2L7EA

The structure of a domain from yeast
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
123
structure length
123
Chain Sequence
MVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription initiation factor TFIID subunit 14
publication title solution structure of Taf14 YEATS domain
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 8
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03366 YEATS YEATS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1970 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2l7eA00
2L7EA 2NDGA 3QRLA 2NDFA 5IOKA 3FK3A 5HJDA 3RLSA 5HJBA 5D7EA 5IQLA 4TMPA
chains in the Genus database with same CATH superfamily
2GJPA 3UJTL 2AF2A 4QWWC 2H4EA 1A4KB 2EE2A 3LVEA 4M7JL 3LHPL 4WUUB 2PYED 5HYIA 4G42A 3LB6D 2YK1L 1AD0A 3RTQA 1O6TA 3FN0L 3WE6A 5F1NB 4R4FH 2D0GA 1SXAA 4UTAA 4N2BA 4X5PA 4FI7A 1WS8A 4XPFH 4UOW1 3SDDB 4NAJA 3WKML 2FGWH 4UIKH 2P7TB 1DZBA 2NUTB 2XWDA 4KVPA 4H0IA 1IE4A 1XGTB 1EHAA 2DQGL 5D71L 4KI5C 4EIZC 3AQXA 3QG7H 3AG1B 1Z2KA 5E7BA 3AB0B 5TFSL 3CLFH 1AS7A 4U3CA 5GZOC 3F58L 3PWJA 2VL5B 4H2AA 3F7VB 4Y19D 5E94B 2BY1A 1EHNA 2VDRH 4UTBH 4BFIB 5EO9A 2BNQD 1I82A 1O7VA 4N90E 3SO3B 3T71A 1FL6A 2XWRA 4K5LA 3P2DA 4XC3L 1R5WB 3FOLB 3WGUB 1C5DB 2NZIA 2VDKH 4JK0D 4BSWB 4E9QA 1IEAA 4FEIA 5E8PB 1KWKA 1P7KB 2Y5TA 1F86A 2D9CA 1EFQA 4KK6C 5C0BA 5FCUH 4C56D 3HPJA 3SYPA 4DAGH 5C0JA 2JJUA 4EN3A 1S7TB 5KVEH 3H6JA 3ZKSD 1SBSH 1XEDA 1MCDA 1CFMA 3NOIA 3PHOB 4XR8C 3ENEA 4FTVD 2NXZD 3GSVA 1Q1JH 1L0YA 3CSTA 3RWFA 4DEUA 3LZQA 3E80A 4H7VA 3RURA 3G5VB 3T04D 4F57H 4JCLA 3UOAB 1IMHC 2EIJB 5KSBF 4WNJA 3JWDL 4R0LC 1UA3A 1CGSH 4YL4A 1G9NL 5LGHH 2ICWI 4X7TA 1Z9SA 5HJDA 3FUMA 1EQWA 1OSPH 2V8LA 5ERWB 3K2UL 4OZIE 3NIDF 3F5WA 3GRGA 3RHWF 4HU8A 4LQFH 2BSBA 5ALCH 1S5HA 2HYMA 3ARBB 1KOAA 3CN0A 3PWUA 3JWNG 4X6FB 4A38A 2X4TA 1KFAL 4H8VA 1D9KC 4FLSA 5E6IA 5CZXC 3WFBL 1HYSD 4HOZA 4ANXA 1NC4D 3L81A 2ESVD 5C0CD 1AGBA 2UX7A 4BZ2L 4NEHB 5HVHC 5I76B 1QLEL 4NKOB 3US9A 2WNGA 5D5ME 1T0MA 3KWXA 5C1MB 5IWLA 2W88A 4H8WH 3T3PE 4QRPA 5SX4H 2WNWA 1RAMA 4LFHG 2M83A 3B37A 2F9BT 1ZLUK 1BLIA 2EC9T 3VI4F 5CSZB 5FUZL 1U8NB 3QQ3B 1UFUA 1L0QA 4FKEA 4YXLL 5FHAL 2XWBB 3NJMA 2RQEA 1LQSR 3KLKA 1PQZB 3H56A 1EA9C 4L5FL 4WFHE 1RJCA 4XN5A 4DPAX 3MJ8B 3HE6B 1J9QA 3CQPA 3NH7H 1BF5A 5D7KE 4I77H 1JYNA 4FX5A 3P9MA 4G43B 4PJ8B 1HWWA 3D85D 4XP5H 1HXMA 43CAB 1MAKA 4KJPD 3U1QA 4R4FL 4OZGA 3KR3L 1VZIA 2J57A 2Y7MA 3DMMA 5I1AA 4IEFB 1PY4A 1YN7B 4E9SA 4UV4H 4UIKL 4MA8H 2AK1H 1V5JA 4HPYH 4I0KA 4JN2A 2VLKA 2VXUH 2ICWB 3QG7L 1VADA 3QUYA 3QS2A 5EB9A 5BQ7A 2W1NA 3VFTB 3NZSA 1F02I 1QKZL 1RZ7H 2DY2A 3CSYA 4PM1A 4MJHA 3FT9A 5FEBA 1MJJB 4M7LH 1AO7B 1OB0A 2ZJSL 4PJDA 5DJ8A 1E8ZA 1CUOA 5SWSB 3TVMB 2AXFA 3FFCE 5GGRY 1CDUA 4B5EA 1W2KT 2CJUL 1BVNT 2VDKL 1D2OA 1NJ9A 3SKMB 1GJWA 3D2TA 5J13C 2EDDA 3NCBB 1FG2A 2YPVA 4MWFA 4L23A 4W9HC 4YZFF 3GYRA 5K33A 2EH8H 5JPNC 1MAMH 3EGSB 3GQFA 4LP8A 5FCUL 2OJZL 3QUHA 1T20A 2CBPA 4H0GA 3V5KB 4ONOA 5E2VL 5JPMB 1U41A 1W0WA 4KO5A 3KLHC 1BYNA 3FNKA 3OB8A 3V0VA 3IJEB 1WD8A 2C1PA 3ZE1F 5KAQG 1M56B 1SBSL 5LGJB 1LD9A 1G9NC 4P48A 2IPUK 4AK2A 4D8PB 1MFAH 5KJ4A 2ZAIA 5HHOE 2B0SH 1MDAA 1FL5A 2EIZB 3HJ0A 5F6IB 4MZRA 4JNXA 3NQIA 1DUYB 3HBGA 1OGAD 6PAZA 2A6IB 2F5BH 2APWA 5I6MA 3QZPA 4B50A 3CFDA 2E4FA 5F7HA 4ZFZA 1WWAX 2LU3A 4TVSa 5FGBC 1QSEA 5B1BB 3S4SB 2XY2A 1OSPL 1U21A 4W9ZA 5IEKB 1YEHH 4W4OA 4HHAA 4LRIA 5FYLL 2EKSB 4Z7VB 1QRNB 2ED8A 1LP9A 3CU7A 2BOLA 3NACH 4MSWA 3LEYL 4YSOA 4X6CA 2WWMC 4JZNA 1NUGA 4S0SD 5EU5A 5C2BH 2QSTA 3WL9B 2CIIB 3GEWB 2DLEA 4S1RH 4B97A 5JW4M 2C1OB 2Y06H 3U6XA 5H35A 2KLTA 4FCAA 4ONFH 4JFEB 4WI0B 1G94A 1XZ0B 5DHXB 2FJFB 1GS7A 4MMXB 2CKBA 5CEXB 1T4KB 3ARXA 1KPVB 3A22A 1EEYA 3U4EB 2YPVL 3OC8A 3QDGD 1RJYA 1VHPA 3N55A 1JYWA 3D12B 3QEUB 2GITB 4ZXBC 4G1MA 3BKMH 3F6JA 4BXVA 3NH7L 4DKFH 3HG2A 5TK2A 4I77L 4P57A 2EACA 1PTZA 4YS4A 5ELIA 4OF8A 3L7FB 4XP5L 4PCYA 1MPAL 2WXNA 3AS3A 1FFTB 4ZOAA 1DEEA 3FQWA 1CK0H 5F88A 4P4KD 5DHVH 4LQ1A 5IOPB 4YXKH 1PG7H 2AK1L 5EBLA 5JHDA 4KH2A 4HPYL 2MTAA 1TNMA 3UIYA 1W8OA 4UQ9A 1EBAA 4ANVA 4F7EB 2X9WA 2ZOUA 3FZUD 1AXSB 4JG1H 4X5XB 5BXFB 1RHFA 2GBAA 5T1JA 1RL1A 2AJXH 4M7LL 4N20A 3B1TA 1EWHA 3ZTCC 5G5DA 1OPOA 4U1JA 4OM1L 1OZUA 3UYRH 3WMSA 4L4VA 1F56A 2YEZA 4G3YH 1MFDL 3L4TA 3WELA 1I53A 2NY2B 3TJHD 2Q7NA 3DUSA 1HSBA 5IHBA 4FOMA 4PJFE 2W60B 3BZFA 4OJCA 4OFVA 2PWDA 5J1AA 5C0BD 3GMLA 4BKSC 3RVTD 1I3UA 4E0RA 1HWHB 5HBBA 3CVHH 4ZW6A 4HCIA 4BEIA 4MHHI 3VJ6B 2ADIA 1A9BA 2J1WA 4U6XA 4XVSH 1W72A 5JQHC 5IM7B 3QJSB 1MFAL 1KN4H 2OL3H 2Z31A 4B6ZA 5KSAA 2XN0A 1RMFL 5DD1H 2IEPA 4TVPD 1DVFD 2EDKA 4MJ5A 4BSVB 2V33A 5E00A 4XVUD 4LHJB 4BJLA 2J3SA 1JGVH 4JHBA 1CFVL 3NCMA 3QCTH 2V2WB 4YNYB 4QXTB 4O58L 3E38A 1DJXA 4V1DB 3ARZA 5L9DH 5TGBB 3ILEA 3RNQB 2YLKA 3BX7C 1JK8B 1AGCA 2JK5B 4GP8B 4OZHE 2NYYD 2ATKB 3CG8A 4XNUH 5CLZA 4A66A 3ALPA 2CDEB 4YC2C 2A4EA 5GJTH 3DO7B 2AEQL 4HV8B 5C2BL 1KYDA 4N0UA 1J0KA 2VLMD 4XNMB 5LGKA 1FUNA 3E3QC 3M6DA 1QTPA 4MAUH 3LIUA 4YWGH 4GG6A 3WG7B 2Y06L 4ONFL 5HHQB 2QPEB 2HT3C 3A5VA 3M88A 3V0JA 3VWKC 1MCJA 4IMLA 5I19H 4IBQA 1E50A 