1WVZA

Solution structure of the d2 domain of the fibroblast growth factor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
b'NNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor 2
molecule tags Transferase
publication title Solution Structure of the D2 Domain of the Fibroblast Growth Factor
rcsb
total genus 12
structure length 101
sequence length 101
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wvzA01
1BZ7A 1J87A 3WO4C 3WFHA 2AK4E 5TE4L 1TETL 4OZ4B 3MBEC 1D6EA 5JIKA 1Q1JH 3OX8A 4LVNB 5SWZD 4ZO9A 4CKVX 3I85A 2DBLL 4CGTA 4WCYL 3PHSA 2CIKB 1DQML 3VDAA 5I73C 2HFFA 4KTEH 2RCSH 2EZ0D 2YD8A 4OQTA 4ETYA 4KRPC 2V5YA 3WFCL 1ES0A 2XOTA 1QFWM 4I2XE 2W0KA 1YUHA 4U6TA 1DVFA 4IMLB 3P9MB 4FFWC 3WNPA 2AABL 4AEIH 5L8KB 4QRQB 3NA4A 4ZXBB 1Q9KB 4BH8B 4YHML 4X80H 3B9KB 1K9TA 4LSDA 4HUVA 1JZ7A 3FQNB 3OKMA 4RGMB 2SEBA 4PJEE 4NQEE 4XVUD 3TBYA 5MEQA 3C60B 4HGWA 3WFEH 4HQQH 1GXEA 4Y88A 1D5BB 1C7SA 2C3XA 1NCBL 4OV6F 1HZHH 4XGZB 5SX4H 4HIHA 2AEQL 3RWJB 3NFSH 4L29B 1NCNA 5DMKB 3ULUH 1X7QA 4HT1L 3B5TA 4M6NL 4X4XB 4F7EA 4O00A 3U6RA 3PGCA 4P5TA 5IESH 1XCTA 1DFBH 5GZOD 3BZ4A 1I1AC 4Q9RH 1A0QH 4AJ0A 5I1DB 1JCKA 5FECA 3SO3B 2FD6L 2G75A 1ZMYA 2VH5L 2HTKD 4YAQB 1JPTL 2B0SL 1TPXC 4ACPA 2P8LB 3MRPA 4MD0B 3OKKA 3NFPB 5EH1A 4XI5D 1NBVH 5BVPH 1TETH 4ZPTA 1I7ZA 2FIKA 5JUEH 1DE4B 1KCUL 3P0VL 4BELD 5IR1A 1YPZB 4GQ9H 2P5WE 2YPKB 1MLBA 3V79C 2V5SA 1EZVX 5HHQB 3RX5A 1CGSL 4LHUB 2G9HB 4WW2A 1YECH 1U3HC 2IPUG 3ULVH 2OS7A 4K8RH 2O61A 2YPLB 4L4TD 5F6IC 2V2TB 2WUCL 2ESVA 4A2LA 1DEDA 2OMNA 1I8MB 3L9RA 4K23H 4KV5E 1ZK9A 3B43A 2LV4A 5ICXA 2NR6C 4L1DA 2A73B 4M7JH 4ZXBA 3LCYA 1GGTA 1AD0A 3UDWA 5JXEA 3RWGA 4LCUA 5C9JB 1R5WB 1YUHB 1XCTB 4JM2A 4IRSB 3BSZL 1NLBL 2A6DB 4FA8A 1U8OB 2AJ3B 3LQMA 1I1YA 5JOFB 1QSZA 3QIBC 4KH2A 4PG9B 2ZUXA 3VXQA 3QWOA 1NCCH 2JELH 1CI5A 1MF2L 2K7QA 1RK1A 4TRPH 3IDUA 2PYFB 3ARFC 3GSOA 3BKMH 4L8DB 3PDDA 5J3HC 3FB7A 3SDDC 4LSTL 4NKOA 4X8JA 5LJYH 3B5HA 4R7NA 5TPWH 2QEJA 3OKEA 2DD8H 3MOBL 3ZKXC 2YUWA 5HGDA 1H3WM 2BVQA 2OJZL 4GRLD 4QHUA 4QRQA 1N5YH 4X4ZA 1WBYB 1R5VB 4O5LH 1CR9L 1A0QL 3KYOA 1R6VA 2AI0L 3KLDA 4LAQL 1MI5D 4OZIE 1OAZL 4O02H 2NXZD 2D9QB 1VEMA 1MWAB 1YMMB 3ZL4H 1UZ6E 1MHHB 4HWNA 3RTQC 3IDJA 1NGWA 1HHKB 1F4WH 2PW1B 3ROLA 2OSLA 4OCYH 3UZQA 1M05B 3U9UA 1S5IL 1IT9L 1O7VA 1FFNB 2BC4B 1RZKH 4PP1C 1F58L 4O02L 5B38A 4D9LL 4TSBL 4EQ2A 2VDNH 4Y0GA 2NY0B 5A3IC 2R1XB 2EE3A 4M8VA 3OX8B 1UH4A 5L7XL 2YK1H 3KDMA 4M61A 3EYQC 5I1JH 3BRFA 3MRGA 3RZCA 2HT4C 3BP6A 3DGGB 4ZOCA 2PUQT 4WDIB 1KENL 1CXHA 2WQ8A 2WBKA 1C08B 1FG9C 1MIMH 2CUMA 4AIZB 1RUQL 4Z95L 3NIDF 3SCMA 4EZMA 1CG9A 2HH0H 4XBEL 4NT6B 4FS0A 5JQ6L 2WANA 3NCYP 2XY2A 5GSVA 3GSNA 3QWRA 4OF5A 4KTDH 1H0DA 3O8XB 4FQIH 4PJ7E 3V6BR 5D7SL 5D71L 3MBXL 1WVZA 4HUXA 4UNUA 2E7MA 2VZ3A 5BXFB 3I75B 3BQUC 1P5VA 5I66B 2CXKA 3CMOL 3ZDZE 2ERJC 5DHVB 1A6UH 3LSOB 4N1HB 2NY6B 4NWTL 5C07E 3NZ8A 3RPIB 3VXRD 3TNNA 1MCPH 4XNQB 1TCMA 2F8OA 5TDOA 4ZD3L 2H9GA 2QQKL 4LLDA 3QG7H 4YQXH 1A2YA 5CEYB 3SCMC 4D3CH 3STZB 4OUUA 5FO8A 2IH1B 3SE3A 1QRNB 1WZ1H 2BNUA 4BFIB 5D7LB 4WW2C 3UTSE 3EYUH 4NJAL 1ZHLB 1ZVHA 4QHKI 4WI5A 4NQDA 4P46D 3H9SB 3IRPX 4N0YH 2AK4D 2YPVL 3ZYIA 4IM8A 1CLOH 4R0LA 2UWEB 4P57B 3KLSA 2DWEA 4PJBE 4E42B 2WIMA 4Z77B 3CFBB 4G8FB 4JDTH 4LARH 1QLEH 3HG1A 1UWGH 1P7KB 3DVFA 1RUPH 4PGBA 3LOWA 4ZO8A 3D87B 1WBXB 4M5ZL 5E8OB 1MFDL 4EUPB 4PY7B 3KLHD 4NUJA 1GH7A 8FABA 1MOEA 4UT6H 2BNQD 4BH7B 4J2XA 3D69A 3U36A 1WFOA 5DTFA 3G6JE 4GRLA 2MTPA 3R06A 1WICA 1Z5LA 3GSXA 4EOWH 4FFVD 3QUXC 3SGJA 5I66A 3V0WH 2BRQA 4F57L 1G6RL 5CLTA 4KQ3L 1ZLVH 5BXFA 4I9WE 4ERSH 1H5BC 3P77A 5HGBA 3MRNB 1SEQL 1H0DB 3O8XA 4KAQH 4PRPD 5M95B 1YN6B 5B39A 1MHPL 1QTYT 3ARFA 1A6WL 1M7XA 3TZVD 1JHKH 2X6MA 5IW6A 5C2BL 5E24E 1MJ7H 3SDAC 1UH2A 1IC7H 5DJAB 3PWPB 3RIAK 3UEZA 1JYWA 4KUCF 5I8EB 1LWRA 4PV9B 3TBSB 2P43B 4CW1B 1DVFC 1YA5A 4MNHA 3AREC 2MFNA 2PTTA 5D5MF 4KTYA 3SDAA 1LP9F 4E41D 4WI6A 1GZQA 4LQ1A 2HWZH 1RIVH 5JXED 2BNRE 2HJFB 3HPJB 4YHOL 2Q3ZA 3MRMA 1G0XA 5EBMA 4GBXC 4AEHL 4FQCH 1RIUL 1IRAY 1MCRA 5GGTH 3F5WB 2NTSP 4PGEB 3R1GL 3D2UD 2C9AA 4ZMAT 1IC4H 1FL3B 3ARDA 4OQ1A 5J6HA 1OTSD 1HI6A 1H15A 1R5IB 3WHXB 1T21A 1VPOL 1QYGH 5CSZB 5C0CB 3DX8A 1DEEA 2OL3B 1ZLWH 3OKDA 4EI5A 4NKOB 2F53B 1EO8H 5EUOB 3DPBA 4FXGA 4MCZB 1A9BA 5JW4N 3MLXL 1JPGB 2PXYC 5IFHL 4EBQL 3QCTL 3FFCD 3O2WH 4KTEL 5C0GA 1PY9A 4NGHL 1U3YA 3N1QC 3IJHA 4RISL 4W6YB 1CXKA 5EO0A 3SDXA 1ACYL 4V1DA 43C9B 4QOKD 3BD5A 4N0UE 1NLBH 1CZ8H 1EH9A 1XR8B 5F7UA 1A6VH 2QKIA 3S34L 2FX9L 2AXGA 1XR9B 1ZEAH 2DQJL 1S7UB 2ZUQC 3OR6A 3LKNB 4E5XB 1CFSB 4DKFH 5IK3A 4W4OC 4PV8B 3QFDA 3CUPA 1AHWB 3HE6C 3OKLB 2FATL 5D7JD 4FQJH 2VDOH 4N0RA 2E8YA 2GCYA 1MVFA 1IC5L 1YMHA 1T21B 3MPCA 5GRYA 2CO7B 1CL7H 3TIEB 1T1YA 1P4IH 2GK0B 1CDIA 1JE6A 4M1DH 1ZS8A 5CD5D 3RIFK 3KR3L 4PJFA 4RZCA 5E2UH 4JKKA 4P4RA 2A6JB 3JUYA 2WAHA 3GKWH 1ORSB 3N85L 4PJIE 1CDCA 1EHNA 2DLFH 4ONGH 5BZDA 2EH7H 2BVOB 4XCFH 5FDYA 3SCMD 2ZZUT 4M4RA 1QHOA 3KLAA 4ZUWB 1JMXA 2OCFD 2VDML 4UINH 5FM8A 5EBWB 3G6AA 4CDHA 4X9IA 2YZ1A 2X9WA 3UJIH 3N06B 5IGXL 1JNNH 5GGTL 3N50A 4IMKA 