4B60A

Structure of rfnbpa(189-505) in complex with fibrinogen gamma chain c- terminal peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
309
structure length
299
Chain Sequence
TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEGYTLTWDNGLVLYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIBRONECTIN-BINDING PROTEIN A
publication title Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
total genus 72
structure length 299
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A02
2Y7LA 3V10A 4B5ZA 4Q6KA 4LE8A 2F68X 3IRPX 4RMBA 3IS1X 5CFAA 3AT0A 4F1ZA 2RALA 4LEBA 2F6AA 4F20A 2Y7OA 4MBRA 4JDZA 1R19A 2VR3A 4MBOA 4F27A 3AU0A 2YLHA 4B60A 3IRZA 4FJ6A 4JE0A 4BBWA 2Y7NA 5IHWA 4LEEA 3IS0X 4F24A 3ASWA 2Y7MA 2Z1PA 4JDZB 1N67A 5CF3A 1R17A
chains in the Genus database with same CATH superfamily
3HG0A 4EDXA 2K7QA 3GBNL 3CVIH 1RMFL 4YE0A 1QTSA 4NSKB 4FFZA 4LRNL 4M9PA 5L2KA 1GPOL 2AQSA 4HSCX 1LYQA 4DGYH 3SDYH 5JHMA 2R9HD 2YWZA 1SBSH 5K9QI 3GRBA 1G87A 2GSGB 4ZZKA 4BFIA 3K4DA 4NBZB 3KXFA 3Q8EA 1MAMH 3U82B 3VRJB 3MXWL 4HG4K 2JTDA 2X2UA 5EG6C 3MGOA 2AEIT 4LLVB 1QRND 4AEHH 4JG0H 1EEZB 3I6LD 1XGRB 3NCYP 3W57A 5EZPA 2I7OA 3VFPB 3QI9A 2FYYB 3O3AA 3GXMA 4HPOL 4AT6A 4BKLA 2NY2C 3PREA 1CXIA 2EKJA 4P4KC 1LXMA 2OS7A 5ENWA 3INUL 4Z7OB 4IKNA 1AOZA 1AR1B 2WBXA 3EH3B 4QJ5B 5KSUB 4FA7B 1IFRA 1UOWA 5DMJB 3MRKB 3NCJL 2GY5A 2OAAA 4EKXA 5T1LD 5JHLH 2NNRA 4WNSA 4LSSL 1S5IL 5EPMB 5J06A 1QASA 4MJ5A 1YN7B 4A37A 5AG8A 4NKMB 4YDZA 4LDLB 4D8PA 1T0MB 1KTKE 4B6ZA 3MREA 3QQ3A 3GRGA 3S4SB 5DJZA 5I2IB 5EZOH 2H41A 4YAQB 1FBIH 2FLMA 4YPGB 4Y5YA 4URTB 2JLLA 1CYGA 4YZWA 1KGIA 4KK6C 1NGQH 2BZDA 4MDJB 5GS1C 1PSKL 3N1GC 1W6LA 3PHOA 4NO0A 5AB9A 4E68A 2DH2A 1RZIB 3K6FA 5F0MB 3EOBA 4NNYA 4K0OA 1S9XB 1HNFA 4NBXB 2ZKXA 1GVIA 2V4LA 2E4FA 5A6IA 4TVPE 1KGXA 1AR2A 1F11A 1H3PL 2R56H 5DFVD 5LDUA 1UJ3C 1E3XA 4BE6A 2AERT 3HC4L 1A1NA 2LFEA 3QVAA 4N68A 2TSBA 3QCTL 2NW3B 3DGCR 4ERSH 3BHBA 3IFNH 1G5AA 1OB0A 4KKCC 4OFYA 4OI8A 3N55A 4FNPA 2ZCLL 2RD0A 4JQIA 4OCRL 4N8UA 4PVNA 4NZ8A 5JW4N 1I1AB 2Y7SA 2P43B 1N3NA 2E86A 4MA1B 5T8IA 1OHZA 2L0DA 4NQXA 2OTUA 4K3HA 1H19A 2D31B 3AZUA 4Q9BA 5FUOL 5HHVH 2HH0L 1UWEL 2VDKL 3N43B 4UU9B 4LKXA 4BE5A 1BQKA 5KYUA 5IT2L 1AZNA 3SHSA 3TC9A 4UQBA 5LGHL 5AOLA 3X14B 2YSTA 2QSCH 5DJ0B 4MJHA 1WFUA 1KFAL 3EJZD 2OXHA 4YSUA 1BXAA 1UM5L 3KYNA 1X5KA 2IWFA 1SXAA 3ZIMA 4TUJB 4CW1A 4LLQA 4E2OA 4KTYA 3UC0L 4FNRA 2I9LA 4MB4A 2UZXA 3P2DA 3UGEA 1SM3L 2ESVB 2C8NA 3WJMB 4W6YB 3D5OF 1HIML 5AAWA 5DSCB 5I1CH 3ZE0B 3MBEB 5JOFA 5IFAL 4HU8A 5HGDA 4HGWA 4Z76A 5L8LB 4N28A 1V3KA 2NMSA 3J7HA 1FCCA 3KYAA 3QCUL 4GRLB 1CXEA 2XRAL 3CFBA 3UBHA 1S7WB 4JVWA 4LKCA 1HCFX 4POZD 4S1SL 4UT6H 4NO5A 5EZJA 5I71C 1V3JA 1HS6A 4KVCL 4WW1A 1IGMH 4LEBA 4FQXD 3VFGL 1KCUH 4GKZB 4MNGB 2AEQH 4FNUA 2Z4QB 4BFBD 2X1QA 2A83A 3PP3H 4JRYD 1RIUH 4MNQE 3MV11 4U3SB 3KPPB 4PWJA 5GGRY 3Q2WA 2K0RA 4I2XA 5D4JA 5IQMA 5KVEL 1A7OL 2FEEI 3IMWA 3D9AH 4YO0A 5B4MC 5FK9B 5K9JL 2YEVB 4FZ8H 4QRUA 1NBCA 2XC8A 5CKAA 3GLZA 4IEFB 1U6AL 2ZWNA 1Z1WA 5D5MA 2ATAA 3NJNA 1Z9SB 1CYWA 1F2XK 1I8LC 3LXCA 4WFFD 2EXWD 2Q8AL 4DK6A 1MZZA 2X6BA 2ZIDA 3O6FC 4WW2C 5EBMB 3SJVB 4YSRA 2KPNA 3S35X 3B2MA 4LMQI 5I17A 1O9WA 2B16A 4ZJ9A 4WI0A 2VISB 3T9WA 4OCMC 3TN0C 8CGTA 3APMA 1S7UB 2MQCA 1DN2A 5D7JC 1DVSA 3CHXA 1FQ9C 2OW6A 5C2BH 3CUPA 1ZPUA 4P3DB 4LE8A 1BQLL 1PGRB 4M00A 1JPEA 3BUYA 5DJDB 3IRCA 3VRLF 4UWQB 3RX5A 1DO6A 1S7XA 3O2DL 4OZGB 4LLWA 1K3ZA 3ARSA 4R4BB 3WJJA 2XDHA 4G7RB 2KDGA 4XMLL 5CD3A 1TITA 5J6HA 1YDPA 2ADJB 3MLZL 2RHEA 5AFAA 5A2IH 1IM3B 4JCLA 1RSFA 2A38A 3WHE0 3CHOA 4LLDB 3KXFD 1SLXA 4DTGL 5C9JA 1OTSC 3MI6A 3NSYA 3QNXA 4OZFG 1LO3H 3UTSB 2CLZB 5GS0L 3EJUA 3WFHA 2G4GA 3MUHL 3SGDH 3TBSB 1J8KA 4QDGA 2HYMA 3DSNB 1J0ZA 1NBZB 4MMZB 4G82A 1DANU 2G5BB 2VMFA 4P2RB 5AOIA 1SXNA 4TVPH 2FLBT 5LHDA 1Y0LA 3KS0J 4Y19A 1R5IB 3RB7A 4I3RL 4PCKA 4XO4A 5I1HL 1ZTXE 2CDGB 3N43F 2V9QA 3VM5A 4XXCA 3LVTA 5M95B 2HJFA 2CG9X 4GW1A 2EIJB 1SDDA 1AC6A 3ARRA 4H8VA 2QQLL 1PZAA 1PKQA 4EF3A 3SDCC 1OOWA 1EHLH 1HEJC 1XGYH 1XGZA 4HF5L 4QHMB 1WCBB 3ARYA 1FIEA 2YAMA 3UTQB 1A3QA 3B1UA 4OD2B 5HVWA 2X4SB 5DYOA 5C07A 2Z91B 2H32B 2WAHA 1U8LA 5F7MC 4HULB 1F3JA 1OLLA 5AVUB 2XG4B 3QUXA 1KTJA 3FC8A 3ZE0F 1LE9A 1IC5H 3QPQC 4U6YA 2WLKA 3F58L 4RMVA 4L8CA 1WC7A 3ZMNA 2G5RA 4X6CF 1VGEL 2J8OA 3OJ2C 2QR0A 1U8QA 4G6JH 4KGLA 4NO0D 4TUOB 2J5LB 1GXEA 1JGDB 2VXSH 3DV4B 4NHUB 4O51A 3SO3B 3ZT6A 2W0FB 2WQXA 2X88A 1U91B 2HUEA 1F3DJ 5TK2A 2VR7A 1WICA 1BIHA 2OSLA 3QJHA 4N2NA 4UAOB 4DFIA 3EH2A 1N26A 3EDFA 2YUZA 1FG2A 2CMRH 1IEAA 4J27A 3GSXA 5ES4B 3EDKA 3RDTB 1T66D 4J3TA 4NP4L 1SJEA 4LCUB 3SQBB 4M6NH 5KW9L 2P8PB 4APQC 1JF5A 4OFYD 4OLVH 4UDUA 1TJHH 1ZVSA 2F5BH 4LDOB 3GRWL 1IC7L 2P24B 5DJYB 3UTTB 1LDPH 2GT9A 2Y7QA 3QUZB 1HKLH 4HBCL 2QPEB 2EIZA 4IMLB 1HFUA 4P99A 5BNXD 5DD1L 2P5EB 2Z0UA 4MWFB 5LJYH 3K71B 3SPCA 3WIIH 2QGBA 3F7PC 1HDMA 1NLBH 1DSFL 4J39A 2BSBA 2WBKA 4KKLD 3C6LC 3DURB 4K2UH 1SEBA 4MA8H 4MJ2A 4Z3IA 4GJTB 4FQLL 4LNVA 5EO9A 4V2CB 4ZFOL 2XKNB 2WK2A 3WLBB 1MQKH 3GDCA 3A6BH 1EBAA 3FQYA 3VYOA 2DQFB 4N8VB 4O2EB 