWH 4RQQB 1A22B 3AWGA 5I23A 4NP4L 3GBDA 3BWAB 3P3RA 2A9ML 4POZD 5EZOL 3N1FC 2DMGA 3MRCB 3AY2A 5L8LB 2XV2A 2E6QA 1LWRA 1P5VA 3TJEH 4AJYV 5FXCH 4QJ5B 4ZW3A 5JPNB 3PXJA 2Q8AL 4X6FA 2HPTA 4HEPG 3LX9A 3ARGA 2VL4A 2Z8SA 4Z7VE 1XH3B 1BOYA 3AU0A 4TSAH 4GG6B 4H4NA 5EZLB 5JW3L 4Y1AB 2ZX5A 5JOEA 2J8UB 5E9DA 2R1YB 1QQDA 3HAEH 5E2WL 4AOFA 5IVXA 1EGJA 3O6FA 4FCHA 3U2IA 3ZDZB 1SJEA 2WCSA 3BAEL 4IRZH 4NERA 3PF2A 3AREA 3IAPA 3PQYA 4FOMA 4X4ZA 1IE4A 4KXCA 1WT5A 4PP2A 3BE1L 3LMJL 3U9WA 2PYFA 1I3GL 1XR8B 4I0PD 4JFEE 3FYIB 4QGYA 4DP1X 3P4NB 1XWVA 1BZOA 7FABL 1GOGA 4IMKC 4PYGA 1ETZB 3DURA 3L7FB 1GHFH 2AQTA 2YQ3A 3NGBC 5E94A 2NR6D 3WXWH 3P9LA 5JMRA 5BV7C 4JCLA 4MRBA 5IFJA 2JKRM 1G7MB 5FECB 2OS7A 4C8XA 3TWCH 2Q2LA 2J71A 5D4HA 2VDKH 3PFQA 5FLVA 4KRPC 1NA8A 4IOIA 1BAGA 2BP0A 4XXDA 1GIGH 5DRNB 1NBYA 3LEYH 1EDYA 2J88L 2X38A 2ISDA 1WBXB 3BAKA 2HVKA 4KC3B 2GFBA 5GRVL 3RIFF 2DWXA 2HSIA 1U93A 5AYTA 4GUOA 3RWFA 4DVRH 3VGAC 3NESA 2C9VA 2PO6A 3CU7A 5I5JA 5C0RL 5H4ZA 3KVQA 4X9IA 1U33A 1FFTB 2EE9A 4PTTA 2CGZA 2NZ9D 4H20H 1ZV5A 4JY4B 2XZAH 3EHBC 3C6SA 3KPSE 3C60D 4OF6A 4KUCF 5ESQA 5HDQL 4UV4H 4WFED 3IWVA 3QHFL 5E5MB 4EZJA 4HSAC 1EO8L 4JHAH 5IVXE 5IEKA 3WG7B 4BXSV 1RJLA 4XP1H 3PQYE 3FUDA 1U95B 5FO9A 3S35L 1UZ6E 2V5SA 4KJYB 4MJHA 3HNVL 3P11H 4CN6A 4HLZG 2XPZA 4Q9BA 3RFRA 3IFPA 2H3NB 1JV2B 5GRYA 5EO0A 3HMWL 3S37X 4LSPH 1NCIA 2CBMA 4XNUL 2D9QB 4K15A 4NEHB 5F7BA 3IGAB 5BJTB 3HS0A 4GI9A 3VTTA 1T7WA 3IAQA 4HHAA 1Q0XH 4XMLL 5KANI 5AKSA 2A9CA 2D3VA 4OJAA 2D7PA 1MJUH 5B1JA 2WXOA 4WK2B 5A3IC 1R5IB 1JWSB 1LLAA 4DUXA 2RD0A 1BPLB 4Q4EA 1I1FA 5EO1B 1IAIM 3WSQH 4NWUH 1XEUA 4Y5XA 1GYVA 1NC2D 4NNYB 2VH5L 1FO0L 1CDHA 4AH2B 1XH3A 2BP8B 4LRIA 1ACZA 3PV6A 1SXCA 1UADC 1CGXA 2R29H 4BXVA 2R1YA 5HHQA 2P5WD 1LP9B 4P9HH 1T1XB 3K6SA 4QMEA 4Q14A 2WTPA 2WXKA 3D52A 3WFHB 