3WXVL

Crystal structure of the human adiponectin receptor 1
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNFLAWYQQKQGKSPQVLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQQFWSTPYTFGGGTKLEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adiponectin receptor protein 1
publication title Crystal structures of the human adiponectin receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/immune system
total genus 23
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wxvL00
2O5YH 3BPNC 3ES6B 5EO0A 2DIBA 1BBDH 2L0DA 1IAIL 2LQRA 3FFCD 1OTSC 3EOAA 4CADB 1QP1A 3LQZA 5FV2A 5IIEB 3QUXD 1BGXH 2JB5H 5F9DC 5A2LH 1CFBA 4D2NA 3O3EA 1LEGA 3U36A 4PRDB 1DBKH 3LIZH 3LY6A 5F7EL 3EYSH 2E9BA 4HK3J 1R24A 4QY8A 5E95B 4XPAH 2X4SB 5D7IF 4P5TD 3FT4A 5GJTH 4PY7A 4HZLB 5EULV 2WIMA 1RPQA 4APQD 2H2SC 4RX4A 4KROD 3ULSA 2DM4A 3TV3H 4D9LH 4KQ4L 3VMNA 3ZYOA 1GIGH 2FJHA 1IJ9A 3ZDZE 3ARBD 3WNMA 4F57H 3O6LL 4NRYA 1P69B 4PJHA 2YC1A 4CN4A 2BNQB 4OZHE 2O5XL 5EU4B 3QHZL 3TBVB 5BS0A 1OP3H 4M8VA 4L3ED 4UIKL 3RAJH 3MV8E 1TCMA 3MJGX 1NCBH 1ZKAA 2IF7A 4N8CH 4MS8C 2HJFB 3F58L 1QRKA 3QIUA 3D18B 4GKOA 1DUYB 2FIKB 2YD1A 2BSSA 1FLRH 2WK2A 2IH3B 1JHKL 4QNPE 2P45B 3BZDA 1I1RA 5C9KA 1OHQA 2YPKB 4PRPB 5E00B 4FFZL 3OZ9L 1IAMA 5T1LA 1MNUL 2WV3A 2ZUYA 1VFUA 5ITFA 1HH9A 1QBLH 3PWLA 4PBXA 4XNUH 3TT3H 4YK4C 4GRWB 1CFQB 3CPLB 3MLZH 1YJDH 2FEDD 5C1MB 3JV4A 1BFTA 1YDPB 3NBNA 4XP4L 2BDNH 4KVCL 2Q7YB 2GTZB 2BMKA 3VRLF 1A0QL 1HOCA 3HG1D 5I74B 5D96B 1R3HA 3GMMB 1DN0B 4BZ1H 3NABH 1DQML 3RTQB 1FFOB 3MRKA 3IU3B 2WWKO 5E2UH 3RWDA 5IQ7L 3BI9X 5C2BH 4N5ED 2BHYA 4XBPB 4YFDB 4AL8L 5FKAB 2FECL 4UQ2A 4X4XA 4MVBD 1HWGB 3TZVB 1DSFL 1X5GA 1FAKT 4WWKC 4X6BA 4MLSA 4DUWA 5E99L 3KR3L 3H7BB 3OSKA 5EN2A 3GBNH 4XCEA 1AO7B 3DRQA 4DW2L 4QXGL 5BV7L 4GS7C 5DTFA 2I9TA 4RAVA 3WSQL 5HGHB 4XTRC 3JVGA 2NY2C 2VC2L 5KS9B 3S88L 3BZ4B 1MFAH 3HNSH 3OXRB 3JV0A 3U1SH 3I6KB 1MIEH 4QWWD 1MHHA 4HDIB 4NQDA 4PJ7F 3JUZA 1Z6JT 2DYPD 2J8UF 1QSFD 4TSCL 4HKXA 1HCFX 3FO9A 1QBBA 3GMOA 1BD2D 1AHWA 4JRWA 5E4IA 3DVGA 3D87B 3FMGL 2Z8RA 5EUOB 1B0GB 3KS0J 4LSSH 4WW2F 4FXGB 4NFDA 1MHEB 1CXIA 3SKUD 2W9EL 4XXCA 5B39A 5I75B 2GK0B 1DE4A 2XZAL 5IM7A 3VW3L 3KPQB 3UBXG 2VDKL 1U93B 4JM4H 3RWJA 1X5AA 1RY7B 4Y2DD 3VXOB 1MFEL 1ZEAH 2R8SH 4MJ4A 5H37H 4LP5A 3F5WB 3PGFL 5K33A 3TCXA 2AK1L 2HKFH 3T2PA 5EBGA 3AREC 5FCUH 4RMUA 1A7PL 1OGAD 4F15B 3GIVA 5T1DH 3MA7B 4D8PA 1B3JA 1A14H 1DCLA 3UCRA 2F54B 2JTDA 1RZIA 5JXED 3G6JF 1MY7A 5HYEA 5AYQA 4MD0A 1RZKL 3FOLA 3KPSE 5MP6H 3IKCA 2DI8A 4PYGA 2Z31A 4I48B 1KB9J 1VFBB 3T2QA 4UQ3A 5E6ZA 2AEPH 2VLKB 3K8KA 4OZ4A 3QI9D 2GAZA 4R0LC 4LKCA 2Y5TB 4JAMB 4LCIL 3WFBL 3DX8A 3U6RB 4FRWA 1E4WL 3RPIB 1XIWD 4YXLL 3VXTB 4X98A 2KPNA 4JVWA 4PV8A 5D1XC 5GIRB 3L3IB 3KHOA 4QHKJ 2ED7A 1EIBA 2EXWC 4Z77B 5KSAD 4IEFB 2YKLH 1GGUA 3EYQC 1PQZA 1QFWM 4G8GB 3QNYB 4Y88A 5TPWL 3OMZA 1Y6KR 1P7KA 3WHXB 1EO5A 3GIZH 4AM0B 3UTTD 4ZYKB 1A7OH 3I50L 1CVRA 1IC7L 2X1PA 4YGVA 3BKML 4RIRA 4QEGA 2HJKB 2JJVA 4MJID 3HI5H 2B1AL 1EH9A 3K8LA 1IRAY 2CUHA 1VHPA 3VRJA 3GMNA 4LLQA 5I1GL 4LDEB 3WHE0 2X1OA 1KC5L 2OI9C 4YDKH 4Z7QF 2YR3A 4I9WD 3O9WA 4LLYA 1R5VA 5A2JH 1OAKH 3CMOL 4LSPH 4FFYL 1EHXA 5D2LE 5J3HD 3I85A 4MHHI 1MHCA 4WEBH 3BFOA 5CP3A 43C9B 3F7QA 3QNZA 4FQQA 3T3ME 1CG9B 5BMFH 1QFWI 4RA0C 4K3GA 3BO8A 1IEAB 3SDCC 5F7UA 1OTSD 3GK8H 3LS5H 4HKJB 2PXYB 1U58B 4HIXL 4LGPB 3IJHA 4MWFB 3IF1B 3QXWA 1P4LB 3HAEG 3SDYH 1T1ZB 5HY9A 3TA3D 1JF6A 2VLJD 3W9DB 2DTMH 3BUTA 4MD5B 1CE6A 1N6VA 2RR3A 4P2OD 3L5WA 5DRNB 5ACZA 4CVZA 1UZ6F 3CAFA 2XZCH 1EEZA 3OG4B 4JQXC 1J11A 4YGAB 4F7MB 5IROC 3OBAA 4DK3A 1FO0L 1QRNB 5ESVB 3MRBA 4DZBB 1G6VK 1B4JL 5IJVA 2G2RA 1I1YB 4M8QA 5J13C 3ULVF 4JM2D 2W60A 3LZFH 4LRIC 3DX7B 1LO4L 4HMEA 2P47B 5D71L 1TCRB 4ZTPH 3T0EC 1AE6L 3SBWC 4GAJH 1H15A 2DLEA 3VFNA 4F8TA 4S2SB 1U8LB 4EI5D 1RZGB 3FHAA 5IGXL 2NY5H 4ZUTA 3G5ZA 4MS8D 3GSWB 4FQLL 3T09A 5MEOA 4XWGH 2QQNH 3EOTH 5IMOA 1ZT1B 3QCUH 1SY6A 5ALBH 3HTLX 4F7EA 4HWEH 2VDLH 3D39D 1KB5L 1GGYA 4QCIB 3BKJH 4HPYL 3P4NB 5SWSD 2CKBB 1Q9KA 3FO2A 1MWAH 2IQAA 3GJFH 4GW1A 2JJSC 1P7QB 5KJRL 4IM8A 4RZCB 2HG5A 5DVKA 3C6LB 3L3JA 4Y4FA 3IDXL 4JGJA 2A83A 1KJ2A 3C6SB 1RIVL 4H1LG 1BAFL 3HMXL 3IDIB 1UFUA 2ZPKL 4RGOH 4H26B 3TCLA 3MRJB 3BE1H 1NMBL 8FABA 5CGTA 1QFUH 1FVDB 1ZLUH 2IWGA 2NCMA 4MDIA 5SX4H 4NC0B 4NBXB 4NQSB 3HB3D 4BQ6A 1FVEB 3QUZB 5CMAB 5JHDA 1IE5A 1AQKL 4BH7B 4U1IB 4Q9QH 1V7NL 4WWKD 3SKJH 4C56B 4HG4J 5HD8C 2JK5A 5IVXE 3QQ4B 1F6AB 1JN6B 32C2A 4N0CC 1SYSA 3L7EA 4PJHF 2PO6A 4A2MA 1P84J 4NQEB 4Q74A 1EEUA 5DJAA 4BKLA 1EFXB 5GZOC 5L2JA 1CFNA 5E70A 1CIDA 1IT9L 3LD8B 4XTRD 2NY2D 5DUBB 1XH3B 3ESVF 5H2BB 4Y1AD 1DL7L 4I0KA 1IGFL 3N1FC 3KAAA 4LLMB 3C60A 4LRNL 3V4PL 2UY6A 3WNOA 4FQXA 5DS8B 1H0DB 3VGBA 4WHTB 2H32B 3GZKA 4OF3A 3N1GC 1G7JB 2DDQL 4JGMA 1EHLH 3MOBH 3TT1H 5M94B 4OIAA 3GB7A 3WJLC 3V7MA 4G6JL 4LPYA 4ZD3L 3QRGL 4P9HH 1DR9A 4XPBL 4DOHB 2XI9A 3ILQC 4ZS6C 1ZK9A 2PYEB 3HE7B 2J88H 1AKJD 3ARED 1GHFH 4H0GA 3BRFA 1P2CB 3PWNA 1NSNL 3DXAA 3PP4H 3ZE1E 4PJ7B 2BNQE 4HUMB 3TPUB 2APTA 5DJ8A 1NGYA 5IWLC 3T1FA 5KN5B 3T2OA 2B7DT 4NRZA 3MBEB 