5CIPB 4QF1A 3LQZB 5HHVH 1YEHL 4M7JL 4IS6A 5FEBA 4NC0B 1UEMA 3CAFA 3RTQD 3IB4A 2P1YA 4WW1A 4X99A 4KRNA 5JLZB 2W59A 1T7ZA 2H3NB 3DARA 1FFPA 3VWJA 1OGAB 1FP5A 5DEGB 2X4TB 4NUGH 4Z76A 1I9JL 1AE6H 4RGOH 1OTUD 4G7YL 3Q3GB 5TDNB 2VJXA 1WZLA 3CSYA 4C59B 4PGCA 2XTJD 4Y2DD 5LCVH 1DLFL 4HCRA 3JTTA 4CVZB 4NQCB 1UXSA 1C5CH 4LCWD 5GZNC 2NXYC 3V5KB 1IGTB 3MBEA 5EU4B 1IJ9A 4JFED 1KPUA 1HYRC 4IJ3C 2EEDA 3UBXG 4XMPL 2ZOLA 3O4OC 1T6VN 4UUJA 3S37H 3RVUC 1V7NH 4JQXA 1KPRB 1DLHB 5F8RC 2EDQA 3FFCB 3LKSB 1CU4L 1ZSDA 3DX7B 5ENWA 3RVVD 4LFHD 3VXPA 4FTVA 4Y4HA 4QTIH 4HX1B 2XZQH 1A7NH 2YSSA 2I07A 3T2NL 3O3AA 3TA3C 3D9AH 1V7NL 4BM7A 2ICEB 4N68A 4D0CA 4Z77A 2B4CH 3N9GH 4NN6B 1IZKA 4DZBA 4QWWC 1VGEL 1KBGH 4LKXA 4LSPL 2YWYA 4KJWC 4I8DA 4WHCA 5IF0B 2DDQH 2M2DA 4XCFL 4BUGA 3CVIL 4QKXB 1EIBA 1SHMA 4UQ2B 4MJIB 5FO8B 3D85A 5ECJE 2R0ZL 4WNQA 2EE6A 3C5SB 5KSUA 3BX7C 2R2HA 1IQWH 3TVMB 4WGVB 1IGTA 3MBEB 2IFFH 2BVYA 3C08L 5L2JB 4OLZL 2CJUH 5FOBA 4DVBA 2GJZB 3AFLA 3FB8B 3LIZL 4CADB 2CLRA 2HG5B 4XMLL 3FONA 3DURA 2V5TA 2OL3H 3OGOE 1PGRB 3SDCC 1U3HA 5A2FA 4KROB 3PWNB 5KZCB 1H5BB 5F3BB 3QDAA 1CLZH 2EO9A 1C16B 3GEWB 5DURB 5I15H 3F7YB 3M1BA 5DD0H 1J0HA 4MQXD 3CX5K 2IGFH 5I1IL 1ZAGA 1QFOA 2WM0A 4D0DA 5HYJA 1IAOB 1D5IL 35C8H 3P0YL 1YEDB 3MX0A 4WDIA 3ALWA 3QG6B 4XNXL 3D85B 1UWXH 1P53A 3BP6B 3QJFA 2HVKB 5IEKA 4LK4A 3MNVA 3OMZA 1HILB 2VABA 4FQ1L 3FO0L 1QFHA 3IU3B 3L3OB 5CJXC 4LLMA 1S7XB 2GI7A 1JFQL 3MGAA 4UU9B 5D2LF 5EC2B 5FUCE 2F74A 2EDTA 4WW2F 3BEWA 5I1KL 3MMEA 4HK3J 1I8KA 5T5NG 3SJVE 12E8H 3OXSA 2BHYA 1N5AA 1S9VB 4QOKE 3CVHL 1JGEA 2D7NA 1A6ZB 1E4WH 3VFSA 5T3ZD 3RZCD 4NO5B 5GJTH 2VB5A 5IQ9A 3QEQD 1CT8B 5D70H 5DUPL 5H37G 5MENE 4M6ML 4F15C 3H7BB 4HDIA 4PJDF 3WIHH 3PE9A 1WFNA 3DO7A 1ODAA 2J7LA 1PKQB 1JPGA 4FQQA 4YUEL 5J56B 1KCSH 5FYLD 4NQDE 5IJVA 1MHPH 3X17A 3SDYH 3F12A 1U8QB 2C1PB 1JWMB 4M62L 2Y07L 4X7EC 5LGJB 1A1OB 1ADQL 4YHMH 4LIQE 3WUWA 5C0RH 1X5KA 4JM2B 3VXTB 1T5WA 3VXSD 3HNSH 1KIUA 4N0FA 4HMEA 1KN4L 3V4PH 3QEHA 3GNML 3O6MH 5KW9H 4XBGA 2A73A 1OLZA 3VFWA 4B41A 3RKDD 1QBBA 4Y16C 5HPMA 1UM6H 3MYJA 2COQA 2KZWA 4WO4A 4C56A 3VFGH 1EEYA 1N5AB 5FAAA 1UQSB 1FPTH 4JJ5A 1MJUL 5F7DA 4JRYE 4FZEL 5EUKB 3VFRA 1PW3A 1JP5A 2X4UB 4Q58C 5D1ZB 1Q0YH 5EZOL 1WAAE 4K2UL 4LSVL 3VH8B 2J8HA 4Y2DA 3FQWB 1XIWC 1ETZB 2YN3A 2QHLA 4ZPTB 1K8DB 4Z7WA 1JGVL 3QDJB 5TF1L 2HVKA 3D18B 1MEXL 3R8BB 4LGSB 1T66D 4P2RB 3HZVA 4F2MA 1J18A 3KPRB 4RFNC 1BIIB 3P30L 3C5ZA 4OM0H 1OCWL 1R0AL 2B20A 1FO0B 1QFWL 3TT1H 1YN6A 5D4QA 3BZDA 3FQRB 5KOVC 1HH6A 2P5WB 3T3PF 1S9KC 1JUFA 2N7AA 4C4KT 3ZL4L 1IL1B 4NQUA 2NY1B 3MYJB 2O26U 4QRTA 4R90L 2OP4L 3SBWC 4FTVD 1X5HA 5IVXE 2FL5A 3QEGL 2DM4A 4Z78B 1CD9B 3KPOB 2CIIB 4QRRD 1D5BA 3EUUA 5E4EC 3O9WC 5ITFA 3PWUA 4C58B 4DVBB 2OZ4L 2CKBL 4KRMB 2DLHA 1MQ8A 5HI5C 2ADJA 4LIQL 1U36A 3BGMB 5MEQB 1M6OB 1MELA 5CEXB 3MJGX 3DETD 2MQ0A 3BKCH 2F53A 3D1MC 4JDVA 4LLVB 2IALB 1K4DA 4AK1A 4WNQB 4YHNA 1G1CA 4U6XA 5ACLA 3SKJL 4UT7L 2QADB 3BIKB 1J8HB 4XVSL 3KPRE 3L3GB 4LEXH 2NY3B 1MRDL 1OWWA 4M03A 4L9LC 3DRTA 3RUGB 1OOAA 4ZFZA 5D1QA 1DBJH 2EIDA 2VIRB 5DR5L 3VFNB 1RZKC 2IAND 3O2DA 4PFEA 3W81A 1RULH 2BNUB 3VFGL 3CX2A 3W39A 5EBGA 2HKHL 4JO1L 4XPFL 4QTIL 4DGYH 3OKNA 1GZQB 1H8NA 3DXAA 4GSDH 3OAUL 4N0UB 2NZIA 3UPRA 2XWJA 3E6FB 3WFBL 3P11H 1HE7A 4IOFD 3RWIB 1Q72L 4MA7L 1TVDA 1S5HB 4ALAH 2H6PA 2VDPH 1IGIH 5J1SC 1S7QA 3G5ZB 4IRZH 4YDVA 5HD8D 1Z9OA 3MYZA 3OPZH 2XA8L 2J6EH 5EIQA 2DLIA 5DRWB 3EO1A 3WNOA 2YRLA 1FAIL 1KYOJ 1YNKL 2Q6WB 1NCTA 2BK8A 1MFEL 3MRDA 5IB1B 2NW3A 1FO0H 4S0SD 2A77H 5MI0B 3T0DA 3V52L 1JHLH 1G7HB 1P9MC 5FA3B 3GKWL 1UACL 3Q5YA 3WIHA 1U2CA 3LD8B 2BP3A 2F53D 4JN1L 5DD5L 1ZT7A 4HJGB 4PJIB 1HINL 3RUGE 5FOJA 3T2PA 1FVDB 4X9GA 1MCIA 1S9WA 1EFQA 2AXFB 5FKAB 5SX5K 4WI7A 4FP8L 5HHPA 5BRZD 1KLUB 4KKLD 1XT5A 4PLKD 4BZYA 2B1AL 4JG0H 1OQXA 2W9DH 3O0RH 4Y4KB 5KN5B 3LHPL 1V5JA 1E4KA 3T77A 4YWGL 3H9HA 4QHLA 2VXUH 2C3HA 1S5IH 4WO4C 4RMWA 4W81A 5TQ2L 3UC0H 3IVKA 4WJ5B 2BZDA 3O3DB 5CLWA 5BV7C 2F19H 2HFEB 1Q38A 2IH3B 3CXDL 4F57H 3TO4D 1TTFA 3DBXA 2VOTA 2OXHA 1M71B 1A14L 3S5LG 5DRXB 5J1AA 1IEAA 4HC1L 4NWTH 3VCLB 1OP9A 3B9VA 4H20H 3VXMA 4TUKH 3NABH 3PQYA 2J88H 5FYLH 3B9KC 4LPTA 2BVQB 4YPGA 3HMXH 5GHWH 2XKNA 4PGDB 2H6PB 1SEBA 3VGFA 2JB6B 3IDXL 3T09A 3FB7B 2JCCB 2OTPA 1QRNE 3OHXA 2HMID 3AGVA 4U31A 4DGVH 3MV9D 4FNLL 3BP5A 5JR1L 4ZFGL 3RRQA 2B2XL 3ZT7A 2R2BB 3AS3A 3WS6C 2I07B 3S35L 3OJDA 2ICWA 2OR7A 4MDJB 3T0EE 1A8JH 1U6AH 2PYEA 2A9NL 3ZYZA 4HT1H 3W5NA 1CICA 4BSJA 4MXQC 3CZFB 3NBNA 5C6TH 5DJ0A 4APQD 4L3CB 2BNRD 3IKCA 3O9WA 3V6ZA 1J1PL 4V1DD 2CO6B 2EICA 3GHEH 1X5LA 5KVDL 1VEPA 1A9BB 4WTWA 2OLDA 4NT6A 2ZOLB 3QR2A 3WN5B 1LK2A 3C6LD 1BREA 5E2VL 2XWTA 4I0PD 2EIZA 3T4YB 3K8LA 1SM3L 5BZWA 4YBQC 1HSAA 1YN7A 1ACZA 4ZSOA 3TCLB 1NCWH 2XG5A 1BZ9A 1HN1A 2ORBL 1Z6JT 1WQVT 4DAGH 3VMNA 4RX4D 1RURH 4HUNB 1BJ8A 5EPMA 3BPLB 1S9YB 4LLYB 3S35X 5SX5H 3G08B 3VD3A 3GNMH 3O6ML 5A2JH 3NPSC 1MH5A 2BSTB 4JM2F 1ZT1A 4MNQE 2CK2A 5GRWA 3BQUD 3JTSA 3FT3A 4GAJL 4XCCH 5TE7H 5DFWH 5D96B 3SDXE 3RGVC 3KG5A 3MQIA 1YEIL 4IRSC 3BPLC 2FHBA 5CMAA 2QADD 4P5TB 