4B60A

Structure of rfnbpa(189-505) in complex with fibrinogen gamma chain c- terminal peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
309
structure length
299
Chain Sequence
TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEGYTLTWDNGLVLYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Cell adhesion
molecule keywords FIBRONECTIN-BINDING PROTEIN A
total genus 72
structure length 299
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A02
4B60A 1R19A 4MBRA 4RMBA 4LEEA 4F27A 4FJ6A 4LEBA 3AT0A 2Y7LA 4JDZA 1N67A 3AU0A 3IS0X 2Z1PA 3IRPX 2RALA 4JE0A 3V10A 3IRZA 4JDZB 2F6AA 4MBOA 2Y7MA 4F1ZA 2YLHA 4LE8A 5CF3A 4Q6KA 2Y7OA 2F68X 4F24A 5CFAA 2Y7NA 2VR3A 4F20A 1R17A 5IHWA 4BBWA 3IS1X 4B5ZA 3ASWA
chains in the Genus database with same CATH superfamily
2FX9L 3CSBA 1T2XA 3AITA 4HUMB 4I5BB 1FL6B 2D03H 1C8PA 3EDEA 1N2RA 1SFHA 1XGYL 4AGLA 4OD1L 2WBWB 1CGTA 4GUPB 4HKJB 1J0JA 2WLZA 4PWJA 4JPQA 3GC3A 3QUHA 3EDFA 4K8RH 5J1AA 2ZOKA 5K9KA 1LWRA 1LDPH 3T2OA 3FSAA 4N0YL 5I71B 1ZA3B 2VH5H 3PWPA 1JGUH 3HW7A 4J3VA 5DU7A 1FNHA 3FT0A 3QC6X 2IH8A 4LLQA 1VAHA 1Z5YD 2WQVA 4Z7VE 3TURA 1N9PA 2GFBB 1C5DA 2JCCA 4MB4A 1XR9A 3WXVL 5IB2B 5KVDH 1JZ7A 1J1PH 1ZIBA 1WJ3A 2IV9A 5GJTH 1VA9A 1IUZA 1QKZH 2YC1B 5LLIC 2DJMA 3R0NA 1T7VA 3TCLA 1G7IA 1HDMA 4Y1AB 3ARFC 4YEEA 1T80A 1MAJA 1NCCL 5C9JA 5LXGH 4F2MA 2QPSA 2VDKH 2XRAH 3KPTA 3Q44A 2XLLA 1FN4B 4Q14A 4PR5A 2GIYA 5A43C 3O6FD 4G5ZL 5LQBH 2OYLA 5J7CC 3SGJC 4H0HB 3QZLA 5EA0L 4MA3B 4NI6A 2NW3B 1N59B 1S9XA 2PF6A 1ADQL 4QKTA 4PBVC 4XHQA 1TU2A 1BQHG 1TLMA 4I0CC 4MB3A 1DFBL 2WOYA 1OB0A 4AJVA 4BZ1H 1EZVY 1EFXD 4YE4L 2LVCA 2ZKXA 4LEBA 5C0EA 5DD6A 3CFKA 4JGUA 1YYCA 2OMVA 4L1LA 2DEYX 4XXDB 4ZFZA 3DJTA 3X13A 2IXQA 3ARTA 5IESH 3C2SA 5D7IF 3LKPA 4JHVA 2IDCA 4TQ8A 4TVPE 4A2MA 4IOSD 2ZWKA 1BREA 4LZKA 4Y4KC 1VKXB 4YSEA 3DX2A 4UAHA 2E75C 1TKWA 1H15A 3UMNA 2DQJL 1YEHH 2EIBA 3TBVB 4G72B 3SO3B 1ZVSB 4ZAKD 5CEYB 4ERSH 1CLOH 3KWUA 2ADFH 1EBPA 3D39D 4NUJB 5D5ME 4C83A 1DJGA 2B3RA 2IC2A 2UV3A 2XC8A 2Y22A 4JRXB 3CQFA 1BQ5A 4LHUG 3T09A 3PXHA 2F5BH 2AP2A 4TV3A 2ATKA 3NAAL 3U25A 1UJTA 2RALA 5I66A 3B2VH 4GUOA 2IALA 3BWZA 4BKTC 1IGYA 2A9DA 3LX9A 2Y1ZA 3ETTA 3H2WA 4KJQC 4L5FE 2VDOB 2G9HA 2ZUWA 3NFPA 4F9LC 3L81A 3MRDB 4ZS7H 3RDTA 5D6DC 1CT8A 2X09A 1AG6A 4DQOH 1FORL 3ZRCC 5HHVL 1RZ7L 4TUJA 4GRLC 4XPTH 4AVKA 4RETB 4GXVL 2OMUA 1NDMB 3LXBA 2NW3A 4A7SA 1JPFA 1ROCA 4WQOA 1QFWM 1SNRA 3L3IA 3DA0A 1UKQA 3PAZA 3PHAA 4EBQH 4EI5D 4W9CC 1CFTB 4G1EB 1AC6A 4S1QL 3QIBB 4FTVE 2O6EA 3BW9B 4RGMC 1HHJA 1W0YT 4NENA 1A6AB 3VH8G 3CMOH 2IVFC 1DVFC 1S5IH 3EF4A 5EHFA 4RIRB 4NCC2 1QASA 3CDGA 3QJFA 5HXMA 3MV9D 5L4IA 1JGVL 1L6XA 1KGIA 2DKMA 4JHZA 4HH9A 2R1XB 3QJXA 5BZDB 4YHNB 2DLGA 1VFAA 4XOAA 3QO1B 3MRQB 3H4FA 1TO4A 4JDZB 3KPMB 1OO2A 4BXSV 1VSCA 2BHZA 3VAEA 1S78C 2CU9A 3US9A 1NGYB 1RHFA 3CX5J 2VZ1A 3ZDWA 3RLSA 3GLZA 2ZXEB 3MLVH 5GSRA 5I71C 3EYUL 2NX5D 3G6DH 4B60A 4GXUN 2DIJA 4LSSH 2C1PB 5ICXA 1NCAL 3GGWA 4RISL 5AAWC 2X4UB 3C60B 2AZUA 1XL4A 5D1XB 5JOPD 3M07A 3OTTA 1TLKA 1MKFA 3DVFA 4HFWA 3CIQA 2CGYA 3OGCB 2WP3O 2V2XA 3DUUA 4OZIB 4Q58C 2CJ3A 2EEXA 4WV1B 3MNMA 2GAZB 3ZE2E 4FNRA 1WBXB 4IU2A 2NY2B 2P1YA 4NNXB 3O6FA 4X5XA 1PG7X 4UIMB 1V7NH 4PRPE 3MLZH 3EH4B 4OZIE 1CZ8L 5DUBA 2IANB 4GINA 3FULA 1A25A 3LQAL 2BRRL 4YZFF 4OM0L 1T1YB 5F6IB 1YDPA 3D2TA 3O2DH 3QPXH 4MTMA 5DVKA 3EF7A 1U92B 4JM2C 1SDDA 2IPTH 5HPOA 5DUJA 3ZK0A 3SDXE 3LN9A 4RGNC 3OC5A 3EBIA 2HJLA 2QKSA 3EJSA 1AJ7L 2NY7L 2VDLB 1L7IH 4PJGF 4U05A 2K70A 2ISDA 4Y5VB 1QBBA 5IVXB 2ZYRA 3PRZA 4ICWA 2OAAA 4MXWH 4Y2OB 4ZUTB 1IC4H 2OYMA 2IFFH 1HYRC 4LOEA 5EZOH 5JUEL 4O2EB 3ULAB 2XQYK 3UJJH 3JV0A 4S1DD 5A3IC 4MLSA 2DQDL 5H8DA 2JJTA 2WWNA 4M9PA 1KC5H 4F7KA 1KB5L 1C5BL 5DHYA 2Q7AA 5HHPB 2FO4A 2KZBA 4P5KA 4PD4J 3UTPE 4ZSOB 4K2UH 4X8JA 1TFHA 2YK1H 3VXRB 4P9HH 3AS1A 2V17H 5HI4C 5BQDA 3SDDC 2EVFA 1MHPH 3ENEA 5FYLD 2NY2C 4TNEA 1OAZL 2V2XB 5AW7B 1GPOH 3CK0L 3ZL1A 5A40E 4ZMWA 3AMLA 5F21B 1RZKH 1D9KD 5CR8A 3BGFC 5I1KH 1U95B 4RNRB 1NCBL 1PDKA 2YGVA 4J2XA 4P0DA 3GJFB 3VWJB 4I48B 5DZ9A 2QGCA 4MRBA 2OYPA 4GKOA 4HS6A 1PD0A 4IIQA 5HGBA 4GS7C 4BA8A 2B39A 3INUL 1FNSL 1OQOA 4Y88A 2IPKA 3U6XA 3ZR6A 5TDOA 2WCGA 3VXQA 2FR4B 2Q8BH 4W9JC 2C34A 1ZSDB 1QHQA 4BQCA 3ZTCC 3T0EE 3MREB 1L6ZA 5E6YA 1G94A 3J8F7 1XSKA 5GGUA 2IWEA 3LN5A 2HPOA 4YZWA 4EN3C 5HTSA 4DT2A 3PE9A 3PL6C 2VDMB 1PY4A 5D9SB 5GGVH 5H4YA 3BLPX 2IAMC 2JIXA 4W6YB 4NDMB 2VDLL 1QFPA 2L4OA 4DTGH 4N2LA 3BPLC 2VRKA 4PJ5B 4PUBH 4NN5C 5ESQA 5IBUB 3VWKC 3ZRSA 4MMZA 2GVYA 1IX2A 3HC3H 1XHHA 4UOZA 3ETBJ 1SQMA 1D7BA 4G8GD 4I1RA 3H55A 4HWBA 2AQRA 3QZBA 2JTDA 1QO3B 1OGTB 3QORD 1AGFB 1RUQL 4KAQH 1ORQB 5FO2A 3GIZH 3GSUB 5DJCA 3GJEA 35C8H 5L9DL 3V5KA 4XB7A 4Q2ZB 3WKYA 1HTYA 1NIEA 3HE6A 3D39A 1V27A 3VX0A 3X1EA 1FPTH 2R15A 5JDSA 2XQBL 3RBSA 3VXOB 4G8FB 1X6NA 3A6CL 5I9QB 4E36A 4FJZA 3FOMA 1MCJA 5C0FB 4X0KB 1BZDA 5D5MF 4ZPVA 4P99A 3CAFA 5AB1A 1N64L 1BP3B 1MZYA 3M86A 3VFNA 3UPCA 3E6HB 3IWVA 4N68A 4PY7A 4P23D 1TTFA 2RAMA 2A1WL 1A7QL 4H8QA 5GS0C 5I1HH 2EE9A 3LRHA 3WSQL 2Y7SA 5EIIA 1KGCD 3H7BB 5I6XB 3L1GA 4LIQL 