1WVZA

Solution structure of the d2 domain of the fibroblast growth factor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
101
structure length
101
Chain Sequence
b'NNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibroblast growth factor receptor 2
publication title Solution Structure of the D2 Domain of the Fibroblast Growth Factor
rcsb
molecule tags Transferase
total genus 12
structure length 101
sequence length 101
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2004-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wvzA01
5GZOD 1Q8MA 1UXWB 4PJHB 3NH7H 4QKXB 4U1JA 3RWFB 2V5TA 2YD7A 5EUOF 4QY8A 4ZXBC 4KK5D 2XZZA 3NVQA 1GYAA 3QAZC 4LF3B 6FABH 1CDCA 5DD0H 4PRHD 3CVIH 3V79C 4MA3A 1E6OH 4MJ6B 3GSQB 1MRCL 1RMFL 3H7BB 4R4BB 3JWDH 4IEFB 3MR9B 4MX7A 5C07A 3LD8B 4G6KH 1L0QA 1PVHA 3O2DA 4RWYH 4G6AD 2PW1B 4YDLC 2JJSC 3LKQA 3PHQA 4XTRD 3CFIC 1YNLH 4XNYH 5HHMB 3MROA 2EKJA 1FFNB 2EIZA 2J8OA 4JFQB 5KSAC 4R97B 3AS2A 3AY4A 1BBDL 3WDHA 1RZKL 3RFZC 2CGRH 2P24A 3KYMA 3MLVL 3LEYL 5ALBH 2YC1A 4BH8A 1N2RB 4X6EA 8FABB 3TCLB 5ADPL 4HIXL 3EW3B 4PV8B 3O4LD 4Y1AB 4EUPA 4RMWA 3V0AC 3IDNB 3OAYK 4A6YA 4PLKC 4I18A 4RAUB 3MRPA 5HD8D 4NQTA 4TN9A 4S1DD 4OI8A 2OZ4A 2AKRA 1JHTA 3Q5TA 1G0YR 1RJLB 4NKIL 4Z7NE 2FX8H 4HKXA 4N8PA 1CG9B 3LV3A 3MCG1 1YY9C 1M6OB 2J3SA 1S9VB 1UA6L 3DARA 5E0QA 2HRLA 1NGZA 4X5WB 2FB4H 3U83A 2X4QB 3LEXB 2HT3C 3X3GL 4QTHA 4NO0B 3MOBL 4GG8B 1PFCA 2ZUQB 3EYOA 2Z31C 1MWAA 5DRZA 3PWNB 1VFBB 1WEJL 4TSBL 1WAAE 1AD0A 2DQEH 3BRDA 4YHIB 1IL1B 4HLZG 4JM2A 1VEMA 4MAYD 3B9KB 3L1OH 1RULL 2APBA 4MNQE 5EU5A 3R8BB 5CJQL 4F8QA 4WFHE 5DD5L 5L9DH 3MLRH 4J3WA 5ITBL 4IOFD 4Y5YA 1U95A 1LP9A 1A6WL 4PRDB 1CIDA 3V5DB 1A4KA 1FL6A 4CGTA 15C8H 4JZNB 5DUPL 4ZFOA 5BRZA 3WFEH 5EIQA 2AJUL 2A6JA 1NEZB 3NIFF 2VUYA 5IQ9A 1B0WA 3VI4F 1DQLL 4OB5H 2Z4QA 2J5LC 3HE6B 2R0LL 2VDKL 1CR9L 2J8UA 3W39B 2CK0L 4Y19B 3CSYB 4M8QA 4G8IA 1HHKB 2EDQA 5EU7C 4JHZA 1K6QL 5HHXL 1NCCL 2YRLA 1NDGB 3QUMB 2VDNL 1OWWA 1U3HC 3UTQA 2WIIA 4Z7UE 3RIFK 3PXHA 5TDNB 1LHZA 5DQJA 3D25B 4HJ0C 3U4EA 2F54A 4PJAA 1IGTA 3EYSH 3PWUB 1WQVT 4DGIL 2R4SL 4LNRB 4LSTH 5I74C 1AXIB 4P2OC 1NLDH 1VPOH 4HDIB 3QFDA 5DR5H 4KVCH 1M7DA 1IE5A 1KENL 3IFLL 5EFIB 3VXTB 4ZFFB 3UPCA 3RZCA 2B4CH 4URTB 4Y5XB 4ELKB 1G7MB 1KTDB 5MEQB 3ZTNL 3D3VA 4NP4H 3WS6C 1G7JB 3OR6B 4MNGE 2VISB 1D9KC 3CXDL 4WW2B 5HDQH 4NT6A 4S1SL 3DLQR 5T33H 3RX8A 4Z5RB 1FZMA 4PJBE 1T89C 4PR5A 1G9EA 1RK0B 4FABL 4MSWA 1RZJC 1KELL 4QXUL 3ZE2F 3QUYA 1CGVA 4U7SA 3E3QC 3MTRA 2NY1D 1U8IA 4IOIA 5B3NA 2BVPB 2R1YA 2R29L 3RUGA 4OTXL 2EH7L 4YDKH 5GGSB 2D0FA 2NY7L 2CJUH 2UY6A 5LVEA 1CF8L 3P9MB 4DKAA 3MLPA 5C1MB 3FFCA 2W0PA 3PP4H 3LB6D 4RGOL 3HI5L 5K59F 4CMMA 2E6JA 1V05A 3ULUE 3BZFB 4N68A 4JO3H 3H7LA 3D0LB 4R96A 4QHKI 2C3GA 1I8IB 1Y18A 4ZQKB 4OIIH 5F96L 3O3EB 1E4KC 1ED3B 2Q8BH 5F1NA 3QPQC 2BVTA 5I1DA 3H42H 1CD8A 1HHGA 4MXWL 3DRTB 3Q6FB 1BAFL 4YAQA 5EBLB 3O41B 3MRKB 5B38G 1D5BA 5CIPB 3NAAL 3BKCL 3HAEA 4MXVE 1OOAA 2P8PB 3FQTA 4ZUUB 1YY8B 3MRRA 4MCYA 4XVUC 5I76B 2CDEB 4KK8D 2OP4H 3BD3A 2GJ6E 2YSSB 1MCPH 3MFFB 4XNMB 5DQDH 1RJZB 4XPBH 2EDWA 3VXUE 4XNUH 3ZKNC 3BP7A 4YHKH 4TNVF 4LSPL 3L3DB 1HKLH 5F1IA 1Q38A 3WNMA 3QIBB 2GTZA 5IF0B 1T1WB 5I15H 2PO6A 3TFKD 1NBYB 1KJVA 2W0KA 4HCRH 5ELIA 5HHPB 1INQB 3TVMB 3U7AA 4YBLC 4GRLC 1K85A 1LEKB 3FO2A 3S35H 4OLZH 3U6RA 3CLFH 5IB1B 3D69A 5IW6A 3OX8A 1EHNA 1WLHA 5F71A 3REVA 1FC1A 3HC4H 3VFWB 1AGBA 2X41A 4NZUL 4OUUB 1N7MH 4A2LA 1LEIA 2CDGB 1QOKA 2XFXA 5H2BA 5C86A 3RZCD 1FIGL 4K94C 3B5GA 3D3VD 5MEPA 1ES0A 32C2A 3VXMB 3DETC 3SKNB 1NSNH 4KZEL 4HZLA 3ARBC 5IT2L 3WJLC 1RD6A 4CADA 3IJHA 4LLQB 4ISVA 3QDGB 1CN4A 1OW0C 2OTWA 3WFZA 1N6VA 3HG1A 3EDDA 3DURB 1OAQL 3HMXA 4JN1L 3RVWD 2VLJB 5DK0A 3V6BR 4LDLB 3FO9B 5J6GA 4HH8A 1ZSDA 3TJHD 4DQOH 3LVEA 3ULUH 3D39A 4XP1L 1UGNA 2NY5L 1LO0L 1GC1L 3RPIA 5FO8B 5I1IL 3DYMA 5EZOL 2WQ8A 2COQA 1YEKH 4KHTH 2APTA 3FFCD 3TT1H 4BZYA 2AXGA 4L3EA 4KKBC 5DJ0B 2ERJB 1BX2B 5FYJE 2PETA 2B5IB 1DUYA 1PY4A 3MRJB 3HNSH 4WDIB 2ZUSA 2HVKB 1QFUL 5HHOE 2E5EA 4JJ5B 4NQVA 1ADQL 1H5BA 5DC4B 3LKRA 1M05A 3IKKA 3QJHB 4PRIE 3QCTH 1GIGH 1HOCB 1DQDH 2I9LB 1W0YT 3DVGB 3GGWB 3LQAH 4HMDA 5F7UA 4OKVA 4OGAC 2P1YA 1EMTH 4IM8A 1EEZB 3C9NA 1NFDA 1FQ9C 1K4CA 3CH1B 3UJIL 4LCIH 3S36H 1BEYH 1SJXA 2PKDA 4PJ8B 4X6DF 1LD9B 5D1ZC 4L8BB 3SDAA 2R2EA 3QQ3B 1DANU 3T09A 1WBXA 3BH8A 1QNZL 1S7QB 4PRHE 5DJAA 3Q1SH 4X5XA 4WEMB 3AXLA 3P73A 3OGCA 3KYOA 2X89A 4Z9KB 4WU5B 5A16A 1KNOA 3DV4B 4EIZC 1MHPL 2IAMA 3CFJB 3T2NL 4FQXA 4HGKC 4K3HA 2VLKB 3HI1B 1ZEAH 4NNXB 5T3XD 1KG0A 4HEPG 1CE6A 2LAGB 4D3CH 1S9XA 1RIHH 3HUJB 2E7LA 2X4TA 5EIIB 1SJHB 5B8CA 4AM0B 4YQXH 3BDYL 1VADB 4LRNH 2UUDH 3SY0B 1T20A 2EEAA 2D4DA 4P5KB 2A9NH 4YHLL 1U8KB 4U1SB 5F9OH 4TTDC 4KRLB 3I50L 3QB7C 4F7TA 1INDH 1Q1JH 4R97C 1VKXA 1M4KA 2R0ZH 5TQ2L 4Y2DA 1L6ZA 3EBAA 1HK6A 3RTQA 4BM7A 1N5AA 3DXAE 1FJ1B 3MGTB 3O4LE 3F7VA 1KEMH 4TOYL 4HS8H 5DGRA 2ICWA 2DQHH 1OCWL 3S6CA 2FECL 2JIXB 1QBML 3T0XA 5TH2B 1KOAA 5FYJH 4ZMAT 4FXGB 2V5YA 5JW5B 2ADFH 1QO3B 1IEHA 5DDHB 3MRLA 3D39D 2F8VA 3QULB 4ZS6C 1B3JA 5DJDB 3RBSA 2VXQL 2PW2A 