1WVZA

Solution structure of the d2 domain of the fibroblast growth factor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
NNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
publication title Solution Structure of the D2 Domain of the Fibroblast Growth Factor
rcsb
total genus 12
structure length 101
sequence length 101
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wvzA01
1XIWC 5EFIA 1E6JL 4GQ9L 4M6AA 2VZUA 2WWMD 3KPRE 4OFYD 4U2YA 1S78D 3D0VA 3VH8G 3U79A 5DZLA 5FO9B 2R1YB 1EHNA 4JG1L 1G9MC 2PUQT 1C7TA 4QRPB 2ID5A 2UZYB 5C08E 1AH1A 3OKNB 3QXUA 3V0AC 4XCFL 4C59B 3TGXA 1U8KA 2AEPL 2YXFA 3ROLB 1U92A 4LAJH 5C6WH 5I6XB 5IJVB 3GSNH 4NNXA 3QHTC 3MLXH 5MEQA 1GIGH 4X8JB 4OB5L 4MNGB 5C92A 5DI8A 3ULUC 3LB6D 1FSKB 5C0FB 4LASL 4R7NA 1KTKE 2NNAB 1UA6H 5ANMB 3C6LB 3HG1B 1I9JH 3NIFF 5HD8C 3HLAB 4NIKB 3GBMH 3QQ3A 4TUKL 1U58B 2Z93B 5F7WC 3ZE2F 3IKKA 3KJ4C 4GRWF 5HVGB 4G6JL 2DWEB 2CDEA 3SDXA 2H1PL 4EIGB 2QBWA 3F5WB 4OD3H 1NGZA 2LV4A 1OARH 4LCWE 3SE8L 1LE5B 4NZDA 3JV0A 1HSAB 3MRGA 4MA1C 2FL5A 2O5XH 4B53A 2EC9U 4G9FA 5KOMC 2CKBA 1KELL 1VADB 4Z78B 1SY6H 2R15A 1AC0A 2FB4L 3QUXC 5D7JC 4F7MA 1QPPA 2C4XA 1KJ3L 4HIEB 4MQ7B 4ZUVA 3QIWC 1DQDL 4LLDB 1Q72H 2NY2D 2V2XB 2NXZC 3U7AA 5L2KE 1QOKA 4CJ0A 4Z7VA 1R3KB 3UTSA 5TDPA 4OGXL 2IBGA 2FHBA 2W92A 4W6XB 3ZDYE 1FJ1B 2XN9B 1UT9A 2AEIT 4CVZA 2D03L 1H0DA 1BX2A 1N8ZB 1Q0XL 1PGRB 3AY4C 3VD7A 4DTGL 5T1KA 4Z7NF 5D1ZA 4KK5D 3SDCB 2YR3A 3MA7B 4OUOA 1LK3H 3EOAA 4JJ5A 4F7EA 1ZHKB 3Q3GA 5MEPA 3MV7D 3FRUB 3LN4B 1JRHL 1OSZA 1W8NA 4M4PA 4OIAA 1S7RA 2I9LA 3PWNB 2EEAA 2RBLA 5D2NA 3VFOB 3DETD 4ZYKB 2R1XB 1T1YA 3CFBA 4QRRB 5AYQA 2Y07H 4KAQH 3UP1A 1GZQA 3FJTA 3SGDI 4NO0A 1MHPH 1YUHB 5A43C 5DT1H 3V8CA 4D0CB 1AJ7L 5IKCB 4NO2B 3IGAA 1WZ1L 1MFEL 3D0LB 4M9OA 1IGCH 1ZE3C 2FO1A 2P45B 3SDXE 1AI1H 1CIUA 1Y0LB 1FN4B 2B5IC 1PX3A 4JN2A 4CNIA 4LSTL 5HDOA 3NABL 4KK6C 3SDAA 1MCWM 1KTRL 1X5LA 4CVUA 3CUPB 1BFTA 2QQKH 4AEIL 4HQQL 4X80H 5J6HA 4KK8D 5J9PB 4RMWA 1YNKH 1FL6A 3QUZC 4JREB 5F89A 4G9FE 3K80A 3AMLA 4D9RE 4NGHL 3IXAB 4P2QE 5IB3A 1I1AD 4GAGH 4X6DF 2M26A 2X09A 2CIIA 4HCRA 5CUSH 5F7UA 4L5FH 2XA3A 2XPGA 1HHKA 2WBJD 3G6DL 3LKNB 4NO3B 1N26A 5C9JB 3FB5B 1CFSA 5DJAB 4LU5H 4M6OL 5E2JA 3CSYB 4S11A 3RGVA 3MV11 2R29H 3WNKA 1TZIB 5ITFA 2NW2A 3OXSB 4Z7VE 3LPGA 2X05A 4RRPA 1IKFL 2VNCA 1NUNB 1S9VB 3ZDXE 4R26L 1A0QL 5DJCA 3CXHK 3X3FL 4YE4H 1WZMA 3N9GH 1EBAA 2EDFA 4L3EB 4NC0B 4XNMA 2WP3O 4G8IA 1G7QB 1YQVH 3MC0A 4X6CF 1EV2E 4FQJL 3EJZC 5JO5B 3RDTB 4UTAL 5IB5A 1CGSH 5IROA 1DE4A 4NKDB 1WWCA 2RIKA 1YDPA 4JKKA 3ROOA 3ECBB 1GGCH 2NCMA 2IG2L 2Z31A 2C1PA 3I9GH 5D7LD 3DUUB 2DQGL 1QLRA 1IM3A 5EZOL 4CDHA 4M6ML 3FFCE 4OIIH 1HWHB 2G60H 4GG6A 2O26U 5D2NE 4KHTL 1MQKL 1EIBA 1UADC 2CDFB 2P24B 3ZHLA 4TTGA 2JJSA 2Q6WA 2YA1A 2VL5B 4I3RH 1JGUH 4PRHB 2ZNWA 2W91A 3PV6A 1HZHL 2E7CA 1I3RB 1R0AL 4RMTA 3VDBA 1P2CA 5IBTL 1AKJA 5BVJA 1GGBH 5SWZE 1EVUA 1N5YH 2VDQL 3EYFA 3KLAA 5GJTH 1E4XH 5SX4I 3GIVB 2NPLX 2IPUG 4GAJH 3P4OB 2JB5L 4JPIA 3C5SB 3WD5L 4NQCD 3RKDD 1NCDL 5IMMA 1HQRA 4U33A 1S7TA 3ZE1F 5LGHL 4NBXB 1IQWH 3D39A 2GEEA 2W0FA 5KTEL 3NACH 3AB0B 4MQTB 1NLBH 3GSWA 3PWVB 4M00A 3RVVD 1FO0B 1P69B 2VXUL 3G6AB 4L4VB 5JIPA 5I18H 3H9YA 4HH8A 1IGFH 4LSUL 1L9NA 4OAWA 1H5BB 4PG2A 4NN7B 1IFHH 1LP9B 5F1OB 5T3ZH 4K2UL 5BZWA 4YFEA 1ITCA 5JQHC 4EQ3A 1D6VL 2DTML 4BZ1L 1S7VA 4P48A 1LO0H 1KXQE 1MJ7L 3OG6B 3GB7A 5CILH 2VYRE 5I75C 3CFKB 3JV6A 4GAYB 1JK8B 4OZFA 2EC8A 3ARFC 4YDKH 4PY8J 3DV4B 2GT9A 2F74A 4JRYE 4UV7H 1AE6L 5ACZA 1HILB 4MGXA 4GG6E 4HUVA 2D9CA 4RFNB 4LFHG 1QFWM 1W72L 4ODWA 5D7JA 3OR7B 5DMGD 5CZXD 3SGJC 4H25A 1QR1A 3F6LA 5MEOA 1JNNL 4I18A 5GGSB 2ZOKB 3S7GA 4K8RC 4N0YL 2YBRA 5FYLD 1QBML 1ODAA 2AJZB 2E3VA 3RWGA 2B1HL 1FQ9C 3DYOA 3KS0J 4HAFA 3L3DA 5C0BB 1RK0B 2WP3T 4U1HB 1I7TB 5HYJB 4OJFH 1N5AA 2X9YA 3F7YA 5IHUH 4JM2C 2VXTH 5HVHC 2VZVA 4YBHA 3PWUA 1FG2B 1GXEA 3QIBC 4YHZH 4H20L 1U3HD 4KVNL 4NN6C 3RZCB 1IGIL 4NQEA 3CVHB 1OAZH 1RIVL 5E2WH 4XCCL 3TYGL 3IDMA 4UZGA 4HK3N 1Q0YL 5BS0E 4YXHH 2JIXA 1W0WA 2I07B 3EO0A 4D9QD 1AXTH 1OQOA 1I1CA 5DR5H 1R5VB 5GXBB 5IVXF 2AV7B 1CDYA 5EO9A 4KMTH 4WO4A 2NW3A 4OQTH 1EO7A 3O11B 5I1EL 1TMCB 4WDIA 1A9BA 2D2OA 5HGDA 4X83A 4QO1A 1IEAA 3WDJA 1KT2B 2SEBB 1UACL 3CFDA 2QADB 3MRMA 3ORJA 2CO7B 4PRNA 3K2MC 3WO4B 3VXPA 2NY5C 2H2PC 4P4RA 4PJBB 4CKVX 3T65B 3UPRA 2HFTA 4OFKA 4TUJB 1ZV5A 2XXMB 3V6FB 5H35A 3TJEH 4GBXC 1J1OH 3GI9H 5E8NA 3MRQA 1OGAB 1RSFA 1NUFA 2WINA 3QXWA 5JPMA 1FV1B 5EBWB 1TCRA 3KPQB 3FQWB 3QYCA 3D69B 4MB5A 1TNMA 1MHHA 4X9BA 3G5XB 5JA8B 2P46B 2YPLA 2ZCKL 4HIXH 3RWFB 1XGTB 2EXYC 1UZ8A 2IFFL 3SKJH 1VCAA 5D6DC 1I4FA 4A6YL 4PG9B 4Y5XA 1TVHA 3F58L 1OB1B 1QKZL 2IBZY 4QHLA 4MNQA 2NXYB 3IXTB 3T4AB 1Z9MA 1BIHA 3T77A 1I1RA 3D48R 3DI3B 4GW1B 4OFIA 1Q9LB 2GSGA 3H2WA 1OCWL 3RWEA 3QNZA 43CAB 5KJRH 3S3JA 1E4WH 3MLPA 1IEBB 2A73B 3IKCB 1YN7B 2A6KB 5F8QC 3O3EA 1NGWB 1QSFA 4OLUH 4PJ9A 3U7WH 3HNSL 3EYUH 4KQ4H 4L9LA 2CK0H 3QJHB 3DX9B 2Z35A 5E9DD 2BRQA 4BSVB 1F6FB 5HTSA 3BIBX 2ATPB 3OQ3B 4M5YH 4FQ2L 4EDXB 4UTBH 1IL1A 4XCYB 5IBUB 5HGHB 5EOCL 1CFVL 2YPKA 5CIPA 