4FQQA 5HHQB 2R69A 2QQNL 2SEBA 2Q86B 4PVMA 1MCHA 4WCYL 3KPOB 3GLAA 1T5WB 1ZPLA 3M1BB 3I9AA 4FD0A 4RCAA 3FQRB 4C8XA 2EUXA 1SEQL 5FB8B 2YD8A 3NSJA 2OK0L 2YRPA 4KXCA 5EBGA 3RP1A 3WDHA 4Z3EA 1ED3A 5DXWA 4QXGL 3VCLA 1EK3A 4HU2A 4ADJA 4IRSC 1FLRH 1XF3A 1YJDH 2RB8A 1X7SA 2FJSA 3CPLA 3ULSA 4CU7A 5E6UB 2HRPL 3FS9A 2B4CL 2A4EA 2QPUA 1PBYA 4NAMA 4H25B 3HFFA 1JMZA 3UG3A 3UZEA 4CKVX 5K1VA 2GI0A 4BFGA 3QW9A 2XBZA 1QMUA 2KDYA 4M6MH 3ZZQA 43CAB 4HFUH 1WUNT 5GRZA 2L8AA 4D7BA 1BOGB 5B39G 2EE3A 5DVOA 3VXSE 1UYWL 1BMGA 5DFVC 3T4AB 5FAAA 4DP8X 8FABA 1ZGLA 4OKVB 5EULV 1IM9B 1G0YR 1QEWB 2OZNA 1X5JA 3K2MC 5IMOB 1DE4B 1NGXB 5AZUA 3K6SA 4ZFFA 3NPSC 3AXHA 3MLWH 1X5YA 4ES9A 3NIFF 5G55A 4DJMA 2J1YA 2Q2EB 1WPCA 1T0NB 3QIBD 1IZJA 5GGRB 1NPUA 3O3AA 3RTQA 4L9LA 1JE6A 4HP5A 4NO0D 2FCBA 1RUMH 3QQ3B 4KNTA 4M7KH 4F8TA 5BXFB 4S10A 4H20H 3ET9F 5AOZA 5AYUL 4DERA 5DO2C 3KE0A 3OAYH 4WNQB 4YQXL 5L88H 2FH6A 3MLWL 1JTOA 4PY7B 4EN3B 1EEZB 2Y7QB 4P4RB 1IAOA 2C3WA 2VL4A 1T1WB 4XN8A 3S48A 3HZVA 2Y9RT 1U8CA 1KB9J 4Y2NA 2BP5M 1NH6A 4DP5X 5ALBH 3CLFH 1DVSA 3WV0A 4P4KC 3K4DA 4AGMA 3SCMB 3VJ6A 4YHPB 1CB4A 2VDPB 5CJ8A 3ARFB 1KXVA 5F3HB 1PKQA 1T20B 2PO6D 5D1QB 4FABH 2FBJL 4FNPA 4R7LA 2OCFD 3F58L 4XODA 3T4YA 1ML0A 2J6EL 1KXHA 2CJUH 1LE5B 1BAWA 3C8HA 1HCYA 5I17A 2OK0H 5IFJA 1LYQA 3II1A 3KLSA 5HGAB 4P2QB 1U2HA 4U3SB 3M88A 1PQZA 5DTFB 4WDIB 5F7LB 3GSWB 3FU3A 1UA3A 3MRHA 3FU0A 3TPKA 1K6QL 1AO7E 2VISB 4N2AA 1T1ZA 3SBRA 3FQXB 1RIUL 3AG3B 4PJHA 3SHSA 1R19A 1S9YA 1G7QB 3FTVA 5DSCB 2O93L 1Q0XL 4ZFFB 2WCSA 3OQ3B 2MHAB 3H8NA 3H4HA 2NY0B 3T0XA 2D7PA 4X7TA 4XCYA 3K5RA 1O5PA 4MJID 3JWNC 1N64H 4XBGB 5T5NG 2OULB 4WI9A 3SDXA 1JV5B 3NP3A 5KTEL 3VFPB 2D7OA 1FGNH 2X42A 4WEBL 1E9QB 4RQQB 5I75C 2I7OA 4ALAH 4I3SH 1G0XA 1RUPL 3EYOB 3DDFA 5JMRA 1DVXA 1EA9C 3V9EA 4BFIB 1P1ZA 3GNML 4R0LC 2OR8A 3L3OC 1P9MA 1BVLB 1ZHNB 2VMFA 3GIZL 3LNEA 1CG9A 4PRBB 1PYWB 2ADGA 1IC7H 2IOIA 3D48R 2YAPA 4PRIE 4MYPA 4WTZG 1HN1A 4V1DA 4JM4H 5G5DA 1YO4A 3FN9A 3FQUA 3FPXA 2BZ7A 1NM9A 4HISA 4F33B 1DBAL 5CLXA 3ZE0B 4ZD3H 2Z4QA 1P0SE 2D7TL 3LZFH 2VDLH 2CKBB 3BESR 3E3QE 1KYFA 4OQTA 3VU2A 4QHNA 1HT6A 3U0TB 2VLJB 5E8OB 5ADOH 4P9MH 1JXGA 1QA9A 4BSWB 3P4NB 1DE4A 5GGTA 4GQZA 5HDQL 3VI4F 2FATH 5AW0B 2Q8BL 3EUDA 2B08A 3D18B 4N2EA 4JQVA 4HAGA 3U30C 2VW4A 3V4VL 1KULA 4K5NA 3FUIA 3GRWL 3HRPA 4GRWE 3DROA 1OLZA 3O4LD 4M7LT 1KIUA 2Y07L 4UOW1 1KJ2A 3U4EA 5IW6B 3A22A 5LAXB 1GPOL 5BW7C 1YCSA 3I9GH 2AXGA 3PDDA 3L7FA 4JANB 4XXCA 4F7CA 4ACPA 1GTFA 1U8PA 1X5HA 4C4BA 4EXKA 3KL3A 1WWCA 5F0LB 5GQBA 4AWJC 4P9HL 1YMMA 3AREA 4BFIA 5JIMA 4N5UA 2CCLA 4GQ9H 4UU9A 4M5ZL 4YSPA 1ZA6A 4IJ3C 4YIQA 3SY0A 3H9HB 3T6XA 1ASPA 4TLUA 4L8CA 1MWAH 3GRGA 3QHFH 1J11A 2B1HH 3IRCA 2VLLB 3LQZA 4JN2A 1V3MA 1YSOA 5F96H 2JVUA 4MXWL 2NY4C 2AQQA 4KKAD 2G2RA 4X6EB 2HLEB 3ATAA 1JGEA 5DF0A 2YEZB 1DJSA 1B4LA 1F42A 3P4LA 4KXAA 4IW4C 4J5VA 3SZKC 4KFMA 4OFDA 4NKIL 1PQZB 2AV1B 1ESOA 1SOXA 5IBTH 1LP9F 2VABA 4LT7A 5TPWL 4U1LA 4ODXA 4PEEA 3VD0A 1JYXA 4HT1H 4LKCB 3EOAA 4HWEL 3MNWA 4KZCA 5FYJE 3LQAH 3IGLA 4R7DB 4APQD 4U1JB 5DMGC 4E42A 4ZX4A 3BUDA 5AKVA 3BAYA 1ODUA 5JDJA 1S7XA 3VFSA 3FN0H 5L2JB 3CU1A 2Y6SD 4PRAA 2FYYB 5F7EH 3WNMA 5B7MA 4U3CA 2XA8L 4IEFB 3VACA 2H0FA 3MMEA 1N0XL 3MI6A 4OVUA 3ZYJA 4ANXA 5C97A 3TO2B 4AYSA 4YDVB 3BZDA 4GRWH 4Q9QL 2DQIH 4PCKA 2CO4A 3ZDXF 5CS7A 2ZAHA 5EOCL 1UUSA 2BY2A 1KYAA 5JHLL 2Y5EA 4PGDB 3UERA 1XGPB 4I87A 3IPEA 3O6LL 3FFOA 1BXUA 5FS5A 4IGBD 3WN5A 3KYKL 5EO0B 2Y0SA 4WW1B 3EJCA 4ZS6C 1CQKA 5H94A 1E40A 4AIOA 2E7CA 3MBWB 3ETBF 1FH2A 1N12A 5AKTA 5ERWB 3QDGE 3H6JA 4YHOH 3MJ9L 5CD3A 3RBGA 5D55A 4IRJB 3ECQA 1XGUA 3CFNA 3L3DB 4LASL 1XEUA 3PP3H 2K6YA 3WI9A 2ERJB 1RPUA 2AGJL 4ZQTA 1I8AA 3WNPA 4UQ2A 3D3VB 3MRPB 2WYIA 5E7FA 1S5IL 1AHKA 1IEAA 3SKNB 4QGYA 3TO4C 3BEVB 4YN3A 2JTYA 4TNFA 1E65A 3DV4B 1NC4D 3Q43A 2QSCL 2B9AA 3FRPG 4GXUM 1BIHA 4XB3A 4WW2A 5GS1B 4FFWD 5E6IB 4LPWA 5C08B 1MOEA 1X7TA 4U3HA 4JFYB 5L7XL 3LKPB 2IAMB 5JHDE 4XP9H 4PJEB 5C0JA 1FLTX 2B15A 3BYYA 1QFWL 1SMAA 3MMEB 4BCXA 2I60L 3I02A 1WFMA 3A23A 5KSUA 1UXWA 2PXYC 1V5JA 1EEYB 4KJPC 4OVVA 5AYQA 2GSGB 3GPEA 3RVUC 4MAUL 1HL9A 3SQOL 1UURA 3P4MB 4NQXB 1O7DC 2FBOJ 3F2LA 3P0VL 1T1XA 5C0EB 2MCAA 1RAMA 3B2VL 3TL5A 2Y72A 3NUKA 4HC1H 4NRYB 4OBRA 5I76B 5CKGA 1WCBB 4CVZB 1Q8MA 2AERT 4LCVA 2BXZA 4KVNL 1LMKA 1UT2A 2OR9H 4OLVL 4LNRA 3HG3A 3U82B 5AW4B 4K3DH 3GSNL 4U1NA 4XZUA 3EOAB 2R1YB 3DURA 2QKIA 4Z9KB 2K7QA 1NAMA 5KSBE 3ZE2B 2VN6A 4LHUA 4D94A 4EI6A 2TRYA 3WKML 4HS6B 3GTNA 1QLFA 2J88L 1YEKL 4ZW3A 5KVFH 4ANUA 5K1JA 1AXSB 3WFHB 3C2AL 1BQUA 2V3FA 4GSDL 5I1EH 1CXKA 3Q2LA 3GMPB 5IHUL 4U6HB 3ZLQC 3T5WA 1NBCA 1USQA 5HDBE 3QQDA 5EA0H 2G9HB 3VFTA 3IMVA 2ZUUA 4MNHB 1S5HB 5LQBL 4FZEL 4MCMA 3TEYA 3HZKB 2VDKL 1S3KH 4XNXH 1YEEH 2YD2A 3L4TA 4H26B 1VCBC 4F57H 4FLSA 5JIPA 3SKUD 1FA4A 3K6NA 3H9SA 3IN0A 1S9KC 4YZFE 1GIGL 2HVKB 4LPCA 3SPVB 1XGTB 2PPDA 3LPWA 1HZLA 2ZCKL 4IGBC 2BM3A 4H7VA 1CGSL 3ZMEA 1BZ9B 1F58H 3ZKQD 2ZUVA 4N6RA 1I3RA 3F05A 4KHXH 4G8AC 4NSKB 3JYBA 1BBJB 4OGAD 4QRPD 2MCG1 3BP4A 1D7FA 3QNXA 3UC0L 4WWNA 3MCYA 4OZFH 3VH8A 3TA3C 2J43A 