4OQTH 2FK9A 3HW7A 4MQSB 5JO5B 2ZCZA 3DTDA 4G6AD 1W72H 4K73A 1CD9B 3SYAA 4PJGF 4A6YH 5BW7A 4RMSA 3E0GA 1SYVB 3MJGX 1M6OB 4XMTA 5KYXB 1D6VH 3L7FA 2VXTL 4OCRH 2E3VA 3MRIB 4N8PA 1EFXB 2QVFB 1ZGLM 4Y4KB 5SWSD 3PAUA 2K70A 3ARFA 3I6GB 2X6MA 1JZ3A 5FECA 1G7MA 1WZ1L 1M3JA 3FO0H 3M1OA 2NY4B 4EAEA 1C1EL 2JF1A 2XACC 2VR7A 3BUPA 4HUVB 2E8YA 4ODWA 3HC3L 2B1OA 1K8DA 4RFOH 2XCMC 2W65B 1WBXA 3D07A 2WK2A 3QR1A 4X98A 4ZTPH 1AYRA 4DEUA 1DBKH 1OCOB 5JQIB 1II4E 3DYMA 3D6GA 3DDFA 3QQNA 4TQPA 2W81C 5E1QA 2J6EL 2X6UA 4YDZA 5FGBA 5CP3A 3R8QA 2CDFB 3BKCL 1GY2A 3V0HA 3BN3B 3B7TA 5J4MA 1G1OA 1YEJL 3GJEB 4RRPG 5GRJH 3ZDZE 2ZF8A 4WFFD 2PWHA 1U95A 3GSXA 3NZHH 4P5RA 2J72A 4WJ5B 3UC0H 3L3OC 2EEDA 5GZNA 2HJFB 1YYML 2WLIA 3QCTH 2X2HA 4KJYA 3GTNA 1DFXA 2KDYA 2XRAL 3MA9H 3VO0A 4ZOCA 4X6EB 1B0RA 3D18A 2AJXH 4DUWA 4OUUA 3WJLC 4L4VB 4HEPA 4HX1B 4G8EA 4U0QB 4YXHL 2ZUXA 4OUOA 2MNWA 4R2GD 1JNNL 1PX3A 5BJTA 4FA6A 4NO3B 3O8XC 4M03A 2H1PL 4PSRA 2FJGA 3RVVD 1HXMB 1ODUA 4GW5A 4U2ZA 5C09A 1NFIB 2EE6A 2N0KA 5IMOB 5EUOF 3MLXL 4XBMA 1OSPL 5KVDH 1Q1JL 5JOFA 3H9ZA 1DLFH 2O30A 4AKOA 2HCZX 1FNHA 1CO1A 3MZTA 3PE9A 5AENA 1I85C 2VZOA 1GTFA 1MLCA 2AXWA 4K4KA 4K0OA 2CLRB 4NNYA 1RKRA 4OCWH 4KWUA 3TO4C 4YLBA 5CAYB 3FHQA 2BP8A 2VDNL 1SOKA 4GAJL 4JB9H 4RMRA 5B4MC 5FB8A 4CAGA 3IK2A 4Y89A 4FEIA 3Q13A 3BWSA 1LP9A 2R39A 3B9EA 4C59B 5MEQA 4B9FA 3BDXA 3HE6C 5D8JH 2ARJA 4NNPL 4EZLA 3PYCA 5M7QA 3WFHA 2BS9A 5I17B 3ILPA 1TIUA 4Z7WA 3IFNL 5K39B 3TOPA 1KLUB 2XZCL 5ETUA 2B8OT 3NGBB 2YA0A 4X80L 1XGTB 1T83A 4M5ZH 5BV7B 3B8SA 1M6OA 1NAMH 1A66A 5KYXA 1RIUL 5HYJB 2PTUA 2YMOA 2PP9A 1XMWA 4Q9RH 1EFXA 3GB7B 4BE6A 1U91B 1BWWA 1UWGH 4H26A 4MCYB 1GXEA 2DM2A 2EVFA 4KRPB 3WTSA 1EZSA 5KOVC 2H6UA 3WXVH 3HFML 4ENZA 3PHSA 2Y06H 2O72A 2CR6A 4WEEA 2DB8A 3M7OA 3EBIA 4ZMPA 3RVTC 4HUVA 1F6AB 1OAUH 