1G7QA 3Q6GH 2ENPA 4N20A 4MD5B 3US1A 3FPYA 1WFTA 4XVJL 2BHUA 5CBEA 4HSAC 3LRKA 1MRDH 2D7MA 3UO1L 1MFBH 5LAXA 3BLKA 1AMYA 3BKML 2H2SC 3CLEL 3E38A 1I3GH 4LSTL 2FSEB 4NNXA 5L0QC 1T5WA 3V7AG 3S36H 2SEBB 2VZOA 3DI3B 5EF2A 4R26L 4OJEH 4PRBA 3VU1A 3FB5A 2FBJH 4QY8A 4ZG1A 3PQYB 1AKJD 2EUWA 2JB6A 3ZT7A 2NUTB 4AH2B 1CICD 3P69A 3VWJD 3OAWA 1G6RB 2E6PA 5G5DA 1E4XH 5A7BA 4BDVB 4PY8J 1MW1A 5T1JA 1G7IB 3VXMA 4F7CB 1U41A 4AGMA 3ZE0E 4LBEA 3ARDA 5F7LB 3WD5L 4HFUL 4N26A 4CVWA 1I4FB 3GBML 1KJ2A 3E2HB 1RLWA 4X6CE 5JW5B 2Z6FA 4HHGA 1BIIA 1JHLH 3UL4A 3UTPD 3WSQH 1NCWL 2XZCH 3DUSA 3UIZA 3AREB 2HVKB 3DRTA 5F8RC 2Z0BA 3ZTCC 2HTKC 3QS2A 3CCHA 2A6KB 3UEQA 4JG9A 3LEXB 4JPWL 4NNPH 4MB1A 3KBEA 4S0SD 5A40E 1YYLL 2AQ1A 3C60A 3QO1B 4G1EA 3TH4T 2FR4A 4MNGE 4JZJC 3P9MB 3MRFA 4XN9A 1V8HA 1V55B 1ZTXH 3DRQA 3QO0A 4JFHD 2BZCA 5I1AB 4RGNC 5E5MB 1NBVH 1ZS2A 4NZTL 5F71A 1RULL 4LSQL 5J3HD 4JRLA 3L6FB 3Q48A 1D5IH 3FONB 1FFNB 1KTLA 2BVQA 2OBGA 4H0IA 3RKDC 4ZI8A 1RZGB 3QEHA 5GZOD 3AC0A 4GP8B 2G60L 3WFEH 2BFVH 3VSVA 3FTVA 1T0NA 4R2GC 4GQRA 4DKEL 4KHXH 4PJEA 4NC0B 1IGFH 1CT8A 4TLUA 2PMZA 3B9AA 3SJVE 3EH5B 2OJZL 3EBHA 3HCVB 1F3RB 4XNYH 3TTYA 1OAZL 4AQ1B 4UNIA 4FG6D 3DDFA 3ECUA 3HG3A 2ICEA 3RJOA 2DQHL 3GJFB 4KKBD 5KJRL 4WFHD 5L6YH 2VL5B 3V0DA 1DUYB 5EOCL 4JNXA 5TQ0H 3GQFA 3LB6D 3FQRA 4ZPVB 1M7UA 4OZGE 1JV2B 5EU3A 1MUJA 2ENSA 2Y06L 3DETD 3N2JA 4CSPA 1L0XA 5F9JB 1T7XA 2IO5A 2FJFB 3ZDXB 3L3KB 4DK3A 2CO2A 4NQSB 1U8JA 4ZMOA 2HPOA 4MSWA 1NIFA 2VDNH 3H53A 2CK0L 4CJ0A 2ZCKH 4OU3A 4Q4IA 4WGVB 3RRQA 3UTSE 3RVVD 1JXDA 1YJDL 5IMKA 4X99B 3EAKA 1OO2A 1BG9A 1P5UA 1PFCA 4V1DB 3L9RA 3LZLA 5DU7A 4O5LH 4L37A 1I31A 1L9NA 3LKPB 5E95B 1KZQA 4QKXB 4QXVA 4FXKB 3NP4A 1XL6A 4N2LA 4P2RE 4NC1C 4QGTA 4WTWA 3VXRB 4BK4A 4KPHL 4TQ8A 1IZKA 2BS8A 4DETA 2AITA 2XBTA 1MFCH 3TV3H 3W82A 1Q9LA 4R7DA 3RGVA 3W0WA 3PWLA 1NM9A 4PWKA 3QCVL 3BEVB 4F2MA 5HYSB 2WJ7A 4XPHH 1UT1A 2J88L 1AG0A 4DPAX 4HUVA 1RUAL 4M7JL 3RWEB 4BGLA 4LIQL 3ZGIA 4BFKA 2YAFA 2EE6A 1SPDA 1U8IA 2NR6D 3RPIA 2YGPA 2IEPA 4FNQA 4N2MA 1EDHA 4X4XA 5DUBB 4GY4A 3O6LL 4K9EL 3DPDA 4XC1H 4MAYC 3SODB 4LCWB 1KOAA 1OP9A 2X4NA 2A9BA 3FU3A 4Y4KB 3H2WA 1G0DA 3VYPA 5J1AA 3P2TA 5HYJA 4QRBA 3ESNA 5E8OA 3FAWA 4K3EH 3HMXH 3RTQA 1A7BA 3GEWB 5DT1H 3D05A 1DFBL 3Q9QA 4M1GH 4NDMB 2FX8H 4LSVL 4M4RB 4WU5B 2OSXA 4M6AA 5AVVB 1R3LA 2G2RB 3VI4F 4PJ5A 4M8QB 4YSSA 3LXBA 5C08A 4YX2H 1GW6A 3EUDA 3HPJB 2WXGA 1NKGA 2WLLB 4Z0XA 4E41A 2ITDA 3OXSA 3U30C 4UIKL 1KBGH 1NC4A 4A7VA 2VDMB 5HHNA 3LMJH 4JM0A 2YWYA 3OVUB 1E67A 5CLZA 5IM7B 3GSNA 4AQ8A 3LS5H 3MV01 3DA0A 4YDJA 5ESVA 3ZZ1A 4HC1H 4HV8B 5E1AA 4W9LC 1H15B 1ZHLB 1PZSA 1MNUL 2OTWA 1ACYH 2AJ3A 2VXUL 3HUJF 1W80A 2WKOA 4K15A 4N86A 1K85A 3MR9A 2DQJL 5ABZA 1X5IA 5J13B 4MD0A 3UTTE 4Y1AB 1QHPA 4DQOH 2DIAA 2WJ5A 3PABB 3FSZA 3UG4A 4JFWA 2P5EE 1VPOH 4OIAA 25C8H 2YIHA 1W8EA 1DJWA 3LNFA 4RQQA 5JMOC 1KV3A 4RMWA 4N9GA 1O5PA 4JM2F 3RWFA 3V4UH 5IQLA 2GSMB 5B8CC 2QADD 1RZKH 4Y9BA 1L9PA 3ZW3A 4HIXL 2BSTB 2W88A 5IK3A 1V5JA 4PJXB 1X7QB 3E6HB 4IRJD 4UM8B 1QD0A 4HWNA 4KH9A 4L1SA 2W9LA 3MRQA 1EHNA 3EJCA 4UBDC 4I3GA 4LARL 2R0KH 4P5RA 3ZZLA 1A66A 1Q94A 2VUYA 1N6QL 3DVFA 2QQKL 1AS8A 4P3CH 3FQWB 4LEEA 2RIKA 4XMTA 5MEPA 2EDQA 2F53A 4PJIA 1D7FA 1PJ9A 4JVUA 4EQ3A 2W07A 3L95A 3L4XA 2OJEA 4H8HA 4AQAA 1JYWA 3SCMD 2LLLA 4JW3A 4L3CA 4XPBH 1X5LA 1L6ZA 3BVUA 1YY8B 3T1FA 2EKSA 2FGZA 1T04B 2WWNA 3DVNB 3ZDXF 3B3IA 3S8GB 4NUGL 3QR0A 5D2LB 5E7BA 4YHNB 1LEGB 5CZXD 4KRNA 3L3GB 1IKOP 3FF8A 3K2UL 4CRPA 3PQYE 1NC2A 5F0JB 3HW7A 3WYRA 2W59A 4G8EB 4O2CB 3JWOC 1Q0XL 5C3TA 3ATAA 1FYTA 3FYIB 1JNJA 4XRCA 1N6VA 5E00A 1J9TA 4JLRB 1K72A 2Q8BL 3TVMA 2JFCA 5IG7A 4ENED 5TF1H 2JKRM 3C60D 5B3NA 1UURA 2DH3A 5DHDA 2A4ZA 5B1JA 4NN7B 2YR3A 5TTRA 4HKBB 2X4TB 1A4KB 1RJLB 1YLBB 4XMKL 5ALCL 1U30A 2ZUWA 4RRPA 4PS3A 1FL3B 4U6TA 5ACZA 3NCWA 2GK2A 4H13C 2B1HL 5CO1A 1EXUA 5HI5C 4JFEA 3GJEB 1HYSC 4BH7A 5EDSA 3US9A 1CFBA 2ZNXA 5FYJD 3ROLA 3AU0A 5CJ8A 1NZRA 3ROOB 4FG0A 2VO5A 3TT3L 3JWDH 1ASPA 4RISH 2JKTM 2BS9A 1MFEL 2GBUA 4X0KB 5DJAA 3GXNA 1L5GB 5GGRB 3AU1B 3JXAA 2PWDA 2V2TB 1ASOA 3KJ4B 3RPBA 4XN8A 3VH8G 1JRHL 1OAYH 2QQNL 3HUJE 4CGUB 2NNAB 4ORGA 2IBZX 2P5PA 3NA4A 2J2ZB 2AK4B 3PWUA 5EC1A 4D9QE 2BVYA 2CO6B 5A7EA 4GRMA 5KJ7E 4ZDHA 2V8LA 4OW6A 4ICXA 2F58H 3IFLL 4WNJA 1J8RA 4X4YA 3WMPA 1E27A 2BHYA 2R7EB 3UBXB 3W56A 1DTUA 3AROA 3OAZK 3NZSA 4P49A 1PX3A 1EO8H 3IRZA 4L4VD 4WHDA 5DD0H 3H9ZA 4NZDA 1NGXB 2Y3AA 5HHOE 2O72A 3PGFL 3EFDH 5T5FL 1AQ8A 3AY2A 4J23A 1GA2A 3MNMA 4AG4H 1BOGA 1KXVC 2X4UA 1CVRA 5JNYA 4UZUA 3EOAB 1LO5B 4ZODA 2AAVA 2XKSA 1XSOA 5E2UL 5C6WH 1WIUA 1J11A 3OF6A 2DEYX 3QIUC 4HCFA 3MC0A 1AXSA 5IWLA 3CVCA 3H9SB 2EE2A 5AVTB 5DR5H 3BVWA 2MCPH 4B96A 4NZUH 1YEDA 2FEEL 3P0VH 1MEXH 4OGYL 1E6OL 5TDNA 3E6FB 2WOBA 3ZDXE 1U92A 1E3FA 4WK0B 1WP6A 3D3VA 2ZSVA 2WKLA 4JR9L 1DL7L 1U42A 1MLCB 4HKZB 4TLSA 1FJ1A 4Q9RH 3D8MA 3UBFA 2WQUA 3DX9B 3D18A 4MNHB 1H3GA 4JREC 4MLIA 1RHHB 4PJXF 1QSEB 1I7UB 3B9VA 4V1DE 3VFSA 5I23A 2K45A 5FB8B 3B2DC 4M7LT 1U93A 1YUKB 1RK7A 3HE7B 4ZUVB 2XWXA 3VXRE 3GSWA 3FSWA 4RZCA 1DVQA 3VXOB 3WIFB 2Z8WC 4GLRH 