4XNZB 1G9NL 4XHQA 2FH8A 5FECA 4L3ED 1U0QA 5FYKL 1JPTL 2Y5TA 1I3RB 2YN5A 3S9DB 3VGHA 2FJGA 1EGJA 3DROB 3QPXL 1AE6L 1BGXL 4YPGB 1YYLH 3C8HA 2X5PA 1T0MA 5HYEA 3MV8B 4F3FB 4RAHA 3TNMB 3MXVL 2A77H 3MGAA 3RU8L 1QVOB 4AL8H 1CVSC 2YPVH 3SHSA 2ESVA 1MCNA 3BVNA 2YRZA 4K7PY 5FB8B 1PKQB 2EDRA 1MIML 2B0SL 4S2SB 5I30H 3CVHA 3CUPB 2DM2A 4H1LA 4P9HL 2VRAA 1NBVH 2GYSA 1TJHL 4PRAA 5TDOB 3B9KC 4M62L 2EIDA 4OZFH 4B5EA 2NQCA 4J1UB 3L3KA 3CFKA 3OBAA 3MLZL 5J7CC 3QCUL 3SDAD 2SEBB 4MCZB 4MQSB 1CZ8H 5TPWL 4U05A 1CXKA 4XX1E 1F45A 4QCIA 4M6OL 2VABA 3B2UC 3ZTJG 2AK4B 3CFCL 3BKYH 3OKNB 4I9WD 4Z8FH 5FHBL 1G7IB 1NCDL 4RFEB 3TBWB 3IETB 4BK4A 4NOFA 3G5VA 1JK8B 3A6CH 2ZUVA 1A6VH 1K8IA 1P9MA 1U8MA 3JV0A 1BZ7A 5E6YA 3QT2A 4HUKB 3KAAA 4RMTA 2IAMD 4NFBA 4BZ1L 4G9FE 4D0BB 4JFYA 3OKMA 1NCUA 1IAOB 3KJ6L 1DQTA 1MAMH 2GJZA 2HVJB 4P5TA 1G7PB 4OCWL 2GJJA 4OCXL 3TO2A 1X5XA 3RDTD 2V2XB 2C4FT 3RIAK 1EUUA 1PQZA 3QG7H 4OF8A 4HWBL 2D7PA 4FFVD 1ZGLP 1IGIL 3GKWL 4N0FA 5TFSL 1E27B 1NC2A 4N5EC 4FFZL 5FGRA 4AT6A 2X09A 5CJBA 1A1MB 4GW5B 4RFNB 4Y2DD 2GY5A 3O0RL 4NUGL 5D7IB 4P2RB 3O8XA 5KVFH 1MJ8L 4W4NA 4DW2H 4KDVA 5IEHB 1Z5LB 3NBNA 2ZUWA 4LPUA 4Y5XC 4JG1H 4QRSA 1S78D 3KLHC 4LBEB 1MEXL 5C0BA 4LSQH 2H32A 1EZVX 2VDPH 4M61B 4WW2C 5GGVY 3LHPL 3BPNC 1KT2A 3MYJB 3VD4A 3VXUA 3RVUC 1NMBH 1ETZB 2MNUA 3ZDZE 2I60H 1AY1H 5CUSH 2VN7A 1J1PL 2AJ3B 4HGWB 5FO9B 1X5FA 4Q6YA 1K5NA 4WO4A 3KLAA 4QRRB 2QV2A 4KMTL 2EKSA 5MHSD 2V9QA 2WBJB 3OV6A 5EWIH 1CLCA 1ZVHA 1VFOA 4XVSH 4MNGB 2CIKA 3Q2CA 1TVHB 4M43L 2ED8A 4QRPB 4DOHE 5E6ZA 2Z8WC 5J11B 3WHE0 5DK2B 5C0GA 2X7LA 5INCA 2DM4A 2ESVD 1BVKB 5CILH 2KZWA 1D5ZB 3K81A 3BEWB 4KJPC 1ZTXL 1MIEL 2E8YA 1NMAH 2EDJA 5DHYB 1WBYB 4U0RB 4YGAB 2O61A 4L9LB 4X6BB 2XWTA 2APVA 1H8NA 2P44B 3MJ8B 1IGJA 2NY0C 1TMCB 1I1RA 1A7BA 4G6JL 1IEAA 3NABL 1MHCB 1A7QL 1KYOJ 2I07A 3VFGH 1ITCA 4PJEE 1RJCA 4LIQL 1IGML 2Z93A 4AIZB 1U8PB 5T5FL 3X13B 1KCVH 4BH7B 4QOKB 1KPRA 2I24N 4BQ8A 2A73A 1I9IL 3OXRA 1BZ9B 4RIRB 4P2YA 1JHKH 4KDWA 1M71A 3MPCA 1KC5H 4N0UE 3T0EB 4JQVA 3O2WH 3E8UH 3MUJA 4P5TD 3TO4B 3ROOB 4HKJB 2EEBA 5DUMH 3QIBC 1U8QA 4NUJB 1RZIA 1BFOA 1Z2KA 4XCEB 4LLDA 3RQ3A 5I2IA 2WAHA 1ODAA 3E0GA 5AZ2H 5HDLA 2VZVA 4MMZC 4NRXA 1A6TB 1U3YA 3HZVA 1BBJB 1NC2D 2AJVL 4XCYA 4YDVB 4LLAA 3S96A 5GGTL 4EUPH 3GSNH 3OKOA 1JCKA 4A6YH 2GJ6B 4KHXL 4RZCB 1CD9B 3D3VE 4JVUA 2NY6D 2OZ4H 3O8XD 4ERSL 5KAQG 4LSVH 4ZFZA 4X4YA 1NCWH 4G42A 3WFHB 2HRPL 5I66B 5J56B 5JIIA 4PY8I 4G6MH 3W5MA 2D9QB 2E9IA 1J87A 4KQ4L 2YWZA 3EDJA 1B0RB 5J12C 4WI2A 1JWSA 3IFPA 1OGAA 3DUHA 3VXUD 5J1AA 5FYKU 4N8VA 1G9MH 4AMKL 4BKLB 2E9JA 5KN5A 5B3JF 4I77H 4KMLB 1I3GL 4TUKH 2XTJD 5F44A 3N9GL 4EVNB 1PZUB 2D0GA 3BUYA 3L3HB 1OP3H 2FZ3B 3QYCA 4NFCA 1MCWW 4G43A 2YZ1A 1R3IL 1MWAH 5JPNB 4R0LB 2JELH 3SKOB 4MD0B 4WO4D 5DF0A 2FBJH 3FFCE 5CWSA 4O58H 4X7SH 4EDWH 3PIQB 3QQ9D 2FIKB 1MJUL 5E9DA 5D2LF 4PJ5B 3C60D 1U6AL 4TUOB 2XRAL 2B1AL 4FQ1H 1EDQA 2ERJC 1A3RH 5D7JB 3WLWD 3BAEL 4PJCF 4JO2L 3U1SH 5IJKA 1AR2A 4H5SA 1LDPL 3VD7A 2YUVA 4PTTA 3LSOB 5DLMH 4LFHG 5E5MA 1OB1B 1CGSL 1CDIA 5GJTL 2C3VA 2FL5B 3MRFB 3ZSSA 4XHJD 1JN6B 2X4PB 2ZG1A 1G1CA 4E5XA 3O6ML 1NLBL 1RVFH 4OIBA 5C7XH 4FN0A 4Y4HB 1A0QH 4PJ8C 4LASH 4BSWB 5HHVL 3VXSB 1KXTB 3M17B 1L9NA 4B0MM 4NCC2 5HHOB 5TE4L 5E56A 5D72L 2DLGA 5F7DA 4L3CA 3PHSA 3QIUA 4PRIB 2AS5M 1WC7B 2E9WA 3C5ZA 5C6TL 3AVEA 3VXOB 4LVOB 1AQDA 5T3XE 3F6IA 1V3JA 1YZZA 5GRVK 1TCRB 2CDFA 2AV7B 1IC7H 3DUUB 2VKWA 1TQCC 2LVCA 1CL7H 4PJGA 5SV4A 1O0VA 5ID0A 2ZKHH 4M1GH 4YO0B 1HCVA 4NQCB 4EQ2A 3O2VH 4B50A 2WINB 1DCLA 1AR1C 2GI7A 1S7VB 3RL2A 4U0QB 1RUML 4IRZH 5E8NB 2AEQH 1JGVL 2XXCB 4Y5VA 5GS1B 5CFHA 3HCVB 1NGYB 3MLSH 4R26L 1SM3L 3BQUB 2X6MA 4OF0A 5BZWB 4CMHB 4NN7C 1RUAH 1UG9A 2R9HC 1R0AH 4LCCA 3WN5B 3ULVD 4HWZA 3FQRB 1V7NH 2MHAB 4XP4H 4TUJB 4DCQA 1WZKA 4LSSH 3GMMA 3D39E 4FQQA 4XCCL 2QQLL 3B9AA 3VWKA 2QQNH 4GLRH 2D7TH 4XP9H 3KR3H 4ZD3H 5LQBL 4QT5A 4YHMH 1NGWA 4BUGA 4L3EE 1D3CA 1BOGB 2R69L 4OT1H 5D9SA 1A4JA 5E9DD 1WGOA 1OPGL 1RIVH 4XNZC 2C1OB 4QHNB 4UIMA 3SDXE 4PJIA 4MNHB 5DA0B 3HPJA 5IMMB 3ZYJA 3WL9B 2M2DA 4U6VL 5CGYC 3MNZB 2DQIH 5K9KB 2HH0H 3HAEH 2WWKT 1N8ZA 4XP6L 2VLLB 2F5AL 4PJXA 2B4CC 5A3ID 5KJRH 4OV5B 5DJYA 4AK1A 3OKEA 5GSVB 3FRPG 4AENB 3MQIA 1F6FB 3BP5B 3L7FB 4NHUA 1KCKA 1FBIL 3BJLA 1AHWA 4M48H 4C54A 3MUGA 1MREH 3FFDB 1JE6A 1TJIL 3WUWG 3QXWA 4UOW1 1KUMA 4YUEL 1D5IL 4I9WE 2AQ3A 4QXWA 4K3GA 1PG7X 1UADC 5F88B 5T3XH 3VDBA 4LOUD 2XXMB 2OL3A 4HV8A 1JZ8A 4MAYB 3HA0A 4GG6A 1S7SB 2WQRA 1EJOH 2W07A 5IHZB 3DJ9A 3WJJA 5C0FB 1ERNA 1FO0L 3STBA 1S7TA 2CIIA 5EU3A 1CXLA 5E95B 5B39B 3QXDA 3WHXB 4N1EA 1YMHA 2DMKA 1H0DA 2X4NA 3IYLW 5JMRA 1C5DA 4GSDL 2V7NA 4QY8B 5LGHL 1BZQK 4YZFF 4PJHF 1W72L 4HWNA 3PWLB 5IBUB 4UOJA 2ICWJ 3HMXH 5IFAH 1QBLL 3W11D 2HKHL 3QIWC 4EEEA 3L3GA 4FTVA 4NKMA 5FHAH 3GBNH 3B2VH 1AXSA 1E4XH 3PWPD 2FEDC 1XGYL 2FJHA 1UWXK 4GLRI 4MX7B 4NGHH 5C07B 1N5YL 4N5UA 4OGXL 1MRFH 1UEMA 1DBJL 4JKMA 2WBKA 1ZOXA 4EBQH 3EJZC 3HI6L 1NC4B 1WFUA 4PLNC 3BEVA 5K9OB 1YDPA 4U7KA 3NIDE 3GMLA 3ARDC 1KULA 1ZT1A 2H45A 3O6FA 3OKDA 4PUBL 3H8NA 4X99A 3HN3A 5EOCJ 4LHUA 5MHSE 1FHGA 12E8H 2XICA 