3W9EB 3B9KD 3BGMA 5FF6B 5J06A 1AQDA 4P23B 2W9DL 3MLYL 3MUGB 3LKOB 4QRSB 1WFTA 4PS4L 4LCYB 1U8OB 1HXMB 3STLA 2H2SD 1L9MA 3GJEA 4HV8B 3CH8A 5IB2A 2KQNA 4PLKC 5E24E 3E6HB 5CSZB 4H1LA 1PX4A 1ZWIA 2ZCHL 4AEHL 4KDVA 4I1NB 4Z7UB 1F42A 2YC1A 3RWJB 1B2WH 4LGSB 1UCTA 4Z7QF 2ZKHH 3KXFB 4V2BA 5C0AB 2XIDA 2M1KA 5CEZE 4EDWH 2CKBH 6FABH 3HZKB 1FE8H 3ARBA 2BOCA 1CR9L 4IEFB 5FA4A 2OX5A 4NQDA 4PJIF 4ZS7H 3WUWA 1M05A 1T6WA 5I1AB 4ZTOH 4HWBA 3NPSB 3T2OA 3Q1SL 5IVZA 3QQ9C 1JN6B 2ENYA 3FN9A 1E27A 1A6AA 1BIIA 4G7VL 2A6IB 2HJLA 1HHHB 5GHWL 3IDIB 1CN4A 2APBA 3VRLE 1UB5A 3MCG1 4MS8D 1FP5A 4NZRH 5FV2A 3G08A 1GOHA 3QSKB 3ZTNL 3JWOH 1OTUD 1ZA3A 4P5KA 1QSFE 3MRKB 3X11B 1M7IB 4Q6IC 1QEWA 2R23B 2IBZX 3MMEB 2R1WA 3HMWL 4N0UB 1JGDA 1DBJL 2YMXL 3O9WD 1NDMB 1RUPL 4J3OC 2HN7B 3MLRL 5B38A 1FNHA 1TITA 1KJ2A 1BWMA 4FZ8H 1FPTH 2DBJA 3D3VB 3T2PA 3OKLB 4I4WA 4CW1A 1XIWD 4HWUA 4NKOB 4YDVA 3T4YB 3BQUB 3PDOB 2Y5TB 5F7HA 4NM8H 5FUZH 1ZT1B 5EBLA 4GUPA 4J3WA 3T0AA 1T22B 4LLYA 4CRPA 4JHAH 5CWSA 5TQ2L 3ZKQD 1PY4A 4TRPH 4JDZA 4AH2B 1NBVL 2J1KA 1FNGA 3RWIB 2VLRE 2YN3A 3QUYB 1EK3A 4HZLA 1JPSL 3HE7B 4APQC 5FB8B 1C7SA 3O2VL 5IVOA 1M7DB 4R90L 3QDJB 4ZAKC 3VXNA 2HG5A 5DRWB 1S7XA 4MXVF 1AXIB 1FL3B 1AGFA 4ETYA 2BOBA 5KAQF 3NGBC 1FZJB 3DECA 1M71B 5IF0B 3U0WL 4OD2A 3FONA 1CF8L 1CGWA 5D5MA 3V4PH 3TF7C 2DIBA 4X8XA 2QQLH 2GJZA 4HCRH 1WEJL 1J87A 5TQ0L 3UX9B 3LY6A 1NBQA 4WFHD 4HDIB 2VRAA 3D85B 3DRQA 2GJ6B 3IDXH 3P9WB 3GO1L 3DWTA 3F8UB 5IMLA 4KC3B 1JHTA 3QUXD 1T03L 3T3MF 2XFXB 1K3ZA 2H45A 1T3FB 4I0PB 1NKOA 4WW2C 1KB5L 3BE1H 1VFAA 2HT3C 3ALWA 2OR7A 5F44A 3PL6B 5ETUB 2BVYA 3WJLA 1AGEA 4D9LH 4Q9RL 1FCCA 2W59A 4PJCA 1JPST 1ORQA 4YWGH 1R5WA 2X4NA 3FO1A 5HHOD 4CBPA 2CLZB 2EYSB 5ERWA 4M5ZH 4X4YA 1KTDB 4KV5E 35C8L 4ZXBA 2X5PA 4F37K 3L7EA 4Q0XH 3VG9B 3G04A 4PJAF 3UBXA 1SMAA 2NY4C 3OJDB 2K9UA 3BXNB 1XCTA 5BOPA 5GRXG 2APTA 1XF3B 2BVOA 2FATH 1S7WA 2HVJA 4ZFGH 3DVGA 2UVFA 3EOTL 1YEJH 2R0WH 1ZGLB 4FQHB 4PY8I 5I1GL 4FQ1H 1ZA6A 5FUCC 2ZOLB 4WCYL 1WBXA 1C16B 3T3PE 4ETQB 1G6RL 4ODTH 4U7SA 5T5NG 4Z77A 4X7FC 1XF4B 2F53A 4XNYL 1P53A 2AJ3B 1BD2E 3ZKXB 1S8DB 1A7NL 4JPWH 1RZJC 2X4TB 4YGAB 2P8LB 3V95A 4NSKA 4WFGD 3ARVA 4KI5C 1HDMB 1FDLH 3QAZC 1E4XI 1X5HA 3LN9A 4V1DB 3U9UB 4JY5L 1G7MB 4JFOB 1JI2A 1KPVA 3W39B 4AL8H 1AR2A 3MXWL 5DA4A 1FNFA 4RMVA 3EFFA 4KK6D 1IGYB 2YZ1A 4Y5YC 2VDOH 4HX1A 2YWYA 1NJ9B 2AP2A 1A4KA 1UENA 3U7YH 3GK8L 5I8EB 2VLLB 3TIDA 2OS7A 2DQFA 3LMJH 1JGVL 4PRBB 3VD4A 3R06B 4F2MA 1JUFB 5HHNA 5DEGA 2XI9A 3NZ8B 3ULUH 4QY8B 5A16B 3DX8A 2W9EH 2EECA 1A4JA 3T0WA 2X1PA 1WT5A 5LGKA 4ODVL 3VFWA 5E6IA 2M8XA 3PABA 4WFFD 4ZG1A 3PDDA 2Z8RA 2ZUQB 3MRIA 3D25B 4PJHA 3IJHA 4OZFH 4DFIA 1JZ4A 4X5LA 4JFYA 2BNQA 3BHBA 4F37F 4RX4D 1B0RA 5F3BA 1Q9OB 3QDMD 4JN1L 4KRMB 1ORSB 3RX8A 2XQBL 3A6CL 4I0CC 3N85L 1SBSL 4R0LB 2JELH 3CSBA 4S1RL 3ZYIA 1X5AA 2VZTA 5T1DL 5I1HH 5CJXC 1XGUB 1UZ6F 3TVMD 3CDGA 4DKFH 3D18B 4JY6A 1KC5H 2F53E 1LVEA 3BGFC 2VAAA 3KYKH 4MSWB 5IBLC 3GMPB 3U83A 2JB6A 2COQA 2EDYA 3SO3B 1YNTB 3W2DH 4U1GB 3RWDB 2ORBH 3QFJD 3PQYD 2RFXA 3IF1A 1U8QA 2EZ0C 2XQYK 5DD1L 2DQIH 3K2UL 5LGJA 5K93A 4OCRH 2BSSB 2OCFD 3VGAB 1G0XA 3O6FB 3AREC 1F2QA 4E41D 1JWUA 5ENWB 1ND0B 1XGPA 4Y19D 3D2UB 5D7IA 5DA0B 4QHUA 5JW4M 4OT1H 1OAKL 4UQ3B 4HF5H 5DZNA 4G8GA 2Q8BL 1TVBB 3VXMD 2HRLA 4HEME 4AM0A 2AGJL 3BJLA 3T09A 1KIQB 1NUDA 1QO3B 2N4IA 3LEXB 1S7UA 4WVRA 3RTQD 3BUYB 3HAEB 1NGYB 5CEZH 2BC4B 4PJEB 4JQVA 4N9OB 4AG4L 4MJ4A 2O5YL 1TPXC 3V7AG 5F8RC 3U9PH 3T0EB 3GHEL 2WLYA 1MAML 3VH8A 3OG4B 4F3FB 4OCXH 1DVFA 2WAHA 3PWPA 3FQTA 4ACPA 2DBLL 3BZ4A 2X89A 1R5IA 1MRCL 2CR3A 4B41A 1BFSA 4QTIH 5ICXA 1CK0L 4YHOL 5DD0H 4S1QL 1FBIH 2Y1VA 1AGCA 4EN3B 4KZEL 2BSTA 1PVHA 3I2CH 1Z9SA 3C8KB 4FP8L 5TPWL 1XCQA 3SE3C 3QPXH 1BVLB 1NC4B 2NY0B 3FB7B 3S9DB 3ULUF 4OLWH 4R2GC 5EUOB 3GMNB 1MAJA 1P7QB 1WAAA 4WW2A 3LQZA 2A9NH 4N90D 4FXGB 5DS8A 4CU7A 1NMAL 1CXEA 4K8RD 1NGPL 4LSDA 3MREB 3G6JA 4RQQB 4NBZB 1MHCB 1PZ5A 1KLGB 5DJ0B 4R9HA 1C5BL 2B20A 5CIPH 1FFOB 1VERA 3U4BH 4JM2D 1KJMA 3TBYB 3WIFA 1HINH 2OL3B 5IV2B 1DBBL 1IGJB 3CX2A 4GRLC 2IC2A 2E6QA 3QIBD 3BP4B 4HUMB 2OZ4A 4YFDB 3LEVL 4HUWB 3IFPA 4HPOL 4YPGA 3BIKA 4MJ6B 4YHNA 1F5WA 3MV8A 4G8EA 5D7IE 3RNKA 4HIJB 3S36L 4H1LH 1VENA 4JFDE 1D6EA 2C1OB 5HYQA 4JFZH 3O6KL 1KENL 4ZFZB 5DUPL 2X6MA 2V2TA 4JKPL 4K3DH 2J88H 3WS3A 5KG9A 3UO1L 5KSBA 1YMMB 5LCVL 1T4KB 5KBNC 4D8PA 5F3HB 3SDDA 4O58H 4DZBB 3QR2A 4GRWB 5HGAB 3QNYA 1YEKL 1EX0A 1LEGA 2YZ8A 2X2YA 1W0VA 1EAPA 1NMCB 2J4WL 2IALA 4IOFD 2VLKA 1XR8B 2IJ0C 5D9SA 1P1ZA 3B43A 3PGCA 3WNMA 2NY3B 3SEPA 2OI9B 3GRWL 5J8OA 3PWPE 4GBXD 4DKEL 1JF1A 5EH1A 3C9NB 1J0KA 1SEQL 3WXVH 5CLTA 4TSBL 1PZUB 1UWEL 3WBDA 1I1FA 2AJVL 3FKUS 4I13B 5EIVA 4FXKA 3WS6C 1FZMA 1OD7A 3O6ML 1N2RB 3BMWA 1U8LB 1DFBH 4Y5YA 4NRZB 1EGJA 4P2RB 2EXYD 1INQA 1D9KC 1A5FH 3SE9H 5CZVL 4M93C 3ARDD 2GITA 2OTUA 5FCSH 4CADB 1VEOA 1FG9C 4WUKH 4HC1A 1YECH 4UIMA 1WAAE 3TCLA 4XCEB 2NQCA 3HZVA 3LEYL 1KJ2H 5DFVC 2CUHA 5KZCD 3GMRA 2VZ3A 1NCUA 3BKML 3BEWA 4OSUL 4IRSB 5BV7H 5C07B 1IGML 4U6YB 1RURH 4PJDF 4XP6L 3S37L 3OR6A 4AIZB 4DGVL 5K9KB 1EEYB 1WC7A 