3ZZQA 4AYFA 3FH7A 5HJGA 2F19L 2IPKA 4TQIA 1A8ZA 1ZANL 3GZKA 1CWVA 3AS0A 3NBNA 1AGEA 4HS3B 5HYJD 3QZMA 2BINA 4FI7A 3O4OB 1XAKA 1IGTA 4OUOA 3VWKB 1DN0A 2XTJC 1HXKA 1T83C 1MWOA 3R1GL 2BWQA 3VXSA 3QEQB 1GRWA 1MCWW 4WIQA 3Q8AA 2R4SH 4PJ5D 5CHNA 5D2LF 5E9DA 5KYYA 3WEXA 2E46A 1S4IA 1R46A 5DHXB 1FHGA 1OGAA 1T21B 2WSPA 3OKOB 3ULSA 4E41D 1CXHA 3QIWA 5C09E 3V5KA 3VFWA 5BS0A 3HZ3A 5ITBH 1NCDH 5BW7A 3TIDB 2JKXA 1RZFL 4FMKA 4LCWE 1TETH 1PZ5A 1RUML 1MLBB 4KFMA 1FVEA 3P4MB 4KX7A 1KC5L 5ID1B 4FLHA 5H4YA 1KYOJ 2FD6H 3LPGA 5GGTA 3NA9H 5FO8A 4Z3JA 5B38A 3B2XA 1XGQB 2DLFH 2YD4A 3OKMA 4ONHA 5I6XC 2XN0A 3KPLB 5EUKB 2R1XA 4MCYB 3X3FH 5DJ8B 3NJXA 3QG7H 5GJSH 3ZDZB 4A2MA 1QFWH 1HI6A 1IO4C 1XIWD 3KW8A 2EUZA 2GSIA 1GC1H 2VLLA 1G6RH 4FTVB 4KNUA 4Q0XH 5CCHE 3LHPH 2DM3A 5FCUL 3P11L 1D7DA 4G9DB 3F8UB 1R3KB 1OANA 4RWYH 5DF0A 3O9WB 5ITFA 2FGWH 4KK5C 5EC2B 5B7MA 3Q1SL 4JO2H 1ZS8B 1TF4A 2AKRB 1A6AA 1PLBA 3FHEA 2RQEA 3HHMA 1T89A 1XX9C 4JQXA 4F3FB 4LCCA 4Y1AE 3MJ6A 2YLKA 3WGUB 2DZEA 1J0KA 4TNWF 1N64L 1C7SA 1T5XB 4HJIA 5DTFA 2E27H 3V4PL 4OV5B 2R0WH 1T1YB 2R15A 1BZ7B 3W1ZA 3KM2A 2ZXEB 4A7QA 4PJXE 2DBLH 1CLZL 1UVQA 4D7BA 4L9LA 1NSNH 5EZIH 4BZ2L 2VAAA 5C0RH 1AQKH 1RURL 5TH2B 4P2OC 1NC2D 2RALA 5H2BB 1K8DA 1N9PA 2QPDB 1UACH 1T7YA 3BEWA 3WCYA 1ED3B 5DEGA 4ZAKB 1LE5A 4KK8C 3DV6B 5FA4A 4IBUA 2EYRA 2R69L 4QTFA 2NY0D 3B2PA 2B0SL 1KIPA 2ZNWA 3K6IA 3EO1A 4QYOA 1VCAA 4XPAH 1P5VA 3T4AA 4XAKE 5CEZD 3AG3B 4GUPA 5D2LE 1I8MB 4OH2A 4S2SB 1AR1C 2AJSH 2OQJA 4PWEA 5FM5O 2XWRA 3SY6A 4XBGA 5LGJB 4YBLB 3QJVB 3ATDA 4I5BA 3CBJB 5EU7C 1F8TH 4UQ3A 2VM3A 4JFFB 4JPQA 1PG7W 2N0KA 2IVFC 3ZRCC 4AUYA 2O26U 3IPBA 1TYEB 3S35L 4GI9A 4B5EA 3MUZ1 4HK0B 5ERWA 4PJDA 2YAQA 1Q9OA 4YEFA 4LPWA 2JWYA 3D2UD 3ZVVA 1QLFB 1TO4A 1GGYA 1L9TA 2YQBA 2VE6B 5H37A 1IGCL 4JFDB 4KX8A 3H55A 2PABA 4NQCD 4W81A 4IBVA 1XGPA 1AGFA 4YHPA 4LP4A 3WU1A 1ZA6B 2EH7H 2GABA 4L3AA 3HRZB 1FH2A 3UJTH 4RWHA 3BUBA 2DMHA 4HD9A 1D5MB 4YHZL 1RP9A 5D6DC 2D3JA 5DGRA 4S1DD 5CCKL 3NZUA 4P4KA 3W11C 5BQ7B 3A23A 4ODWA 1E9OA 5J6SA 4DAGH 4AYBA 4ZTPL 2EYTA 3KHOA 1REIA 4LPVA 1MW0A 2XJKA 5IHZA 4GG8B 2WZ5A 5EU6A 5MERA 1G7JB 2FX9L 1F4WH 4WSKA 4WHYG 4KJQD 4UV7L 4CJ1A 3O2WH 1U8MB 3S37H 1H6UA 1G4RA 3KCPA 3VA2C 4WI9A 12E8H 1BD2B 3P4NA 3W9EA 3ZDZF 3DPBA 1E4WH 1M7DB 4ODHL 3BESR 3ZKXB 4LBAA 4KO6A 1D5BB 3N5AA 2GIYA 4LCYA 1PNDA 3T4YA 2EE0A 5KBKA 4MA1C 4Z7UA 1PCSA 5EV7A 1CE1L 4ZX6A 4AIZB 3CWGA 4DN4L 2BDNH 4LU5L 5BV7B 4KOCA 1BAGA 3IDJA 4YK4B 2C1PB 1NBYA 3HE6B 1GAFL 3D3VD 4DKDC 5GS1A 4OGAD 4L1HA 4C58B 1BWWA 3V5DA 1ETJA 1TQBB 2FK9A 3LEVH 3MO1A 3OR6B 4U49A 1WFMA 2DQTH 1P7KB 3S9DB 3BW9A 1D7BA 1N4XH 2VDMH 2DM2A 1CFTB 5KSVA 2CSPA 5D7HA 3TCXA 1RV6X 8FABA 1KT2B 5JR1H 2C9XA 1UJ3A 1XMWA 1RL1A 4Q2ZB 2YQ2A 4L29B 1QBMH 2J55A 3B7YA 3OB0H 5E8NB 4BUGA 4L9DA 4FTDA 2HLAA 3B6SB 3AS3A 3VYNA 1WAAA 2CD0A 1QSEE 1VSCA 3KZ8A 2B20A 3RB5A 5E9DD 3I6GA 1KNOA 4GW4B 1AXTH 1MFDL 4PMFA 4Y4HB 5I6KA 4DQAA 2GFBA 3TEXA 4CUCA 1MELA 3EYUH 3NJMA 5I6PA 2P44B 4GRLC 4HAKA 3GSOA 2YUVA 1URIA 4CDHA 3L4TA 4Y4FB 3KDPB 3VGAC 3MLWL 4KROB 2K3TA 3A5VA 3BDXA 4ZBJA 4UTBH 1G9NC 1W8NA 1WZ1H 5C8JB 2WWMC 2MNWA 3VGDA 3KJ6L 4X6FA 4KUCF 3PWPB 4V33A 2CKBL 5DMYA 4QCIB 1RUKL 1AOHA 3QZWG 5EEWA 4QIRA 3M8OL 5CD5D 5IJVA 3X17A 2CO7B 5DMGD 5DURB 3MFGB 1GW0A 3UC2A 4IJTA 4YWGH 3F7VB 5B21A 4IHOB 1Z2KA 3QRGL 4KOBA 5G4NA 4E9SA 2Z31D 1Z5HA 5IVXB 5JXED 1U2YA 1Q72L 3HNTL 3ZDZE 4IRZL 3QARA 4NXSA 1JZ5A 3NZ8A 3FO9B 1PQZB 3A21A 4DEWA 1JZIA 5HYFA 4FTVE 4UZGA 5ECJE 4EI0A 5HI3D 4QF1A 5MENA 1UOVA 2QVFB 4HIHA 5GIRB 4AWJC 1FLTX 2DQDL 2FWLB 2DQCL 3MCG1 4DW2L 4ZNEA 3QT2A 3L3DA 4GBXB 3NZHH 4RAUA 2A6IA 3FQXA 3RWGA 4XPGH 4P48A 3RVWC 3FUHA 3SKNB 4F7MB 3Q3GB 1EFXD 1JK9A 1MCKA 4PV8A 5DUPH 1FCGA 4N87A 4O4YH 4M3KB 4M8VA 3NUKA 1YY9D 2OMTA 5IFJA 1DVFB 1U58A 3NESA 2ZAIA 2RA1A 2WZPD 4L8DB 3N1FC 1T0OA 4KVNH 3PGDB 5GGQL 1IGIH 5LB1A 1KEGL 2NRDA 4HS6B 1OCCB 5AG9A 4KITB 3RAJH 3PP3K 4XBEL 1BHGA 1I8LA 1CGWA 4MMZC 4ZW7A 3UPRB 1Z5LA 2B08A 4WW2A 2PW1A 3KL3A 3H3KA 1F56A 3CNKA 4AY0A 3BZ5A 1G7MA 4J3WA 4NQQA 1PZ3A 4EE2A 3JV5A 5F7EL 1O6SB 4NCC1 5HVGB 2HFGL 3HLAB 5AZEL 2YARA 3DVIA 4NRYA 1PLGH 3VA6A 2ICCA 1E5CA 4X83A 4WLCA 1MQ8A 1TZGL 3I85A 1UB6B 4P2QB 3DXAB 1YEIH 1IRAY 4RNRB 2AJUL 3FOMB 4UNVA 4TYUA 4BELD 4DN3L 1A14L 2AP2A 4ZMPA 5IHHA 3BMVA 4NXKA 3VD0A 2IANE 4X9HA 4U1KA 5D93B 2QVMA 1QYGH 3H3PL 4JFFE 2FJUB 4YLBA 2HRPL 1DVTA 4KDTC 3BD3A 1I3RA 3IGUA 2R2EB 3QUGA 1ND0A 1NANH 3ZZSA 3DSFH 5B22A 4N8PA 3ZTNL 3MLUL 4DNLA 5HPOA 4WI5A 5FO7B 5F7AA 4P4KD 3EXJA 2YMOA 1CI5A 3SO3C 5F9DC 1AD9A 5CEXB 3D87B 1U2CA 3TASA 2ICES 1EJ8A 1P6AB 5C86A 4JFDE 1RP8A 1B0GA 3HB3B 1NMAL 3AAZA 1PAMA 4P3WA 3FU5A 5K33A 3WAJA 2BNQB 1TEGA 4BUHA 4U6VH 4UAOC 2DB8A 1V54B 2ZUSA 4PRDB 4NFCA 3AXLA 1AIFA 3SDCA 3VCLA 1M7IB 1EPFA 1JIBA 2V3EA 4Q58C 3V6FA 3DJ9A 3ISWA 4BZYA 1FNFA 3WE6A 4XHJC 3KPSD 2O6DA 3MNVA 4V2BA 1E90A 3QUZC 3HMWL 2AQPA 5I0XA 4PG2C 4KK6D 1CDHA 2P52A 4PGZA 1CLOH 4N0YH 3VE0A 4ZUUA 1YEJH 5AZ2L 2XPYA 2GK0A 4G9FB 3SDDD 4FFYA 3QC5X 2WKGA 3QJOA 1UWGH 3HFML 1BBDH 4YOKA 4C4KO 3MLSH 2AABH 1ZSDB 3VD1A 3TBWB 2YXMA 5G2NA 