1DLHB 4RFOL 2P24B 4UINL 4LP5A 2YC1B 1J18A 4KTYA 3QUKA 4JO1L 2ICCA 5L2KD 5GS3A 2R0WH 1JZ5A 4HD9A 5I19H 2YKLH 4KTEL 4EUPB 3L9RA 3D0VA 4CVZB 5AUMA 2YD1A 3MRPB 2ESVE 4M7KH 5JW4R 4F57L 3QNYA 1HHHA 5CJOL 4LLWA 3IDGA 2AKRB 2A83A 2GKIA 1JHTB 3X11A 4X4ME 5D6DA 5J11C 3P3YA 4N0CD 4UTBL 5JW4N 5ANMB 1FIEA 2AEPL 2F53B 5I16A 4ZUVA 1KIQA 1UM6H 3VGAB 1NAMA 2CSPA 3PGCA 5ICXA 4L9LC 1LO3H 1G0DA 3BZDA 5HYSA 3L5WA 1HSAA 2RBLA 3MRBA 3OWEA 4MJIA 5IB3A 2FHBA 3DX7A 3KPRA 4QTHB 3HB3D 3FB8B 3AROA 1GZQA 1IC5H 3SE8H 4HFWA 3EYOB 1MWAB 5DRZB 4HKZA 5IB5B 1AD0B 1A02N 5LWYL 4JM2B 4Y7MA 1FRGL 5LG1A 3V7AE 1Z9MA 3K1KC 3ULUC 4MLSA 3OXSA 3G5XA 4I0PA 3TV3H 4X5LA 4WUKL 3STZB 4OZFG 3C5SB 2IH3B 3GNMH 4Y5YB 1CWVA 1LP9B 1U95B 2FGWH 3SDDA 1A1NB 4MQ7A 2PCPB 3QRFM 1A4KB 1AGCA 1FL6B 1PX4A 1TFHA 1RUQL 1WWBX 1TPXB 5DFWH 4K7PH 4ZFOB 2KDGA 3TO4C 5BRZB 3H9SD 1N64H 1T2QL 3TYFA 1IGYA 4Z7WA 1MRDL 5IQ9B 4XMKL 1SYVA 5TGBA 4QGYA 1JPFA 1KB5L 4OZHB 4Z77A 3K4ZA 1IAKA 43C9B 3MCLL 3OKLB 4LRIA 2J8UB 3SOBH 4K55A 3LQAC 3OJDA 1OARH 4M8QB 4TPRL 4G8IB 4LGPB 5DMGD 1HHJB 3FT3A 2P42B 4JG0L 3UTQB 2WIIB 4LMQI 3MRCB 5TF0A 5BMFH 2BRQA 4AQOA 4O00A 3ARGA 1ZANL 3UP1A 5DQJB 2NY4B 1HQ4A 3U4EB 5FDYA 2F54B 4PJAB 3RVXC 1IGTB 1FYTD 4D0DA 2BVYA 3TNNA 2DTMH 1EGJH 4H0IA 4PS4H 1WISA 2YD3A 2IBGA 3W2DH 3QFDB 4NKOA 4X6CE 3O6FD 1ZE3C 2CPCA 1HINH 2XY1A 5D6CA 3RZCB 3U82B 1T5WA 1KIPB 2WM0A 5DQ9B 5EOCH 5EC1A 3SE9L 4K8RD 4XXCC 4KAQH 2H8PA 4NT6B 4H1LH 5FUOH 2NXZB 1YN7A 3SO3C 4HG4J 3IGAA 4PR5B 4POZD 1YPZA 1R3KA 4MSWB 4HT1L 4WW2F 4G8GA 3QA3B 3UO1H 3EO9L 4JDZB 1BFVH 1LO4L 3QUYB 4GBXC 3I6KA 4OZGE 1NAKH 1U8IB 4KVNL 2R1YB 1PDKA 2ZNXA 4FQJL 5D7JC 3RUGB 5FGBA 3F58H 3TWCH 3CMOL 1FGVH 1CFQA 5DD3H 5DT1H 2CO7B 5C0IA 4CU8A 5D71H 1QYGH 4XCFL 3QRGL 5DZNA 2VQ1A 5GGVH 5EBWB 4K9EL 1RIUL 4Q2ZB 4MJID 5CZVH 1J5OH 4HGMA 3FQXA 3FO0H 3KPRD 1HKFA 5C3LD 5GRUH 4F37F 1KN2H 2DJUA 4C56A 5LKNA 2Y23A 2G5RA 1XIWA 3U9UA 1XF5A 4JY6A 1QBBA 1Y18B 3KXFB 4Y4HC 5E08H 3RY6C 4XX1G 4I0PD 5IEKB 5F1NB 4JHWH 1KLFA 3UTSB 1ZHNB 3HZYA 4XPTL 5I1DB 1RHFA 3SDDD 1O7SA 4F7MA 2ICWI 4ZFGH 5DRXA 5C3TA 1IT9L 1HHGB 2ATKB 3CLEH 1LK3L 1P53A 4OJFL 4O9HH 5JXEC 4YAQB 4ZUSA 1D5BB 4LVOC 3HAEB 4Q9QL 3FQTB 3GUTA 1DE4A 4FG6D 4MCYB 4K2UL 5GS0D 1ULVA 2H32H 4WHYG 1I1FA 5GZOC 4NBZB 4NJ9L 4H20H 2DYPD 3VG0L 4L4TD 4E0RA 4KK5C 2FATH 4D2NA 4UILH 2NY3B 5F1IB 4TVPL 3QWQB 2JCCA 4DAGL 3OPZL 2W92A 4F9PC 2PO6B 2LU7A 1KJVB 1ZLSL 4B41A 1S9YA 5DEZA 5HYQA 4OQTL 5EU6D 5GGRB 3ARGD 4FNLL 3FO2B 3U6RB 1FFOA 5GS1C 4ORGA 3ULVE 2ZUYA 4OV6F 3D69B 4I13B 5IW6B 3OX8B 4UV7L 1I9RL 3BQUC 1XCQB 3REVB 1HYSD 3QFJD 2G5BA 1AGBB 4G6AC 4J7RA 4YWGL 3SPVA 2DM3A 3MLUL 4CVUA 1P5VA 3WIHL 1ZLUK 4WCYH 5HXMA 4XTRC 4CRPA 1S8DA 4W6YB 1EIBA 1MCLA 3ARFA 2XFXB 5H2BB 2VXUH 5ACLA 2DWEA 5MEPB 32C2B 3U4AA 3UJTH 3I84A 4QTIL 4Y16B 2IQ9L 4HZLB 3ELAT 5E9DE 4OM1H 5I75B 5IB4A 3QEGH 5T3ZD 1N3NB 4ISVB 3TH3T 2OTWB 1VERA 3VE0A 1QKZH 4PJDA 3VFVB 3HG1B 5I8KH 4IMLB 5C09D 5LGJB 3ZHKA 4W6WB 4Z95H 3OAUH 5DK0B 1UZ6E 4GMTH 4DN4L 2HKFL 2W9EL 5FAAA 4YPJA 5E4IA 4LDEB 5J6GB 5E1AA 3EGSA 3QEHA 2Q20A 3KNBA 5HD8C 3WKML 5C0DB 1TZGL 1RJYA 2BSED 2X4UA 4S1DC 1QLEH 3D39B 1MRCH 1RMFH 1MCEA 2OLDA 5C0JA 5MI0C 1KEGL 3ZLQC 3WDIA 1MCQA 5JDJA 2AXGB 1TTFA 4PGBA 1ACZA 1DUYB 3UDWC 4BK5A 4M00A 3X12A 1CFTB 3GJFK 4M5ZH 3HMWL 1JYNA 3HZKA 2NXYD 1F6AA 1OLZA 1H5BB 4TSCL 3LKRB 1M05B 1KXVC 1X4XA 1KCSL 2D3VA 3FKUS 5MEOA 1AKJD 4OD3H 1QRKA 5CBAA 1P1ZA 3LEYH 1CD0A 3C9NB 4WW1A 3TLRA 4MAYC 1NFDB 5B22A 3QEQA 2UWEE 1JVKA 4NSKA 1PW3A 3F5WA 3VD9A 1CFSB 4X0KB 3VXNA 3B6SA 5DD1L 5FV1L 2R2EB 3AU1A 3N1FC 3EYQD 1WBXB 4WI7A 3DYPA 3BH8B 4WHTA 2B2XL 4Y4KA 3P0GB 1G6RL 4FZ8L 3P4OB 1JFQL 4XGZA 1AXTH 3NOIA 1BQUA 1HILA 3AXLB 3VMOA 3BHBA 3P73B 5A2KH 4NQDA 3ULVH 1DBAL 3OGCB 3S5LG 3KYOB 2RCSL 3AS1A 3PWPE 3OR7A 1OT2A 2VAAB 3QHZH 1ZLWH 1JRHH 4FQXB 4M1CD 5I1CL 5JNYB 3JTSA 4JFDA 5GRZA 3T3PF 1LE5A 2J88L 2Y1VA 4XC1H 1KG0B 1CE6B 1S9XB 3BD5A 2WNGA 1DTUA 2XQBL 3X3GH 2YEZA 4ODHL 5EPMA 1UYWH 2X4RA 5B8CB 1F3JA 5F7EH 5I8OH 1Z9LA 4NDMA 1DVFD 2KQNA 4YXHH 4TSBH 4ZOEA 3HUJF 1XR9A 2BOCA 1T20B 1QHPA 4NOBA 2UY7A 3EJYD 3ARFD 2LTQB 3OKKA 5BO1H 1RULH 3DSFL 4UUJA 3KHQA 5CJQH 1JV5B 4F7TB 4QWWD 1F13A 2VDLH 2DQJH 4Y2DB 5ITBH 1KLUA 2R39A 4IJ3B 3AY4C 3UPRA 2OMNA 4DKFL 3RTQB 4DVRL 3QNZA 3VFTA 5L2KE 1ORSA 1N5AB 4PJIE 5DUPH 4XP5L 2HFTA 2BVUA 2AJUH 5C0RH 5FF6A 1BVZA 2ICWB 1UWGH 2HWZH 3HKFA 1F4YL 1NGPH 2R0LH 2FJFA 2VDKH 3BI9X 4PJXE 3VW3H 2BXYA 2NW3A 4I18C 5EG6C 3CDCA 1UM5L 3UZVB 5AAWA 5CEZH 1BLNA 2Q3ZA 3MRLB 2UZXB 4PRNB 1CXHA 5HHNB 5JUEL 4PGEA 4Q0XL 2NY1C 4MQTB 1WJ3A 5DJ6A 4WWKB 4MWFB 3K4AA 4XRCB 5GHWL 5FECB 2Y5TB 4PGZA 1N0XL 4ZS7H 3EKCA 3QUZA 1MJJA 1KJ2A 3ZT6A 1K3IA 4HUMB 4KQ3L 5CZKA 1A7RL 1D5MA 1T0MB 1G9MC 2EDEA 4JANA 1VGEL 2NZ9D 1IM9B 2LQRA 2VQUA 3FN9A 1KENH 5FA4A 3BVNB 4GG6E 4MB3A 5F7YC 3CVHB 3V6FA 2DMCA 4GRWE 5D96C 4JM2C 3BUTA 4PRAB 2EYSB 2D0HA 3TN0D 3G6JB 1FZKB 3BZ4A 3QEQD 3CFKB 5KANI 3CXDH 3O11B 3EO0A 4S1SH 1FNFA 3F7YA 3A0OA 3BKMH 3M07A 3PJSA 4UT6L 5E99L 1QRNB 3S88H 3OJVC 1NMCC 4FABH 4ODUA 3H9SE 4M5YL 5F6HJ 4Y5YC 1Z3GL 5IQ7L 1TZHA 1JRHI 4QXUH 1A1OA 1RZFL 