4ODWA 4LEOA 1FE8L 2L04A 3EO0B 4LCIH 2XN9E 3DRQB 1MNUL 2KI6A 1U58A 2QSQA 1JHKH 2BOBB 4LSVL 1ZMYA 4HPOH 3TN0D 4BZ1A 3FU7B 2BNRA 2EH7H 5C71A 1UD3A 3FO9A 3V52H 3I75B 4BJLA 3B9VA 1ACYL 3PJSA 3O9WD 5KVEE 5IBLD 4NAJA 1ZTXH 5FKPB 3SO3C 4EMZA 3S9DB 2A6DA 4MNGB 2D03L 4PJIE 1OAQL 2OMNA 4IRSD 5I1JH 3IJHB 4QO1A 4WTXA 2F74B 4HIJA 1XSIA 1HH9B 2CDFA 4KITB 1NDTA 4ANWA 1P4LA 2YA1A 4ONGH 1IQDA 1O9VA 3D9AH 3BMVA 1IBDA 1S9VB 5DWUH 3ARGB 3BIKB 5MERB 2ETWA 1P6FA 4AVJA 2ADIA 2C4FT 1YUHA 2MKWA 3BE1L 4OIIH 1RL1A 4P3DB 3ARFD 3HN5A 4D9RD 5E5MB 1IM9D 3QUMH 4I3RH 3DXAA 4OGQC 1HNGA 1W6WA 3F8UB 5D5MB 5DK2A 5E8DH 5CIPB 1JFQH 4U1GB 5EPMA 4IGBB 4CJ0A 5D4IA 4UI2A 5F6HJ 1DLHA 1MLCB 4XVJH 1XD1A 5KSBF 1U42A 5LGKA 2OMXB 4M43L 4WIQA 3SPVA 4BFOA 3GGWB 2YQBA 4B9FA 2A9NH 4UM9A 1QSEB 4YC2C 5DR5H 2EEFA 3LQAC 4JO4H 1NMCC 4NUGH 2CO7B 3LKNA 3SE3A 1AQHA 4AGPA 3ZW3A 5E95B 2FO1A 1MHCB 4XHJD 1AY1H 1HVXA 1GGYA 3Q5YA 5KVEH 2A6JA 5IR1B 2CIKB 1EFQA 5B38G 4PJCE 3BRFA 1KLGA 4N8VB 3CFIC 1BQHA 3G6JB 3S8FB 5LNGA 3OR7A 1W8NA 4DN4L 4UV4L 2EACA 2APSA 2HX8A 4IK6A 5ABAA 2Y06H 3MUUA 1M1XB 4NFDA 4LL1A 2IGLA 5CJBA 1JZ8A 4GO9A 1PDKB 4NN7B 2EYRA 3MGTB 1E4JA 4NT6B 4HJUA 1U8JB 4A7QA 2CBOA 3HJEA 2HKHH 3ABLB 1PKOA 4ZFOB 3SE8L 4ODHL 1H3UA 1GGCL 4HWNA 4JVWA 5EU6B 1IGFL 3W11C 1KACB 1OEZW 3EJUA 2FR4A 1A64A 4TLSA 5D2NC 1DQTA 3TYFA 3FRUB 3PPSA 1CE6A 4V33A 1PKQB 1OGAE 2CIIA 1PLGH 5CBEA 1YUHB 4YJZL 4J8RB 2UY6A 1LE9A 5EZIL 4CGUB 1RD6A 2F7IA 3BWAA 1WO2A 5I8EB 1TG8A 2PPFA 2BY3A 1CLZL 3ARWA 3TBSB 1M3JA 4AITA 4FQHB 3FQ1A 2GHWB 5DS1A 1KYOK 3GJFA 5DC4B 1CD0A 4Y9BA 1KFGA 2PWEA 4J6RH 2JCWA 5E9AA 2HJFB 3DVNB 5E99L 2F0CA 4BFEA 3FTUA 2APFA 4M6OL 1U2CA 3G04A 4RWYL 4NM4H 4PJEF 5EZJA 3BFWA 4WY7H 3SPJA 4JHAH 5JOFB 1WFJA 3IJYB 1LNUB 4UIKH 5JLZA 3LEVL 3OKDA 4M8VA 4OF0A 5FM5M 2ZAIA 2Z8WC 2KT6A 1NEZG 5IWLC 2GITB 3ATEA 1U8HA 1XGQA 4BQ8A 1UCTA 3BRDA 4FFYH 4NHCL 5I30L 4H1LB 2ORBH 3FUFA 4FCAA 1EGJA 1XH2A 4BFJA 1WV7T 3ALXA 5DVPA 1YEIH 3GSVA 4AE0A 2AAAA 3FQNA 4J8QA 2WN2A 1CS6A 1NBYB 2R0LH 3B7YA 2FIKB 5A16B 2KQNA 4KHTL 4L18A 1GMIA 5FIEA 3AQYA 4ABUA 1JPGB 3P77A 5FYLH 4LCCC 1JDDA 4OJFL 2ZWSA 3GDBA 3WJMB 3O0LA 3DIDA 3MOAL 3L2LA 3SDYL 5EWIL 5MERA 2DQMA 4PAZA 2YUZA 2VLJD 3FU9A 1MHHA 4I9WE 2Y1VA 4QGTA 5D6CA 5IJKA 2EUVA 5TE4L 2BIIA 4IHBA 3Q3GA 4ZI8A 2FEJA 3K6DA 4J23A 4O02L 5CBEB 3EHBC 3QEQD 5LNDA 4W9DC 1QWNA 3UBXA 2EH8H 1O0VA 1E9PB 1SPDA 3LHPH 1KJ2L 3Q5TA 4OF6A 4YDKL 4YL9A 3T0EA 3GS7A 5EBLA 1U8MA 3PWJA 3EADA 2JLLA 4PJDE 5FO9A 4EIUA 1KWGA 2J8HA 3NDYE 1K3ZA 4EE2A 5FA3A 5ISZB 3WIFA 2F1BA 4ABWA 3WNLA 1TZGL 3NJJA 3QO0B 3OG6B 4GO8A 4MX7B 3HS9A 2GBUA 1FG2B 4HXAL 3Q2CA 4PP2A 4G82A 1CDJA 2O5YL 2BCMA 4O51A 2AJXH 3WU1A 1WC7A 4XHJC 5SX4I 1JWMB 4R90H 5ICZA 3V7MA 1A7RH 2GUOB 4Q74A 4CN4A 1JDAA 4MZ2A 3HC4L 2ZX5A 1EJ8A 3RGBA 2ATAA 1MLBA 4Z0XB 3STLB 4Q6YA 3OR6A 3TCXA 3CZNA 2VERN 3LXAA 3VM7A 1PZUB 4Y5XB 5JQHC 1M05B 1PZ5A 1VFBA 3NK4A 2O5ZH 1OAXL 4H8WL 5E6SB 1G7JA 4V11A 1KYUA 4HGWB 2XDHA 1IBGH 4FFZA 4G8IB 4P5TA 3QUZC 4XBGA 3N06B 3DJSA 2P28B 3MA7B 2A73B 5D7LD 3RFZC 2PTUA 3GXFA 1E27B 1NOLA 4L05A 3WJJC 3DDGA 4OY9A 4QTIL 2MFNA 5F89A 3LRLA 3ULUC 2AJZB 4RFOH 3RIAK 4YDZA 3FUNA 4GFTB 4NP4H 5C0GB 1KPUA 4R4FL 3QXVA 4L29A 3P02A 1SUHA 1FFRA 3ZDXB 2OCJA 4RRPG 2VLLA 1NKRA 5HI4D 3SCMA 1M6OA 2O26U 3KJ4C 4Z0BH 1W0WB 3IDJB 1JF1A 4GI9A 4QRRD 4XCNB 3VRJB 2OJZL 1WE5A 3NA9L 2AJ3B 5C0RH 4P2RA 4APQC 2HKAA 4XNAA 2XN9A 1FVCA 2ADJA 3LB6D 3GK8L 2VLKE 2CUIA 2VDNL 1IGJA 2HT2C 4NLAA 5T1LD 4TL5A 5A2LH 2ZSVA 3RILA 1TQTA 4EDXA 3P30H 4HIXH 1I8UA 1JD9A 4YBLB 5E9DA 3O3EB 3O2DA 5IG7B 2ENSA 4R5XA 5HVFB 4YFEA 1BFTA 5DHVA 4Y4FC 4ZXBA 4O51B 2PWDA 3NIGF 3ULUL 5KG9A 2KC0A 1YY9D 2YSSB 4WZ9A 2A6IA 4TVSa 3B5HA 4ZOAA 4M00A 4AQ8A 2XFXB 4GJTB 5K93A 4OCXH 4Y16A 2GBVA 3WG7B 3ZUNC 2ZP8A 3K8LA 1ZT4A 1OT1A 2C26A 4CVUA 2BSED 2JI3A 4WO4A 1QSED 3RWDA 4ZS6D 4TVPH 3TVMB 2HUEA 1M56B 5T33H 4ZDHB 3A4AA 2X4RA 3V0GA 5BOZG 3HI6H 3D85D 1UB5A 2DLTA 1MHHB 3Q7JA 4PRHD 2GG1A 1K5NA 4WY7L 1WUZA 4YDLB 4PWEA 2HP4A 3PWUB 1MFEL 3WN5B 4OFYA 1U3ZA 5FO8B 2BVOB 2N56A 1YRKA 2RACA 1EHNA 4HWZA 4WGVB 2WO2B 3TZVA 5CD3B 1M6OB 4YSOA 4MJ5A 4FQXB 2OZ4L 2JH2A 1AMXA 2FQDA 4N3TA 1WWBX 4JMXA 2AJ3A 2YD4A 4PJAE 2VN5A 3RU8L 3WS3A 2NR6D 4BE5A 1PAZA 1U8QB 2JKXA 3CVIL 4ELME 2AANA 3QI9B 5SV3A 1K4DB 4F9LA 2VDNB 3DRTB 3NCYP 4R3SA 5I24A 4XC1L 4FADA 2N4IA 4A7GF 1KBPA 1LO5B 4Q0XH 2HKHL 4HJSA 5FUCE 3ABGA 3T4AC 2HZHA 3PCYA 3X1GA 5PAZA 2VM3A 2RD0A 1WFTA 1QFUH 5JHLA 4XCYB 3AM8A 5FGCB 5HY9A 2VT0A 3LCYA 1JZFA 3MCLH 4G9FE 3SBWA 2X2JA 5DJ2A 1RY7B 5JHMA 2V2WB 3WY4A 2J44A 2FSEB 5C0AD 4AYFB 2HJKA 3NVQA 1UTDA 1F3JB 3EGXA 3IJSB 3P73B 4DW2L 2VR3A 5C0IA 3CVBA 4Z7WA 3OKNA 2OL3A 3SE9L 3DTXA 1MWAA 4AZ8B 3L1OL 3B9DA 3GZKA 4KVCH 4DP2X 3L3HB 5BUGA 1BDYA 3W38A 3HVDA 1GW6A 1NJ9B 4HUXB 2C9QA 1MJJB 1Q9WB 2GFBA 3FSOA 5JIKA 1TMQA 4AQEB 4CNIB 4PJXF 2P44B 3DROB 4OLUL 3OF6A 1U3HA 3APDA 1DLFL 3NIDE 3IS1X 4XTRC 2PN5A 4HJ0C 1J0KA 3VW3H 1HK6A 1VGEL 5KJRL 4M6NL 2LU5A 3SB3A 1OD9A 4L4JA 4PRHB 1M9SA 4IHOB 4OJCA 5D96C 2ED6A 2WINA 4HALA 3SZ6A 4QD2E 2VC2H 5DJAB 4DEWA 4HPYL 2WY3B 5AOKA 5B8CB 2PETA 