2DYRB 1TQSA 3UG4A 2DWXA 2O6EA 2Q76B 1OCWL 3FCUB 3CDYA 3MOBH 3QFDA 5B1CA 3BKML 1MW3A 2KI6A 2VMCA 2HZHA 2WZAA 2DJ4A 3HC4H 3NDZE 1CLOL 4JFUA 5EUOF 3SJVE 3WEOA 1I7TA 4Y16B 3U7YH 4DKEH 5FO7A 5DJYB 3LDBB 3M8OH 4L9LB 2KS0A 4Y5YA 5DD6A 3BESR 4HIXH 4L8SC 5FF6A 3HNSH 1U91A 4U1KA 1CK0L 5A2JH 5C0FB 2E9GA 1XB8A 3DX1A 3GSXA 2HLFC 5KS9A 5D4QA 3V6OE 1PG7L 3H3PH 3Q2NA 1BVLB 4ODTH 2VR4A 1JNJA 2AEIT 4OBRA 2F74B 5EO1B 4ZMTA 1HOEA 2GG1A 2WOBA 4JG1L 2ZX6A 2B39A 1KSRA 1LDPL 5IB3A 2X12A 2PYEE 2CRMA 1LEGB 3MRGA 4DFIA 2LLLA 4U3XA 1AAJA 2AJXL 5DC9B 4GRWH 2TAAA 4JO3H 2MOVA 4ZD3H 3C2AH 4IIZA 1JFHA 4HQQL 4G3YL 1MHCB 3FT4B 3IVKB 3DDGA 1G1OA 3MLWH 4PREA 1ZHLB 5F7AA 2O6PA 5BOPA 4ENEC 4OW6A 1RZIB 2VERN 2YARA 3GBML 1CG9B 3QXVA 3HUJE 3L4UA 2X4PA 3AG2B 2WWKO 2QL1A 3CVHL 1P84K 4KV5E 4Y19E 3BCFA 3K71B 4JPIB 2BNQE 4W6WB 4XVSL 4AXWB 5M95B 1UD3A 3TPUB 1CGTA 5E5MA 2YA0A 3ZKNC 2OL3L 2VR8A 2XA8H 4QD2E 5D7SH 3KEDA 4N9GB 3ARWA 2RB8A 1TUPA 3H7BA 2YD7A 3AREA 3WFHA 4DVRL 3VH8B 1I1RA 3IEAA 1TDQA 1KF9B 2X7LB 2NYKA 4C56E 3BKYL 2VLJA 1OB1A 3JWOH 4HT1L 2X0WA 1Q38A 1JGVL 2WUBL 1EERB 1JIBA 2LLNA 1J0IA 2QZ5A 3QCTL 1U8OA 4YHZL 2ZKHH 2WZ0A 3RPIA 3F7YA 5IW1B 3AT9A 4GH7B 5C6TH 1ODAA 2ZYSA 4ZQKB 4FTVE 2HJFB 1I3RA 3UFIA 3FJTA 4XN4A 1IFGA 1IL1B 2CNZA 1JWSB 1H0DB 3TM6A 4DH2A 1MVFA 1K3IA 3VX1A 1IBYA 4BCZA 1EK3A 1LO5B 1OK8A 1NCTA 3LV3A 4RZCA 1AQDB 5BO0D 4R5TA 3NIFB 5A1AA 4F7TA 1N67A 4ZAKC 5J8OA 4YHPB 5IT2H 3B9KB 5C0GB 4LKCB 3TGXA 4PJ7F 1MFEL 3MRIB 2ZXQA 4YWGL 2IMNA 3VFPA 4JFWA 3SKOB 1A3RL 1XHHA 3DX9B 1PEWA 3PGDA 1X7QB 2AXHA 1JPEA 3J2PA 2ESVE 3BVTA 3JWNE 4DPRA 3QJFB 1K85A 3RWCA 4EF3A 1S9VB 1Q9WB 3FCGA 3MOBL 3BP4A 4Z0XB 1G6RL 4JJHA 3P4OB 1J9RA 3FU7A 4DKEL 1FFNA 2P5WD 4JDEA 3U7YL 5E2TH 3D69B 4H5SA 1HL9A 4KZDH 2WCPA 5FLUA 1I1FA 2HJLB 4ADGA 4HIXL 1NANI 2J6WA 1AGFB 2UYLA 3H3PL 4L3EA 4PRAB 2HFFA 2HRLA 2ZCZA 4GW1A 3IMRA 1JAEA 1GR7A 4FFVC 1KJ2B 4PB0H 3WNJA 4U6YA 4WV1B 4DEWA 4N3TA 3QQ4A 3I02A 4K4KA 3NJNA 2DIAA 1KYUA 3GBDA 4J8RA 3D50A 4ZNEE 4IKNA 4YBQD 1NCDL 2VCOA 3FCSA 4JO3L 4QXVA 4DQOH 3C2AL 5AW5B 4NC0B 1UWGH 4KUZH 3Q8FA 4S1SL 2G2RB 2TRHA 4FNPA 2CGZA 2A6KB 4UDUB 3VXNA 1IEBA 1ZJAA 2DQDH 3LQAH 3Q2VA 2GIXA 1R0AH 3SOTA 5GRVL 4QHLA 4G8FB 1RURH 5HPMA 1I8MB 3P0YL 4DP4X 2FECL 4HMDA 5D1ZA 1NCCH 2LTQC 2WVSA 2J25A 2HVKB 4OT1H 1RLWA 2EDJA 1OVZA 2ZKYA 3Q2CA 4IRZA 4NSKB 2XA8L 2GJJA 2H7WA 3ZHDA 5CR1A 4HKJB 1CFTB 3QZBA 4GUOA 1IFRA 1NGZB 2XFXA 3DV6B 3IPEA 4F8NA 3LH9A 5I1LA 1MN4A 3ZE2E 3JWOL 2XA3A 5KSVA 1KULA 2X9ZA 3MLZL 3QUML 2FRGP 5KBKA 4YDNA 4RMUA 2B59B 4YHYC 3EDEA 1WJ3A 3CPLB 3KNBB 4FNTA 4JRXB 1T04A 2K8QA 2MQCA 4LNVA 2NW2B 1P5UC 1M3IA 1OGAE 5IJVB 1H3XA 1MRCL 2PR9A 4ZTPH 4RRPA 3S5ZA 4LEOA 4W70A 3MV8D 2F1EA 1KBKA 2XN1A 3MCYA 5EEXA 5IW3A 3MNWB 1GZHC 2VMJA 3IJYA 1DSYA 5HYFA 4EJ1C 2VDML 5DS8B 4YDLC 2HVJA 1YPZB 3IDJB 4IRJD 3VFSA 2BCKA 1LEKB 4H25B 1D5XB 2Y3NA 4MNQB 1DP0A 3HZMA 1R5VA 3P54A 3PDGA 3IB4A 4OCMC 2C26A 4PBXA 2Z92B 4S0TD 1NIBA 3GJFA 3B2UD 4P23D 1MCWM 2ENSA 4NOBA 4TLTA 1NPUA 3BKCH 2X88A 4HFWA 3TJEL 4IOSA 4UZUA 1BMZA 1U8LA 3DJRA 2JXMA 4WTZA 4N2CA 1KY7A 3ASOB 4KDTC 5B38A 4LASL 1A1NB 1XSIA 3V6FA 2FLRT 3SY0B 3P4MA 3MRFA 4KZDL 3E0GA 2JIXD 1T0PB 4UOW0 4Q9BA 2F2HA 2OYPA 4A2EA 2GAZB 3SPCA 3QDGE 3R19A 4PWFA 4NCDA 1A22B 2HRHA 5DEFA 1S9KC 1CO1A 4XMPL 3F7KA 4PB0L 5D7JA 4HIJB 4U3SB 5AOKA 4NC1C 4PRHB 1G7LA 3VB9A 4QJ5B 3PXLA 2ARJQ 5ANMA 3L1FA 3GM8A 5AB9A 1B6DA 4G59C 3P02A 4DQOL 4GFXA 4LT7A 1OGTA 4KUZL 5DJXB 1ZXQA 4WW1B 4J3TA 3ZIYA 3RFZC 4OGXL 1M6OB 3I6KB 1GY2A 5CIPH 1AGEB 1A4JB 2DQDL 2NLJA 1FAKT 3LQAL 5FECA 1IGFH 5IVXE 2F54A 2IJ0C 2GFBA 3UAJD 1RURL 2W94A 4OIIH 1EO8H 4R0LB 4PGCB 1JS4A 1YAIA 4F37F 5BOJA 1MH5B 4MCZB 1OKEA 2CU9A 3BOVA 1NCCL 2A0LD 2E75C 3JWOC 4BFKA 1FORH 3DK2A 4ZO6A 3BDXA 4AJWA 4YE0A 3WEXA 5ESQB 1QPKA 2XN2A 2ADGA 3ESMA 4PJIB 1XCTB 1UUNA 3Q2LA 1I4FA 4KKQA 1WBXB 4ELME 1IBBA 3ARYA 1D9KB 2MOQA 1DYZA 5DWPA 1G7QA 3R7RA 2R1WA 5HVHB 2ILLA 2G30A 1FHGA 3GBEA 2F68X 3FH7A 4UQDA 1ADQH 1V55B 2C3VB 4G7QB 4MDIA 2VXTH 3ARSA 1JI1A 5EF2A 1INEL 3IFOB 3O45B 3OB0H 1UD2A 3CFKB 4ZTPL 3IRZA 5TE6L 2R7EA 2ZF9A 4FQPA 4NQVA 3IAPA 4RDQG 5TH2A 5AKTA 3ZKMC 1GS8A 4H13C 3QO1A 1VDGA 2ZXAA 3U9PH 1MDTA 1IM9D 3QWNA 4EI5D 4L8DA 2AV7B 4QCIA 4BFRA 4APXB 1K4CB 1YLBB 1NWPA 2H32H 3U6RA 3W2DH 1WFIA 5T1DH 3RU8L 4Z7OB 4P9HL 1I8UA 3ULUF 3IETA 3Q05A 2W0FA 1HEZB 4A04A 3DX8B 2VLME 1MW2A 1E9QA 3TA3C 1I9EA 3D4GA 5E8NA 3QXAA 4ERSH 4IRSC 4PW3A 4PHZA 3VW3H 3G6AB 2OJ1A 3KJ4C 2K6YA 4GXFA 4DUVA 1A21A 3D05A 1I9IH 4IOIA 2DQHL 3PL6A 1SUJA 5CS7A 3TO4C 1H3WM 3GXNA 3RP1A 2V7NB 3FPXA 3PNRB 4L2YA 3C6LC 4GEJA 1ITCA 1HDMA 5J13B 3EF7A 2EDEA 3V4VA 3UZQB 1OQXA 1NCUA 3VRIB 3HC0B 5JPNB 2WQVA 4UQCA 1R3JA 3HRPA 3LQAC 3QDJD 1GMIA 4K9EL 5CXPA 1BM7A 2ZOKA 4RH4A 5FWQA 4KK8C 3WY2A 3ZRSA 2FO4B 4AVIA 2OBGA 4ADJA 4QRUB 2EJ1A 5EA0H 4H2CA 2AANA 5D8JH 3RJOA 1NMAH 4LLDB 4AIZA 4AYEC 4V33A 4B9GA 2PO6C 1TU2A 3SYCA 3O4LA 1IGFL 3LHAA 3QNYB 2XT1B 4OCRH 1VGKA 5F7EL 4P2OA 4W9GC 4OSUH 4QLRA 4Y4KA 1F0LA 4PVLA 2OSWA 2R23B 5D1ZD 3AAZB 4PJDE 3QARA 3IDGB 4OKDA 5D93C 1FORL 3JV6B 4NIYE 1QLEB 2UY7A 3ZIMA 1QFUL 3SBWC 4F2MA 3ZSTA 