4KZDH 4MAUL 1FLRH 4X5XA 4WI5A 3ARWA 3O45B 3REWB 5CBAB 1X4YA 3GSRB 3DVNA 4JO1H 4M7JH 4NZUL 3FT3A 1CE6B 1YJDL 3CFJA 4BKLA 4DN3L 3MROA 5JZ7D 3L9RB 5AUMB 3QBTB 5L8KB 3BKCH 4JY4A 5GS1B 3FQRA 5JXAH 2DI9A 3B2UD 1DN0A 4HIHB 5B39B 4P2OB 5EU5A 3LIZH 1MFBH 1YNLH 4K9EH 5FYJD 1MFCH 2GFBA 3CLEH 3WIHL 3VWJA 5GS0L 1SJXA 1CXIA 3WLBA 4XBEL 3NPZB 4K7FA 3PF2A 4PLKD 1U8MA 5IG7A 1A22B 4HSQA 4Q6YA 3TNMA 2VLKE 3ULVE 5C09E 1O0VA 2DLFL 2GTZA 3O3AA 1RU9L 1VEMA 4LEOA 2G2RA 2CIKB 5EZIH 2O5ZL 4NHCL 2IAMC 1BBJA 3P9MB 4IIQA 1MI5D 1J05B 1XGYL 4XGZA 4K3JH 4BM7A 3S96A 3FMGH 4X6DB 3VXRA 2AJYH 1FH5L 5IWLC 1UFUA 4X9GA 4HS6A 4PJ8B 3MRPB 4TUOA 2R0KH 4NZJA 4LCIL 5MENB 2EDDA 3O41A 3H7BA 4MNHB 3T08A 1BHGA 5D8JH 4LPTA 1J8HB 3H9HB 2YEZB 5ESQB 5EORL 3UZQA 4MJIB 1KF9B 4H0HB 5J3HC 1R24B 1KYOJ 1JTPA 2HKHL 4LF3A 4NT6A 4HJJH 4POZC 2VXVL 2XG4A 4X6CB 3AC0A 1TQCB 1G84A 3SKMA 3F7VA 3RIAK 4QOKD 1ZVYA 2PF6A 4N0RA 4MD0B 1AFVH 2DKUA 4EIZC 4JFFB 3NOIA 3MRRA 5J57B 4DGIL 3UDWC 4ZQKA 1S5IH 4QWWD 3X12B 1KCUL 3CC5A 4BQ6A 1JWSB 1XFPA 3DO3A 4JQXA 5I74B 3RUGA 5MHSE 2DLTA 5KANI 4O5LH 1NBYB 2X4PA 4JPVH 4YHYB 5JXED 3BP6A 2O61A 1Z0MA 1TQBC 5GJSL 3FQNB 2EKSA 4L8BA 4NQXB 3GMMA 3L3KB 4LLUA 2Y36H 4F7CA 1MY7A 5A2FA 3PHOA 2E7LA 3GSQA 4HG4K 1EZVY 2LABA 4ZAKD 4S2SB 4LNVA 2P5WD 3EO9L 4WY7L 5EO0B 1FVDB 5HHME 5CEYA 2V17H 5ITBH 1JFQL 3IU3B 3TZVB 2ZSVA 3VXRE 4C56B 1DQJB 2ICCA 2HH0H 3HAEG 1CXHA 4O9HH 3SQBA 4W4OC 3HE6C 2FECI 3FT2A 4G6FD 4EUPB 2FX8H 3T0XA 5DD3L 1OT1A 5E2UL 1QYGL 1BJ1J 2X4SB 4L29B 4HG4J 4K23H 1BPVA 1YEFL 5FO9A 2R1YA 4XNQB 4KKBC 4G6KH 4QRPA 3G5ZB 2R8SH 2X70B 5L88H 3OKNA 3UJIH 4DKAA 5AG8A 4KUZH 3ROLA 2OQJA 5IJVA 3QHFL 3O4LD 5D5MF 4NN7C 4X8JA 1IM9D 4MNGA 4NOBA 1ZXQA 4OGYH 1A47A 5GSRA 1QPXA 1L6XA 5C0FA 3WEXB 5IOPB 2NNAA 5ANMA 3C6LA 4JM2F 3HG1A 4MVBC 2NZ9D 3HLAA 1KN2L 3OB0H 1U58A 2Z93A 3V6OA 4PJ5D 2R2EB 5LWYL 2DWEA 3UZEA 1B4RA 4M1GL 1WF5A 4QRUB 1HK6A 3F5WA 4TTDC 2C3VB 3EHBC 3HB3C 2HMID 2R4RH 1A7OL 4OF6A 4DOHE 5I17B 3H9ZA 1LE5A 1HSAA 2AERT 5J11B 3LS4L 2D0FA 4IRJC 2I5YH 4WUUD 4YDJB 2F8XC 1VADA 4Z78A 5DUML 2CK2A 4EXKA 1DLFL 2ADFL 3H9SB 4HIEA 4MQ7A 4Z5RB 3MTRA 4L4TE 2F8VA 1RAMA 4OKDA 5EO1B 4LLDA 4H88L 4RCAA 2V2XA 4Q2ZB 1ZGLP 3MJ9L 1G7LB 3KPRD 3THML 1R3KA 2FRGP 4EBQH 1H3PH 4OI9A 1KJVB 2WW8A 3BO8B 3VFMB 4KI5D 2DQJH 4L8SB 1KOAA 3KPSE 2J6EL 1FJ1A 5C08D 4WU7B 1EZVX 3P30L 2XN9A 3OB0K 1C8PA 3E1F1 1S9YB 3RZCC 2EO1A 5DMIL 2WUBL 1N8ZA 3P73B 3JBG7 4LKCB 3SDCA 1EEQA 2NY2B 5IVXB 4UT7L 1DANT 2EO9A 4WRLA 1ZHKA 1MQKH 5MP6H 2FX7H 3FRUA 3LN4A 4O4YH 2BVTA 4Z7OF 5A40E 3ZL4L 3O2WL 4FMKA 1H3WM 3OWEA 2CLVB 3PWNA 3W0WE 4GQPH 1GZPB 4QGYA 3PGFH 2Y7QB 4PREB 3VFOA 4I48B 4ZYKA 1QP1A 4ODHH 2R1XA 4L9DA 3GKWH 3U36B 4WHTB 3RY4A 3P9LB 2Q7YB 1L7IH 4JKMA 4YHML 1BLNB 4RGMB 1A14L 1BM3H 1YUHA 4LCWD 4XI5C 3L7FB 5HI5C 3QEQB 5FECB 5ANME 4JZJB 2DI7A 3HG1E 4D0CA 2QLVB 5IKCA 5F97E 3BWAB 4NO2A 2RCSL 1BZQK 1QRNB 5HJ3B 4XP5H 3D0LA 2VXQH 2Z8WC 1YEEL 1Y0LA 1FN4A 3QUKB 1FNAA 1MIML 1MPAH 4ZUWB 2E7BA 4OZGF 3HR6A 2DQCH 4LQFL 3CUPA 4M8VA 1LO5B 5L2KD 3A6OA 5J9PA 4XC1H 1N3NB 4LLWB 4DUWA 2B0SL 3IXAA 3V4UH 2Y25A 4WGWB 3LKNA 4NO3A 5C9JA 3FB5A 2CSPA 5DJAA 1OAYL 4LSVH 4UB0H 3CSYA 3B83A 4D94A 3HC4H 3FN0H 1S5HB 2J7LA 5B39G 2NYYC 5IBLD 1TZIA 3OXSA 1OPGH 1CU4H 1EUUA 3B5HA 4WIQA 2DL2A 4JRXD 1S9VA 4YHPB 2YPVH 4S10A 3LS5L 2OZ4H 4JKLA 2EZ0D 1I1AB 5F9JB 4L3EA 3P4LA 2WBJB 4HUUB 1G7QA 2Z92B 3RDTA 5H37G 5JO5A 1N0XL 5C0JB 2DJ4A 3P4MB 1RIUH 4LOUC 2FIKB 4NKDA 4RSVA 4PB0H 5A2IH 2WUCH 4LSPH 4JB9L 4EI5D 3ECBA 1F4YH 1ZKAA 1D7FA 1IAII 4WI8A 25C8L 1A7PL 3SDYH 3DUUA 3SHSA 5I15L 3VMPA 3TCXA 1PG7W 3MLTB 3CIQA 1BQSA 3C87A 3ULVH 1MF2L 5KVFH 5ESVB 1GH7A 2YD4A 4PD4J 4MQSB 2P24A 2CDFA 4L3CB 4QRRE 5T1LB 2VL5A 4HGWA 2XYCA 4IDJL 3NCCB 2QSQA 3BD4A 1PG7H 4PRHA 5E8PB 1IQDB 4MAYC 4FFYL 4XP4H 5ACMA 5L2JB 4G9FD 5I1KL 4Y4FC 2OJZH 5D7LB 1U95A 4PJIB 4P2QD 5I8OL 2F19H 3KLHC 3DMMB 1EGJH 1A6PA 2IF7A 3K74B 3GIVA 1VGEL 4ELKB 3BD3A 3CLFH 3P4OA 3C5SA 3NPSC 1U3ZA 4IJ3C 1QSEB 3RX7A 1MCOL 5DLMH 3RI5K 4HC1H 4FQLL 4LAQH 5DWUL 3CFIC 4K3EL 4K94H 5I30H 4XPFH 4PRPD 3EJJX 1EO5A 2B8OT 3EAKA 3L6FB 2KBGA 3PWVA 1KFAL 1FO0A 2FD6H 1RZKC 5E8DL 5GRUH 5DMYA 4XPGL 1P4BH 3G6AA 4L4VA 4R2GD 4WEBH 5D93C 4NQCB 1H5BA 4XC3H 1MCEA 3RL2B 2VDPH 5FA3B 1LP9A 1BQLL 3WXWL 4L3EE 3KGRA 1CFTB 1CQKA 1JHLH 3FFCD 2F15A 5EZLB 4X7EC 1U8HB 3MUJA 2HTLC 1ZVHA 2C4FU 4NZTL 5ILTL 5GRVL 4GRLD 2PETA 2UZIL 1AXSB 4KKCC 3CFKA 3U30B 3MLUH 4GAYA 3ZYOA 1JK8A 2BFVH 1ZVSB 3Q5TA 3WE6B 3DV4A 3P0VL 2UZXB 1U42A 2MTPA 1QHOA 1J10A 1DP0A 3HE7C 1R6VA 1HILA 3QI9B 2N7AA 1T7XA 3BGAA 3HNTL 5DEZA 5SWZD 2Y6SD 3HNSH 3MRJA 4HFUL 3OR7A 5IHZB 3RWHB 5EA0H 4CVWA 1RVFH 2MCPL 5GGSA 3JWDL 5KVMC 5GPRA 4PUBL 2AJZA 4X99B 3JUYA 4NFCA 3SQOL 3TFKC 5C0BA 1RK0A 4U1HA 5GGVH 1I7TA 5HYJA 4ZDHB 2A1WL 5CS7A 4PIRF 3SBWC 3WFZA 1IC1A 5J1AB 2CMRL 4ELMF 2F58H 1WQVT 1FG2A 3FO0L 1C5DB 4DCQB 1E28B 3RI5F 2OP4L 4JHZA 4QXGH 2VABB 1N6VA 3S35H 3RZCA 1MJ8L 3CVHA 3LKRB 2DMCA 3FOLB 4MZ2A 2PTUA 4PS4H 3X3GL 5KSBF 1NCCL 1A6WH 2VC2H 4OF7A 1D9KD 2I07A 4KTEH 2V5SA 1R5VA 1G7IB 4U3XA 2AV7A 1BQHB 5IW6B 3O11A 2A77L 