4B60A

Structure of rfnbpa(189-505) in complex with fibrinogen gamma chain c- terminal peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
309
structure length
299
Chain Sequence
TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEGYTLTWDNGLVLYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN-BINDING PROTEIN A
publication title Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Cell adhesion
total genus 72
structure length 299
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A02
2Z1PA 2F68X 3IS1X 3ASWA 2RALA 3AU0A 1N67A 3V10A 4B5ZA 2Y7LA 3IRPX 4FJ6A 3IS0X 4F20A 5IHWA 1R17A 4F1ZA 1R19A 3IRZA 4LEBA 2VR3A 4MBRA 2F6AA 4Q6KA 2Y7NA 2Y7MA 2YLHA 4LEEA 4B60A 4MBOA 4F24A 4BBWA 5CFAA 3AT0A 2Y7OA 4F27A 5CF3A 4RMBA 4JDZA 4LE8A 4JDZB 4JE0A
chains in the Genus database with same CATH superfamily
1UZ8B 4NKDA 5J12C 3SYQA 5MERB 2X4NB 4P9HH 3DBXB 1M42A 3F6LA 5BUPA 3CHXA 3G7TA 4MJIE 3WFCH 4CILA 3G6JF 4P2OD 3EYVB 4OJFH 1YEIL 3IAQA 4F7PA 3G5YA 2XBTA 2ZYHA 2OXGB 1ZT7B 4FHKA 4R96A 2NMSA 2YD6A 1JNLH 1S4IA 5D7IA 5EBWB 5HHVL 2HTLD 3SKOA 5DC4B 3IU4L 5KYUA 4HGKC 1TZHA 4IHOB 4QOKB 4AL8L 3HJEA 3QVAA 4MQXD 5CGMA 4HEME 4WTZG 1KCBA 4NOBA 3P9LB 2FSDA 2C9PA 3R18A 4KK9C 1U8PA 4L5FH 1ZLDA 1YCSA 2CLRB 2Q8BL 4JKLA 1GJUA 1XF1A 1MW2A 5FYJH 2E86A 4MA1B 3B5HA 2XXFA 1AQKH 4XNXH 2JLPA 5I1LB 2R0ZL 2DH3A 5KSAC 2L3BA 4ODVL 4G8EA 4YGVB 2MWCA 1AD9A 5D2LA 1OP5H 3F6JA 3A47A 4FP8H 4X6CB 3CHRA 2V7HB 3V6OC 2OW6A 2FQDA 4IMLB 4H8WL 1FJ1B 2FIKA 5DS2A 4NCC2 4E41B 3BISA 4NQVA 4P4KD 3GMRB 3IDGA 4PJ7F 3RVUC 1G7MA 5C86A 1BYNA 1XMWA 3S96A 2DJ4A 4WEBH 4N2NA 1H15B 4OFDA 1PVHA 1EZLA 4N90E 4BELD 2Q76B 4ZTEA 4JFDB 4QOKE 5EIQA 4G83A 1DFBL 3DYPA 2XN9A 2XQBH 3MA9L 2A2QT 4U1MA 4GG6B 4UBDD 2XVGA 3ZL4H 4P3WA 4DGYL 5AYUH 4N0YH 5B4MC 2C9QA 3O9WC 1C5BH 1KN4L 1RI8A 3CSYA 3BSGA 4XC1H 2C8NA 1J88A 4PJCB 2WY3B 3G5WA 4JQIL 4F15C 2HG5B 3RVXD 4Z95L 1MCFA 4LCWB 4HS6B 1Q9WB 2GBVA 3D48R 4AC2A 4XP6L 3K72A 2H6UA 1RV6X 4MZ3A 5EIIB 4JRXA 4WI3A 2AXGB 3JXAA 3P11L 2YD7A 4X6CE 4MRBA 5E8EB 2F58H 2NYYC 5IVZB 3D06A 1VESA 1ZPLA 5KWYC 1TVHB 5E0QA 1M7DB 3TVMC 4PJFA 1EWHA 2GSGA 4E41E 3C08H 5ICUA 1VSCA 4CMMA 3E80A 2D3VA 2WKOA 4BUQA 1FYTB 4HWZB 5AAWA 4WTZA 4MVBD 5FIEA 3V6FB 3S7GA 2CA3A 3O0RH 1EDYA 1NDGA 3OBAA 4JFDE 1KCLA 1H3WM 4E5XB 2ESVD 1I1AD 3QS2A 2DMHA 4GG6E 5K1NA 4UT6H 3JWDL 3A22A 4YIQB 2XX0A 1ZA3A 3VFVA 4CVZA 5B1AB 4EI5D 1M7UA 5DFVC 2J6WA 4NNXB 2WYIA 4PW4A 1Q8MA 1DO6A 4AENB 4PJCE 1TTBA 2VDPH 1VJSA 3DURA 3CU7A 1A7QH 3CFTA 1HINL 1SOSA 3EOTH 1V3LA 4LCWE 1WIUA 4ZOBA 4AXWA 3RWDA 4D0BA 5J56B 3DGCR 2WBJD 4DKDC 1E2VA 3A6CL 3SDDC 3QWQB 4NAJA 5F8RC 2W0LA 3IKKA 1H6TA 1CQKA 5IW1A 1E43A 5A43C 2CAKA 1C12B 3FQUA 3LEXB 4FLRA 5F3FA 1BQHG 3QT2A 5E1AA 4U4IA 4TRPH 2X89A 4CSSA 4L1DA 1A7NH 2N7AA 1RUPL 2F7IA 1O6SB 3UDWC 4IMKA 3ULVL 3FNKA 3WYRA 3GLAA 4N8CH 3LKPA 3VX1A 3ECBA 2R29L 1GH7A 3AAZB 2Y4SA 3LQZA 3F7KA 4ELKA 4WTXA 1IKNA 5LCVH 2Q7YB 4OF5A 4EF3A 5TDOB 2RHEA 2OTPA 2Y36L 1A4JA 1C7TA 3PRZA 1TU2B 5EB9A 3N2JA 5F1NA 1AY1H 4V33A 3RPIB 3REWB 2COVD 4V1DA 1YEDA 3MGAA 5T1MA 5GS0C 4G7VL 2WAHA 1F8TH 1NCUA 4UUJB 3SZ6A 3RUGF 1HHIA 4PS4L 4NBZB 1XF3B 2OJEA 5HY9A 4RAHA 1XZ0A 2YMXH 3IJYA 4B5ZA 5B38B 1MRDH 4K3JH 2GEQA 5L2KB 1ZT4B 5PCYA 3UTSA 4LLYA 1EPFA 1T1YA 3ULSA 4WWKA 3WV0A 1WUZA 2FUTA 4FNSA 3QUZD 2ZJSH 1XCXA 2P43B 1CYWA 5CZXC 1OLZA 3G08A 5DI8A 1KEGH 3GSXB 2WZPD 4JGNA 1M7XA 5IEKA 4WGKA 2KZKA 2TRHA 2F74B 4M5ZH 5F3BB 1B0GA 1KYOJ 2PTVA 4AE1A 2EZ0C 5L4JA 1OF2A 1D6EA 5H4YA 4C56D 4H5SA 4X5QA 1ID2A 4QJ3B 4ZT1A 5AVSB 3AXLA 4FXKA 3VSTA 3VDBA 3DVNA 3K74B 4M3HA 3GXFA 5ALBH 1MCWM 2ARJA 3S8FB 3VD2A 1PZ5B 3QXDA 1FFOB 1MQ8A 5IMOB 2NY3D 3O45A 4NDMB 1A3ZA 2NNRA 3DV6A 3K8MA 2YD5A 1FO0B 3QNFA 2H2PC 1JWMA 3FUHA 1YLBB 3NEXA 3LZOA 5DVLA 1I1CA 2DWEA 3HN8A 4O2CB 4BRJA 3D12B 3NTCL 3V0FA 2CNYA 1HHJA 4MGXA 3QJZA 3H54A 1BQHA 2JKRM 3L08A 2NZ9D 4XMKL 1NAMA 3POHA 2N0KA 3VGHA 5L2KE 5A2KH 4OT1H 3VTMA 3L7EB 2BNQA 3NESA 5AVWB 4DW2L 4GKOA 4OLVL 4PRAA 4M6OH 2VJXA 5JIIA 4NQCA 2EIKB 1CPUA 2WNGA 2YFOA 4LK4A 4OGYL 3FOMB 4FG4A 5GGUA 2JMRA 3VXTB 4D0DB 3BYTA 2IADB 1QA9A 5MHSE 5DZVA 1FC1A 5I26A 4HJTA 4WY7L 5L2JB 1S8DA 2BSEA 3ZSTA 1FQ9C 3SOTA 3E6FB 4M62H 2XBDA 3ESMA 4H0LC 4PLNC 3L3OA 1OZUA 