4MA7H 4P59H 3CQQA 2X41A 3LNDA 4L0ZA 1L7IL 4RA3A 1B4TA 2BFGA 2DL2A 2QVKA 1JN6B 1K2DA 3GD1C 4DGUA 2I5YL 3RWIB 2WLNA 1FYTA 1C8PA 3L6FA 3N0AA 1JF5A 1GTNA 1A8ZA 2WAHA 3CFEB 3ZT6A 3LZNA 1ADQL 4HJTA 4AGPA 2VXTL 3HAEA 1KXTA 3TCLB 5KBMA 1B0GB 3L1EA 3PNWB 4KDVA 1FCCA 5DQJB 3X13B 4ZFGH 5I6KA 3QRFM 3HG1D 4LLWB 2X6AA 2ZONA 4LLYA 5I5JA 4KZEL 1XCXA 3NIGF 3IDMB 3W9EB 2ZUQC 1DQQB 2ITEA 3O8XB 4Z0BH 5GGTH 1CL7L 1K6QH 3MNVB 1P7BA 5FDWB 1SZNA 1KB5A 4XNAA 5B1JC 1ZLDA 4P9HC 1SM3L 3HE7C 4GSXA 5FO9B 3T0VA 5GS1A 5KTEH 4ZXBB 3U9PL 3VXOB 3DSNB 4PJGE 3U1SH 3QA3A 4G71B 1U8HA 2YAFA 1YEFH 3WFZA 1ZVNA 4XOEA 2RH0A 4IKLA 2ZT9C 2EE0A 4B96A 4JFXA 4U1SA 4X7TB 3W2DL 2WLIA 4WTZG 5T1DL 2NDFA 5B38G 4HJJH 2H6PB 4HUNB 5E8DL 3K4DA 2P48B 2YWYA 1T7WA 4XXWA 5SX4I 3BAEH 3KLAB 1NM9A 2QJDA 2UXVA 3SGEI 1DLFH 5BUPA 4UQ2B 4NRZA 2VDKB 3J07A 1YG9A 1NDGB 4TMPA 3QQDA 2J20A 3HC3H 5D1QA 3QVAA 1MI5A 5DEJA 3VW3L 5DQ9B 1RZJH 2E4TA 4PJCE 4GIAA 5L4IA 1E7VA 1ONQB 2R56H 1LWHA 2CLZB 4J8QA 3NESA 4ODUB 4DNLA 2LR4A 4K9EC 2WBJA 1ZGLB 1FNGA 4IK6A 4PS3A 2WWNA 4NNYB 3OGCB 3RKDD 3ABZA 4LMQE 4G83A 3GDBA 5D7JD 2YXFA 4H40A 1YQVL 4PV9A 4XWOD 3IGAB 5EIIA 4OZFA 3L3IA 1JWMB 2P5WE 3LN9A 3SDXF 3NP4A 3MLRL 5LAXA 1JZ8A 3GGWA 1AHWC 3AWGA 1CLZH 5EA0L 5JXAH 1RIVL 5D8JL 4PY7B 3MRQA 1NMAL 2C9PA 5F44A 3D5OF 5E6YA 5EU4B 3EYOA 1HXMB 2MWCA 4PRPB 3DBXA 4OCRL 2F54D 1UOVA 1KB5L 4W6YB 2D4DA 2RHEA 3B2PA 2DDQH 5I1AB 5I74C 4OSUL 3T3ME 4FQIL 4RMBA 1L0PA 2VYRE 3REWA 3FUJA 1RHHA 3MC0A 4K15A 3RBGA 2E7LA 3QORA 1ZHNA 3H2QA 4YLCA 3LKPA 5CWSA 3OZLA 4M02A 3VXUD 3J8F7 1E2ZA 3TN0C 4ZUUA 4BFEA 2AQQA 3MU3A 2YRBA 5AKSA 4P59L 2YAQA 4U1LB 3L16A 3AXHA 4LSUL 5DZVA 1SLXA 4NO2A 5HGGS 4N0RA 3O3EA 4RETB 1CIUA 5AVRB 1V3LA 3ZPDA 2GTZA 4YC2B 1P84J 3GMPA 1RZGB 1FG2B 1JV5A 2NY4C 2VSMB 1GAFH 3ETSA 3MRRB 4QY8B 3GMMB 1CYWA 1CXKA 1OTSC 4OIBA 3CN1A 4ZOCA 2VAAB 1BSIA 3EYFA 4ZFGL 4PJXE 3DIFA 2X1WL 2OAAA 1SJEB 1YYLH 4YJZL 5IB4B 4MVBC 1EFXD 3VWKB 3SBRA 4HIEA 1FV1B 4Z7UF 4Z0BL 3VACA 1K6QL 1W16A 1JZ5A 3I6GA 3VCLA 3GLDA 1JNNH 1EJ8A 2CPUA 5KTEL 3DPBB 3DUUA 5H37H 5HJ3B 3QXDB 1Y1UA 2J72A 2PTTA 4P2OC 2W9EL 4RMVA 4HJ0D 1YEFL 4JZOA 3CZFA 2XV0A 4Y4FC 1L9MA 4ZFZB 4NP9A 4LIQE 2F7QA 2B9BA 2WANA 2VTFA 1WFOA 3IJSB 1WZKA 5C0AB 1UGKA 4L8SB 3F00A 4YX2H 4HJJL 1DQDH 1Y0LA 3J27A 3MV8E 4JO1H 3ARDA 3BAEL 1CR9H 4PD4K 1DLFL 3D25A 3N06B 2VZOA 1H3GA 5DHMC 4UBDC 3MRMA 1SXNA 2X4OA 3OX8A 4A6YL 5IHZB 3ET9F 3HC3L 2NR6C 1ORSA 5DEZA 2IG2L 1QW9A 5IUSA 4W9JC 1ROCA 1PVHA 5EU5B 3WV0A 3HI6L 4JQIH 4NZRH 3S3SA 2D03H 1BIIB 4P2YA 3JWNH 1W0VA 5I28A 5KW9H 2V4LA 1BXAA 3ML9A 35C8H 4TNEA 4FFYH 3LZLA 5EOCJ 3QIUA 5IIEA 1J0ZA 3ZDZB 5KSBA 5KOVC 3ZZQA 4OV6F 4Q6IC 1KLGB 5IBLC 1XBRA 4LGSB 5LBGA 2FQDA 3RL1A 2ITCA 4A7GF 3B5GA 1IVLA 2XBZA 3TL5A 1S3KL 5TDNA 5BO1H 1CLZL 15C8H 4XCYB 4NQED 1FGVL 1T6WA 2AQ3A 3G9VA 3MLVH 1S7RA 3O0LA 4QXWA 4WU7B 3SQBB 3KBPA 4P5KB 4NWTL 3ZVVA 5CU9A 4O2CB 3O4LD 1R3IH 3O3DB 3PWPA 2LOEA 4DGYL 5A2AA 2X4SA 1PYWB 4OIAA 4P5TC 2DDQL 4KJWC 5ESAB 3ZDYE 2KUTA 2WTPA 1XF2A 3ZYOA 2IAMA 4C8XA 1F5WA 4N86A 2X2IA 1IAMA 4PJAF 4AQ1A 3T0DA 1CYXA 2JCCF 2XTSA 4XMTA 2YD5A 3IPBA 2VZTA 2JI2A 5A2IH 1Q72H 5MP6H 2YN3A 1E5YA 3DUHA 4CU8A 3UJJH 1CFQA 2R0ZL 3L3DB 2I27N 4OCLC 5IBTL 1QR4A 1G7MB 1HEHC 5IFJA 2IC2A 4WNQA 3HAEG 3PQYA 4E9XA 4R84A 5D6DC 3RZCC 4G6ML 4PW9A 3S36H 1GAFL 2A6JB 4ZAKB 4I0PD 2YPLA 3GMLB 3ZE0E 1GH7A 2BP0A 3S0PA 2AJUH 4J39A 1JV2A 4Z6AT 3L95B 3FMGH 4RIRA 5BS0B 1P6FA 1QSVA 1YYLL 4JY4A 2K9UA 4ZNCD 3FB7A 1E6OH 1QYGH 4MZIA 2EDHA 3S5YA 4EKXA 5I8OL 3KDMB 1J1PH 4WEBL 3L8QA 1K4DB 1JNNL 3C5ZA 2VAJA 4Y9BA 4Y1AD 2IH9A 4NM8H 4H0HB 1NGYA 3TIEA 1MHPL 2Z4TA 2YUVA 4HLEA 3L2MA 1UD8A 3NCYS 4PUBH 4BIKA 4BUQA 1E27A 1T4WA 1IC4H 4FHKA 3PHQB 1FZMB 3EJUA 4KKBD 3RWJB 2E7LC 3WTWA 3RHWK 2NCMA 2HP4A 4G8IB 1X4ZA 2AQRA 3H9ZA 3NCJH 4M9OA 5EU3B 5GGSA 4JO1L 1HHGA 1CR9L 3K72B 1KTRL 1UXWA 4PGDB 3PJLA 1AGCB 3DX6A 3QEQB 4DESA 4AGLA 5M7QA 3V6ZA 1XF5B 5EEWA 4CA4A 4Z7WF 1EX0A 1X5JA 5D7LA 1ETA1 2VN6A 4WWKA 1U33A 4NZRL 2H41A 4JQIL 4XNZC 1D5ZB 4B7IA 2MHAA 4K71C 4I4WA 4IK7A 3CVHB 4UZSA 4NB7A 2C5DC 2ZSVA 3CMOL 1TJHH 4FL4C 4HUWB 4OZFG 4JM2A 5FYJU 5IMOB 2V3DA 1HZLA 3H3BC 3KW8A 5DMIH 35C8L 1DQVA 1MKFA 2ZXEB 3CDZB 3V6OC 4AUJA 3UZVB 2BSEA 1SJMA 1N0LB 2AITA 3R0MA 3SPIA 3UO1L 1ZGLM 5HHNB 3LXCA 5E56A 2YWZA 2OL3B 3KVPA 1DJGA 2HFGL 4JPKH 3QWRD 1A2YA 2CCVA 1B3JA 4B53A 5KN5A 2RMNA 4CGUB 1EHKB 2J2ZB 4XHQA 3L3KA 2B5IB 2VLRB 3HIZA 1HHIB 4K94L 5EBGA 1F4YH 2LTQB 4Y2DD 3C6SA 1G7PA 5FWRA 3S2AA 1MZZA 3VMOA 1R3IL 3PY9A 5EF3A 4MS6A 4YHIB 1WITA 2Y36L 3LZFH 4CDHA 3QDJE 5C08A 4L48A 4JE4B 4KJYB 3QK0A 5HVWA 1MUJA 3ILPB 2UWEB 3UTTD 4MQSB 4AIOA 2E9JA 2EO7A 2FATH 4YHYB 3GS0A 3M1CA 1KXQA 1Q72L 3BLPX 5GSVA 5MP6L 3EO9H 2Y69B 1AJ7H 1E4XL 2R1YB 3W11D 1KFGA 5BJTA 1OT4A 1P5UB 4WO4D 5F3BA 4WUKH 2FECI 3S5LB 4CJ1A 3N6YA 4IGBD 1G0DA 1OAUH 4QR7A 3S36L 5T1LD 1CD9B 4W9LC 2BY3A 4XPAL 3F64A 1C5CH 3FO1A 3DI2B 2Y7NA 4H26A 5JXEA 2H3NB 3OJMB 4JRYA 4FA7B 1E42A 2XYBA 5BZZA 1Q4NX 4MJ6B 1G6RB 1NA8A 2AJUL 2QVFB 2NXZC 5JW3H 5E7FA 3MLSH 3LKQB 4YSDA 3CFJA 2BNUB 2YD0A 4LPXA 5FHBL 1E6OL 1QYGL 3SE3A 2COVD 1IJNA 4H0LC 3BP7A 