4F7PA 4E9YA 4BRJA 3ASOB 1JPFA 2JCCA 3FCBA 4JHAL 3CDCA 1M9WA 1TPXB 1CMOA 1HH9B 1QOKA 2EZ0C 4WDIB 5D1QB 2WTRB 5ESQB 3TZVB 2X4OB 1FZOB 1BGXH 3FPXA 6PAZA 2PKDA 4G8FA 1TENA 1R3IH 1GZQB 3IF1B 4Z0BL 3FCGA 3MRIA 4KKCD 1NGPH 4N0RA 1ITBB 2VLMD 2YC1B 3IFOB 1URZA 5EOQH 3TYGL 4ALAH 4J8RB 4HJJH 4KXCA 2CJUH 4PD4J 1EERB 4ZMYA 1JNHA 4F91B 2DYRB 2HVJB 3W2DL 5KSBA 4YXKH 4OCNC 1SUJA 2D3VA 5C0CB 4Z7WB 3L5JA 3II2A 2ETWA 1LTXA 4OCWL 4CNIA 2ENQA 2NY5L 3C6LA 3BWUF 3VQ1C 3GK8L 3HC0B 3NSJA 2CGRH 2MHAA 1FL5A 2VTFA 4QWWD 3RFZB 3PL6A 3UERA 2X4PA 4M5YH 3EYQC 4ATWA 3IJYA 1MREH 3E2HC 3Q13A 1PEZA 2QL1A 2VLKE 3SOBH 1GTFA 2JJSC 2EEAA 1TQCB 1J1PH 4NZRH 1K5NA 3SN6N 2VLJB 4NWUH 3LNDA 5BXFA 1AHKA 1Q1JH 3RL2A 1GZPB 2QLYA 4PAZA 3L45A 1A9EA 1I7TB 2UUDH 3I3BA 4F27A 4UT7L 5T3ZD 5IW3A 1AXIB 4K8RH 3PWPE 2R2BA 2DEXX 2PTTA 4ADJA 2J1WA 1QO3A 1NUGA 5TE4H 2GJZA 4ANKA 4TNVF 1UM4L 1UXMA 3APDA 3K72B 5E6RB 3U7WL 3B43A 3UJIL 2YPVL 2OPCA 4X8JA 1KXTB 1X5MA 3WIHA 2F6AA 4B97A 3MDJA 3V55A 2WV3A 2P4AB 5LG6A 4GW5A 2OXGA 2CNZA 1A1MA 4FGMA 5IVXE 4R5VA 2YMXH 4N3TA 4QTHA 3ZR5A 4MCZB 5C0FA 3UPCA 2COVD 4OQTA 1KDIA 1JK8B 2DQGL 2UWEB 3W5NA 5I1DB 2V5YA 1A6UH 4R6UA 1AO7B 1OEZW 3CFKA 1X4YA 3V52H 4A2LA 1CIUA 4PRIB 1KDJA 5A2CA 1YPZA 1SXZA 1QZNA 2BW5A 2KT6A 2R23A 1JHTB 4F7EA 5I1LA 4RSVA 4JDTH 5CEYA 3FQNB 2X7LA 3EH1A 1T03L 2P80A 1DEEA 2DYPA 4JZJA 4KK9C 2IPUG 4F20A 5AUMB 3V4VH 4JPVH 5DJXB 3O6FD 3NFSL 4MD4A 1OARL 4ZFOB 1TLMA 5DC2A 5K59E 1KCLA 2NW2A 4UB0H 4R97C 3FN3A 1MWAL 4D0DA 4EKJA 4DERA 3SKOB 2YGVA 4K23L 2WGXA 4WJ5A 3TN0D 3RUGB 1P0SE 4NQDD 2R0LH 5HP5A 1HEZB 4JMXA 5D7JD 3OKNB 2GPZA 3WFDL 2L7JA 5ID0A 3DTXB 4A7UA 4B5ZA 2FQEA 2IDSA 3L3IB 1AMXA 1CLYL 1NDGB 3ARPA 5EBWB 5I8EB 5FOBB 1TCMA 1KSRA 3AT8A 4OZ4B 4NM4H 4FXKC 1V3LA 5D2NB 2BVUA 1YYML 3C75A 2LT9A 4GXUN 1AQDB 3HOGA 5IFHH 2FJHA 4GNKB 3CSYB 5LCVL 3VFUB 2JCWA 3Q1EA 4M5SA 5JIDA 5CZKA 1RPKA 4HX1B 1OTSD 3VJ6A 3VXQA 1IT9L 4ISVA 2EE3A 1ORQB 5D1XB 1GH7A 4M7LH 5CSGA 3I75B 4Q56A 5MP6H 4WUKL 5I76A 3S36X 4PRPB 4JFPB 3GXIA 4UQ2B 4YHMH 4BSWB 4DPCX 2OCFD 3FJTA 3RKPA 3WHXA 4P2QE 2E59A 1BLIA 4EXKA 2E6JA 3ZOAA 2PO6B 3M07A 5J8OA 1CE6B 3GLDA 1EBPA 1X5XA 4Y2OA 3HKFA 3CH1A 4YC2C 3BAEH 4JKKA 3RE0A 1SUHA 3SGDI 2I9TA 4Y4KC 5CKGA 4JPSA 4QRRB 32C2A 3GBNH 4JDVA 2XVKA 4JPKL 1RMFH 3S7GA 4QHNA 4B60A 1Z32X 2FWUA 3DX8A 4DP7X 4POYA 3ARGC 4OZFH 4LRNH 3TPKA 4U7MA 3DX7B 3SDCD 1TVDA 2OMWB 4WI6A 1GPOH 1PX8A 3WN6A 1MCEA 2YD1A 3LSOB 1X5FA 2I07A 4LGPB 3LXUX 3SEPA 3PJSB 2AJZB 4LLUB 1TG8A 3P40A 4OT1H 1CDYA 4ZXBA 1QZ1A 2C1OB 2PF6A 1ZE3C 5L4FA 1S3RA 3CAFA 1EANA 4PJBA 2CK2A 1IIKA 2VLRB 2WYIA 3H9HA 3APFA 3MXWH 5KVEE 3FCTB 4Q6IB 5F9OL 3QPQD 5B1AB 3QDGA 5D1ZD 4FQIL 3EGDB 1JGLH 2X3BA 4R83A 3LN4B 4HPOH 1WZLA 3UFIA 4ZX4A 3MJ8B 3U79A 4PJAB 2GBAA 3L13A 2IXQA 2J20A 4KO9A 3W5MA 3INUH 3LY6A 1XH0A 3P9LA 4MAYA 3I9IA 5J13C 4A1RA 5F3FA 3VFVA 4BXVA 3HVDA 1CTOA 4FC3E 3WKPA 2B4CH 4WTZA 2RFXA 3L5WA 1HHHB 4OSUL 3GMMB 1CZ8L 1B0RA 3OMNB 1OPGH 4LSSH 2C7UB 3ARFD 4MXQC 4XP6L 3ABMB 4WTQA 2HPTA 3QULA 3B2VH 1KPVB 1T20B 3X11B 6FABL 1JYNA 1K2DB 3DX1A 3SPGA 4HSQA 4APQD 1LO0L 2QKIB 5A2LH 3T0BA 3QDHA 3VM7A 3WN5B 3UZVB 4J1UB 4GMSH 3FCSA 5M7QA 5EUOB 1ECYA 3JYCA 2DWSA 2AV1B 5F89A 5HY9A 3S8FB 4JY5L 1RZJL 4JB9H 4UOW0 5D1QE 3P77B 1GR7A 2W80C 4U1NA 5I18H 2IWEA 3V95A 1J1XL 1PSKH 1HT6A 2JK5A 1TZOA 4XH2B 2E7LC 2WM0A 2Z35A 2QEJA 2HX8A 1OXYA 4KMTL 4X7TA 4Z3EA 3HPLB 1D9KC 4NKIL 5F7NC 2J1KA 1S7SB 4GAFB 4G1MA 1DE4A 2DQUL 4EUPB 3QSKB 1X9LA 4QRSA 4J3OG 3V0FA 4HEMA 3RUGF 4ENZA 1VFAA 1J05B 4YDLB 4KKAD 1H3PH 4W93A 3U9UB 2P42B 3HC4H 2OA9A 1II4E 2P3YA 3D39B 3OXRA 5IF0B 2P47B 3UTOA 4F8LA 5FM5M 3UCQA 3QCTH 1HQRB 1M71B 3J27A 4GAYA 2XPGA 5B8CA 4P06A 2ADFH 4U3CA 4R96A 3GXDA 5LXGL 1WFJA 1H0DB 2V7NB 4LHUA 1AZVA 1TYRA 1DYZA 2ZCLH 4KMLB 3ZE2B 4NN7C 2D73A 4Y16B 1BFOA 3U7YL 5FV1L 4M7KL 4U3XA 3S5LB 2AQRA 2XBZA 3DC0A 3FB8A 1F18A 2CH8A 2N0MA 4R3SB 4JM4L 3GHPA 3LKNA 1C12B 1D5ZA 1UWEH 2V2XA 2VDKH 3AS1A 1XF2A 4O02L 4XOBA 4YGVB 2VLJE 3HI1B 3ZKMC 4A7GF 5LWYL 3MYJB 5JHBA 5E7FA 1PYWB 3BH9B 4K3DL 1DZBA 5IT2H 1KYDA 1RZPA 3UJJL 2W65B 2XWJA 3GEFA 5LGHH 1LNUA 5DVNA 4FP8H 1SDAB 1MFAL 2BIOA 5EU4A 3HN8A 4X5PA 1PEWA 4B0MM 3GBDA 4AMWA 2O93L 1E4XI 3KJ4C 1BSIA 1UM5H 4U4IA 5GS2H 2WB1A 3DARA 1CG9A 1DQMH 1KG0B 2E7BA 4LNRB 5KBLA 3UC0H 5HYQA 2NX5B 5HGHA 1BQHA 3I9PA 1J86A 2A9DA 4I9WD 2HTKD 4JDZB 3C8DA 1CL7L 1RUQL 4G8GD 2CPCA 4OLUL 1HL9A 4CU6A 8PAZA 4N0CC 4BFGA 3RBGA 2DYPD 1OAJA 2CRMA 4ELMF 4YZFE 2I7SA 1ETZA 4NM8H 3QCUH 4PEEA 5A2AA 1NCHA 1PVHA 3HA0A 2J6EA 4W9EC 4DPBX 2UWEE 2ZSWA 2XRAH 2Z4TA 2JELL 1KIUB 4N5ED 4MS6A 4EO5A 3QZOA 5EEVA 1AO7E 4S1SH 5GS3A 2P48B 2ZOKA 3IE9A 2FJSA 2G0LA 3OKKB 4PRIE 3RKDD 2QV2A 2VW6A 3PAVA 5I28A 4G7VL 5FUCE 2EABA 5AW2B 4FD0A 4F8OA 3VFGH 4PJAF 4JY6B 2MCAA 3B9KB 2Q86A 1JWMB 1SJHB 1A6PA 1SYSA 1THCA 4EEEA 1PW3A 2WIMA 2VW7A 5IB5B 5M94B 2YPKB 3WFZA 1MIML 1WA0X 1A7OH 5F1NB 5DZNA 3QUMA 1KY6A 3IM1A 2VO8A 3X12A 2AJYH 3RUGE 3BPCA 3U46B 3GS0A 4MCNA 4Z77A 5K9JH 1KWKA 3TURA 1T0PB 1HZHL 1WAPA 2JKWA 3KVQA 4MVBD 2A1WL 4LXFA 5KG9A 2LAGB 1G9HA 4Z7NB 1U6AH 2G0KA 1INDL 1E2ZA 3CVBA 