4PG2A 3BVXA 4X7SL 3NN8B 4Y5VC 4FQ1H 1SLUA 3U1PA 4IBYA 3H56A 3EJZC 1HKFA 3C2AH 3W2DH 5EEZA 3GPEA 1TTCA 3OX8A 2D7MA 1IKFL 1RJLA 3C5ZD 3NCJH 4R2GC 1J8HD 3F05A 4QRQA 3SQOH 4M7LT 3Q43A 2ZXWB 4HKBA 2LLNA 4O5LL 2F1AA 4XXWA 1NCOA 1AOHA 4L3CA 4UDUB 1MVYA 4YDMA 2VZTA 4P5KB 3JWNH 2ZTBA 5DEFA 3ZHFA 3S4SB 3CAFA 3DUHA 5IB5A 3GO1L 1CLYH 2ENYA 1NGXB 4MWFB 1DL7H 5T1KD 4F9LA 3SHSA 1NGWB 3EO9L 3TP4A 5K59E 1CDHA 1CCZA 4F80A 4LARH 3TN0B 2DBJA 3BP6A 4HPYH 1DJIA 1N3NB 2YUZA 4IRZA 5I8KH 5HYSB 1FFNB 3ZR6A 1TTUA 3D39D 3ABZA 1YMMB 2WLNA 1O7VA 4HDIB 3RE0A 1YN7B 2VLJD 1M4KA 5DVKA 2ZCLL 3ABGA 1IAIH 1MN4A 5AWNH 3X11A 4JDEB 2AZAA 4JFXB 4N6RA 4C47A 2APXA 1Q0YL 2BY1A 2IGFL 2MPAH 3F84A 3P0YL 3U0PA 2HFFB 4M4PA 5IVOA 4DP2X 5HHOB 2OR9H 3QQNA 3KPPA 5F9JB 4WHTA 1N8OE 3L9YA 5AG9A 1BMZA 4X9FA 4KK8C 4L8CA 2VRKA 4GSUA 2NY5L 1S9KC 1AYRA 2BRRH 3FTGB 1Q9OA 3MJ9L 3QIBA 5JOPE 4MD5A 3MNZA 4HVBA 1H8SA 1JZHA 1KZYA 4NZJA 4WI9A 1THAA 2GKIA 4PG9A 5AOMA 1JGUL 3BWSA 4G6JL 4APQC 5BXFB 2DQUL 5HGAA 2YXMA 4PBDA 2A6JA 1JZEA 4UAHA 3T04D 1B88A 3IXTA 5FKPB 4B3VA 1IAII 1RPQA 5DURD 2P8MB 3LXAA 2WK2A 4KJQC 3WN5C 2F54B 4NKOB 1YMME 1C08B 3N42F 4XVJL 5TFSL 3FZUC 1T22A 4KPHL 1D5ZA 2DIEA 1BQLL 1MHEA 2XV6B 5F7NC 3NVQA 4XN4A 2A9NL 5K39B 3V4VL 1JYWA 2N0MA 2CK0H 1QOKA 4MHHG 5ICXB 2ZSWA 3S3CB 1L9PA 3BSZL 4ZO8A 1TJGL 1UXSB 4YDIL 1DQVA 5HHOE 2MIZA 4BK5C 4MAYD 3MX0A 3MCKB 4OU3A 4UINH 4YFLI 2FJGA 5JYMA 5F0PB 4LF3A 4QGYA 1IV8A 2DI8A 5KYYA 4KQ4H 4Y5XC 1XB6A 5F72S 4AG4L 1GC1L 2HRLA 4F57L 2MKLC 4WJ5A 2WLLB 3UPAA 1RK1A 3ARDB 1I1RA 3F7QA 3N3EA 2ADIB 3HRZC 1VCAA 2EQDA 1J0JA 1YEGH 4TVPL 1BM3L 2YAHA 2YK1L 1C5DA 1CGYA 3ARXA 4H44C 4LIQH 2RTTA 2HMID 4AQ1A 4X7CC 5BZDA 4XGZB 1DUYA 3VXNA 2LAAA 2J4WL 3FXIC 3P30H 5IHZA 2F54E 2VITB 1L7IL 4X9BA 9CGTA 1AGCB 3CFKB 3TNNB 5BVJB 1R3HA 4OQTL 5CJQH 4FTVA 1KEML 1VFUA 1AZRA 3L16A 1W72L 2FHCA 3T08A 2X5PA 1J5HA 3RFRA 2YN3A 1A6ZB 3MRPB 3SPVA 1MQKL 2W60B 4PY8I 4NUGL 4Q6IA 1MLCB 1DBKH 2DM4A 1GMIA 4UV4H 1S3RA 2O6PA 4U6HB 1HHHA 2HH0L 2PXYA 2XIDA 5E9DD 1LWJA 5HI5C 3IBOA 3FUNA 1LK2A 5ENWB 1U8CA 5CGTA 5BVPL 3RL2A 1AQDA 3QHTC 2X41A 5B1JA 2YGQA 4P57A 5TE4L 4L0PB 4G5ZL 4PJBA 1Y1DA 2YGOA 1MEXH 3ZLQC 1G7QB 3LKOA 3R19A 3QORD 4O2EB 2XG5A 3CDGB 2Y2WA 2R23B 4H25A 3HS0A 1DUZA 2AK4B 4O58H 1UURA 4BCXA 3SZKC 4DN3L 3BH4A 1EJOH 1G7IA 5EF3A 1DQJB 1DSFL 2RR3A 5DRXB 4E9XA 3VI3B 1FZOB 3VXUD 2IGTA 1SDDA 3KBPA 5IGXL 4POUB 2ZONA 4DO5A 3W56A 4PLJC 2GC4C 1U8IB 4I9WD 4ODHH 3DX1A 2VKXA 2IWGA 3JWOC 3MRIA 5I16B 4XMZA 3EO0B 5KVDL 3POCA 2Z8SA 3IXAA 4HWUA 1LEIB 4PIBA 4JG1H 5IVXA 4P5SA 3GMQA 4NRZB 4BH8B 1LK3H 1KV3A 1S46A 1JNNL 4JVPA 4WENB 3HAEA 3NCMA 4U1IA 5A16A 2G3XA 2PMZA 1CJYA 1JAEA 4KK9D 5E00A 3SBWC 2K9FB 2XI9A 3G5XB 2ICEA 4P49A 5AOKA 5GRJL 3TBYB 4C57C 2G5UA 3B8SA 5IIEA 1KENL 2VCOA 4LZKA 4Y19B 2G2RB 3ATDA 5DO2C 5KS9B 4MDIA 5CILH 1IIKA 3TA3B 3LNFA 4KMLB 4Q74A 1ETB1 5EEVA 3QI9C 4XOCA 5TF1L 1IRAY 2AK4E 1R3LB 1A5FH 4Z7AA 4PRIB 4IOSD 2ZKMX 1S9VB 4Q2ZA 3TYGH 2ZOKA 2ZKXA 3VI3E 5HP5A 4XBPB 5T33L 1HE8A 3PQYA 1BAFL 2O61A 1P5VB 3U0TA 3S36X 3AG1B 3BKYH 1E7UA 2OYMA 1XD0A 4NUJA 4RIRA 2FGZA 3HI1B 1K3ZA 4HIJB 2VIRB 3CFCL 4CJ0A 4JO5A 1IFRA 2K8MA 2VGLM 4FHJA 5DHMC 4LSTL 1WCBB 3SEPA 2I26N 4Z7IA 1E9QB 5H8DA 1D5BA 3DX6B 2NT1A 2PCFB 3HE7C 3U9PL 5D7LD 4JG0H 3U36B 5CJOH 5FLVA 5GGVH 3IJ8A 4Z5RA 1AANA 1OK8A 1AGBB 1QTPA 1P4IH 2AV7A 2VE6A 5B4MD 4PJ5A 3FUEA 5D2NC 4EI6B 5IF0B 3KXFD 4KY1H 1M6OB 1VFOA 3FFDB 3W0WA 4Y19E 1JK8A 4ICXA 5KS9E 2XDHA 3JBG7 1AS6A 1TT6A 2AKRA 2IMNA 4XNQB 4N2FA 5JA9A 4X6CF 4D8PB 3BVVA 4Y5YA 2PYEA 4P0DA 5J6GA 1Q9KA 3RDTA 4AQAB 1YY8B 4PRIE 2TRYA 1GZQA 4JFWA 5EOQH 1LE9B 5L88L 2NYYD 3ECVA 1L0QA 2WLKA 1ZT1A 5AOIA 3TVMD 4UILL 3G9VA 1TXKA 5C7XL 1NFDA 3ARBA 1ZHLA 3FT3B 3BH9B 1JI1A 5BOPA 5HJ3B 4R6UA 1ZTXH 4JLRB 1GYUA 3RIFK 3RRQA 5DZ9A 1JTPA 1OAKL 5I15L 2HT3C 1MJ8H 2HFGL 1BVKB 5KG9A 4GG6F 1IGTA 3ARQA 2VXUL 3D7PA 4N2IA 1OSPH 3L4TA 4HQQH 5FKAB 3SIKA 5D71H 3CVHH 4HAGA 2L4OA 2DL2A 3FB7A 4QXWA 5SV4A 4KDWA 1BLIA 3CDFA 2DLGA 4KTDL 4PJCF 5TD4A 4C8XA 4M8QA 3GMMA 1DN2A 2JQMA 2XKSA 1Z9OA 3B2XA 5J6HA 4ZI8A 2FGWL 4PWGA 1XO8A 3CMOL 2J8UA 1TZAA 2P8LB 4G43B 2YSSB 1NTDA 1CE1L 2L8AA 3DMMA 2EDTA 4JRYA 3SDDD 5INCB 2E74C 2Z93B 4HK0A 2VLKA 3ARFD 4GI6A 2HPTA 3IS0X 