4U1IA 3BO8B 4QEGA 3SKJL 4NQSB 1GPOH 3CGTA 4NM8L 2WIMA 1L9PA 3V0WL 1QBML 1TQBC 1CVSC 4J4PD 3U0TB 2VJ0A 1ASQA 2I60H 4HBCL 1WFMA 2VLJB 4K2UH 5DFWH 5E6RB 3HG1E 4TVPH 2KC0A 2N1KA 3EFDL 5HGBB 3TYGL 3A21A 4RSVA 4XCEB 5EORH 1HYSC 4FNUA 3NCJL 3SGJC 1EZSA 4E5XA 1NMBH 3WTUA 3KCWA 4J3UA 4ATWA 4ZFOL 1P4BH 4GRWB 4PJHF 3WS3A 3QIBA 1ZTMA 7PAZA 5TQ0H 3OKMA 32C2A 4M48H 2D2OA 1MJ7L 5AOMA 3SN6N 2IPKA 3RWDB 1GMEA 5E8EA 2C34A 5K59F 3O2DA 4FQXA 4FDWA 1MNNA 1WS7A 2DBLH 3NZHH 4CMMB 4F15C 1BQLL 1QFOA 3BDYL 5IKCA 3RFZB 4K94C 4P3CH 3LZOA 4UQAA 2CGYA 4KK5D 3RDTD 3G6JF 4XBGA 1YECH 3H3KA 2BC4B 4YDJB 4JPKL 4NIKB 2I7SA 2Z35A 4CAGA 2BHZA 3HW7A 4N24A 5B3JE 4ZJ9A 3CLEL 3KPLA 4KJPC 2LFEA 1HNGA 3BSZA 2XV3A 4OLWL 2ZXCA 3QUMB 3W5MA 3T0XA 3AACA 3VXQB 1YYCA 2OMUA 2IH3A 4XODA 3FUDA 2A77H 5DJAA 3FQ4A 3LZFL 5DJDB 4QNPE 3ME0A 5B7EA 3SQOH 4CSTA 1DBJH 5I75C 1I85C 3Q13A 2GCYA 4J1UA 3ZO0A 2EUWA 3UC2A 2X0UA 1LNUA 4R9HA 4N8UA 4B5ZA 5ID0A 2EYSB 5BVJB 2FATL 3QXWA 3PGCA 4NRYA 2N7BA 4LLQB 1KCKA 2DI9A 5AW2B 3EBIA 1OW0A 4GRMB 5AYQA 1IAOA 3EO9L 3G5YB 1BQRA 2VDMB 4QTHB 1EPFA 1KPUA 5CJOH 2F54E 1I8KA 3MV11 4D9QD 5B3SB 2GEEA 3ABGA 3W56A 1RK0B 4JM2C 1QEWA 1QLFB 3WFEL 2HX7A 5CP3A 1CBVL 2AMGA 1S9XA 3OAWA 5EUOA 4IS6A 1C5CL 1V27A 2FT6A 5EH1A 1WWCA 5E70A 3VXUE 4IQHA 2V9UA 5J12C 3MBEA 4QHLB 1L9SA 4QAWA 2PNDA 2EXTA 3CUPB 5I1JH 1JF6A 2R59A 2Y4SA 3AZUA 3S7GA 3NSCA 2OSLA 1NGXB 2YXVA 2ZX5A 3IE4A 3MLSL 4G9FB 4H8PA 1X6NA 3T77A 1LGVA 5K5YA 1BG9A 3IRPX 1GPOL 2VDPH 4NO0D 1QO3A 4FABH 2DYPA 2J1ZA 1OE2A 2OMXA 4LPYA 4PJ5E 1SYSA 2WO2B 3TA3B 2J43A 2WQWA 4IRSB 4K2UL 5IQ7H 1CICA 2WMPA 1WBZA 3UG5A 1KELH 3KJ4B 4MNGE 3U4KA 3WTSA 4WRLA 3BEVA 1THCA 3BUQA 3T6VA 4L4JA 3B3IB 4XMWA 3TO4B 4GW5A 1A9VA 1FDLH 2QSQA 1E9PB 3TIDA 3D18B 5KYUB 5I1EH 5DVKA 1MOEA 3C6LB 4L3FA 2Q5BA 5LNDA 4TNVF 4M48L 1UXSA 3OKNB 5D2LB 1R3LA 1DBBH 4QXGL 1FFOA 4I2XA 2XWTA 3PHSA 3RJQB 1XBDA 3AABA 4OGAD 5IV2A 3U9WA 1AQKL 2DBLL 3P0VH 1LMKA 4F8TA 8CGTA 3BUPA 4AG4L 2GUOA 1G5GA 2F53B 1U92B 2W9LA 1T1WB 1BYPA 1FP5A 1A5FH 1R5VB 2OXHA 4N8VA 1JNLH 1A7NH 4WHYG 2PO6B 2NX5D 3GMNA 2MPAH 5HYJD 1XMWA 3MRBA 2Z91B 3QCVH 3CHSA 4LDOB 2K7PA 5HGDB 4AV5A 3RLSA 4K5OA 5FW6A 1R33A 2OTWA 4P46D 1UD4A 2NDGA 2XN9A 1UM6H 4QOKA 4F93B 2FJHB 1NIDA 1WV7T 5D93B 1HESA 1X5KA 2CALA 2YGOA 3LNGA 4P4KC 4LSVL 1AY1L 3LEXB 4AW4A 3GLEA 4WW2F 2LABA 3M86A 3DVGA 1KYOK 1F2XK 3N42B 3OAUH 1FSKC 3JVFC 2KT6A 1IILE 5LUMA 4D9LH 3IFPB 5IQMA 1DBJL 2Y23A 2V6HA 4PJ7A 4YHNA 5DVNA 5BZWA 2XQYA 3DA0A 2Q8AH 3UC0H 1LLAA 4NQEE 1FO0A 1QNZH 2FJSA 3SE4C 2XG5A 4M62H 4E2OA 3L45A 1U2HA 1FN4A 3O4LE 4G8EB 5C86A 1MWAA 4OZIB 2B3IA 3HFMH 2NQDA 4JCMA 3BHBB 4GI6A 4FXTA 5E9AA 2ZUQB 3ECVA 4HKBB 3RVTC 1F6AA 4PTUB 1ZLVK 1J05A 2YMOA 5HYSA 3X1GA 3UAAA 2NLJB 3HE7B 5D5MB 4HG4K 2PF6A 3SDYL 2K6WA 5I1JL 2PPEA 1YEKH 2CCWA 2YUZA 4XMKH 5HVGB 1NCNA 8FABA 4DT2A 1SEBA 4GAGH 4Z3TA 3LKNB 4BDVB 3BXNA 1U3ZA 4N1HB 5E5UB 2Q2LA 3MRHB 4NBZB 1DVFC 1MQKH 4ZODA 3BPNC 2Z0UA 5FK9A 2VDPL 4WWPA 1LTXA 2QKIA 5HYEA 1KWGA 2CM6A 4XVUC 4FABL 2FT7A 4HK0A 1JZ3A 4DZ8A 5FOBB 2BXZA 1YSOA 4HBQA 2QGCA 5AB1A 3AY2A 5CSGA 5IQ7L 3KXFE 4E5XG 4PWIA 4Q6YA 1NFDE 3W37A 1KELL 1WC7B 3VFMB 5DUJA 1CL7I 3VE0B 5I5MA 3BD5A 3VXMA 3I3DA 4OD3H 5F7DA 4DTGH 2JNZA 5IHUH 1AKJD 5I1EL 2QTEA 4Y1AE 4DETA 3FQYA 4AJYV 2WGXA 3BIKB 1JGLH 2Y1VA 4JFOB 3KHOA 4E9RA 1Y6NR 1DBBL 1HOCB 1NWOA 5CIPB 5I5RA 3DOSA 4NQVB 25C8H 2TSBA 4LIQH 3NCYP 1XB6A 2IDUA 3DRQB 2C7UA 2BZCA 3OZ9L 5KYXA 3QG6A 4XH2A 3P0VL 3KYNA 1AHWB 3N85H 3ZL4H 4QJ3B 5KYYB 4KDWA 1F18A 1CQYA 1XR9B 3FFCB 1J1OH 3UPCA 2E46A 3B9DA 4L8DB 3U2IA 3QCVL 4Z3FA 1T7XA 3Q6FA 1AQMA 2AQPA 2L7QA 4GYBA 1JGEB 5GZND 4XB7A 5I74B 5CD5D 5AKVA 1JFQH 1URIA 2Q20A 4HZAA 2WW8A 1UM6L 4ALAH 3ZDXE 3TN0B 3QZMA 5DI8A 1BAFL 3GSRA 1QEXA 5I6PA 4UWQB 3ABLB 3LNHA 3OAUL 5HHOB 3L3GB 4HS6B 3TASA 2GHZA 4WI9A 2QKSA 1FNEA 4CADB 4PJ9A 2IAAC 4ZUTA 3LH2H 5JIPA 1NM4A 5CKAA 4RNRB 1PD1A 5LCVA 1G1YA 2DQTH 2VC2H 2Q8AL 1TQTA 2AI0H 3KBEA 4XNQB 3UC0L 2NY4B 3LRSA 3K46A 2M26A 4X4XA 3MCLH 4GQ9H 4M62L 4JQXC 4UM8B 3G08A 4YOKA 5SV4A 3HFML 1WEJH 2IXQB 4N2MA 3MLUH 1RZPA 3L4ZA 5GRJH 4DZBB 5MEPB 3EOBA 4XN2A 5I1GH 3OF6D 3L4WA 4LVHC 3RIFF 4MCMA 1KTJA 1JL8A 1N8ZB 4HC1H 3S37X 3UTTE 4PRID 4X50A 3C60A 2O5XH 3VGEA 4KRMB 1VGEL 3CZSA 2J8UE 1VACA 2EXSA 1VGKB 2QGEA 4UNUA 3WHXB 3KBFA 3MA9H 1YEKL 4P2OB 3N1FC 1S9YA 3EDKA 1L5GA 4GAGL 4Y4FB 5TDOA 4N25A 4DCQA 5AB0A 2DM4A 2BOBB 3DDFA 3FQXB 5FPIA 1UB6B 2XC8A 1C08B 1A3LH 2C9VA 1MQKL 3L2LA 1J1XL 1LE5A 4ELKA 4F2MB 1M2OA 1UH2A 3IJ8A 1NBCA 2OJEA 2V3FA 2ZXGA 1VFAA 3CD4A 2GJRA 1SGKA 2DQUL 3LS4L 3VD5A 4ODWA 1CICD 5I18H 4F1SA 1NPNA 1HSAB 3T65B 3CSFA 1DN2A 1KEGH 3WLBA 2BZ7A 2KPWA 4XGZB 2VXSH 1E4KA 2E5EA 2B08A 5AENA 4NPKA 5IHUL 2ITDB 1N3NB 3HS0A 1Q0EA 4JB9H 3DHJA 3ZTNH 5EZJA 1KBWA 3VRJB 5D2NA 3DGGB 4QRSA 3ESOA 3G5XB 4Q6IB 4JG5A 1SY6H 1GY1A 2AC0A 25C8L 2P26A 5FUCC 4LIQL 4K55A 2PABA 3UTSD 1N8OE 2DLFH 5JORB 4L8BA 1KB5B 2CIKA 4HWBA 1BX2A 1CTMA 3QWOA 2C7FA 3N85L 4N8VG 4X98A 5CO1A 1RJZA 4LU5H 3VG0L 1A02N 1PD0A 1EXGA 3KPPB 1XB3A 1AI1H 2PN5A 1IUZA 4NYLB 4BH8B 4PVBA 1J1OL 4L4TD 1D7FA 4G6FD 1TEYA 2L8AA 3DHMA 5E8OA 