4NQCB 4DKAA 5DQJB 2PUQT 4X9IA 4KRLB 1JGLH 5BXFA 4H5SA 4KPHL 3RNKA 3WXVL 5I8CB 4NOBA 1GGBH 5HPMA 5KVDH 3FQWA 2NQCA 2V7NB 4QTIH 4I2XA 4JFHD 4PJEB 3V4UL 5C6TL 3G9VA 1C5BH 5JR1L 3WS3B 4PRPE 1CF8H 1YN6A 4GRWH 4EQ2A 2QQKL 1QHOA 1A5FL 3IETB 4MSWA 5GRJL 5D1XD 4YAQA 2XWBB 3B9KC 2JB6B 4GRWE 2CRZA 1DLHB 3O11B 1ZXQA 4UILL 3HZKA 2J6EA 1F5WA 1WEJH 3CH8A 4Z0XB 3EYQD 5J1SC 4YBQD 3W9EB 4XNZC 2XKUA 3WLBA 5ITBL 5DQDL 3G6JB 2ZUVA 4RRPA 3I2CH 4E42A 3H0TB 2C3GA 5E2JA 4CVUA 5CKAA 3W2DH 1QBML 2EYSB 4HS8L 2FD6L 4U0RB 3N1PC 3GHBL 4U6VL 5IEKA 2NXZC 4LEXH 3S7GA 3QCTH 1PKOA 1J0HA 4F7CB 4Z7NE 4MYWB 2VN4A 4LCYA 5ENWB 3WLWC 4RGMB 3VXSA 1Q0XH 1AO7E 3G6DH 5J12C 1YY9C 4F7PA 4FQ1H 5AWNL 3GI8L 3GEWB 3MJ8A 5SWQA 3IJYB 2NX5A 3OKEB 4FTVA 1KT2A 1M71A 3OKNA 4J4PA 5KS9E 1A3RL 4J6RL 4F7TB 2O5ZL 1JJUA 1SJXA 4NUGH 5F7NC 3IRPX 5MHSD 4LVHC 4L8BA 1FNGA 2D4DA 3U2SA 3SDCD 5IOPB 3D5OF 5AD0A 4LHUB 3ULUF 2VKXA 2VRAA 4LF3A 5EIQA 4NQVB 3RL1A 4K07A 4E41A 1JUFB 2AV7A 5EUOE 3BD5A 4MAUH 1URLA 3VXPA 3CMGA 4NDMB 4DGIL 3T04D 4F2MA 3E8UH 4FQJL 4WY7L 4P46A 4O4YH 4EDXB 5E24E 4LLDB 3QQNA 3RWEB 1TQBB 4U2ZA 2DRUA 4WHYH 5I71C 1D6EB 4HT1H 2BFVL 3QCVH 4M1GH 4OLUH 6FABL 4HHAA 3ARFC 5DHXB 2FLRT 2OMNA 1RJLB 2VDQH 5EU5B 1FNHA 5TE4H 4XP5L 3AB0B 1ADQA 4KI5E 5E94B 3ARRA 1CN4A 2BRRH 4JGUA 4Y16C 4CMHB 2UUDK 5J06A 2X9XA 1FGVL 3LKNA 1T5XA 4GMSL 1E28A 2IBGA 4HS6A 4R6UA 4ODXA 2F19L 3T0ED 2F54E 3UC0L 4F80A 1ORSA 4IS6B 3UJJL 4PP2A 1RVFL 3D85A 1E6JH 3AXLA 4Y19D 2VLLB 3W11D 4XC3H 3QZWA 4JDVA 4OZIB 3BIBX 3CU7A 1S7VA 3ARDA 1NUNB 4NWTH 4XVUC 2VLKE 2AJXL 3MROB 2MFNA 1CZ8H 4M5ZH 5DMKA 3QIBA 1N0XH 5BOPA 2ORBL 3AAZA 3G04B 1OD7A 4CVXA 5CCKL 5JW3H 3FQXB 1UCTA 1YJDC 4UB0L 4UAOB 3P9LB 2QEJA 2PW2B 1UJ3A 3BT2L 1FNEA 2OZ4L 2V2WB 3IDJB 4HEME 5DO2C 5HVFB 1CLYH 1J1OH 1WWAX 4X4MA 3SO5A 4M61A 3DV6B 3SGEI 5C8JA 2B2XL 4G8GE 4N0YL 4PRNA 4YR6B 5I30H 4R90H 2X4OA 4K3DH 1MQ8A 3HNTH 2HTLC 5HYSG 4ODUB 1CFVH 2H8PB 3P4OB 3MREB 2KBGA 2UVEA 2XNAB 5JNYA 1G9NC 2VXQL 2ZG1A 2GSIB 1GH7A 3WL9A 5HD8D 4LPCA 4WHDA 5FEBA 2WIIB 4N0CD 1Z3GH 3JWOH 5MERB 4YZFE 3ARPA 3O2WH 5EO0B 4Z5RA 3L6FA 3LAFA 5DI8B 4G9FA 2E8ZA 3VXRA 3WUWA 5C7XL 5GZOD 3EOAB 1J7VR 1R3LA 5AUMA 1CK0H 1LK3L 1MCSA 3WV0A 4LCCA 5I1KL 3EHBC 1NCDH 2V5SA 3O3EB 3U36B 5DR5L 3TEUA 1VFAA 1FG2A 5EH1A 1R6VA 2B1HL 3U9PH 4LGSB 15C8L 1IKFH 5F1IB 1IGCH 2C1OA 3GI9H 1R24B 4Q9RH 3I3DA 2DJSA 4QY8B 4PY7B 5J56B 3D2UD 4KHXH 4KVNH 3O0RH 2XPGA 1ZT7A 1MJUL 3P77A 4EZMA 1QFWH 4ZNEA 3QDMA 3TM6A 3GKWL 3R1GL 4PJHB 2YC1B 3ZKXC 3E6HA 1V3MA 3ILQD 5BS0B 3PP3H 5FYLH 1QPPA 1QA9A 1JHLH 4RDQG 2APFA 2CJUH 1QRNE 4KJPC 3GRWL 4X4YA 2NLJA 4DWHA 3ARSA 1BOGB 2BSSB 5HVHC 5D6DA 3RVXC 4YWGL 4NPYA 4NM4L 1WBXB 3K46A 3MLVH 5KW9H 1CD8A 4D3CH 3VFPB 4M62H 3S5LA 1JPST 4RFOL 5AZ2H 3QQ3A 5ITFB 1HH9B 3PWLB 5D1QA 2K7PA 4HSQA 5C0NC 2F5BH 3OQ3B 2ID5A 5TF1H 3S36X 2N7BA 3WFZA 4UTBH 4AIXA 1NDMA 2BMKB 1HOCB 1R3HB 5TQ0H 3TBWA 1MCWW 1PEZA 3L1OL 4KKLC 1RUKL 2Y72A 5EZLA 1A1MA 3MRKB 2X09A 3KWWA 3IB4A 4FQCL 3IXTA 4XVJL 3LKRB 3RWDB 1INQA 4QRPA 1JP5A 2Q8BH 2EH7H 4NCDA 2BNRA 4UQ2B 4X4XB 4H88H 5CZVL 4YDVA 5I1LB 1VFMA 4ETYA 3RWFA 3LS4H 3KS0H 5JW5A 2EICA 2VZOA 3QWQB 1KPRA 4EOWL 3DRQB 1WZKA 5DTFB 5C71A 2I9TB 2YUXA 3GHEL 2IAMC 1RUML 2PTVA 1QLFA 5L0QC 2BY3A 3TH3T 3RZWA 4OT1H 3V7AE 4HEPG 3MRGA 1E4JA 1ZVYA 4C56E 1J10A 4KJWC 1CLOL 1MHHB 4HLJA 4NQDB 3Q0HA 3WLWD 5IBLC 1BZ7A 3FO9B 4HKXB 2NY6B 4NQEE 1YY9D 2OXHA 3GMOB 1AHWB 1UWGL 2BC4A 1FQ9C 4KK9C 3DVGB 2P48B 1RFDH 3U30B 3VE0A 4X7FC 1AGCA 4KHTH 5D72L 1L7TL 1H3XA 3BISA 1EEQA 3HUJF 1NCAH 5B39B 3ARGD 3IDGA 5L2KA 1A64A 5EOQH 1FSKC 1UM6H 1MRDL 1AP2A 3MACH 2F53A 3RWJB 4XHQA 3VRLE 4RA3A 4JHWL 2H32H 4P99A 4ZFGL 4JDTL 1VEMA 4KUZH 1R3JA 3QO0A 1E27A 5GQBA 3CFJB 2QTEA 4GO6B 3PV6A 5F9OH 2VLRA 1GZQA 4YBHA 4YH6A 3F7VA 2VERN 5DMYA 3QAZB 3LSOA 1KFAL 3UTPE 5JQ6L 5I18L 3GIVB 1UKQA 1XFPA 3LDBC 4OCNC 3MX0A 3RY6A 1ERNA 4DOHE 5L6YH 2H1PL 2X4RB 2PYEE 1RZIB 3ARFD 3WNNA 3MV8D 1MFCH 2FX9L 4MD0B 4JFEA 5LG1A 3C2SA 2HVJA 3RZCA 1Z9SA 2Z31B 4QXWA 4UQ3B 3G6AA 4NZTL 4PJ7E 3V4VL 4OZ4B 2NY5C 3HC3L 4OLZH 1B4RA 5F7LB 4LKCB 3IJSA 2N56A 2AI0L 4NQCE 4OLVH 3DX8B 3F12A 2RGSA 4Z7UF 4WFHD 1SEBA 1CDIA 4PV8B 3LQAL 4LCUA 1C8PA 5F97E 3WFCH 1ZLSL 4XVUD 1J0YA 1EXUA 2NY0B 3DTXA 5K9JL 4PJEE 4CN6A 5E08L 5C07A 1PQZB 2V2XB 1N64L 1QSVA 1JTTA 1WSST 1NCTA 1P7KB 5F9WC 2FIRT 3A6CL 1OM3H 4MDJA 1NMCC 5HHOA 2A1WH 1JWUA 1QUNA 5DO2D 5E5UB 1OAQL 5GRXG 1QNZL 2EDLA 4JKLA 1JWMA 4UBDC 2NY3D 4GMTL 3H3KA 3VRJB 2YD9A 1OW0A 5DJDA 5DZNA 1OSZA 4TN9A 2XWJA 1NCWL 4Y5VC 2HTLD 3Q1SL 1T89C 3G6JE 5D7JC 4OSUL 2P24A 5JOPE 3LHPL 3O9WB 1MOEA 3OR6A 1R5VB 4LLYB 5CINL 4Z95H 1ZHKA 4NHCL 5JUEL 2IPKA 2BSTA 4DKEH 5E6ID 1MHCB 3ECBA 4GLRH 5HHVL 2XG4A 4FQQB 3QNZB 3WFDL 2CRIA 4XB7A 3C5ZB 3A67L 1W0YT 3Q6GH 3BO8B 5GGSB 5ABDE 1SM3L 1BQHG 4C57C 1D5BA 5C0BA 2IANB 1NEZA 4KKAC 3EHBD 2O5YL 1AGFA 3IJHB 5E8EA 3G5XA 4OCYH 4OGAC 1G6RA 2FO4A 1VGKA 4G6AC 2CR3A 1EAPA 2X42A 3CXHK 1CE6B 1BGXL 2JB5L 1A7NL 4JFXB 1A9EA 3L5WB 1BECA 5ACZB 4CVZB 4PR5B 4JLRB 1JK8A 1U42A 4ZXBD 1EEZB 4OBSA 2WBJA 3IDNB 4MJ2A 3VDCA 1T03H 3EYSL 1RURH 3AU1A 2QADB 1MRCH 