3NRFA 2B0SL 1L7TH 3ARUA 4JDVA 4MNQB 5CSZB 4YOKA 3V4PH 4BSWA 3VFPB 5KJRL 1GPOH 2DQEL 1M1XB 2DAVA 1XFPA 3TTSA 1VIWA 2XY1A 2R69H 3DHPA 4K9EC 2YKKA 1DVFB 3O3BA 1AD0A 5IROA 2OYKA 1O7SA 1CGSH 1YNKL 4NO0A 3CIQA 5ESQA 2P44B 3V7MA 4HUUB 2RIKA 4OV5A 3L2LA 1X7QB 2CM6A 4IRSD 1EXGA 4KROB 1T03H 4YHIA 3DSNB 4OM1H 1Z0NA 4Y2DA 1UB6B 3P4LA 4Q8BA 1F1DA 2VM4A 3RY6A 3PG2A 3OKLB 4FCAA 4KAQH 2DICA 4BDVB 3TO4C 1OTSC 5GS0D 2DJUA 2GUOB 2NTSP 4G6ML 4UNTA 4XPFL 1D5MA 5CJ5A 5BV7C 2EVJA 4Z0XB 5D6CB 5CP3A 2YD9A 2VT0A 3VWJA 5GRZA 3NIGB 1EDHA 2J6EA 1OP4A 2OA9A 3LEVL 4ZAKB 2RQ8A 1WWCA 4DAGH 1ZIAA 4R4BB 1FNAA 1Z9SB 1K3IA 2GJ6A 4I3RL 2IOMA 3HIZA 3NEOA 3NJVA 3PHAA 4PYHA 4AUJA 15C8L 2C7UA 1KTDB 2XYCA 2VZ1A 1MNNA 1F90H 4YHLH 5CZXD 5HHXL 3FUDA 4RZCB 3CHSA 5L8KB 5FDYA 5HDQH 1E3XA 5JOFB 1UG9A 3MOQA 5E8PA 2AQRA 3UGEA 3MTRA 3BMVA 4ACPA 2NY2C 4H0GA 4LT7A 2WTRA 1R5IB 4Q52A 4JJ5B 2FYYB 1SEQH 1RZIA 4BK8A 2CGYA 4NIYE 4C55A 3MR9B 3T8XB 1RVFH 2YPVA 1U42A 4J4PC 4Y1TA 1NBYB 1TVDA 1T20A 3UJJL 2BP3A 3WTWA 2DEWX 2ZAIA 3FSOA 2IPKB 3CFIC 5FDWA 5ES4B 1UWXH 2F18A 4J3OG 2XX1A 2KT6A 2HJLA 4B60A 3DSFL 1MHPH 1LYQA 1IC0A 3NIGE 4F92B 2V3FA 4WJG3 1I7ZA 4PRHA 4MCZB 4KRLB 5EU5A 4HETA 3Q5OA 1YNLH 2WNWA 5HVGB 4K3HA 3ZSSA 3RZCA 1JTTA 4EIZC 1QTSA 4IU2B 3WE1A 4R26H 3PP4H 2BY0A 2QR0B 4LGSB 4WW2B 1HCFX 3WFHA 5CFHA 2NSXA 3RAJH 5HGBB 2EDQA 3SY0B 4YEFA 3QH3A 4NXSA 1G6RH 1HH9B 4LSDA 5E9NA 3BIAX 2A9MH 3CXHK 2J1YA 3O6LH 2XTLA 1J1XH 1URIA 3A6OA 4LQFL 4M6AA 2EIDA 4F5CA 2VDQH 2YEVB 2MJWA 4OCNC 1F4HA 4U4BA 1PX3A 4W4OA 4NC1E 3I6KB 4EQ2A 3HI5H 2ZE0A 3OGCA 3EDJA 3DX9B 4K94H 1U92A 4JRWA 5B7MA 5JXEC 2FH6A 2A3TA 2VN5A 3CH1A 5I1KL 1UGKA 4CU7A 3NZ8A 3ULVE 4CADB 1RIVH 5K59F 4WFFD 4HUXB 2XWXA 1PYWA 5I17B 2H0JA 1W15A 3QK0A 3MV9A 1VHPA 5CHNB 3TJHD 4X7TA 5KEZA 1ZIBA 4ZX6A 2WSPA 3BJLA 3EYQD 3HLAB 1K2DA 2J5LB 3F2LA 1IGJB 2YGNA 4JM0A 4KH9A 8FABA 4AJYV 4I18C 4OBRA 1DCEA 2WBWB 2X4SB 3AGWA 3L95A 5EUOB 3N44B 5AVXB 4EXKA 4ZW3A 3SCMC 3SDAB 2IDQA 3WLWD 3KCPA 2OMXB 1KTCA 1SFDA 2ZD0A 4YSOA 4J5VA 2E7LA 4ATWA 1OM3H 4E9VA 2Y7SA 3ARGA 4MHHI 4CVWA 1G9NC 3CZSA 2EDRA 3SYAA 4YXLL 3MRRB 3CDZB 4F8OA 4POYA 1LTXA 3MLUH 4X80H 3TWCL 4RBPK 4IU3B 2C4XA 2QQKH 3STZA 3VH8B 3TBVA 1GZPA 2WZ5A 2A38A 1OPGH 3E8UL 4RISL 2GBUA 3D0VB 4RGNB 2CLZB 7FABH 1PD6A 5ELIA 2HAZA 4OCWH 3TT1L 3OXRA 4QYOB 2I9TB 2MKWA 4L8SB 2X7LB 1B9KA 2PCPB 3E7JA 2F53D 4WVRA 4WI8A 1QABA 5EU4A 4AV0A 2CO2A 2YEZA 3PUCA 4NHUA 5TE7H 4BZ1H 1P4BL 2WSDA 1G7LB 2J7LA 4GRLD 1AR1D 1FFTB 2XZQL 1OY3B 3BC9A 3FUKA 1QQDA 1T83C 3IFNH 4JAMA 4NQED 5EUOE 3WFZA 2BX5A 1HQ4B 1J5CA 2BJML 2X4OB 4XOEA 4ADJA 1KDIA 2XJLA 2H6PA 1IO4C 1H3GA 3LNIA 5TQ0L 3Q2NA 3CVIH 5CKGA 3EH1A 3NA9L 2RFXB 1EX0A 4YUEH 4N2KA 1M2VA 1AC6A 5KJ7E 4QXGH 5GPRA 3MU3A 3VJ6B 3ZMRA 2WXKA 3GIVA 4UYPA 5LGKA 5DRZA 1OCWL 5K9OA 1AO7B 3J7HA 1DQLL 1OTTD 1PLGH 4UOJA 1QVOB 3VWKA 2L7UA 4FYTA 3LKNA 4PJ8B 2BC4A 1BPVA 2DLHA 2F8IA 1XAUA 2ALAA 1MCOL 2BM3A 4LGPB 4LEOA 4RGNE 2DKSA 3BVWA 5CU5A 5DVOA 3QHZL 1TJHL 3K6IA 4X9GA 2R0WL 3NH7L 1PQZA 4HC1H 1EZUA 2CSPA 4GW4B 1Q0XH 5C2BL 3GT6A 3MRNA 4WU5A 3FS9A 1VFAB 4G6FD 1OOAA 3QW9A 4ZUTB 1AXTL 5HVWA 5BZZA 1QWNA 1TSRA 1OGAD 2FX8H 1IVLA 1S3KH 4DGWC 3HW7A 2NY6C 1PIGA 3CFDA 5FLUA 3RJOA 3NFSH 1NCJA 2E27L 2JB5H 4M61B 4IS6B 4DKEH 1KNOB 4TUKL 4X6FB 5DYFA 3UEZA 2DY2A 1WVZA 1S7WB 1XR8A 2BVQB 1TJXA 3OTTA 1OARH 4OLWH 4WGWB 4O51B 1RJZA 2R9HC 5EN2B 3ZRCC 4QRSB 1HC1A 1CLOH 1RD6A 4M6MH 5GIRB 5F1SA 2ZPKH 5D4HA 2J3SA 1AO7E 4P23A 3HC3H 1EUUA 1FAIH 2CPUA 2PWGA 3QQ4B 5AW1B 2D3LA 5E5MA 4PJXB 5JMOC 4JY5H 3WE6B 2V17H 4PJDB 1E27B 2EE0A 3FQNA 3MBXH 5EF1A 3MOBH 3GSNA 3DJSA 4RNRB 1XGPB 3Q6GL 2C9XA 3EFOB 5EU6B 4E42A 1F2QA 4WLCA 3IGAA 5I74B 2V0AA 2VISB 3E2HC 3KYMB 4I5BB 3X13B 3CMGA 5L6YH 2LTQC 3GC3A 4JZJA 4OJYA 1A6VL 1QI5A 1R5WB 4L8DB 4YSRA 3VXRA 3VD4A 3E9TA 4LLQA 2IFFH 2N59A 2P45B 5F9OH 2CGRL 1IM3D 3MXVL 5CIPA 2R2HA 1SJMA 4TF4A 5EF0A 4CAGA 4ZMPA 4PGBA 3BLBA 4DCQB 4RLDA 1ET8A 1D7DA 2LU7A 5KAQG 5EZLB 4WW1B 3NCEB 1I82A 4A7QA 5LQBH 5FW6A 5A2CA 4JDTL 1F58L 3N1GC 4P46B 4U1JA 4KI5F 4M4RA 1QZNA 1UTDA 2H47C 4DQAA 4YN3A 2VLRA 3ASNB 3H9HB 4FQLH 4NC0B 2MOQA 3MNVA 4NRYA 5CP3H 1YZZA 2FIRT 1CI3M 3DX0A 4I0PB 3O4LA 2J6EH 4XCEA 4PJXE 5GJSH 4PJDE 2AP2A 1DBMH 2DWXA 2Z34A 2WV3A 