4NHUA 3TFKC 2V17L 1YMMD 5AUMA 5DZNA 1DQDH 2CJUH 2EYSB 3VGAB 5I30H 2Q8BH 3ZQXA 2QPUA 5FYLE 1T0PB 2ALAA 3HRPA 1KYDA 4R90L 3C8HA 4RSVA 2G3ZA 4NRZB 3CSPA 5CGYC 5I18H 1BQ5A 3BZ4A 5GGSA 3EHBB 4EIBA 1P69B 5ID0B 3LKSA 3VG0H 3MCG1 1ZTXE 1YEEH 5GZOD 2Y24A 3VW3H 4MS8C 4E9RA 2WLHA 4R8WL 2HT2D 2PTVA 1D7BA 2BRQA 1LP9E 3SQRA 3MRNB 4MXVE 1F5WA 5GS0D 4OVVA 1AIFB 5DO2D 3EBAA 2J8HA 3S36X 5LNDA 2F1EA 4UQEA 5I1JL 1KB9J 3KYNB 4CVUA 5F7YC 1MCFA 4NO2B 1E43A 2FHBA 2YD6A 3WHXA 3N2JA 2V0AA 5LBSA 1UT1A 1F3RB 2FD6L 5HGDA 5C3LD 2AJUH 3B2UC 4R9HA 3VFGH 4Y2OB 1I75A 1X5YA 5IBUG 1F58L 3KYMB 5FDYA 2VZUA 1LE9A 1P4IL 1NFIA 3GSNH 3N85L 2W60B 5IMOA 1MREL 4ZBJA 5DUJA 2YPLA 3V4UH 3ML9A 3PNRB 1J8HD 3H3KA 1NEUA 2ED6A 3H53A 1JE6A 2OR8A 5LCVA 4POZC 3CX5K 1F3DJ 2HT3D 4PRPD 4TQEH 3WFCL 1ACYH 1BYNA 4P2QB 4B5ZA 2F53B 2WY3B 2LAAA 3DOHA 1KIQB 4W93A 1KYOJ 4YS4A 3NFNB 4WSGA 4F2MB 2QPFA 4KJQD 2H0PA 4YXLL 1WG3A 2DKMA 4LBAA 5IM7B 4KOBA 1DQVA 1S8DB 1NOAA 4OCLC 4QXWA 5I17A 3QC5X 4NUGL 1JHLL 3D4ZA 1PJ9A 3S8WA 1G9MH 5K39A 2GUOA 1KLUA 3IU3A 2VDLH 5F7MC 3MBXL 1PCSA 3WIHA 1A7OL 4K3GA 3BHBB 4H13C 5A2FA 1T5XB 3OLIA 5J6HA 3RPBA 1K8IB 4KI5D 2CLVB 4QR7A 3MUHL 2Y1ZA 1MFMA 1U91A 1R3IL 3NJGA 5A2AA 4IU2B 1ITBB 3G5VB 3P69A 3FQNB 2NR6C 5TFSH 4CMMB 3IU4L 4HUXA 3MLSH 3IS0X 1X5LA 1F56A 2QSCL 3QXUA 4IIZA 5HGHB 4AQAA 5CCGE 2DQUH 2VC2L 1P4LB 4AV4A 4CU6A 1F6AA 3TVMD 2YPLE 4QY8B 4KTDH 4ATTA 1BQHG 4G6FD 1UUNA 4NRZA 1RERA 2BIMA 2J44A 3KHOA 4K2UL 5LWYH 4ZUVB 4HS3A 3NMEA 1G9EA 3Q5YA 1LEGA 3TJPA 1RZKC 3K6IA 4HWEH 6PCYA 4KKQA 2X53A 3CMOH 1WVZA 4KJPD 5IBUB 3K4AA 1A6WH 3N41B 2NZ9C 4ODXA 4GSDH 5BMFH 2YN5A 3L3GB 3L3OB 3TCLB 4AEHH 3C60C 3EOAB 1P0SE 2YXWA 1EUUA 5DJYB 3MCLL 1JVLA 4Z3EA 3KYNA 3HA0A 2B5IC 1QG3A 2IH1B 5F88B 3RFZC 1AZBA 3PP3H 1OY3B 3I9GL 3MBEB 3O8XB 3OKLB 3KXFA 4N2CA 5FHBH 5HHOA 2D7MA<