1KLGB 1KCVH 3RJDA 1HWHB 4P9HC 3CFCH 3TBSB 3MRBB 4DGYL 1XGPA 4P3WA 2G2RB 5GJTL 5IJVB 4M8QB 5K9OB 1H3UA 1IC4L 1DBJL 5F6IB 3LH2H 3HE6C 2W60B 1S8DA 1PSKH 2ZCHH 3TPKA 1GIGL 2FWOB 4PJXA 4Z7QE 1H15B 3VFNB 3K4AA 3QHFH 3G5ZB 4LSVL 4MNHA 5LGJA 2FATL 1YMMB 4KU1A 4LSRH 4NO2A 1M7DA 2PNDA 1BJMA 1NDGA 3KPSD 4K3JH 3RIAF 4KI1A 3BRDA 3RAJL 2E7LC 5IMOB 1GYAA 4XMKH 1NCBL 4F7EB 4DZ8B 4UINL 5FGSA 4YBLB 4HQQH 1OAXH 2W0FA 1RZ7H 5B4MC 3OL2A 4RISL 3Q2CA 4JG1H 1TZIB 3D25A 4K94L 1Q9KB 5DUPL 3FO2B 3DUUA 1FLRL 4GW1B 5FECA 2DN7A 2P1YA 3BH9B 2HG5B 4OZIE 3KPRB 5C0ND 4Y4FB 2HFFA 1F4WH 2ADIB 2A83B 4I3SH 5HVGB 2LE9A 4IMLA 1C1EH 3U4EA 2XRAL 4W81A 1Q72L 1UZ6E 1EDQA 1RV6X 4XNUL 3WYRA 5I74C 8FABB 5D96C 4KKLD 2OQJA 2YD2A 2DD8H 3RTQC 2XACC 5GGVH 1I3UA 1UM5H 4G43B 3FB6A 3C08L 5DJCA 5JHDB 3TYGH 3NABL 1Z5LA 3CSPA 3ULVE 3ET9F 5E2UL 1LVEA 4FQ2H 3TZVC 3EO1B 1UXSB 32C2B 3L7EB 1IM9D 2ATKA 5DJAB 5L2JB 1LO5B 1CFNB 3O2VH 5DJXA 5ADOL 2IAMD 5CJQH 2D2OA 4XNMA 2H6PA 2DQDH 3VFTB 3SGEH 4KJWD 2Q7NA 4WI9A 1WWCA 5IBLD 4OTXH 3HNSL 4FQXB 4KK5C 4KK9D 4HW6A 4YXHL 1I7TA 3VI3F 4X9GA 5DZLA 2X89D 4WVRA 4GRLD 1SMAA 2ARJA 5I75C 2E9IA 5GRVL 2PTTB 3QXAA 3GB7B 1WFOA 2VN7A 1WFTA 2VISA 3G9AB 1B2WH 1FV1A 1MQKH 4LSSL 3BP5A 3D48R 4OZFA 1AH1A 5BO1H 4NCC1 3JBG7 1KEMH 4D9RE 2ESVB 3O6KH 1P9MA 4JM4L 5KVGH 3PWUA 4JZOB 2DLHA 25C8H 4XNYH 4UNUA 2ICEA 2R8SL 4LSDA 3PWNB 5CD5C 4U1MA 2VE6A 3TVMA 1NC4A 3FZUC 4PJHE 2C9AA 4DCQA 4ZUWB 5DJ8B 3WIIH 3D6GA 5BS0E 4QT5A 3QXDA 1A6UL 4M43H 2FZ3A 4NRZB 4S1QL 5CD3B 1BF8A 4LLAA 2MJWA 4G9DB 2BVYA 4U1HA 5BXFB 2R0LL 2Z8VC 3HUJB 4P4KA 3RNKB 3JUYA 3KPPA 3OV6A 2X4TB 3FQWB 5GSVB 5IF0A 2ZCKL 4C54A 3K2MC 2W91A 4I2XB 2G9HB 3PDGA 4Y0GA 3GBMH 5MP6L 1T4KA 3D3VD 1WUNT 3B9DA 5JOFA 1DLFH 3OKMA 1KCSL 4MSWB 3CC5A 4YAQB 1BHGA 4HJ0C 4KDVA 4ONOA 4LSQH 5FFLA 1GOFA 4UDTA 3HZKB 1F3DH 1NH6A 1GC1H 3PGCA 3FFDA 3KYAA 3NPSB 3WLBB 1ZAGA 2X7LA 1IARB 4E42B 2NTSP 4X9FA 1KF9B 3DARA 4WUUA 1TMCB 4BK5A 1JI2A 4HBCH 3BPLB 3RIAK 4UBDD 4A6YL 5IEKB 5DJ6A 3U7YL 3O3UN 3W5NA 4MB5A 4PG2A 2HP4A 2MKWA 3PQYB 4LCYB 3VXSB 2JJUA 3NOIA 3HI5L 5D7JD 3JZ7A 4Z7UB 1NAKL 2VO5A 2DKUA 3MJ8B 4NKDA 4LK4A 5SWQB 5DGRA 3L5XH 2NX5B 3JWOC 1TJGH 4U49A 3H9HA 4M6OH 4FTVB 4BQ9A 2C5DC 5E4EB 4YHML 4YDKL 1F2QA 4LKXA 4QRRA 4PP1D 1TJIL 4GW5A 4RFEA 1I1AA 1G9MH 4AEHH 4NQDE 1OAKL 5IB1A 2GSGB 1WV7T 1UVQB 3DGGA 5I8KH 2HKHH 2KZWA 4L8BB 1FNGB 3U2SB 2EE2A 3MRCA 1KACB 3RL1B 4E41B 4KKAD 2AV7B 1DBML 3VXPB 2PXYC 2YWYA 4E5XA 5EZOL 4G6AD 2C4FU 4P46B 3RX7A 1SBBA 4PJ5A 1WBYA 4TNVF 1M4KA 2FR4A 4UIMA 2OJZL 4WFFE 2V17H 3ZMRA 5CSBA 4HHAB 2CGRH 3QUMA 2ENYA 4P57A 3U4BH 4O2FA 1JZ7A 2X4QA 5CSZA 4LLUA 1MVUA 3GNML 3EDKA 1U3ZA 4JJ5A 3SDAA 1MCJA 3BEVB 3LKNB 1T5XB 1E28B 2BNQD 2GJ6A 1CFSA 4JQXA 2B39A 1ORSB 3DVIA 4OKVA 4PP2B 3D85B 5IROA 3BYTA 4JFFA 2CIKA 3KPOA 2ZWLT 3C5JA 3LZFL 1J87A 3QZWB 4F33A 2XXCB 1R5WA 1S7VB 3ARDB 4V1DD 3ULUH 3FQRA 4LRIA 4M6AA 1EBPA 3MODL 4OCMC 1Y18A 3BP6A 5B4MD 5TE7H 5DMKB 3NH7H 3ULUE 4ZFZA 4OJFL 4PRPD 3QCUL 5L7XL 5ALBL 4U4BA 1UJ3B 4R9HA 1CU4H 1FNEB 3HNVL 3KLAA 1C16A 4RMQA 4EUPG 1IC5H 5EFIA 3I84A 2F9BT 2JLLA 4NKOB 3ARUA 3CVIH 1MWAL 4P5MA 4PBVC 2QQLH 5JA8B 5JPMB 1KN4L 2K3TA 5C8JB 4F3FA 4NQXB 4PRNB 2X4OB 1PJ9A 1NBYA 2Q3AA 2FX8L 1PX3A 1OARL 1LP9A 3RTQD 4Q97A 5J1AA 2C3WA 3D69A 2FNBA 1LEKA 4RGOL 4MNQA 1QVOB 3UTSD 2XKNB 3QUZC 4RBPK 2Q8AH 3TZVD 2R9HC 1DANU 4UT6H 4IRZL 1CQYA 3PJSA 5CHNA 4HAGA 2A73A 3DHJA 5CJXC 1JL8A 3L6FB 1W0VA 1TXKA 4G9FB 4K7FA 4PIRF 3VXRB 3WUWB 1AO7D 2X44D 5HDBF 4EQ3A 4PJXF 4Q9QL 1UYWH 1R3LB 5AUMB 2OL3L 1E6OL 5CP3H 4LCCB 4XVSH 1FPTL 3LD8C 4H8WH 1VFAB 4YE4H 2WMPA 3AM8A 1INDH 2HH0H 4NNXA 1EPFA 4KZDH 1WICA 2C1OB 4ELMA 1I3VA 4YHKH 4J3SA 3SOBL 1SQ2N 2BJML 2IANE 2OS7A 4Z7VF 1A3LL 1AGEA 3DECA 3BKYH 3MUJA 4ZTOH 2XPGB 2YK1L 5FK9B 3AY4C 3E1F1 3EW3B 3KJ6H 4HGKC 5DQ9A 1JWSA 4I0CC 3UP1A 4LQFH 3QDMB 4RMTA 1N8ZA 4MA7L 5K9QI 3TIDA 3IFNH 5E5RB 1W8NA 2DS4A 3E6HB 3MOBL 4MGXA 1I75A 1FN4A 2ZCLH 1QA9B 5I1DA 1KTKE 2AK4A 3HE7C 4P2RA 2L7JA 4JO4H 4DTGL 1OL0A 4TYUA 4K7PL 4PGDA 5E2VL 5CD5D 3WJLA 4KJQC 2NLJB 4AIOA 4KI5D 3FZUD 3NFPA 4WO4D 5LAXA 3CFBA 4JPKL 1GHFL 2CLZB 4C83A 4NN5B 3MA9L 4NPYB 1RMFL 1YEIH 4S10A 1CD1B 3MBEC 4X6FB 3S5LB 1SY6H 4LU5L 1YMME 1ZANH 4Y5YC 5D1QB 2A74A 5HGAA 3RGHA 4WW2C 2DBLH 5IESL 2KDGA 4P3DB 5GS1A 3QO1A 1FNLA 3OJ2C 3RVVC 2VLKD 1A8JH 1NDMB 5IWLA 4WCYH 1WZ1H 3HAEA 3EO9H 1GGBL 3SDXA 3TBWB 5KVDL 5HI4C 4XCFL 1LWRA 3P0YL 5EZLB 1A1MB 3AS2A 3KWWB 1X7QA 3IXTB 1ND0A 1INQB 4LNRA 4NKMA 4QRPB 4HJ0D 1QSEA 4F37F 3N85H 2X5PA 1CGSH 4NZJA 3OB0K 2BNRB 2OP4H 5I1EH 1T66C 4M6MH 1CDCA 3RWCB 2LTQB 4G80A 5EC2A 4OCSH 1DDHA 5JW5B 1F97A 1KPRB 1TZGL 5I16A 2YN3A 4TTDD 1T0NA 3MGAA 1AD9A 4PJ8A 3B9KA 4KTEL 3D1MC 1GAFL 5JHDE 1QR4A 4JO2H 3LB6D 1UM4L 2DQTL 5GXBB 1VFOA 2VR9A 4H25A 4PGCA 2RIKA 4U0RC 4NO0A 2FRGP 3RVWD 1I8KA 1OT2A 2R1XA 2XYCA 1OCWH 5L8JB 3WKML 2WLZA 5HDLA 1BZ7B 4RGMC 2KQMA 3E6FA 5IVNA 3CVHA 2BC4B 1E4XI 2XTLA 3VE0B 1VSCA 5GS0C 1Q0XL 4QRUA 3QFJA 2IGFL 4OD2A 3THMH 2HAZA 5LBSH 1CQKA 5DD1H 3IDGB 2R1WB 2OCFD 4U1JB 5C0GA 4GXVL 3RDTB 3S34H 1AP2B 2F53B 1EA9C 1J1PH 1LNUA 5LQBH 4HF5L 4XMLH 