4P2RA 1UYWH 3G6JF 3U7WH 4HSQA 1T4KB 4OI8A 1LO2L 5DJXA 3ZT5A 1I9RH 1NEUA 3S6CA 3FQTA 4L29A 4PRID 4X8JB 4XPGH 1CQYA 3MRQB 1LO0L 3GJFH 2GJ6E 1YEJH 5K9JL 5B39B 3P3YA 3QQ9C 1D3CA 4UTAL 3P4LA 3HCVB 1EA9C 4GW5B 2NY5H 4WTZG 4LSRL 1FCCA 4XP1L 12E8L 4MVBC 4U0RC 2DN7A 1GCFA 1OPGL 3VI4F 2AQ1A 3O4LA 4BFBD 5DJ2B 3MLZH 3IFNH 4UB0L 1B0RB 1F97A 3GFUA 4JRYD 1W0YT 4HK3N 4IRSA 3DWTA 2VDQH 4IMLA 5IJKC 4FTVE 4LSRH 4ONOA 4L3CA 3U7YH 4I13B 2C7UB 4K71B 1N64H 2WK2A 1RZJC 4L3EB 5C0FB 3Q1SL 4S1RH 1S7TA 4U1SA 5ERWB 2NY5C 3S5LA 5C0CD 5GRUL 5J0BA 4KK9C 4PJCF 4DK3A 4WEMB 5ETUA 5INDB 2X09A 5C3LD 4ZUTB 4CBPA 2NY3C 3NCJH 3ULVL 3VD5A 4HIXH 2A38A 2V7HA 5EOCH 3DO7B 1T3FA 4JHAH 5E08H 4UBDD 3JVGC 1P69B 4XZUB 2WV3A 2NNAB 5JOPD 3OB0H 1DBJL 3V8CA 3BRGC 2X41A 2FB4H 4GS7B 3E8UH 2QSCH 2I24N 2W38A 4KMTL 4Q6IA 4DKAA 1J1XL 5J1AB 4K07A 3FQUA 5F7FA 1KJ3H 5BS0E 2AKRA 3ZSTA 4FG6C 1F90H 2LTQB 4L8CA 3MRMB 2IBZY 3SKNA 4Q9QL 1QFWI 1U3JA 3E8UL 4JPIA 4MZ3A 5C0EB 4Z0XA 2EXWD 3E3QC 3ARBD 5JMRA 1KC5L 1HHJB 1T7WA 4P3CL 4X4XA 1RJLB 2IPKB 3RVUD 1FVEA 3C60D 4JFEB 3AMLA 5ADPH 5DMKA 2F9BT 4BZ1L 3MGOA 1HILA 2VABB 1T2QL 2IFGA 2DQTL 4UBDC 5I1AB 1TQBC 3ZHLA 5ANME 3NOIA 3SCMB 1FVDA 3IFPA 1MFCH 1CLCA 3PWPE 4XC3L 2XZCL 2ZJSL 3NIFF 1MI5E 2HLAB 4OFDA 3PP4H 3TT1L 4M61B 3HUJA 1DCLA 1EPFA 1C16A 1I1RA 4JLRB 2H8PB 2ZNXA 1SQ2N 4DW2L 3MA7A 4GG8A 5FHAH 2Q8AH 2CMRH 1HHJA 1G6VK 4GJTB 1FNFA 2VNCA 1KTRL 2FLRT 3C5JB 3WO4B 3T0XA 3PABA 4HIJB 1WBZB 1OAQH 3DNKA 5K9KB 3SKNB 3EGSB 3L3HA 4LARL 3BP5B 1HHHA 3IKKA 3E6FA 2MHAB 1F5WA 2J12B 2YA2A 3CXDH 5E6YA 2XA3A 3DXAB 3V6FB 4G8FA 1TTUA 3RUGF 1YYLL 3O4LD 2C4FT 4DVRL 3H2WA 3HC3L 1NBYA 2FB4L 1LO3L 2XKNB 1U58B 4IRZL 4G8GE 1EAPA 1ZHNA 2CKBB 3B3IA 5EU6E 3S88L 2R0WH 1NC2A 4R7NB 1J1XH 2VXTH 3QDJD 4AL8L 4O58H 1RUKL 4NNYA 1T7XA 4JEGB 4JVPA 2EECA 5A43C 3RNQB 4BFIA 1RK1B 3WS3B 5DQDH 1N8ZA 3L3HB 5FGRA 1MPAH 3STZA 5JPMA 3QCUL 2PYED 4YFLI 3CDYA 4LLUB 1EV2E 5HHMD 1FG2B 1G7LA 5DXWA 3HNVL 4ZAKC 4KMLB 3VXNA 5JA9A 2ADJB 2P5WD 1KV3A 1VFUA 4RAUA 4YHYB 4G80A 4Y19E 1OLLA 1AY1L 1T2QH 2N4IA 3FOLA 5AZ2H 4P2YA 2OR9H 1XF3B 1PDKA 4TTDC 4KK6C 4NNXB 2XKUA 3H0TA 5J89A 4C83B 5IBUB 5BQ7A 3QXTA 3BVNB 3H7LA 4K3EL 3VI3F 4U1IA 1ZGLM 5D70L 1MHEB 3JVGA 4L9DA 4LCCA 4U6HA 1EGJH 1FNHA 4FABL 1SM3H 2NTFA 4KZDH 4LRNH 3CGTA 2RQ8A 5KBNC 3LN4B 2WIIB 3IFLH 1UACH 3ULSA 2FEDC 1JN6B 5T3XD 3VFTA 4FQLL 1AGFB 4BSWA 1HKFA 1I7ZB 4OZHE 4YDLC 5DJXB 3A6CH 4JRXB 3L5XL 3RZCB 5DYOB 5FA4A 5I6XB 5J57B 4GBXD 4NRYA 3M17A 5IVZB 1EVTC 1FN4B 1P4LA 1UM5H 2Q3AA 4TUJB 3HTLX 5F7WC 4ETQA 5JXEC 2X4UA 4KAQL 3UPCA 1RD6A 1AR2A 2E9BA 3V0AC 5I1EH 5IWLA 1DBAH 2ZSVB 3UC0L 4EN3D 4L8SA 3DUSA 4EDXA 4PS4H 1RUMH 2GTZB 2FR4A 1S78D 3SKMA 3QPQC 4ZUUB 3QRGH 4NN5B 1A14H 5D1ZC 1PD6A 4PJFB 1RIHH 1FSKC 4PBVC 2GJ6A 2D31A 5DJZA 3EYVA 3QULA 5H2BB 3SGJC 3TN0A 1I8LA 4FQJL 2DKUA 1KXTB 2HTLC 3VFPB 1M6OA 3ET9F 3X13A 4TOYL 3UJTL 3AROA 4H88L 1Q9LB 4AH2B 1RIVL 1AI1H 4Z78A 1G1YA 1XR9A 1INEL 4W4NA 4TSAH 5I1KH 1XR8A 4H8WC 4WTZA 1KLGA 1CICB 3CFCL 3LV3A 5DJCA 2BXYA 2DJ4A 4N5EC 5GS1C 4YGVA 3UJTH 3LRSA 2EE2A 4YHZH 2V17H 4OZGE 2J6EA 3RWDB 3PL6D 2BMKB 3GMPA 3AVEA 4OGZA 5DMIL 3NIFE 5D72L 3G6JB 4NZRL 5K9QG 4PJXE 1OW0C 4M3JA 2VAAB 4LNVA 4MJIE 3M17B 3SE3C 1KN4H 3JV5A 4XP9H 3QCTH 3UXFA 1HDMA 1RFDL 5HHOE 3X3FH 4NQEA 4Z7OE 2E7CA 3QUYD 2YPLE 3PV7A 1KTDA 3BKYL 1K8DA 2V2XB 3GB7A 4PRAA 1FL3A 1IAKB 2G5RA 4AY0A 3U4EB 3SY0B 2FR4B 5AAWA 5L6YH 4F80A 3GHBH 3IDNB 4HIIA 3W9DB 5TE6H 2GW5A 2R0KH 3DUSB 3GRWA 4RAHA 2XICA 4NZUH 4DKFL 1NCBH 2QV2A 3O9WD 4PRIA 1BD2A 3P4OB 5LXGL 4XP1H 1FZMA 4GG6F 4JFHD 1AO7D 2HKHH 4JO1H 1LD9B 1T0NA 3ARYA 3DUHA 5I75B 4P2QD 3LRGA 4ZFOA 5EORL 1CVRA 3CPLA 1M7IA 4MB4A 3KLHC 4P59L 5I8EA 5GS2D 3SOBL 2EH8L 3LKOA 3S36H 3ZYOA 5DJAA 1JGLH 4OFKA 1EMTH 5KVFH 4EJ1C 4AZ8A 3JV4A 1CDGA 1X7QB 3OWEA 5LGJA 4TVPD 1JN6A 4RIRA 4HIHB 2BNQE 2BVPB 1RVFH 4U6VL 5CWSB 4ELKA 1BBJB 5D5MA 4S11A 2ZJSH 3EDFA 3UJIL 3RVTC 2B4CL 2DJSA 5LBSH 1YEKH 3BUTA 1OW0A 2IF7A 1KT2B 4KDTC 4LAQH 4MAYD 1TQCC 5HI5D 1T20B 2IEPA 1YMME 4YFDB 5CGYD 1AXIB 2BVEA 3MUHL 3L7EB 4PR5A 5F9WC 3B8SA 2FO4A 2ZUUA 2CKBA 3B3IB 3EO1B 3MUY1 3FZUC 1OD7A 3DX6B 3BKCL 4B7IA 3B8YA 4UB0H 1QSFA 4R97C 2UVEA 1YY9C 4BH7A 4F37K 1OSZB 4CVWA 2DQUL 2DAVA 5D72H 5BV7H 1AGCA 2DOCA 1G9MC 3JUZA 5CCKH 1Q8MA 3K2MC 4YDIH 1CIDA 3BGAA 1B6DA 3X12A 4QRRB 3DSFH 1B9ZA 3T8XA 4JRXE 5FYKU 1CGVA 4N0UA 1AE6L 4XH2B 5EU3A 1FE8H 5E6IA 3PQYE 5CAYB 3QDGB 5HVGB 4PJ5E 1WTGT 5IOPA 3OKYA 4YFEA 3O2VL 3IFOA 4Y4FA 2VKWA 3RNQA 1SJVA 5AZEL 3VFNA 2ESVE 1I7TB 4LVNC 5EC2A 4PJ9D 2CDGB 3UAJC 4NQDB 2OQJA 4QEGA 3P0GB 3S37L 1A3LH 1ZHLA 4PRNB 1QSFB 25C8H 2CH8A 5EDXA 4NM8H 1UZ6F 2X4PA 5IEKB 5C71A 1NBYB 3BD3A 3QUXB 1PQZB 5T5FL 5HY9A 1ND0B 3C6LB 1CXLA 1FORL 3O3DA 3MXWH 3CLEL 1YYMH 3H3KA 4XCEA 2CLVB 3FO9A 5HYJB 4OB5L 4ZUVB 1I1AB 1LEIA 5FYKL 1FAIH 3I02B 4XNQA 1FZJA 5GGSB 3WKML 4U1LB 5EZLB 2YD4A 2J4WH 1N59A 3U9PL 3IYLW 3MGOB 4PRPE 1ZVYA 5HI3C 3REWB 5D9SB 2IPKA 2LVEA 1X6NA 1E27B 2EKSA 3QEUB 3JZ7A 3UTPD 1C5DA 5SWZE 5DQJA 3O11A 2OM5A 5AEAA 5CBEA 5SV4A 1MRFL 1UEYA 3LQZA 3RVXC 3HAEG 4KVNH 4L4VB 5BVJA 2A6KB 