1E9PB 4MA1C 1JUFB 5EU6E 2D4FA 3X12A 2VDLH 5C07D 3CPLA 2CALA 3Q1SL 2A4CA 1AZCA 1YEHH 1HAUA 1F97A 4R4NC 3US0A 5D7SL 2WWMC 3IDXL 4WO0A 2IBZX 4NKMB 3VACA 1MRFH 3AT9A 1W72B 4JANB 3QI9D 2VZVA 1KBGH 2DQTH 1M57B 4MMYA 3O2VH 3NCYS 2WAQA 4P2OA 1SXNA 4NO3B 4AYDC 2FWSA 4TNVF 1BZ9A 1AVAA 3BAEH 4BH7B 5DQJB 3FQRA 4GUQA 1I9EA 4Z77A 2BXZA 2FH8A 4Y4FA 1BZQK 1JZJA 2K9UA 4RRPG 2DQ6A 3D0LA 1HCVA 3D2UA 5AOLA 3MV7D 3CZUB 3KYKL 1JV5B 2UYLB 3H0TB 3QUYB 5I9QB 4GO8A 2CRYA 2D8KA 1FVDA 1DDHA 3C9NB 3WAJA 2JXMB 2CUAA 2ZOTA 4JN1H 2Z4TA 3HE6A 1J1PL 5KS9F 3UPCA 1KB3A 2CXGA 3O8XD 4R0LC 2DL9A 5EC1A 3OF6D 4CDGC 4R4FL 3CVBA 3DWTA 3OB8A 4OJAA 2I9LB 1ODAA 4RFEB 4X4MA 3MRGB 4GAYA 3DOHA 5AW8B 5EO9B 2XNAA 4XVUC 4QKTA 2BDNL 3CC5A 1ZLSL 3G04B 1AP2B 4PJIA 4XC1L 4E0RA 5KSBB 3L7FA 5GGRA 2P8PA 3KD4A 2QQLL 4NZ8A 1I31A 2ZWKA 3IMTA 3FCTB 4KUCD 2BOBB 5KVFE 5MP6L 1ROCA 2ZNXA 2NW2B 1SBSH 4HS3B 4KRPD 1OW0C 2CNZA 2VXSH 4CW1A 1WZ1H 3UAJD 3NYKA 3VXSA 2B20A 1L0YA 4ERSH 4GI9A 2CUIA 5E8NA 4A66A 1OSEA 3K2UH 5DD1H 1A1MA 2VN4A 1G7JB 4KNUA 5E6IA 3S97C 3CZFB 4KVNL 3WEAA 3O3DB 3PGFH 4F1SA 5BMFH 1QNZH 5JW4Q 3TZVD 2EAEA 3GXNA 2GAZA 3WGVB 5IW6A 4BCZA 3BRFA 4OCXH 2YAMA 5BRZD 2P5WB 1MFCL 1IGIL 2XCMC 1KJ3H 1L0PA 1X4ZA 2GT9B 3ARRA 3EGXA 3LMJH 5FYJU 5MEQA 12E8H 3OKOA 5J89A 1D7BA 5KSBE 3VW3L 1GZHC 3CCHA 3DRTB 3HVDA 2K0RA 1BZ7A 1I85A 5GJTH 5C9JB 4XOBA 2D31B 3LRLA 5DC9B 2C3XA 4AEIH 1JF1A 1UZ6E 1TOXA 4J3OH 1ZHKB 1JPFA 2X4PA 4P2RE 4ORGA 4QCIB 4XMUA 3PL6C 5JPNB 5GGSY 5JNYA 4N1CA 3WU1A 1DLHA 2EXSA 4ZSOB 5AUMA 1I1AA 3RGBA 1SRDA 5D1ZB 3MMEB 3P69A 4UM8B 3S3BB 4YXHL 5D5MA 1X5YA 3MXWH 1JDDA 4IEFA 5HI3C 4QF1A 1HE7A 4FKKA 4RMRA 3CX5K 2WINA 4PFEA 1MWAL 1DQKA 5HYEA 1FYHB 2VDRB 4PB9L 1WGVA 3LS4L 3U46A 4OFQA 1RZ7L 4J3VA 2XPYA 4WRLA 1ACXA 3S5YA 1MG2C 1OTSD 2O4EA 2WLYA 1OTUC 2CJUL 4D94A 3D2TA 1T89C 2P5WE 5LXVA 1JWSB 4PSPA 5FUCE 5SWQB 3O11B 1QFHA 3DX2A 3HR6A 2BP5M 2YUXA 1BIIA 1M71A 1QAWA 4HKJA 3VD7A 1RIUH 2OMWA 3MCLL 2M26A 4L8BA 3ZDZF 3INOA 3HPLA 3ZE2B 1OAYL 4PJAA 4C54A 4RFOH 2Y06H 3BCFA 1SUHA 4MB1A 4S1RH 1XL4A 1EIBA 4FZEH 1NGYA 4YDKH 1NBQA 2XY2A 1ZDSA 4U31A 1I1YB 5FGSA 2DD8H 5EWIL 3I9GL 1QSFE 1OO2A 4K3JL 3IKCA 4ZSOE 1BVZA 4PJHA 1N6VA 5C0JA 4OJDH 5B1KA 2J25A 3EHBB 2CD0A 5KOMC 2F5BL 1X9LA 3CK0L 4HIXL 2WXLA 4IOIA 3SYCA 4X8GA 5L9DL 1KC5L 4M7ZB 1OAXL 4M9OA 4XVSH 2CMRH 1AKJA 4FQIH 43CAB 4HPHA 2W8CA 1MW3A 2ZWSA 3ETTA 3MODH 2BZCA 4J4PD 5EDXA 5GISL 3ZGHA 4AEHH 2AJZB 2H32H 3NIGF 2SEBB 1TZIB 4WWNA 1Q72H 3QCUL 4DVRH 4AGQA 3LB6C 5EZPA 4M56A 3AXHA 3ZE2E 4LOVA 1PPIA 3QO1B 1NLBH 4QDGA 3KYAA 5F71A 4LLVA 2HTKC 3H6JA 4TUOA 2WZPA 1SMDA 1NJ9B 4NENA 4N0UA 4QRBA 3OWEA 4R7DB 2Z1PA 2PO6D 3OKNA 1ILUA 2R2EB 1CZ8H 1S7RA 2VC2B 4QRPA 1NQBA 4HIEB 2P5EE 1VGEL 2FUQA 4QXUH 4JKNA 3WEXA 3LV3A 4HZLB 3B6SB 3BN9D 3MNDA 1ET7A 5DQ9B 3UGUA 2NUTA 1PEWA 1QBLH 4R7LA 1AHWA 5ECJE 1BOGB 2BP0B 2YEQA 2HLAA 1XT5A 1LP9B 1C7SA 3MLTA 4HJ0D 5HSFA 2B39A 3W82A 3QG6A 1RUAH 2FATH 1A21A 3QJFB 2BHZA 1LWRA 3SDYH 4YSDA 1TFPA 1JGDB 1KGXA 5HD8C 3B9KB 3K4AA 4JO2L 1V27A 4MNGB 5IJVA 1AS8A 4LHJB 1K9TA 1UFUA 2FL5A 2Y5QA 3GBML 3TN0C 1U41A 4KTGA 2EDDA 2UY6B 2CKBB 1T1ZB 5D7EA 1T1XB 3KEHA 2D7TH 2ZUVA 3MRQB 1S5HA 4OZIA 5CP7B 3U0WH 2UUDK 2YAFA 3ZO0A 1SOKA 2A9AA 4CC4A 3GSWB 1E4JA 2FWLB 1BP3B 3RZWA 1OAZL 5IB4A 2C7FA 3P0VL 2VM9A 5EFIA 3GZPA 4WFED 1A9BA 4RQQB 2CBOA 3T65B 1KIPA 4X8CA 1JPTL 5ACZB 5BUAA 4ZUVA 1NFAA 3QUMA 2B7DT 2ALWA 3QZPA 3K7UA 3SD2A 2IAND 5DMJB 2YXWA 3V0EA 2IGLA 2DTSA 3FMGL 4NGHL 3UIZA 2JKSA 2OYPA 1DFXA 3TBWB 1LP9E 3M86A 5KW9L 2X09A 4HIIB 4G7RB 5IUCA 2KPNA 3BLKA 1OCRB 3U79A 1MAMH 4HPOL 5C6TH 1LO4L 4QRRD 4MNGE 3BZ4B 3P4NB 2A0LC 4LSQH 2JJUA 4IKLA 4EEEA 4OLXL 1NDMB 3Q3GA 5T1KA 4LDOB 2CH8A 2WIMA 2ZOLA 3TTYA 5CM1A 5EUOF 4YXKL 3ZZQA 4LBEA 4ONHA 5F96H 1CDBA 4Y16B 1ZXKA 1RZKC 4L9LA 4KWUA 4NKIH 4F33A 2G3MA 1FNGA 1HIML 5FW8A 1ADWA 1FL5B 1RK0B 1U36A 3LRSA 3MNWB 1G43A 1VEMA 4NT6B 3ZYJA 2KZ1B 1FDLH 3STLB 1AI1H 4O9HL 3ZT5A 1QFPA 2XFXB 4FD0A 3NRQA 5FO2A 4KKRA 3U6RB 4XPGL 5SWZB 4NBXB 3D09A 4K23H 2QDWA 5KVGH 4LFHG 5J8OA 5EEYA 3O2WL 4LKXB 2EIZA 4KH2A 2V5MA 3H55A 3L48A 4FFYH 4NO2B 3A4DA 2UWEA 4BD4A 1HILB 4ALAH 1H3TA 3ARDC 1FNLA 1HEHC 3V9CA 3APFA 3PDOB 5I28A 2OMBA 2AMUA 3WENA 2A83A 4N0FB 5MEOA 2DMKA 3E8VA 