2D7OA 2VYRE 5I1CH 1R3JB 3B3IA 3QO0B 5CUSL 2R2CA 3PV6B 1A21A 4HXBL 4Y4KB 2VLRB 1GZQB 3B4NA 3P4MA 3V0AC 1YC8A 2B5IB 5E7BA 3LSOB 1RSFA 4IHOA 3CX2A 1I9JH 4PB0H 3BDYH 5JDSA 5IHLB 3DPBA 5GHWL 1TQBC 5JPNB 4PGJA 3GUTA 3KYNA 2ESVE 4O4YL 3IVKA 4N1HB 2QV2A 4NWUL 3U0TA 5ADPL 1HIML 1QRND 3QCVL 4M1GL 1A1OA 4O2CA 2HVJB 5FYLD 3RZCB 1W8OA 3IFLL 2EIBA 1SBSH 1JV5B 4IJ3B 3WO4B 3G6AB 1B90A 3MGTA 3W0WD 2VDQL 4CMHC 5TE4L 5FGBC 3PXHA 4I3RH 1VPOH 4OM0H 3F12B 4XPTH 5DMIH 5H37G 1GCFA 2BRRL 1EGJA 2X4UA 3RRQA 4UZGA 3S37L 2KZ1B 3HUJE 5D1ZA 4YHZH 4LCUB 4LSUL 1T3FA 5F7HA 3NZHH 3PGDB 1G7HA 5EO1A 1EXUB 4Y16A 4Z9KB 1S9VB 4I2XE 5C07B 3RP1A 1DFBH 5GS3A 1YEEH 4L1DA 4ERSH 4X6DF 4F58L 2FLBT 3HZMA 2J6EH 4UAOC 5BCAA 1CZ8L 2AERT 5HHOB 5E6YA 1FZJA 5EUKA 3C6LD 5H35A 2J4WH 3U9UB 1JWMB 4LAQH 1F6FB 4MMZC 5GGRA 2VXSH 1N5YH 1P5VA 5HBBA 3ULVC 2YPLD 4MA8L 1OSZB 2XWJB 3SE3C 4QRSA 2CMRH 4F9LC 1UB6A 1XEDA 5IBTH 3E3QE 2P24B 4WENB 3UDWA 3OR6B 5I30L 1ZHKB 3BAEH 4R7NB 2BCKA 3QUZD 4KY1L 2IPKB 4R8WL 2BSTB 4PY8I 3CIQA 1CFVL 3ECBB 2V5RA 3PQYE 2NZIA 2SEBA 2GITA 3H3PL 5TH2B 3VXSE 2X40A 5GGSY 1CLZH 3MUHL 4NIKB 5EU6D 4NQED 4Z7UE 1EFXD 4UT9H 2ZJSH 5C0BB 1OAUL 1G7PA 1NEZB 4KV5F 1Z3GL 2NX5E 5DEGB 3QUYD 1AGFB 3O2WL 3TJHC 4IRJB 5E8EB 1IILE 3FO1B 3G5XB 4FTVE 2BOCB 2FO4B 3IKKA 1HQ4B 3VMPA 4KQ3H 4NZDA 1CK0L 3B8YA 1A9EB 1NCDL 2IBZY 1CXFA 2WQRA 1JK8B 3CSGA 1HZHH 2WBJB 4E41E 4JN1L 1B9ZA 1IKFL 1BJ8A 1TENA 3GI9L 4FP8L 4JRYD 3CCHA 4QF1B 1XGPB 3OGOE 2Q6WA 1GGIH 4KHXL 3UTPD 1JPTH 5F9JA 1MF2L 1S8DB 3OKLA 2HT3C 1QFWL 4PJXB 4JHAL 2PYED 1BWMA 1ADQH 3HE7D 4JKPL 4NGHL 3ZSTA 4NZUH 4MNHB 3MO1A 5LGJB 5C0CD 2L4OA 4GUPA 4NO2B 2YZ8A 3V5KA 1M7DB 3QDGA 5FYLL 1S3KH 4U0QB 1JHLL 3O45A 2CJUL 5MENB 1PZ5A 5GRUH 2W0FB 1I9RH 4RWHA 5DLMH 4LHJB 3T4AA 1DQLH 3SE9H 4M1DL 3D25B 1NBQA 3MBED 4NQCD 4WJ5A 5IBUB 4LGRB 3H6JA 3DUUB 5FECB 1A6AA 4OCRH 3MCLH 1FYHB 5C0DA 1LGVA 1YY8A 2EO9A 1AY1H 2HFFB 3ROLA 3EOBA 1CBVL 1MJ8L 5A2KH 4IMLB 3U4EB 4M62L 1BM3H 1I3RA 1EEYB 5AZ2L 2MCPL 2NPLX 4GG8A 5AG9A 4P23A 5HI4D 2F5BL 7FABH 2N7AA 3BZEA 5D9SA 2OQJB 3KNBA 5E8DL 3QWRD 3K1DA 2VDOH 1MJ7L 3FT2A 3O3DA 5IEHB 5T3XE 1KYOJ 1U6AL 3T2NH 5C6PB 3BP4A 1Z5LB 4BUGA 4YIQA 4P2QA 3AC0A 1UCBL 4OFKA 5E56A 1T7XA 4AK1A 2ATKB 4G8EA 1QSZA 4H88L 3UAJD 5DJXB 2DMKA 5JOEA 3FHQA 5FM5O 4XNMB 1YQVH 2H6PB 2BK8A 2VDPH 3HZYA 3MJ9L 3IDMA 4LIQH 3JVGC 2KL6A 5D5MF 5J4MA 1IEBA 1ULVA 5JTWA 4K23L 3WEXA 4BFGA 2FH8A 4JO3L 4PB9H 5JORA 4LASH 4LIQE 4PFEA 3VXRE 4G9FE 3RVTD 3IDYB 1HNGA 3MMEA 2DQIH 2NY6C 3GMRA 1AHWC 1DQJA 1HNFA 1ZLWK 4EDWL 3U30C 1IGIH 3KYOB 4XPFH 1HINL 4KWUA 1ZHNA 1HHIA 2ARJB 4AT6A 2LV4A 4XXCC 1S5IH 1VESA 1IM3A 4M9OA 1DVFA 1U92B 1JPGA 4JPWH 2R15A 5GSRA 4AH2B 4QHLB 5K9KA 1FV1B 5CFHA 3BP5B 4L5FL 1O7VA 1S7QA 4OZFB 5ISZA 3JXAA 1IAKA 4LHUD 4AEIH 2JIXA 2Q86A 5C0FA 1YEDA 2ZUTA 2OXGA 2A6IA 3PWUB 3O6MH 5BOZG 3UTZA 4Y4HB 2ICEB 4KUZL 3QAZC 4U1MB 4HXAL 4ZNEE 3QDME 5HYSA 2FEEI 2VE6B 3TVMB 2Z4QB 3O6FD 1NC4B 2EECA 4DCQB 3U46A 1XF1A 3L5IA 5E8PB 2E7HA 1T1YA 2FZ3B 4QYOA 2ICWJ 1RD6A 3KLSA 4CW1B 4U1HB 1M7IA 4HC1L 5L6YL 4P4KB 4ZNCD 3KPPB 5DD3H 5FUOH 1NBVL 4R2GB 5IF0B 2Z31C 5KVEH 1MCIA 2ZOLA 2FSEB 2CK0L 3IT8D 1T4KB 3EJYC 1NUDA 3ULUC 3OKMB 4GG6F 3UEZA 5EBMA 3CC5B 3VI3E 3T1WA 4KZEH 4EN3A 3TO2B 1YNLL 4X99A 4YDIL 4OLVL 4XC1H 5DK0A 4TUJA 3VXUD 4UDTB 1A4KB 3PGCB 1BZQK 2NY0C 3FFDB 1A7QH 3MLWH 4ZFOA 3I6GA 5DWUL 1YMHB 1ED3A 1CDHA 1PBYA 4U1GB 4NYLA 1QSFA 4LVOB 2X7LB 1MY5A 1J8HA 1FC2D 4XVTH 4QRPE 1R3IH 5F89A 4P3CH 1PW3A 1A6ZA 4WUUB 1F90H 1ZS8A 5EIVA 3VXQA 2BNRE 2ZUSA 3HI6H 5KVMC 1UH2A 4HBQA 2P49B 2R0ZL 5DJ6B 2IMNA 1MUJB 1ZA6A 3REWB 3N06B 4UOJA 4ZOEA 1OSPH 3GO1H 1BPVA 5HYJA 4KGLA 1RULL 3UYOD 4QHNB 4RBPH 2VZSA 3T0VA 1NEUA 5IMMA 3O9WC 5KTEH 3H9HB 3WXWH 4LKXB 4QRRB 3LN4A 4L8CA 4PRIB 1I1AB 3V8CA 3U7AA 5IB1B 2F58H 3DGGB 3KLHC 1JRHI 3C5ZC 4H8WC 4EBQH 1T89A 5E8NB 2ICCA 2XKSA 5ALCL 4FZ8H 2CPCA 4K3EL 4PV9A 3TJHD 2DIAA 3NCJH 2PW1A 3L7FA 2CO7B 4E5XB 2YSSA 3Q6GL 2BVQB 4JR9H 43CAA 4EI6A 4MMXC 3OKYA 3P30L 1NC2A 1MRFH 3LKQA 3MLTB 5IW6A 4XCYB 4PJ5B 2BHZA 1RK0A 4ZQKA 1WBYB 2F53E 1D6VL 4PYHA 3GMLB 3EYUH 3LEYH 5B3NA 1KB5A 5CLWA 1TETH 2FR4B 4UIMB 3DVNB 1QEWA 5B38A 2OM5A 4D9RD 1WJ3A 1PG7H 2QADC 3TWCH 4P57B 3GSNB 2VLRE 4OBRA 4RX4D 4X0KB 5B8CA 4O2FB 1CGXA 1H9VA 5C70A 2X4QB 5FYJE 3VJ6A 5E2TH 3L9RA 5F3BA 3H9YA 4LLUB 1MVUB 3HR5A 4JJ5B 1PY4A 5FB8B 3SDAB 3CFCL 5F6IC 2GJ6B 2BP3A 1CFSB 4GQ9H 2D7MA 2IBBA 2XWTA 5BS0D 1UG9A 4P9MH 1XF5A 2CIKB 3LH2L 3KPOB 1VCAA 2Y23A 4TUOA 5LWYL 4F33B 4YLQT 1R5WB 2NYYC 5I6XB 3QIUD 3QHFL 1CXHA 4ZS7H 3HE6A 3MV7A 4WHYG 4YBLC 1Y18B 5EU4A 1S7TB 2DQCL 1C5CH 4XMKL 4W4NA 2JF1A 5T1LD 4HQQL 4K7PX 3UBXB 5I1IL 1OAXL 5CEYA 3HI1A 1RZ7L 1U8QA 4FNLH 1IGJA 3KLAB 4PUBH 1C16B 2E7LA 4J23A 3O2DL 5DD5H 1FGNH 5EFIB 3I75A 4P5MB 3QQ9C 5C07E 4HJJL 1EX0A 1NBYB 5EBWB 1NCCH 1F4WL 2YPKA 1L7IL 2AJ3A 2H41A 5E00A 3OB0H 3MOAL 4YFLF 1LP9B 1YEHH 4R7DB 2IPTL 3FCTA 3D69B 3NCMA 1LEKB 5HHOE 4G8FB 4CNIA 5I0DA 4MNQB 1YDPA 4CMMB 3PJSB 1YEJL 5CHNB 4GSDH 4D0DA 1RZJL 5KBNC 2Q7YA 2AVGA 5M7QA 3F65A 3GMMA 1W0VB 4K7FB 1FFOA 3MLSH 1KENH 4I8DA 1XR8B 5I15L 4M48L 3UJIH 