2AI0L 2K7QA 4U6XB 1OSPH 4CGTA 1KT2A 4KI5F 4RGNB 2SEBA 3VU2A 5KW9H 1LP9E 1U3HB 1ADQL 2AQ1A 2VITB 4NQTA 4PJAB 4HFWB 4KMQA 4YXLL 3ETBF 4PJBA 1VFMA 3T65A 4TUJA 4JRYD 3V6FA 3VG9C 5F21B 3C09B 3KJ6L 3OGOE 2ZP0T 2D7PA 1ZHBB 1CZ8H 4H8WH 1OGAA 1REIA 3BZDA 1FV1A 5EBWA 3KPQA 1IKNC 3VXTB 3FQWA 5EC2B 3ZHDA 3G5XA 3EDDA 5C8JB 3S8WA 1CICC 3RWFA 2Q8AH 4E42B 1XGTA 3QEUB 5FDWB 1VPOL 1T7YA 4RNRB 4PG9A 3TT1H 3V0WL 2IPUK 4PJGF 1CG9A 3IXTA 3T4AA 4YUEH 2CQVA 4UBDC 4GW1A 1Z3GH 1Q9LA 2KQMA 5ICYB 43CAA 1OHQA 4JJ5B 1IEBA 2A73A 3IKCA 3X14B 4KJWD 1YN7A 2A6KA 2YD5A 1NGWA 3RWCB 3O3DB 3BKYL 4JFHE 3VDCA 3EO1B 3QJHA 3DX9A 2NX5A 1A02N 4OUUB 3ZE0E 4BSVA 1Q94B 5BS0D 1ITBB 5IMOB 5I16B 3ARGB 3UCRA 4EDXA 3KHOA 4O02H 1C12B 4XCYA 3H3BC 5HGHA 3WFDH 1OP9A 1MFNA 3GSNL 3QWRD 1WZKA 2E8YA 3W9EA 3MLXL 3ZYZA 5C0EB 1GIGL 2E9WA 5FF6A 4P23A 2JJVA 1LDPH 3QUMB 5E08H 2D7QA 3OJMB 3MUGA 3QIUC 3QWQB 4HWNA 5K9QI 2DM3A 1UA6L 4M9PA 3LKOA 4S1DC 4QRSA 5JHLH 3V5HB 1I9JL 4LCYA 1U8OA 1HXMA 3GBML 1XF5B 3EW3B 3O8XC 4HV8A 4RWHA 3K8KA 3E6HA 4NP4H 5CSZA 4M62H 4POZD 2ZUQC 3T2NH 4OD3L 4OFVA 5EOQH 4Z7UA 5I76B 3MBEC 3RWJA 4JO3H 1N6UA 1OARL 1N7MH 1K4DB 3KXFA 3SOBH 5H2BB 3MPCA 1WJ3A 2BDNH 3IB4A 5C0AA 2O5XL 3WNNA 2H6PB 1T0MB 1OGAE 1SY6L 4OD1H 1GYAA 3HZKA 2AJUH 2FH8A 5J0BA 4XWOD 5I1AA 1OAXL 1I8LC 2APXA 4AEEA 1Q72L 1JN6A 2RB8A 3SGKC 5E03A 1AR1C 2A6IA 3P4NB 1HHHA 4U1KB 3IDIA 1HH9B 4KQ3L 2IQ9H 1O7SA 4WWKD 3SO3C 5HI4C 1MQ8A 4LGPB 1N4XH 4NYLB 1KBGH 1FCGA 3DX7B 3I6GB 1ED3B 3BVNB 3MRKA 3X11A 1M7IA 3IRPX 1EFXB 4JKWA 3TN0C 3OAZH 3FO2A 3RIFF 2R23A 3MMEA 3SN6N 4N0UA 4RMRA 1LK3L 3VGGA 2N1KA 1NDMA 2HN7A 4F15C 1T89A 4HT1H 3H3PH 3D3VA 1A1OB 3HE6D 4WO4D 5HDQH 3M1BB 4WV1C 4JDVB 3TO4C 4NKOA 1WTLA 4LHUD 3T4YA 3BQUA 3PDOA 2Y5TA 2ILLA 1ZT1A 3WL9B 1G7PB 1T22A 2XWBB 2CDGB 5INDB 2Y07L 3IVKB 3R0NA 4KAQL 1WFOA 4KKBD 4C58B 4F9LC 1MHPL 3NTCH 4WW1B 5KSAC 3CXDH 4KK9C 4AH2A 3OSKA 5DRXB 3RWIA 2DN7A 3QUYA 3HZYB 3GDBA 5CEZD 3Q0HA 2E7MA 3HE7A 2IADB 3C8DA 5IMMB 3NFNB 1IGCL 1M7DA 3SCMC 1IGTB 3QDJA 1AI1L 1XIWB 5DRWA 1FL3A 3M07A 4BUHA 3MBXH 1FZJA 5IF0A 1F11B 4YQXH 2QQKL 3NFSH 3ELAT 4X80L 4MVBD 3KXFE 4WNQB 4YDLC 5C0AE 3OAZK 1DL7H 5IB1A 1DUZB 4G6AD 4GAGL 3CZFB 5JW3H 5ABDE 4NN5B 5CUSL 1CFNB 4TTDD 4OCNC 4L5FL 43C9B 4EN3C 4LU5L 1GSMA 4HDIA 3PG2A 3D85A 1X5KA 1CCZA 1QSFD 5BZWB 2GJ6A 5IHBA 5LVEA 4PGDA 2R29L 4GG8B 1HSBB 4IRJD 4Q9BA 4KJYB 2D0GA 4HKBB 3S97C 2YS4A 4MD5B 3V7AE 5JW4N 1JZ3A 2XFXA 1T3FA 4I0PA 1LE9B 3OKKB 3KJ4B 3MR9A 3N9GL 4YE4L 2R2HB 1INDH 1K4CB 2XTJE 3JV5A 4UU9B 4DUVA 5ESAB 2AXHA 4NBYB 5HGBB 3PL6A 5ETUA 2GT9B 2MKWA 3LZFL 4MA1B 5KAQG 3K4DA 3T1FB 1OT2A 1GRWA 1GGCL 5HSFA 4OZIA 3VI3E 2CLZA 2EYSA 1WVZA 4P4KC 5T1MB 1KTDA 4FABH 1SBSH 3I9GL 2MHAB 1RZ7H 3QUXB 4WU5B 2AK4D 3D3VE 3DHJA 2VLRD 3KLSA 4GJTB 1FVCB 3MNWB 4FQCH 1MRDH 4JZOB 4OIIL 3ESVF 3EFDH 4OV5B 3VXQB 3OJDA 1CS6A 2G60L 3BXNA 1MWAB 3QIWB 2XRAH 2NXZB 3AROA 3AM8A 1J0YA 4I3RL 3QG7H 1JGUL 4MDJB 1ZGLA 4FQHA 4HJ0C 1BP3B 1JCKA 2JJTA 2OM5A 5HHOB 1L6ZA 1KCKA 2KKQA 2ZOLA 5HVWA 1PDKA 3D1MC 3QRGH 3SPVB 1C16A 3QCUH 4ETQA 1TCMA 1XF4A 1GGBL 3MSPA 3CH1B 1N5YL 2AJ3A 5GJTL 1E4XL 4Z76A 1S8DA 1QBLH 4GAJL 3RL1A 1A3RH 5HI5D 5JOPE 2OI9C 5ALBH 3V52H 1HDMA 4XP1H 5E99H 1IQWL 3U9UA 2FZ3B 4V1DA 1BQHG 1G7MA 4JFOA 3W39A 3NACL 4KKNA 1S9WB 4HD9A 1NLBL 2WBKA 1IGYA 5TH2B 5I2IB 1NJ9A 1F4WH 1X7QB 2CGRL 1F3JB 1F3DH 4BSJA 15C8H 2VLLA 5I8EA 1KXVC 1X4XA 2VB5A 4PRBA 5I18L 3R06A 1IGFL 2A74B 12E8H 3BSZH 5EN2B 1IFHL 5FHAH 5T3ZL 4PJDB 1KCSH 1UM5H 3NZ8A 4XMPH 3RNQB 2ZWLT 4KJPC 4QY8A 5FIEA 2B5IB 3QDGD 4YH6A 5FYKE 4KROC 1LO0L 1EEUA 5DSCB 5CILL 2XKSA 3QUZB 4P99A 1TJHH 5EBMB 5F88B 3RVUC 3D25A 1RUML 4ZMAT 4Z95H 1TNNA 4YDKL 1NCBH 5D70H 5IW3A 1Q9OA 4UV7L 5GS1C 4C83B 4KHXL 4GMTH 1HYRC 1ORSA 4FP8H 5TPWH 4EI6B 4M4RA 4U3HA 4R0LA 1BD2D 4LHQB 1F45A 4XAKD 2C7UB 5DRZB 3RPKA 1JF6A 4HK3J 4LSRH 1XGUA 3E8UH 1UH2A 1NANI 1DLHB 3G9VA 5D7KE 3VMOA 5CP3A 4AZ8A 3SGKA 5C6TH 1TJIL 4LVEA 5SX5K 3QDMB 4OJFL 3AVEA 2ESVE 9CGTA 2MWCA 4MSWA 3GMPA 1YNTA 4YO0B 2VXTL 3P0YH 3RWDA 5F1SA 2AQ2A 4MAYD 1OM3H 3AXLB 1GGYA 1SYSB 2FEDC 3PXJA 4Y4FD 4YHZL 4V1DE 1OAZL 3CVHH 4FMFA 5FKPB 3ALPA 5E2WL 1KN4H 1DSFH 4FNLH 3MFFB 2IPTH 5D71H 3TVMB 1JZ2A 1PQZB 2BSSA 4GFTB 4YXHL 4PJ8C 3VD3A 1AXTL 3Q2CA 5DR5L 1L0YA 3O6FA 4NWTH 2EXWD 2GQHA 4P5TD 4X9IA 5B3JE 4KMTL 2OXGA 4JKPH 4N0CC 4OQTL 3CVIH 1A1MB 1ND0A 3F65A 5ENWA 3TM6A 2ZG2A 1SBBA 3QFJB 3D2UA 3PQYB 3RJDA 2Z8SA 3F7QA 3ZO0A 4UQ3A 5JDJA 3HR5B 1E4JA 4ZXBD 1TVBA 2RQ8A 1P6AB 1PW3A 1WWWX 3WIIH 1KIQA 2VDRH 1QO3A 3LEXA 5DK2B 3RVTC 1M05B 3TJEL 1MCHA 5T3XE 1J1OL 3HAEA 1AGDB 3BUYA 1NGYA 3GI9L 2ADGB 1BVKB 3IDUA 2BC4A 4PJEA 4JHWH 1LQSR 4YJZL 3BPOB 2R9HC 4E41B 1AO7D 4Y19B 1X5GA 3GBNH 3T0EA 5D1QD 4FTVE 5F7KC 2BNRD 4F3FA 4HIXL 4U1MB 4JFPB 3OKEB 5LXGH 3SKJL 1A7QH 3VXMB 5TGBB 2F53D 2EDEA 3TIEB 1G9EA 4JAMB 1F97A 4EN3A 5TE7H 5KJRL 1E4WL 4MX7B 4ENEC 3C8KA 3STBA 1OVZA 3U7WL 1H3XA 1QFHA 4OLUL 1T0PB 1AHWC 3EYUL 2VAJA 4KQ4L 4RWYH 4B7LA 4BQ8A 2CK0L 4OSUH 1BVLA 3V5KB 1NC4A 3FB7A 1FIGH 5EUOA 4RBPH 1EAJA 3GMNA 1P7QA 1NL0H 5AG9A 4J4PC 4M5YL 4FXGA 3U4EB 5I75B 