1QBLH 1B0WA 4JFEE 5ELIA 2GFBB 3RX8A 1I1AA 2I9TA 5C07D 4AT6A 5GIRB 1X4YA 2P44B 2R2HB 5JIPA 3SHSA 1FL6B 4N5UA 4LCCC 5EWIH 3L5WB 4JKWA 3WV0A 5DD6A 2VXUL 1YNKH 4U1GC 1A7PH 4R4NC 3ARFD 1F8TL 1NFDF 3PJSB 4JANB 1RJLA 4KK9D 2X7LB 4UI2A 1HCVA 32C2A 5B38B 2XWJB 4XTRC 4HS3A 1U8JB 3OKNB 1G6RB 3GSWA 5HDOA 2B5IC 3BZFA 5J7CC 1ZANH 3CFDA 1U91A 3VXUA 4KQ4L 5JW4R 2FX7L 4HBCL 2YC1A 4Q74A 3X12B 7CGTA 3MOQA 1NGZB 5IW3A 2VZVA 1NFIA 4R2GB 4B50A 3W0WA 3TBVB 2DICA 3GZKA 3ARGA 2YA0A 4OGYH 3A6BL 3LPFA 2EDEA 3ARRA 1ZANL 3DIFA 2BY1A 5KW9L 2NPLX 3GRWH 4XRCA 3TGXA 4PJIF 1JPSH 2C1PA 4C55A 4BYHA 3U0WH 2R56L 4UDTB 5FYKH 2DM3A 3QUYA 4PJ9B 3NCMA 3MRCB 3ULVE 1J0KA 1UXSB 3T3MF 3VWKD 2IBZX 4FXGB 4XX1G 3GSUB 1T1XB 5F6HI 4QWWD 4Z5RB 3GUTA 5DC9B 5GS1A 3QXDB 5ERWA 5T33L 1F3JB 4LSVH 4JFDD 1B4JH 1HKLL 2YPVH 3FOMA 1FFOB 3O6FB 5HYJD 3T0ED 1NC4D 4QYOA 1JUFB 1ONQB 2ICES 1AO7E 4YHZL 4IS6B 3TFKD 1JV5A 2PR4H 4MSWB 2EIBA 1OARL 4JFFB 1ORQB 2C26A 1B3JA 4R7DA 5F1NA 2Z91A 2NQCA 5H94A 3L9RB 4NP4L 5IP4A 4N90E 2QHRL 2IADA 1BIIA 4YIQB 1G6RA 3GSWB 4RCAA 5I0DA 2X1XR 2DQEH 3MRIB 1C12A 2DM2A 5DFVD 4HS6B 1YY9D 2H26A 2NW2B 1KUMA 3L7FA 3MBED 4MAYB 2ED7A 3LAFA 3REVB 3EYSL 1ETZA 5IVZA 4XB8A 3THMH 5KAQG 3FZUD 3IU3A 5E4EB 4C57C 3QIUC 3EDDA 4I48A 1OAKH 2Q7NA 4QCIA 2J8OA 1N4XL 4BK5A 4DN4L 3RL2A 5E94A 4JJ5B 5KOMC 2GKIA 3RI5K 4GS7C 4LLWA 3RVTD 4OFPA 5IHZA 1NGXA 5GIRA 1LK2B 5I76B 4JO4H 2QADC 3GJFK 5HPMB 2EDBA 2NY0C 1P7QA 1UM5L 5HSFA 1ACYH 5GRJL 1XZ0B 3H42H 5JPNB 1NAMH 3FT3B 1IEHA 3Q6GH 3IAPA 3O11B 3IKCB 3RIFF 1BF2A 4YGVB 2FWOA 3K1KC 2EH8H 3TBWA 3GRWL 3F7QA 1E28B 2X89A 4RWYH 4WU7A 1T1ZA 3CFCH 1A1OA 2A0LD 2E9IA 4KKNA 1MEXH 3D48R 4HFWB 2Z31C 3V6OC 4M7KL 1IC5H 4HIEB 4JFXB 2AV1A 5F7NC 5C9KA 2A2QT 1RSFA 4JVWA 4FN0A 4NRZA 3VGDA 3QUYB 5HPOA 4OLUL 1CFQB 1V3KA 5GZND 5T33H 1FLRH 1ZLSH 3O6LL 2GITB 3C5SA 5KSUB 3H3BC 1PQZA 3QUXA 1S7VA 1MCJA 2WBJD 1FC2D 2O5YH 4Z7NF 2D31B 3SGEI 3UAJD 5EG6C 1A7RL 2CLZA 5L8JB 1UC6A 2Z0BA 4LCWA 3K8KA 3CU1A 3UYRL 3ZE1F 1AD9A 3AAZA 4R3SB 3NA9L 3BAEH 3KWWA 4PGEA 5BCAA 3SEPA 3RU8L 4DZBB 3A67H 4HHAA 4RA3A 2HFTA 3DMMA 2XTJB 5D7LA 1F2XK 2I27N 4O5LL 2DI7A 4RMTA 2OP4H 1U58A 5CILL 3EHBC 3X3GL 5D7JC 3HAEH 3PG2A 4POYA 3A0OA 1XGUB 2DQEL 3AS1A 4MA3A 3BGFC 4NKMB 4PJAF 1LMKA 2HFFB 1YPZE 2EDXA 5L8LB 2DTMH 4X4YB 1I9IH 3HB3D 1YEGH 4OFYA 1SEBB 1GPOL 5GGVY 1QZ1A 1QBML 3BKJL 1OY3B 1QFUH 2RAMA 3L5WA 3OTTA 4GG8B 5DJDA 1HH9B 4I0KA 4EXKA 2FO1A 5JHDE 3O45B 2X9YA 3LN4A 1Q94A 2FGZA 3F7YA 5EU7E 2HFEA 3GM8A 1W0WA 4U6HB 4PJAA 3MOAH 3NTCH 4P2RE 2CR3A 1Z9MA 4XAKE 5CP3H 4G7VL 3EOBB 3OV6A 4PJ8C 1UA6L 4KXZI 1NSNH 3ZE2F 1QR4A 4ZODA 4PJGF 3UBXI 3H0TB 4ZAKB 3K80A 4WO4D 5C0IB 1G9NC 1BJMA 4Y4FD 4LSTH 2LABA 3ZO0A 1IQDA 5DS8B 3TM6A 1EBAA 1NDMA 4W4OA 4JFQA 2OYPA 4MWFA 4M7LL 3U7AA 5EIIA 1DVFD 5AUMA 1MI5B 4ZFOB 3VDCA 5JTWA 3CMOH 2GJZA 3IDIB 3LN5B 3GKZA 1VGEH 4X7TB 5T3ZH 4XPHL 5HGAB 2ATKB 2UYLA 1KIQB 3LEXB 5L2JA 1TPXB 2BY2A 5F3HA 2C3VA 3HG1D 4LLUA 4V2BA 3V52H 1N26A 4UNTA 3MZGB 4ZUWA 2FHCA 1MAMH 3BP7A 3P2TA 5DA0B 4RX4A 3W0WE 2OMBA 3QG7L 3VRIB 4GLRH 3RQ3A 1H3XA 1UKTA 4PRNA 3FQUB 5I8CB 1E6JL 3LS4L 5F9OL 4D9RE 1F42A 2V9QA 3FCTB 1OTSC 4K3GA 1NC2B 4TSBH 1WBYA 4LHQB 5GGVL 2EDNA 3EYUL 3QWRD 4WVRA 2OTUA 2C1OA 5SWSA 1PYWB 5EOTB 4JO2L 3MRBB 4N1CA 3O3AB 1OM3L 3QQ4B 1T3FB 3PGFL 3HRZB 5CJ5A 3CLEH 3DV4B 4ORGA 4FFZH 4TYUA 5JW3L 2PYFA 2ADFH 4TUOA 2QJDA 5EZIH 5ITFB 4I5BB 3HFML 5K9KA 2FX8H 1IM3B 4J7RA 1GPOH 3LEVH 3T0EA 1L4IA 1NAMB 3VWJC 1O0VA 3QO1B 4L4VD 2P24A 4NO2B 1YDPA 3QCUH 3EFDL 5I1EL 3PL6B 1DBBL 2D9CA 2H8PA 3VGBA 4MCYB 4XNXH 5E9DB 4N8PA 3GSVB 2CKNA 4JO3L 4J12A 5DK0B 35C8L 3DYPA 1U41A 4NQVA 2AAVA 5D1XD 4H25B 2IANB 3VFPA 5D7KE 2YKLH 3MXWL 1XEDA 2FYYB 1K4CA 3GK8H 2EYTB 5C0CE 4YQXL 4Z6AT 1A4KB 3CFJA 2E8ZA 5FCUL 4I48B 1NDGA 1I9RL 4PJGE 3SKMB 1FGNH 1OP3K 5BMFH 2VLJD 5T5NF 4PP2A 3K7UA 2H26B 3NCEB 2JK5A 3HPJA 2D7MA 4PTUB 1KTLA 5DGRA 3EJYC 5AWNL 1HZHL 1WAAF 4PLOB 4X6CA 4Y5VA 4JQIL 1W8NA 3U46B 2ZCLH 4O2CB 5L0QB 1I1CA 3NVQA 4G9FA 5IJKA 4P2OB 4N0FB 1S7SB 5MEPB 3L6FA 1UADC 1RUPL 4LLAA 3O3BA 3KYOB 1T5WB 1OB1A 1RURL 1KCLA 3HA0A 1ZGLP 2HVJB 3G04B 1C1EL 2NNAA 3MRJA 3WYRA 5I1IH 4EDWL 4WENB 4URTB 3VH8A 4WI9A 4CJ0A 2B8OT 3T2OA 2VISA 5IB4A 3U79A 2WSKA 4I0PB 1L9NA 1QYGL 4WWKB 1QPPA 4NQVB 1RJZA 2NTFB 4OLYL 3GMPB 1G7PA 2A83B 3NPZB 4PRDA 1CE6A 2Y23A 1S7UA 2UZXB 3AM8C 4XP4L 4O2EB 1EX0A 4XRCB 1YDPB 4F7PA 1XF3A 1BWMA 1DBBH 4Z7WF 3GO1H 5K9OB 4XVJH 3ZDZF 3QT2A 1HHGA 4HUUB 4Y8DC 3TPUA 5C0GB 3V6ZB 5MERA 2D4DA 1X6LA 1VACA 3TBVA 3GMRB 4HMDA 1VFBB 3MCG1 4XP4H 3BI9X 2BSED 4G6JL 2R4RL 1MFAH 3TV3H 4ORGB 1CS6A 2PYEB 4YNYB 1YZZA 3K3QA 2Z31A 1N2RA 1SBSH 4K8RC 3V4VL 4HMCA 3ZDXF 2R2BA 1MY7A 3RY5A 3JBG7 5KVFL 4X8XA 3PWVB 4KKAD 1S9XB 2BVUA 5DJZB 3BJLA 4D0BB 4DWHA 3TVMC 4YX2H 4M7ZC 2YD5A 1H3PH 1FVCA 4M9OA 1MAKA 3X14B 3TYGL 2YPKA 4HPYH 4DN3H 5JOEA 1NH6A 1MIEL 1B4RA 5CUSL 3MV7A 4OJFL 3DVNA 2R69L 2P49B 5IESL 5DZLA 3RI5F 5L88L 3R1GH 5IBLC 5AYQA 2Z8SA 2X89D 1H3PL 3O3BB 4QRUB 5F1IB 2B0SH 4QHMA 3ZTNH 4JHWH 2FD6H 3HZKB 3VXRA 4MAUL 2KDGA 2MNUA 5DK3A 4ELMB 2IQAB 4OZHA 4PV9A 1CR9H 4TVPH 3BZ4B 