1S9KC 3EZ8A 1U8JB 5FHAH 2IQ9L 3GSUA 3P2TA 2HYMA 3OAUH 5ERWA 5JW4N 4NQDD 2DQDL 1Q0YH 5LXGH 3DHMA 4OAWB 2NY6D 5EU7E 3DOSA 1XGQA 3FB7B 3M07A 5C0BE 4EJ1C 1AGEB 3QG7L 4BQBA 3T3PF 5HGHA 1PD6A 1CR9L 2FJFA 4OTXL 1MCRA 1N7ML 1ZVHA 5EG6C 3OXRA 4L8SA 3I6KA 1T22B 4H0HB 1N8ZB 1P5UA 5AAMA 4HDIA 5C86A 4JHBA 5MEPA 1FN4B 2OTPA 4WFFD 1EUUA 2AK4B 4P2RB 4ZUSA 4Z7OE 1FZOA 3WNKA 2YBRA 1KEML 5D5MB 1D9KA 1XF4A 1OP5H 3KPQA 5KVGL 1U93A 4G6ML 2EIZA 5J1TC 5LAXB 4XNYL 5CS7A 3VGEA 2WUBL 3RQ3A 3VXOA 1LEIA 5ILTL 4PJXE 4JPVL 1WQVT 4I77H 1N6QL 3EJJX 3F5WA 4K8RL 1SEQH 3S3PA 5LCVH 2R39A 4MHHG 5BRZB 4XBGA 2A74B 1GPOH 5HGAB 5F9AC 1WF5A 2VR4A 3V0WL 2Y6SC 4UTAH 5GS1B 2Z31D 1BQHA 5MENE 4NNPL 3V5HA 1F8TL 1EMTL 1RIUH 1A9BA 3KVQA 3AVEA 2O93L 3HAEB 3SDXB 3ULUD 1UENA 2F54A 2AKRA 2I60H 2R29L 4ZG1A 5HYQA 1X7QB 2GUOA 1ND0B 4NKMB 1AI1H 3NA4A 2XZZA 1QSEB 1R0AL 3NCEB 4QHMA 1NPUA 1DLFL 3R4DA 1JFQH 2WANA 4I48A 3V52H 4R4NC 2NY0D 1OLLA 1FORL 3AROA 4G80B 1CGYA 1IVLA 4ZFFA 4DAGH 1FG9C 2FGZA 1DDHB 3NA9H 2L7UA 2JCCF 3NPSC 3UPAA 2Y5TA 4ZO8A 2HRPL 4K9EH 5I16B 3RUGF 2PR4L 1GC1L 1T0NB 4TVPL 3RPIA 2XA8H 4PJ8B 3E3QC 3GJEB 4MJ6A 5GIRA 1YEFH 5C2UB 1BJ1H 3MV9A 4H25B 3FB8A 3BPLC 4PGCB 3UROR 4XP9H 4M1CC 4Z77A 1F4HA 3EYFA 4HH8A 1HEZB 3E2HB 1I8KB 2R1XB 4HBCL 4G8GA 3QNYA 4G6KL 3E6FB 3C8DA 4AM0A 2BERA 2CKNA 2W07A 3O9WD 2DQHL 4YHIA 1MHPH 5LGHL 4YFEA 4QRUB 4FQPA 3QFJB 4PRHA 4JY5H 4OF0A 5EU3A 2HJKA 4J4PC 5E4EC 5IB4A 4Z7WF 1K85A 4W4OA 3L5XL 1OGTA 3KLHD 2AJYL 4I5BB 4NBZB 1LNUB 4J3XA 4XMPH 1IAIM 1MFNA 4UT7L 3NAAH 3V7AG 3B3IB 4C58B 2CXGA 3RA7H 5L9DH 2HKHL 2G5BA 3P4MB 4OZFH 3MRQB 4IHOB 4S1DC 5EA0H 43C9A 4P46C 5LJYH 5JDSB 1G7IA 4J12A 1KJ3H 1W72L 4E0RA 3GUTB 1MCOH 2VQTA 4GKNA 2P5WA 3ZDYF 4HKJA 3IVKB 2PXYA 2QADD 5EOCH 3U0TB 1TPXB 5E7FA 1QACA 1A1OB 4O2CB 5C09B 3SKMA 4J8RA 1I3GL 4RDQF 3HKFA 3KXFA 4KMTL 1IQDB 1RUAH 4FABH 1IAII 1OPGL 2WM0A 1UC6A 5HYIA 5JIHA 4QO1A 4Q9BA 3MLPA 2X4UB 1IGYA 2HLFC 5E2WL 3V6BR 2BX5A 1EZVY 2YA2A 3KYMA 4WU7A 5D1ZB 3ZDXF 2NYYD 4DZBA 1T3FB 2QKIB 5BVPH 2VWEE 1G7HB 4PS4L 2VL5A 1I1YA 1CT8B 1FAIL 3BJ91 4WUKH 3RBGA 5DRZA 5I1JH 5IJKA 3VWJA 2Y7QA 4XB8A 1TCRA 4GAYB 1WBZA 5KVFL 1KTLA 4IBLT 4OB5H 3EKCA 1J88A 1PLGH 3OR7A 12E8H 1RZGA 4XP1H 3JWDL 3PV7A 1UJ3C 4MCYB 5TE7L 2R2HB 2RCSH 5EUKB 2W9DL 2IFFL 4Y4FD 5H35B 4NBYB 4AG4L 1ZT1A 1S78C 5GGRB 2CR6A 4LDOB 4HIEA 4BSWA 1CU4L 2ARJQ 2LVCA 4NO3B 1IC5L 1T04A 4QRSB 2G60L 2F8XC 5D7IA 1UB6B 3CVIL 2CKBA 4HFUL 4NQTA 1VGEH 2EEDA 3D0VA 4D0CB 4WUUE 3SE4A 1P7QA 1EJ6A 4ODWA 4WWID 2BCKB 4DVBA 5JHDD 3GM0A 4KGJA 4GH7B 4FQIH 3ZKNC 4NRXA 5GPRA 2UZIL 2PO6D 3U48A 5T5FL 5FYKL 3S35H 2Q8AL 4F15C 2YA1A 1J18A 2RQ8A 5J89A 1JGDA 4YNYA 4LCCC 3PIQB 3U83A 1YQ2A 3GRWA 1BBJA 4QRRE 2VXVL 1IQWH 5ESAA 1UYWL 4PRIE 1L9NA 1QFHA 3MRNA 4C56A 3WD5H 3HMWL 5KSBA 1J5OL 1ZLWH 1NGWA 5CJXA 3C8HA 5JHLH 1UB5B 3C60D 3SJVA 5IFJA 2AJUH 4FQXD 1EO8H 1Q9WB 4KZDL 1L0QA 3OTTA 4HZAA 5E8OA 2K1MA 3CX5K 4JKMA 5DVMA 1XH3A 3CCHB 2FECI 4YC2B 4XBEL 5F7DB 4M4PA 1JRHH 4P2CG 1RUPL 4PJ5E 4X6EA 4YHOH 4ZTOL 1KIRA 3QUMH 4LLMA 5F9JB 3OKLB 3KJ6L 3KG5A 5LVEA 1T6WA 4JDZA 1XGUA 3RKDC 4LLVA 3MO1B 3I02A 4O5LH 4GUPB 3IRZA 3V5KB 2RBLA 1BOYA 3QDGB 1JNLL 4LHUG 5C3LD 3DV4A 4Z8FL 1FYTA 1U8PA 5INDA 3TN0A 3B5GA 3O45B 2LABA 3DXAD 3IU4L 1ZGLP 2B20A 5DMGD 4YDLB 2GJ6E 2JELH 2FHCA 3T4AB 3TO4B 5D6DC 4NN5C 1S7RA 2IG2H 1V3JA 3VG0L 2F5AL 5BV7B 1A6AB 1S9XA 5C0DB 4OQTL 3CFIC 2PYFA 3AS0A 1YY8B 4LVNB 1C08A 5D1QC 2QLVB 3ROLB 2Y6SD 2APBA 2J8OA 1PX4A 1X5FA 3HRZB 1SY6L 1RJCA 1UACH 1I3RB 3LEVH 2Q3ZA 5B21A 4PJ7A 3MBXH 4GG8B 4JM2F 4NM8H 2J8UA 4P23B 4B7IA 1I8MA 5KN5A 3BZEB 2EDFA 2HT4C 1L0YA 3FFCB 5D9SB 3NCYP 5T1KA 4WGVB 1JYWA 4WRLA 2E7MA 2D3VA 4Y5YA 1BEYH 4WW2A 4PLKC 1WZ1L 3FT2B 2OR9L 1X5YA 3LPFA 3VGGA 3BP4B 4M3KB 4R4FL 1A47A 1KJ2L 1A4JB 3BX7C 4AQOA 4YIQB 4P2QB 4NQUA 3RFZC 2LTQC 2Y36H 1CGSL 1MELA 4B53A 3WS3A 4G8EB 1LP9E 1LD9B 4Z76B 1U8OB 5I1EL 4ODVL 3IETA 3VFMB 4OLYH 4MNQE 3IDMB 3D9AH 1LE9B 4PJDA 4Z0XA 4OCWL 1NGPL 3SGDI 2EDWA 3WEXB 3DYMA 5JORB 2YPVH 4JO2L 3U0PA 1KUMA 1Z2KA 3P11L 3VXSD 4MQXC 1NFKA 3MMEB 2PTUA 4R26H 2AJVH 4IOSD 1DQJB 3ARZA 3H0TA 1OCWL 2NX5D 3BKCL 1NAML 1F4XL 2EYSA 4FTVD 2D31A 4J4PD 4AT6B 4HK3N 1IM3B 1DVFB 5GSRB 1JPGB 5DUMH 4CU8A 5K9KB 1I9IH 2R4SL 3RDTC 4ELME 4F7CA 2EE3A 3IGAA 4WW1A 1P6AB 1S7QB 4J3OC 2Y06L 5ENWA 2A77H 1AJ7L 5ISZB 4PJFF 5C08A 2JIXB 2VQ1A 1MFBH 4G7VH 3LRGA 5INCA 4E41D 2Q86B 2YS4A 5C0FB 1YEDB 2WAHA 2A6IB 2AQ3A 1J1PL 5LQBL 1NKRA 3UTZB 3S4SG 4Y4KC 4U7SA 2B5IC 4ODHH 4F7TA 2ZUXA 5HYSB 4P46D 3RIFK 3U46B 2W92A 4M7JL 3RY6C 1FH5H 5GJSL 4U6XA 3ZT7A 3HG1B 5EIIB 1T1YB 5E1AA 2VDNH 4QYOB 4GQPH 3IFPA 2V9QA 1I9JL 4ZDHA 1JUFA 2AK4E 4P2RE 4LP4A 1WTGT 2A2QT 4H20H 2GT9B 5DEFA 4IOFC 1M7IB 3SKNA 3MUY1 5IW1A 1N4XL 4J1UB 3BIAX 5D2NA 2R56L 5I1HH 5D5ME 4YPGA 1MH5B 3VD9A 3RZCC 1DZBA 3BGAA 2DWDA 1N59A 4P48A 2AJSH 4IJ3C 2ZOLB 4LLDA 4POZC 3RWEA 1MAKA 3WO4C 4CUCA 1X4YA 3GSQA 2QHRH 1HXMA 2GK2A 4QRQA 3BRGC 2HLFD 5JLZB 3D85D 1LO3L 4FOMA 4QXUH 1D5IH 5BRZE 4EN3B 4X99B 1VPOL 2X9WA 1EVUA 3FTGA 3HAEH 5DK0B 3P0VL 3ARDD 4TUJB 5E94A 1T1XA 3I6GB 5FGBA 2AEWA 1ED3B 1HXYA 3SDXE 