1Q9KB 4UTBL 4XHJC 2FGWH 3MREA 4LDEB 4RQQA 5D1XC 1MHCA 3ARFB 1ETZB 1KLGA 5DJ0A 4F7TB 1PAMA 2GKIA 1UH3A 3VRLF 4GW5B 3TBYA 3RBGA 1MJJB 1S3KH 5L0QC 2OL3A 4WTZA 4OLZH 1NFDF 5IV2A 1IGJA 2VXSH 3BP4A 1RZFH 1KEGH 5DQ9B 4BQBA 4JCMA 5DGQA 1EFQA 4PY7B 4HUWA 5GS0H 4MJ6A 5C0RH 3GMLB 2VIRB 4IBLT 4HIJA 2C1OA 4ZFZA 2AABH 4YEEA 1HN1A 3MRNB 1O5DT 2ZKHL 5F1IB 4JM2B 5JOFB 5DURB 1YMMA 2MSPA 1T4KA 1PKQB 5FKAB 5F3HA 1HH6B 5HVHB 3N1GC 4I0KA 4DZBA 2CKBL 4PJEE 4KH2A 4OTXH 5HGAA 6FABL 1FE8L 3BISA 3QIBB 4RBPK 4HAGA 4NN6B 5AZEL 1XR8A 2BERA 4N8VB 4OF5A 3RZWA 1RZ8B 3I3BA 3T0EE 4ZS7L 2XQYG 4UQ2B 4ZTOL 1BEYH 5BO1H 4KWUA 2ICEB 3WN5B 3C9NA 1U8IB 4CMHC 1OTSC 3JVGC 3NIDF 2MQ3A 1YYLH 3IYLW 3QQ4B 4NZRL 1N2RA 1U8LA 3JWOL 1FC1A 1CICD 4NRZA 4P2RA 2X4RB 3OKYA 5CGYD 3S5LB 2AEQH 4P59H 2RHEA 2AK1H 1TJGH 4CADA 5K59E 5B21A 5EUOE 4GBXB 4YXKH 4UBDD 2JCCE 3OKMB 7CGTA 3KYMB 3LPWA 4NJAH 4XCEA 2J2ZA 2RJMA 1FPTL 4FZ8L 4Z7WF 4Z8FH 1ACYH 4C54A 4PBWD 4IRSA 5C07A 4U6YA 1K2DB 1ZHLB 4AIZA 5K9KA 1EEYA 5EBGA 3U1SH 3LHPH 4NM8L 5FUZL 4JFDD 4GSDH 3O45A 3REWA 5CBAA 3GSRA 4JHAL 1CE6A 3O3BB 2HA1A 4FQPA 3IFOB 4TRPL 5CLWA 5DEFB 1I8MB 5BQ7B 3L9RA 5AUMA 5GS1A 3QISA 5KZCB 1EEZB 2YK1H 4HIHA 5B39A 3C2SA 3VMNA 1NUGA 4P2OA 5GGTA 3TPUB 4LSQH 5F72S 5EC1B 5FO8B 4S1DD 1ZTXH 3NIFE 3O0RH 3PWPD 3V4PL 2EIEA 2X89D 3IETB 3ZE2E 4GRWE 3K1DA 1TZGH 4XWGH 2YD7A 2ITCB 2BNUB 2GSIB 2QQLL 4HCRL 3V6BR 3ME0A 3MBED 4OZGB 3DSNA 2CIKA 1Y6MR 1ZLWH 3ZYJA 3T3PF 3DETC 2P7TB 3IDXL 3P9MA 5CJQH 1J05A 1AP2B 4IMKA 4X6DA 3MOBH 2OTWB 3U0PB 2KZWA 5GQBA 2GTWB 2JE8A 4WGVB 1DQTA 1I8IB 4PJ8A 3MRPA 4CU6A 3BE1L 1UC6A 5MENA 4MNHA 2R39A 4U4BA 4PV9B 5FYKH 4UT9H 5C0ND 5HHQB 1J8HA 2YEZA 3H9HA 4K7PX 5ESQA 4YWGL 1YA5A 4MJIA 5GZND 1R24A 4M5ZL 3QXDB 2PYEB 1NLDH 4KK8C 4M7LL 5DO2D 4ZPTB 4G9DB 4PV8B 4Q0XL 1OW0C 4X6CA 1I1AC 1N6QH 4Z7NE 4G43B 1EPFA 3TN0D 3BKJH 2HJKB 2BHZA 2WBJC 2FATL 3LSOB 3NAAH 4ZFGL 1WWBX 5CHNB 4MD0A 1YEJL 4E0RB 4PP1C 2MMXA 1CGUA 1ZLWK 4PJ7F 2J8OA 5SWSB 1GJIA 1JPFB 2DOCA 3MJGX 3IJYB 4FQ1L 3X12A 3QP3A 5JNYB 1JWSA 4YHLH 2LU7A 4ODTL 3L5WB 3RU8H 3ULVD 5C09D 1NBYA 4Q6IB 1Z9LA 1JGLH 4JPWL 4XX1G 4LHJB 4WTWA 2HFGH 4KK9D 4QOKB 1GC1C 4NQXA 3TA3C 3L3KA 1FDLL 4HULB 4XP9H 2RR3A 1HQ4B 3NA4A 4XVUD 4MWFB 3SCMD 4AL8L 4S2SA 4DN4H 5A3IC 1EHLH 4I3GA 1FVDA 2XACC 1XZ0B 2W65B 3MRLA 5EO0A 1NFIB 5C0DB 4GW4B 3ZSSA 3U7YL 4XMLH 1IBGH 4M7LT 4UINH 3IU3A 3LMJL 3TZVA 1ERNA 4C56A 4X6DE 1I75A 1DQJA 1NAMB 1J0HA 5IEHB 4APQB 3ZL4H 4EUPA 3QG6B 4YNYB 1NSNL 2FEEI 3IJSA 4LCCC 3ULUL 3KPNB 4JDTH 4X5WB 5D96C 5IEKB 4ZAKB 3UTPE 2W9EL 5EU6B 3V7MA 2X4SA 1MELA 4L29A 3VWKC 3SGDH 3H0TB 4HKXB 5HXMA 1IARB 3NGBB 1QBAA 4XNQA 3CU1A 5F1KC 5T3XH 2EIDA 2X70A 4M7ZC 1J8HE 5IT2H 4YHMH 2VR4A 1BOGB 3HPJA 4ZSOB 3VXSB 3OAUH 5D72H 4MJIE 3FB8B 3RKDC 2BVPB 1F4XH 3MOAH 1B0GB 4G6FB 4NM4H 5HPMB 4X6CE 3JWNC 4OFYA 4DAGH 2BSTB 3WEXA 5MHSD 2X4UB 1LMKA 5IOPA 1MCPH 2BXYA 2IEPA 4LDLB 1QA9B 3VFPB 4NOFA 5ALCH 1XEDA 3RVVC 2JELL 1ZSDB 1F6AB 3GKZA 5I1HL 4CUCA 4JFFE 2R2EA 4Y2DC 3VWJD 1TLKA 4QRUA 2C3VA 3ZKND 3M17B 4NCC1 4DKFL 3LKPB 5CP3H 3O4LB 4JJHA 1MEXH 1IM9B 5I17A 1KC5L 4DW2H 3LN5B 5GISH 3KYKL 1T2JA 1VFUA 3OV6A 2DLHA 2I24N 5F7EL 3GFUA 4YDJA 5HHMD 3W2DL 4JM4H 4HJ0D 4ZTPH 2ORBL 3WIFB 2P44B 2EYRB 3N50A 3H9SA 4PJ5B 3VGEA 2EDRA 4Z5RA 2DQIL 1YJDC 1KACB 5EO1A 4G5ZH 5B8CC 4OZIF 2QV2A 4RAHA 1PFCA 4Q2ZA 2NY4B 3BIKB 4OCRL 1G7LA 3UYPA 4ELMB 1KJVA 3BO8A 4K7PH 2LAAA 3VFMA 2BSRB 4L8SA 3ZE1E 4ONFH 1HHGB 3VFVB 4C56E 4WU7A 5C9KA 4TNVK 1TTUA 4N1HB 5DMGC 4JO4H 4OT1L 1S9YA 4HF5L 1EA9C 3P73A 2ED8A 4LKCA 3BPLC 3VXUD 1QFUH 2NMSA 1JVKA 2PTTB 5IVXA 1ZOXA 3KPRB 3HAEH 2OK0H 2CLVA 4IDJH 4LNRB 3QAZB 3MQIA 5JQ6H 1SJEB 1GZPA 3U9PL 2Y7QA 5C08B 4PREA 2YUWA 4KJPD 1EMTH 4I48A 2UY7A 2OLDA 3U36A 1U3HC 4OCXL 4WHTA 3P9LA 2Q7YA 2YRZA 1K85A 1BLNA 4KROD 3L7FA 3S5LG 3QEQA 5FECA 2VISB 4ZFOB 4JZJA 3EKCA 1INQB 1GGIH 3OHXB 5B4MD 2NR6D 3BWAA 3MLVH 4QTIL 5ISZE 4KKAC 5DD0L 2R2BB 1FBIL 1QRNA 5HJ3A 1YEDB 3I2CL 3TCLB 3QUKA 5E56A 1BVZA 3JZ7A 3QPXL 1WTGT 4HJGB 4ZUWA 3KHQA 4L4TD 2XTJC 2ZUYA 4PBXA 4RA3A 1LO5A 2FBJH 4PJGB 3LRHA 4GO6B 2FDBP 1N3NA 3ARSA 1KFAH 2DYPD 4LCWB 4LLWA 4MXWH 2A9NL 4BUGA 4BZ2H 4UILH 3X13B 2VWEC 3CK0H 5C0CD 5IB4B 3KPSD 2FCBA 1EO8H 2K3TA 3H9SE 4JGJA 5DFWH 5EUKB 1Q1JH 3KYOB 2Y23A 3U4BL 1S5HA 4LFHD 4ONHB 1HINL 3B4NA 2OL3H 3BH8B 5L2KB 4X7DC 2AJXH 3ILPB 4YHPA 3B5GA 2FEDD 4LVOC 2UZIH 1S9XB 3P2TA 4K71B 1I1AA 5F9JA 4TNVF 4YX2H 3W0WD 2P8MB 3HS0A 2WBJA 4HUUA 4JFZL 1A3QA 1MHEB 2Z92A 5C0JA 1WFNA 3MUZ1 3P4MA 4XPAH 2DMKA 3WJJC 2FIKA 3BGFB 2J88L 4K3DL 5IVXE 5TF0A 4NQVB 5DJ8B 1AY1L 3CD4A 3U2SB 1LEIB 3O2DA 1PY9A 1KPUB 5TE4H 3UTTB 1JBJA 4O58L 2AXGB 1UKQA 2UV3A 4JRXB 4GRWH 4MCYB 1WISA 5I71B 5ESVA 3JWDH 4UV4H 3B8SA 4L3CA 5D2LE 5T1LA 4I9WE 5AZ2H 5I19H 3REVB 4HWBL 1YPZF 4HS6B 4GMSH 3B9KC 1VESA 3I50H 1EH9A 3HN3A 3MCLH 3WXVL 5K9QG 3QEQE 5E8PA 1IQDA 3AREB 3BUTA 4OCWH 5JTWA 1GPOH 3R8BB 2R9HD 3B2VH 4EI5B 5L2JA 2JJUA 3DO7B 5D7LA 3C5ZC 4PJIA 3FO0H 1X5FA 1QRNE 1DFBL 2HWZH 2H2SC 3DMMA 5ID0B 1T0NB 1MREH 2X1OA 4ELKA 1A5FL 3SE9L 1KLFA 5I73C 1C5CL 1J9CT 4LARH 3BPCB 1QSEA 4WUKL 