5EOCH 3MLXL 4ZUSA 3BXNA 3JV5A 3MN8A 1YPZA 1MJ7H 4AKPA 3X1NA 3MJ8B 3KYOB 4NEHB 4HSCX 4QRUA 3B3IB 4ZQKB 4MJID 2AC0A 3RL1B 4PTUA 1RP9A 5FF6A 1TITA 3FT2B 3ZE0F 1P7KB 1W6LA 4PN6A 1MUJA 4BA0A 5D6DC 3HNSL 5TF0A 2EXYC 3OZKA 4CVUA 4BFOA 1KWGA 4OZ4B 4KJYB 4X7EC 2QPDB 5L8JB 4KI5C 2WNXA 3T0ED 5DHYB 1KPRA 1F00I 5SWZE 3GWJA 5SX4I 4TUJB 1BVLA 2XHNA 1KIRB 1VPOH 3LN4B 1FIEA 1Q9LB 3KLLA 1L4IA 2GITB 4HKXB 2OMVA 2XQ0A 5E94B 4JFYA 5EUKB 2G9KA 3KH4A 4XPAH 1QATA 3GSRB 4GRWH 1FN4A 2GTWA 2OL3B 3BVNA 3MZTA 5JW5B 3WNIA 4QWWC 2FSEB 5I1AB 3RWFB 2MHAB 4WFHE 1K8DA 2VMCA 1UWGL 1KB9K 3SPCA 3FQ2A 1QRNA 1MDTA 4MCMA 3QRGH 4OLYH 2G60L 1PLCA 3WIAA 1FV1B 4ZMQA 3FDWA 2WVTA 3AUVA 3UBXG 3EOAB 1DJWA 2OR7A 7PAZA 1UYWH 2O30A 4IJTA 5F3HA 4D7PA 5A7BA 2R1XA 3O3EB 5FO7B 5CEZE 2I69A 2HYMA 3JT2A 2WANA 3LPFA 4TN9A 2QKIB 1QLRA 2J71A 1SXBA 3DX7B 3CVDA 1F4YL 2NNAB 3COOA 4HT1L 5DD5L 4L4VB 5CD5D 3KEDA 4PJXF 2VLLA 1MZZA 3LPPA 4UQBA 1DVTA 2B5IB 4JO1H 1FZMB 2KKQA 3GJEA 3SKMB 4AZUA 3MROA 3U2SA 2GABA 4GB9A 2EIJB 5E9DA 2OTUA 2PCYA 3MREB 4LPCA 3QGVA 4L4TA 1JPEA 3PLYA 5E6RB 1FL3A 3ZKXB 3OD3A 5DMKB 3FN0L 3WXWL 3QJUB 1I8MA 1WRFA 2PCXA 4F58H 3TA3C 4S10A 3RVTD 4HWEH 2WYHA 5JLZB 4JG1L 4JREB 4S1QH 1U58B 4S2SB 4ZX3A 1KJ2A 1QBAA 4I77H 1IEHA 4A6YB 1T4KB 4K7FA 1HDMA 5IR1A 1W0WB 1F4XH 1O6TA 3WL9A 4E41D 2NT0A 5LGHL 2E0PA 2X4TA 3NFPB 2WVSA 1NCDL 2D9QB 1FSKB 1ZK5A 3J27A 5DJXA 3FRPG 5DSCA 2HB0A 3FCSB 4I9XA 4JKPH 1N4XL 5D1XE 3I6LE 1VDGA 5EO1B 4L4VE 2LLLA 4JFDD 1EO8H 2IDTA 3AROA 4LRNL 3TYGL 1CR9H 1R4XA 1DQMH 4ODXB 5DJ0B 5IG7A 1SHSA 4K8RC 1VZGA 5DD3H 2J5WA 5IJKC 3MRCA 1NCBL 5AZUA 1A02N 2LLGA 2JCCB 4PREB 5JTWA 3QXWA 3ARVA 5DZAA 4E9YA 2ATPB 1NGZB 2IV8A 1IEBB 1DE4B 2XC8A 1SEBB 3WY3A 3ET9F 3A6BL 4MCYB 1D9KA 3VGAB 3U9UB 5TJWK 4EDWL 2NX5A 1UH2A 4NI6A 1KXVC 2DBLH 5KSAA 1N12A 1NAML 4IIZA 1I3GH 1ORSB 4TTDC 2X38A 3S0PA 4NQXA 4OCRH 4AKOA 4XVUD 2ZUXA 3V8OA 4UTCA 1P4IL 3V6OA 1F1GA 3HTLX 2QZQA 2FJUB 3AU1A 5TDNA 3DJRA 4KY1L 3MLPA 1Y07A 2QQNL 5I8EB 4X5XA 1HYRC 2XWJB 2W95A 4DUVA 4ZMLA 2EVGA 4Z76B 2FR4B 5T3ZE 3P4MB 5T1DH 4ZXBB 3H1ZA 3DPBB 4Q9BA 1YNTA 4QT5A 5I30H 3MRHA 1FYTD 3LIZL 1PKQA 1RULL 4XE0A 2J55A 4PVNA 4FQ2H 1CVSC 3IJEA 3QFJB 4KZDL 3TFBA 4F20A 4NZTH 1R17A 5CMAB 4OLZL 3IETB 1SUJA 5D7LA 1E4HA 1CDIA 3WKPA 3BQVA 4I88A 3ULUH 1I7UA 4TSCL 1G7PA 3MACH 2VABA 2CQVA 2WMPB 3F7RA 4R97B 2JCCE 1MF2H 3O9WA 2X2HA 4G8GA 3HG2A 4AM0A 2IBGA 3PIQB 2C1PB 4GXVL 4U1GB 2IIJA 1P4LB 2XRAL 1FGNH 5DXWA 2PPEA 3QEGH 5TQ2H 2BMKB 5BO1H 1IJNA 2ZUQB 4K15A 5CEYA 3GHBL 1OP9A 4LPXA 4KMQA 5CN1A 4PJ6A 1ACYH 2VH5H 3KPNB 2BSSA 4F37F 3D25B 3QWRA 1THCA 1BBJB 1NIBA 1ITBB 1UZ6F 1HCZA 3KPSA 4IRZL 3X1FA 3TVMA 1NC4B 2LHAA 1BQRA 3FRPA 3MKGA 3QUKB 3Q6FA 4Z3TA 5CLZA 1DVFC 3MC0A 2VRAA 4XVTL 4Z3GA 4KC3B 1SYVB 1RU9L 3IRCA 4F27A 3VDCA 3FQ1A 1KB5A 4UAOB 1FC2D 4H26B 1LVEA 4JE0A 3MV8D 4Z7UF 1ED3B 4XB3A 3QFJE 3F58H 3UJIL 4HFWB 1M53A 4KROC 4M7KL 4KZEL 1TCRB 2X9XA 3NQIA 4M7JH 3QIUD 4PLKD 3UYRH 1A7PH 4G1MA 1KGJA 4NN7B 3OKEB 4PJBF 5T1LA 4ZNCD 5D8JL 2E6PA 2FB4L 2V7NA 4OGAD 4Y9GA 4L5FE 2DLIA 4X99A 5AW0B 4AMKL 3MHZA 1JG9A 5FYJE 4JFFB 1CGSL 4W9KC 2W59A 4ZFOB 4XBGB 3S37L 3WDJA 5AVZB 4LDLB 1FZKA 4JUSA 2VDML 4FG0A 2ZX5A 2O5ZH 4QTIH 3GSVB 1OTUD 3UXFA 4QYAA 4PJEF 4W1TA 5A2IH 1A3LH 3TBSB 1IIIA 4GAGH 4H2AA 4WI2A 2LVCA 3H42H 3GI9H 1IBGL 4ZNEA 1E90A 2A4EA 5DD6A 4KAQL 2IXQA 4AX3A 3LS5H 5DD0H 4XCFH 3NP3A 1TLKA 4QNPF 3WKNA 3B1TA 4DKFH 1U8LA 1DO5A 1TZ8A 3A67H 4RESB 3UDWA 4H1LH 1G87A 4PHZA 5J6GB 4X4YB 3PGDA 1T66C 4BFNA 2ZG3A 3QRBA 4FKEA 1G1OA 1LLAA 2EKJA 1TQVA 4NC1C 3KAAA 1F3JB 4PQXA 2X88A 1JHLH 2R2BB 3WLBB 3DJTA 3QRFM 1F90L 2EH8H 5F8QC 4JFFE 2ADGB 3OR7B 4P3DA 4ZMXA 5JXAH 2VDPB 1LEKA 3NJXA 2WWKO 5ICZA 4UQDA 5DJZB 1DBJL 2DMGA 2Y1YA 3GBNH 4Y2LA 4Q9CA 4YSQA 5G4NA 4Q9RL 5D72L 2IG2H 4GKSB 1BLNB 3ZE2F 2Z6FA 4YDLB 3PREA 4X4ZA 4YAQA 1YDPA 3EJSA 4P4KB 1I9IL 1PFOA 4GW5A 5DJ6B 5KSUA 3LB6D 4MA8H 3P73A 2P80D 3N40F 4FQJH 4WW2C 3GJFK 1QHOA 1DBBL 3VTTA 3SSGA 2XKUA 3SGDH 4JFEA 5EV7A 2C3VB 4LOUD 1AAJA 4Z78A 2HTKD 5LGJA 4AITA 1A9EB 4Y8AA 1OK0A 1IZKA 3W38A 1MREL 3HG1A 3NZUA 1M3IA 1MI5D 3BZ5A 1L9OA 1IGYB 2BS9A 5LG6A 3EOBB 1O75A 5ANHA 4BQ6A 1FH5L 1F56A 1JN6A 2VJ8A 3LQAL 4Z6AT 3DRQB 5I1CL 2D4DA 1QPXA 4PRBA 5ALCH 4Z7WB 3RJQB 