2AJZA 3QIBD 3OJDA 4NYLB 2DYPB 1RI8A 1QSFB 3P9MA 5EWIL 5F1NB 4TSBH 4IS6A 2YMXL 4ODTH 1BF2A 1J8HB 4LFHD 3PDDA 2HLAA 5F89B 5B3JF 1QSEE 1DFBL 5J6GA 1ZS8B 3QIWA 2E27H 3ZKMC 4L8DA 2BNUA 2JJTC 1XGRA 3FRUA 4A2LA 1ZA6B 3MOQA 2DQJH 4HCRL 5CIPA 5CWSA 4G7YH 5HYJB 1OW0C 5CBAA 3UYPA 5F9WB 4Y2DB 3VDAA 1FZKA 2APWA 1T5WA 5IMMB 1V7MH 3INUH 2PW2A 5DRXB 5I8OL 5J8OA 1QKZL 1C7TA 1FO0B 1UZ8A 2CMRL 3IDJA 3KPLA 3PL6A 3EZJB 4YXKL 3CVHH 1OGAB 3ZKND 3QISA 3DV6A 3VH8G 3U0WH 3BAEL 2DMCA 4ODSH 4YR6A 1PVHA 2IJ0C 3VXRD 4G9FD 1QPXA 2H8PA 4NJ9H 3HFMH 5EU7C 4C4KO 3MREA 4PV9B 4GKZA 5FUZH 2XNAA 2PW1B 3L7FB 2NZ9D 2YSSB 3QFJE 1JGVH 4IRJC 4X83A 3UO1H 4EI6B 1RU9H 1F58L 1NC2B 1NL0L 2ZJSL 3LKQB 5D6CB 4TNWF 5IW6B 4ZQKB 1RK0B 1KB5B 5CEZE 3QI9B 1GVIA 4X5LA 1CL7L 1R3KA 5DI8A 3KYKL 5TDNA 2WBJC 1QEWB 3Q6FA 5B38B 4KQ3L 2E7CA 3BQUA 4WI3A 3NIDF 5B8CB 4XPHH 4HUVA 3NIGE 3VJ6B 3DGCR 1OAYL 3L9RB 5F3BB 3HPLA 4GBXA 3QDMD 4JO1H 4MNGA 5KSAB 5F1IA 3HR5B 3E0GA 3JTSA 1UJTA 1BVZA 3O4OB 4Q0XH 4ONGL 2XWTB 4HS3B 5DHVB 1XF5B 3RKDD 1JPTL 1F13A 5I76A 1NMAH 3VGAB 4TUOB 4D94A 3CZFB 5C09E 2CO6B 3TJEH 1ADQL 2DM2A 4OI8A 5JO5A 2F8OA 2P42B 3EFDH 3HE6B 3MV7B 1EGJH 2Y07H 3TNMA 5ID1B 4KK8C 3UYRH 1GXEA 3MTRA 5CEYB 4NO5A 1CTNA 1I8IB 3HI1B 1U8QB 5JXAL 1LDPH 1IGJB 5D1QD 2VAAB 1DQLL 5GZNC 3SE9L 3I75B 3C87A 1DBBL 3L3DA 1BOGA 1IAIH 3BHBA 4AEEA 5KSBF 4ZO9A 4OCRL 4Z18A 2DJ4A 3CLEH 2XQBL 4FS0A 1AY1L 2HT4D 1OB1A 1G7QA 1JTOA 1I9EA 2AJ3B 3BPOB 4OI9A 1SJHA 1HYRC 1WBXA 3NPZB 4O58L 5GGUA 3VFPA 2VUYA 3VFUB 3FCTB 4LPXA 5F7EH 4QRPD 2EDRA 4CNIB 2X10A 2BNRD 4K9EC 4RMWA 2VLJB 2VABA 2HFGH 1LO2H 4D0DB 4P2OB 4OFDA 3T2NL 3IAQA 4BQ8A 4KQ4H 1BFOA 2DKSA 3FQTB 3M1BA 3LKRA 2C3XA 1IBGL 1CGTA 4M5YL 4S0TD 1KN2L 3O6LH 3QEHB 4U6HB 2HMID 3PABB 3GSUB 2VDMH 4MXVF 3QHZH 5ERWB 5I1LA 5IHZA 5I8EA 2RHEA 4UIKH 1YQVL 1G9NH 4JM2B 4MQXD 3WUZA 2VAJA 2E8YA 3IDYC 1XGQB 4DQOL 1I1FA 3F58H 4AY0A 4PB9L 1S7SA 4EI5B 4LASL 4FZEL 2FJFB 5EZIL 1RK1B 1JHKH 1MAML 3QJFA 1OWRM 4J2XA 4LAJH 2HA1A 5L2KD 4L8SB 1K3IA 4WDIA 2EZ0C 4YO0A 4FFZH 3OZ9H 1IGIL 1MNUH 2F53D 4O2EA 4XPFL 5MEPB 2DM7A 1K5NB 4HIJA 4FXKA 2A9NL 5SWSB 1Q94A 2Q1EA 4HPOL 1P9MC 4ZUSB 4JZJA 5EC1A 3HC0A 2VLRD 1FZOB 4XP4H 4KVCH 2YBRB 4Y4HC 1A0QH 1F2XK 1UEYA 3N1QC 3VGHA 1D9KB 1XF4B 1YPZA 1DQMH 2P44B 5TF0A 5C0RL 3K81A 3O6ML 3TVMC 1FP5A 2EIZB 4X5XB 1U3YA 5FDYA 1P4IH 4OZGF 3RX8A 5IQ7H 3O3BA 1J0KA 1WIUA 1LEIB 1AFVH 3VRIA 4AL8H 3W5MA 1M6OA 3CFJA 3GKZA 1CD0A 2AQ1A 4JFED 4Q6IB 4XBGB 3QDGE 3KR3H 4P4KC 3UX9B 2D7QA 3RZCD 3V8OA 1BQHB 2VWEC 4TNWK 3V5HB 4A6YA 4PJDF 3SGKC 4R2GC 4DW2H 4WI7A 5BV7H 1C7SA 2X4PA 3NFSL 1A9BB 3S36L 1IL1B 4DGVH 2X4RA 1IM9A 2AKRB 3NFNA 2VC2H 5HYQB 1XGYL 3S88H 3Q5TA 2GUOB 3A6BH 3T3PE 5DD6B 3DROB 4UV7L 4QHMB 3RJQB 5FV1L 4TSCH 2V6HA 2ED9A 4DKDC 3EYOB 5C07D 4ZFFB 3O4LA 5TJWK 4JZNA 1HKFA 2AABL 3FMGH 3FJTA 4GKSB 4U1GC 4IDJL 1UWEH 3FFCE 4LVOC 2ADGA 2DJUA 4DUXA 2XZAH 4X7CC 1A7QL 3MLWL 5T33L 3QPXL 3VW3H 3DSFH 3S9DB 4BH8B 3ZKMD 2VDKH 4MJ6B 1YEKL 5HHOD 3CJJA 3NZ8A 2X89A 4P49A 3MV9B 4XCNA 3FB8B 2DQGL 3EYFB 2A6DA 1MFEH 2DWEB 4P2QE 4P3CL 4AJ0A 2VMFA 4NN7B 5E03A 1FBIL 2V2XA 5IVOA 1T83C 2C26A 4PG2C 4UNTA 3AS1A 2E9WA 1SJEA 3PGFH 2AK1H 1C5DA 3KPMA 3TNNB 3KJ4B 2FDBP 1A7PH 1OSPL 3GO1L 4YHIB 3VFGH 4M3JA 1K3ZA 3EUUA 4PRHB 5EU3B 2QSQA 2R0WL 5IB4B 4JG0H 4I18B 1KIQA 3ZKSD 2WUCL 1I1AC 1I85A 1OGTB 3W39B 1CI5A 2FB4L 4HLZG 1RZKH 2V9TA 4WI5A 4JQIL 3AMLA 5C0BD 5L8KB 3LMJL 4U1SB 2F58L 2G5BB 3MRMB 4ETQA 1DQTA 3H9ZA 4FFWD 3SGDH 4BFEA 1MFDL 4PJIF 2P4AB 3WFBH 4X9HA 3NCJL 2HTKC 1G7IB 4OD3L 1E4WH 2AP2A 3C5ZA 1MCCA 4YXLH 2OK0L 5ISZE 5GISL 4E0RB 5GGSA 3D3VA 2WBJD 3ZLQC 2Z0BA 4GKNB 2P5WB 2IANA 1KEGL 3LEYL 5JQHC 4CJ0A 3NCCB 1YYMH 1BMGA 3SKMB 5DFWH 5TPWH 4J8RB 4JFXA 4KC3B 4UOW0 3KXFB 4GXUN 4JLRA 4PR5A 3M17A 5HGDA 3SDAC 3IDNA 3B9VA 4EEEA 1IC7H 3CZJA 1EUTA 4G3YL 3BKMH 1CICA 4O9HL 2H2SD 4HWNA 1IGYB 4J3UA 1KLGA 4JVUA 3KYMB 4WU7B 5HI3C 3TBSA 3RY5A 1TFHA 1LQSR 5D8JL 4P9ML 5I6XC 2IBZX 2VL5B 5I1GH 5K9OA 4D9QE 1NJ9A 4XX1G 1KC5H 2FYYA 5DRZB 4KTDH 3QDJA 1H3TA 3VWJB 2Y7QB 3WIHA 1WBZB 4KK8D 1KTLB 2FWOA 4OZHF 4FFYH 4ZS7L 3OR7B 5FM5M 2OL3A 2ICES 4OIBA 1YMMA 1SMOA 5GZND 1MCHA 4LNVA 3ARXA 1OVZA 4DVRL 5GGRY 4X80L 4DZ8A 5FO7A 3Q3GA 4HIEB 2I27N 4BSWB 1U91A 5DF0A 1QSFE 1T04B 1FGNL 2MMXA 5DD5L 1LK2A 3BGFB 1I8LA 5D7IB 4QNPF 1TZIA 1P4BL 1J8HE 3MJ6A 3OWEA 3D0VB 4GAGL 4ODWB 3BH9A 4KRNA 3KPRA 5IT2H 5J11B 1NCCL 4WI4A 4DVBB 1QYGL 1TIUA 3H7LA 1CCZA 2ADIA 5IFAH 4XNXH 1J0JA 3ILPB 4YHLL 2VXTL 3VFOA 2EYTB 4NRXB 4G5ZL 5HYJE 5KZCB 1V3LA 5J9PB 5F96L 1B4JH 3ZE0F 2ZZUT 1NCNA 1J1XL 1NFIB 1JGDB 4YNYB 3ZDXE 4G43A 2PN5A 2WW8A 1BBJB 1FNFA 5ESAB 1LO4H 3MLSL 1KENL 1MREH 1ZHBB 4NC2B 3MRNB 1GGCH 1OGAE 3AM8C 4RRPG 5D71H 5KSBB 3EO1A 1AE6H 1UXSA 3PXJA 1NGWB 4M93B 1RZ8A 3JV6A 2BOBA 4Z0BL 5IGXH 1T21A 5FHAL 2FBJH 3SJVB 5IFJB 1TDQA 2CDGA 4FQLH 1LO5A 3B2UC 2B4CC 2ADFL 4M7KL 2NXYB 4BFIA 5E8OB 3VWKA 1KB5H 4ALAL 3VFTA 1G6RL 5I2IA 3DYOA 4X6EB 1KIRB 2XTJC 4NP4H 1UXWA 5FA4B 4TOYH 2NMSA 5FM4A 4U33A 5FO9A 2W9LA 3IDXH 5J6HB 4JDZB 1Q9LA 1XGUB 2UV3A 3MRHA 4LLVB 1VKXB 1RIVH 1BAFH 3I02B 5D93B 5KSUA 3BWAB 5DEZA 