3LSOA 3SDCD 2Y36H 4YHIB 1OP3H 1BZQK 4EQ3A 4PRIE 3I9GH 2OJEA 3PHQA 5FHAL 4O9HH 3MLSH 1IKFH 4Y4KA 5K93A 5KN5A 1CGSH 2VN4A 1YQVH 4HEME 1QFPA 1CN4A 2WQRA 4OLXL 2W0FA 3ARVA 4NSKB 4NZRH 4NCC1 5A16A 4PLNC 1FZJB 2APBA 4I0CC 4HGWB 2EYTA 1X4XA 4X4MA 2GSIB 4GAYA 5IBLD 4TULL 3MFFB 4MJ5A 5D7JB 4AIZA 1P2CA 1RFDH 5CP7A 3QAZC 4JAMB 4OCXL 4F7CB 5CINL 2VXVH 2D3VA 4V2CB 4IHOB 4ENEC 3VGEA 4XHJD 5E2WL 3VW3L 2FECL 3CFKB 3LKQB 4QRSA 3C60C 1KEGL 3QDGD 3W11D 3GSVA 4YGAB 5TDPA 4GKZA 4NQTA 2Q6WA 1HK6A 4P2QE 3RVXD 2HFGH 5E99H 3U83A 1JIBA 4JR9L 1CTOA 1OHQA 2DQTH 1L0QA 2LFGA 1P7KA 3V4VH 3VD9A 1OP5K 4H8WH 2NY1D 4LEOB 2VXSH 4YC2C 2YSSB 5LWYH 5JPMB 3TT3H 2EXYC 3FB8A 4YX2L 3SQBA 4FTVB 4HWBL 3RA7L 5I1CH 1DN0A 4LNRA 3DV4A 3T2NH 2ZCHL 2G5BA 4B53A 2RR3A 3W2DL 2DQUH 1W72A 4K94H 2EO1A 1IM9A 2OJZH 3PP4L 5FO7B 3DVNB 2W1NA 1S7VB 3PQYB 1OSPH 5INCB 2XNAB 4U1GB 1A7RH 1INQA 5ADPL 1QSED 2V7HB 1F4XL 4GW1A 3T0VA 5D7LE 3EJZD 2X4QB 4OSUL 4G8EA 4J3OC 3HLAB 3PWVA 4LRNL 1OWRM 4PJCA 4TVPL 1IEBB 4Y16B 2VZSA 4OM1L 3PABB 3EO9L 2OTWB 3QXWA 2MKLC 4KI1A 4KK5C 5CEXA 3O6KH 1I1YB 4YJZL 4YWGH 3SJVB 1WCBB 5JNYA 1U8OA 3TBWB 3IJYB 3IU4L 4JY5L 5DT1L 5BOPA 4WW1B 1R5WA 2ZUQB 4GRMB 3EFDH 1WEJH 4JFQB 2ZUSA 2VDKL 9CGTA 5CJXA 2XQBH 1ZA6B 1Y18B 1UZ8B 1RZGA 2Q8AL 2EZ0C 4HAFA 4ORZC 5GISL 4JAMA 1KPUB 4OIIH 1MCHA 1KJMB 5ALCL 4KVCL 3WFDL 4QHKJ 5MENB 3UTTD 2BRRH 2FJHA 3CZJA 1D9KD 1RJZB 2D7TH 1UGNA 2XZAH 1JPSL 4NQXA 2OZ4A 4P9MH 1F3RB 2W60B 5J06A 1YQ2A 3HN3A 4L4VE 1G7MA 3RIAF 2XN9E 5LG1A 1BVKA 1IKNA 3VXOA 5GQBA 5KS9A 4AEFA 4KVCH 3WFDH 1N0XL 1FGNL 3C6SA 1FORH 4APQC 4XNMB 3G5ZA 3L3DB 4MXQD 3L3IA 3FQWA 3MJ9H 3ZDXE 2UUDH 1OT1A 1UXWB 2H1PH 2PW1A 3ROLB 3DV6A 3PWJA 3EJYD 4JFPA 3VGHA 3G6DH 3V6OA 2H45A 3UO1L 1WAAA 1CDUA 3LMJL 5KTEH 4PTUA 3AY4C 5LGKA 1KELL 3C8HA 3GHEL 2N1KA 4X6EA 1KLGB 4LPWA 3QEHB 2EDDA 2HN7B 2XZZA 4LCWB 1LVEA 4NKQB 2HMIC 3GMQA 3VG0L 5GGSY 4ZUTA 1LE5A 3NCCB 4JY4B 5DURD 5KSAB 3MNWA 3BIKA 1HEZA 2FIRT 1AO7A 2F5BH 5CD5C 5I19L 5IW1B 3N1PC 4RMSA 4EI5B 3FQNA 4X7FC 1S7TB 2OBGA 2JIXB 1FGVH 2KBGA 4CU7A 5CSZA 2VLJB 1DUYB 4FQXD 3D39A 1RZJL 3U0PA 3Q48A 1CFSA 4HIEA 4M6OL 1GOHA 4PJ5A 1BEYL 2DMCA 3OAZH 3F6LA 4UTBH 5CJOH 3FHQA 5BMFL 1EEZB 1NMCB 4PLKC 3QXVA 4PYGA 4PRHE 1B6UA 4U49A 4RRPA 3FN9A 3BZFB 1IL1A 2LVCA 1RMFL 1LHZA 2B2XH 4GAFB 4J3UA 4I5BA 5EUOF 3ZLQC 3WJLC 4LHUA 3QQNA 1QSFE 4MCZA 4DEPB 1PFCA 3KS0H 5CJOL 3OHXB 1EUTA 2WMPA 3JWDH 5JDSB 1QSVA 4JQVA 3V5DB 3C5ZB 4EUPH 4UV4L 4B7LA 3OXSB 5EOTA 5C0CA 4IJ3B 4L8SC 1YEJL 5K9JH 1FLRL 1ZLSL 5CJBA 5FKPB 3VFMB 2P8LA 3MRPB 4BSWB 2VAJA 5TQ0L 2E27H 5E2VH 1CGUA 2HWZL 5IV2A 4KMQA 4NQSA 4N9OB 3NN8B 1RJYB 1UM4H 4FFYH 3MLZL 4BFGA 3WXWL 4Y4HD 3IRZA 2QQLH 3LS5H 1EBPA 1KTLB 4PJFF 1U92B 1GYAA 5EOQL 1Z5LB 3GSXB 1S9YA 4LLYA 3L95B 4PD4J 1CQKA 1FNLA 3EYOA 3BN3B 2UVFA 4ZSOE 2GHWB 5DEFB 1IFHL 1NGPL 2V5RA 4OCWL 3LD8C 1U8KB 1H5BA 2DF3A 1I1FB 3QI9A 4X6DB 5C0RL 3IDYB 3FOMB 3I02A 5FCSH 3PQYD 4WWID 3SJVA 3Q6GL 3MLXH 3DYOA 1V7ML 3HG1B 3QAZB 4HD9A 1JWMA 1ND0A 3C6LA 2VR9A 3QUKA 1F13A 2CKBH 5BRZE 2VLLB 2X4PB 5IB5B 3ZZ1A 2D0HA 4EBQH 5F8QC 1PKQA 3BXNB 2EKJA 2HLFD 2QSVA 3P77B 1BEYH 4OBRA 4FZEH 1PG7H 4F9PA 4JHZA 2ZKHL 5CIPH 1LDSA 4Y7MA 5FO7A 1FNAA 2OK0H 2ENYA 1R3IH 1AR1D 3HB3C 5DI8B 1WTLA 5GSRA 5BV7B 3FN0L 3M07A 2VLRE 4JRWA 3BSZH 3VFOB 4H8WL 1JTTA 3RWFB 1VADB 1YYML 3RWIA 1DN0B 1OAZH 4NRXA 4X6FB 3ZTNL 3MJ9A 3QIBA 3AREB 5I30L 5IHBA 2IMNA 3C5JA 3RWEB 4Q6YA 5DHYA 3FN0H 3INUL 3GBMH 3A67L 4DKEL 1QQDB 1UCBL 4PJ8D 4HX1A 3FB5B 2C1OB 5SWSB 2CRIA 3KPMB 5KVEL 1CGYA 3GI9H 3FFCA 2YRZA 4FXLA 4M7KH 4I18C 4A2MA 3HR5B 1AXSB 1F4YH 1A3QA 3ARDC 1S7WA 2WBJC 1GOGA 2DTML 3DBXB 1KN2L 3K0WA 5TPWL 1RPQA 2MPAH 4GKOA 1VEOA 3MV8D 3TZVA 1R3LA 3O6LH 2BVTA 4F7CA 1LEGB 4YZFE 1MJJA 4RIRB 1X5JA 1MUJB 2GITA 5BV7L 5CCKL 5IROA 2B4CC 5JHLH 1UENA 4X9FA 1A5FL 4L5FH 3LKOB 1L7TL 3NZ8B 3QZWB 2NY7H 2CRZA 2EYSA 1ZTXH 1IFHH 1NGPH 3G5YA 4XP5L 3VXMD 4CVXB 4HFWA 2EKSB 4QRTB 1T0NB 3VWJB 1LK3L 1E28A 1JWUB 1U3HB 2HFGL 5E99L 4OLZH 4X6CE 5K59E 4HK0B 2EE9A 5JLZA 3D6GA 5L7XH 1RZFH 3RZCC 2I9LB 1M05A 2X1PA 4OD1H 1VDGA 5EZLA 4U1MB 1EK3A 1AGBA 2JJWA 3NN8A 5FOBB 4I2XA 1AFVL 5E1AB 3RWHA 5MEOB 4HWBH 3E2HB 2ADGB 3QXUA 3ZKQD 1TLKA 2CLVA 1PG7L 4PJDB 2IQ9L 1XGQB 3KPRA 3STLA 1R5VA 4O58L 1P4BL 5BRZA 4CVUA 4XAKD 5KSBB 2VDPL 1IGJB 4H20L 3KXFD 4HXBH 3D25A 2NLJA 4ODTL 4OZHF 4XXCC 2VWEE 3MR9A 4NN5C 5F97E 1I7TA 4N0YL 2VXQH 2VL5B 1N3NB 4OTXL 1T1YB 2GK0A 4IIQC 4TNVF 3N9GL 4K71C 2NY4C 4I77H 4OSUH 5GGQL 2EDYA 2GCYB 1F02I 1QG3A 1N2RB 4CRPA 1Z3GH 3QFJA 1A47A 1XF1A 1G9MH 3QI9C 2AJ3A 4WHTB 5CBAA 2KUTA 1JV5B 3JSSA 5EUOE 5MERB 3ARWA 5JW3H 2K9UA 4UUJB 5K9OA 1I75A 2JJUA 1DUYA 4GQPH 2FO4B 1VHPA 4N8VG 4F58L 1II4E 5GS1B 3GI8L 4MD4B 1INDH 4ZFOL 3QPXH 4PRPA 5I19H 2CJUL 2FJFA 4XMKL 1SEQH 1FIEA 3LIZH 1AGDB 2BRRL 3PWUB 1J11A 2F5AL 3KYMA 1AJ7L 2DQDL 2F58L 3ECBB 5HHNB 4HUWB 1QBAA 2AJXH 2KQMA 3J7HA 1NBZA 2WWKO 4IRJD 1KPVA 4MNGA 4G3YL 4XPAH 4D9QE 1HQRB 1R5IA 5H35A 4PJ7F 4HF5L 4X98B 4XP6H 4PTTB 1R3KA 4QTHB 2Y06L 1CFTA 3S4SA 3BE1L 4LSSH 1M7DA 2EIEA 3JWOH 4OZGA 3MJ7A 1LD9A 4DCQB 4AIXA 2QQQA 5FECB 