3LKQA 2Q8AH 5EUOF 1JTTA 2FO4B 3QEUA 3HE7C 3U4EB 4DP9X 2YSSB 4HJ0D 4FS0A 2J8UB 2O5YL 1KXVA 1G94A 4DZBB 1A65A 3UBGA 4IS6B 1CN4A 4OV6F 3T3PF 3D0AA 1YN6B 3GMPA 4KV5F 5DK0B 2XSKA 1GOGA 4Y1TA 2TSAA 3FUKA 3QIUA 3O4OC 3IDGA 1OF2A 4G8IB 2ZUQC 4OKVB 2KLRA 1SN5A 3HZYA 3VWKC 2UY6A 5D1XE 2VN7A 1BQLH 2IAMD 1SHSA 3NIGF 2A74B 2F8OA 4PRPE 1QBLL 4TSCL 3OHXB 4RMSA 1QWUA 3OGCB 5GSRA 4APXB 1CF8L 4J4PC 4JS7A 4YFEA 5KZCB 4U1SB 3N40P 4XMLH 3MLZH 4Z78A 1DQTA 1P7HL 5E6IB 3O8XD 2IADB 1NGZB 1XF4A 4PY7A 2Z3FA 5IQ7L 1RVFL 4QRRE 4DGIL 1G1YA 1TU2A 4A2DA 4LCIL 3IGKA 2DDQL 1Q38A 5GS0H 4HOMA 3ZE2F 4C54A 4X6BA 2GITB 3LPWA 3QDGD 4KUCD 3PNWB 4AYID 1BM7A 1JI1A 4WF7A 3JQOB 2C3XA 3QQDA 3WFBL 1OLZA 2IJ0C 3FMGL 3WTYA 4GSUA 1RJCA 3QZPA 1X4XA 3FTZA 3P30L 4I3RH 4WHTA 3CFEB 2FLRT 5L88L 3DLQR 4CKQA 4MAYD 4ELME 5I1HH 4EZMA 2F15A 4AL8C 3V0JA 4QMEA 2VLRE 5BZWA 3IU3B 4YMPA 1L0PA 1MHPL 4XNQB 3MLPA 3EOTL 1T83A 3PAYA 4JFSA 2QQLH 4A2EA 1HH6A 3BQUD 4X5XA 3JV6A 5K1NA 4C56B 1YEWA 4HF5H 1JYXA 4MNQA 4PJAE 2PP8A 2Y5TA 4LQFL 4YEEA 4XGZA 1XR8B 2CRZA 2H7WA 2WGNB 4DVRH 3FTXA 4NX0A 3KR3L 2HJKA 4U3HA 5C0JA 2FUTA 4NPYA 1AQMA 4K3JL 2J73A 1T7WA 3IGFA 3QDMB 1J9QA 1SBSL 1T2JA 2LGNA 1I1YA 3F58H 1ZA3B 6TAAA 4I48B 4NIYE 2OMYA 4UDTA 4CC1A 1ZMYA 4HOXA 5EB9A 1EZVY 1QUPA 1U8NA 1VGEH 3DMMB 1TNMA 4LLYA 4QNPF 3RL1B 5KN5A 1AFVL 2C9RA 2XWDA 4MJIB 4R7NA 4TMPA 5DMKA 1Y6NR 2NSXA 2X41A 2OMZA 5F3BA 1YEEL 5EUOE 5IOPB 2ZYRA 2XVGA 1AP2A 5B39G 2K4WA 3GBLA 4LRIC 4MXVF 1CFQA 3SZ6A 5L2JA 1ZEAL 4L8BB 2VMJA 3IMTA 4JO1H 2B59B 1UT9A 4KV5E 3M1OA 3AVEA 4ZAKC 4GIAA 4PI2A 5I8CA 4IKJA 1DVZA 1CGTA 4W9IC 1JCVA 4ZW6A 1PFOA 5BUPA 3IS1X 2NZ9D 1I8KA 3GRWH 4X8CA 3NIGE 1J9CT 1F4YL 1EGJA 1M6OA 1XAUA 2CIKB 4U33A 4HBCH 4OM1L 4HUUA 4W6XB 5GGRA 4Z7NF 4YBLC 1U21A 2ZPKL 5DD1H 1DQVA 2DV6A 1D6VL 3D39E 1DSFH 5EZOL 3PAZA 1MG3C 4N3UA 4NSKA 3FS9A 5DEZA 1CFNB 2X9XA 3NFNA 5DJ2B 2VDLH 3V2AR 4ZFGL 4AVKA 4EIUA 3ZE2E 1NGQL 3HZVB 4HCRA 4LIQE 4CADB 3P3TA 3VTMA 2BY2A 3BC9A 1IFGA 1SXBA 1IBYA 2XG5B 3NDYE 2WXIA 1NOFA 1IBBA 3VRJA 4XVJH 1IBFA 1FV1B 1JMXA 1IILE 3UO1H 1UATA 3HRZC 3GHBH 4NS0A 3BKMH 4LLVA 4XVUD 1EEZA 3CLEH 1XGRA 3QDAA 3VFPA 4LSTH 5IBUG 3ILQC 4N4YB 2R56L 2FYYA 1DFXA 3BO8A 3UCRA 1OWWA 1WA1X 3SDXB 2ZKWA 3ARBC 2F68X 7CGTA 4X9GA 3B7RL 5KSUA 1LQSR 4E9TA 3OAYH 1NFDB 4I87A 3BLPX 3MRKA 1CGXA 4X98B 1A7PH 2ZX7A 5HI5D 1HYSD 5MHSD 4I89A 1F45A 2W5PA 1FNHA 1N7ML 5EPMA 4Q74A 1LLAA 2F54D 1XTLA 1YN7A 4NKMA 3WD5H 2PCXA 3MV7B 4HFUH 4KTEH 5IKCB 2ILLA 1T0MA 4DZ8B 1UA6H 2XXMB 5KUMA 3S4SA 5I2IA 4QNPE 4YPGA 3CDZB 2AEPL 5BV7C 1MNNA 4YK4C 3HE6C 2QSCL 1A7RH 3VACA 5E4IA 5JQ6L 4U1HB 4MDJA 4BFJA 2N1TE 4MXVE 4JPWH 1TQBC 4NZJA 1Z5YD 1NAKL 2NCEA 3VQMA 1TSRA 5D6DA 1RZIA 3D06A 4XI5C 3G6AB 4Z7QB 1A7NL 4XMUA 1S9XA 1SLVA 4QXUH 3ME0B 1FL6B 1GSMA 1WWBX 1HX0A 2ED6A 3OBAA 3Q43A 4OLZH 4PLJC 1WZAA 4P59L 3P4LA 1RULH 4FQJH 4LSQH 5DQJB 2GJRA 1MCDA 3KLDA 3VFOB 1G9MC 5C3LD 2N4IA 3ZTJG 3MSPA 4NIKB 4ZPTB 4PQXA 2D0HA 2NW3A 1JZHA 1XZWA 4XN5A 3IMVA 4Z7NE 4U6HA 1ZVYA 2UXVA 3QUYB 4J3OC 4YHKL 2H6PB 1R19A 1X5GA 4DKEH 3SGEH 1WWCA 1KGCE 1A0QL 1UA7A 5KSAB 2OJZH 1QUNA 2J8UE 3H0TB 2Q7YB 2D31A 4O2FB 1CDJA 1H5BB 3I74A 1WIOA 1EEYA 1J0IA 1E50A 1RIUL 3LRGA 4UU9A 4Y4FC 4KROC 1P53A 5KJRH 2VZ3A 4GAAA 5EOCH 3LVEA 2H0EA 3GFUA 2JI3A 5TDPA 3I3EA 1V27A 3X14A 2CCLA 5DJ0A 4FZ8L 4L5FL 3L17A 1L0QA 3UYRL 1WD9A 2Y06H 4FHJA 3SDAB 2CA3A 4A2HA 5LLIC 4TUJA 5L8JB 4XTRD 5D71L 2CK0H 2ESVA 3HG5A 4G80B 3WJMA 5I16B 3MU3A 4QOKB 3F5WB 5KJ4A 5KEZA 4YSDA 1TEYA 2P5WD 5DSCA 1YJDH 2XTJD 5JPNB 3MBEA 1UZGA 4GLRI 2C3VB 2XKUA 2DLIA 4HC1A 1QA9B 4OF8A 4K5OA 2P8MB 2AZAA 5IP4A 2NXYD 1V10A 2ZXCA 3K6SB 3OX8B 4MNQD 4GRLA 2NYYC 4KPHH 3OB0K 4FADA 2FBOJ 3EFFB 1S7WA 2YK1H 3IE4A 1W72L 5SX5H 5BJTB 4OR1A 4GSDL 3NIDB 5E9AA 4NI6A 3QCVH 4HIIB 1TQTA 2ZXQA 4AKQA 1H9DA 2BNRD 4YJZL 1KYFA 2E56A 2J88H 1O9ZA 2E7DA 5DRXB 3QQ9D 4MNGA 1RUAH 4M7JH 2EDWA 3CFDB 4LIQH 4MKMA 2Z4QA 4FDWA 4C56E 4G7SB 4Q52A 1OTUD 4NLAA 3UACA 1LO3L 4U3SA 4EI6B 1M4KA 3KPPA 4GEIA 3CZJA 2Q6WB 1SBBA 1F90L 2VSKB 3GGWB 1NCCL 3N6YA 3KPNB 3L1OL 4I77L 5FK9A 1DVFC 4HXAL 3TO4B 3ELQA 3QDME 2EIDA 1DFBH 4IEFA 1G9EA 4PGDB 2ERJB 4KK5D 5D4HA 5I0ZA 2EDXA 4JDEB 5KOMC 3LZFH 1NCGA 4DESA 4YFDB 3Q5OA 1FFOB 2ADIB 1V7MH 3N42B 5EBMA 5BO1L 3SJVA 1M7XA 1CDIA 3LHAA 4X4ZA 1IGYB 3FFDB 1EEQA 5J11B 2WVSA 2VISA 3CH8A 3S3BB 3C5ZD 2V37A 4G72B 3U0TB 1QBBA 2VDRL 1ADQL 3QISA 1ITCA 4P3DA 1HSAB 2AQTA 3EHBC 4WHCA 1MNUH 2UYLA 4MDIB 2VXUH 4D3CL 3E9UA 3BGAA 2X5PA 4OZGA 4R4BA 5L4JA 4JEGB 3BWZA 4Y1SA 3BZFB 5FXCH 2ADJA 1S9WB 1JWUB 3U2SB 2WLNA 5IROC 1AY1H 1IM3A 3UYPB 5BCAA 3QZLA 4LMQE 2P8LB 4MHHI 3RWCB 5AB0A 4LLDA 4P2OD 1CXKA 1E9QB 4GXFA 3UAJD 2Y2WA 5D93C 3UTSA 4GQ9L 2CLZA 5C0BE 4QTIL 5FW7A 3VXUB 2BY1A 3TBSA 4KK8D 1KIRB 3ZTEA 3PDOB 3DSNA 4MMZA 4OZIB 1NBZA 3DO4A 4ORZC 2NTFB 4HIXH 1WBZB 1P4LB 2G5BA 5E8DH 5LN4A 4DCQB 5HBBA 4YE4L 4P2RA 3AWEA 1CXFA 5FGBC 1R5IA 3FT9A 4Y8DC 3C5XA 3KCWA 1DSWA 1W0VB 2CDGA 4W6WB 3WUWB 4Q6KA 4LARH 5EO0B 2CKBB 4OLVL 3HB3C 3IRPX 5FYJL 3FHAA 2QQKH 4K94C 3U36B 1D6EB 2XA3A 3EW3B 4C4UA 4L18A 1BFTA 1XGUB 4JVPA 4EDWL 2B14A 1SF5A 