3S5LA 1YAIA 5IB1B 1COBA 3BPOB 2V5RA 1S7TA 2E3VA 5M95B 1RUML 2OULB 4RSVA 3CZEA 2HRPH 2WLIA 4ZFFB 1SVBA 1OB0A 1BJMA 2L7EA 4FI8A 1IEAB 3GMPB 1TMCB 4CN6A 1F4WL 3N1QC 2J5LC 3TN0D 3QEUB 1KBKA 4LLMA 3TU6A 1FLTX 1S7SA 3SDAC 1JZGA 1YMMD 3OXSB 3VUAA 4YK4B 2ESVB 2ORBH 3H4FA 5ITBH 4Y9CA 1AH1A 3V5DA 1R34A 1JVOA 5DT1H 3UC2A 3FB8B 1K72A 1Z66A 1UUNA 4LASL 4OR1A 3VSQA 1AE6L 1RHHA 3BD4A 2Y5TB 3M7OA 1A2YB 1E6OH 4JPVL 1VACA 4Y5VA 5HHOD 4LP4A 2NTFA 2VW7A 3UG5A 1JF5A 3ZOAA 4HBCL 2WBJB 3RGVA 5AEAA 2KQMA 1V05A 3M1OA 2X6BA 3OKKB 4L2LA 1OZTG 4RGNC 4Z7WE 1T04B 1R0AL 3WDHA 1FNEA 4U1LA 3IJSB 4L8SC 5TK4A 5HYQA 2Q20A 2H0EA 3IDMA 2R2CA 3QULB 4IOFC 4MASA 3RWCA 3FHEA 5K9QG 3EJRA 1EAPA 5EBLA 2W38A 4PV8B 5I1GH 4XNBA 1VRSA 4X6EB 1KJVB 1HQRA 4GIOA 5F88A 4C83A 2XV2A 2BS8A 4N68A 2P24A 1BA9A 5FM4A 2EYTB 4JN2A 5E8DL 2I60H 1X6NA 2EICA 2A74C 2OMYB 2GY5A 3AUWB 4J6RH 5TDPB 4I4WB 2IH1A 4X7DC 4R90H 2AK1L 2BLFA 1RHFA 4UTBA 2ESVE 5I82A 3A24A 2DQFB 3S35X 1HL5A 3KWTA 3B56A 4MS8C 2UZXA 3MJ7B 4ZX5A 2WWKT 2TAAA 4NLAA 2E7HA 4NZUL 5A3ID 5I71C 5LBSH 1T3FA 5MENA 1TTRA 4JQVC 1U8KA 2RACA 1YYLL 4PJ8C 3ZKNC 3SDCB 2FJHB 2CDFB 3BAYA 1IBDA 3BP5A 2HN7A 3T4YA 4YE4H 3PPSA 3RI5K 3CVIL 4DQOH 3MLYH 4N8PA 2O6CA 1QTYT 3MBEC 1KPUB 1L3WA 2I32A 4MD4B 3GMOB 4HISA 2VYRE 3DTUB 4M5TA 2DQJH 1BMWA 2F53A 1P7HL 1ICTA 1AGFA 2BCKA 2A6IB 3BD3A 3GXDA 1PZBA 4WUUA 2Z31B 2GHWB 4APQA 4PBWD 3SKOB 3RU8H 5LXGL 5JW4M 2MTPA 4JHUA 1PLGL 2KBGA 3AB0C 1XGYH 4M3KB 1TZHB 3PWPB 2YMOA 1BG1A 4YDVB 2PW1B 1IM9A 3JVFC 5FHAL 4EBQL 1ZANL 3FTXA 4TQIA 4U1SA 4L0YA 1ML0A 3NIFB 4JHBA 2Q3AA 2XZCL 3WN5A 1C5CL 1U8PB 2RALA 3K5SA 3UBXI 3MUJA 1B0RA 3JTTA 1S5IH 2HVBA 1XH2A 3PDDA 4PI2A 5LB1A 43C9A 4CUCA 2R56H 1MFAL 3RDJA 3U25A 4NX0A 4K71B 2AAVA 1WA1X 3CFNA 3C8DA 2Y7MA 4LHUG 5D2LB 3LN5A 4G80A 5MEPA 4JQIA 2JB5L 4KBPA 5GHWH 4NPYB 3C75A 4BK5A 3EBGA 6FABH 4FZ8H 1UEYA 4EI0A 3GNMH 4DEPB 4KKLC 1TPXB 1GYWA 1HSBB 5E4EB 4BQBA 4Y5XA 2OZNA 1INDL 1EANA 2F8VA 3D4CA 3NZSA 2DKUA 1I8AA 2H3NA 5I8CB 4NQVB 2Y23A 3W9DA 3IDGB 3NCWA 1F02I 5J9PB 5A6MA 3SKJL 1G7MB 1M05B 1ZK9A 3S96B 3MRJA 3SPJA 3B2PA 3JWNE 1FAIL 3BJ91 3HRZA 4NJAH 1JPSH 2XN0A 4YHZH 1UACL 5SX5K 3INUL 2E5EA 3PWPE 4GAJH 1WISA 3MRKB 1G9ML 4M02A 4U1NA 4WU7A 4LAJH 1D5XA 3EIFA 4MDJA 2XN9B 4XC3L 1NBZB 3HMXA 3NIFE 3GLZA 4MXVE 2X28A 3CSYB 4P46C 1S7XA 3G6JA 4MCNA 4U6XA 5JIQA 1KGCE 1B4JL 3PHQA 5FCUL 3EUUA 1BPLB 3QDMD 5KZCD 4LCIH 3SGKC 1KLFB 1CD8A 35C8H 3FRUB 2DTMH 5IOPB 1AHMA 4WI0A 3V0WH 3NJNA 2AGJL 3LZPA 5D2LE 4EOWH 4DSYA 3DOSB 3ATFA 5EZOL 5DTFB 3APNA 2IALA 1S2EA 1DHKA 1INQB 1SJEA 4ES8A 1A1OA 4J3XA 2GSGB 1BVNT 4LE8A 2EILB 4ETQB 1RUQL 4Y19D 1RH8A 4CMMB 5BS0D 5I1EL 3HR5A 3TA3D 3P77A 1TETH 1LDPH 1QFWM 2J6EL 2NQCA 2VXVH 4UIKH 2X4RB 3N0PB 4PRID 3UTZA 3BT2L 1ASQA 2XN9E 4W9CC 5C0CA 3KPTA 1JXFA 2VDLL 4HHAB 1X6LA 1N7ML 1ZA3B 2BIIA 3GXMA 4TNWF 4CVZB 2NY0B 2X2UA 4OQ1A 4Z7QB 4XZ4A 1ERNA 2Q86A 2DWDA 1A6TA 5E2UH 3EYSL 3F6IA 3ATEA 4LVHC 3DURB 2ZKWA 3RY4A 3DIDA 1NMBH 3FFCA 4PJ7A 5AAPA 4D0BB 3RWDB 3QUYC 2NCMA 5FWRA 4KKAD 1P7BA 3ASOB 2F1BA 2X1WL 1IFHH 1WQVT 2MTAA 4ZD3H 1Q1PA 4ECNA 4YBLC 3BHBA 2Y1ZA 3QEHA 1BXUA 2ID5A 3MPCA 4K8RD 1SN2A 3CH8A 4PTTA 4NERA 3FQUB 1N26A 2YPVL 3SBWA 3NSCA 4HMEA 1CTNA 3MLVL 3FO0H 1UENA 2E9IA 4TULH 5B39A 3L5HA 1JRHH 4LSPH 5IUSA 1NCHA 3EYFA 3KJ6H 4OJCA 3TGXA 1S9YA 2AABH 3LKPB 3ECBB 4CJ1A 1H8LA 4FMKA 4MD0B 4OZHB 1XB8A 1WYJA 5EBMB 3MRDB 1R6VA 3VRLE 4NYLB 4LIQE 3V0VA 1V3KA 2R0KL 1O7DE 1N59A 2CR6A 5IREA 3IE4A 1TJIH 4F2MA 5F89A 1T0MB 4Z7QE 2E7MA 2AI0L 5FA3A 1QPKA 5ABZA 4P2QA 3ZKQD 3ML9A 3GI8H 4E9SA 4KUZH 3K6OA 5KYWB 1AACA 1CICD 1JNHA 1KACB 1SYSA 4X2UA 4GPVA 3I50H 1YN6B 1RMFH 3SDXF 5ID1B 1MOEA 4LRIA 4W81A 5HY9B 1G94A 4MB4A 3VA6A 1XZ0B 2F5AH 3HNVH 3HE7A 3NJGA 1JHKH 2MCAA 4QKXB 2Y69B 4QRTB 3EGSB 4JFUA 5C0AD 4A63A 3UTSB 3VFSB 3PABA 1AIFB 3ULSB 3WUWB 5D2NA 1AKPA 1SBSL 1E4XH 4FYRA 3BEWB 5B1BB 1KCUL 3G08B 2PTTA 4TOYH 4GMTL 5E56A 5FUCC 3SPHA 1PZCA 4MX7B 2O5XH 4AJ0A 5I2IA 5IEKB 1R9FA 4LEXL 1E5UI 2Z7WA 1B0GB 1OD9A 4OZHE 4XVOA 4M1GH 3IVKA 1UKSA 2EE9A 1OF2B 2AAAA 5C3IA 3MJ6A 4H5SB 1JV2B 1YC7A 4FXKB 3WO3B 2AQPA 4XXDA 4MNQD 1TNMA 2N7SA 3UROR 1WWBX 4GNKB 4AIOA 2ZOUA 3WD5L 4X5LA 1XIWC 1Z9NA 4TSBH 3S35L 3CFUA 3QR1A 3WIIL 4OCXL 2VAAA 5JPNC 