2XZQL 3TFKC 2PTTA 3DV4B 4YJZL 1NMBH 1FYTB 1U8PB 3TN0B 2FX7H 5INDB 3TVMD 1GGTA 4RNRA 2V5MA 1J12A 3O8XA 1U8IA 2ESVA 1AQKH 1S7RB 1JVKA 4JFOA 1GL4B 1S9XB 4JZOA 1AGDA 2PYFB 3R06A 2FGWL 4P4KD 1C08B 1OAZL 3OGCA 3BEWB 1ORQA 4I77L 4Z6AT 3DI3B 5GS1C 3MV7E 5CZXC 4YPJA 3ZTJG 4ZUWA 1HYSC 4ZSOB 2J8UB 2VNCA 5HXMA 4LDLB 1I8MB 2XN9A 1IT9H 3DX6A 3VXMA 5T1KB 5CD3A 1YECL 4G9DA 4NJAH 4Y5YB 4WW2B 4BZYA 1DL7H 3QHTC 3HUJA 1IGFH 2D0HA 3B8SA 1PYWA 4L1HA 2X4TA 5DT1H 5JMRA 4LRNH 2I60L 3V4PH 3RWHA 5GSVA 3RHWF 4XWOC 2G9HA 3MV11 4KUCD 2J7LA 1HE7A 1EV2E 1G0XA 3HZVA 3TLRA 1JFQL 3V52L 1QFPA 2OMBA 4B0MM 5JZ7C 3MFGB 4WUUD 4PJ8C 4LARL 3QRGH 2EXWD 3MLXH 2VLJE 1JGUL 2WWMC 1YPZF 4LFHG 4PJDB 1FC1A 3WBDA 1ONQB 3LRSB 1FL6B 3SGJC 4UV4L 5B22A 3E2HC 3U0PB 3QFDA 1J0IA 3T77A 2D03H 1G7LA 2DQUL 3ARVA 2DI7A 2YA0A 1DANT 4MXWL 1X6NA 3WFEH 4O02L 1ZVSA 5IP4A 1FZMB 3O3AA 1BVKB 2D31B 4QRRD 4CU6A 4LEOA 1K4DA 1I1AD 3QDAA 4BQCA 1WIOA 3IGAB 1AC6A 4WW1B 3PQYA 4J3WA 1H3GA 1KCUL 5C08B 3C09B 4EUPB 4KPHH 1BLNA 2VQ1B 4LBEA 5ECJE 1X4XA 4Z7UA 5HGGS 3WXVH 4WFED 5INCB 1F3DJ 3BOVA 1CGUA 1MCWM 3L95A 2MWCA 4ONHA 2N4IA 4IIQB 4K55A 5C6TH 3V4UH 1RUQL 3SQOH 3X3FH 3CNKA 1K6QH 1Z9LA 5D2LF 4PJ5D 1MCKA 2GSGA 2QQKH 1UVQA 1A5FH 5GRJH 3PUCA 4U6XB 3VI4E 4N0RA 5E1AB 4ZDHB 5SWSE 3DO7A 3IFPB 3FRPA 4XP6L 3NVQA 4MQSB 4UILH 1KJ3L 1XGTB 5DEFB 1ZA3A 1S7UA 3SKNB 3QT2A 1TPXC 1CDGA 5D2NB 5EOTA 5IW1B 4YPGB 5DDHB 4AIZA 3PWJA 3MCG1 4RMRA 2DWDB 1N59B 4QXTA 4LMQI 3BWUC 3SDAD 4N9GA 3LKSA 3GSQB 5AZEL 4EXPX 1HXMB 4KDTA 5EPMA 4X4ZA 4HS8H 4QRQB 2FD6H 4LCWA 1VEPA 4W70A 2E7BA 4JFFD 2YUWA 4TULH 5HI3D 2HN7A 1O0VA 5I19L 5A2FA 5D1ZC 1MCEA 4GOSA 3FTGB 3UPCA 4RMVA 2LU7A 4PJIB 1YUHA 4AZ8A 1T1XB 5AWNH 3GI8H 2ATPA 1WLHA 1S7XA 3BEVA 1HXYB 2AJZB 2UZXB 5CBEA 3VA2C 3OJDB 4QHUA 3P9MB 3M45A 4WUKL 4J6RH 2HLAB 4L29A 1WK0A 3GGWA 5I1JL 5CJOL 3ZTNL 2DIJA 5J6GB 3IAGC 3QIWB 4XI5C 4L8DB 5BW7C 2BNUB 1XGRB 4KKNA 3X17A 3ARGB 3FRUB 5GRVK 4CRPA 4TVSa 2J8HA 5CIPB 5CWSB 5IHUL 4W6YB 2QBWA 3DETC 2X05A 5CBAB 1FCCA 1JMZA 1FZKB 1NFDA 4DGIH 1T5WB 4WY7H 4Q2ZA 1YN7A 3UDWC 1UZ8B 3BXNA 3MV9E 3KPLB 3EJZC 4MNQD 2W0KA 3RWGA 3PL6B 4NKOA 3UZQA 3VFWB 2BFVH 5JPMA 2YD5A 5DMJB 6FABH 5L8LB 4NQXA 2XQYK 4MLIA 4NZRH 5TGBA 4RAUB 3QNXA 4XP5H 4KKBC 4YHPB 4FQIL 4GKZB 5JDJA 1SHMA 4PRHE 4YDJA 1QVOA 2XKNA 2CDFA 1FGVH 3IAPA 5CILL 4GMSH 2F19H 5CAYB 3UC0H 2AXFA 1RZFH 3UJJH 3HC4H 1RVFH 3I3EA 5IVXF 1L9MA 1R3KB 1IQWL 2ZUUA 1T0MA 4OCXL 5TDNB 3FN9A 4DKFL 3Q6FB 3B2UD 1Z9OA 4WV1A 3WD5L 5B3JE 3BQUB 1JZ2A 1CLCA 3MNWA 4G6FB 4HUVB 2AJXH 1F3JB 4S1RH 2ZNXA 5F6HJ 3FN0H 1FNSL 4YC2C 4JB9L 4JPIA 3HPLB 2X4NA 4GBXB 4MNGB 2ORBH 2ARWA 5TE6H 5CCKH 2MPAL 3JTSB 3BT2H 1DJSA 1JYXA 2EDYA 2MSPA 1JNJA 2P5WE 4ZO7A 3QUML 2DF3A 2AK4D 4P2RD 3DUHA 5I76B 1AQDB 5FK9A 4Q6YA 3TFKD 4N0YH 3MNVA 4XCCL 2J2ZA 2VITB 2NY3B 4TRPL 5JO5B 2IH1A 1WAAA 4JREB 3KXFE 1EJOL 3MLYL 3TNMB 4X8XA 3BW9A 4YDLC 3QEGL 2ZKHL 4ZS6D 2VXQH 2J5LB 3TO4C 2AV1B 5TFSL 3DLQR 4NO5B 2QSVA 5BV7C 3CSBA 2OYPA 4LVNC 3BP7A 1MCPL 3MJ9A 4AMKL 3L3DB 3BHBB 4X7SH 4L9LA 5E6IB 3ZT5A 4OFYA 1HYSD 2FHFA 2AGJH 1LK3H 9CGTA 3ZE1F 2CLZA 1MVFA 3OG6B 4UUJA 1OB1B 1JF5A 5DR5H 1G7QB 4P23C 5T3ZH 2YD3A 4RWYH 1SJHB 4UU9A 5GGUB 1CD1A 1UACL 4X6FA 2R69H 4NKIL 1QSED 4NM8L 5BZDA 5T3ZE 4NFBA 1U41A 3ARYA 1FE8L 2MQCA 3K4ZA 3J8F7 1T1WA 4P3DA 2VABB 5KSVA 2CKBH 3ORJA 5MHSE 2CH8A 1U9KA 2C3HA 5IV2A 5ACLA 4NUJB 5D7IE 4ZXBB 2AS5M 1OTUC 5JZ7D 1MJUH 2NY7H 2P43B 1BFOB 5HHNB 3M1BB 5DC9B 2B8OT 4PJ8D 1Z9MA 3B9KD 5DVLA 3GKWH 2O26U 1MCNA 3R1GH 1BWWA 5L88L 1ZSDB 2IPUK 1H3WM 4DN3H 1UA6L 2WWMD 1HDMB 4NO0D 1T2JA 4AQ1B 5IHZB 5I8EB 3RWCA 1B0WA 3H9SA 3MRFB 4YQXL 5JW4M 1Q1JL 1JPFB 3GRWH 3DMMA 1I1FB 1KJMA 1EFQA 2E3VA 3D0LA 5AYUL 4ZOAA 1HHHB 1KOAA 1S7SB 3VFSA 1MIML 4C4KT 4P59L 4OGXL 5DK2A 4HC1A 3QFJD 1RZKC 2VQUA 2NXZD 2VH5H 3QEQA 3QJFB 4NM4H 5KSBE 2R0KL 4WDIB 1DVFC 4YO0B 3TBYA 4HMDA 4O2EB 1A6TB 3V0VA 4Z7NF 3SJVE 4LPUA 1GRWA 1A6WH 1DQDH 4HIJB 4FXKB 3DX9A 5DUML 2EC9T 1I9IL 1Q94B 4JZJB 5D7SH 5EC1B 1MI5A 3HC0B 1HSAA 5F8QC 5KAQG 4G7VL 4U1NA 1KIPB 2CQVA 2R1WA 4U1JA 1YPZB 3RDTA 1RUKH 3GJFK 4XVJH 4HK0B 5DD0L 5IMLB 3O3BB 3G5VA 4ODHL 3VRIB 4I0PA 3WFHA 1M6OB 1FFNB 1U8MB 3DO3A 5IB2B 1II4E 3T65A 5CZVH 4Y4KA 4KJYA 1FH5L 1TJHL 4XNQB 4N5EC 1EBAA 2VDNL 1FYTE 4N0FA 4A6YB 4EOWH 5IB5A 2XOTA 2YN5A 5ANMA 4EIGB 2X4PB 2VJXA 4K2UH 5JPNA 3VXNA 2XFXA 3L3GA 1IM9B 3FOMA 2X70B 3NFNB 2AJSL 1KULA 1PG7X 2YXMA 1CLOH 5D1ZD 2EIEA 4EN3C 2OTUA 2P5EA 3HN3A 5MEQA 2Z92A 3GSOA 4M4RA 4QGTA 1YNKH 2DKMA 1JV5A 4Y16D 3CXHJ 1HHGB 1ZGLA 4KI5F 7CGTA 1UWGH 1FRGL 3O4LB 2HWZL 2J8UE 2AEQL 1A6VH 4JZNB 4J3TA 4ZSOE 4XT1C 1NGQL 5D72H 2W59A 1L7TH 1VERA 2VZUA 3RVUC 2ADGB 4WU5B 4PJBA 5F6HI 1H3PL 3OB8A 1PEWA 5DJ2B 4XI5D 3LQMA 3NZ8B 1K4CB 3PWPA 4GRLB 4XCNB 3PGDA 4JHWH 3ROOA 2QL1A 1NLBH 2Y4SA 2A6DB 1RHFA 1S9VA 4ZFGH 4JDTH 3MXVH 4JQVA 3DETD 2J3SA 1JCKA 1ES0A 1SJEB 3PDOB 1C5DB 3KPMB 4Y2DC 2OX5A 3GSRB 4S1SH 5JQ6H 2WWKT 2VIRB 5F7KC 3ZSSA 5I18H 1Y0LB 2JJTA 3EJZD 4ZMAT 1JF1A 3QUKB 2FL5A 3RGVA 3U9UA 2H1PH 4PJDE 1V7ML 3INUL 5DA0B 1KIQB 3X14B 4IRSA 1K8DA 1RJZA 1JNNL 5TQ2L 1QLRA 2UWEA 2FX9H 1DBAH 