1H8OA 1YECL 2YD8A 1RUQH 4LMQI 4AQOA 4IMLB 1FL5A 1KJ2L 3V0VB 1TPXB 4JVUA 5BV7L 1I9RH 1RURL 4P2QB 5HYIA 3L6FA 4WENB 5T3ZE 1NAKH 4KZDL 4GS7C 4JO1L 4M7JL 3TC9A 1MCIA 2XZQH 4NQCA 1QACA 3RL2A 3WMSA 3BKCL 5FA3A 3H6JA 2OR8A 5JXAL 1CFTA 2R56H 4MS8C 4PRPB 1LO3H 5EWIH 3LIZL 5EZLA 2EDJA 1MFBL 1QNZH 5GGTH 1U8HA 1J0JA 1YNLL 4K9EL 4WEMB 1MFCL 1SEBB 4QRRD 4U7MA 2WM0A 3CLEL 4R2GB 1AXSA 5TDNB 2OXHA 3BH9B 3LQAH 2CJUH 2Q87A 4KI1A 2EE6A 1ZVSA 1VACB 4FOMA 5DVMA 3WE6A 5EOCJ 3O9WC 5J12C 4TOYH 2L0DA 3L3HB 5ELIA 3L5IA 3HZMA 3FFCB 1IJ9A 1RUAH 3E6FB 4WI4A 5EZIL 3BKYH 5IHZA 3RWHA 4GRLB 4K3JL 1YYMH 1IAMA 3FMGL 3TWCH 3NCYS 2AJYL 4JFEE 3H42H 4YZFF 4X99A 2FYYB 2FBOJ 4PJIE 2FHFA 3KPTA 4NHUB 3QZWB 2R0KL 4NN5C 2AW2A 4ZDHA 2OQJB 1HHJB 5D8JL 4P9MH 5J1AA 4X4XB 5SWZB 2J5LC 2E27H 3RVXC 1OTSD 1QSEE 1C5DA 4DCQA 5GSRB 1E28A 4F8QA 3UYOD 2VABA 1KCRH 4RAVB 4JLRB 1EJ6A 3LKRA 3FOLA 4NC1C 4TULH 5FGBC 2I60H 4LLMB 5DJXB 1E4KC 3TEUA 5FGCB 5IK3B 4HJJL 3FB6B 5JHDB 2HT2C 3IT8D 2BP3A 3I6KA 2KH2B 4PGBB 4HS8H 1G7IA 1BQHA 5IW6A 1AFVL 2R69H 2YD1A 4NQCE 4U6XA 5F9OH 1G7HB 4PJFA 3BDBA 5TJWK 1UXSB 3FO9B 3V6ZB 1DQMH 4P9HC 1S5IL 4J7RA 4ERSH 1U3HA 4HH9B 2VITA 4PJAA 1LK2B 2FJGB 4HFWA 3UROR 2WNGA 1F13A 2VLME 2QQQA 1QHPA 3ZTJG 2PXYC 4O5LL 4UIKH 2Q76B 1D9KB 4JPVL 5DJYB 2G9HB 1OAXH 1ZHBA 4QCIB 4M93B 3QCVH 3Q6FB 3FQUB 4OFDA 4KTDH 1VFBB 5EU7E 1MCCA 5LBSH 2UY6A 4KXZI 2Y36L 3VXTA 1PYWB 5EC2A 2OYPA 1NEZB 1RY7B 4LK4A 4KQ3H 2EIZB 2PW1B 5C8JA 1V3KA 1ZLVK 1FHGA 5A2KH 4E42A 4MXVE 2B39A 3QEUA 4OGZA 4CVXB 5FDWA 1G1CA 2P5EE 4RNRA 4JRYB 2F9BT 2IFGA 2V17L 5ITBL 1JPTL 1QLFB 2H8PB 1U8JB 1KGCE 5ICYA 4XH2B 3H8NA 3IDGB 2ED9A 2HH0L 4LRNH 4O9HL 3X14A 2PO6C 3B9VA 3OKDB 3RWCA 3O3DA 5L9DH 1EXUB 1QFWH 2FX8L 5E5RB 2BSED 4EUPH 2OJEB 2B2XH 5DHYB 1X5YA 3EO1A 3OB8A 4FRWA 4PB9H 4OUUA 5E7FA 4K23L 1Q94A 4LIQH 4BQ9A 5IMOA 2EIBA 3C5JA 4QGTA 5I16A 3ARGA 2E7HA 4G6KL 4B7IA 5HYSB 2R8SL 5L88L 3T3ME 1C12A 3UJIL 1F8TH 3UTZB 3O4OC 4KUZL 4MYWB 2DL9A 5C0EA 4XMKH 3WJJA 2LQRA 2IWGA 4QRQB 1SM3H 3QUMA 4OGYL 3SY0B 1XMWA 2EE3A 1KNOB 4Y4HC 4NNYB 2IAMB 5BS0B 3O6LH 3V5HA 5HHVH 4BH8B 1XF5A 1F4HA 2MCG1 4RGNE 2V9TA 3B5TA 4XNXH 4LQ1A 1R3IH 4PJAE 4J3UA 1EDQA 4Z0BH 4Y1AD 5I76A 2R4RL 4KPHH 3L3IB 2XT1B 2YD9A 4HGKC 5TE6H 4O51B 1K4DA 2DJUA 3DRTB 5H2BA 1ZT4B 4PP1D 4P3DB 2I5YL 2H6PA 1T0MA 1WCBB 3MNVB 1C1EH 3AS2A 5ADPH 3UTSE 4B5EA 1U9KA 4MJ5B 1V7NH 4XTRD 3SJVD 4JG0H 4JFHD 3RGHA 2GK0B 2XNAB 1DBAH 3S36X 4EBQL 1JWMB 1H3PL 1U2HA 3KAAA 4MCZB 3P4NA 4U1KA 2DQJL 1JL8A 1HH9A 3TA3D 2QSVA 4RISH 3LZFH 2IGFH 4NYLA 3I6GA 3DX7A 1ED3A 2HVKB 5A3ID 3BVNA 3R1GH 4U6VH 4FS0A 2XOTA 1EFXA 5CJ5A 2BRRH 4R8WH 2H9GB 3TVMC 2QKIB 1XAUA 4X4MA 1TQBB 2Q3AA 5MP6L 4LGRB 3G5VB 2FX7L 4URTB 4O4YL 4HGWB 1MY5A 1A1OA 5FCUH 4WWKB 3M1BA 4JDVA 1T5WB 4UNTA 3PGFL 5JR1H 1QLEH 4ODHL 3WL9A 2QADD 3LD8C 1G7PA 3GKWL 3VWKD 4JFQB 2XWBA 2CDGA 1L7IL 1U95B 5INDA 3IVKA 3DGGB 5DDHB 1HI6B 1YEGH 1V7MH 1BM3L 1V05A 4WW1A 5DRXA 5BXFB 3ZHKA 2QEJA 2UUDH 1G7JB 4YEFA 1JE6A 3HZYA 3KS0H 3C6SA 1P9MC 3CDFA 4PTUB 2IADA 1OGAD 4EJ1C 2VO5A 1LO4H 3BPOC 4XP5L 2VXQL 3NFNA 3HE6B 4KFZC 1IGTA 3QXAB 2EDLA 1XIWA 1FNEB 1MPAL 4LHUB 4XNZC 2VDNH 2V9QA 1NC2D 2DQCL 1F11A 4G3YH 4IHOB 4Z6AT 3SKOB 2M2DA 3S37X 4WNQA 3KYNB 4XC1L 2A38A 5J4MA 1JYNA 1DUZA 2CGRH 4Y2DD 3CPLB 4LSSH 3CZFA 3NCBB 4YFLF 3V4UL 2PW2B 5C0IB 3RTQC 1CFNA 1UZ6E 43C9A 1WITA 2HLFC 3TH4T 4LSVL 4UB0L 3HC4L 2MOVA 3FN0L 3LKQB 4QT5B 5CCKH 2ICWJ 4GG8A 4OLEA 1HSBA 1IC4H 2AXFB 1OPGL 1CU4L 3TBTB 4KJYA 5FHBH 4HKBA 4Y16C 3ZT6A 4NQSB 4MD5A 2OR9H 2VQ1B 4PGEB 5FGBA 1E4KA 2YPVL 1LE9A 3OKKA 5HGGS 2OZ4L 1S7SB 3LQMA 3GI8H 2UUDK 1HXYB 2R2HA 5DC9B 1K4CA 1WGOA 4UU9A 5ESAA 1RUMH 5FO7A 5FM4A 2P4AB 5HGBA 1NFDB 5BW7C 5I1JH 3U6RA 5F9DC 5DJDB 1RIUL 4TSAH 4P23D 2YUZA 4PB0L 2WUCL 4AMKL 4KHXH 4LSPL 1MNUH 3T1FA 4IRJB 1F4YL 3O2DH 5IJKC 1YEHH 5T1MA 2BHYA 2MHAA 3MRJB 2PKDA 3QUXA 3SDYL 3EYOB 4WU5A 4UI2A 1FVCA 3MNWA 4Z9KB 3ULVL 5GS0D 4JZOA 4OV5A 5KVFL 4MHHI 3VXQA 3PP4H 1MWAA 3QIWA 1DDHB 4RFEB 3K3QA 3QZWG 5IIEB 1TJIH 3FHAA 1PG7L 4MDJA 3QDHA 4NJ9H 4XP4L 3TJHC 2CR6A 3J8F7 5HHOA 5B22A 5C0AD 5K9OA 3SPVA 4P3CH 5I1IL 1NCWH 2OJZL 1PLGH 2AK4B 2F19L 2VLRB 4ZOEA 4XT1C 3NMEA 3CH1A 1EGJL 3D39E 3AY4A 2F5AH 2UWEF 3EIFA 3BESR 3BAEH 1NKRA 4QRTB 3FOMB 3CLFL 1UCBH 2XWJB 3WN5C 3IS0X 5DLML 4HC1L 2DM2A 4KKAD 4JPKH 4NNPH 4LAQL 2FZ3A 3SE4C 4K94L 5I30L 4XPFL 4NPYB 1S9WA 2WQ8A 4HGMA 3UMTA 2ITDB 5TH2A 4O2FB 5I2IA 2XTJD 4IOFC 1X7QA 2FD6L 4B50A 1F3JA 5GRUL 3ULUE 1P4BL 2GYSA 3E2HC 4WEBL 1AQKH 2Q3ZA 1CTOA 1V5JA 2A74A 4Z7WB 4XC3L 1CLOH 2VDPL 1IT9L 3EYSL 5EN2A 1YMHB 4PJDA 1PJ9A 4J12A 3RNQA 2DKMA 3WKMH 4JGMA 1JHLL 1NEZG 2ED7A 5JUEL 1JI1A 2DLEA 4Y4KC 3BQUD 5K9JH 4FQXD 2YRPA 5DSCA 3QUZA 3MLUL 5EBMA 5F88A 1ULVA 1I3UA 2BVQB 5HHXH 3ARDC 2BFVL 5L6YH 1CG9B 3TYFB 3VA2C 3EZJB 5JA9A 3QUYD 1AD0B 1CD8A 3T04D 1RJZB 4C83A 3K0WA 3G9AB 4ZD3H 2IMMA 5DQDH 3QDGB 3WFHA 1WBYB 3GM0A 3KPPB 1UKSA 4EI6A 2CD0A 2IH3B 2C7UA 2B1AH 4LPXA 4ZUUB 1K8DB 2NX5B 3OF6A 5DRZA 2G5RA 5JOPD 2OTPA 5EA0L 5MI0C 1RVFL 1J1PH 1DLHA 5HBBA 4XXCC 5JZ7C 1CYGA 4GXUM 1F58H 2FX9H 3EZ8A 5GGVL 4WI2A 