4JRLA 1EZVX 4Q89A 2FYYB 3WFDH 4PTTB 4PJFB 3CX5K 4P5TB 2ARJB 3L5XL 4TSCH 2X5PA 2AZUA 5DRXA 1JZFA 1JFQL 3DURA 3MO1B 5IJBC 3JT0A 4GO8A 1A6VH 2GYSA 2XN9D 3GRWA 4FNLH 1J0YA 5T5FA 4ALAL 5HSFA 1KIRB 1Y18B 2BVQA 3D2UA 4JFYA 4Q58C 3D1MC 1TQCC 5KSBE 1JPTL 2GT9A 2OM5A 3LNIA 1JGIA 3L9RA 3HB3C 5EU6A 2XQYG 6CGTA 2MQ0A 4UI2A 1JCVA 1OSZA 4PV1C 3RZCB 3UGUA 4ZI8A 2W81C 3BH9B 3NIDE 4KQ0A 2VC2L 1T2QL 1HKLH 1IZKA 4WDIA 3PP3K 5DXWA 2BHUA 1Q9LB 5I8CA 4GQ9L 5DZOA 3ZZ1A 4GRLA 5JIIA 1W6WA 2L3BA 1A1OA 2YOCA 3BW9B 3SO5A 2N56A 3GSQA 3EH1A 5HYSG 4QF1A 1FL3A 3FCBA 1GGCH 4NQUA 1J5DA 1NAMA 3BVNA 3SEPA 5I1GL 4WGKA 4OZHB 4J3OF 1FNSH 2CQVA 2AQTA 3CLWA 4HC1L 3MUUA 3EYOB 2VN4A 1JGDA 5K9OA 3MSPA 1BZEA 3VI4E 1ED3A 1TT6A 1KPRB 3C5JB 5E99H 5EOCL 3VYPA 1QUNB 5BZDB 3HNVH 4AC2A 1MHEB 1FAIL 4GKSA 3BAKA 4OLYL 1OSEA 3OR7A 4A6YB 3L9EA 1S2EA 5LXGL 4Q2ZB 1PGRB 4IU2B 4TTGA 3OKEB 4HDIA 2DLIA 2QQLL 5AWNH 4IRZH 3KCPB 3VFWA 2YD3A 2PWFA 2R8SH 2CR6A 2DQFA 2AVFA 3GINA 4UNIA 1PAZA 3E2HC 3IFNH 2WLHA 4OB5H 5CMAB 5EU7E 1KGIA 5I18L 3WIFA 5T5FL 1W6LA 4XMXA 1HHJB 2QVMA 3SJVB 4JPVH 1I9RH 4YDVB 3X17A 5I15H 2VXSL 4AQOA 3VXMD 3QCUH 3D39A 1DQLH 1E9OA 4K71B 4WHTA 4DK3A 4FL4B 1CYGA 2X40A 4HSCX 3BZDA 4JB9L 1QA9A 4L1LA 4NAMA 3ZTNL 5KANI 4NHCL 4LEEA 1IE5A 4IHOB 4YL9A 3E6HA 3BFQG 4NQCA 3DHUA 1SY6L 4IRJC 4KKAD 4F9LC 2CA4A 2DLFL 1L9TA 2J88H 3I6GB 4X4YB 2PYEB 4BK5A 3C60C 2D3JA 1QBLH 5B3NA 2MCPH 4FJ6A 1DBKH 1GGIL 3NEXA 3O81A 2PTTB 4NO3B 4R7NA 1AI1L 4OD2A 3QJVB 3U82B 4ALAC 3GHBH 3CZFB 2Z9TA 1U8CB 4EUPB 2HT2D 4OQTH 3SGKC 1N64H 4HCRL 4MJID 4M29A 5HXMA 4OCYH 4PPTA 1S7WA 1IC7H 4AEHH 3ZE1E 2OP4H 2Q3XA 3THMH 3HUJB 3GJFH 1A6VL 3QNXB 1HHKA 1CJYA 4NI6A 3NK4A 4Y19B 1TZAA 1D5MB 2GJ6A 3MRMB 1UQSB 4P49A 2JKNA 3B83A 2BNQB 3MLTB 5EHFA 4CC4A 1NBZB 1X4YA 2CE6A 4KX8A 1J8SA 3FB6A 4N0CD 1SMOA 5L8LB 2NX5E 5HYJE 2J4WH 1FIGL 4LOUD 5I66B 1E4KC 8PAZA 1ACYH 2XKNA 4PU2A 3BAYA 1EUTA 2I9LB 1YNTA 1SVCP 1WT5C 4FZ8H 5D2NC 1HKLL 3ZY7A 1T1XA 2YRLA 1Y1DA 4Y88A 5IFAH 3P30L 3ATDA 3GTTA 3X12B 1XH3B 1T5WA 2EDLA 2KPNA 3FT1A 4FTVB 2NXZB 4HALA 4JY6A 4OLVL 4DUXA 2H2SD 1SJVA 5ABZA 5MI0C 1HH6B 3T8MA 3UPRA 3V5DA 2FJUB 3LMJL 2GTWA 5DF0A 1FNSL 3MXWH 3A4FA 2FL5A 1LK3L 1VKXB 4ZBJA 3UAJC 5FA4A 1TETH 4Z3GA 1OY3B 2WNXA 3HHRB 2ALAA 3FKUS 9CGTA 4OCWL 1TQBB 1XMEB 3EGXB 4E36A 3DXAA 3WSQH 1E4XI 5F72S 4OI8A 3HNVL 4RGOL 2EIMB 1A1MB 2EYRB 2KHAA 4K5PA 3RG1C 3O6FD 5AAWA 1ES0B 4J27A 1YCSA 1C12B 2EDNA 4HU2A 4AJVA 2ESVB 4Q8BA 4ZW7A 5EZLA 1OV8A 3EFOB 3FFOA 5KYWA 1UVQA 5GJSL 3KWWA 4Z7QF 4M8UA 3HI5L 4UT6A 5LXVA 3OHXC 4ODSL 4QYAA 1KTBA 4J6RL 4LVEA 4U2ZA 5I15L 1SYVA 3ARTA 1SOXA 5TE4H 2O4EA 1CU4H 1XGUB 3H2WA 4A67A 2XXFA 1PG7W 3MRCA 2RJMA 3L1OH 1RJLA 1NFAA 4F15B 3H9SA 4YSUA 4A2HA 4GSUA 3ULSA 4PJEE 3V0GA 2FX7L 4HMEA 3OHMB 5IMKB 4NQXB 3BZ5A 2PYFA 4QGTA 2VR9A 3LSOA 3DYMA 3UGXA 1BLNB 3INOA 4AH2B 2GC7C 2J88L 3AQYA 3AMKA 3D85B 1QBLL 5IBUB 2FO8A 2MCPL 3LQMA 1DBKL 3C09C 3TIEB 5IQLA 4GQQA 4BZ1H 7FABH 1YY9C 3FC8A 1ZT4B 1CXLA 4QHUB 5G4OA 2A74A 2FUTA 1WZLA 4NZUH 4OBSA 4PSRA 4OQTL 1OM3H 4PR5A 4B9JA 4OCYL 4LP5A 1HH9B 4AEHL 5JQ6L 1UFGA 1LJMA 2OP4L 4KKLD 3T8XB 3RBSA 5I75B 3VFUA 4FLRA 4OAWA 3U4AA 1TSRA 1KYAA 4EE2A 5CCGE 1E8WA 1BW8A 2J6EA 4HAKA 5FDYA 4UAOC 1BD2A 4GXVH 5J6SA 4B9PA 4G1EB 4XP6L 5ALBH 4FMVA 1QFWH 4POUB 4BELD 5EZOH 1F97A 3VTMA 3W9DA 1ACYL 5JNYB 2QV2A 3QDMA 2NQ3A 3WENA 4JM2B 3WEBA 3MTXA 1MQ8A 2WCSA 4FZ8L 3F6LA 4GLRH 3ZE2B 3TEYA 5ETUA 3CFNA 1HJBC 1ZS8A 4C83B 3BISA 2K4AA 2NXYD 3TV3L 4GRLD 3FB8B 4Z5RA 5FCSH 1PLGL 3V0FA 2HH0H 3MYJA 4YEFA 4P5MB 1ZE3H 3A23A 2X4QA 5F7UA 2IBBA 1MCIA 4BK5C 1KYOJ 2OMWA 1PZAA 3ULUD 4B27A 5A7EA 2HLAB 4OUUA 5BRZA 1HQ4B 5DURD 1NEZA 3MXWL 1CS6A 4N2LA 1OGAB 3GSOB 5D7IB 1UJ3C 2Q86B 1KCVH 4ELDA 1TETL 1NC2D 2EEDA 2OMVB 3DX7B 3S6CA 3CDCA 1ZPLA 3QI9A 3LIZA 4ZFOB 3KYAA 3WSQL 1QHPA 4ZPTA 3GPSA 1WH0A 1YPZF 4WK4B 4X7CC 3TBVA 2CMRL 4X7FC 3PAUA 5DT1L 5E0FA 5AD0A 1PW3A 1E5BA 3RIAF 2HN7B 2CK0H 2R0LL 5TD4A 1EANA 5DMKA 4APQA 1KIPA 4LHUA 2WQSA 5EUOE 4PRIE 3T5WA 5IB5A 4KMTH 1TJGL 3B7YA 2OQJB 4M6AA 4HG4J 2R69H 4MASA 5AVYB 2BSCA 2NNRA 4A7GA 2QHRL 1WICA 4F80A 3AITA 3TBSB 2CUAA 2XZAH 5TE4L 3RYMA 3BZEA 1CU4L 4B3EA 2QSVA 3C8DA 3QHZH 5CKGA 2I07A 4N0YL 3P3YA 3GXPA 4XPGH 1R46A 4HIHB 3AC0A 1SDDB 3O9WD 3M7FB 4WTWA 1OTUD 3N2JA 4NQCD 2X6VA 3MKGA 4Y9CA 3ETBJ 4AYFB 3U1PA 3JV5A 5DRNA 3CN3A 1NH6A 1KJVB 2FK9A 4M61A 1GZQB 1LXMA 1DR9A 5KSUA 3WJMA 1S7XB 4NRXB 1XAUA 2B1OA 3VVWA 4LL9A 3CQFA 4BZ1L 5A2KH 3MJ9H 2JWYA 3PABA 3WY3A 2IPTL 2MNUA 2ZOLA 2VQUA 4P4KB 1YEDA 4HJEA 5IGXH 1O7DE 4AQAA 4MQ7A 1OM3L 4RWYH 2YBRB 2CZNA 2Q3AA 3EJCA 3TLRA 1FSKB 4OLUH 1QABA 1RP9A 2CLRB 3IWUA 4MAYA 4HF5L 2XVKA 3UTSE 3VFNA 5IVXB 3VD4A 1QX1A 1OF2A 1F1GA 1Z9LA 3TV8A 4X0KA 1BVNP 3B9AA 3GS7A 4I89A 2PWHA 1OCCB 2R4RH 5L2JA 1S3RA 3EJYD 4GXVL 4JX0A 4L4TE 3KPMB 1TZIA 4UIMB 5ALBL 5KZCB 2FIKB 1H6UA 2VISA 1GZPB 3RTLA 1EZVY 2Y0SA 4QRRA 4ELMB 3C08H 3AXLB 3SCMA 1NCBL 3NCEB 4QPEA 2I9TB 2HPTA 4NPYB 4ZFFA 3KWUA 4F2FA 4ES9A 2HH0L 2ZAGA 4BV1A 4MFHA 3LKRB 4OZFH 3WNOA 1ZK5A 1KDIA 3C8HA 5F9WC 1BQKA 1K8IA 5IR1B 1Z9NA 3LJ3A 1JYXA 4LOFA 1MCLA 4XP1H 1EAJA 3L1GA 1RZQA 