4KKBD 3CVHL 3ABZA 1LO0H 3U0WL 5JXEC 2A38A 5GGQL 5I73B 3LVEA 4R7NA 3V4VH 4ETQB 3IS1X 3B9AA 3HC3H 3LV3A 4M7LL 1HKLL 4NJ9L 1E0OB 1PFCA 1RJYB 1A3QA 1MEXL 2AI0H 5FUZL 3UTOA 3RBSA 4RMSA 5GS0H 5TH2A 4HGWA 4MA3A 5C08E 4KRPB 3QI9C 3D3VB 4YZFF 3LQAH 4HV8A 4NN6B 5DEGA 2CDEB 1XIWC 4IRJA 5K9JH 3FO1A 5E08H 1BBDL 5B8CC 2BOCA 1N64H 5TDPA 1HQ4A 4XXDA 3O2DA 1M1SA 3L3OB 1MWAB 3GJFB 5KSAC 3BYYA 4XPHL 3A6CH 1DBKL 1AXTH 3M17B 5HGDB 3SHSA 1N6UA 2EDKA 3O4OC 3LIZL 3P73B 1OAQH 1NFDF 1CICB 1P7HL 4ONFH 5FF6A 2BSRA 1E4KA 4R4BA 4N9OB 4GMTH 5D2NE 4QF1A 4XPAL 3VGAC 4D0BA 3QDGD 2VZ3A 1NCWH 1NJ9B 2FYYB 1X5XA 4GW4B 4OSUH 1XF3B 3LHPH 3QDJB 3LKPB 1MSPA 3TV3L 4D9LL 4NHCH 2WBKA 2MOVA 1EVTC 4F57L 4KJPD 1JNHA 1ZT4A 2OL3B 2Y07L 5HHVH 4U7MA 3WFDH 1HK6A 3A67H 4XHJC 4WIQA 1XR9B 4PJIE 4WI2A 3DVFA 2MQ3A 1SM3H 5MENA 5FO7B 4N8CL 3Q3GB 2Y5EA 5GRWA 4LMQE 1LDPL 5I1AB 1U91B 3RVXD 4P23D 3S4SA 1LK2B 3V2AR 3BPOC 1KBGH 4Z7VA 3CSYA 4PJGF 5SWZA 1A7NH 3CLEL 5CIPH 3DIFB 4CN1A 4EIZC 2GY7B 3TA3C 4EKXA 1TTGA 1EEYA 4P2QD 1QBLL 1RHHA 1UWXK 3ELAT 3TT3L 3VFOB 4P2OC 4PJAA 3JTTA 2OTWA 1OTUD 2KQNA 3MLZL 1YJDL 2HFGL 1LO2L 2YZ1A 4DGYH 2BDNL 5GS2H 3ULVH 1IC4H 1DBJH 5IEHA 4EXKA 3EGSA 4BZ1L 5GGTA 3HR6A 1T0PB 5C2BL 1WAAF 1RZ8B 1L0XA 4PD4K 3JV6B 2BOBB 1T21B 4JM2C 4LSVH 3F7YA 2FATH 2CDGB 2VDML 4BFIB 1G9NL 3UJTH 4EI5C 4UINH 3VWKB 5DURD 3GBNL 2VR5A 5I2IB 4HUWB 4V1DB 1DVFD 4RISH 4L8SC 4K94H 4TQEH 5DUPH 1A1NB 4Y5XA 1JGEA 1UXWB 2DI9A 1IAOA 5ISZD 1WGOA 1MFAL 2JIXD 4MA1B 3U1SL 5FO9B 4WFHE 1MIEL 2I5YH 1Q9LB 2XRAH 3MRHB 3KYOA 5KSUB 1Q72H 2GYSA 4POYA 4JEGB 4YX2H 3WO3B 4PGZA 4YHNB 5DA4A 1U92A 4LSTH 4MNGE 4AH2A 3QXVA 4HWBA 1D9KC 4QHLA 3EDFA 4RNRB 3G5YA 4B7LA 3O8XB 1HHKA 5C0EA 4M7ZB 3C08H 3ZE0E 3FONB 1T2XA 1FIEA 2LU4A 1U8IB 3L3HA 3WN5A 5ICXA 2I24N 3DUSA 4JFOB 1P4IL 3VH8A 3WKNA 4M6NH 1AGDB 4Y4HA 3R06B 3MRLB 4Q6IC 1AFVL 1HHJA 2OSLA 3HB3C 1ZEAL 3OGCB 3UTSB 4ZAKA 1MCDA 1ORQB 5CGMA 2Z4QA 4D9QD 3MRRA 3KPNA 1CXKA 5ADOH 2HKFL 2XN9B 5E8PA 3DX6B 3VXMB 5FCUL 2DQFB 5FXCH 4EVNB 2OR7A 5T1DL 3SPVB 2GJZA 1BIHA 5C0IA 4CW1A 1V8HA 1A14L 3BPCA 2UUDH 4EN3D 4DGVL 1BQUA 1PYWB 3RWHB 3SGKA 3CLFH 1U8HB 3A6BL 3MNZB 4HJGA 2FSEA 4MAYA 1CS6A 3BZFA 4OV6F 3QXTA 2WSKA 4KRMB 4YXHH 3LPWA 4RCAA 3HZVB 3RVUD 1J8HD 4UDUA 2AEPL 1CFTA 2VZTA 3TO2A 5E9DA 1UWEL 3STLA 1A4KA 3DSFL 4TPRH 2NY1B 4WTZG 4OF7A 4Q9CA 2PCPA 1F45A 1YMHA 4NN7C 3QFDB 4PJEF 3T77B 5HYJD 5DFTA 1W72A 3UZVB 1G7LB 1AIFA 5ICZA 1DTUA 2YKLL 1PAMA 4KXZI 4MZ2A 3KJ4C 4S0SD 1ZVSB 1ZTXH 3O3AB 3ZL4H 3GIZL 3PP3K 4LEOB 1K4DB 1A6UH 3BVNB 1MUJA 5FIEA 4I18C 4S1QH 3REWA 1A7OL 4W4OC 1T83A 3VFGL 3L3KB 4WO4B 5FOBA 4QHNA 4JG0L 1BLNB 2R0LH 4JCMA 4LBEB 2P7TA 1FFPA 3RWIA 1XZ0A 4M02A 3L95B 4ONHB 1X5IA 2ZCKH 4X6CF 1NGZB 2E9JA 1NC2D 4PRIA 1J05A 4B50A 1KCSH 4LSPL 1CDJA 1AC0A 5E8NA 4X6DA 5D70H 3DO7B 4WEBL 3S35X 1PGRB 4PJBF 1A02N 5D4QA 4DFIA 1ZA3B 5BMFL 2CLRA 1S7UB 4OGAD 1D7FA 3V6FA 2BVQA 5EOTB 2NW2A 2F74B 3GK8L 3LS5L 1YPZE 4OGYH 3MLTA 1V3KA 4AIZB 3PWJB 4XCYA 2CSPA 4QXTB 4HGMA 1HSBB 3GMLA 1YYML 4JANA 3SDYL 4N9GB 3LKSB 1IGMH 3K8MA 2DTML 3DVNA 4OFVA 1XAUA 3G08A 4HIIA 5EPMB 4YBQC 3NGBB 5FDWA 1J9CT 4LCWB 3EFFB 4A6YH 1M05A 2ZOKA 3GSNA 3U7YH 3WS6A 4X0KA 2HN7B 2XZCL 4X5WA 2NTFA 3QG6A 1YUHB 4U3HA 3HE6D 1NAKH 2ATPB 3MV7D 4L4TA 5FB8A 1TLKA 1S7XB 2UWEF 5CBEB 5IJKC 4FN0A 3VWJC 4QHUB 4YHMH 4LHQB 1MLCA 4L29B 3GGWB 1TJIH 4KTDL 1HI6A 4ZTPL 4XHJD 3P4LA 4GAJL 5A16A 2FCBA 4N8VG 2NY5L 3B5HA 3O4LE 4ZFOL 1T7VA 5DYOA 1DBMH 4XWGL 1A22B 1S7TA 5F72S 2QQNL 3EOTL 3K74B 5EZOH 4OCLC 3BGFC 1NFDB 2VDLL 4HWEL 3UBXA 2ZSWB 4B5EA 4Q2ZB 1YN7B 3SE4C 4ZUVA 2GI7A 3BXNB 5J11C 3BKJL 3IFOA 4OZIF 4N5UA 3RWGB 1KB9K 2OJZH 3MLRH 1N0LA 4ZOBA 5IT2L 1WTLA 1NGXA 5EBWA 3MYJA 4UOW1 5IFAL 4XNXL 5TGBB 4R7DA 4NNYA 4BYHA 3QNXB 5IW3A 3S96A 2IFGA 4OQ1A 4G8FA 3GNMH 3BE1L 4YDJB 2CDFB 5IVZA 1QFUL 2GCYA 1O7SA 3BMVA 3A0OA 1F02I 5A3IC 2AXFB 4CMMA 5F3HA 1MAJA 2R1YA 3GDBA 3W0WB 4M93C 1ETZA 4HULB 4MX7A 1C12B 2BVPA 1T0MB 3NCFB 1MREL 1GGCL 1W2KT 4WV1B 3SKJL 1XR8A 4PJGB 4R3SA 4Z78A 1D5XB 1OTTC 3MNWB 5JW4Q 2NXYC 4I4WB 4WI8A 2FBJL 4OQTA 3MODH 1U8JA 2OBGA 3W11C 2P8MA 4JPIB 4OJFH 4NSKA 2X4NB 5L7XH 1JMXA 1KTDB 5ELIA 1N2RB 3D3VE 4OAWA 2VTFA 3HNVH 4AEFA 3FB7A 4PTTA 4KK5D 4MB3A 4L4VA 4NP4L 2EKSA 1KN4H 4TOYL 2YRPA 5D93C 3MNVB 2VXUH 2FX8H 1D9KD 1T22A 1OARH 2IH1B 2YEZB 3TN0C 2YPLB 2YRLA 4PJAF 3WJJA 1EHLL 3BW9B 3TT1L 1VENA 2FX7L 4B41A 3T4YB 4P9HL 4IRZH 2AXGA 4AYFA 2UYLA 3FL7A 2X2YA 5BJTA 3BP7B 3WIHH 5D5MA 1OWWA 3K1KC 1N5AB 5IFHH 2J88L 1Y6NR 4L9LB 3R0MA 2Z9TA 4PG9A 4JRXA 3QDJE 4PY8J 2OL3H 1WCBA 1E6OH 4UUJB 3SQBA 2QSCH 1FPTH 1CVSC 2F54D 1NBZB 1QO3A 4UU9B 5DRWA 5EU6B 3PP4L 3IYLW 3QUYB 3SDDA 5BRZA 5BZDB 1NAMA 3CK0H 2Q76A 3SOBH 1T1WB 2A6KB 2Z35A 2BJMH 5KSVB 3PHSA 4NJAL 1JGLL 3OX8B 4TNVK 1FDLH 1A3LH 5KG9B 1WWBX 5IV2B 4JY4A 5DT1L 2CLVA 2YK1H 4QTIL 4I13B 1C5BL 4QHKI 4PJ9A 3KPRE 5C9JB 4MA7H 2MHAB 4JRYB 1CF8L 3MV9D 1OP9A 1IMHC 3A6OA 2C4XA 3H9SB 4G8GD 3ZE2F 3OAYK 3N1MC 1DEDA 3MLXL 4DTGH 1S7WA 3Q5YA 1WEJL 3DMMB 4K7PH 1KJMB 4P2YA 5E2VH 3D0LB 2YD7A 3VFSB 1U3HA 4NCC2 1X44A 3GJEA 5C0CB 2D03L 1G7MA 5DK2B 4N90E 4PRHD