3DXAB 3QDMA 4NQEE 5I0ZA 1BGXH 3B2UC 4L8CB 4CJ1A 4YO0A 3WSQH 2X44D 2F58L 1BD2B 3QA3B 3AXLA 5I9QC 2EDOA 1DUYB 4QXGL 1SYSA 5I1LB 3RY5A 3S35L 3C5ZD 1V8HA 1Z6JT 4FQIH 1OLLA 4MA7H 5FKPA 1ZLSH 1A6WL 2VC2L 4FFZH 5FYLH 3CAFA 3MFFA 3TVMA 1PQZA 4KTEL 5DC0A 1RUKH 5DTFB 5CBEB 1QFOA 4OM0H 2EDNA 5FYKD 1A1MA 7FABL 4W68A 4MAYB 3B9DA 1OSPL 3QFJA 3PQYA 3FTGB 3VG0L 1T7WA 5I1CH 2QSCH 4Y4FB 3Q6GH 5KW9L 4OCMC 2ATKB 3RY6C 4PJDE 4KU1A 1A1NB 3HR5A 3N1MC 1G1YA 2XWTB 1TXKA 4M43H 1TVDA 5AZEH 4F7PB 3JV4B 5DF0A 4HPYH 5DK2A 4PGJA 3Q5YA 4ZOBA 2YPLE 1AGDA 1CZ8L 2ADGA 1BVKA 4H8WL 4LLVB 4PJ7B 2V7NB 4IJ3B 2DKSA 4P5TB 4E41A 4Y19A 3IRZA 4YGVB 1RJYB 4MNQE 1F00I 1K3IA 5D7KD 3UC0H 3ZT7A 1QRKA 4U1MA 2Q8AL 2FO4B 3GSXB 4JFPA 5JMOC 3OKEA 5IM7B 3VXMA 2BVEA 2F5BH 5TGBA 3TT1L 1X6NA 5A2LH 3C08H 3TIEA 2ESVD 3L3JB 4YUEL 4F8TA 1UXWB 4Y5VC 4TSCH 5FGRA 4JAMA 5D93B 3FO2B 5FOBB 2CH8A 4ZUSB 3C60C 1Z3GL 2K1MA 4DZ8B 4JVPA 1HWGB 3MRHB 3A0OA 4MX7A 1AO7B 1MUJB 1U0QA 1T83C 4YC2B 4V1DD 5D1QB 4R3SB 1DR9A 2BNRB 3MO1B 3V5KA 1OD9A 4QWWC 1T7ZA 5BZDB 3OKOB 4TNWF 3I75B 3FRPG 2C4FT 1KEML 1QFWI 3N1FC 3U4EA 5IQ9B 1Q9KA 5JXEC 4O02L 3KPMB 4GKSB 3ARFA 1ETZA 4F7TA 3WFDL 5A2JH 1I1YB 5E4EC 5BW7A 3RQ3A 2MNUA 3WDHA 1P5VA 4CU8A 5FOJA 4GLRI 1LDPL 1LO2H 3FQXB 4GW5A 4QLRA 1MJJA 3QUMH 5E08L 5DYOB 2HAZA 3RVXD 5IJKA 1RJLB 4LHUG 5JHLL 5T3XD 5DQ9A 3SGJA 4PY7A 3EDKA 4KDTC 3QFJE 4NP4L 1OWRM 4M62L 1J0ZA 3GMLA 2VIRA 1WIOA 5IB1B 2HTKD 3T2NL 5E8EB 2HT2D 5EOQL 4FTVD 1MCSA 2IAND 3MRNA 4JO3L 2VSDA 5F1IA 1N7ML 4NQDE 4JM2A 3H7LA 2YD6A 5JOFA 2ARWA 2P8PA 3SOBL 2BDNL 1MVFA 1PKQA 5FKAA 1HH6A 1MIEH 5AAWA 4CL7A 5DJZB 2VLJD 4TN9A 1GHFH 1CDJA 4OD1L 2AJUL 3QIBA 4PGDB 3ZLQC 3DGCR 2CRZA 4Y19E 4N8VA 3QCTH 1RZ8A 1X5IA 4LLQB 4LPWA 3QO1B 2J12B 4UQ2A 2PXYD 1U8NB 4CDGC 3MR9B 2ICEA 2XZAH 3WN5A 5I0DA 1U8IA 1P4IH 2WMPA 2D7OA 2IQ9L 3QQ4A 2OSLB 4P46C 1N4XL 2NZ9C 4X0KB 3OAYH 2L7JA 4OZIB 1KBGL 4YHKH 2X4RA 1RK1B 3S5LA 4M7LH 1EVTC 1FYTB 3GGWB 2JKXA 4PJFF 5EIIB 1O7VA 1Q9WB 2LTQC 2QTEA 5KS9F 1DQQB 4QXTB 2HMIC 1T04A 4GBXA 1ZS8B 1W0YT 5DD5H 3OKMA 1U6AH 3KYMA 3EOYG 4HT1L 4NKQB 3SGEH 3H3PL 3OGCB 4XVTH 2PO6D 5HDQL 3OMZA 1K2DA 1ZHLA 4TVSa 5BVPH 4M3KB 4XCNB 1CICB 1G9NH 5D6DA 3O3BA 3RA7H 3NTCL 1MFAH 3IFOA 4EOWH 3CXDL 5DEFA 1I8MA 1LNUB 5BQ7A 5I8KH 1EBPA 4Q9CA 4Z76B 2CRYA 3RL1B 1LWRA 3E0GA 1EEZA 4ZPVB 1I3VA 5D5ME 3DLQR 5JW5B 3VI3F 4TVPE 4MD4B 2GCYB 3MRFB 1T5XB 3OAYK 2Q1EA 4U1JA 3MBXL 4UOJA 3TPUA 1CLZH 4D0DB 5EC1A 5FO8A 4Y4HD 4YQXL 3NFSL 3PNWB 1PKQE 1IMHC 1DL7L 1LGVA 1G9MH 3ARZA 3BP5B 3IETA 1H3TA 3N06B 4YLQT 2ITCA 2BNUA 2R4SH 2GSIA 5JW3L 4PLOB 1KTLB 3IFNH 1FZOB 4UAOC 1HKFA 2YXMA 4OZGA 2R0ZH 32C2B 1NSNH 1R3LB 5E2VH 3I3DA 5DQJB 3MZGB 2P7TA 3QIUB 5CGMA 3DV6B 3KG5A 1AP2A 2UYLA 2QR0B 2OTWA 1ZMYA 2DLIA 2V5RA 3U0PA 3O8XB 5BJTB 1JNLH 4PJCE 4U7KA 4XHQA 2GTWA 1I8IA 1INDL 4YHIB 1NDGB 1SVZA 3UPCA 3MBEB 4PRAB 4PV9A 4MA3B 5M7QA 3MV01 1CFQB 5FV1L 5HHQA 5LAXB 3O3UN 3ES6B 3HCVB 4P9HH 3JXAA 3QXDA 4FABL 2PYEA 1DBMH 3VFTB 2EDWA 1RZ7L 1G0DA 4ZPTA 4J6RH 4G9DA 2AJSH 4PV8A 1BJMA 3BDYH 4FQCL 1MRDL 4K71C 3B9AA 3EFDL 1LHZA 1J8KA 4G43A 1MWAH 2EDHA 2HJKA 2XRAL 4HXBH 1YEIH 3VFSB 3LSOA 5CHNA 5IBUG 4AIOA 1TDQA 3QG7L 2HRPH 4HEPG 4E0RA 3IFLL 4Z7OE 1CDIA 4M02A 5SWSA 3WFBH 4KRPC 4QXUH 4MA8H 1RHHB 1JPFA 3IJYA 5F7EH 3ILQC 3QRGL 1ES0B 5JNYA 5C70A 3QCUL 4D3CH 3L5WA 5E00A 3LCYA 2KL6A 5I71C 1YPZB 1AGBB 4Q6IA 3TN0B 1QBLL 1A3RL 2NY3D 4QOKA 5ALBL 3V52L 5F1NB 4F15B 4XP1L 5E99L 1INEH 1L4IA 1HQ4A 4EI5C 4MWFA 3UTOA 4F33B 2X4OB 4WV1B 5F7NC 3TO4B 1W72B 4YAQB 4ONOA 4GKOA 3BFOA 4JR9H 1VGKB 4U6TA 1HE7A 4HXAH 3PIQB 4OZGE 1XZ0A 1H3VA 2W65A 1NFIA 5CJOH 1F4WL 1FO0L 5C09B 5C0DA 3VI4E 4GW4A 3GSOB 4M7KH 1TETH 3RRQA 15C8L 4PRIB 5KSAB 1WV7T 4NUGH 12E8L 3BSZL 1NAMA 2F54B 2B4CC 1OLZA 5IEHA 5FHAL 4APQA 1NQBA 1KCSL 2XY1A 3QG6A 4YNYA 1UM5L 4XMPL 2HLFD 3SCMB 3KPNA 4LVNC 4X6EB 4X5WA 5IEKA 4ZAKA 3FAWA 5EU6A 4PJHE 4ZFFB 1MLCB 4EKXA 3H0TA 4HKXA 3L5HA 2BNQE 5E2TH 2FJFB 5ID1B 3ISWA 4ODUB 4Y16D 1TZHB 2EH7H 1T1WB 4YDLB 2QHLA 1CXLA 4WJ5B 4G6ML 1BOGA 1TJHL 4ZSOA 3VXSA 5DVNA 3FB8A 3RJQB 2Z0BA 2PYEE 4X6FB 2BVPA 4Z95L 1BECA 3IU4H 5B3JF 1B0GA 1N59B 1NCBL 5D70L 1DQLL 5KVEH 2EKJA 5HPMA 4E5XB 3I84A 4G42B 4GMTL 5GIRB 2X4UA 4P2OD 1QA9A 3VFPA 1FVEB 3JWOC 1MOEA 5CGTA 4Z0XB 5TF1H 4GKNB 1ZSDA 1CIDA 1F6AA 1JMZA 3MLWL 5SWSE 2EH8H 4LSRL 4MDIB 3E8UL 3NFPB 5CINH 5D1ZC 3M17A 3NN8B 3LKPA 3O4LA 3L3GB 5C6TL 3AFLA 1IM9A 5GSVB 3LN5A 3TV3H 4M1CD 5GGRY 1D5IL 5C7XH 3P0YL 4QOKE 1ROWA 4M1DH 1OM3L 4P49A 4U1LA 3TJHD 5D2NC 3DBXB 2EYRA 1KCVH 4P4KB 4PJ5A 3CVHL 4A6YB 1KN4L 2ZUUA 1DSFL 2W07A 4FNLL 4QHKJ 5D71L 2IPTL 3INUH 4O2EB 3UTPD 4ELMA 4NCDA 4XRCB 3UPAA 2BSRA 4NWTL 4NUJB 1IAIH 4G8GE 4WI7A 3ZDZE 1HHGA 3CVIL 3K4AA 5KVGH 1A7BA 3VFVA 3L1OH 2Y6SC 5IHLB 1IC5H 1AY1H 4RFOH 1CLYH 3SDAC 1MRFH 3EOBB 3UXFA 1P7KB 4HLJA 5CJ8A 5EU6E 3I02B 3OZ9H 2PTTA 4N8CH 3WIIL 2VDRL 4UT6H 3KPRA 4DVBB 1OF2B 2EDTA 1U8PB 3U48A 4HWBH 4JHWL 3WHXB 4LNRA 1YQ2A 2PCPB 1SJEA 1PEWA 3VXSE 1UYWL 3PP3H 3RGVC 3GBNL 4JFFD 5C08A 1KLUB 3BMVA 3A6BH 2GUOB 2HFFB 5CMAB 2B7DT 4Y4KD 5LXGL 1A7QL 3VXUB 2VISA 