5DD3L 2XRAL 4UAOC 2UZIL 4FXKB 3DV6B 3F8UB 3PWJB 5ICXB 3JWNC 1FZMB 1D5IH 1WFTA 2EC9T 2Y25A 4MXWH 3HNTL 3MJ6A 4N90D 2VLRB 1TZHB 3CC5B 4HWEL 4FNLH 4HJ0C 3QUZD 3WDIA 2EC8A 4Z7WB 3VJ6A 4DUWA 1ZLWK 1S7XA 3QQ9D 4ENED 1YPZA 3C8KA 2NCMA 5HHNA 3U4EA 2WBWB 3DXAE 3ULSB 3PWPA 5EU5A 4I77L 3EOAA 3OGCA 4XVTH 4GMSL 5GJSH 3OKKB 4P23B 1YEDA 2NY3D 3CFEA 3B2VL 4MD4A 4FQPA 5FM5M 2E5EA 2QHRH 1IGCH 3PV6B 4D0DB 1NMAH 3P40A 4R7DB 3CUPB 1K2DA 5F1NB 1OGAE 5IK3B 5JXAL 1NQBA 4YHLH 3TJEL 3RGVD 3QI9D 4PTTA 1IC1A 5HI3D 5F21B 3P30H 3WSQH 4MS8C 3CZFA 4G5ZH 43C9A 1J7VR 1DQJB 1KELH 1FBIL 2X1QA 4X6BB 3LRHA 3EBAA 4M48H 1PZUB 1UB5A 2APFA 1NEZA 3GSUA 4HV8A 5ITBH 1VPOH 3FJTA 4PY7A 1ZXQA 5L9DL 3LDBB 3ILQC 2FSEB 4PB0H 5IKCB 4LPCA 3D3VD 5CSGA 4JO4L 4XCCL 3MTRA 5TE7L 3LPWA 1IGJA 2XT1B 3GHBL 3EOTH 5EO9A 2A9MH 2Q20A 3QEGH 4ODXB 5CP3A 1U8IB 1KIPA 1IMHC 1ZA3B 3P0VH 3V2AR 1KNOB 1MCOH 5J6HB 3VXMB 4LDOB 3T0BA 5F7HA 4JVUA 3CDCA 2P5EA 4XXCA 4NO5A 4Y2DC 4PLJC 5IVXA 5I1GL 1GIGH 4TQEH 4MA1B 4IRSD 4ZXBC 3S8WA 4M1CC 3VD4A 1FPTL 4Y1AA 1LO0H 5ICZA 1XGTA 5FYJH 3QB7C 5F3HB 1EMTL 2I9LA 2G60H 3SDAB 1KB5L 4YC2B 1AP2A 1K6QL 4M1GH 5HGAA 1JWUA 3MA7B 3RJQB 3WJJA 5LWYL 4NKDB 3OB8A 1P7QD 1NJ9B 5DSCA 4LDEB 3C8DA 2HLAA 2G60L 4ZAKA 1JNLL 5DD6B 2HJLB 3CVHB 1DFBL 1UG9A 4L4TA 3OQ3B 1YY8B 1MHCA 1K3ZA 3WHE1 4UOW1 3X3GH 3IFPB 4G8GA 1MCCA 1SVZA 4Z7VF 3SKUD 4G9DA 2Z35A 5I1AA 1BD2D 3CH8A 4CVZA 4GG6E 1MAML 4I9WD 4AM0A 4S1RL 4ZYKA 1XCQB 4KK8C 1E4XI 4OLXH 2QR0A 1MHEA 1X5YA 4GUPB 5L2KA 3UYOD 3LS4H 3I3BA 3DSFL 4JPWL 4G6FB 5BO1L 3LKRA 3P9WB 3JWOC 1CICD 3HE6D 3NGBB 5GRZA 43CAB 3VU2A 2RJMA 3FOLB 5IFHH 4U05A 2HG5A 3QO0A 4WUKL 1GZPB 1PX3A 3BZEA 3RFZC 5C92A 1CU4H 4G7YH 2W9EL 4ODHL 4K7PL 4NBZB 3SO5A 3M45A 4PGZA 2Y5EA 2XPGB 2AXHA 5F6IB 1C5CL 3ZHKA 3QQ3A 4XVSH 1RK0B 1CXFA 2FLBT 1HHKA 4OCNC 3GSNH 5LAXA 5JDJA 3BPCB 1BOGB 1UJ3A 5GGTA 2QBWA 3HC3H 3HR5A 4RZCB 1AC0A 2V2XA 4QRPE 1GJIA 1GHFL 2DRUA 1QBMH 3BKJH 4MLSA 2AVGA 3H6JA 4XPTL 1ZHBA 3FRPA 1JNHB 3OKEB 2CGRL 2IALA 3MFGB 4MJ4A 3PNWA 2FDBP 4L3EA 2CUIA 5C0FA 2GY5A 3QUMH 5ESAA 1SY6H 2DLFL 4NRXB 4Z8FL 2C7UA 1LILA 5D96C 2XA8H 5GHWL 4JKPL 4LGRB 3FB6B 3CU7A 2EYRA 2YXMA 4X7SH 4ZTOH 2O5XH 5GSRB 5I16A 5CKAA 4XNZC 4YDIL 3L7EA 5J13B 5KTEL 4DUVA 4P3WA 1HQ4B 4KWUA 3HCVA 2VE6A 1HHIB 4P46B 1UJ3C 4CMMB 3FQRA 3QPXL 4CNIA 3T1FB 2MWCA 4JGJA 3C09C 4NQSB 5CWSA 3OKOA 1LDPH 3CSYB 2XXMB 1IVLA 3R8QA 2NMSA 4CDGC 1EJ6A 3BN9C 2D7PA 2YPLA 1WZ1L 3ULVF 4P99A 4XNZB 5H2BA 1F3DJ 1BBDH 3G04A 3P0YH 1SJHA 3QIWA 1FFPB 1MRCH 2AS5M 2VR4A 1SYSA 1F11A 1DLFH 3TZVC 2HP4A 4YDJA 3KDMB 1KCRL 2YK1L 4P4KB 5MEPA 4XP6L 3O0RL 1LO3H 3V5DA 1BFOB 3L5XH 2JCCF 4IOSD 2Q86B 2LTQC 3REVA 2GTZA 1VFMA 1MCQA 3QDME 1IAIH 1JK8B 3WNNA 5F89A 1S7RB 3BPNB 4JZJC 1CFVH 4HIIB 4RBPK 3NMEA 4OGYL 3S3PA 3W9DA 5HXMA 4OZGB 4X9BA 4EI5D 2RIKA 1X4ZA 4PRAB 1FYTA 2J88L 5FCUH 3VFVA 4EOWL 3VFMA 1D5XA 1OGTB 1JF6A 3U6RB 1NFDE 3E1F1 1A6UL 4F7EB 1QO3B 2P5EE 4P23C 5TGBB 1A6AA 2NX5D 2APTA 4KV5F 1QR1B 3ES6B 3F12B 4HKZA 4HEPG 2DKSA 3QUML 4TNWK 4ZG1A 1RIUH 2DDQL 3QEQE 5D1QC 4O4YH 3V8OA 3MACH 5E5RB 2SEBB 3L5IA 3GSRA 3V5HB 4XAWL 5HGBB 4HKXB 3VH8G 4EN3C 1WZMA 5D1XA 4OZIF 4NNXA 3DIFB 4PJHE 5J1TC 5HHOD 4KRPB 5FYJD 1NAMA 3K8MA 1IAMA 2AJZB 1MCBA 4G80B 2AGJH 1GGCL 1NFIB 3U0PB 4NUJB 4UMGA 1CTNA 4YBLC 5CBAB 4OKVB 3MV7E 2XWBB 4YBHA 3O4LB 4HBCH 2FX7H 3QFJB 4M1CD 1JGEB 5GS2H 2DL2A 4MAUH 4KFZC 1I8MA 1QD0A 2O5ZH 4YHOH 3B4NA 2Q1EA 3MO1A 3MGTB 1ZGLB 1DQLL 2UY6A 1A9EB 4XNMA 3TCXA 1MLCA 3RX7A 4P5MB 4S10A 2ZNWA 1A6PA 1HI6B 4HG4K 4WEBL 5KS9B 2X40A 3LEYH 4I3SH 3QHZH 1IAIM 4NWUL 4F33B 4Z7VA 4IOIA 2K1MA 3VG0H 2IANE 1D9KC 1JPTH 2D7QA 2HJKB 2AJXL 2KPNA 3FO2B 2PO6B 3JWDL 4EDXB 3NFPA 1RHFA 4JCLA 3MRFA 5HHMB 3ZE1E 3BO8A 3UMTA 3NCJL 4HIXL 4WI4A 2QL1A 2VLMD 4R6UA 1XF2A 3UTPE 5DHVH 3UZEA 3T65A 4PJFE 4UQ3B 4MNHB 2H2PD 4X7CC 3M1BB 4TRPL 1UJTA 5FGBA 3RKDC 1QSFD 4D9QD 3MUZ1 3L3DA 2QSTA 3NH7H 4ZAKD 5FM4A 1IC7L 5DUMH 1NUFA 1PBYA 3PWLA 5IQ7L 3GJEB 4WUUB 1E4WL 4KGJA 3EOBA 4UTAH 2F54D 4GRLC 4XBPA 2NR6D 1FV1B 1Q9OA 2AJYH 2AP2A 5T1LA 2DQCL 1IGFH 4G6MH 4RDQF 1J5OL 4XC1L 1EO5A 2ARJQ 5FYKE 2ZOKA 1Y6NR 4HS8H 3H9SE 3MRHA 1KB9J 1MCEA 1HSAB 1HNGA 1L7IL 1PY4A 4GMSH 5GJSL 1INQB 1MUJA 4OGXL 4ZO7A 1MHCB 1OAUL 1YEKL 3B9KA 5JZ7D 3EOTL 4ODSH 2XV6B 3U2SB 1ZHKB 1RU9L 4KJPD 3WUWG 1CK0L 5C0JB 2FH6A 1W72B 3HR6A 4LCYA 5JW5B 4HPYL 2CDGA 1Z9SA 2UWEF 4JPVH 4EIZC 5JNYB 1WCBA 1XGYH 3IS1X 4JZJA 4XX1E 1NAML 1YEGL 1IEBA 4X5XA 5AYUH 5HYSA 3QIBB 4JGUA 1MY5A 1REIA 4DUXA 2DQFA 3EFFA 1G7JB 5B4MD 1BJ1J 1FFRA 1IGYA 3EOYG 4ZS6C 3RWFA 4U6YB 1X5ZA 5JHDB 3HUJF 5D7SH 1L6ZA 3WFHB 1YEEL 2IPTH 1ZA3A 4K23L 1RZKL 4LLQB 4NC1C 4XZUA 1W0VB 2PN5A 2J1KA 3BP4B 1NSNL 4JDVB 4LLVA 3MUGB 2GY7B 5FO9B 5IKCA 5A2IH 3GMMA 1CFNA 2DMKA 4NRZB 1UWXK 1OAXH 3UTOA 1MCPL 5I1JL 4LVEA 4ODTH 3FN3A 1SY6L 5KSVA 3JXAA 1Q9OB 4NZTH 3HE6B 4UIMA 3S5LB 4WRLA 3MODH 3UYRH 1DDHA 3BH9B 4FQ2L 4GT7A 2V7NA 1N0LA 4XT1C 2GIYA 5DRZB 2BNRA 4X6DA 5BO1H 1I1FA 3QI9B 4N8VB 5C0AE 4WFGD 5CEZH 3NFNA 4A6YB 4ELMA 3L1OH 5JPNA 4R4FH 4OCLC 3WEXA 1DANU 3WLBA 1JTOA 4MVBD 2ICCA 3HZKA 2X4OA 2ZUYA 4MDIA 