4J6RH 4AZUA 1AZZC 1WCBA 3CFNA 3WIIL 3SDXE 3UTQA 4OD2A 4OZHB 1RK1B 4NUGH 2X4SA 1NEZB 2Z91A 3IS0X 3GD1C 1OPOA 2H32A 4MA8L 4R4FL 1N5YL 4TNWK 4JGJA 2YD5A 1A3LL 2IF7A 3K2UH 4UT9H 4ZNCD 1NKOA 1I85C 3KPQB 2XG4A 1TCRB 2ZUYA 4AZ8B 1V7NL 5E4EB 5JXAL 4W9KC 1HWGB 3A6BL 3BKYL 2YJLA 1GGIL 3EXLA 4KDTA 4H1LB 3GZOA 4FABL 3GT6A 4HJGB 3RVXC 4EIZC 2HX7A 3MV7E 3APNA 3BOVA 3D1MC 1JGDA 1MRDL 4HWEL 3DV4A 4NHUA 3W11D 3JVGC 1DO5A 2W0FA 4XMKH 1DBAH 1H3WM 4XR8C 3RWIB 5ALCH 1G7HB 3NIDF 3VMNA 1U91A 1KELL 3DOSA 4JZNB 5CCJA 2B9AA 1TPXC 4UTAA 5F0PB 3QJUB 5D1QC 5EZLA 5EA0L 3GXPA 2CQVA 3TZVC 2V3DA 4N0UB 3CFIC 5EF3A 3RGBA 3RDTA 2E5EA 3DGGB 3RIAF 3TT3H 3IJEB 4G5AA 4QRPD 2DIJA 3SQBA 2P8PA 5E56A 3VSQA 4Z7QE 2VSCA 5D4IA 4Q9QL 2O4EA 5A2FA 1E4XL 2A4CA 3U4KA 2P24A 3HTLX 5DJYA 3UTTA 1JZ6A 4QD2E 1JRHH 1JF6A 1SQMA 3QUZA 5TJWK 4PJ7F 1Z9MA 3FT3B 4FKEA 4IMLA 3QNZB 2P5EA 4MWFA 1LHZA 2LLGA 2R1YB 2VGLM 4PG2A 3K71A 4WHYH 2O61B 2OX5B 3IFLH 5C1MB 1JHLL 2FL5A 3WSQL 3DURA 2WXKA 1NUNB 1NMBL 5ICXB 3IGLA 3LRSB 3QDJB 1F4XH 2XNAB 2X9YA 2XKNA 2AEOA 4X7CC 3WLBA 3F65A 1KCRL 2HX9A 5AVWB 3RFZC 5T5FH 3PGFH 5EFIB 1GIGL 4PJHB 2DQFA 4N8VA 5CINH 4P9HC 5F7YC 4O2EA 4WY7L 4FEIA 4MD5A 2YD6A 4RETB 1TQCC 4ZMWA 2LV4A 1C8PA 5E2UH 5BRZD 4H8WL 3S0PA 5GJTL 4ZMZA 2HLFC 3DIFB 2ESVD 3NIFB 4IBTA 1UYWH 3KYMB 3H1ZA 3WFCL 5TK4A 1ZGLM 1JHKL 1D5IL 2SEBA 5F9WB 4XCCL 5C92A 1B0IA 3O3UN 5E8PB 3VSTA 5KANI 1E2VA 1KENH 2C34A 4GRLD 4LAJH 4OGYH 3CGTA 3PQYA 3WNNA 3HNSL 4YHYB 3GSNL 4HZLB 3KGSA 2NUTA 4AH2A 5FA3B 3X13B 4JR9H 4JGNA 1DL7H 1G6RA 3JUZA 1UZ8B 4OZIF 5IZ7A 4QOKE 1G7IA 2WIIB 1VEOA 4UAHA 4F7CA 1XEDA 1J8HD 1EV2E 1I4FA 2L4OA 3I6KA 4WAFA 1SOKA 3VU2A 3MTRA 3QFJA 1N68A 5JW5A 3NMEA 4ABQA 4F8TA 4PRHB 3BSZH 3G6JF 5L6YL 1Q9KB 2WMPB 2F19H 2ARJQ 2JJSA 3IDYC 2GAZB 1ZANH 2X3AA 3FNKA 2HVKA 5E1IA 3RIKA 4A67A 2CO1A 2HUHA 3NIDE 1KJVB 3KLKA 3L3JB 1FN4B 4FFVD 1QNZL 2V9RA 4U1JB 3K0WA 3E3QC 3LEXA 5FUCC 4MX7B 3QO1A 4GB9A 1XB3A 1VEPA 3C8KB 3LZQA 2VDNL 3P9MA 4PCTA 1Q1PA 2EDKA 3T0ED 4IRSB 2ZCKL 4JRFA 1UM6L 1YEGL 2HRHA 1A2YB 2L7EA 4L2YA 5FYKU 5I26A 5I1AA 5E5MA 3P3YA 5JIQA 2Y4SA 5ANMA 1G4MA 3KE0A 3L6FA 4PPTA 3SYCA 3FONA 1FFNA 2UZPA 1RUMH 4CKVX 4UYPA 4Q14A 2P9RA 1KC5H 1RZGA 2VN5A 4I1RA 4FKHA 2UUDK 1MW2A 3HBGA 4UM9B 1MFCL 3TV3L 3DO7B 2AV7B 5JTWA 1CTMA 5J1TC 4FLOA 5GGSY 3HC2A 5D2NC 1S7RB 3S96B 4J7RA 3P02A 3HCVA 3CFJA 1FZMB 2ALWA 3C2SA 5FCUH 1IBDA 1FGNL 2VRKA 4PWGA 3GJFA 4G3YL 4WWKB 5CFAA 4QAMB 2AQNA 1DUYA 3MQIA 1JZJA 4P57B 5D1ZI 2Z93B 4CVXB 6CGTA 2KERA 3EGSB 4ZPVA 3VG0L 5CEZL 2GC4C 3QUKB 3UADA 2OMUA 1FFPA 1UWFA 1JV2A 1P2CB 3HJ0A 2FX8L 1T4KB 2CCVA 2QPUA 3BCFA 2DI7A 2PO6C 2FJFA 3L3KA 4NQSA 4YUEL 4UQIM 5IW6B 1BREA 1HESA 1JWSB 5I19L 5B1CA 5E2JA 4B3EA 1VACB 3CHPA 3JTTA 1JPGB 3KBPA 3MLTB 2R29H 4X99A 1PZDA 4V1DA 3VXUE 3LMJL 1GCYA 1U4EA 3V4PH 5E5RB 4AIEA 4PLKC 4P5MB 3R7RA 4OZIE 2CM5A 3LKPA 3VXRA 1HU8A 4FXKA 2GUOB 3LS5L 3G5ZB 1CLZH 2L3BA 4PVLA 4ZFZB 5TGBA 3BAIA 1QPXA 3H4HA 1OSPH 4BZ2H 4OLXL 3LZRA 3NIFF 1RURH 2E7CA 4AGPA 2XN9B 3ARWA 3BN9C 4RA0C 3BEVA 3L3OB 3DX4A 3N9GL 5CGMA 1HJCA 1PKOA 2B0SH 3RZCB 3HG1A 2VDPL 3GB7B 5DUBA 3LQAL 3C5SB 4MFHA 1PZUB 2E9IA 4LCWA 1IIIA 1TSHA 5AKRA 2OZ4A 3O4LB 4Y4KA 2V6HA 1NANI 2D2CC 4GQZA 4M1CC 5IMMB 2APSA 4NDMA 3ARGA 1E8YA 5KYWB 4BWWA 1ZT4A 4M4RA 4WU5A 2GB2A 1UXLA 3S35H 4M8QA 2DS4A 1SMOA 4UUJB 4L4TB 3IJ9A 4TVUA 3MRDB 2WLLA 2NPLX 3M7OA 4JRXA 1XL4A 3MX0B 4U0QB 4P05A 2QKIC 5FM4A 4J3BA 2APTA 4XHJD 1LO4L 3AWGA 2Z92B 2EVIA 3Q2CA 4MYWB 4YGAB 3ZO9A 5IM7A 1J5OL 1MWAB 5FYLH 4YVUA 1QVOB 2KBGA 1RPQA 3WENA 4N0UE 3VSUA 1I1RA 5I5MA 4ODVH 2GBVA 2VB5A 4CMHB 3IKKA 3L2NA 3H2PA 2A6DB 2AMUA 1VLXA 4FF9A 4YHZH 1BVKB 5CCKH 2HMIC 1T80A 1ID5I 2EIKB 1X6LA 4BK5C 3QAZC 5AAWC 1RY7B 2FATL 4YDLC 3ZXAC 1R33A 5TF1L 2F5AL 3PABA 2FX9H 2NY1B 2EZ0D 4UV7H 2RBLA 1JGVH 4B0MB 1FH5L 1QRNB 4NRXB 2EYSA 4ODHH 3QDJE 1F4AA 2BSTA 4HWBA 4UTBA 4PJXA 1X7QA 1ZLDA 3E6HA 4UM8A 3ZYIA 3CZFA 2IOIA 5GRUL 4KI5F 43C9B 2PWHA 2QSTA 1CE1H 4Y16C 4AE1A 4PB0L 4PJHE 3EBAA 4DN4H 3JWDL 2VNCA 4LU5H 1JZDC 4OFVA 2R39A 4J12A 3BP7B 5GGTL 1GAFH 4K9EC 1DVUA 2ICWI 3FQWA 5T1LB 3NIFE 2E7LA 4UCFA 3PXLA 2AF2A 4WNQB 3G04B 3IU4L 2X2HA 4P5TD 1HL4A 3Q8FA 4JE0A 2EINB 1YY8A 5LNGA 4TTDC 3DVNA 1JP5A 4JGUA 4YHNA 1SGKA 1LEGA 3QFJD 4H26B 3L3GA 1RU9H 3DX3A 1IU1A 1EO8L 2EADA 2NZIA 1ZHNB 1JDCA 4O2CA 1IJNA 3G5WA 2J1YA 3AY4C 3NOIA 3CZLA 1TVBB 4JLRA 3SBPA 3ZDYB 1XCQB 4XP4L 3F85A 4LOUD 3FUDA 4DUWA 3T0WA 1MFDH 3TH2T 4HKBA 4H2AA 2X4TA 1A4KA 1RJLA 1ZWIB 4ZMXA 2RAMA 4KTGA 4U2ZA 3BUPA 4XNAA 3B56A 5F2FA 3FQTB 3WKQA 2WNKA 1LP9B 3GJEA 2AVFA 1AVAA 2OI9B 3GBEA 5BZXA 4XPTL 2ATPB 4C4KT 2DI8A 3NGBB 1Z3RA 3KS0H 5JOPD 1CFSB 4X0KA 2VUOA 4OUUB 2CALA 3KJ6H 1L5GA 1ET7A 3AU1A 3AXHA 2V2TA 1MHEB 2CKBH 4TQHA 1Q0YH 2GTQA 3GI8L 4YDMA 2NNAA 1AHWB 1RUKH 1ZT7B 2CBTA 3CMOL 2J2ZA 2AK4A 5LO7A 2X6VA 3M8OH 2CO6A 3REVB 4PS8A 2ZX9A 2XWBB 15C8L 2CBMA 4Y2DC 2F1BA 3CV5A 3GLEA 3QRGH 5I66B 2R7EA 2WXHA 3UBXA 4FKKA 4IMKC 2ZOTA 2VDQL 4XXCC 3SY0B 4KK9D 3U9PH 4W9JC 4KGJA 1SYVB 3HNTH 1NGXA 4IRZH 1ZSHA 4HCIA 1BQSA 2VRQA 5EU5B 1F41A 4F58L 4D0CB 2E75C 1NH6A 4WFED 2R4SL 3EOAA 