3ARXA 2C9RA 1T7ZA 2WLIA 3NT0A 1Q38A 4GMTL 5DD6B 5JW5B 4S1SH 4Y16B 2HT3D 1GAFL 1ZTXL 3MODL 3OKYA 1ACYH 3TEWA 4HV8B 3PXLA 3G5YB 3X14A 1N0LB 5LGJA 4GQPH 4FTVA 2GJRA 3TVMA 1NIFA 4GAYA 3WIIL 1FL3B 3GUTA 3RZCC 5BS0A 1MNUH 1KJVB 4HUWA 3MA9L 2FHCA 1JWUA 3MVSA 4NJ9L 2DAVA 3SYAA 1AGCB 2KZWA 1VKXA 3OPZL 4ENEC 4JM2A 4X6CA 1CDYA 1R3LB 3FH7A 1SJHB 3CTTA 4I85A 4QRRE 3IRPX 1X5FA 4WU5A 4PJXA 3D85A 2OJEB 4N0RA 4PGCB 4HG4K 1I8IA 5GGRY 1F11A 2DBJA 5DD0L 3B4NA 1U8OA 4P5TD 1BBJA 4B6ZA 4A37A 1N6QL 4KH2A 2ODHA 3IN2A 4LLQB 4NQED 4YDLC 1IBZA 2HFTA 1V05A 3MV7B 5FYKL 4OZHA 3FFDA 4M48H 5C9KA 15C8H 2DJUA 2EO9A 3VXSD 1YEEL 1FN4A 4M5YL 4OI8A 3GM0A 3RVUD 4I2XE 1GGIL 5HVWA 3LPOA 4P46A 4LCUB 2DYPB 3TLRA 4TPRH 4CDHA 4R2GC 3BLKA 4IU3A 1EJ6A 1BFOA 4WFHE 3SDAB 3W5NA 2GJZA 5BO1H 1NUDA 5CEZL 1CIDA 7PAZA 2F53E 5AOMA 4FQJL 2R0WL 4J4PA 1JNLH 4PR5B 5LCVH 4A6YB 3BDBA 2AEIT 1I3GL 3ASWA 4EI5C 3WY3A 3H9SE 1GYUA 5BZWA 4OB5L 4WI2A 3ZO0A 4G7RB 3VSVA 1AXSA 4LESA 4WHYG 4KKLC 4TRPH 3F62A 3ATDA 4UDUB 2D0HA 3MUHL 4X50A 3KPRD 4KNQA 4ZW6A 3L95A 1J5HA 3MXWH 3M46A 4ZW8A 2CUAA 1ZK5A 1CICA 2OR9L 3KVDD 1SHXA 3BEWA 2RCSL 1VADB 5AYTA 1Y0LA 3ARBA 2N01B 4NN6C 5CBAB 5DVLA 2LQRA 4P2RE 3QG6B 1FAIH 2DQUL 3A47A 3CFQA 2QPEB 1G9NC 4FLOA 5FFOA 4JDZA 3DIVA 3PL6A 1EXGA 2FECI 2ZXQA 4UB0L 5F8RC 3ZGHA 3DV6A 2OTUA 4S2SA 5DJ6B 3MV8E 2W0PA 3P0VH 5JMOC 3PGFH 5AVZB 5FUOL 2BO0A 4NBZB 4DUVA 2AITA 3NJIA 3TTSA 3MBEB 3WO4B 4UBDC 5D2LA 1OSZB 2ZXDA 3LKRB 2DEXX 4GRMB 4S0HA 2IV8A 5DD3H 4I8DA 3K1DA 2X89A 3VXRA 4ZUWB 2F5AL 4YO0A 4NJAH 3ASOB 3GMRB 3QC5X 4NUMA 4KWUA 4CSSA 3HE6C 3LIZA 4G8GE 3KMDA 2Z8SA 3L5XH 2JKJA 4E9VA 4FA7B 2JELH 2BHFA 3FF7A 4WI0B 2XG5A 3F7KA 4A7TA 5DMIH 2A6DB 5AW2B 5A2CA 5BV7C 4YFLI 5CWSA 1U30A 2AZAA 3AREC 4J27A 5LXVA 3WFDL 4DKAA 2IBZY 3I3DA 2I9LB 1FYTE 1TZHA 2PXYB 1MW0A 1L9RA 3GBLA 3TN0C 3C6SB 1QEXA 4IOIB 1RJLA 1HHHB 3B6SA 1TPXB 4ZOEA 1BD2E 3QFJB 4N90D 3KXFB 2RA1A 4TUOB 5KSUB 3TNMB 1TJMA 1AQMA 4FTVD 1TNNA 3GIVB 4MAZA 5DQJB 5JZ7C 1UWEL 2CHZA 4WHDA 1VF5C 4WV1A 5L2KD 5D7JD 3SJVA 2GUYA 3U7WH 2CSPA 5EEXA 3KGSA 1YECL 3DX8B 5C70A 4OZGB 4JPVL 3JVGC 3X3FH 4I0PD 5FHBH 1ZRUA 3A6BH 5DMKB 5CKAA 5AAPA 1BWMA 3UZEC 4LOUC 2UXFA 4Z3IA 2CO6A 2BINA 3FW6A 5DUPL 3DUUB 3NFNA 2MQ3A 1BXAA 2GC4C 2OI9C 4PJIF 3LPPA 3LKRA 4GRMA 2NTFA 2ICWA 1DSFH 1V3KA 4LEOB 3TIDA 3BH4A 1TT6A 1PX3A 2X6CA 3NCJL 5B38A 2OXGB 4ZO7A 3V0WH 3GJFK 3KVPA 3OKEB 4ZPVB 1TEGA 3D25A 2IANA 2GW5A 5SWSE 4IOFC 4DGIL 5IROC 5IVOA 3MRBA 1A5FH 1YNLH 1YPZB 4GI6A 5DHDA 1HEJC 1KENL 1LO3H 3QWNA 4PJBF 4J4PD 1RK0A 2AI0L 5ISZD 3UGEA 3IJEB 4RVBA 2YQGA 3ULUE 4ZFOA 1NCWH 4O58L 3WFBH 5B1JC 4IBQA 4IKNA 4HUUB 4X6FA 3C6LA 3FMGH 2ZXWB 1QSVA 5AW1B 3MTRA 3C60C 4AW4A 5IFAL 4OD3L 2WLYA 5J56B 1ZJBA 2CIIB 2UWEF 3CCHA 2DICA 5B22A 4B9PA 4YDMA 3RIFK 1KIRA 3NRPA 4FQPA 5A2FA 4DETA 3RWJB 2VUOA 1F18A 2E47A 2DKSA 3N55A 1QTSA 1E50A 1GGBL 3GRWA 3IF1A 3T3PF 1TQSA 1LEKB 3QHFL 2DN7A 3VVWA 4RMRA 1DSYA 3LPFA 3N0PB 3QO0A 4MX7A 3BWUF 4ZAKC 1Q9LB 2FGWH 3VD2A 4URKA 4KZDH 4M5ZH 1D5BB 1WISA 4BQ9A 4MKMA 1JZ2A 3AT0A 4GW5B 1IQDB 4FYTA 1TJGH 3IT8D 3AU1A 5BOPA 3F7YB 2FE0A 3STLA 4KGLA 1UGKA 3IRZA 4J3OC 5F1NB 4XPAL 2BVQB 5KVFE 5ACZB 4MNQD 4KJQD 2Y2YA 5E6ID 1MCOL 3VFRB 4UT7L 4AYDC 5C7XH 1E2WA 4DK6A 4FYSA 3MKGA 3OKEA 4NRZB 5EZLA 1I9IH 1ZS2A 2YPLE 2CRYA 3H54A 2VIRA 2YLKA 1H6EA 1UJ3C 2HAZA 3BZ5A 4MZIA 2X53A 1HZHH 3GFUA 1E4KA 2DMBA 4OGXL 4UTCA 4Q9RL 1JBJA 1F4WL 4QY8B 1S9VA 2FATL 4K3JH 3D3VD 2WGXA 3BKJH 1FFPB 2O72A 4ZUSB 5EU4A 4IOFD 3S35L 3PGDA 1CD1A 2LLLA 3K3QA 2VXUH 4U4BA 3TNMA 4E9XA 1PF3A 4AIZB 3UYRH 3UYOD 4MD4A 4U3XA 4DGVL 1MXDA 2JQZA 5I75B 5C08D 1UZ8A 3U36B 1OTTC 4M8RA 1J87A 4QRSA 3S36L 1I8MB 1TQCB 4NZDA 5H2BB 2AQ2A 3HG4A 4KKQA 3KYOA 1KT2A 4MAYB 4LGRB 3D69B 1T03H 2WIIB 4M9OA 5ID1B 4YHZL 1W72L 4FQQB 3RG1C 1BAFL 3QQ9D 4BK5C 1C1EH 3ARBD 1FC1A 2CCWA 1FIEA 1WBZA 1UM4H 2NOYA 3F83A 1SJXA 3DPDA 3MRHB 4I3SL 1G1OA 2VM4A 1BWWA 2BY1A 3GBNL 2B1AL 4P3CH 4AMWA 4JO5A 4M3HA 2EILB 2LW3A 4F9PC 2ZKHH 4OT1L 2R56L 1NIDA 4B50A 3L9BA 5DEGB 2YXWA 5B1CA 4U1KA 1MIEH 4UNIA 3T3MF 2FIKA 1JV5A 5JO5A 5JHDD 3H7BA 1MI5D 3TH2T 2HUHA 1CGYA 5FKAB 1CVRA 1F1DA 5EC1A 5IB4B 1K6QH 5T1DL 1E27A 4DEUA 2F7PA 1DN0B 5KAQF 4IIQC 4Q7DA 4JQIA 1CE1H 1P1ZB 2AK4E 3AY4C 1W72H 2ZYIA 3VFWB 3EBHA 3AAZA 3L7EB 5J9PB 1MCEA 4H2CA 1UFUA 5I8KH 4UMSA 3GBNH 3QDJE 2X4PA 4I89A 1ODAA 3HG1A 1C9SA 2WZAA 4UDTB 1Q90A 4Q6IA 1P5UA 2QJDA 2XXFA 2CH8A 3SY6A 4YHZH 3Q6FB 3KPRB 4HJGB 1KOAA 2DQFB 3BUYB 1RMFH 3T0AA 4FABL 4Z7QF 4PBXA 1NMAL 5IBLC 1EEUA 2WQWA 3DYPA 3N85H 5T3XE 5F7BA 3UYRL 4J1UB 4L4VA 4MB1A 3JWNH 1PGRB 1QG3A 4PJDA 2OV0A 1HHGA 4WWID 5IHZA 1B9KA 4LO9A 5HGAA 2WWMC 2YGQA 2YRZA 2H6PA 2R23B 1H9DA 3LH2L 5D7JB 2A3TA 4L9LB 3ZTEA 4CN1A 1OE3A 1X7QA 4XE5B 3SYOA 1UXSB 3DPBB 2P3YA 3W37A 3LNIA 1Y1DA 5C7XL 1EAJA 4BHUA 1ZLDA 4DPBX 5KSBA 4K3JL 1GXEA 4N2KA 4TUKL 1MFCH 2DWTA 4ZFGH 4BZ2A 4CADA 5CR1A 1BVKB 1SBBA 1ZS8B 1J1OL 2O4EA 2L7QA 4KK5C 4N8CH 4YPGA 1MFUA 2I26N 4JL2A 4K94C 4UT7H 1UC6A 5KANI 2ZNWA 3JTBA 5C09B 4KZDL 5EC2A 2X44D 4M6ML 1MI5E 4ATTA 3F6JA 4OCYL 1NLBL 3O2VH 3ULVL 1G6RB 4WSKA 2NNAB 