3BH8A 2XTLA 4PRIB 1TJGH 5HHXH 3G6DL 4KU1A 4BQ8A 5I8OH 3MFFA 4MJ5B 2V2TA 1OAUH 3WFZA 4GW5A 1I3VA 2AI0H 3ZKXB 1T1WA 1FC1A 3TIDA 4Y5YA 5B38G 1CK0H 3P73B 1N6UA 1HINH 1ZT4B 2NZ9D 4KY1L 4LSUL 3ARGD 1QFUL 5LGHH 4R4BB 2NW3B 5I15L 1KCRH 3VJ6B 2QLVB 1RHHA 4MAYA 2ADIA 3D0LB 3LKPA 3KJ6L 3H9ZA 3VFUA 3PWPD 4HUKB 4YHIA 2DM7A 1FRGH 5CMAB 3U9UB 4JN2B 1IAIL 4E41A 5C8JB 3QNXB 5JORB 3K74B 5DLMH 4L8CB 5CD3A 5HHOA 5I75C 1PSKH 3IDJB 1YNLH 1UKQA 1ZTXL 2D4FA 1RULL 3BE1H 4LSSL 4JO3H 4Z8FH 1VACB 2YD3A 4FRWA 2AEIT 3VE0B 4F7TA 1LK3H 3Q6FB 5HYEA 1QLEL 3HE7A 1NMCC 2ZG2A 5HGDB 5DJCB 4F7PB 2ZUVA 1B0GB 1PSKL 1VGKA 3TA3A 4H1LG 6FABH 4WFHD 5IB3B 1IBGL 3V5HA 1V3LA 5IJVB 2D03L 3ESVF 5D71H 5ESVA 3GSOB 1TZGH 3MXVH 3RZWA 1EXUA 5TF0A 3MRCA 2DIJA 4WTXA 4UNVA 4QXGH 1FJ1A 3OKMB 3U0WL 1WT5C 2EIZB 4BUHA 4HUVB 3H7BA 3EYVB 2A77L 3QULB 2GUOA 4IEFB 3MNWB 1Q9KA 5GGVH 4AEHH 1B90A 3SDXF 1MRCL 4ZD3H 4HWUA 1QA9A 4P9ML 4OGAC 2A9NH 4BSVA 4E41E 4F9LA 4OUOA 4QO1A 1B0RA 4HLZH 4WY7L 4X7DC 4WIQA 3K4AA 2ZSVA 3T2QA 4O2EA 3G5VB 3FAXA 1T7VA 3NCFB 4RMVA 2ITDA 1JK8A 3EKCA 2L7JA 2R1YB 4CU6A 2JTDA 3ZMRA 5C0BD 2W9DL 4WWKA 2P8PA 2RBLA 1U8NB 3A6CL 4JANA 4XB7A 4DGIL 4B5EA 1T03L 1KFAH 1DJSA 2YBRA 1WF5A 3PP3H 4D9RD 5ISZE 2AJVL 5IR1B 1OAYH 3O2WL 4AYFA 5HDBF 1LNUB 2PO6C 5DYOA 4HPOH 3QJFB 4Y5XA 3TBTA 3C6LC 1F6FB 2AJSH 2ITCB 4MLIA 5IWLC 1E4XL 4U4BA 4K55A 4LVOB 4WHYG 1Q0XL 3WBDA 2YEZA 3ZKMC 1OAYL 4G9FB 5DQ9A 1RQ5A 3VG9C 3OBAA 3JTSB 5ISZA 1HQ4A 3BKYH 4L4JA 5GS0H 4AENB 3ALPA 2D7OA 5C70A 4ERSL 5ID1B 3BVNA 1FL5B 2I25N 4GKNB 4NO2A 2PYEE 1BMGA 3ULUC 2F54E 2E9WA 4GRLB 5TE6L 1SJXA 1ZWIB 4NIKB 4JFOB 5F7YC 3HE6A 4UIMB 1SY6A 5T1MB 4HH9A 4OCSL 3HMWL 5E56A 1JHKL 1DQDH 4CADA 4JB9L 1K4CB 5LVEA 1MCWW 1N6QL 1CZ8L 1JYXA 2WWMC 3PF2A 4GAGL 3T4YA 1LEGA 1JNHA 2R69H 4Z7QF 2IANA 5FYJE 3K1DA 2HTLD 2VLME 4BKLA 4BZ2H 4NP4H 1XIWA 3BWAB 3QIUA 1D5ZB 1S7WB 5JHDA 4U33A 4WFEE 1HCFX 2PXYB 5DUPH 5C0BE 5ITBL 4I3SL 5HD8C 4LHUD 1IGYB 5INCA 4HCRH 5EOQH 1QHPA 3L3JA 1ES0B 1OPGH 2DQFB 2Y6SC 1KN2H 2J5LC 4WV1C 5DEZA 1LO5B 1BWWA 2B5IB 5DGQA 1SMAA 4XPBH 2XPGA 1HXYB 1A7OH 3MJ8A 1L0XA 1PLGH 2VDNL 4JPKL 4Y4HB 2ATKA 2KKQA 2UYLB 4D94A 1KJ3L 1HHHB 3BWUC 5HDQL 1MI5A 1OSZA 3ARED 4HIJA 3S97C 4OV5A 2NY2C 1UH3A 5BJTA 3VRJA 4WV1B 3HE7C 3FMGL 3ZDYE 1BM3H 3GGWB 3S36X 1KCUH 2I60H 1MFBH 5IMMB 3HC4H 4AQOA 5EA0L 1T04A 2B1HH 4G8GD 1DQQB 3DRTB 3RUGA 4JFHE 1A1NA 5L6YL 3HUJB 1UT9A 3P11L 1W0WB 5DQ9B 2DYPA 4NJ9H 3VRIA 3C2SA 3VI4E 1EFXB 2JELL 3IDMA 4FQHA 3IVKB 1K5NB 4TNVK 4P2QB 1S3KL 1J88A 2C3WA 1T0MA 2C3VB 2X4TA 4XC3H 4AQ1B 4U2ZA 3H9HB 2YPLD 4L4TB 5D1ZD 5EC1B 4OJFH 3MRGB 3DRQB 1JGLL 1U8KA 5FGCB 5AUMB 2VERN 4HH9B 3SOBH 3GBML 5C08B 1NDMB 4U1NB 3QXAA 1RZIB 3PWNA 2WNGA 2BNQA 4JKPH 5F9JB 1MWAH 1U92A 1AP2B 1CICC 1RZ7L 1ZLVK 4NKIH 2BOCA 5FYJL 3S98A 5LKNA 4Z0XB 5ICZB 1RVFL 4Y16D 4JPWH 1GSMA 4OZHB 5DO2C 2FH8A 4ZNEE 2PO6A 4QXTB 5JQHC 3EO0B 4LHUG 3UTQA 5D7IE 2LE9A 3SY0A 2H2SD 3MLRH 1CLYH 2FZ3B 4HAGA 4XC1H 1T80A 4KY1H 4Q6IB 1VFOA 4EEEA 4IOIB 3SDDB 4I4WB 4HZLA 5ALBH 3HZVB 5F7LB 1SVCP 3RBGA 5IIEB 1KIPB 4S1SH 3TIEA 4E0RB 1E6JH 1HDMB 4KPHH 4OLVL 1S5HA 3ETBF 3P4NB 1ZLUK 2PO6D 4WFGE 4M8QB 4UT6L 5SWQA 1FE8L 1TCRA 3WLWD 4WFED 4WGWB 3O2DL 5JQ6H 1G9NL 4NKMA 5AZEH 4E5XA 2YUVA 2CR6A 3VXQB 1FNGB 4QRPB 3IJSB 3N0PB 1KGCD 1B0GA 1EEZA 3S37X 3TA3B 5ICYB 2A6DA 4HWBA 4MYWB 5EO0B 2VITB 3MLUL 2HT3C 3PUCA 4G43B 4ZFZB 2XXCB 3O2DH 3ZT6A 4LBEA 5HVFB 2CLZB 3DROB 3U4BL 2OL3L 1CDJA 1J8HA 3ULVC 5DZOA 1MSPA 4KQ4H 5I9QB 1P84J 3T0AA 4RSVA 2CQVA 5KS9F 4NM4H 1WC7B 4NO0A 2HH0L 4UT9H 1CE6B 1KEML 3DX8B 2X5PA 4D3CL 1QO3A 2G9HA 4WW2B 3EOAB 3OGCB 1H15B 2GSGB 4QNPE 1UB6A 2ATPA 2ED9A 4RAVA 3BESR 2VMFA 3EDJA 3V7AE 5DEGA 1T5XA 3V4UL 3HNVH 2NW2A 3L7FB 5EBMB 3BHBB 5KSAD 4L8SB 5J12B 1QVOB 4GXUM 1T83C 3UO1H 3EDEA 2BJML 4MXVE 1AH1A 4M7ZB 3ARBC 4ODWB 2G75B 4FHBD 1F00I 3L1OL 5FFLA 2ILLA 3V4UH 1XF4A 1FH5H 5I1DA 1D6VH 4J4PC 1F4WL 2O5XL 4X6CB 4Y5VB 3MA9L 1AJ7H 2DQDH 2F58H 4YDJB 4XHQA 1MH5B 2BSTA 4X98A 3QUZB 1I4FA 1JGDB 4QCIB 2BVOA 3LEVL 3QNYA 2XQYK 1AGFA 4S1DC 3VWKC 4KDTA 5D1ZA 5IFAH 5J9PB 1ZT4A 1QEWA 3F7PC 5D6CB 3SDDD 1GC1C 4HS6A 5A1AA 3TIDB 5DD3H 4Z18A 5FB8B 5GS0C 3VGGA 4DKDC 1A6WH 4YIQA 4YK4C 1EEYB 3TN0C 3SE9L 5DJYA 4HJ0D 4WO4B 5GPRA 1CD1A 4G6KH 2EDFA 1X5AA 1PKQE 5KVGL 4UTBL 3DROA 4PJHF 4U2YA 4XNYL 3CFIC 1MJ7L 3WEXB 2BCKA 1GGBL 3LKNA 3OR6B 3V6OE 3BEVA 5HTSA 1GGYA 3HMXL 5LQBH 1INEH 5I73B 5K59F 1WBXA 1I7RA 1XF5B 4IBLT 1DZBA 3P4MA 3OJMB 3RWCA 1RUML 3IJHB 3IGAA 2F8XC 5GRJH 2VRAA 4Z0BH 1U8QA 4GRWE 2OTWA 4EI6A 4Y19D 3AS0A 1WUNT 4G6JH 5C08E 3KXFB 4UV4H 4X5LA 1DUZB 1HWGB 3GJFA 4OM0L 5DJ8B 4P9HL 5F70A 3RY6C 5SWQB 4MD5B 3GMLB 3TVMA 4FMFA 4LCYB 5JW5A 1P7HL 4ODVL 4ODUA 4P0DA 1FDLL 1TJHH 2CK0H 4W6WB 5C0JA 1TVBB 5F7KC 1QKZH 2X4RA 1BHGA 4LLQA 4EUPG 5ACZB 4G6AC 1QRNA 5I8KH 3QP3A 2QQLL 3LS5L 3FQXB 5J11C 2E3VA 3VCLA 3DVIA 1FL6A 1S8DA 3WSQL 4OF8A 4LF3B 5KG9A 2O93L 4OZFA 1SJEB 5FDWB 5EU6D 4BQ6A 4NNPL 1UCTA 4FFWD 1R24B 2Z93B 3QDJE 1GZPA 5BVJB 5HYSB 4J4PD 3H3PL 4LEOA 1HSBA 4X6DE 2VN7A 2BOCB 1P1ZB 5I2IA 1I8KB 1Z0NA 2E6PA 4PJAE 3LKSA 2DLTA 5E00A 4KDVA 