4KI5E 1LO5A 5KYXA 4DJMA 4IK7A 3EZJB 4B50A 4HALA 2B7DT 2DQCH 4DW2H 4D9RE 1NAML 5EHFA 3EYOB 2BVTA 3H9SA 4W9ZA 3RURA 4Z18A 3CDYA 2FQFA 4JG1H 3OHXC 4RRPG 5I6MA 5EORL 1F3DH 2H2PD 1KXQE 4NAJA 4TNVK 3MZGB 2DLFL 3T8XB 1A6VL 1G0YR 3FFCB 5E6IC 3TP4A 3ZL2A 1YUHB 4GPVA 4YDIH 5GJSL 4W68A 3EO0B 5GGQH 4X7FC 3BIAX 1MLCA 3JV0A 4HKZA 1KEGH 2ZD0A 3DX9A 1GC1L 1UJTA 4FQXB 1QSEA 1I7UA 4F5CA 3LHPL 3NPZB 4G7YL 4O02B 4NQED 4XBEH 5JDJA 4Y7MA 5DQDL 5T1DL 1CC3A 3HE7A 5T3XD 4ZUVA 2XWZA 3HG1D 4RH4A 5IBUB 3VXOA 3WIFA 4HJUA 1QSVA 3OKDB 1OV8A 4Y9EA 2QKSA 3VRIA 4JO2L 3LIZA 4PGJA 5F7EH 1IAOA 2PPDA 1C5DB 4HS3A 4Y4KD 2XN9E 3IBOA 1BCIA 4L0PB 1J0YA 1BZEA 1JS4A 3VWKA 3BISA 4HH8A 3ARGD 4NP9A 3QEQA 1DQIA 2K78A 3TFKC 2A5UA 3IJSB 4AW7A 1KN4L 3N1MC 4J4PA 3D50A 4JRXD 2MQGA 3FT1A 4JY4B 5EOTB 1KPRB 4GKLA 5FAAA 3EG9A 2AJUH 5EF0A 3ETTA 3TIDA 2E27L 1SQ2N 2ENJA 3IMSA 1A14H 3MOBH 5EF1A 1MLBA 3O4LE 4LASH 2V9TA 4FXGB 3ZDYF 4NYLB 3H3PH 1Q90A 4YSTA 1AI1L 2HRPH 4TQEL 5EZIL 3FFOA 2IBZY 1KWGA 3UEZA 4G6AC 2C9PA 1XGQA 2DWDB 3KPLA 5EUKA 3DMMC 5DJ8A 1HL5A 3F84A 3MLUH 4XNDA 3GSVB 2WSDA 4A6YH 5FO9B 2HKHL 1LP9F 4KJPC 4DKTA 4Q4EA 3CSGA 4FTVA 4G9DA 1TMQA 3QH3B 4DK5A 1R3KA 3CC1A 3UZQB 1ORSB 3OLIA 4ZOBA 1INQB 1KB9K 4WKZB 3OM3B 1WV7T 4KJWD 2AK1L 4MXQD 4EI5B 5EC2A 3GM8A 5JLZB 1ZS8A 5J5EA 1AG6A 4ELDA 2N56A 4E9WA 5LNDA 2AKRA 4AT6B 2H1LM 2IALA 3NN8A 1BEYL 1VAHA 1U3HB 3D09A 4MMYB 3HMWH 1XF5B 1AH1A 1ZVNA 1LK3L 5JUEL 2EC9T 1J7VR 2HKFH 4ETQB 1T5XA 1QRNE 3I6LE 3F64A 3PP4L 5AZ2H 4OV5A 1D9KD 3CN3A 5IB2B 1BZ7A 4JFQB 4MJ5B 3HFMH 2YFNA 4YLCA 3MREB 2W92A 4JHAH 3HAEB 3WXWL 4Z23A 1E30A 3FOLB 5H2BA 4QLWA 3E0GA 5B38G 2BSEA 3TA3D 4ELKB 4RFEB 1ED3A 1QFHA 4CSTA 4UV4L 4ZAKA 3RX9A 1F1DA 3DV6A 1COBA 2EDDA 3FZUD 5EO1B 5IBTH 5T3ZL 4IGBB 4XE5B 1QTPA 1BVNP 4NO0B 3F83A 1NIDA 12E8L 4HK3N 1HQ4B 4ZS7L 1I8MA 4S2SA 3QP3A 5EIIB 2WCGA 1E4WL 3W2DH 4E9QA 2XIBA 4UI2A 4BYHA 1ULVA 5LGJA 3VI3B 4DEUA 4QGYA 4EN3D 1G1CA 3L7EA 5I0YA 1M53A 4YL4A 1OCRB 3ULVC 1K4DA 4JFFA 5CFHA 5DDHB 4OCWH 3ZKMD 2NY5H 4PREB 1EXGA 4JHZA 3ZDYE 3GK8H 1LEKB 3KVPA 4HK0A 4DPRA 4AXWA 4XWGH 3LQZB 5FKAB 3D30A 1QLFA 4AVIA 5FYLD 2VE6A 3LEVL 4JFDA 2VABB 1UT2A 1IEBB 4N22A 1CDGA 1KB3A 2CU9A 2DQEL 2AK4D 3F01A 1A25A 4GO6B 1LP9E 1ZA6A 4ECNA 3HRZA 4PJGB 1FFRA 4P2CG 2WVUA 3IWVA 3M86A 4LKXB 5ADOL 2AAAA 2ZUTA 5JR1L 1D5MA 4JQVC 3BPNB 4TULL 4N0CD 5KUKA 4OB5L 3DHPA 1ZV2A 3K2KA 4UT7H 1TZHB 5BQ7A 2J25A 5AYQA 2WC7A 4PS4H 4A04A 3DHJA 4HKJB 3CMGA 2CE6A 3T09A 2G30A 1VKXB 3A6CL 4LVHB 4GG8A 1G7JA 1U8MA 1UM4H 1XH1A 4HXBL 4TTGA 3BPLC 4AW4A 4DP4X 1BD2A 1HZLA 3EYUL 3U7WH 1D2PA 3UJIH 2YPVH 2LTQB 2QQQA 4LLMB 1P84J 1M7DA 5DO2C 1JBJA 3QUYC 1D5BA 3QJFB 5LBSA 3OAYK 3H9SD 4YIQB 5EDXA 2Q3AA 4HGWB 5EBLB 2GG1A 4JFYB 4AIZA 1H3TA 3UO8B 2EXYC 1GZHC 3T5WA 2BM3A 1IM9D 5L9DL 1AKJB 2C1PA 3RVTC 2C4FT 4K73A 3HE6A 1ET8A 4JCWA 5LKNA 1CICB 2X05A 1H5BC 3VWJB 3ARQA 5BZDB 3PAUA 3K6DA 5EZJB 4LHQB 5HVHC 3OR6A 1KTRL 1M1SA 4FFWD 5JPMB 4RDQF 1P7KA 2OK0H 4P07A 3VQ2C 2BPBA 4AK1A 4YWGL 4UNUA 5H37G 2X1XR 1CFTA 1OARH 2A83B 3HE7D 1ZAGA 5FUZH 3PV6B 2YUWA 1KT2A 3S5ZA 1KBWA 1JTPA 3FFCE 4Q2ZA 4K23H 2D7PA 4L29A 4DVBB 3TJEL 5E8NA 2BP8B 1OM3H 1GJUA 3TH3T 2FDBP 3B6SA 4QRUB 5GRVK 3WFDH 2A73B 2FX7L 2EICA 4EIBA 5JPNC 2VXTL 1G7LB 3DNKA 1CLYH 3QEQD 3SE9L 4AMKL 4GW4A 3G08B 3P0YL 5H4ZA 5JHDA 4R0LB 5F1IB 2G4EA 4JRYE 1JFQL 5BZZA 5BVPL 3O45A 1F2QA 3UX9B 2CGZA 3FU0A 5EMYA 2VXVL 4Y2NA 4IBSA 4Y4FA 3MJ7B 5LBGA 4O4YL 2UVFA 4XNUL 1ADWA 1IT9H 2A7BA 3WY3A 5PCYA 3BDBA 3IXAB 5SWZB 4WUKH 1XF1A 5C8JA 3PXHA 1I75A 4BK8A 4KVNL 3CN0A 1ZHKB 1IGIL 4WFFE 4WO0A 3WDIA 4LF3B 3VI3F 3PWPA 2QZQA 4QCIA 2EO9A 3FUFA 3QUHA 3N0AA 5DVKA 3H3BC 2CO7A 3EF7A 4OVVA 2RCSL 2OMBA 3F7VA 3TO4C 1UEYA 4IHOA 2X40A 4FJZA 4JPKH 5ABDE 1OK8A 1SNRA 3GYRA 3GTNA 3C09B 3FRPB 1CVSC 2G3XA 3RNQB 3AMLA 1K3IA 4X4KA 2XZZA 5IVXA 1AANA 1M05B 2PCPB 4QHLB 3S88H 2L7UA 5EEZA 2AW2A 2LU7A 3FF7A 2PN5A 1WBYB 3QB7C 3U6RB 2F7IA 2NUPB 1PQZA 2BRQA 3FO9A 4MQXC 5J11C 4G6FD 1CO1A 3LKRB 4OBSA 1F5WA 1ZJBA 2FZ3B 2XT1B 2B3IA 2WXOA 3CHRA 3KXFE 3DO3A 2DJUA 4P23D 5GIRA 5C71A 1JGIA 4HJTA 4FQIH 4PSPA 3NSCA 2V17L 1XCWA 1MI5D 2YN3A 3OSKA 4F7MA 3Q3GA 1TKWB 1YEFH 5SX5K 9CGTA 2PNDA 4P5SA 2WLHA 3EBIA 2HP4A 5DYOB 3T8VA 3TVMC 2Y1ZA 1FLRL 2HTLC 4WEMB 3DSFL 4KY1L 1DVFA 3T77B 4L8DA 1Z9PA 3PGDA 4X80L 4OSUH 1QR4A 1R17A 4HS6A 2G3NA 1UOLA 2WSKA 4JCMA 2NQ3A 3VX1A 2VIRB 4ZAKD 1KF9B 5I75B 3UPRA 4CBPA 1B6UA 3RHWF 3FUIA 5DI8B 1JYVA 2DQIL 3R0NA 1BMGA 1RZJH 2ZF9A 4FOMA 3HLAA 5FIEA 3A47A 4ZFFA 1J5HA 2DL9A 3PRZA 1ZXKA 3PHSA 1VFUA 3FQ4A 1HJBC 5DC4B 1FHNA 4Y88A 2XWTB 4BQCA 5CILL 1KLGB 3TBTB 3OKLA 4OQTL 1UB6A 4P2QA 3DXAA 3THML 2OTPA 4L3FA 4N0YL 2ARJB 4RNRA 3FOMA 4H5SB 1H8SA 2MRYA 4I3SH 1AJ7H 5IROA 4XNMB 5CGTA 2MPVA 3VI3E 1F02I 1XD0A 1GGTA 1BBDL 2FRGP 4YVNA 5E4EC 1BJ1J 1WFNA 4M43H 2AABL 1W72B 2XXCB 4P46B 4KJYB 1QR1A 1R47A 5LXGH 3Q2NA 4KQ4L 3ZRSA 1BM3H 5CN2A 1OSEA 2JNZA 4AM0B 5FO7A 1BGXL 5FGBA 3ARBD 3ELAT 5CEXA 3U7YH 1R3IL 2Y2TA 1BFVL 3IDMA 4AYSA 1RZ8A 1G7QB 2JKLA 3AACA 2BNQA 2A0LC 1XSIA 4PJ8D 5EOQL 4OJFL 4JM4H 1VCBC 4PJGE 2CJUL 4O02H 4PRDA 5LWYH 2YKLL 