2VABB 1TPXC 4Y4KD 3MRIA 1TCMA 3MACL 4UT9H 1J0HA 3CCHB 5DJXA 4M7LL 2A9ML 1MFNA 1U8MB 4KK8C 2EH7H 1MNUL 1NBQA 3NPSB 1BZ7B 3X3FH 5KVGH 1P7QA 1CF8H 4HFUL 3OKMB 1WAAF 4MJ4A 3DGGB 1EAPA 4PY7A 1XF1A 1VDGA 2GJZB 4ONHA 2X9XA 3TO2B 2DQUH 2QBWA 2FO4A 4R3SA 1A3LH 5J6HB 1GZPA 1FYTE 2RHEA 3LRSA 1JF5A 3BGFB 3GJEB 3IFNL 4JFFA 4WVRA 4YFEA 1PQZB 3MV9B 5BS0A 4Z7VA 43CAA 3QH3A 4XXDA 1VEOA 2NY4C 4N0FB 3DVNA 5F96H 5IGXL 4GXVH 3BESR 3GKZA 1I1AB 4M9PA 1OW0A 2DLEA 1I4FA 3C8KA 5HPOA 4YHOH 4IRJD 1FO0B 3RZCC 4P57A 1FNLA 3MODH 3UTTD 5D7IF 3OL2A 2ICEA 5C0BB 2CKBL 3Q0HA 2VDOH 3VGFA 2EDOA 4JPVL 3NA4A 4JHAH 5JPMB 1U8OA 1P4IL 2H3NA 4GKOA 2HFFA 4Z7UF 2VDQL 1V3KA 2XTJB 2FR4A 2ZUTA 2E7BA 5DC9B 3QUYC 1AI1H 4V1DA 4LSPH 1G7HB 3KPLB 3K4DA 5A2FA 3HC3H 4I2XE 1K5NB 3KLAB 3GSWB 2EKSB 1Y0LA 3O6LL 4Z0BH 3TJHC 4MJIE 5I1EL 4LCYA 5DUBA 1DL7L 3B9VA 1V7ML 3SKJL 1C1EL 2CIKB 3MRGA 1ONQA 4GRWH 5I18L 1EEQA 2JB6B 3S3JA 5C0GB 2X7LB 1HIML 5INCB 2VIRA 4PJBF 5F1OB 4QHMB 5DYOA 4KI1A 1OP5K 1DQML 1ZT4B 3WD5H 2H2PC 1LWRA 3IU3A 1QSFA 1C7SA 4X83A 4I0KA 2BSRA 1IGJB 3P11H 1CDYA 1EPFA 1IEAB 4YE4H 1J12A 3J8F7 1LNUB 3SDYL 4WUUB 4U6XA 4JFEA 1OAQH 3AAZA 2BX5A 3D48R 4KUZL 5AG8A 4UIKL 1V8HA 1ZS8A 3FRUA 3T0AA 1KPRB 4L4TE 2Y6SD 3WSQH 2A73B 1K9TA 3OXRB 3LN5A 5JA9A 1PG7L 3ULUF 3UCRA 1KACB 4ZO7A 5B38A 1P7QD 3UPAA 1GC1H 1P84K 5I1IH 1JTPA 1M71B 4HXBH 1AGDA 1NDMB 3WIFA 1VFAA 2VDRL 3MV7A 4ODBD 5EU6E 1DBBL 2ENSA 1U8QB 1RZIB 5JQHC 5I1KL 1BFOB 1IGCL 4LLDB 5EDXA 5E4EB 5I2IB 4JFFD 2PXYA 5BS0D 1T1XB 3QFJE 4NRXB 1FE8L 1L0XA 2P46B 3NN8A 4NBYB 4K8RH 3WHE1 4F15B 3MLTA 2F74A 3HZVB 3UBXG 5L7XL 1J11A 4XCYB 3THMH 3G08A 3C09B 3KPMB 3OKOB 5M94B 4G8FA 1JNLH 4MXVF 1WK0A 1S3KL 4M1DL 4C83A 5IFHL 2XKSA 2WV3A 1JHLL 4DTGH 4ZFZB 3VMNA 5T3ZE 3MLYL 2P5EA 4LQFL 2CLZB 3ULSA 1T7XA 1QFWH 1A7NL 1YPZE 4G8EB 5ADOH 5I75C 5CINH 3RWEA 1A3QA 5C09E 4FZEH 1KCUL 3IFPB 5IW1B 4AEFA 1OGAB 1QNZH 5I1JH 4LNVA 4P2CG 5KN5B 3NFPA 2DBLH 3NCEB 2QQQA 4OSUL 4XVTH 1TETH 3VH8G 4V1DD 2H9GB 4HBCL 2JB5L 1A9BA 4PB9L 4TULL 3P9WB 1A7PH 1B9ZA 5ISZA 2DQDH 3NACL 3GSRA 4HAFA 1PBYA 1CDGA 3V6OA 3B5HA 4HLJA 1KIUA 2GEEA 1QSED 1KTKE 3U0WL 1H3TA 3BDYH 3LMJH 1TQBB 1KN4H 3K8LA 2V9RA 3NFNA 2Z9TA 3FMGH 4MDJA 1EHLH 3R1GL 5F6HI 3LIZL 1F90H 3CDGA 5L88L 2H2SD 3FOLB 4PTTB 3Q48A 1BVLA 3C2AL 2HG5A 3P0YL 4KK9D 1QSFD 5GS0H 4OCYH 4NC2B 4NYLB 4ODSL 1SY6L 2B1HL 2C3VB 2M1KA 3C6LA 1CLYH 3TIDB 3ZE1F 2MJWA 3V7AG 5ALCL 4E5XB 3P4NB 3W9DA 3ECBA 4JFED 3S3PA 2DLHA 4ACPA 2KKQA 2OYPA 1HDMA 5HBBA 2A6DA 2HT2D 4BELD 3T8XA 3G5YB 3VWJA 2MCPH 3SDAC 2HJFA 2VXTL 2QADB 1IQWL 5E2UH 4ZAKB 4GAJL 1NGXA 5GS2D 1J1XH 3QIUB 1OD7A 1G9NH 5T1LA 1MFAL 1RZJL 5DVKA 2Y07L 3C5ZB 3ZMRA 1BQHA 3IDJA 4H8WH 3QPXH 4OGYL 1AQDB 1TENA 1BGXH 2BNQA 2IAMC 2WLYA 4OLUL 5C0ND 2PXYD 1R5WB 3EFDL 3P4MB 4LSRL 4I5BA 4AZ8A 4FQXC 4ZYKA 1JPGA 3RNKB 1QFWI 1T1ZB 4JN2A 5T3ZH 2IF7A 3TZVA 4J2XA 4PJGB 5JOFA 3GRWA 2E7LC 1T83A 5B8CC 3T2PA 5ID0B 1J10A 2FGZA 1NCTA 1IRAY 4FFVC 3QWOB 1TJHH 1KFAH 4M62H 3FQNB 1RHHB 2P5ED 3IT8D 4IIQA 2DN7A 2EE6A 3R06A 4Y5VB 1H3PL 4PJDE 4MMXC 4UAOB 4Y2DC 1B2WL 4HK3J 1T6VN 3WMSA 1NCBH 2C7UA 2JJUA 3NPZB 4HWZB 1HN1A 1FNEB 4DCQB 5HY9A 1XGQA 3D6GA 4FQCH 3TP4A 3K2UL 3VWKB 4LIQE 5ISZD 4QT5B 1NGWB 3IDXH 4GAFB 3P40A 3P77A 4NKDA 2XA8H 2A74B 2UYLA 5E8OA 1J88A 2Y4SA 5EOQL 4RRPG 1NCAL 2DQTL 2MKWA 2Q7YA 3MOQA 3QSKB 3HPJB 3SGDH 3QWRA 2IBZX 3WUZA 1IGIH 1X4YA 5JQ6L 5TFSH 4FFZH 1YC8A 3DO7A 5EN2A 4YHYB 1N8ZB 4D9LL 4LPVA 5EB9A 2BJML 5FYLD 4NUGH 2VYRE 5ERWA 2VMFA 3QEQE 5DJYB 3OKEB 2AJSH 3C6LD 1FG2A 2QQKH 4BSVB 5JHDB 1MEXH 1AHWB 5FA3B 2GITA 3MUGB 4U33A 1CICB 3NFSL 5GISH 3HR5B 3EYVA 4F33A 2F5BL 2P8MB 4H0HB 5IM7A 3LHPH 2CUMA 4K94L 5DS8B 1T04B 1JZ7A 3L7EA 1YC7A 4YDJB 3VWJD 4UDUA 3RWDA 3RBGA 1VGKA 4IDJL 3S35X 1FZJA 4PB0L 1YJDH 5DI8A 4E41A 2PTTB 2OL3B 2OXGA 4HV8B 3SKMA 4F9LA 4GG6B 4Q58C 4ETQA 4OCRL 3NCYP 2WSKA 4KMTH 3RY5A 4WJ5A 1P9MC 1NGQL 1F4XL 4QRTA 2R15A 1I1YB 2CIIB 3U79A 3KJ4B 2C5DC 4JY4A 2BNQD 3QXDB 3CC5A 4MB4A 4JY5H 3FJTA 1YMHB 1H0DB 2X4NB 5E8PA 4P5TC 4MYWB 1C5DB 3TZVD 3DV6A 4B53A 1FPTL 4MQXD 1YYMH 2XWJA 3O4OB 1FAIL 5DMIL 2ZCKL 1GH7A 3AS0A 5EZJB 4P23B 5I9QB 1C5CL 1J1OL 4RMSA 1HXMA 3ME0A 3L3GB 4FTVB 5I6XC 4NKMB 3RJDA 4O2CA 3DMMB 1AXSB 3UTTE 3NABH 1X6LA 1YEEH 3RHWK 2J6EL 5CBEA 1F97A 4PBWD 3O8XC 3PNWA 2EXWC 1CGYA 5BW7A 1YNKL 2XKNA 4LIQH 5C0AA 5EC2B 4JE4B 2AI0L 4J4PD 2WLZA 3WXWL 3VD3A 3F7QA 2XG4A 3BEVB 1A6AA 4P59L 1YDPB 4C4KT 1I9IH 3GMLB 1G6RB 2XV6B 1ZT1B 5EA0H 1C12B 3O6FB 3VRIA 1MOEA 3RJQB 3WFCH 1S7UB 4X99B 2XTJC 4LHUB 1MHHB 2R1XA 5MEND 3GMPA 3VU2A 3VFOA 4WO4C 4N9GB 1FL5B 4RA0C 1FH5L 5HYFA 4QRUA 1PJ9A 3DWTA 3L9RB 2A0LD 3QWRD 2G75A 3UYRL 1GSMA 2L0DA 1UQSA 4N0RA 1RZ8A 3S36X 3QNYB 1HHHB 3C60C 1AGFA 3IDGB 3LZFL 5D1QD 4P9ML 4MA8H 3X11B 4HH9A 2XN9A 1C5BH 3WLWC 1C08A 3FB6A 2HRPH 2P4AB 1XMWA 4HC1A 4HJGA 3V6ZA 3W0WA 5FK9A 3ZDZF 4CN4A 3RX7A 1JGLL 1NAMB 3PGCB 3FONB 3L3OA 4D0CA 5HYSB 3L5WB 1HSAB 4GUPA 4Q6IA 3MRBB 5IB3B 1AGEA 4N90D 2RR3A 1FLRL 4XHJC 3DX7B 3KPRB 1YEIH 3S4SB 4TVPD 1GZQB 1KV3A 4WU7A 1D6EA 3DI2B 1EFXA 2BY3A 1NUGA 2DQCL 4E41D 1X5LA 1ZT7A 5HVHB 1R3IH 5JZ7D 5EU4A 