4MJ6B 4CW1A 1I8IA 3LVEA 4JLRA 4YZFF 4LEXL 3CK0L 2EEAA 3NIGF 3HC0A 3VI3E 2AXJA 3LY6A 3DOSA 1BVLA 4LMQE 3WJJC 3U48A 5C07A 3AXLB 5EC1A 1NC4A 3S9DB 2LU7A 5IW6B 3SE9H 3NPSB 5EU4A 4I3RH 5F93C 1JRHI 4WUUE 3T04D 1VENA 2PKDA 2PW2A 1Q94B 4PJ9C 3B6SA 5EOCL 3IT8D 3FO2A 1H8SA 2OK0L 1G7HA 1NJ9A 3B83A 3BDYH 3QDMB 3KPSB 4NFCA 4Z76B 1X44A 1Q72H 4Z7VB 2J8UB 2M8XA 3T0WA 2R1XA 1FFQA 3QIWC 4M93B 5IB2B 1K8IA 1NKOA 5E95B 3KPMA 3LQAL 3VRLE 1ZE3C 3CX5J 4WI2A 1CDBA 1MWAL 4HWZA 2KL6A 4YXLL 5MEND 5I30H 1N6VA 4A6YL 4XPBL 4CJ1A 2F54B 5HBBA 4H0GA 3BD4A 5C09E 1R24A 4LCIH 3RTQB 3FT4B 2Y5TB 4Q2ZA 2Q8BL 4LF3A 1NPUA 3QNZA 1YEFH 3E0GA 4NDMB 4M93C 1LO5A 1KF9B 2A74B 4BQ9A 3FT2A 4LPVA 4QHUB 1CFBA 1NL0L 2QTEA 4XCNA 3L3JB 2HJKA 1TVBA 1NGQH 1TDQA 3QWQB 1JWSB 1JHTA 1A21A 3P9LA 4MAYC 3GMNA 4RQQA 5HGGS 2R4SL 4PBWD 1Z2KA 1IKNC 4PJEA 1ZVSB 4OIBA 3HZMA 2B1AH 1EAJA 3BXNA 3I9GL 4YBQD 2APWA 3C09B 2HAZA 2NY7L 4Z7UF 1LO4L 1DUZA 3CH1A 4OBSA 4NJ9L 5JHLL 1NEZB 1H8OA 4Y19A 3MCLH 1CWVA 1I9IL 3BPOC 4Y5XC 4LLDB 4M43L 5JOFA 5J6GA 1AKJB 1J0IA 2CRYA 1YJDH 3MLWL 1U8MA 1DANT 4K7PH 4H1LB 3TNNB 2OZ4H 3QRFM 4IIQA 4RFOL 5DEFA 5HDLA 3RWGB 1I3RA 5E8NA 1VERA 5IEHA 4NGHH 3CLFL 3BKML 1CGXA 4M43H 4OZIA 2V9TA 1BM3L 5I17A 1GAFL 3SDCA 2ESVB 4MMXC 4XCYB 1KJ2A 3BFOA 1NCUA 5DD1H 1WT5A 2IQ9H 5GSVB 5E6ZA 4YHKH 1FO0A 4JKMA 1W72H 2VSCA 3D39E 3FO0H 1JBJA 2CGRH 2CDFA 2BVPA 5T1KA 5E4IA 1IBGH 2R9HD 3TO4A 5HVHB 1JPFB 1K3IA 2E6QA 1BGXH 1DEEB 1OGAA 2X4NB 4QOKB 3RNKA 4F2MB 4HZAA 4P48A 4QT5A 3H8NA 2AEPL 1OGTA 3NAAL 1TJGL 5HHXL 5I8OL 3BUYA 4X5WA 1X3DA 5C6TL 1G9ML 3RAJH 3MLTB 2F15A 2ID5A 3U82B 1OAXL 3I50H 3WHE0 3OKOB 4FXKA 1TQCB 2P8PB 1KJ2H 4GO6B 4AMKH 3P4OA 2IBBA 2R1YA 1OTTC 1LDPL 3B2UC 5F9WB 2PTVA 4KROD 1QBLL 4M6MH 3KJ6H 4OQTH 3TO2A 5H35B 4KROC 2Z91B 5I18H 3G08A 3O41A 3VFWB 5E8DH 1MHHA 5IEHB 1NBZB 4NN6C 4JFFA 1NANI 5F9OH 4GXVH 5AZ2L 3TBSA 3UDWC 1CLYL 4JO2H 1ONQA 4QYOB 4AH2A 1VKXB 3D39B 1N7ML 3C60A 3A6BH 5ALBL 2R29L 3MLVL 4NN7C 4PJ7B 2EC9U 1OM3H 3UTTE 5I18L 4KJQD 4M62H 3TH3T 1AFVH 2Y07H 3D85D 4U3HA 2XYCA 4U1JB 1TENA 3PDGA 4KZDL 1T7YA 5ESQA 1FJ1B 5C6WH 1A3LL 1F3DH 1CF8L 3EAKA 5KVDH 2M1KA 3O6FD 4KJQC 2VE6B 3QPQD 4P46A 4XPAL 4DQOL 2N56A 4JFZH 2R29H 4LU5H 3W9EA 2D03H 4Y4KC 3RWDA 4Y5VC 3LZFH 2RFXB 2Y06H 2I26N 2X1OA 2AABH 4AEIL 4XCNB 4MGXA 2VDRH 1H9VA 1OF2A 4OFYD 3T08A 1CF8H 3DUUB 1CCZA 1AKJD 5FUOL 3MLPA 1MJUH 2P8MB 4OLWH 5IQ9B 4ZOAA 4NFBA 1Q9LA 5DDHA 3MRKB 5D2NE 2FBOJ 3HNTH 1UWEL 4FZ8L 3CMGA 1VB9A 5CD3B 4JFDE 3QHFH 2Y6SD 4E41B 5C8JA 3DHJA 1ZKAA 2O61B 3WHXA 5CEZE 3F7RA 4KVNL 5IIEA 4DGVL 4R0LB 5CGMA 3PJSA 4UV7L 1BVKB 5I8KL 5TFSL 1PZ5B 1IEAB 5ILTH 4LSPH 5KAQF 5MHSD 2R0LH 1DE4A 2DB8A 2AJYL 2ED8A 2BSSA 4DTGH 1JYVA 2Y7QB 1NMBL 1VSCA 4LCCB 4JREC 4HS8L 1N4XH 4DN4H 1A2YB 2P46B 3EYQD 4YAQA 4PREA 1OVZA 4LOUD 3T77B 5T3ZE 3ZKNC 4ZFFA 4NHUB 2IFFL 4OT1L 4JM2C 4L8BA 4OZFG 5BS0D 1J8HD 3UBXA 5DSCB 5GRXG 3U4AA 4NRYB 4P49A 1OGAD 3ARSA 2VDLL 4H0IA 1O7SA 5CZVH 1C5DB 3HKFA 3WJLA 1AXTL 2GT9A 4RAUB 5ID0A 1FIGL 3LPGA 4JREB 4Z7UE 1FG2A 1G7LB 3DURB 4P2QA 3RWJA 2DIAA 1QLRA 4PJIA 1XCQA 4Y16A 1GGIH 5SWSE 2WIIA 4DAGL 2X44D 4M6AA 4AM0B 5IFAL 3O45A 5AAMA 5FK9B 4G9FD 4EXPX 2P5EB 3BDBA 2IAMA 2EDWA 2NY4B 3GO1L 3MUGA 4HXAL 4PRHB 3FRUB 3X3FL 5DJDB 2XNAA 4C83A 1I8LC 3NIDE 3FB5A 4BH8A 5M7QA 3QRGL 4RFNB 4LFHG 3GIVA 4KK6D 3QNZB 1RIHL 4YE4L 1CL7L 8FABB 5IQ7H 1FZKA 1PEZA 3Q5OA 2A0LC 5CS7A 2ICEA 4D0CB 4EI6B 2I5YH 2P8MA 2YMXL 1XGUA 3AU1B 1WFUA 3W39B 4HULB 1JF1B 4Z7UB 4ODBD 5L0QC 2E7LA 1AGCB 1MIEH 1PLGL 3DXAD 4OGXH 5FYKD 1FBIH 4IDLA 4D8PB 3ILPA 4TTGA 4GG6B 1EAPB 1ZHNB 1ZHKA 4JN1H 4M00A 4JM4H 4WU5A 3KPQB 5GGRA 4G8IA 3RDTA 3ULUL 1BF8A 5J3HD 1K2DB 5DJ6A 5C08D 3NA9H 5D6DC 4RRPG 1IARB 3V6FA 2AQ3A 2FJGB 3EDKA 5J13C 1T20A 3WE6B 2JJSC 5B8CA 1EUUA 4K94L 2AK1L 2MHAA 3KPRD 1JGUL 2ZOKB 1P9MA 4I3GA 4XNUL 4YDKL 5DWUL 4O2FB 3JTTB 3SKJH 3KPNB 5T1LB 2J3SA 2DQJH 3I6GB 1LEKA 4LSUH 4PG2C 4PG9A 2NXYB 5IG7B 1BD2E 3C8KB 4X6BA 3ZE2E 1YQVL 4O9HL 1IKFL 1G7IA 2ARJB 4JFDA 1PJ9A 2FWOB 3CSBA 4APQA 3I75A 2VDOL 5ID1A 5C9JA 3RL1A 1V3JA 3AB0C 5ISZB 3FAWA 1GVIA 1P4IL 2VO5A 3WKMH 1AQDA 1NCCL 3KYKL 4JPVL 3TYFB 5T3ZL 3SPVA 3N85H 3OZ9L 4JFYB 5DRNB 2AW2A 4QRUA 5CINH 4DFIA 4FQIL 4HJJL 3WD5H 1BGXL 2JCCE 3BHBA 1KEGH 2XZQL 3IXAB 5EU5B 2B1HL 2DQHL 4KI5C 1MLBB 3DMMD 3ZDYF 1ZEAL 2EDHA 4PG2A 1KXVC 4P4RB 1MFNA 5EZOH 5JDSA 2DI8A 4K2UH 4UAOB 5D7IB 1YYLH 4JRXD 1FO0L 4BA8A 2GSGA 3QH3A 1JGVH 5TF1H 5ETUB 3DECA 3CSGA 5EU6B 1BFVH 1XGRB 1MCDA 4A6YH 1LQSR 4UDUB 4WFFE 1I85C 2KQNA 2ADFL 4LCIL 1CFTB 3S4SB 4NJAH 3GSQA 4PJXA 2QKIB 3IDYC 3QBTB 2HRPH 3F7VB 4OLEA 1D6VL 4FQ2H 3W11C 4XP5H 2VLKE 4XTRD 4BJLA 2JIXA 1NFDA 5E8EB 5DJYB 4HUWA 2BFVH 4Y19B 5DMJB 3TH2T 4L8DA 3WIIH 3OJ2C 4Y2OA 5HVWA 2P7TA 4K3HA 5KSAA 4JY4A 2YOCA 1CLZL 3MRQA 4ZTPH 3QWOB 1ZVSA 5IB3A 4ZNCD 5F72S 4YK4B 3TN0B 1VGKB 4K8RD 2VL4A 1OB1B 1NANH 2BOBA 4LVOC 1D5XB 1F8TH 2QQNL 3WUZA 3MREB 1LGVA 1P4BH 4L3AA 3TLRA 4MQSB 4DVRH 2J2ZA 4PB9H 1CFVL 4QXTA 4TNWF 5C0BA 3KPPB 5IHLB 4AMKL 4HFUL 1KG0B 2QQKH 1F4AA 2DLEA 4QY8B 2WUBH 2P45B 2YD1A 5E9DE 5B21A 1WJ3A 4CAGA 1RUKH 5DK2A