1EHXA 4ZFOA 3HUJF 1BZ9B 4ISVB 2GJJA 3OHXA 3QFDB 2EICA 1C5CH 5J13B 2R2BA 3BRGC 4OM1H 5CZKA 5TE7L 1YEDA 4AT6B 3RFZC 4Q7DA 5IROC 1C08B 4HJGA 4RWYL 3O4LE 4RGOH 5J6GB 3G6JE 2Z31C 5EULV 4OF0A 4PJGA 3EGSB 1FIGL 4KROB 4R96B 4XPBL 4LCWA 1NL0L 3MV9D 3X13A 4L4JA 4DUXA 2FGWL 5JORA 5IB4A 3V2AR 3TZVD 2JJSC 5EUKA 2Y06L 2N56A 3KYOA 1FORH 4DGYH 1X3DA 3PP3K 1EHAA 4BSWB 4ONHA 3MV8E 1S3KL 4L4TB 4OLZL 3BH8A 4ELME 5L2KA 2VXSL 3W82A 2X9WA 3ILPA 2DYPB 1RZFL 1KEGL 3TBWB 4LEXH 5CJXA 1S9XA 3VFRA 5C0RL 5KSBE 5GRZA 5FUCE 5C0CB 4K8RH 1D5BB 3KYAA 3KPSB 2JCCF 5C2UB 2P8MA 5J1SC 2DQUH 1OY3B 4TVPH 1MCQA 1MHEA 3BP7B 4OCSH 2AABL 2VN7A 1J5OH 4KJWC 4DEPB 2V7HB 2NLJB 4NQVA 5DJ8A 3U2SA 1LEIA 1KPUA 3UTTA 4I3SH 2AXGA 4JRXA 1GGTA 4OTXL 4KI5E 1KYOK 4MCYA 1AC6A 4YK4C 5EIQA 5ISZD 4JO2H 3CDCA 5IESH 2E9BA 2AVGA 3GM8A 4IS6B 2ZPKH 1H8SA 3VFGL 2ADIB 3W0WB 3BZEB 4YBQC 5BO1L 1BEYL 3REVA 1SQ2N 4PG2C 1I7RB 1J1XL 3GSVB 1U36A 3QH3B 3AREA 2NZIA 4EI5A 3STZB 1SJHB 1YYLL 4KKLD 3DO7A 2NY7H 1A2YB 1BJ1H 4BH7B 5FYJU 5ID0A 3H9SD 1RZKL 2NY5H 1T0NA 3QB7C 2AEQL 4P59L 4J2XA 1B4JH 2AK1L 5DFTA 5F9WC 3E3QE 5JMRA 4PJGE 1TJGL 3BPCA 3S88H 3FT4B 4YXKL 1T21B 3DOSA 3C60D 5F93C 1BFOB 3UZVB 3MYJB 4NJAL 2Z91B 4IMLA 4Z8FL 3V0VA 1ACYL 5IGXH 2VH5H 4WFED 5IFJB 4P2QA 3RAJH 2NTFB 4YPJA 3SGEI 3U1SL 3LHPL 2Y5EA 4XWOC 3DJ9A 3VGBA 4GSDL 5CP7B 4JRWA 4AENB 4I18C 5EB9A 1KB5B 3TNNB 4Y88A 2Y9RT 5HY9B 1D5MB 2DRUA 2YK1L 3EJYD 2ZG3A 4WWKC 4PRPA 3SE3A 1AHWB 4NFBA 3M8OH 1SEBA 4LSQL 4I9WD 5BRZB 1ZTXL 5TDNA 3BH9A 3MRLB 3O0RL 5T5FL 2DMBA 4O00A 3UTTE 3QEQD 1VACA 4JRXE 1TZGL 4XWGL 1JPTH 2CRIA 5D1XB 3UJJH 3QNXB 2VOTA 3ET9F 3L3HA 3QDAA 1QRND 1I7UB 4WO4C 1MJUH 3FFCA 3E6FA 1FYHB 1XGRB 4ZNEA 1T80A 3IJSB 5FYJH 5L0QB 5CJQL 4GRLA 2ENSA 1A3LH 1G6RB 3DSFH 2HKFH 1DZBA 3MOBL 4ORGB 4RA0C 4Y8DC 5IMKB 1ZEAH 3PXHA 2ZCLH 2FYYA 3MACH 1CI5A 4N8PA 4LCUB 4NHUA 3QZWA 3F12B 3HPJB 5F96H 5AD0B 4ZS6D 1CBVH 3BEVB 1BF2A 5J89A 1HHJA 5T3ZD 4X4XA 5AWNH 1IAOB 5FYKL 5SWZA 4UT9L 3IAPA 1F2XK 4MB3A 2VERN 1PEZA 5GZOC 4RAVA 4JLRA 3VRIB 4P46D 1NLDL 1PSKH 4LLMA 3GJFB 5DJXA 4ORZC 5KSUB 5IK3A 1VHPA 2HLAB 4Y5XC 1RIHH 3FB6A 4G6AC 5JHDA 1N6QL 4ODBD 1K6QH 1NEUA 2QHRH 4W4NA 4PGBA 3BKJL 3ULSB 3NAAL 4JHBA 3RUGE 5JPNB 1FIEA 1UG9A 2FLRT 4PJ9C 3UJTH 1G7HA 4BFIB 4CMHB 3AS0A 4L9LC 1HNFA 1UXSA 3BPNC 1JZ6A 3FO9A 3GSUB 3V6ZA 3WS6A 1OGTB 2DD8H 4HH9A 4R4FH 3MCKB 1LK2A 2FJGA 2YKLH 4WTZG 4YHLL 1CVRA 5J1TC 5L7XL 5E94B 3RU8L 2PYFB 4PRPE 1RULH 4H0IA 2Q76A 4X4ZA 1D9KA 5DJYA 2G9HA 1JGLL 2Q86A 4QCIA 2WWKO 1FRGL 3Q6FA 2HFGL 2J8UF 2P1YA 3FQUA 5T1LD 3VD9A 4OGAC 1VFBA 4ZOCA 3VGHA 1Y18B 3QEGL 2BY3A 1PYWA 2VSCA 4XP9L 3L3OB 5ACLA 1NEZA 1I7ZB 5HDBF 3LH2H 2EIZA 2PW1A 2ICWB 4JFED 4PYHA 1K9TA 3HI1B 4W70A 4DN4L 3A67H 1WCQA 1EHLL 4CVXA 2UWEB 2EE2A 4MHHG 4JRYA 3DMMD 3MRDB 4ZNEE 4XAWH 4XMLL 1QLFA 2H8PA 1IBGL 3AS1A 1U8JA 2XZCH 3CXHJ 4P2CG 4UINL 4Z18A 4XH2A 4GT7A 2RGSA 1QSED 3IDGA 3PWLB 4WHCA 1LD9B 1MFDH 1NAMH 4QHKI 4QRPE 3OKDA 1EXUA 2QJDA 2X4QB 1AIFB 2OJEA 5DHYA 4JDTL 4I2XB 4NWUH 4C4KO 4ZNCD 1CGTA 1QQDB 5F7MC 3ARBC 4OKVB 5HYSA 5T3XL 4MNGE 1I3GH 5IT2L 3T1WA 1KSRA 2XY2A 1CT8B 3OAUL 3UTZA 5D72L 4FXLA 4PJXF 2WLZA 1S7QB 1F4XL 3MOAL 4KUCD 3MV7B 5FGCE 5DRNB 4W6WB 3V6OE 4QRQA 5JHDE 4NM4L 3SY0A 3R0MA 4DAGL 2VLMD 1KNOA 1N0LA 1X5XA 1MCPL 4NNYA 4X7CC 2IAMA 4F57H 5BS0A 5ALCL 4BH8A 2L7UA 5ICZB 1JPGB 1DBKH 2YD2A 3U4AA 4LP5A 5C0GB 3MGTB 4WI9A 5IWLA 2PN5A 1MCBA 5HVFB 4ODSH 2AAVA 3QWRA 2A0LC 3NIGF 5FFLA 5IFAH 3L3IA 1MEXL 3HMXA 4QHMB 4DW2L 4O51A 5GISL 3DRTA 4TYUA 3QQNA 5GRJH 2RAMA 1ZT4A 3QI9D 2P5ED 4P3DA 5BV7C 2DQHH 4JM4L 1WCBA 4KRPD 3MNVA 4ZTPL 3L5XH 1NPUA 1X6LA 3OJVC 4L8DB 1KGCD 2DI8A 3ILQD 4MJ5A 3BWUC 3ZTJH 5HI3C 1QZ1A 4PD4K 3MLSH 4G5ZL 4N1EA 4Y1AB 1UVQB 2A83B 2XN9E 5MERB 2GK0A 2XNAA 1JWMA 3HS0B 3T2QA 4K7PL 4MCZA 5GRYA 3WYRA 5C2BH 4OLVH 3HRZB 4ONFL 1A6TA 3UDWA 4K9EC 4AMKH 1RFDH 1FFNB 4KJQD 3LRSB 4JO4L 4JVWA 2HVKA 2E8ZA 1HIMH 1WFUA 3NA9H 5DUBB 4RAUB 1P7HL 1QFUL 2H9GA 3SJVB 2ARJB 2QKIA 1RZJH 1Z5LB 2WWKT 3G5VA 2H3NB 2ZSWA 5F6IC 2BK8A 5GGUB 2OK0L 3TA3B 5JIKA 4WWKA 5JQ6L 3TPKA 1T5WA 3MXVH 1ONQB 2D0HA 4RGND 1EMTL 4XPHH 3FRPA 1CDUA 3ZKSD 4JFQA 4PBVC 3WV0A 5I1IH 4D9RD 1FGVH 3DGGA 4FQQB 5DDHA 3WFEH 1HI6A 1DCLA 1J7VR 2OMBA 2FH6A 1UM4H 5BXFA 1G7JA 1GGIL 3GHBH 3MRCB 3MLVL 3VJ6B 4GXUN 4L3AA 1QSVA 2QQNH 4NRYB 4PTUA 1F6LL 4P5TC 2EXWC 2APVA 1OTTC 3OPZH 4W4OA 1IAKB 3HE6A 1A64A 3AGVA 3QXAA 2W0PA 1T1XA 3UTSD 3ARPA 3WJLC 1FNEA 5ADOH 4LHUA 1FL5B 4LCCB 2YRLA 5D96B 1H15B 3VWKB 3M45A 4IHOA 3SKOA 3FFDB 4C4KT 2FBJL 4CN6A 4ZUTB 4Q58C 1QVOB 3KYNA 4ZXBC 2D4DA 2H41A 3DUHA 5D2LF 1U93B 4M7ZB 4MXWL 3CPLA 2AKRB 4BZ2L 4UILL 1CXKA 2PW2A 5T1KD 3CK0L 5C0IA 5FEBA 4OV6F 5D1ZD 1EO8L 2R0LH 2VDML 5D7SH 4XNUH 1Q1JL 2I9TB 1IT9H 3EYSH 4YC2C 3EYVB 3LKQA 2GW5A 1T1ZB 4QT5A 5D1QC 1NC2B 4JFXB 1UM6H 2AXFA 2OL3L 3TBTA 5JUEH 4W81A 1MVUB 4NQSA 2AJXL 2VQ1A 4PGEA 3KNBB 1KIPB 1MCKA 2YA2A 3ARGD 1S7SA 4Y2DB 1HXYA 4U1SB 4YX2L 1YY9D 4NO0D 4V2CB 1BFVH 1NFDA 3MGAA 3CZJA 4XPAL 1A6VH 4XVJH 1U3JA 5DJDA 5IQ7H 5CFHA 2APFA 1A7RH 3HZMB 4IRJA 4EUPG 3VRJB 5TE4L 1HOCB 1NANH 3S4SB 4QXWA