5BXFA 5KSVA 4HS3A 2R0KL 3EOTL 3G5XB 4JM2F 5F9AC 2DDQL 1GGBL 4KI5D 1VHPA 1MI5A 2GTWA 2YK1L 4MQ7B 3RL1B 1F2XK 2XA3A 1ZHKA 1AGCB 4JFFE 3AFLA 4JQVC 5EO1A 5FEBA 5BS0E 1MUJA 3SGJA 1LP9F 2IEPA 2O5ZH 1YNTB 4X4XA 1IGYB 1VA9A 4Z7WB 3BAEH 5F7WC 1B6UA 3DVFA 4JVWA 1WZMA 5TGBB 3LKOA 2DWDA 1JPFB 4Z77B 1IAKB 1D7FA 3A67H 2WMPA 4GKZA 1KLGA 2AABL 4FQ2H 4DFIA 3OJDB 5EO9A 4X6FA 3C09C 2XWBA 5GJTH 4NO2A 4JZOA 4LKCA 4JRXA 3PABB 2C1PB 5H94A 4LEOA 5T1KA 1RU9H 2AK1H 3IJSA 5IROA 2FO1A 1NLBH 4LSUL 5C0AD 5MERA 3KPTA 3ARGB 4RISL 3NTCH 1SHMA 4D0DB 3BT2L 2NX5B 2Y72A 3TNNB 1T7VA 2O26U 2HLAB 4PJAF 2QSCL 1KJ2H 4V1DE 3SQOL 2VE6A 3PV6A 1KPUB 3DVIA 1DQJA 3GI9H 3ULVC 2DQGH 3QQNA 5D6CB 1YMMB 4KTDH 4PBVC 1T5WB 4OCNC 2C3XA 4AEIL 3LOWA 4O02H 3V9FA 2FEEL 3CZFB 3IDMA 4JVPA 1U58B 4MLIA 3SGEH 3EYFA 4KRMB 5KZCD 1ZWIB 2OR8A 3OF6A 2H8PB 3BPLB 1QSEE 2FSEA 3DYOA 1YN7B 1U9KA 3IGAB 3N85H 5D5MA 3SBWA 1XT5A 5L8KB 2NPLX 2E27H 1KPVA 5EUKA 1BJMA 1XF4A 3GHBH 4G8GB 5DRWA 3I6KB 3WFDL 1TQBC 4X98A 2XN9D 2RB8A 1QSFE 4ZTPL 4HUVA 2WUCH 5IJKC 1CFQB 4PRPE 3QUML 1MELA 4M7ZB 3KPNA 2AJXL 3MLWH 1JGVH 2VQ1B 1Q72L 3IS1X 4K71B 4OFYA 1SM3H 3TT3L 2QHRL 1FGNH 2VZSA 4JFEE 1FORL 3KYKL 3EJJX 5CEXA 1REIA 4MZ3A 3GO1L 1EXUA 1QUNA 2YPLB 4C56B 5J3HD 5GZND 5BVJA 5I1GH 1XIWB 3U9UB 2R2BA 4JY6B 1MCKA 4N8CH 4APQD 1B6DA 3VFRB 5ILTL 1WBZA 1BJ1J 2QADC 5CP7A 2EDDA 4NZTH 1TVBA 5IVXA 2M26A 3HZYB 3H3PH 1AIFA 3RNQA 3QIUC 2A1WL 4L8CA 2Z0BA 4J8RB 4TRPL 3C5ZC 4OF6A 3S34L 4ZUSB 4FQIH 3NA9H 3I9GL 2EECA 3M8OL 3GUTB 1DE4B 5EUOE 3QIWA 4I3RL 4P46A 4LHQB 1D6VH 3IF1A 3FTGB 5SWZA 3HR6A 3BMVA 4Y4FA 1UB6B 4LLYA 4Z6AT 3OHXB 5IHUL 4YDLB 2P5EE 2JCCB 2L4OA 4JRXD 4P3DA 1LQSR 1KJ3H 3HNVL 5FCUL 5T1KD 5KTEL 2PYFA 1S9YB 2P48B 2DF3A 3MOAL 3BN3B 3SCMD 5KSAB 4HJJL 2XNAA 4YBHA 1J05A 3WFBL 4UU9A 4Y5VC 4ORGB 4UAOC 5I1HL 2HLFD 4JZJA 3JWOH 4U1KA 4LCCC 3CIQA 3SPVB 2V17H 3MLXL 3IAGC 5T5NG 2ADIB 4KKLD 1S8DB 4J3XA 3ZDYE 2PR4L 5ISZE 3T2QA 2DWEB 1G1YA 4KGLA 3UZEA 1OTUC 2OMBA 5C0EA 3ARED 3VWKC 5IB4B 4ZNCD 2E9BA 3OF6D 1AJ7L 3IU4L 1XGTA 1IVLA 4MXQD 4N1CA 1NBZB 3VE0B 4DGYH 4PJDB 1T03L 3VFPB 5LGHH 3IJYA 1QFPA 2JJVA 2XZCL 2X05A 5HYJA 4X7DC 3G6AA 2FX9L 3F7RA 4K3JH 4BJLA 4M93C 5FYLE 4NNPL 25C8L 4GJTB 1PLGH 5E1AB 3QEHB 3KNBB 2Y7QB 4M6AA 5CCKH 1O5DT 1RJYB 3KLSA 4JAMA 5BVPH 1FLTX 1X5IA 3FT2A 1XGYH 5DRNB 4DN3L 2VN4A 2OJZH 2ZPKL 1AC0A 2YD8A 2ZOKA 4N0CC 5GQBA 4E9LA 2Z31B 5GS2H 3A6OA 5EORL 3D18A 4HWEL 1Z9SA 2B8OT 5D8JH 4LFHD 3RA7H 4PJFA 3PE9A 1AHWC 4EXKA 4J3UA 2GCYB 3MNWB 4POUB 3X12B 1CCZA 1JGUL 2UZYB 4PD4K 3HZKB 1QD0A 1Q9OA 3FRPA 3PWJA 1OAXL 2GQHA 1Q9WA 1KXQE 5EZIL 4HHAA 3HB3C 4PUBH 4PLJD 5FIEA 1IM3A 4ZPTA 1LO2H 3NH7L 1BJ1H 1QFOA 4RFOH 2AJYH 5CBAB 3PGDA 4UINH 5ETUA 3WUWA 3BIBX 4NWUH 2BNQE 4JO4L 4U1MA 4P4KD 2VC2H 4JO1H 4OIAA 4DWHA 4CVWA 1WTGT 4CW1B 3WJJC 6FABL 4KC3B 2J5LB 2JJTA 3JXAA 1DSFH 5ESAA 5DD0L 4NSKB 4KTEH 3F5WB 1NFDF 4UV4H 3KJ4C 1E6OL 5DJCA 3B6SB 3AU1B 2ZCHH 3ILQD 5CJOH 2AQ1A 1EV2E 4P46D 4PJ7A 5CLWA 3NIFE 5SWZD 3VI4E 1T7YA 1U3HB 3BH9A 5DMKA 4RWYL 4UTBH 1UXSA 2YD5A 2AEPH 3O4OC 3BHBB 4NQDB 3V5KA 8CGTA 3QDMA 3OR7B 4XNYL 4KXZI 3O45A 4HUUA 4L5FH 5E7BA 1IKNA 5I74B 3MRHA 4JFDB 4NJAL 1LE5B 1L7TL 1WFOA 3MO1A 2QR0A 1X44A 1LK2A 5EPMB 2X4RB 4NM4H 4Z0XA 1WTLA 1F3JB 4RMVA 3ALPA 4NDMB 2CGRL 1BPVA 4KJYB 1XR9B 2BOCB 2ZOLA 3BWUC 4ZXBD 2WUBL 3OJ2C 1B4JH 5C08A 4YEFA 1FRGH 3UYOD 4XXCA 4H88L 1EX0A 4JFPB 5IB2A 4PTUA 3MC0A 2EO9A 1GC1C 3R4DA 7CGTA 5MENE 1KLUB 3O6FC 1U8HA 2K7QA 4FMKA 1M7IB 5FYLH 1ORSB 3NCBB 4M6NH 3HLAA 2JK5B 3SE3A 2FX8L 2VDML 3S37L 5IIEA 5FF6B 4MVBD 4K8RC 5HYJD 3NGBC 2VLRA 3NCFB 4POZC 1M7XA 2FJFB 5GSRB 3IXAA 4LSDA 5DVNA 3GFUA 2FB4L 1BLNB 4G6FD 4TPRH 1OM3L 2RIKA 2W38A 5J57B 5HGHA 5DJ6B 2P49B 5D6DC 1U8JB 4JG0H 3NIDF 3VDCA 2DQEL 3GM0A 1X5YA 4N90E 4ZTOH 2BFVL 3L1OL 3QUZB 1TJGH 4U1NB 3V4VH 4F80A 2OR9H 1CD1A 1HHIA 1WCQA 4TVPE 2EICA 1D5MB 3WIIH 4JANB 1Q94A 3HE7A 5TF1H 3H3KA 3MLRL 3SJVA 3RZWA 3QCVL 4E41E 3E6FB 3NZHH 4JPKL 5FA4B 5HVWA 3PWVA 3QQ4A 15C8L 2ARJA 1FN4A 1BREA 3GRWH 4WFGD 4KI5E 3T1FB 3V6FB 3WFEL 3LKPA 1JMZA 4QHLA 1F11B 4Z78A 3O9WA 4D8PA 4LU5H 4EKXA 2VAJA 1J0JA 3TGXA 4OB5L 3BZ4B 1C8PA 4I0PC 3F7YB 2KPNA 3MRQA 4ODUB 1R5IA 4HT1H 3SDDC 4KPHH 3WNNA 1TZHB 1RZ7L 3EO9H 1LO4H 2YD4A 1A9EA 2QSTA 3MRIB 4HSQA 5DJXB 4KVNH 3S3SA 4PRHA 3GM8A 3Q5OA 4FG6C 3NCCB 3CMOH 5E2VH 4YBLB 3PQYA 5GS0C 3QDMD 3PP3K 5AD0B 2VWEE 1OSPH 3UZQA 1BFSA 4K9EH 4LSTL 1NLDL 4PY7B 1VPOL 4ONHB 5C0AE 1WIPA 5DR5L 4KVCL 2MSPA 2Q8AH 2FO4B 4R3SB 1UH3A 3GSOA 1F42A 1L9MA 1V3LA 3OMZA 3SE4A 5C6WH 2B4CL 4CBPA 3B83A 4Z7VB 4Z18A 43CAB 4NP4L 3GI8H 4NPYA 4XXDB 4OM0H 3ARGC 3ARBB 5C08D 2C3WA 5DEGA 3DVNB 1OHQA 5T33L 3DHMA 2BVOA 3BGMA 4KKAD 2VITA 4YNYB 4OAWA 1HYSC 5MP6H 1PAMA 1W0WA 4F7PA 1RSFA 1G9NC 3DX6A 3C8KB 2I27N 3LPGA 1IT9H 2EC9U 4P57B 1L0YA 4H8WC 4ODVH 2V5SA 3DXAA 2GFBA 1OAKH 2ICEB 3O4LA 3QP3A 4XAWH 5IBLD 2HAZA 3F62A 4YDKL 3QUXD 1H3XA 3U9PL 1HXYB 1MFEH 1U8OB 2VLRD 2MCG1 2CJUL 4S1RL 3B9DA 2HFFB 4NN6C 1HH6A 2XN9E 4NZDA 4AG4H 3PP4L 1DANT 2DM7A 4TVPH 1RZGA 4L3AA 3VA6A 4LVNC 1FVEA 1ND0A 3ARRA 4M4PA 4JO3L 2Y36L 3L95A 5FGBC 4OFPA 3RVVC 4OQTH 