1EZVX 1DVFD 1JWMB 4HG4K 2WPGA 3P4OA 4LAQH 5L4IA 3WHXA 4A2DA 4BBWA 3LKSA 3BUPA 4MA3B 4JFOA 1X5KA 1FUNA 1E4XI 3BH8A 4HAKA 4OFPA 4N1EA 4CVXB 1IC1A 4KK5D 5GRVK 4DP5X 1E9OB 1YEIH 4AEIL 4B7LA 4N8VG 5CCKL 3JUYA 4R7NA 3ECQA 4PRAB 1KJMB 4NQCB 4QHUA 3PAUA 4GEJA 2VDKL 3IU4H 5GGUB 1IC4L 1EHKB 5BRZA 2XKNA 3QYCA 1UD5A 1UXLA 4AL8H 3VXUB 3RUGA 1S8DB 1E28B 2XUWA 2N4IA 3ARTA 1A1NB 2Q0ZX 2ZKHL 3T0WA 2EYRA 3OC5A 3B2UD 3L3OB 4XO9A 1BW8A 2CBQA 4L3FA 4LPYA 2Q8BH 2WXRA 4O2FA 4OLEA 1G6VK 2CJSA 3N1MC 4ZAKD 1KT2A 4WNSA 2B4CL 4L3EB 1GRWA 3IF1A 2MNUA 4G9DA 2R0ZH 5EO0A 1RKRA 2A99A 3FF8A 5EU7E 4ODVH 3V9EA 1RJLB 1QO3B 4QRQB 1T0NA 3BWAA 5HDWA 5DJDA 4A39A 1LHZA 3EHBC 3CN4A 3V5HB 5CD3A 4H8WH 1BXXA 5DF0A 3CVHB 2O6FA 2JKIS 3IT8D 3QQ9D 4RFOL 1DZ0A 5DEFB 4F8PA 5LN8A 1SDYA 3MJ9A 4Y1AA 5IB5B 3TC9A 5I6LA 4N87A 4R9HA 3FSAA 4NQCE 4KY2A 3C6LC 3IFPA 1HEJC 2NXZC 5I1IL 2D2OA 4NUMA 1BM7A 3NT0A 3TO4A 3GUTB 1KSRA 3V2AR 1UXWA 3VXUE 2NNFA 1DFBH 2GJJA 4X8JA 3ULVD 3MA9H 4KO9A 5GRWA 4DGYH 4OD2B 4Q0XL 5ESVA 1CD1A 1PS3A 1ZRUA 1ZPUA 4FNLL 4F8QA 1OM9A 1KN4H 1RCYA 1ZA6B 3U0PB 3V4PB 1X5ZA 3QIWD 4JQIH 1ZVHA 4L3EE 5FO9A 4JJHA 4Z95H 1JGEB 2D3NA 4C4KO 1CYGA 1OT4A 2EC9U 3FUJA 3LH9A 4EIBA 4L8CB 5DFTA 4DP7X 4GT7A 3LHAA 4FJZA 3AGVA 4A2FA 1ZTXE 3QIBB 3OMZA 2PP8A 3MNZB 3P11H 3OKYA 5DDHB 4N8VA 5A1AA 3OJMB 4WQOA 4RMQA 4HUVA 5JDSB 4ZUUB 1FG2B 2YLHA 4I48B 1OGTA 3KXFB 3VAEA 5HGAB 3ZXAC 2A6JB 3QNYA 3TWYA 1TO5A 3GSNL 4MNHB 1RXLA 4L37A 4G71B 1KYOK 3VI4B 3KE0A 3HMXH 2D2CC 4D7BA 4FQQA 4ZJ9A 4J4PA 3B9KC 5FGBC 1Z5YD 5EBGA 5E8OA 4YDJB 4UQ2A 3JWDH 3FU7A 5K9QI 1A6AB 4XB8A 3B7UX 4JHVA 1G9EA 4WHCA 1A0QL 4KTEL 1ZVSA 3EG9A 3ULAB 2W9DL 1WC7B 1NOAA 4L18A 3Q8AA 3L9RA 4ZBJA 3PWVA 4W9FC 3UP6A 1HINH 3MX0B 4XP5L 1PGRB 3NJHA 4YBQD 2BSTA 2JK5B 4PW9A 3ZJAA 2QDVA 4X8XA 1WFOA 4LF3B 3A6CH 5CINL 4ZUWB 2CRZA 5HPMB 3BP7A 3SE3C 1R47A 3GEWB 4D3CL 5EZJB 1TIUA 1UADC 4AYFB 1EHLL 2NY4D 4WJ5B 1RK1B 2X6CA 2EEXA 2OK0L 3KXFE 4Z7WF 2DLFL 4ZMVA 2E76C 3N50A 4G2AA 1HK6A 1RUPH 4JUTA 1MFDL 3VI4E 5BZDB 5IB3A 1T7ZA 3PJSA 3ULVH 1XGUB 2R29H 2Z92A 5KVEL 2B8OT 3FAXA 5JXEA 1PLBA 5DJ8A 4A67A 5KSVA 3ARFB 1WP6A 4UZUA 5FUZL 3DC0A 4L1LA 1PG7L 5JW3L 1RLBA 2PF6A 3I9IA 5FCSH 1U8MB 2Y36H 1A6PA 2YO3A 2AQ1A 4RAUA 2C1OA 1GOGA 1UOWA 1I9RL 3V55A 3B2DC 4F7TA 3HHSB 3SPVB 4Y16C 4G7VH 2DKMA 2GJPA 3OLGA 3Q48A 2IAMB 5KTEL 3B7YA 3Q8CA 4I18A 3K8LA 3MGTA 4KDTC 3SCMA 1T5WB 1GR7A 3EDEA 1AQDB 1G6RB 3CSFA 1NUGA 2DQHH 4FMVA 5A2FA 2FQFA 1X9RA 1DBAL 2K4AA 1ZV2A 2QGDA 3M17A 2XETA 4MS8D 1ETZA 4F3FA 2Z8RA 2VDQB 3IDUA 3RKDC 2OSXA 5D55A 4AMWA 3CHPA 1AO7D 4H25B 4HF5L 2CLVB 1DUZB 4AYEC 1Z32X 4GW1A 4AIZA 1S7VB 3VFMB 4FNPA 4ODBD 2OMNA 4M3JA 4PJ8D 3ZKND 4RWYL 2JIXA 5FGCE 2HKAA 1LO0H 1JZFA 5C0BB 2BHFA 3LZNA 4C4KT 4MQ7B 3K0YA 3FO9A 3AADB 4JZNB 3TIDA 4PJ9C 4EJ1C 5EEXA 1HCYA 3MRIB 4HAFA 3MRBA 5DWUH 4YMPA 3L81A 4N4YB 3CHOA 3JV6A 3PWLB 4OZFG 1B0WA 6CGTA 3FQ4A 4Z3IA 1XD1A 2YRZA 2ITCA 5IVXB 3GMQB 4NPKA 4PJHF 4UOQA 4H20L 4U3SA 1T83A 5C08B 3EBIA 5JIPA 3FQWA 3LQMA 4RMWA 5E00B 3NTCH 2QMJA 1BECA 3VD0A 2EDWA 1MCWW 2WM0A 3LAFA 2OBGA 1G4MA 5T5NF 4JFVA 1CK0L 5GZND 3RVWC 4XN2A 3RWGA 4XMLH 1IQWL 4LKCA 2CIIB 4WKZA 5J1AA 1QFUL 4AK2A 4OLVH 4DW2H 2HRHA 3TJPA 5HGHA 1ZSDA 5C3TA 3T3MB 5F1IA 2GFBA 4OGYH 1A7BA 5GS1B 2H2SD 3O3AB 2ZOKB 5C8JB 1UWEL 1H5BC 2O61B 4WY7H 1RZQA 2X53A 3QYNA 5DRNA 2IQ9H 2NLJA 3SPIA 3KYNA 1OF0A 4KKLD 2X70A 3H6AA 5C0BE 4OW6A 3D30A 2KLTA 1S9XB 5SWSB 4QHKJ 1ADQA 4X7SH 3KL5A 4FQXA 3DX8B 1K4CB 1W8EA 1JMXA 7TAAA 4UOW1 3V0JA 2DQIL 3HZKB 3NIFF 1V10A 4XPAL 3G5ZA 2EEFA 4GKZA 4XMPL 5IVXE 3U4KA 1IKFH 4MQTB 1PEZA 4MJIA 3RPBA 1ZOXA 4N0CC 5C70A 5C08E 1H6FA 1ZVYA 2VQTA 3LHPL 2YPLB 4EUPG 1DQDL 3IB4A 4O5LH 3VXOA 3M1BA 1J9TA 3CUPB 3ZZ1A 1FIGL 4PJ5B 3B34A 5D7JD 5F7DA 1BX2A 5D1XC 5HI4D 3EXJA 4AUYA 3IMVA 5DCCA 4X6BA 2WSKA 3FB5B 3MFFA 3W0WB 1W8OA 3GO1H 4KQ3L 2A6DB 3QQXA 2B5IC 4LMQI 2AKRB 4OUUA 3EO9H 4NBYB 4YZFE 4RBPH 1A3RL 3T3ME 4TVSa 4I0PD 1FFPB 3H9SB 2PABA 4ICWA 5FECA 3U2IA 4RGOL 3ZKXC 1ZJBA 3L3KA 3NGBB 5IMMB 2ZCLH 4DKTA 3PNRB 3L4CA 5T3XH 1P0SE 3U83A 5DK0B 4OZFA 1NFDB 1XH0A 3FW6A 4JREC 1K6QL 1ZHLB 3ARBB 5SWSE 4ZZKA 3TEYA 1Q0YH 1WE5A 4ZMAT 1BYPA 1SXZA 4UU9A 2IGFH 3P0YH 1RZFL 2Q2EB 3PJLA 1A6WL 4JQXC 4AK1A 1ET5A 4IS6A 5FFOA 