3RUGB 4RH4A 4JO3L 1E5YA 3H9ZA 3QYCA 4WUUB 1JZEA 2CHNA 5A2KH 2PCFB 2LTQC 1SOKA 3WUWA 2VSMB 4PGZA 2GT9B 3VDCA 1R17A 2WNXA 4JFOA 1IIKA 1M2OA 5IB1A 3H6AA 5FFGA 1FFNB 3REWB 3WHE1 5HYQA 1T5XA 1IFRA 5GRXG 2EC8A 3T3ME 1KBGL 1PS3A 4U1IA 4WCYH 5IF0A 1F90H 1HKLL 4QNPE 4YSTA 2WLHA 1YEDB 3UP6A 1D6EA 5K33A 2PCPB 1Y18B 1CG9B 1HSBA 2M83A 1TTUA 3WSQH 5GHWH 2B5IB 3VYNA 5HI5C 1KTJA 4V1DB 1OW0A 1WIOA 4A39A 3V0VB 4OV5A 3WFBL 2NR6C 2OZ4A 1FG9C 5SWSA 1A7PH 1N0LA 3T8MA 1BM3L 2QFRA 4WUKL 5IFHL 1A02N 2ZD0A 3V0WL 5AG8A 5IEKB 2ZZUT 4EPSA 3AZUA 5SX5K 1WGVA 1Z9PA 4KKPA 1FF5A 4DGIH 1JTPA 1Q9KA 2LLGA 4Y19B 4FMFA 2YXFA 1ETB1 5IB5B 1RUQH 4KAQL 3RPBA 1KIPB 3F7RA 4JFPB 3VRJA 4X5PA 3NJNA 3BC9A 4A38A 4PGDA 2DL9A 3EUUA 3QXWA 4FXGB 1OSYA 3CBKB 4P4KA 2ZPKH 3AG2B 3BPOB 3U6XS 3Q6FA 1HCZA 4JFEA 2WTRB 4PUBL 4XPFL 2CCVA 3TYGL 5HYJE 1HEHC 5IWLA 3B3IA 4EF3A 1JTTA 1CFMA 1CLVA 4PCTA 3OSVA 3EJQA 3MGOA 4JFDA 4B53A 3WMSA 4JANA 4F7CB 2XVKA 4JPVH 5GGSY 4LVHB 2P5WB 3MRRA 1YECH 1EZUA 3SGKC 2FX7H 3JV4A 1K4DA 1A3ZA 1IAII 2NUTB 2PW2A 2IADB 4U1LB 5D8JH 5DD1L 1W16A 1FNSH 1P6WA 3HCVB 5D2NE 4DP7X 3FT3A 4JAMB 4DESA 3JV6A 5ADPL 1ZLUK 2P26A 1IU1A 3B83A 3TFKC 5BCAA 1MFVA 2XACC 1AHWA 3OMZA 4NKOA 1S7SA 3K72A 4HWZB 3EHBD 4WWKC 4AH2B 4LHQB 4GI8A 3BH8B 1AANA 1IGML 3IS0X 1T6VN 1WA1X 2QHRL 3JYCA 3RY6C 2J73A 1U8PB 4AXWA 3QJVB 1MH5B 5KBLA 1UATA 1FL6A 2NX5B 2F5AH 4FAAB 4G3YL 4LOVA 2VQ1A 1T2QL 4FULA 2CUHA 4PJ7B 3HZYB 4HGMA 3KS0J 2ZG3A 4K2UL 4MMXA 2V37A 4FP8L 3TASA 1RZIA 3L5XL 2LE9A 2NTSP 1MCIA 2VWEE 2LGNA 3WL9B 4ZMYA 2R59A 4LLYB 2A6KA 4JFFD 1KC5L 1TQBB 1VZIA 4RMQA 2NW2A 1B4TA 2DJ4A 2OBGA 4PJBB 1KN2L 1D5ZB 4PV8B 2KLRA 1WZ1L 3U30B 3I6KB 5J3HD 4WFFE 1FAIL 2DQUH 1AQDA 2BSCA 1LK3H 4C4KT 4X7EC 3NOIA 5ENWA 3VUAA 2XICA 2NXYD 1G7LB 3ISYA 4YFDB 4E9WA 1QRKA 3BUPA 4LXFA 5CFHA 2WNGA 2VO8A 4TSBH 2AABL 3OX8B 5F0PB 2APWA 3V9FA 4A2DA 3R7QA 3D4ZA 4JFQB 4IBTA 4TRPL 5D1XC 5I0DA 2BIPA 2BP8A 4B7IA 4ILDA 4HSQA 4OM0H 2WINB 3T0VA 5CZVL 4ZOBA 4JZJC 3WO3B 2J8UA 1FNGA 1I3GH 4B95C 2WBJD 1ZDSA 1KXTB 5KSAD 1F4YH 2WC7A 3MLXL 4XMLL 4HV8A 5IMMA 1QHOA 1QR4A 1N70A 2W9EH 4MVBC 1SDDB 3DETD 2QTVA 3C75A 4RMTA 1TPXC 5LCVL 1JNLL 4XXWA 5BW7A 2AS5M 1X9UA 1F6FB 1AGCA 5F44A 2A9ML 1AGBA 4IKJA 3L9EA 1DN2A 1KLFB 3QQNA 4G80B 1OPOA 4G1MA 2BIHA 3KPPB 5DD0H 1C5DB 4NZFA 3K7UA 3VWKB 1UFGA 4BA0A 2ZSWB 3VXMB 4KKRA 1ZT1A 4NGHH 4NO0B 4MDIB 1DVQA 3KD4A 2JJVA 5EBMB 1SXAA 3TCLB 2BS71 3MRKB 3SO5A 1WCBA 3RWIA 4ODBD 4DKFH 3BQUC 1CFNA 2XU9A 3BVXA 2G30A 4EXPX 4YHML 1SMDA 4HS3A 4AQ8C 5H4ZA 1I4FB 3P9MB 3N43F 3DBXB 4JG5A 2OMZB 3L3IB 4NZRH 3VGBA 3DECA 4Z77B 4XO4A 4YC2B 4JAMA 3H3PL 1JNNL 2L3BA 5HJBA 4LLAA 4FJYA 2VW7A 2Z9TA 3JZYA 2VO5A 3E8UH 4LHUB 3SDCC 1UACH 2VN3A 4C4UA 4QIRA 3ALPA 4EBQL 3POHA 4NENB 4R84A 3BAEH 1MCPH 5CJ5A 4WWKD 2H3NA 3QIWA 3IDXH 1OHZA 4NKDB 1S46A 4XPTL 4B7LA 1E5BA 3MODH 4PV1C 5GZOA 3HE6D 2VR6A 5HHVH 4GKNA 4S1SL 3BT2H 4Y4HD 1T21A 2FEEI 5DFTA 3L95B 3VQ1C 3NGBC 1GVIA 2N1KA 3IDUA 3FPYA 1DLFH 1EEYA 2JI1A 4BUGA 4P46B 4GSXA 4M5SA 4YE0A 4ZXBD 4EUPA 4K7FA 1T1XB 3BCFA 4OQ1A 1S7VA 5HGGS 1L9PA 3QUKB 3NJGA 5GGQH 1DLHB 4HCRA 4KDWA 3NAAH 2DM7A 2WKOF 4PHXA 5DZLA 1E42A 3FQYA 2CK2A 5D7IA 2QQKH 2IALB 4WO4D 1HE7A 2BVEA 2XWBB 2RR3A 4MGXA 5KYUB 4JLRA 5E1GA 1B2YA 3U46B 3GSQB 3CH8A 3WIAA 4ERSL 3ZHNA 5BV7L 4TQIA 1BSIA 1DQML 1CL7L 1YY8B 3EO0A 3G5XB 2NTFB 1WK0A 4N6QA 1JXKA 1H0DA 3ZMRA 3CZFB 3RZCB 3L45A 1OF2A 3IXAA 2BS9A 3HN3A 5G2NA 5IESL 3SE9H 3ASNB 3FAXA 3SOBL 3BD3A 3GPSA 3TO4A 4XP4L 4DPAX 1OTTD 4NNXA 4QHUB 5BRZB 4Q0XL 4MAYD 5LG1A 3F7VB 3HS0A 1DP0A 3FTXA 2JCCF 3NCXA 3QIWB 5DVMA 2QZ5A 5D1ZC 3S5LB 3TS8A 1NBZA 4DP0X 2X41A 5D1QC 1NAML 4AQOA 1N10A 4B9KC 3ZSSA 3EOYG 2OZ4H 1OCZB 1A3QA 5I5IA 3N41B 4FXLA 5KSAB 4BKSC 1E67A 3X1NA 4WRLA 2FQGA 4YDNA 3RDTC 1LL1A 1XAKA 4Y4HC 4EUPB 4DK3A 2XG5B 4L8DA 2RGSA 4GNKB 3WXVH 1Z3GH 2NLJB 3NN8A 5CCGE 4WK0B 3DJ9A 3ZXAC 3I84A 2X4NA 1HS6A 2DYRB 2P5ED 5GRUL 3NJMA 2CO7A 3LKNB 2XJLA 4KMTH 1FDLH 1JI2A 4WKZB 5AB0A 3QWQB 3DGGB 4TVPL 4HIEA 4C56E 3QEQB 5EUKB 5IJVA 3B9KD 2FEDC 2OL3L 4LB8A 1CC3A 3P40A 3PPEA 4A2FA 4F80A 5AOJA 3IE9A 1JYNA 2IQAA 1CXEA 5DK2B 2EE0A 3L17A 5DZAA 1KLGB 5F93C 1SN5A 5HGBB 1XZWA 4GOSA 3VFUA 2E6QA 4OGZA 1DN0A 3NIDF 3C8DA 4JKNA 4X5LA 3LV3B 4P5TC 5ID0A 5HHMD 4LFHG 4KKCC 1JSYA 1U3HD 3QPQC 4H8PA 4LVEA 3KJ6L 1A22B 1IM3B 2J25A 4E0RB 1LEGA 3V4PH 2C3XA 4G8EA 1LP9E 4P07A 3V5HB 1JMXA 3UZQA 5TDPB 4HQQL 2WYHA 4K94H 3A4FA 4YHPA 4P5RA 25C8L 3ULVF 1G9ML 2Q0ZX 2C9VA 3ZKMD 2OJZH 4PJFE 1OVZA 4FHKA 3RI5K 2VITB 2UZIL 2AV7B 4KROD 1EO5A 1MRDH 4RGNE 5IT2L 4U7MA 4ORZC 4IBYA 3QNZA 1FZKA 4RFEB 1R3KA 5FA3B 3C5JA 3LMJL 5L2KE 2BWIA 2G75B 3NA9H 5C0RL 2G3MA 3DOIA 2TAAA 3IGFA 3JWDH 3RDTD 4RFOL 1TTAA 4Y8AA 1DBJL 2YIHA 5DURB 1RI8A 3OC8A 2GJJA 1L3NA 5KVMC 2F1AA 2Z92B 4FMVA 4IBSA 5EO9B 4I18A 4YAQA 1AO7A 4NHUA 3ZT5A 2GEQA 3MKKA 2X2HA 4X9FA 3MV7D 1GZHC 3TCTA 4CADB 2X7LB 3HG1E 5KYXB 4LOFA 1A9BB 1CPUA 4UUJA 2VKWA 5C86A 5EZLB 3HC4H 4FNQA 4Z8FH 1WDAA 2FWOA 1WIPA 5HD8D 2L7JA 5TF1H 5A6LA 4ANVA 2ALAA 4KNUA 3W0WB 2IH1B 3ESMA 4IJ3B 5BUPA 2VZUA 1LQBC 5GISL 1AQKH 5C0ND 3FCSA 3NIGB 5EU4B 