1BFTA 2VXVH 4LCYB 4M7ZC 4FNLH 4OIIL 3ES6A 1D9KD 4L4VB 4UV7H 2Q8BL 3BISA 3MRGB 1ONQB 3ZTJH 2DQFB 2KL6A 3SJVD 4U1HA 3MLUH 2VOTA 3MRDA 3U7YH 3H42L 2VIRB 4XB8A 2WBWB 4JLRB 5F72S 3U2SA 1LDSA 3TPUB 1E4WH 4I4WA 2IQ9H 2BSRB 3OZ9H 1YEFH 3DBXA 4XNXH 1I7TB 2ZZUT 3DGCR 2J8HA 1YQVH 4XPBL 4WGVB 5KS9A 3HRPA 4RQQA 3K7UA 3PHOB 4XNUL 5CSBA 4X6DE 3AB0C 4YHKL 2LVEA 5I15L 3VA2C 3UROR 3FRUB 4HCRL 3WNOA 2YHGA 3PL6A 4IS6A 3EYQC 3PQYD 3T0BA 4IDLA 2XPGA 4OLZL 3CLFL 4HIHA 4JRXE 4K3EH 4ZODA 2OJEA 3E2HC 4G9FA 4ODTL 2YOCA 5HI3C 3WIFB 5IR1B 2DLFH 3MV7B 7FABH 4I48A 5E1HB 3C87A 5HGGS 3L3JA 1NFIB 1P69B 1DN0A 4JGUA 5BZDA 1J8HB 4LLMA 2PNDA 4M1CC 3D85A 3HMWH 1XH3A 1U2HA 1P5UA 1NSNL 2F74B 2ADJB 5SX4I 1YJDC 4DKEH 2IH1A 4PJ9A 4RDQG 3EFFA 3G08B 4G8FB 4UMGA 5IOPB 5ABDE 2EEDA 4C83B 1OQOA 5SWSD 1DVFC 4HS6A 2Y9RT 2UZIH 3FAWA 1CQYA 1R5VB 3EJYC 3ARFC 3ULSB 3DXAD 4LF3A 5D5ME 2R2HA 4J6RH 3D9AL 4QWWC 3GSNA 3BDBA 3RGHA 4HC1H 3RWEB 5DD1H 4DQOL 2NLJB 3H7BA 1W8OA 3BIKA 3NFPB 2HTLD 3G9VA 4KHTL 5AWNH 3SN6N 1OAZL 3VFUB 4FZ8H 5JIKA 3TT1L 2PW1A 2DI7A 3ULVF 4G9DA 5FKAB 2BZDA 3TBYA 1N4XH 4U1IA 2P7TA 4XPHH 5FGSA 1T0NB 1AQKH 3GK8H 1Q0YH 3QISA 3GSRB 5I1CH 4JFQA 4EI5D 4BFBD 4JRYB 3MBED 4ZUWA 3D87B 4ODHH 1GIGL 2CLRB 3BP4A 1DQDL 1IAMA 3L3IB 3LQAL 1QFWM 1EMTL 3NFNB 1H8SA 2XI9A 4NRYB 1XGRB 1YEHH 8FABA 1PGRB 3ARWA 4K7PX 3CDGB 3BKJH 1TTGA 5IVXE 3S36L 1BVLB 1BEYL 4XH2B 4PV8A 2NZ9C 1F8TH 4EN3A 3I02A 1LE9B 1JTOA 1MCSA 4TNWF 2LU3A 4RAUA 2G2RB 1H3WM 1YEJL 4DJMA 5HI4D 4XP5H 3H6JA 2LU4A 4PJEA 3Q1SL 2VTFA 3OJMB 3ECBB 1CG9A 2NNAA 4Z7OE 4DGVL 1H15A 1HDMB 5SWZE 4OI9A 1F4YH 1WV7T 4G7VH 3T8XB 4OZIA 1S9VA 4EXPX 1S7XB 2HJFB 1F4HA 3PL6D 1MLCA 4KKNA 5FKPA 1MPAH 5JHLH 3JUYA 3LEXA 1NGXB 4D3CL 5CD5D 4Y4KC 5ICYA 1EVTC 4G9FD 4JKKA 1MF2L 4GKSA 5T1LB 5GHWH 4N0UA 2JF1A 4YQXL 4LEXL 4LRNL 1VFBA 4XMPL 3MREA 4L1HA 4YHIA 5BQ7A 3BX7C 2A9NL 1IC1A 4GT7A 4KQ3H 5F9OL 2YMXH 4I5BB 4JFHD 4ZYKB 3D85D 1INDL 3S5LA 2HT4D 2R0ZL 5IMKA 1FNHA 2VZ3A 3TZVB 3PXJA 4PJ9D 4PRDA 3ARTA 2P8LB 3SDCA 5AZEL 4ZO9A 5FO7A 4JZNA 4OD2A 1ZLUH 4EI6A 4PJGF 4TVSa 1KEML 3U0TA 4N9OB 1YEGH 4OLEA 2DQHL 2LABA 2QHLA 3BPNB 4IIQB 1T1YB 3R06B 3HE6A 4M5YH 3HNTH 3KDMA 4IRJC 3W39A 2ADFL 2GUOA 3WE6A 3CSYA 2GSIA 5HYJE 5KVEH 2ZSVA 1HHKA 3GBLA 2C7UB 4R8WH 3MACH 4K3DH 4NZRH 4Z76A 2MOVA 3HC0B 1YECL 3EHBC 3MNVB 5HY9B 3MA9L 3GMRB 3D25A 3AM8A 1YYLL 5HHMD 1F6LL 3PWUA 4JFOA 4HKBA 4ZNEA 5FDWA 4EOWH 4YFLI 2A77L 5H37G 4NQUA 4HDIA 3BMWA 4AL8L 2EO1A 3P77B 4NKDB 4JM4L 2YPVL 4NNYB 1SBSH 3EDEA 4PJFE 4ZFFA 1W2KT 2W9DH 2AEIT 2W65A 3P9LB 5I30L 4JEGB 1G7MA 1KTDA 4KKCD 1T5XB 2Q7YB 3GMQA 1XCTA 2DLIA 3WNLA 1NBVL 3QUZC 5CJ8A 3OR6A 3EDFA 3KPPA 3GJFH 2O5YH 2XQYG 2NY0B 4MD5A 4PJIF 3DO7B 5EN2B 4CN1A 4Y1AD 4WFGE 4EN3D 5J8OA 5ERWB 2CXGA 2V7HB 1CZ8L 4MDIB 5KSUB 2BNRA 1VFMA 3R0NA 4PJXF 5I0ZA 1NANH 1OP3K 3BKYL 3BZEA 4PLOB 4OZ4A 2GITB 2CKBH 3A6CL 1A6VL 3EYVB 4NN5C 3L5XH 5BCAA 1JTTA 4J3TA 5IM7B 4PJ7E 1FP5A 4OLWL 3U0PA 3L7EB 4JFZL 2A6IA 4HMCA 3GDBA 4UDUB 3JVGA 2VDQH 1MAML 5DI8B 3QDME 2BC4A 3MZTA 4NO0D 3SKMB 3ZKMC 1XAUA 5INDA 3D0LA 3QG7L 5D7KD 4WJ5B 1JPSL 4L1DA 2HFEA 4CUCA 4O5LH 4GG6F 3LQZB 1I8IA 1CTNA 1ZKAA 4IRSA 3VJ6B 3B9KD 4ZQKA 5C8JB 4JQIH 2ITCB 5I18H 4GRWF 4XC3L 2BY2A 3IKCA 3IDIB 2EDBA 5KVFL 5C08E 2XWJB 2AJZA 1KYOK 3DRTA 3SDCD 4HK0A 2PYEB 1IARB 4YHZL 4JREB 3WCYA 5EBLA 3O41A 1KCLA 2WP3T 1DQMH 1I9JH 3MRKA 5EBMA 4LSQL 4ZUUA 1HXMB 2VDPL 3KS0J 2OK0L 5J12B 5I76A 2CDEA 2JKXA 1MCDA 4O2CB 3WYRA 2BDNL 1QACA 4XNMA 3HE6D 4MHHG 1E6JH 5HTSA 5D2NA 2P47B 1NMBL 3N1QC 3G04B 1HSBA 5CBEB 1S9WB 4FP8L 3PNWB 4X9HA 3E6HB 2R8SH 2I60L 5CUSL 5EO0A 1MCOL 3L3DA 3LEVH 2VLRE 5IF0A 1FFPB 3PGFL 4LARH 3TM6A 5DJ8B 1FZOA 1BIIA 5HHPA 2VSDA 4O51A 5EWIL 4YX2H 2IMMA 3L6FB 1LEKA 5F7LB 4XVSL 2EYTB 1JWMA 5DSCA 3JV4A 1DDHA 3TBVB 2R1XB 2DL9A 4OUUA 1KCRL 5EIVA 1OL0A 1MVUB 2DICA 1DBBH 4R7NB 3B3IB 3KPSA 3SDXA 5CILL 5HJ3B 3GMPB 2VSCA 3VFOB 3RIFF 4NQXB 5D2LE 1CDHA 5BV7H 4KZDL 3SJVE 4QRUB 3JWOC 2CR3A 4X9FA 2G75B 2CO6B 4PG2C 1UQSB 4LPTA 1RZ8B 4LLQA 1JYXA 4PJCE 5KBNC 4HH9B 3VFGL 5DVOA 3DO3A 3FT4A 1JHLH 1WZ1L 3O3UN 2YBRB 1C08B 4GKNA 2BNRD 3FB6B 3S98A 3MLYH 4GO6B 2H2SC 3O2DL 4HJGB 3V6ZB 4LQFH 3W0WB 2UV3A 1A7NH 1UH4A 4KK9C 2ZP0T 1AD9A 3TH4T 3RKPA 4GUPB 4Q6IB 1BQHG 5E00A 1Q9KA 1AGEB 2DJ4A 1JHKL 4BQCA 1FCCA 1JBJA 1KC5L 3MJ9A 4WU7B 3O2WL 3E8UL 4PGCB 4OSUH 4IMKA 1EFXB 4DEPC 5B21A 3PQYE 4PRBA 1ZT7B 3ROLA 5GRYA 2HT2C 4QYOB 3JV5A 3VRLE 5BXFB 4HS3B 5AZ2L 1QLRA 1P84J 3CDFA 4PFEA 4XPAH 4IRSD 1MI5B 4NQEB 1TQCB 1JGEA 1A21A 1UCBH 2A2QT 2EE3A 3RDTA 5JOPD 3QJHA 2Z8SA 4A6YL 5EO1B 1MUJB 1AH1A 3V4PL 3U0WH 3GGWA 1X5AA 2Y5EA 1NCWL 4JPWL 3RWCB 5C0NC 2MWCA 2PXYC 1JMXA 2DWDB 5L88H 4G6ML 3P2TA 1SBBA 2H6PB 4Z7WF 5SWSE 3DTXB 4WRLA 2ATPA 3VXRA 4GKZB 1KLGB 4OBSA 4NN7B 4ZDHB 3CU7A 5EO9B 4U6YB 2Z92A 2XWBB 3KS0H 4NO2B 4JZOB 1G9ML 2G9HA 2VH5L 1HH9A 4MAUH 5H94B 4LEOB 4TUKL 3UBXA 2BSTA 5T1KB 3IJSB 2OBGA 2OQJA 5MERB 4R7DB 2F58H 1MWAL 1MY5A 4WU5A 3RWJA 2JELL 3DV4A 4J3SA 2FBJL 3TVMD 4YFDB 5L8LB 4O58L 4NZJA 1IQWH 2VE6B 1H3VA 3PV6B 4RGND 3CU1A 1DQJB 3MUHL 1UACL 1QPPA 4AM0A 4DUXA 1RZJH 5FOBA 3CFEB 3RI5K 