1DVFB 3WI9A 5CJXA 3QJOA 2A6DB 3BPNB 1KCVL 2XIDA 4PJ7E 4RAVA 2A74C 4PJBF 3STLB 3FYIB 1IEHA 4QGYA 1LDSA 4ORZC 3MJ7A 1PS3A 3DXAD 4HS8H 4G6AD 4LEXL 1SOQA 1K3ZA 4IU3A 4DP1X 3QNZB 3BE1L 2Y25A 1R3KB 3SDAA 3PGCB 4LSSH 5JLZB 4N1CA 3ULAB 1AE6H 4Z7OF 1TSHA 1F90H 4PRNB 4L0YA 3EYVA 3Q6GL 3KVQA 4FG6D 4GI8A 2R69L 3LN4B 4NS0A 3FTUA 1H15B 5E6UB 2VDNL 3BPCB 1IAIH 3BUBA 5ICUA 3FU9A 3ZYIA 4AV4A 3CFBB 1LVEA 1Q8MA 2WIIA 5DJCA 3FTSA 4MX7B 1OHZA 3JV4A 4AZ8B 1QWNA 2A83A 2WN3A 1JZDC 1S7SB 3DJ9A 2BIHA 1LL1A 2V7HA 1RFDH 2BVPB 2NUPB 4QT5B 5T1MB 2ERJC 3T77B 1DANU 1ID2A 4DVBB 4LCWA 3VFOB 1LE9B 3VM7A 4HJ0C 5CNHA 1COBA 2Q6WB 3WIHL 4Z77B 2RALA 3V9EA 3VXME 3JYCA 2BPBA 3MJ9L 2APTA 2AW2A 4UU9B 3FDWA 3ARGD 5AYUL 3GXUB 3MRLA 5IGXL 3MCKB 2IH8A 1P0SE 2APFA 5C70A 2PXYA 4OLUL 2YJQA 4AE0A 1JRHL 2DQJH 1JYVA 5LBSL 4OH2A 2VW7A 4JFFD 1ZS2A 1Z5LB 1R24B 4UILH 3B2XA 3STZB 3J7HA 2P5ED 1G4RA 4OGZA 4M03A 5C0IA 1P4LB 1SXBA 4L18A 1NIEA 2R4RL 4O02A 3S96A 1DUZA 1XTLA 1MHHA 1KENH 3KPRA 4BQ9A 2VERA 3SPHA 5BRPA 3CTTA 2D73A 4HOMA 4LCUA 5F0JB 1HHHA 3K6IA 4MJIE 4NUJB 4G80B 5T8IA 2NY3D 1OLZA 3CX5J 3KYOB 5JDJA 1IKOP 1IFHH 3EO1A 3ZJAA 3ARFA 5AEAA 4LVHB 4BKTC 2IH1A 1KIUB 2QVIA 4LMQI 3P3RA 3CZEA 1K72A 2GSGA 4ZW8A 3TC9A 1KBPA 2ADJA 2VDPB 2XIBA 7TAAA 5C7ZA 3DC0A 5SWQA 3NMEA 2ISDA 3ROOB 5JR1H 1NEZG 4QHKJ 1NIFA 2O5ZH 1S4IA 5JDSB 3NJLA 4PLKC 2M8XA 1YNKH 4N87A 5GHWH 1I1YA 5DUPH 4XP1L 4OF7A 3NRQA 2V9QA 4FQ1H 1M4KA 4PJHA 4AVKA 2BCMA 3ZRFC 3GSWB 5I8EA 3GMQA 2FTAA 4ZMOA 2NSQA 3B5TA 1F3DJ 1XSOA 1U95B 5T1KD 3S35H 1KT2B 3FK3A 4WI3A 4HS8L 5D72H 3P77A 1P6WA 4AL8H 1DBML 3C5SA 3SPGA 4PJGB 4FLOA 1ZTXE 2F1BA 5FAAA 5J7CC 1BBDL 3W5NA 2DOCA 4LHUG 3VMPA 5B4MD 4HUXA 1HEJC 1TTBA 2ZCHH 4LSSL 1HXYB 1TMQA 2JCWA 4IW4C 1F90L 2PPFA 3MODL 1SPDA 4PBVC 5BVPH 1K5NA 1DEDA 2VXQA 1TOXA 1VEOA 3AS1A 1XGRA 4RVBA 2CHDA 2N59A 2UZIH 2VM4A 3NSFA 3X2QB 2BHYA 4XMLL 4I0PC 4S11A 1E0OB 2F0CA 1JERA 1FLRH 1W8NA 1Q94A 2D0HA 2J55A 4MDJA 4R5XA 4MBOA 3I75B 2NNAB 2QPSA 3DRTB 4Q6KA 4PJCB 2WLJA 3H9HB 3OQ3B 3H6AA 4QTFA 4MD4A 3RB7A 3X1EA 4K8RC 3RDJA 1RFDL 1KTCA 2KH2B 3MPCA 3JT2A 2N7SA 2DM7A 4I5BA 3SE9H 3BIBX 3BXNB 4FXGC 4MDRA 5I0DA 2OXGA 3BP5A 4WTQA 3ZX1A 3R1GL 3EOTH 5IMLA 3P0GB 2QR0A 1C16A 1EMTL 2YAPA 1DO6A 3RA7L 3ROLB 5DVOA 4KKBC 3GM0A 3WFCL 1T7ZA 3FTYA 4DZ8B 3L3HA 3LRKA 3OD3A 4TF4A 1UH4A 5ISZA 1M42A 4Z9KB 1RUMH 1Q9KB 3GB7B 1TQCB 4FAAB 1U8KB 1XXDC 2BOCB 2OX5B 3HB3B 3KWTA 4XAKD 4ZUWA 1UZGA 2DQJL 5INDA 5F7DB 4LLUB 1RP8A 4Q74A 5C0EB 4UILL 4BHUA 2WAQA 1U9KA 4CNIB 3T3MB 4BFJA 1F1DA 5DS2A 1UH3A 1T7VA 1UKSA 1QQDB 2F58H 3MZGB 1M1SA 1PZ5B 1ZWIA 4OU3A 2VUKA 1DQML 4JVUA 2OI9C 2VXQL 1JSYA 3CIAA 4QRRD 2FBJH 3MLXH 5F3HA 3WKQA 4Q56A 5DCCA 1MFNA 4AVJA 4LDCA 1MXGA 4U1MB 1A4KA 1A14H 2Q10A 4G6JH 3FHQA 5F9JB 1YN6B 4JG9A 4WUUA 4Y2DC 5JR1L 2DV6A 2OYKA 2F08A 5IJKA 1WQVT 2O5ZL 4CDGC 3OKDB 4JFQB 1HVXA 5F1NA 1YNKL 3QRBA 5DUPL 3ES6B 4PP2B 1A6PA 4JKNA 2DIBA 4OD1H 4FKHA 3SDDA 4NUPA 1AXTH 1OL0A 2P7TA 2ZOWA 3QFJE 2NUTA 3W3BA 4ZG1A 3S35L 5PCYA 1QP1A 1AD9B 5MERB 2VSDA 5D72L 4F8PA 5IMMA 3HRZC 3P73B 1ET8A 2VL5A 3E2HB 4AL8L 4PVMA 1UM4H 5E94A 4ZUTB 5JHLA 4BH7A 5AB2A 1OGSA 3ULUE 4BFIA 4MB4A 1DVQA 1OXYA 4WCYH 3PG2A 1QI4A 2ZCHL 5B39G 2DN7A 4JM0A 4GKNB 4LSQH 1MVUA 2NMSA 1R5WA 3FOLA 2W0KA 3PAVA 1NL0L 2IWEA 3LKOB 4OCSL 3MV8B 4X7DC 1BOGB 2Y5EA 5E8PA 3O41B 2Z1KA 4FFZH 4D2NA 1LP9F 2AXJA 3MRPA 3GT6A 5BPPA 4H44C 3BGFC 4BCXA 3QXUA 2WVVB 4ORGB 3ARFC 4IRJB 3WMPA 2UX6A 3GIZH 1BM3H 4X6CF 4F9PA 1S7TA 5FFLA 5IW6B 5J11C 1ZOXA 3SYQA 3PHOA 4WLCA 2X4NB 4AE1A 1IKNA 1DBAL 5LDUA 4P23B 4RFOH 1OK0A 1YEJH 3G5VA 4Y5XC 3SE9L 2UXFA 4HIPA 3GZPA 3NZUA 2EEAA 3RVXD 5E9DB 4J4PC 4DFHA 2UXTA 2JELH 1T0NB 5HHXL 3JVGC 4NM4H 3RVVD 4KNSA 2JIXB 4GEIA 5ERWA 2JQZA 3SE8L 2EVFA 1VAHA 2WVUA 3D0VA 4GI9A 5E95B 1RUML 2VC2B 4S0HA 3ARBA 5F8RC 1YUHB 5IQ9B 1CGXA 4HSQA 3QUXD 4GUQA 4W4NA 1GKOA 3TH3T 1F45A 3JUZA 5I76A 2FZ3B 4NKOA 4TNVK 4QLWA 3DO4A 4FYQA 3ZDYB 4GKLA 2CDGB 4AX3A 3TCTA 3HG5A 5D2NB 1LHZA 1UACL 2XETA 4YSRA 4KMQA 5DZNA 2Z7ZA 4ZMZA 1XAKA 3CC5B 1YY8B 3HMXH 4WAFA 3MX0B 4EVNB 5CBEB 2F58L 2OMZB 2ZX7A 2QQQA 1LEIB 4LSRH 1RUPH 3TESA 4L8BB 5CSZA 3RY5A 1U8NA 1Q0YH 3QQ3A 1CB4A 2F5AH 3FOMA 4P2RD 2XWBA 3WXVL 5MI0B 3RDTC 4KK5C 3MLXL 5E1HB 3EYSH 3NJGA 3K3QA 2EE9A 1N7MH 1PQZA 4N2FA 3ATAA 5DZPA 5SWZD 4LESA 1SHWA 1O6SA 4DN4H 2ZCKL 3HE6A 4G6JL 1JZ7A 4TULH 1R5IB 1IM3D 4FA8A 3CXFA 4PJ8A 3NIGE 1LK2B 1CDCA 1FHNA 4G8GD 4R90L 3ZE0B 1T3FB 3F7QA 43CAA 4EIUA 1Q0XL 2C9XA 5F9DC 3UJIH 4AL8C 4QRAA 4NZTH 1PL3A 2PCFB 4IEFA 5IG7B 1YN7A 1AXTL 2ZWLT 5EDSA 2HTKC 4YFLI 4EDXB 3GI8L 2D9QB 3OJDB 1IQWL 2ICWA 1T1ZB 4KO7A 2ZXDA 5ACLA 2JE8A 4OFYA 5A6IA 1H3TA 5ILTH 1UM4L 4WSJA 5AKRA 3F85A 3OHXB 3S48A 1VPOH 1C7SA 2F19H 4TNFA 1P7QD 1MJJA 1V8HA 3LXUX 1RUAH 5SWSA 3TVMA 1HNFA 4WCYL 4JRFA 1H3VA 3SD5A 5IJDC 4LSQL 4JKPL 1G4MA 4A7TA 3SKMA 3DVNB 2F8IA 4FFZL 4EMZA 3GSQB 1I31A 2QTVA 3DXAE 3EGSA 4P5SA 2DWEB 2X70B 1IM9B 1EAQA 1EAOA 1ID5I 3GMOB 5EU7C 2EC9U 3V5KA 5JPMA 5DVMA 4EI5B 3GIZL 4UANA 1BM3L 3RB5A 3IJEA 5IVNA 3MGAA 5LGJA 2KZ1B 5CP3H 1T5XB 3C09B 4D8PA 1RZFL 3MV9D 3NPZB 2EIZA 1X4XA 2H47C 2JKJA 