2C9XA 1WAEA 4P46D 2VZSA 3HE7D 1I1CA 1QBAA 3GM8A 3KCPA 3N04A 2B20A 2XG4B 5JNYA 5A2IH 3QDMD 4NQCA 2EP6A 3VXPB 3CSGA 3O4LA 2VAJA 3WAKA 2O5YH 1UM5H 4U6YB 5FLUA 1BLIA 2Y25A 3MBED 3FTZA 3H7LA 4HXAH 4JZOA 1XSJA 1RURH 4NRZA 3NJXA 5CILH 5GXBB 3P0YH 4HJGA 4KI5C 1NCDH 1RU9L 5EZJB 1C12B 1RK1A 2FIRT 1EMTH 1XSOA 5HHMB 5DMJB 1GZPB 2OMYB 1MVUA 5C0BA 4HJJH 4F7TA 1DEEB 2YHGA 3C5JB 4K3GA 4GRLD 1HHGB 4NN7C 4MB5A 2I32A 2EH8L 2DQTL 1QATA 1R47A 2OPCA 3FUDA 3MOAH 4GP5B 4RAHA 2VYRE 3V6OE 4NQDA 4X7SH 4UYQA 4KK8D 1W9XA 4HUCA 4K8RD 3C12A 1YMHB 4DOHB 5C0FA 5F3HA 3RNKA 1GY2A 1JK8A 3OKOB 3P3SA 4KY1L 4W9IC 3RPKA 3S35X 1UXSA 3B9KA 4KFZC 4ZUUB 1DHKA 3FO1A 3CZSA 4E5XG 1UXMA 4CUCA 5CN3A 3QCVL 2YXVA 1R34A 4FFYL 2XWCA 4PRDB 2XN0A 4AV0A 5I30H 3MZGB 1SYVB 3BN3B 5C8JA 1MVFA 1WEJH 4KHTH 4TF4A 3STZA 1HOCA 3KEDA 3O9WC 5F89B 4N0CC 5D6CB 1GS7A 4KTYA 4LLDA 4JHAL 3V4VA 3IAGC 1E28B 3OWRA 4RWYH 2MMXA 5D7LE 4FXGA 3OWEA 4ZQKA 4HCIA 1F3RB 4JFZL 3S3PA 5KVDE 2Z8RA 2VL5A 1O7DE 2TSBA 5EFIB 1D9KA 1FDLL 3CHSA 3FK3A 3LZRA 3WTTA 3IGKA 1TTGA 5CCKH 1BLNA 2O61B 3VXSA 1UD6A 5DDHB 4UDTA 3RWGA 4ZFOL 2H41A 4QOKE 3WTYA 3BRGC 4AM0Q 4M6OH 2Q1EA 2EAEA 3AG1B 4KTGA 3RB7A 1YNKH 4CDGC 3WS3B 1AOZA 1GS6X 2BMKA 3PU7A 5DJ0B 2W94A 4HIIB 2LT9A 5IKCA 3CFJB 2Z6FA 1A14L 5I1GH 3GEWB 3UO1H 2R2HB 5KYYB 4PJGE 2WNKA 3WIFB 4KROB 1ZGLB 5IM7B 5EIVA 3CUPB 2YPVL 1FIGH 2NXZC 3CFKB 2Y06L 1ZLWK 4FFVD 3V6OA 3T2LA 3ARRA 3GWJA 5GGRA 1Q9OA 4QXTB 4U0QB 4PG9A 2A6IB 2EVIA 1GR7A 5JORB 1HJBC 4GBXB 5ILTH 5D96B 4TXVB 4WWKB 4XP4H 1I3UA 4YX2H 4F24A 3MNZA 5ANMB 1DEDA 1YJDC 3IXTB 4UV4H 4DN4H 1WICA 2QQLH 3VRIA 1FO0A 5KSVA 4LP8A 3TPUA 2TRHA 4ZDHA 2WVUA 4GAFB 4LLYA 5E1QA 5DEJA 3OL2A 3O45B 4ZMPA 2YKLH 1WZAA 1DSWA 1M7DB 3FQUB 5ESAB 3QISA 3TH4T 3HR6A 1MDAA 1J5DA 4MA8H 4S0SD 1NJ9A 5BV7H 5F7AA 4J28A 3HE7A 5F7NC 5L8JB 4JE0A 1CTNA 5E8PA 3F7QA 1XB8A 3FT2B 5HI3D 4W9LC 1RZKC 1G7PB 2QQKL 2A9NL 3PLYA 3QUML 2VLJA 4I3RL 5AAMA 4L1HA 1H6UA 3TJEH 2ZOKB 5GGQL 4FFYA 3KPNB 3FQ4A 1T0OA 2XQYG 4P2QA 5DHVB 4O02B 5E8DL 1F8TL 4Z7UA 5DI8A 4M8QB 1KCSH 4P48A 1E4KC 3M45A 5LG6A 3ZY7A 4PJHB 2WUCL 4U0RC 1ET5A 5AZ2L 3WCYA 4N9OB 4BZYA 5B3JE 4XPGL 4RA0C 3MJ9A 4XAKD 3ZYIA 1WG3A 3IDXL 3NPSB 4N9GA 3PHSA 1G9NH 1FVEB 3EJJX 5IHLB 1LD9A 5F1OB 1W6LA 2E56A 1EH9A 3L2MA 2APVA 4LGPB 1RUAL 3TF4A 1VEPA 1IC5H 2Q76B 1E6OL 2CO2A 3QDGA 2L7UA 1T2JA 2F8IA 4TLKA 1E3FA 4HKZB 4XX1E 5DURD 1JNNH 1CCZA 4NZRL 4NNYA 3ZJAA 1BM7A 3D4GA 3SGDH 5F8QC 4BH7B 3V52L 3WDJA 1ID2A 1MWAB 5GPRA 3KPMA 1MJUL 1JHKL 1V10A 2XOTA 4NO0A 1XR8A 1KIPA 2V8MA 3FB8A 4JFPA 4AENA 1RJYA 4M6AA 4M3KB 5DD5H 1P2CB 2GQHA 2HMIC 4P4KB 4JFHD 3VI4E 2XIDA 2V8LA 1U91A 1TNMA 1MUJB 2E27H 3EZJB 3OKMA 2WAHA 5DJ2B 3SCMC 1MWOA 5F9AC 3APNA 3OBAA 4X6CE 4OZHB 2BFVH 3G6AA 4P2CG 4XNXL 4XTRD 1CGSH 1V7ML 1O6SB 5DJZA 1AYOA 1I4FA 3P9MA 4QHNB 5DRZA 3U0TA 1KCLA 3PP3K 1YLBB 1XH1A 5SX5H 1PVHA 2MIZA 1LLAA 4JFDE 5I1LB 3D33A 1HSBB 2WWKT 5D1ZI 4ZT1A 3L3JB 3RX5A 4PJIA 3WOVA 4P59H 5IB5A 2K3HA 1UM6H 2UWEA 4ORGA 1S3KL 4L4TE 1CF8L 3DRTA 1FBIH 3QULB 1A9EB 1HL4A 1IE4A 4LBEA 1MRCH 2V6HA 2X9ZA 2XPGA 4J3TA 1E2ZA 1F4YL 1W2KT 5JW5A 1PG7H 2BOLA 2C3VA 5IHUH 4LCYB 1KIUB 5EU7E 5ERWA 3ZDYB 3F5WA 4BYHA 1PNDA 1MNNA 2MTAA 5D1XD 4OLVH 5IMMB 3HB3C 1J9QA 1YEKH 1ZVNA 5KVFL 1FO0B 1A4JB 1ZXKA 1RULH 4GLRI 2EYTB 3CXDL 2ZOTA 3AXIA 3FFCE 3QORC 1WWWX 1M7DA 4OF8A 5K9JH 4LCWD 1XGPA 1HKFA 1FNEA 1IEBB 3NA4A 4WU7A 1GZQB 2VRQA 2R4SL 5JW3L 2MSPA 4XWGH 2KQMA 1TETL 1XIWD 3DX3A 4FLHA 4EEEA 2RFXA 3D85B 1B0GB 5K9QG 1XGTA 4A6YH 5H94B 4U4IA 1YYLL 2HLFD 4IBLT 4NIKB 1BZ9A 1D5ZA 1XXDC 3P69A 3WEXB 3W9DB 3WLBA 1TJHL 2JI2A 4Z7OE 5HI3C 5CLYA 1N6UA 4JQVC 4MQSB 5EB9A 1MUJA 4MJIE 4GAYB 3FCBA 3ZTNL 3EJTA 4WW1A 4E68A 4TSCL 4I9WD 1QFWH 1QZNA 3GXPA 1XB6A 3FQTB 4XP9L 3GBDA 2P48B 4YUEL 1A6WL 2LFEA 2YFOA 2WSDA 2XNAB 3B9AA 1HE8A 4MHHI 4CKQA 2I24N 2V9UA 5IW1B 3SGJA 1TU2B 1ZK9A 2A6KB 1ZANL 1J5OH 4WI0A 4Z1PA 1IQWL 3K72B 5J11B 3KZ8A 5MENE 3ALWA 2FYVA 2R8SH 1JWSA 2OI9B 5D70H 4NRYA 1PZSA 2PLTA 5IV2B 3SKJH 3CC5B 3BUBA 3NMEA 4KKLD 4YXKL 3VXUB 5B8CA 4QTHB 1JZHA 1MI5A 2R2EB 5I82A 4ENZA 1URIA 1RERA 1FGVL 4ONFL 5EO1B 3X3GL 1BQLL 1KBKA 1M71A 2V0AA 3GDCA 3ZZLA 4LASH 4RA3A 4N3UA 4WENB 1C08A 2JV6A 1CLYH 4NIYE 4O5LH 4H88L 4MD0A 5CLZA 2V5RA 4UTAH 1MJ8H 4L5FH 5FDYA 4AM0A 1SDAB 3DVGB 5GSVA 1XGZA 3PL6B 1CFQA 4G80A 4GG6E 2ZXCA 2GJ6D 1MG3C 3Q0HA 4MKTA 1RZGB 4G83A 5G4NA 2WLLA 1DJWA 4MCYA 3MPCA 1NGYA 4EVNA 1ORQA 3UTSD 3U6RB 2DQIL 4Q9QH 4L9DA 4X99A 2P5PA 2AQTA 3MRKA 4GKLA 2X4OA 1IAIL 4RRPA 2VLME 5LNEA 2IBGA 4CRPA 5AENA 4CVZA 2KERA 2GC7C 1J9RA 4WHCA 4YK4C 5FM8A 4TMPA 3THML 5ABZA 5F9WB 3QRFM 2VUKA 4OLEA 1XMEB 3C5ZD 3BGFB 5SWZE 1W91A 4ZFQA 3W2DL 4ABVA 1PEZA 1SLXA 2KYIA 4NQDE 3T8XB 1IL1A 2NZIA 4Y89A 2P8PA 1BFOB 2PKDA 1PLCA 3AADB 4POZC 2GBTA 5LN4A 3MUGB 4HWEH 4QLWA 3KL0A 4L23A 1Q94B 1KCVH 2I5YL 5T3ZL 4HKXB 2DI9A 1VDGA 1OTSD 3QHTC 3AQXA 1TCMA 4U1SB 5EU5A 3ABKB 2IAMA 2HG5B 4NKIH 4H40A 4ZO9A 3EHBB 2X10A 4GIOA 3RA7H 3LH9A 1EZLA 4NWUH 4KO7A 3JWNG 4OUOA 5C0AB 1TJIH 3I75A 4L3CB 4TQEL 1XF3B 4YVUA 4Z6AT 3E6FB 4BKLB 5AD0B 1KBGH 1TF4A 2D2OA 2QVFB 2DZEA 