1A3RL 1CFVH 2EIEA 3IDMB 3KPSD 3U1SL 3DOSA 3V4UH 4JRWA 5IBTH 4ZFOL 3HFMH 1YA5A 4OLUH 1U8KA 1A6ZA 3EFDH 2F19H 4G80B 4P48A 4M8VA 3VH8A 3VXMD 4JDVA 3V6OC 2DBJA 4H25B 4HXAL 5EUKB 2JTDA 1XF4B 2W60B 2P43B 3GIZH 3QDGD 5DRWB 2H26B 1YPZF 3WXVH 3C08L 4AIOA 4X4MA 4X98B 5H35B 4HUVB 4P4RA 2OR7A 1MCJA 1DLFL 1RVFL 4HUWA 4HIIA 1OP5H 2EE9A 1U8LB 5IVZB 1NJ9A 2VLJD 5C7XL 2ENYA 3KPNB 3QR2A 1A0QL 1T0PB 4NHCL 2XZAL 4LASL 1U8NA 5D70L 5CZXD 1IZJA 5KS9E 4KRPB 3ZDXE 1ZHBA 3KPQA 5DDHA 4RX4D 5K9QI 1ACYL 3C6LC 5DJDA 3ZYOA 4X8JA 4J3VA 2VXSH 2MQ0A 1EXUB 1F58H 1U92B 4WTWA 1P4LB 5BVJB 2R2BB 4YPGA 3T65A 3VWJC 1PZ5A 4MNQB 4NWTH 3BPOB 1IC7L 5EZLB 1QVOA 2HN7B 4N0YL 1AIFB 3RNQB 5CSZA 4KUCF 2ZKHL 1PKQA 4S2SA 4JFHE 4X80H 4TTGA 3O2VL 1NCAH 3CUPA 1KGCD 2HFGH 3QIWB 2ZCLL 5D7SH 1IKFL 4J1UA 5KVMC 4PJ8D 5IJVA 4DVBB 4WV1A 1OGTA 3VXRD 3MLSL 4Y4FB 4KRNA 3TZVC 2KZ1B 1VCAA 2SEBA 1I75A 3MA7A 1RUAL 3S8WA 1DBMH 1R0AL 1T83C 2NR6D 1FNSH 4QNPE 1XGUA 1J8KA 4YHNB 1V7NL 4XP4L 1G7IA 4RFEA 3TBWA 2PYFB 4WEBL 3ABZA 3C8DA 2JCCF 4Z7UB 4YDIH 2VZ1A 3NFSH 2VLMD 2XNAB 3ARDB 1J05B 4IIQC 4UU9B 2QQNL 2D7TL 1ZA3A 4JQXA 4XP9L 5DWUH 3KR3L 4ZD3L 4D0BA 4YHML 4U1KB 3T77A 1G7PA 1IMHC 4ORZC 4X6CA 1RIVL 1HEZB 5HHME 3MUY1 2BOBB 2CQVA 3U7WH 4K9EC 5C0EB 4KWUA 3O81A 1E27A 2FD6H 4QRQA 4ZOCA 1XGTB 4XVJL 5CSGA 2HH0L 3C60A 1A1MA 1SEBB 4GW5A 4PJBB 1C16B 3SO5A 2W9LA 2IJ0C 4HULB 3PDGA 5JW3L 1FV1A 1PEZA 4ZG1A 5DMIH 4PJDF 1QR1A 2ZCKH 4HF5L 3GMOA 4OZGA 2BXZA 4Y1AE 4UZGA 2A0LC 2KQMA 6CGTA 1C5CH 2D03H 3SQBA 4ELMA 1OAUL 1MREL 1IZKA 3OB0H 4JAMB 1IFHH 1NUDA 5D1QC 3FT2B 5ICZB 4RRPA 1UKSA 1KTLA 1II4E 4U31A 2FLBT 5T3XL 1X7QB 1I85A 3D18B 2WIMA 2AVGA 4HGWA 3FB5B 4LVHB 4D9RD 4PJFB 4OZIE 4CVXB 4WHYH 3NMEA 3EUUA 4QRRA 3VXQB 4DK3A 2X4SB 2J1KA 2BSSA 1K4DA 2WBJA 1Q9OB 5CHNA 4WY7H 2X70B 2NY2D 4HHAB 1IILE 2ZNWA 1IM3B 4ZPTB 5D7KE 1GAFH 5DK2A 5CD3A 3WUWB 3B43A 1I8MA 4F9LC 3BEWA 3QXAB 2RQ8A 3HMXL 2HMID 4AEHH 4KI5C 2JJWA 2DLTA 4R4NC 4NO3A 3BDXA 5DJCB 4X6BA 3UYRH 5CJXA 1M1SA 1X6NA 3MJ8A 1CYGA 2R23B 5FHAL 3GBNL 1QEWB 4PJ7B 1U3JA 1UENA 3CH8A 2D31A 3RP1A 3TA3A 4UTAL 1R3JA 3BH9B 1CXEA 1MRFL 5E2WH 5DURB 3I2CH 1CLZH 1UXSB 1KBGL 1GPOH 1WWWX 3V5KB 5LXGH 1U8PA 3QDMB 4S1QH 2DD8L 2AK4D 4EBQL 4JREC 3X13A 5J06A 3TBSA 1HWGB 1UEYA 4HUUB 4QOKA 3ZYZA 3MRHB 1MAJA 4RIRA 1BZ9A 4KJWD 4NC1E 5C6PB 4UDTA 2VWEC 3QZWB 1HI6B 5JW4M 3T0EA 4WWID 5BW7C 1JNHB 1F4WL 2QSVA 2ZOLB 4O2FA 5F1KC 5C08B 4O2EA 4XCEA 1K2DA 1QG3A 5F9JB 1OTSD 4PTUB 4ZNEE 3JWDC 3SO3B 3JWNC 1G84A 1A6TA 4M7KL 4JKPH 2YK1H 4GBXB 4YDVA 1PSKL 4M6ML 3T04D 2CRZA 1PYWA 2PF6A 3RIAF 4P2RD 2XQYK 9CGTA 5E8DH 4XCNA 2F9BT 3ARPA 1KJMB 5JXAH 4W81A 2IGFH 1P4BH 1HNFA 3GB7B 2EDYA 1UVQA 3IXAB 4KY1H 1XF3B 1IAIH 5C2BL 2AABH 2BNRE 1LMKA 4XWGH 3HHRB 5HGHB 1HZHH 5EBGA 3KG5A 2KBGA 3CXHJ 1IC5L 1U93B 4XAKD 3SE8L 4EVNA 5D1XA 4KGJA 4LSUH 5KG9B 2G60H 3O6KH 3FN3A 2HYMA 5L0QB 4O4YH 4EJ1C 4R0LA 3SKOA 3BT2H 1CD1B 1MCRA 3JV6A 4QRRD 1NH6A 1Q94B 3HE7B 1IGFL 4Q6IC 2WBJD 3MBXL 1ZK9A 3GNML 2FGWL 4XB7A 5DTFA 3TIEB 4ODWA 4HG4K 3PWVB 4PJ5A 4QRPD 1FN4B 5J3HC 5GZNC 4K7PL 4ZUTB 4AEIH 3RWIA 5JR1H 3MUZ1 2NCMA 4QHLB 4APQC 3GIVA 4Z78B 3O9WB 5JOPE 4D8PB 4HUXA 2UWEA 3C2SA 3K8KA 4X8XA 4ONFH 2YD6A 2WWKO 4YGVA 1I9EA 5L6YH 1OB1A 3SOBL 4I1NB 4KK6D 1OARL 1BM3L 1A9EB 4U7MA 3SGJC 1QA9B 1I3UA 4OZFB 1GOFA 3TA3D 3TPKA 1JN6A 1CK0H 1GGIL 4PRHB 4ONGL 1MQKH 2J4WH 4P2QA 3ZSTA 1CDBA 1I7ZA 3PWPA 1JGDA 3CPLB 5D2NE 4F2MB 2FWOB 1EGJL 5ESVA 4QOKD 1GHFL 5D93C 1TDQA 3GSOB 1JNNH 3LS4H 5TE6L 2CR6A 1WC7A 3T0ED 3UTPD 5LBSH 5KW9H 1LEGB 2WW8A 2BRRL 5IROC 1EHXA 5EOCL 3TO4D 2R4RL 1NFKA 4RGNE 5DEGB 3CVHL 3OTTA 1E0OB 1L7IL 4Z7VF 2BVOB 5ILTH 3BGMB 1TCRA 3VFSA 4OAWB 5KSBA 3MSPA 2RGSA 2RAMA 4R4FL 3QNXA 3CFDB 1WCBA 3KPSE 3H9HB 4KKLC 3UO1L 1IAII 3PV7A 3LN4B 4YO0A 5L2KA 3DXAB 1NAKL 3VXME 2GFBB 3O4LB 1BQLL 1TXKA 2Y25A 4GRMA 3F58L 5DHVA 4GW1A 1FGVL 5DD3L 1S7VA 4FMFA 5DT1L 4A2MA 2OTUB 3QDGE 4MXQC 1ZLWK 5D71L 1QBAA 1QYGL 3FN0H 3BE1H 1I7RA 3RVTC 5GGVL 1UKQA 3SBWC 5MI0B 5AG9A 1HH6B 5IKCA 1NGYA 5J9PA 4XNQB 5BZWA 2XKUA 3MGOA 5IHUH 1CE1H 3OSKA 5CZVL 2VLJE 1J5OL 3FO0L 4JCMA 3WN5A 1MFDH 1ND0B 5GRUL 1KN2L 4UOW0 5DFVD 2MHAA 4TUJA 5D1XD 4GAGH 3P4LA 1UH2A 1NCNA 1R24A 4TSAH 3WFBH 1V5JA 3DUSA 4TNWK 5E08L 4KRPC 4NM8H 1CT8B 4JHWL 1OAYL 1QFHA 4U1HB 1AO7A 1W0VB 4ZFGL 2ITDA 1CL7I 4DZBA 4QHNA 1OVZA 4PJ5D 1MFCH 3CLEL 1DBKL 4BFGA 1RFDH 4XMLH 4XPGH 4O9HL 1CGUA 3U2SB 4MNHA 3VG9C 1CFBA 3ZE0F 4I4WB 5D7JD 3V5HA 1ZLVH 2I5YH 1AJ7H 4PLJC 3RAJH 1CTOA 5DVLA 4FXKA 3BPOC 2LAAA 3K8MA 4JPIA 4U1JB 1URLA 4H20L 3H9SA 1KGCE 1T03H 1C7TA 4RQQB 3WS3A 1OF2A 3H0TA 4C58B 1EO8H 2ZG3A 4AENA 5SWQA 3QEUA 3U46A 2FX9H 1BECA 3VXRE 2EZ0D 4MA3B 5E2TL 3I3EA 1QPXA 4IS6B 3ILQC 4P2QD 4P46C 3FFDA 2OJEB 2CMRH 3RWHA 4Y4FC 4G9FB 5B4MD 4EIGB 4JDTL 2YXFA 5EORH 4Z7QE 4I48B 2VLME 4PG9A 3LKQB 3PHQB 3NCJL 3N0PB 4LCWA 5A43C 4Y8DC 1FYTA 5I73B 1QQDA 4HIJA 3MROB 3RRQA 2EIZB 5BZDB 2D7OA 1ZGLA 3D85B 3UJTL 2W0FA 4OM1L 1EBPA 3QEGL 3HUJE 2IH1B 4PJ9B 4JZJC 3EFFB 1FAKT 2CRMA 1QKZL 1Y6KR 4HS6B 5IHLB 5I8KL 3KYMB 4BH8B 1WT5A 4X6EB 1CBVL 4JO4H 4Z95L 1L6XA 2GHWB 3OAUL 3PWLA 1DR9A 1K8DA 