1BD2D 2W1NA 4HLZG 3PGCB 4JJOA 1M7IA 5DZJA 3K4ZA 4YXKL 4BFOA 2QADB 1UCBH 3T6VA 3OGOE 1DDTA 2Z7UA 4IRJB 1ZGLB 3NJVA 4BZ1A 1HXMB 2Q76B 2VWEC 3QXWA 4OAWB 2CGRL 1I85A 3P4OB 4QY8B 2NQCA 1OCWL 5FV2A 4XNXH 4H40A 1JZEA 4LT7A 1I8IB 1CL7H 1RUQH 2QMKA 2ZWLT 4OLUH 3SOBL 5IOKA 4HIEB 2VDRB 4G9FA 3SCMB 2K1MA 1J1PL 1R3HB 1AC0A 1U8OB 5TE6H 3JVGA 1WH0A 4HZAA 1ZSDA 3BZEB 2V2WA 3TBWA 5CN3A 2ZP8A 3O2DA 3QQ4B 4OIBA 2JELH 1GHFL 1UKTA 3NH7L 1HH9A 4WDIA 5D1QA 1EJ6A 2WTRA 3TZVA 2BSDA 2X4OA 3RY4A 3UG5A 3DRTB 1FZOA 3JWNG 3PXJA 4XN1A 5ESAA 4FFZH 3QIWC 2ZF8A 1BDYA 4U7KA 2QFRA 3S48A 5KBDA 5BQDA 1GZQA 1XT5A 2IOOA 3IF1A 4YXHL 1KLFB 4PI0A 5TE4L 3STZB 1FVDB 4J3OD 3WKNA 2NY3B 3C60B 5F9WC 5C6TL 1P4IL 3D52A 3IFOA 3ZL4L 3RWHB 1IL1B 4J8RA 5JIPA 5JHDD 3G7TA 1NTDA 1OSZB 4WFGD 3UTPE 2BK8A 4HKXB 2CBPA 2HT2C 4Z7WA 5AW8B 5C0CA 4ZTOH 1AZRA 2MKWA 2AQQA 3MUGB 1TNNA 5F96L 4B9IA 3ZTJH 2A1WH 2V5TA 5DRNB 3SGEI 3RVUD 2L04A 3EKCA 4KROD 3P54A 3H6AA 1G6VK 5CXPA 5AL0A 5KWYC 3HC0A 2VOTA 5KYNA 3R18A 4XN2A 4HBQA 2W95A 4PJ9B 3RFZA 4PB9L 4L3ED 4GS7B 2ZCZA 4JDTL 4JFHE 3PWPD 1OGSA 1S46A 2YMTA 1B4TA 3BE1L 2O5YH 5IIEB 4DP6X 3OJVC 1JD7A 2Y7MA 1T2QL 3MFFA 2XX0A 4PUBL 3V4VL 3UROR 2X28A 5JO5A 3LD8B 5DURD 4OFDA 2VLJA 3D12B 4U2YA 4MB5A 3WNMA 1GZPA 3MCKB 4LCCC 1I7TA 2QTVA 1ZY9A 2HA1A 2XX1A 4LB8A 1QBLH 4KKPA 4TSBH 4XP9L 2P46B 5DWUL 4L4VB 2XICA 2YEQA 4NJAL 5HVFB 1CF8H 4BHUI 4ONOA 3O3BB 2X4RB 3OQ3B 3HI5L 1EDYA 4FJYA 4NFBA 2PWFA 1SDYA 4BUQA 5IQ7H 4DGIH 2FQGA 3QRFM 2EDYA 4HIJB 2DDQH 4WFHE 1ZLUH 1KXTA 3M46A 1DBJH 1DDHB 1S7QB 2FT8A 3WFBH 1I82A 3FMGH 3KHQA 4HP5A 2XN1A 3C5JB 1JK8A 2UWEA 4M02A 1AKPA 3MJGX 3FUJA 1HTYA 3X1EA 5I1DA 1EHXA 3DJTA 3LPOA 3KDMB 1AO7A 4KI5C 1S8DB 1HAWA 3TFBA 1DCLA 3A6OA 1JHTA 1MHPH 4WWKC 3MUJA 5IHWA 3FQNA 1A9BB 4GSRA 4JQIH 3HEIB 5A16B 3SGKA 4AGQA 1IC4H 1MVFA 3GNML 4ZOAA 5AUMA 3TYFB 1YQVL 3MV8D 4IOSA 5FYKD 5DJXA 3RILA 1GS8A 3ULUC 4ZFOA 1L6PA 2IOMA 2QBWA 4LQFH 3MV9D 4QXTB 3MAWA 3KR3H 2WXLA 1YVLA 2CLRB 2YBRA 3ASNB 3SKOA 2F1EA 3L16A 4MBRA 3NACL 3RUGA 1QEXA 3KPRD 2GI7A 3ILPB 5HYJB 4K3JH 1HEZA 3VG9B 5SV3A 1BX2A 3OKNA 3VD7A 2IMMA 2PYED 3AM8C 4OT1L 5BMFH 3FRUB 3DTXA 3BCDA 4W4NA 1CGUA 5AWNH 4IBZA 4FQQB 1H6FA 1NCJA 3EHBD 5I8EA 5EBWA 5FOBA 1MHHB 5J12B 3VD2A 3NRFA 4JKNA 3N41F 4OZ4A 1AFVH 5IEKB 1MZYA 2KZKA 3DXAD 5D2NA 5FGCB 3U25A 3WLWC 4LSRH 1AQDA 1YEEH 4B9GA 1IB5A 4L5FE 1JGLL 5IROD 1ML0A 3CSYA 3VFUA 1EVUA 1KGWA 4E5XB 4POUB 2WZAA 1M6UA 4HX1A 1ZEAH 3KGUA 3L3OC 1SOSA 1O9VA 1L9OA 1ORQA 5D1XA 2CIIB 3SKMB 1PX4A 1MDTA 2BOCB 3MBXL 5ESVB 2WQAA 3I75A 4JFUA 3D33A 4PRPA 4JFPA 3L54A 4UQ2A 5D72L 4BSWA 2B4CL 5HHPB 2J6EL 1BF8A 1OPGL 4U7SA 4GRWF 2IV8A 1XIWB 2PO6A 3OG6B 1CE6A 1JSYA 1F4YH 3B2VL 4GMTH 3K91A 2XYCA 4G8AC 1M3JA 4OM1H 2ZPKH 2BNQD 4QRRA 2ROYA 1YNKL 2KUTA 4GMSL 5T1MB 4ZUSB 1D6VH 1NDTA 3GHEL 2EDHA 1P69B 2A6JA 5DK2B 5L8KB 4QRAA 1JGEB 3IJ8A 2GJ6D 1UH2A 5FKPB 2OMWA 4JB9L 4M48L 1UD5A 1EJOL 3LSOA 4ZFGH 1JNLL 3ZSTA 5I18L 4S0TD 3PJSA 3GIVB 3QRLA 2AJZA 2VDNB 4LLUA 5DO8A 5IR1B 5FR3A 3BP4B 1YNLH 3QUML 2C1OA 2XY2A 1QBAA 4ES8A 2IQAB 3MRQB 4FL4B 2X09A 5DHVA 5C0IB 2VLRA 2EO7A 4PV9B 2ZWKA 2JQAA 3FCTA 2N1KA 4TRPL 1KBVA 3W39B 1K5WA 3U0PB 3GF8A 4GFTB 5MEPB 5MEOB 2YEZB 3OB8A 2VSDA 2OJEB 3LN4A 1NIAA 4G9FD 5D7KE 2EVJA 3MJ8A 2QGCA 1U8KB 4PJAA 1RHFA 4ILDA 2R9HC 1DQLH 3ESVF 2ADFL 1USQA 2ZJSH 4ANUA 4OVUA 4RX4D 4FI6A 4ICWA 2NY1C 1NC2B 4QAWA 1HHHA 2X3CA 3GMMA 3TZVD 4FQPA 2Q7NA 3QRBA 1N7MH 3IN2A 2C7UA 2WQ8A 4HA1A 1KPVA 1T20A 2M83A 2OR9L 1S2EA 1K2DA 4ZOCA 3X11A 2NY0B 2QKIA 4PWIA 3S34L 3D85D 3WN5A 3UZVA 2BERA 1MCQA 4I8DA 4OJCA 1U3YA 4N6RB 5EUOA 3L5XL 4JO3L 3B5TA 2AV1A 4JFOA 3LDBB 3LV3B 5HDQL 2AEPH 4X8XA 4MXWL 2Z1KA 3P77A 4FP8L 5C0CD 3BXNB 3ZHLA 5JQ6H 1GL4B 5EH1A 3V6OC 1EZSA 4XH2A 4HEPA 4NHCL 1YG9A 1B2WH 4QUOA 4BFEA 4IU2B 1NAKH 1DQML 3HPLA 3DI2B 1JRHI 1S7SA 1QFUH 4WUUD 5E08L 4EUPA 1A7NH 4FCHA 1R6VA 4JGMA 2P7TB 4L4JA 3D2UB 3VFMB 4BK5A 2MTPA 4A39A 1J05A 4PG9A 4P59H 1T7VA 2NLJB 2VQ4A 3T8MA 5JIMA 1AGCB 4NQCB 4GRWE 3U9UA 3H56A 4NM8L 3OJMB 1Y07A 5IF0A 4X6CB 1FC1A 5FYJE 1M71A 1L7IL 3LTVA 3F7YB 4PBWD 3I02B 3S98A 2EUXA 3ZT5A 1H0DA 2V7NA 4LLAA 4YHKH 5E99L 4XX1E 1MOEA 2I85A 2VAJA 5JMRA 1CB4A 4ZUWB 2XUWA 3VXTA 1A0QH 2D9CA 4Y16A 4CN4A 5J1SC 4WTZG 2VDPB 4FLSA 2Q3XA 4NQVA 3S5LA 2DY2A 3L4ZA 5CR8A 1KLUB 3IDIB 4R3SA 1MCOL 5DFVC 3RIAK 3BZDA 1C12A 1S3KL 1I9IL 4YGVA 3IPEA 3MJ9A 5AB1A 3HI1A 4M56A 3WTXA 3MYJA 2WLZA 1PYWA 3BH9A 1DANT 1T3FB 4R4NC 3NGBC 2WKOF 4F1SA 2W65A 3DUHA 2AJYL 2ED9A 2K8QA 4L5FH 4L4VE 3ET9F 5AOJA 2B1OA 5FW8A 3UYRH 4X9YA 2R1WB 2VH5H 1YEDB 4ACTA 1AHWC 2CJSA 3CPUA 3CD4A 1KG0A 5FW6A 4LNRA 1U92B 2HG5B 2NX5A 1I7ZA 1WHPA 2CM6A 3AY4A 5D71H 1AHMA 2E47A 3ZHKA 4JDZA 4PLOB 4BCZA 3BWAA 4WZ9A 3SE4C 1Z9LA 3VGGA 4LSDA 2Q9OA 1TMCB 1BMZA 3L08A 1EAJA 1ZLVH 3VFSB 4Z1PA 3P73A 4TQPA 3D2TA 2LAAA 1EGJL 1ONQB 3MNZB 4NT6A 4GQQA 3GSWB 2PR9A 1JAEA 2BIHA 4B27A 2JKJA 1RIHL 1W72H 2TRYA 3TIEB 5L2KD 5FWRA 5LBVA 4YSEA 4GSDH 1DUZB 3OKKA 4LCVA 2YBGA 1CD8A 3FAXA 3ILDA 4LVNC 4F37F 1JGUL 5AYUH 4LHUG 5C0AB 1A6TB 5LDSA 4F2ME 2WHVA 1JWMA 1SJHA 1JOIA 3G5VB 4HH9A 4HCRL 5IB5A