3QUKA 2JCCE 1H3VA 4WHYH 3RY4A 2E9GA 3VH8B 1G1CA 4GQ9L 4M1CD 1P4LB 2X3CA 2BSRA 2QELA 3GI8L 4FF9A 4NUQA 4RMBA 1MXGA 5B4MD 1JHTB 2WLLB 5GRWA 2HX9A 3VI3E 4PGBB 4ZUVB 1EBAA 5EN3A 5D7HA 4JO3H 4WAFA 1T21B 1PFOA 5J11C 4QRPE 4H1LA 5F1NA 5ACZA 1QOKA 3BP7B 4HUKB 3HOGA 1A7OH 1J1XL 1Y07A 1A4BA 2BOBA 5D7SL 3MV11 4BIKA 4L8BB 3QUMB 3FTGB 2OXHA 3KWWA 3BP5A 4AVIA 3ESUF 2E7DA 2K8QA 1FZJA 2WQXA 2CM6A 2YAHA 3TH3T 3A4EA 1IAIM 1PMYA 3VFTB 5F7WC 2VXQH 2AQPA 3D51A 2ZWLT 3A67H 1XO8A 4JN1H 5EDSA 5TDPA 5IMKA 6FABL 4ALAC 3D07A 2UZPA 3Q1EA 5HDQH 3LZFL 4PRIA 2D7TH 3WFZA 1M53A 4APQB 1IMHC 3WHXB 1P4BH 2V5YA 4Z7NB 4KZ0A 1CVSC 2W88A 4DZBB 1NDGB 1ONQB 3B2DC 4K8RC 3U1SL 1KYOJ 2ZUSA 4JFED 4ENED 4K5LA 3V4LA 2PR9A 4YDIL 4X8CA 1U95A 3MGTA 3WEAA 1KDIA 3LVTA 4YSDA 1CQYA 4NO2A 3DKHA 3F64A 1DJYA 4PMEA 4ZD3L 2AW2A 4Z7IA 5E1AA 4P5KB 4JZJA 3ML8A 1X9RA 1U93B 3BDYL 2KZKA 1PZ3A 3I3BA 1K8IB 4OF5A 4XMTA 1OOAA 4OW6A 3KYNA 2Z31A 3QDMB 1NKGA 4WEBH 4RZKA 4OZ4A 3UG4A 2WVSA 3QG7L 4HIEB 4LLWA 4M1CC 5KS9E 5KTEH 3U9PH 2X1QA 4O4YH 5CJQL 3F3HA 5CSGA 4CGTA 4P2RD 4QRBA 2QPFA 2XWDA 2VW6A 2OSLB 4ALAL 2ZOUA 5AVVB 3K6OA 3IJHA 3QUMA 4QO1B 3GMOA 1WQVT 3EDJA 4ONOA 3O11B 2WK2A 4OT1H 3G9AB 4F15C 4BQBA 2E5EA 3CFDB 5EIIG 3AXLA 1F0LA 2CMRH 2I27N 3LVEA 4FG6D 1WAAE 1F2QA 2VDPL 4IDLA 4IYKA 3T2NH 2E3VA 1BF5A 3GBML 5E6RB 3FQRA 3F58H 4I3GA 4W68A 1T7YA 3QUXD 4PWHA 3LDBB 2YEVB 1BZ7A 1MCSA 5AWNL 3S3CB 4QKXB 4QRSB 2CJUL 2F54A 2G3NA 5DMGD 1T3FA 4PFEA 3EYSL 3OLDA 5E8OA 5I8CB 4H25A 4G7YL 4LCWB 1U8HB 4AQ1A 4UMGA 5L2KA 4NQEE 4JZNB 1LEGB 2J1XA 3LRSB 3SKOA 2VNCA 4KNSA 3RVWD 4L37A 4NS0A 4G8FA 3CLFL 4YSQA 1HH6A 2BDNL 3NBNA 1SBSH 3SIKA 1QW9A 2XTSA 3D1MC 4UZUA 1XF2A 3BKJL 1OAUH 3I6LD 1L7TH 1V3JA 2NNXA 4HWBH 2HH0L 1UHVA 3DX7B 1RK7A 4F1ZA 3LV3A 3KLDA 2HB0A 2YGNA 4GW1B 2X2UA 4YQXH 3J7HA 4NT6A 1XX9C 1I9IL 4PJGA 5K9OB 4AW7A 1SBSL 4OZFG 4NN5B 1MCOH 5CMAA 1JYVA 1WC7B 3PV6B 1ES0B 5IGXL 4G71B 4ZPTB 1ET8A 3BSZH 3GMNA 3MO1A 4ZQKB 1T1WA 1NEZB 3DMMC 5HDOA 3F6IA 4J3WA 1S7WB 3ARUA 5MI0B 1H5BC 2W38A 3UTSB 3WN5C 1TQWA 4J3BA 4HFUL 4FDWA 3S96B 4FQHA 4JR9H 3WS6A 4A2HA 1LP9A 1HAUA 3OXSA 1SHWA 2QHLA 3OLEA 2ZOLB 5BXFA 2CKBL 4F2FA 2EVHA 4G59C 5J4MA 1KB5B 2QADB 2YAQA 4LHUD 3S3DB 1CFVL 3T2NL 4AZUA 1YJDL 1JPTL 2OMYA 5C0BB 1ZLEA 1UB6A 3C8KA 5DRNB 1TEYA 4QXGH 1T83C 1RCYA 2HFEA 3CHPA 4I0PC 3DXAD 2BNRD 5TQ0H 4ECNA 1ORSA 3TV3L 4IMKC 1NCOA 1QRNE 5FYLE 4HOZA 2YLHA 2IH3B 4DPCX 4D0CB 4NQCB 3RNKB 2P7TB 5E56A 3MYJB 2VQUA 2EKSA 3U9WA 1ZLVK 2AI0H 1KEGL 4Q8BA 5D4QA 5I1HL 1HWHB 5FK9B 3M8OL 4IRZH 4QXVA 5I73C 3DGCR 4PJCF 1F3JA 1KGJA 4IS6A 4OFPA 4Z7QE 2ZTBA 3UXFA 3RL1B 2BVPA 4P4RA 3FUEA 3VXTA 2WUBL 5E2WH 4HPHA 1QA9B 3KHQA 1R3IH 1T6BX 2ZE0A 1WD8A 3HI5L 4P2OA 5FKAA 2XG4A 4GSUA 4MASA 1XQ4A 3FOLB 2W95A 4NQDB 4R7NB 4JDTL 4ADIA 4U6YA 1NGZB 5B1BB 4X4ME 1OY3B 3G9VA 5L9DH 3GSRB 3UBXB 2Q9OA 4A2EA 3UTQA 2YAEA 1AD0B 1E2VA 4OCMC 3I9PA 3J2PA 3OAZH 2B59B 2OMTB 3C60D 2P4AB 3NSDA 4EDXB 5AL0A 1NUGA 3NYKA 2AXGB 4PJ9B 1YC7A 3PABA 4Y1SA 2KS0A 1TOXA 4D8OA 1RQ5A 3HC3L 1P5VB 4IBWA 2A7BA 2AVGA 4GAAA 2VLRB 2UWEB 2J2ZA 2OW7A 6FABH 2AQNA 4D9QE 7TAAA 1M6UA 3RE0A 2VXQL 3RNQB 3IDMA 4Z3TA 3FT1A 3D39E 3Q48A 3INOA 5IY5B 5JIIA 1S8DA 5IM7A 3NEOA 1HESA 1KTLB 1DVUA 3TJHD 1IRAY 4JG1H 2H6PB 2R23A 1AR1D 2Y1YA 3KLAB 1M7XA 1PY0A 5FW6A 3VO0A 1DFXA 4AH2A 2X2YA 3WTVA 1YPZF 5HYSB 4F33A 1MHPL 3ZPDA 2EKJA 2WLJA 5D7SH 4RQQA 4JFXB 5I5JA 2ZJSL 5E6IC 1L5GB 4GG8A 4TS6A 1NCBH 3QNYA 1Z6JT 2X9XA 5I1KL 1OAJA 4R7XA 5EC2B 1RZKL 3L5JA 2CAKA 4R0LA 3L3OA 3LZPA 3NCEB 2R2HA 1C5BH 4NQTA 4BH7A 2WXNA 2W9LA 5EFIA 3KVQA 5CSZA 2DQDH 1ZHLA 3FRPB 4LAJH 1RH8A 3ZKXC 2X12A 4ZMZA 3QEHA 2AXJA 2O5NA 3FB8B 3GI8H 2K45A 4PJBA 3U2IA 4AENB 5LDUA 1DDHA 4LNVA 5F1SA 1VZGA 2X4QB 4BV1A 2FYYA 1U91B 3DSNA 2GEEA 2WLMA 3MCKB 3UJJL 4NO3B 2XA3A 3CVCA 4PW9A 2F08A 4XBEH 4GKSA 4Z7WB 4TQEH 2G2RB 2YZ1A 2XIIA 4X6EA 3MNVA 4GYBA 3U0PA 1J10A 1R3HA 3JTSB 4OCSH 2WANA 3RA7L 3OJVC 3JV4B 3SDAA 1AZCA 2WTOA 4Z7UB 3TNNA 3QAZC 3VI3A 3AREB 5LWYL 3O9WB 1N3NA 4KX9A 3BGMA 2H26B 4B96A 5KN5A 2FD6H 5IV2A 3T77B 2DLEA 4QWWD 1LO5A 2ZX9A 2DLHA 2HJKB 2NYYC 4UT6H 4XNBA 4PP1C 3FT2A 1H3XA 2NSXA 3DXAE 1TEFA 4JN2B 1UOWA 5AOIA 4Y19A 2A2QT 2HCZX 1CGVA 4FQJH 1NCNA 3CSTA 3KPNA 1AR1C 4JFXA 3KLLA 4XOBA 4GG8B 3B2MA 5GZNA 5ESAA 3ISRA 4TPRL 2FZ3B 5HPMA 2XJKA 2Q3AA 4O9HL 3G6DL 4DGYH 2KHAA 1IAIH 3T3PE 1XWVA 4M5YH 3IAPA 4L4TB 5KWYC 3V4PA 3FO0L 3PDGA 4M48L 4NPYB 1G7PA 4C54A 2CNYA 2X88A 4YVNA 1YC8A 2AC0A 4JPKH 4PJEA 5C0JB 2DQEH 3QZOA 2A4CA 2X6VA 2J1ZA 2XSKA 1JGVH 4KXZH 1JN6A 3AB0B 3MN8A 4EZLA 4YGVB 4UTAL 2EDFA 1IJNA 3CFUA 3R4RA 4X6CB 1MFNA 4H88H 1H3WM 3PAYA 5IK3B 4NWTH 3L3DA 2CR6A 4TOYL 3FQWB 3GSNB 4AE1A 1E8YA 4FI8A 1DJIA 4HOXA 4ES8A 4I77L 2FUQA 3J27A 1QUPA 1GYAA 3X3GH 4IHOA 3ZE0F 3HHSA 3ZBMA 2WBJC 3JZ7A 4XXDA 3O81A 4ZFZB 4XN2A 4YXKH 2IQ9H 2VZTA 4G6JL 1KGUA 2I9LA 4FXGC 3N40F 5D7LA 1RZ7H 1GAFH 3FB5A 1Z66A 4PJ7A 3QXAA 4RSVA 2VAAB 1J5OL 2WVTA 1A6UL 1ZANH 4GKNB 1R3LA 3PGCB 2ZUYA 1B4JH 4ODUA 4HPYH 3BH8A 3U79A 4KI1A 3OSKA 3OKNB 2IH9A 4G7VH 2IAND 4NQDD 4R8WH 4B3EA 3UDWA 4CSZA 3W0WD 3SJVE 5F2FA 5F3BB 4TSCH 