2NZ9D 4HUUB 4RFOL 4GG6F 2QADD 3SDXE 1DUYA 3UGEA 4IJ3C 2A6IA 4ONGL 2HTLD 4CVUA 2GEQA 1RSFA 3GUTB 3RVWD 1CDIA 1RU9H 4MRCA 1O7SA 1TTFA 3S4SA 3VXSD 1JHTB 3F7PC 5IEKA 3JTSB 4P2QD 2CJTA 5ISZD 2EKSA 4Z7VA 3FUHA 4UAOB 5FYJL 2WLLB 1QRNA 1XDTT 4E42B 3NRFA 4L8CB 1PFOA 3CXDH 2LW3A 3HS9A 1LWJA 2BSSB 2R2EB 1I8LC 1MCPH 2BWQA 4PLOB 1E28B 1U58B 1B2YA 3D39B 3II2A 5ACMA 4UTCA 1QUPA 2XXGA 2BHFA 3OLEA 3MGOB 1U3YA 1P4UA 3QDJB 4D3CL 4JHZA 4OGAC 1IZJA 4PIBA 3WL9A 2CIIA 4QHNB 5AZEH 1ZLVH 5I17B 3X11B 5L4MA 4JN1H 2E56A 2VH5L 2YGPA 2C1OA 4LSRL 2X1PA 5DD3H 4AM0Q 4WI0A 4JFEA 3KH4A 1XZ0A 4IDLA 4X6EB 2FJFA 4UNVA 4MMXA 5CEXA 3IAGC 1Q0YL 1TZGH 3UYPB 1T4KA 2EINB 1KPVA 4X5RA 3U4EA 1CDBA 5DLML 1QPPA 4RISH 5K1JA 3GTVA 1AS8A 1Z9OA 3BWAB 4JFFE 4WY7H 4PCKA 5EFIB 4HWEH 1UJ3B 1IBZA 3QEUA 2P5EE 2GITA 1JDCA 4KK9C 3L7EA 1FIEA 4HUCA 3GHPA 3EZ8A 4AEEA 1ZLWK 3Q7JA 4NJAH 3D9AH 4OLXL 2DMKA 5F7NC 4ANUA 3L7FA 1THAA 3L4YA 5FUOL 3VYNA 1A6AB 1XGPB 2Y1ZA 3CHXA 5LQBH 4Z7UE 1JOIA 1KY6A 3PE9A 1A3ZA 3AM8C 3GPEA 3BH8B 4YHOH 4K3HA 5F93C 3D3VD 4RWHA 1D6EB 4TNWF 5IOPA 3AY4A 2EH7H 3N41B 2WTOA 3ESPA 4F7EA 1JZHA 1E40A 2Y2YA 1AXSA 5DTFB 5BXFA 4X5XA 4TOYH 2NTFB 1PKQE 3F62A 5L2KB 5CGBA 2YXWA 1NBYB 3V8CA 1VPOL 4PGEB 3DGCR 1R4XA 4ZQTA 3K5SA 1A6UH 1YNTB 2KYIA 3FSAA 5J1TC 1RUAL 5DMYA 3EXLA 4FQHB 3L9BA 5FIEA 2XTJD 4NKIH 4M5ZL 1QMUA 4LSTH 4WI7A 1CLYL 3RJDA 1FO0H 2W60A 1OPGH 3G5ZB 3AQDA 3RIFK 3HN5A 3WIAA 1MWAH 4AYDC 3EH2A 1NDMB 4JGNA 3VJ6A 2BS9A 1D7CA 4H20L 2YD1A 2RQ8A 1GHFL 3PPEA 5IM7A 1FGNH 4L1HA 2BFVH 1OAZH 4FP8H 4RDQF 3QEHB 1M71B 4N8PA 5CZRA 3WNLA 4XN9A 1S7UB 3BSHA 3I9GH 2N0KA 4TRPL 4LXFA 4BSVA 4AYGA 1PSKL 5KVEE 1RU9L 2IF7A 3V95A 4U3HA 1ACZA 4XX5A 2X4UB 4Y9EA 1YUKB 4NN7C 4WI8A 2V2WA 4YNYA 1UVQB 4QXTA 1PJWA 4V1DA 3ARBD 1RIUL 5TGBA 4XT1C 1D3CA 1PF3A 2JJSC 3RNQA 4CN4A 1JK8A 2EDRA 4LLMB 2F8OA 2JK5A 1D2PA 1MCPL 3FULA 2ATKA 5IJCC 2YJLA 3W0WE 4GT0A 1R19A 4O2EB 4PJAE 2JCCE 1SVBA 2O61B 3DO7A 4GKZB 2JKLA 4HV8A 4W1TA 4OF5A 1OLLA 4E41D 4XNMA 3VU1A 1D5BB 4MXWL 4POZD 4PFEA 2YFNA 5AZEL 2FGZA 3IS0X 2WV3A 3ZOAA 2UVFA 5B8CC 5L7XL 5HHQA 1JPGB 3FS9A 2YAEA 3M45A 4NJ9L 1TZGL 3BRFA 5F9WB 4HKXB 4XAKE 3IBEA 4LGRB 3MXVH 1HNYA 3OLDA 2QQNL 4DP8X 4MGXA 4MZ3A 2XYCA 4WY7L 3VFGH 3GXTA 4DOHE 3JZYA 4HWEL 2Q76A 5F6IC 2JB6B 3IKCB 3QP3A 2VUOA 3WGVB 3QDAA 4WZ9A 5INCB 1QI3A 5CD5C 5GZNC 4H4NA 4IMKC 4OFPA 1BG1A 3VYOA 4XMZA 3EUUA 4Y16A 4XOBA 3LS5H 4RA0C 1E43A 3FU5A 3MACL 3VXUB 5LQBL 5DJYA 4L9LA 3MRJB 1E5CA 4YHOL 1BFOA 4PSPA 3MJWA 4QRRE 2HMID 4HKZB 3U36B 5C0FA 4JKWA 2PKDA 3HEIB 1DVTA 2WVTA 3QJQB 2V37A 3GSUB 1TTRA 2P8MB 1BVLA 1JTTA 5MEOB 1T5KA 2F74A 2APBA 2XU9A 3B2VL 5DUBB 2B20A 5EO1A 3TYFB 4TOYL 4X9IA 2BIIA 1J5CA 1LEGA 4PJ5B 3OGOE 3QPXH 3HZVB 3CX2A 1AO7D 4M7LT 4YGVB 1H9VA 5ETUB 5C07E 1WVZA 3LRLA 1NMCC 3RL2B 4NKIL 4U1NB 5HI4D 3OB0K 1MHCA 3FT4A 4LSTL 1EFXB 3EUDA 5C8JB 4D7PA 3IVKA 1WZMA 1ZHLA 2Z93B 4PI2A 2X4RB 2CO3A 1FVEB 3MUGB 4I48B 1GCFA 1RZIA 4NLAA 4Z7WE 5D1XD 4UB0H 3SODB 4ZTEA 3HR5B 3S2CA 3HS8A 1CG9A 2PCYA 1YA5A 2F8XC 1PMYA 1V7ML 2D3VA 2ERJB 2NY1D 2OR7A 2IFFH 3PUCA 4M93C 4URKA 5D2LF 1MAJA 1KV3A 3A67H 1R1CA 4OJFH 2CHWA 3BIAX 1TKWB 2O6CA 3AADB 4JPIA 4PWJA 3CBJB 3HBPA 4AXWA 2Y7SA 1L3NA 1MIML 3MV7D 3GLZA 4F7MB 4PG2A 3TPUA 1FGNL 4WF7A 2DQEH 4N9GA 4HULB 3FYEB 1G9ML 3MHZA 3I9GL 3VH8A 3S4SG 43C9A 5BQDA 1XSJA 5C97A 5HD8D 2GK0B 4EI6A 1WAAF 2MNWA 2G4EA 5E1IA 4K7FB 5IW1A 1JVOA 2IGLA 4EN2A 3K8LA 4B60A 4ZQKA 1CC3A 2HJFA 4O51B 2W92A 3IFLL 1T6VN 1XIWD 1IL1A 3TH2T 4LPTA 4D0CB 1JWSA 2BY2A 4R2GD 3S37H 1H0DA 5BW7A 4OM0H 1O7DC 1AQDA 2I07B 1ERNA 2YD2A 1N2RB 3N42F 4JHUA 4GBXC 4M3KB 2ENYA 2VMFA 4KTDH 5EZPA 5MEND 2ORBH 3FTWA 4YHPA 2L4OA 3B9KA 3NCFB 4LKCA 5C0GA 5F0MB 2DM2A 3MRIA 4R4ND 4LRNH 4NQEB 3SKOA 1XGYL 1JRHI 4NT6B 3DX9A 1TEFA 4JRWA 4OKVB 1U8MB 1X7QA 4RX4A 3OSKA 1DL7H 3B8SA 5F71A 2WO3B 5GGVY 3EW3B 4HWBH 4OJAA 1N6QL 2ZIDA 1S9VA 1Q9WA 4Y4HD 3SHSA 4Z0XA 3P4OA 5F1IB 3WDJA 1QSZA 5CP7A 4MB1A 1I1AD 3LEVL 3NFSH 2WLMA 2H1PH 1UA7A 3K0YA 1ZRUA 1PZ3A 2G5UA 4TL4A 4YHML 2HJLA 2YR3A 5DU7A 3O4OC 4KX9A 4P2RE 3NCWA 1M7XA 4C58B 1AGFA 2VDNB 2X6CA 3L54A 4GPVA 3I85A 1TYJA 4HA1A 5AW4B 2ZQKA 1AZRA 4PRAA 5SWZE 1OT2A 1VF5C 1WRFA 1TZIB 1LO2H 5AW6B 4HIIA 1NTDA 1KJ2A 5DSCB 2BRRL 4NC2B 5CUSH 2JJTA 4AKQA 2BSRB 3U9UB 2AQ2A 5I0VA 2E3VA 4GMTH 3KYMB 4I0PB 1GGBH 4G8GE 1VFBB 2EABA 4GKOA 2AABL 2IDTA 1JZ2A 3KXFB 4OV5B 3R06B 3V4PL 4G5AA 1UZ8B 5HYQB 4NENB 4LPVA 1DANT 3ZQ9A 2G2RA 4BFFA 1V3MA 2A6KA 4UDUA 1XSKA 4NQDD 4DPCX 1EO5A 1MJ8L 5K59E 4UB0L 1BZDA 2J71A 1YMMD 4FXGB 4Y1AB 1G9MC 2GIMA 3VQ1C 2IFFL 1ZTXL 1P53A 2YUWA 4G7SB 4G8AC 1BCIA 4G8FA 5JYLA 3A67L 5ADOL 1I8MA 3ULUH 2I25N 4JFSA 3UP6A 3Q8CA 2H26B 3MJ7B 1NSNH 5GGUB 4NQQA 4NSKA 2YEVB 5LAPA 3P3UA 3G6JE 5ICXB 1CFTA 2EC8A 1NGZA 5D6CA 1NUFA 5E2UH 3DV6A 4CILA 4M8VA 2ENJA 5TQ2H 2P8LB 1A4CA 3V2AR 2MNJB 4CSSA 2B59A 4X5WB 4CSPA 3WAKA 3CPLA 3DIDA 3KNBA 1WIUA 5DVPA 4YUEH 4J3OG 1QRKA 4JRXA 4M5SA 3EHBD 2X2YA 3MV9E 3EJQA 2FE0A 3K2MC 4IDJL 3EIFA 3ZDXB 2NW2A 4J3OD 4OM0L 4TSAH 5IJVA 2FWOB 3AJ7A 1NAKH 3BAIA 2OI9B 3JV4B 4K3EH 1MF2H 3P9WB 1TO5A 5CCKH 4MLSA 4F58H 2AJSH 2CO6B 4KKAC 