4NQCD 1VESA 4GMTL 1ADQA 5J1SC 2R2HB 4Q9RH 3GSNB 4A6YB 4I18B 1RURH 3F65A 1QLEL 4G7YL 1GGCH 2NY1B 3DI3B 4JR9H 4UB0L 3BIKB 2YR3A 4U2YA 4HKXB 3BQUD 3HZMA 2EDNA 2PTVA 3LV3B 5TE7H 4MVBC 5T1MA 1Z9OA 5JLZA 5F7NC 3MJ9H 4G9DB 5D7LA 2YD2A 5GRWA 3TBYB 4U1IB 2NTFA 2AP2A 2P7TB 1NC4A 4I2XA 3UC0H 3QHFH 1VFUA 1NGZB 2BP3A 4M5ZL 3GMNA 5K9OA 4KMQA 3TC9A 4NJAH 4LCUA 3ZDYF 5J1TC 1CDUA 1L7TH 1EAJA 1R3HA 4D9RE 1JZ6A 4ZUWB 1JYWA 3SGKA 1FDLH 2V5MA 3BP4B 4TQEH 5CP3A 4IHOA 1CI5A 4MJ5A 4OD3L 1AO7D 1DLHA 4DOHB 4U3CA 1WWCA 5D96B 4LVHC 4PD4J 2WUBH 1DUZA 4CDHA 5EU5B 4H88H 3MV8E 3V0WH 1NMCB 4EN3B 2Q86A 3I02B 4CVZA 2YA0A 4JJHA 2OCFD 1INEH 1PKQE 1FFQA 5HDOA 4NBXB 4XPFH 1E4XI 4TNVK 3JBG7 4HQQL 4PJEB 2VDMH 3UJJL 1Z0NA 2A6JB 3S37H 5BV7C 1AXTL 2NNAB 5ANMA 4CDGC 3ULVL 2F53A 3MYZA 2Z4QB 3FHAA 5HDBF 1H15B 3ARZA 1P6AB 2JJTC 2H1PH 5F7FA 2FX7H 4OZIB 3V8OA 3CGTA 2DYPA 3QHZL 4L4TA 1JRHL 3MFGB 1MLCB 5FKPB 1X5ZA 1WFTA 4XC1L 1OM3H 2AK4E 5ICYB 4J12A 5DJ2A 3LKNA 3FB8A 4YXLH 1UYWL 4GKSB 4N0UB 3CK0H 5F7EL 5I8OL 4YXHL 5IB5A 5EU6A 3MREB 3OKYA 4PREA 4U1GB 2Y06H 3V52H 4LCWD 5BQ7B 5BO1L 2BFVH 1CU4H 1FYHB 4WHDA 3ALXA 5DEFA 5GJSH 1IKNC 2HJLA 3QFJA 2VUOA 3S5LB 3AGVA 3STZA 4BA8A 2VDLL 3C5SA 2DQJL 2IH3A 3QCVH 5IMKB 3K0WA 4W6XB 1M7DB 1A1NA 2PCPA 4JPKH 1SEQH 2ORBH 3SDCB 3LKSA 3UXFA 3A6BH 5FO7B 2IBBA 4EI6B 4OD2B 3D3VB 3EYUH 3U0TB 4NIKB 4ZO8A 5DD6A 5C0RL 2VR5A 4BUHA 1UWGL 2HWZL 4KKAC 4LLVA 5JDSA 1FZMB 1A2YA 2BCKA 4OZHA 43C9A 1NGPL 1RUKH 2L7UA 4AQ1B 3OKLA 3VW3L 5D7IE 1MH5A 1DFBH 4P2RE 3KDMB 3KHOA 5C09A 2GUOB 2YD9A 1S5IH 1RZ7H 4Q7DA 3WE6B 5CEZL 2GSIB 2ZSVB 1X3DA 4AH2A 3T0WA 1HHJA 3I3BA 4IOIB 3SE3C 5C07D 3MMEA 4NRZA 4K7FA 3ZO0A 4ELME 4YK4B 4Z76B 5KVDL 3MRCA 5IBLC 4QXGH 5D7LD 4ZS7L 3QUXC 3ZL4L 1NC4D 2ZSWA 5GRXG 4JFOB 4XAKE 3O3DA 4HKBB 3FFCB 3LH2L 5FDWB 4HPYH 4FRWA 1Q0XL 4CMMB 4XBEL 4QRRE 1KIPA 2W65B 1EEYA 4R96B 3PG2A 5DQ9A 1TNMA 3GMQB 1XCTB 3GSXA 3IS0X 3LDBB 2ARWA 5L0QC 3KPPB 4G3YH 4MD5B 4QRPE 3UBXI 3HE7C 3BKML 3S88L 3P0VH 1AKJA 3CZJA 3QA3A 3DSNA 4JDZA 4PP1D 1OP9A 2BNRB 4HWBA 2RJMA 3Q6GH 1A7OL 3BZEB 4UT9L 4OZ4B 2Q6WA 3O9WC 2F53D 3P30L 3MRRB 4YHPA 2FHCA 5IUSA 3DIFA 3U9PH 1P6FA 3X3FL 3U0PB 5KVGL 2A6IB 1GCFA 4S1RH 1BWWA 1T21A 5EBWA 2CLVA 4HX1A 1EO7A 1ZXQA 3BP7B 4Q2ZA 2DQUL 2GTZB 2BC4B 1A3LL 1N26A 5INDB 4QOKE 1XZ0A 2Y36H 35C8L 2HFEB 4OLVL 5J13C 4IRSB 4JM2D 3KXFA 3K46A 5AYUH 1V3MA 4GXVL 3I75A 1MHEA 4KI5F 4LKXA 3T0EE 3UTPE 4PV9A 1UM4L 5IEKA 3IKCB 3UTSA 1DVFA 1ZHNA 4YHOL 1LEIB 1P7HL 2DJSA 3U4BL 5FYKD 2AJZB 1JI1A 5DZLA 2ATKA 3MZGB 3SE4C 3MODL 4HK0B 5E5RB 1ES0B 5EBMB 5BRZD 1F3RB 4HIEA 5F3BA 1EUTA 4I3SL 4ZSOA 4L29A 2VDOL 5J89A 4CADB 3IJHB 5JORA 4JHAL 3JUZA 3IRZA 5D2NB 3Q3GA 3UMTA 5IV2A 1HSBB 5C70A 1LO5A 3T3ME 4KROD 3ZT5A 4M7LT 1AI1L 5EO0B 4R2GD 1UZ8A 1HNGA 3EOYG 3HC3L 4HEME 1SJEA 3PDDA 1FZOB 2OL3L 1BIIB 4M03A 1ZSDB 5C9JA 3CSBA 1TNNA 4O51B 2VZUA 4Z0BL 5GGRA 1I7UA 4NKQB 2NY4D 2F54D 4RGNB 3RPIB 2DKUA 4QEGA 2HTLC 1JWMB 4ODTH 1XCQA 5DSCB 3JV4B 4L3EB 1DDHB 1T22A 3IXTA 3KPSB 3SDXB 4I0CC 1UWEL 1B90A 5CEYA 1FNGA 3M45A 4L8SA 1YUHA 3WD5L 4NQVB 4Y16A 4EI5C 2M8XA 3MBEC 1N3NA 4PJ5E 3P11L 2NXZD 1BBDH 2OS7A 4YE4L 1RZKH 3GSUA 4LP4A 4OKVB 3VFVA 3KYNA 4FXLA 1MLBA 3MLVH 2NZIA 3FT4B 4IMLA 4GKNB 1XR8A 5LGJA 3QUYD 1K4CB 3TN0A 5ADPH 4CU7A 4HIXH 1U42A 2ZUXA 3D9AH 5GGTA 5SX5K 3X17A 4IOFC 2IMNA 4X9GA 3SDAB 3WSQL 3ZE1E 4CL7A 1AD9B 3IFOA 2AXFA 1E4JA 5E00B 5C0DA 1Q9KB 5F8QC 5GGRY 5F93C 3X14A 4NKIH 4D94A 5HI4C 4HXBL 5DJAB 1OAZH 1J7VR 4X5XB 3V95A 3MXWL 4P3CL 4E42A 4P2QE 3FCTA 4PRBB 3ROLB 3I3DA 5DO2D 2FIRT 1KNOB 5A16B 4PGJA 4KJQD 5IK3A 2IAMB 3VXSE 1UA6H 3BPCA 1QLRB 3PP3H 1CFTA 3PL6C 4K8RL 5HPMA 2H2PD 3KXFD 3O3AA 1JGEB 3RDTB 5CD5C 1NEZG 4YC2B 5E94A 3THML 2X4TB 3MOBH 1JNLL 1BOYA 3UTSD 2QJDA 4Q97A 1WEJH 2YN3A 1T66D 4DTGL 1AFVL 2Q7NA 5I73C 2BHYA 5KSBE 3C5JA 1QFWL 3INUL 2X1WL 1VKXB 5DD5H 4YFLF 5ADOL 2HT4C 3FQUA 2ATPB 3VXRB 1CFSA 4X0KA 5CINL 4IRJA 4FZEL 1A6WH 4PJ9C 1NAML 2Z92B 4OF7A 1YEJH 3N1GC 4KU1A 4NQCE 2G9HB 3QDHA 1HH9B 5E6IA 3UTTA 5I1JL 2DBLL 4GAYA 3JTTA 5GIRA 3F7VB 3P4OA 3UBXB 2BMKA 2BSTB 4XVTL 3B8YA 1MCIA 3WLBA 3H9YA 1TETL 2OQJB 1Q9LA 3K2MC 2NY3D 1DQLH 3F7PC 4DGVH 4ALAL 3RWJB 2VAAA 1BF2A 2PO6D 1A7PL 1CR9H 1S7RA 2DQDL 2VNCA 5JNYA 2C4XA 2CK0H 3MV11 4OLXL 1SQ2N 5ACZA 5KAQF 2D2OA 2PW2B 4HPOL 1K6QH 5HHXH 1NCCH 3LD8C 2VDNH 1MF2H 5FOBB 2DTSA 4UNTA 3LMJL 1KN4L 4LEXH 2FJGB 5CMAA 4XMPH 5IMLA 3FMGL 5ECJE 1EHLL 2IFFL 1F90L 4KDTA 3QI9A 1A6ZB 4DGIH 2R4SH 3VH8B 3LB6C 4JDVB 1JV5A 4Y16D 5DFTA 1AO7E 1F02I 5GS0L 4U1LA 2ESVB 4OCYL 3IFLH 4PPTA 5D5MF 2CKNA 3KVQA 4WHCA 3VCLA 1GL4B 3VXPA 1CLYL 2X2YA 5AZEH 2YUZA 4KKCC 1NL0L 3ZTNH 3HG1D 4H1LB 3H9ZA 4P4RB 4JFXA 4CAGA 4LK4A 4HUWB 4HIIB 3L3KB 1NJ9B 4Z7NF 3QXUA 1U8NB 4EN3C 4GOSA 2MCPL 1ZHBB 3LS5L 3KPQB 1KELH 4PY8J 5I0DA 1WVZA 5E2UL 4BSJA 4QCIB 2X4OA 4PRNA 1TTUA 5HHNA 4P49A 4X8JB 1J1XL 3PF2A 4WWKA 5I8CA 4MWFA 4UQ2A 4XRCA 2XACC 2R29H 4PP2A 3G5VB 5LAXA 1R6VA 2I9TA 1K8IB 1YECH 4OTXH 1RUPL 4H8WL 1Y6NR 3MA9H 3C6SA 3T65B 4FFWD 2NY7H 5ID1A 1E28A 2NY2B 4Y2OA 5ESQA 1OY3B 1PZ5B 2PTUA 4JFYB 2BY0A 3MCKA 1UFUA 2FLRT 4P5TB 2JLLA 1IM9A