1SHSA 2VXVH 1QLFB 3GLDA 4P23A 5CEXB 5HYFA 1JZ5A 1ACXA 2BVUA 4ZS7L 1PTZA 5B3SB 3V0EA 1NGWB 1AHMA 3QEGL 1AIFA 2FSDA 1IFHH 2A38A 1BVNP 2ADFL 4DGWC 5B39A 5HYSG 3L5WA 1X5AA 2YZ8A 4YSRA 1D5XA 3NESA 3WDIA 1DUYB 4QT5B 1TETH 4Y4KD 4P2OD 4XWGL 2NY5L 4KTEL 3SE4A 4Z3JA 2R4SH 3K1KC 4WTZA 3RY5A 5K9JL 1QQDB 1YQ2A 3CLEL 2YWZA 3L08A 4P4KD 3KWVA 2KH2B 4ONHB 2VN4A 1CLOL 3Q8BA 4X4XA 4JB9H 3SGKA 5D4JA 3QZWG 3KNBA 1V55B 2GKIA 4YHYC 4X9HA 3ROLB 3SDCD 3T0WA 3IJ8A 2IEPA 5DS8A 3REVA 1YN7A 3MZTA 2AQ3A 1DFBH 3SBPA 2BSEA 3QCUL 4P57B 4TUJB 1ADQH 3RGVC 2XX1A 2ILLA 4F7PB 1QPPA 1QNIA 1IFGA 3IBOA 1HQ4A 3LJ3A 2EZ0D 1JPFB 3PQYE 5E5LA 2IMMA 1TCRB 4WGKA 4YE4H 1M71B 4P59L 2UXTA 1KLFA 2VQ4A 3QIBA 4BZ1L 1KMGA 1F3DJ 2YPVA 3UGUA 3HNVL 4ZOCA 4N2CA 3N40P 1MCCA 2ITFA 3BI9X 5JR1L 4GH7B 2B14A 2P5EE 5DZPA 2CLRB 4F7EB 2YBRA 3RWHB 1UQSB 1AGBB 2GTQA 1MG2C 4HZLA 5EBMA 3IFOA 2WB1A 3ZZSA 3AT9A 3ZE1B 5F9JB 1QKZL 1CDBA 2ZX8A 3GTVA 2HSIA 3HMXH 4XNZB 5FYKU 1HHKB 1HL8A 3HZ3A 5KVDL 1K9TA 1LDPL 3OMNB 4MCZA 5FR3A 5KBKA 3G5ZB 2A77L 4C4KO 1MJUH 2WVVB 2MCPL 2CZNA 1SRDA 5J5EA 2FJGA 5IHHA 1QTYT 1RIVL 3CSYA 4OD1H 1JGUL 4D8PA 1TZAA 3CZFA 3VSTA 2YUXA 3RZCA 1OP5K 5DZOA 3GHEH 5T8IA 2HT4C 1BA9A 5D2NA 2J55A 3CVDA 4PJ7F 3EFDH 5EOTA 1ASQA 4JO8A 5D7LB 3FFCD 4O2EA 4ZG1A 4Y9EA 4ZBJA 1A65A 1NANH 5GRVL 4G6AD 5D1ZD 2ZP0T 1I3RB 4HVBA 2FX9H 1U9KA 2CWRA 4OLYL 5DGQA 3ULUH 2YD7A 5D1QD 5DUBB 4OSUH 3VA6A 3UP1A 1KCSL 4GBXD 1AFVH 3O0RH 1MIMH 1HFUA 4A7GA 2C4XA 4APXA 4CC4C 5ES4B 2MPAL 5C0CE 4QDGA 1P4UA 3WE6A 3A24A 4WVRA 2CDEB 5L4JA 2VDQB 3LPGA 2VITA 4RWHA 5D7IB 5FDWA 2X1XR 3DV6B 1RZGA 5I5MA 4AEIL 1H6FA 3QUGA 3T8XA 5AW5B 3VVVA 3EO1A 3NK3A 4FZ8L 5HGDB 4JPIA 1QBLL 3U6RA 1RZ8B 1MW1A 2JKLA 3QDHA 4N20A 4D3CL 4DHLA 3QDGD 4Y5XC 5B7EA 4D2NA 4MA8L 4Q52A 3CZLA 3HRZB 1J8RA 5JOPE 2YD1A 5FWRA 1CDUA 3JUYA 4NM8H 1KJ3L 4AV5A 2R29A 2YMXL 4J8RA 4PJDF 4GUQA 3P1VA 3OB8A 1GOGA 2X9WA 4UOQA 4E9QA 4LLWB 3MXVL 3CSPA 2I07A 2BNQE 2H1PL 3ROLA 5CJOH 1BD2D 5D9SA 4OZGF 4OIFA 5IQOA 4QTIH 3IU3A 4IBZA 4PYGA 3ARZA 2VLRE 1ITCA 5LO7A 3IJEA 5J13B 4UT9H 1EVUA 4N8VA 5E2UL 5CUSL 3KWWB 2EDJA 4K5OA 2O5ZL 4H8WH 3TVMD 4CC0A 3KJ4B 4QXWA 2IOMA 3DGDA 4X6DF 3PV6A 3QJZA 1SFDA 5FOBA 3TIEB 2L7EA 4UM9B 3AU1B 4DSYA 5CM1A 1JRHL 1NEZA 5J9PA 3CCHB 4TNGA 2DMKA 3VI3F 1NLDL 3H42H 1UD2A 4R90L 3U7YH 4AYEC 3MV9B 4QAWA 1HZKA 4A55A 1VPOH 3BH9B 3D52A 3HG1B 3Q05A 3CFCL 4FL4B 5IMKB 1CXFA 1F4XL 2P80A 3AABA 1J9TA 4WJKB 1I7ZB 4E41A 2R83A 4JKMA 3TONA 4JO1L 1MFDH 5E1HB 2I25N 1CFSA 1FNAA 3CGTA 3ES6B 3GMLA 3UBFA 2GABA 5F9WC 5DC0A 1YEJL 4PTTB 4AG4H 1K3IA 2NY3C 4JFFB 2R39A 4LSTL 3LNFA 3MLTA 2EDEA 3LHPL 3IJ9A 1QSFA 5CINH 4OI9A 3CFMA 4MCZB 1LO4H 1VACA 1U2YA 5F6IC 5L2KB 3HPJA 2X4NB 1OANA 4G6ML 1EXHA 1RZJC 2PPEA 1QNZL 4E9TA 3L9YA 1FVDA 4XAWL 2HT3C 1UOKA 3JTTB 5T1MB 2HKFL 3FTYA 3R19A 1HH6B 1G9MC 2GITA 3TT3L 3RFZA 4UM8B 3MACH 4MS6A 4ELKB 3X12A 5EWIH 2MTPA 5EBLB 4YHIB 3AQZA 3AMKA 3OAUH 5C0BE 3QCVH 1AXTH 4KXBA 1HSAB 4XMUA 2EIMB 3GSVB 5EOQL 1JZ3A 1BJ1J 1ZPUA 1UENA 5C6WH 3HI1B 5I73B 4XCEA 4X9GA 3T6WA 4KY1H 5SWQA 3GMOB 2NMSA 4MD4B 1YEIL 3P77B 1ZHBB 1U8LA 1WGOA 3QEUA 4UV7H 1AI1L 3UTSE 1IBYA 4R7NA 3FRUA 4H1LG 2ICEA 4X7SL 3OKDB 2ITCB 3ZSTA 1A6PA 2N0MA 3X11A 3UPAA 3VGHA 4MRCA 1RZPA 3B1UA 5CINL 3T65A 5I16B 2HN7A 1SY6H 2FT6A 5A2AA 4HJJL 3SQBB 2Z93A 2OJ1A 1BLNB 1TVBB 4LSTH 3V6ZB 1WAAA 2BVTA 3L16A 4Z7NF 2X4SA 3GXUB 1MCFA 1L9SA 4QRPB 5F88A 2QLVB 4JO1H 3EFFA 1TITA 2KLSA 3MOBH 2YJQA 4ZO8A 3QXUA 2BZCA 1I7RA 1XIWB 2DL2A 4KO6A 4JDEB 5AAMC 2F58H 3GSOA 4RMVA 4KRPC 1H6TA 1C5CH 1VPOL 4KX8A 3ARDD 1FYTA 2V7HA 1BZ8A 2XHNA 3JV5A 5IQ7H 1IE5A 1L9NA 2NQCA 1EIBA 4TUUA 4W1TA 3C5ZB 4MA7H 1R5VA 3NZHH 3B1TA 1WBYB 4OZ4B 4QF1A 2FJFB 4QMEA 5J6HA 1QSFE 1JRHH 4KK8C 3HZVB 4R4BA 4L29B 4L1BA 3D30A 4X9YA 4Y16C 2E9WA 5GISH 2X1OA 4WO4C 2YARA 2QMJA 1TXKA 5HY9B 2DH3A 1NSNL 1FZMB 5CUSH 2P7TA 3SE8H 1S9YB 2GJ6A 4NLHA 1E4XH 5GIRB 1XCXA 5ETUB 1IZKA 1Q1JL 3KDMB 4PN6A 5CJOL 4D0BB 4FX5A 3APMA 5F9OL 3AAZB 1EDYA 1T0NA 2R0ZL 4U0RB 1RV6X 4F7TB 2JFCA 4KKZA 2FB4H 1UVQB 1B90A 2RJMA 4AZ8A 4KY2A 1OM9A 5B4MC 3P11H 3HAEB 1BX2A 3TZVC 1QPXA 3B7RL 5D7JA 3SJVD 2WGNB 2UXVA 5HVGB 4B0MB 5SWZB 5IJKC 3K2KA 4WI7A 1QBLH 5DO8A 4XN7A 1LK2B 4XVTH 1F5WA 3OJDA 2XTJE 5GS0H 2F7RA 2FECL 2X4PB 4XBMA 4Y2DD 2ZUTA 3VXRD 4N24A 4QXUH 3TBYA 1KY7A 1T3FB 3GSXB 4QWWC 5E1IA 3U0WL 1JL8A 5IT2H 3B8YA 3RWDB 4G43B 1TFPA 3S34H 4N2DA 2FT8A 3FB7B 3HLAA 4K3EL 5ID1A 5EEWA 1FJ1A 3FUMA 3IDNA 1AFVL 2K0RA 2QL1A 3O0RL 5DS2A 4F8QA 2E9JA 3D50A 4AKQA 3G3LA 3EBAA 2GUOA 5FO8A 3BMWA 32C2A 4C56A 5I19H 3LIUA 4UM8A 3KJ6H 4FFVC 4PB9L 1PYWA 1K4CB 2AK1H 1M42A 5DWUL 4EUPG 3D9AL 1IV8A 2QMKA 3QIUA 4ONGL 4NZJA 2ZUQC 3L6FA 1F4HA 1UWXH 5CGYD 3QDJA 2WZ0A 1EAOA 1DVYA 3GHPA 1IGCH 5C0CA 1FVCB 1L5GA 2EDMA 1A6VH 1EFXB 1F2XK 3HFMH 1NFDB 2OMWA 2J7LA 2ZSVB 4UBDD 2ESVE 4HPOL 3WL9A 2WHVA 3WLWC 4X5WB 5MEQA 2EICA 2C1OB 1G7QA 4R6UA 2QVIA 5FYJH 5MENB 3SGEH 2XV6B 4NPYA 4NOFA 6PAZA 5INCB 3Q8AA 1JZ4A 4ZXBB 1U8OB 2VR7A 3UC0H 5IB1B 2X1PA 3WJLA 2WXOA 5T3ZE 1NCIA 2FL5B 4ZYKA 4HUVA 1BG1A 4UQAA 5EU7C 1WLHA 4I88A 1I9EA 1F58L 2A0LD 4LQ1A <