2KQNA 2ORBL 3MNWA 4KROD 3VXSE 2V7HB 4YSQA 1FZJB 3PRZA 3HZ3A 3I84A 3CWGA 1XGZA 2X9YA 2IWFA 4P2QE 1H8NA 1YPZA 3HI1B 3IDJA 1LEKA 4H25A 2DS4A 1D5XA 1DSFH 4MNQA 1NBQA 4Y2DB 2VKWA 4N0FA 4LEBA 3I50L 5DR5H 4KKNA 4ZX4A 2A9MH 1QPXA 2HT2C 2IOIA 4LBAA 1KXVC 2Z92A 5LO7A 3RKPA 3ZXAC 4PBDA 4PY8J 3QWQB 4MHHG 1KGCD 4KX7A 4PG2C 1A6TB 2AVGA 3EJRA 3QZNA 1JHKH 5C9JB 4RDBA 5FKAB 2FBRA 4MLIA 1A1NA 3BWZA 5C7XL 3LD8C 3SY0A 3NFSL 4FFTA 3UTTB 2DL9A 3HRZB 5GZOA 3HJEA 3VWJD 2J8UB 1F4XH 3RGVA 4JFZL 1P5VB 3FU3A 2FLBT 4N0CC 1UWFA 4EBQH 4N4YB 1MFVA 5LBVA 2GAZA 4PMFA 1RULH 3DARA 4K73A 2BIQA 4WO4B 1A64A 2F7RA 3CHRA 1LO2L 4IGBB 1JF1B 4HIJA 4LCUB 2XSKA 2YD9A 1HHHB 4U3SA 3TPKA 2E27H 1OARL 3FPYA 4PRHA 5T1LB 3RI5F 2IANA 2WN2A 3BGFB 4GMTL 2GK2A 1AVAA 2WZPA 3ARFB 5DHYA 4O4YH 2OMTB 1ET5A 1GGYA 5FGRA 2OSXA 1BFVL 2YFOA 3D3VE 5HGAB 5DJXA 5JA9A 5J11B 3TBWB 4WW1A 1M6OA 3ZHKA 3I6KA 1IT9H 5AW7B 1AGEA 3OSVA 1A4JA 5M94B 2RA1A 2PCXA 4Y5XB 3OJ2C 3RUGB 1ANUA 4CBZA 1H9DA 1BZ7B 3U30C 3UH8A 3OXRB 4R0LA 1P4IH 1U4EA 4P4RB 4PGCA 2GI0A 3TT3H 3ULUL 1MH5A 2Y2WA 3CH1B 4MCZA 3NRPA 2OSYA 3T4YA 1E6JH 1UKTA 2CDFB 3V7AE 3GI9H 4X4ZA 3O6FC 2XTJE 1NSNL 1M05B 3VH8G 1TO4A 2PP8A 1XL6A 5ESQA 5HI5D 4PJIA 1XCTA 1MIEH 3LCYA 4Z78B 4MXVF 1WBXA 4N3UA 5E2UL 1D9KA 1II4E 2IO5A 3AGWA 4WJ5B 3PAZA 3GXIA 2DLTA 1Z0MA 3FQTB 1DE4B 4NGHL 4EZMA 1A0QH 4ZMNA 5I30H 2C3VA 4PP1C 1OWRM 5I1KH 4YUEL 3UTOA 2FH8A 3K1KC 1QFWM 2IV8A 4HEME 3IDNB 3IFOA 3O45A 1CFBA 3PF2A 3IJ9A 2DTSA 1HI6A 3II1A 3CFKA 1NAKL 3KPOB 4K3EL 1MF2L 1YHPA 1FVDB 1PKOA 3H54A 3RDTB 5CCKL 4F58L 3M46A 2AJSL 3TWCH 3EZJB 2YGNA 3WKNA 1IAKB 3B9KD 4GS7C 5C71A 3D0LA 4XVOA 5FB8B 2F7IA 3NAAH 4PYHA 3NIDB 3OMNB 5JQIB 4JLRB 1DSFL 1M7IA 2QQKH 3K81A 1J5OH 4R7VA 2AV7A 4APXA 4YIQB 1K4CA 3TZVC 5KYNA 2VSKB 3QJHB 1T80A 4KTEL 4DJMA 1T7YA 1JHKL 1UHVA 2ZCLH 1HEZA 4LP4A 4UQ3B 4E41E 4ODHH 3DX8A 4YVUA 2OZNA 4XI5D 1CFSB 1WFTA 3I9IA 3FH5A 3O6LH 2DZEA 3KGRA 4YEEA 3IF1B 3VI4B 1F4XL 3G6AA 2DH3A 4H1LB 4X4MA 3DO3A 3OMZA 1QVOB 4AWJC 1PFCA 2QSCH 5E4EC 3MMEB 3NA9L 4OF3A 1M7UA 5AW1B 2V7NA 2O1AA 1H6TA 1CDHA 4XX1G 1EXHA 4JFPB 3L48A 3VNYA 5BUGA 2EUXA 3P9LB 2J6EH 1OEZW 2E27L 4R26H 3UZQA 3VRIA 5JPNA 1OAKH 4YDIL 4I3SH 5KG9B 2NXYC 4C57C 3UZEC 4RMRA 4O4YL 2FO4A 3O2WL 1ZDQA 4QRUA 3ULUC 2DQ6A 1SLVA 2ZSWB 4UT9H 3ULVF 2IQ9H 1IT9L 4LLDA 2FHBA 5DEGA 1YEIH 2XZQL 2Q7AA 1SHSA 2YO3A 2ENPA 4NO0B 3MI6A 3QNYA 4P9MH 4YE4H 3B7RL 3FONB 1NFKA 4IJ3B 2YSSA 2A9CA 3VXRD 5A7BA 1UCTA 2FX9H 3TT3L 1MW0A 4WNSA 2R23A 1AO7E 1E6JL 2XQBH 3AAZA 3ATBA 3DTUB 1X6LA 5FGBA 3DOIA 3GI9L 3IDGA 3ZTEA 3JV6A 3HG4A 4BZ2A 3CK0H 4JFDB 5IMMB 2PR4H 4R7DB 4M1CD 2R27A 3NP3A 3UBHA 2D2CC 1PPIA 5CM1A 5C0DA 3RGVC 2HT4C 5D1XE 4BH7B 1ZANH 1PNDA 1TVDA 3A47A 1WAPA 1JN6A 2ITFA 2MSPA 1MVUB 3RWIA 3ESVF 3S8FB 2YPKB 3HLAB 3WU1A 1PZBA 1HTYA 2WLKA 2XJLA 3CFEA 3ZE1B 1BF8A 1D6VH 5I30L 3MV7E 5I1KL 4AY0A 2ZOTA 1UM5L 1WGVA 3MRPB 4JRXD 4KVCH 4LPCA 4UAHA 1B0GA 4KV5F 3TCLA 3PNWA 5DQJA 3X13A 2EILB 1KDJA 4LLWA 4G9DA 5DZAA 3O9WC 1J9TA 4BFOA 3IDMA 1WP6A 3VUAA 1DQQA 3W9EA 2HKFH 3WO4C 2NX5B 3O8XA 1MRDH 5JIKA 2ADYA 1AR1D 3DECA 3FCTB 3MNVA 4FD0A 5FDWA 2P8PB 2VN5A 5EOQH 5AW0B 4QWWD 1MEXL 3TWYA 5FO9A 4UOQA 2WTRB 4P46B 5I1CL 4RAUB 3VXOA 4ZXBA 2PWGA 4LCIH 3DSNA 5DHDA 3FUNA 4WK2B 1CURA 5IB1B 2ED6A 2W5PA 4AIXA 2PCPB 3S9DB 1CD1B 2H6PA 4X8JB 1USQA 3ESNA 2CO7B 3D0VB 3NFNB 2ZCLL 4UM9D 3T0ED 5MENE 3KLAA 1OP3H 2IALA 1U3JA 2DEYX 2ODIA 4Y1SA 4UQ2A 6TAAA 2XNAB 1NDGA 2FNWA 3BGAA 3L3OC 3EJYC 2BNRD 2FNBA 2P24B 4KWUA 5DQ9A 3S98A 3KW7A 1ONQA 3CCHB 4ODUA 2CLZA 2QSCL 3EXJA 4H88H 2AEWA 2ZPKH 3SYAA 1ZGLA 4HLZH 1WZAA 3WCYA 5CF3A 2E7MA 4NNYA 4ZO7A 1DDHB 3OGCA 3EADA 3CXHK 3P1VA 3IGAA 4PRHD 4LFHD 1ZV2A 1XGQB 1JWMA 3FOMB 1VCBC 4UINH 5DFVD 4XZUB 3MLYH 2VITA 4BK8A 1N5YH 5EC2B 3A4DA 2WXQA 1DCEA 1L9QA 3ECBB 5DLLA 4RMTA 5KWYC 1DN0B 1LO0H 1O6SB 4FA6A 4PH8A 1BFSA 3APCA 2EZ0D 3BUYB 3QHFH 2X3CA 1VFOA 4PY7A 1T03H 1OD7A 1E8XA 2IQ9L 2GBVA 5EU4A 3MRDA 1YEIL 4AYID 1PX4A 5ECJE 4PRPA 4P9ML 2BVTA 3EYQD 4PJEB 3AUWB 2OCJA 3BPLC 5AVUB 4XPFL 2FGWL 3QGVA 1A7BA 3VVVA 2ZUYA 2XQBL 3BQUD 4N68A 4NN7B 4QUOA 3WKPA 2R51A 3PV7A 2KDYA 4KQ4H 2IOOA 3CLFL 3F84A 4LKXB 4J28A 1I3VA 2C3XA 4NQDE 2I85A 4U1LA 2VDRL 4QRQB 4UTBL 1AKJB 5GISH 1YMME 2IIJA 5CZXD 2Y9RT 3BZ4B 3UDWC 1GYWA 3B8YA 4I3RH 3HMWH 5ACZB 3L4CA 1QSFE 5L6YH 1BZ9B 2EO1A 3JV0A 5DD0H 5FO8B 1RZGA 1D6VL 4QY8A 3MRRA 3GMMA 4NPJA 5AL8A 2W38A 1RIHH 2PW1B 5ITFB 3P4LA 2PW2A 2OW7A 2VAAA 3HHMA 4DAGL 5B8CB 1UEMA 3CZLA 4JDZA 2DMHA 3JWDC 1SJEA 5IB4A 5KVEL 3IU3B 3UYOD 3VWKA 1FV1A 1G9EA 1AXIB 1NCWH 1FLTX 3UBXI 2GABA 1F00I 1Q1JL 4XXCC 4HGKC 3QE5A 4JM2F 5I6NA 3DPBA 5HJ3A 4P05A 3QXDA 4LCIL 4F57L 3EH5B 3ZE2F 2VZUA 2KLSA 3FF8A 1PZDA 3SZ6A 3ARGC 4O5LH 1CGSL 5LGHL 3US0A 3IJSA 5C0AA 5L0QC 3ZO9A 5I6LA 4L8SA 4XBEH 3WNNA 1JTPA 3UTZB 3ZTJH 2FCBA 5I1HH 4LQFL 3QUZD 5ALCL 3GWJA 5D7IF 3SOBH 3SDCD 5IROC 3LXAA 2HA1A 5IHZA 1TLKA 4MNHB 3QIWD 2VB5A 5LG1A 3U7AA 2GUYA 3QAQA 4P3DB 4YN3A 2YMXH 3LKSB 4ZS6D 3X14B 1NUNB 4H8WL 1BIIA 4H88L 2QELA 1KGCE 3ZLQC 1NMCB 1CVRA 2K70A 4IOFC 1USZA 2XKUA 4O02H 2N4IA 1CD0A 3O3BB 3UXFA 1KLGA 2BSDA 3MLYL 4PRIB