5KG9B 1GJWA 1UZ8A 4W9GC 4FE9A 4KHXL 5AOZA 2X4NA 4U33A 3DBXA 5GRUL 2NY5H 2Q5BA 4ABUA 4OI9A 1L5GB 2EKSB 3MJ9H 1M7IB 3MGOA 4GRMB 2YPLE 1PZ2A 1LO5B 2OXGA 1ZT7A 3RWHB 1NC2A 4M8QB 4LSSL 5I6XB 1OAJA 4G8FA 2KDGA 4HGWB 1FSKC 5EBWA 5I73B 3KWUA 4PJ5E 1JGUH 1NM9A 2QSVA 4G6JH 1WV7T 4X5RA 1T6VN 2DQUH 3UG3A 3UTOA 3EJCA 4HOWA 3W0WE 1MCIA 4MQSB 4IHOA 2J8UB 2ZICA 3MLSL 4QOKA 5JW4R 4X98A 4WWPA 1HOEA 4OFVA 2YAOA 5TE6L 1H9VA 2BY2A 4L0ZA 3H9SE 3N1FC 5JA8B 4Y9EA 2LU3A 2VJ0A 3F01A 2CLRA 4A2LA 4XVJH 4NM8L 3NZHL 5TFSH 3TA4D 2X0VA 4KPHH 3Q2LA 1BQLH 3VGAC 2ZUTA 1CFNA 2A9NH 1DDTA 5I1LA 3V4VH 1NFDE 1CFQA 1M9WA 1KTRL 5DUPL 4AVJA 4GRLB 4ADIA 5CAYB 4YGVA 4DVBB 3VRLF 3O3BB 1AR1B 3BSZH 2WQWA 1TJGH 1LXMA 2Q7NA 4YDIH 2V5TA 1O5PA 3N40P 1TYRA 3PNWB 5ESQB 1K8IB 4X6CA 1Z2KA 2NZ1A 2V7HA 2ZIDA 3MFGB 4XNYL 4EUPA 2APWA 1HJBC 1RAMA 2RB8A 1HZKA 3U30B 4P9HC 2CE6A 4Z7QF 4XO8A 3D3VA 2A4ZA 3S2CA 1UB5B 4AG4H 1G7HB 1GC1H 4E41A 4ZXBC 2WCGA 4EVNB 4URKA 2D0FA 1EXUB 3CFBB 4WHYG 3ZY7A 3KGRA 2VW4A 1H15A 1FFQA 4TVPH 1BM3H 2YK1H 1WHOA 1T0OA 2J8UE 3E9UA 4JFDA 2YAQA 5DK2B 3P02A 4GG6A 3OHXA 4GEIA 3F5WB 3VXMA 3NSJA 2J4WH 1S9WA 5HYFA 1J9QA 2KDYA 4R97C 3NABH 3VWJB 3ZMEA 2IPTL 1L7IH 1N9PA 4B0MB 1L3NA 3AM8C 4U1GC 3ZRFC 4OQTH 2Y2TA 4PJCA 4DTGH 1KEMH 2HG5A 2ED7A 4XCCL 3T1FB 5E4AA 4LCWA 1H8NA 2C26A 2VDLB 1W72H 4HS6A 3RNQB 3RVVC 4R0LA 4G6FB 1HL9A 4NZTL 1NEUA 4OZHF 5AKRA 1RZ8B 3S9DB 5EIIA 3K6FA 1MQKH 3LNEA 2ZAGA 1E7VA 1CLZL 2AXGA 1BD2D 4FL4C 3ES6A 4YNYA 4NUGH 2WQRA 4YBHA 5IVZA 4PBVC 4WO4D 3DI3B 1P6WA 2W0KA 3S3DB 1VEOA 4OBSA 3OZLA 4P8QA 1N2RA 2HH0H 5AB2A 4YLQT 4FERA 5BVPH 1TSHA 2WXHA 5I5RA 5DMIL 5TQ2L 5HJGA 2WTRB 1IAIM 4G5ZH 4UAOC 3I3BA 3B7TA 1RZIB 5FWQA 3VGFA 5JQ6L 3G6AB 4HWZA 1HXYB 4ADGA 1E4WL 5DJ2B 3V6FA 4Z3FA 1B4LA 2XPZA 1BBDL 4MLSA 1T20B 4GFXA 3LOWA 4NOFA 4B9PA 3ZRSA 4DN3H 5I6MA 4NN7C 1OW0A 1BZDA 1LO3L 3QUML 5D1ZD 1DSFH 1Z1WA 2OP4L 5JYLA 4YIQA 2HJLB 2X1OA 4MBOA 2QGEA 1ZGLP 4HW6A 5IGXH 4IGBD 1IILE 3QDAA 2LABA 3QO0B 4CA4A 3B5TA 1I7ZB 2O5YH 1CT8B 5EU5B 4AENA 3VFUA 2Y3AA 1QZ1A 1VFMA 1SZNA 2WP3O 3T8VA 2W0PA 5KVDH 3D8MA 4RX4D 4M7JL 1OGAE 1CQYA 5B3JE 5DWPA 4IBWA 3RIAF 3ZKMD 1U8NB 1XSKA 1JNNH 4N1HB 3WTYA 1MW1A 4N2OA 3K80A 4UMSA 1C12A 3LEXA 2HTLC 3JYBA 5C0IB 4HZ1A 5GRJH 1GZHA 2MQ0A 5KBNC 5BJTA 3QDGB 5EHFA 4MQXC 4ZDHA 3U7YL 5E7FA 3OGCB 1J18A 1CF8L 3L4VA 1NKRA 3RWJA 3HZ3A 5TF1H 3PL6A 2OI9B 4OCYL 2Q7YA 1R24B 5I66A 1DQQB 4EDXB 1MVFA 3NZ8B 5A40E 2YXFA 2F61A 5T33H 1BAFH 4PBXA 3S98A 2VDOL 3RX7A 3EHBD 5AB9A 5E1IA 3CZJA 4QR7A 1TU2A 2ZOOA 3V0HA 4NHCL 2OPCA 5ESAA 2DM2A 4S0HA 3CFCH 2GI7A 1QASA 2OMZB 3OB0K 4UUJA 1K2DB 5C0FA 3K0WA 4FXGB 5IQMA 2CHWA 4MMXC 2NNXA 5IQOA 1ZMYA 2KERA 3OV6A 4LSTH 3KWXA 1XF3A 1CXHA 1QUNA 2IMMA 3QFDA 4GQZA 3KCPB 2Y7LA 2E75C 4M00A 4YDLC 3U9PH 2YBGA 5JHLL 2GBAA 3C5SB 4P4KC 5L2KA 1ZT4A 1AMYA 1IQDB 4D9QD 2AJ3B 2X4UB 1EEUA 4Q89A 1NUNB 2AQTA 1BF2A 3ARGB 1S7UB 2QSCL 1ZAGA 2EH8L 3Q5TA 4Y8DC 2ZYSA 3WSQL 3AVEA 2HFEB 3HG5A 4F7EA 1JXGA 3QDGE 4FG2A 4DPBX 3GSXA 2ENPA 3MV7B 2VWEE 3BGFB 3IDIB 4G42B 4LLUB 1H3PL 4UBDC 3SOBL 3STZB 2F74A 5E1HB 1TVBA 5F3BA 1QHPA 2PPAA 3SYPA 3W81A 3IMUA 1KGYE 4U0QB 1CDGA 2AVGA 3ABKB 4X9HA 2VDKB 3OXRB 4YZWA 4A55A 1SVZA 1G9HA 4M5SA 3RVXC 5L88H 3KGUA 1PZ5A 3W11D 1FFOA 5IMOA 2V2TA 4UILH 4NDMA 2RAMA 5C7XH 1RZJL 4I0KA 1FO0A 5C92A 2R83A 1U6AL 2EE6A 5I15H 1OD7A 4JB9L 1OAKH 4JAMB 1XL6A 1V54B 3TCXA 3ZGIA 1YJDL 4GSQA 2HFGH 4N85A 1BIHA 4FI6A 4TPRL 2VXUH 3WJLC 1KYAA 4HUWB 1LE5A 1YNTF 4FCHA 3II2A 4KTDH 1M2VB 2Q1EA 2JQAA 4K5PA 4MVBC 5EEWA 1FLRH 1TQWA 1FBIL 1XX9C 2WKGA 4XX1E 1UATA 5ALCL 4DZ8B 3UPRB 1KFAL 1RPKA 3FOMA 3U4EB 4YK4C 3VSVA 4D0DA 2FGWH 3MV7E 2IADA 3CMOH 4PI0A 5LG1A 2BP8B 5L2JA 2BC4B 4PCKA 1CE1H 1HWWA 3E6FA 4EI5C 5FYKL 4LEOB 2WP3T 1JCVA 1ZE3H 3RNKB 3MUZ1 3QSKB 4PP1C 3RTQD 4W9EC 1U8QB 4B9JA 3D9AL 4N25A 4EO5A 3GXUB 2B0SH 4XMTA 4KMTL 3VI4F 1EK3A 5I75B 2VR7A 2WBJC 2DQEH 3QXUA 2DV6A 3DTXB 2DDQL 3E1ZA 4GKNB 2DIJA 1IC7L 1A6UL 2A5UA 3QDJD 1YNKH 4DP8X 2L7JA 5B21A 1HOCA 2AV1A 2K70A 1T0PB 3IK2A 3DUSA 2DN7A 1V3MA 2H32B 1XR8B 2HLFD 4XI5D 3BI9X 5CFAA 1KJ2L 2KLSA 3FHAA 2EVIA 4OAWB 3VSUA 4BFIB 1NGWA 4LGRB 1N70A 3S6CA 3RWIB 2ZOWA 1I3UA 1ZHNA 2HSIA 3O41B 3TL5A 1N3NA 2ENSA 3RBSA 1FFNA 2DB8A 2N01B 4DP1X 4HDIA 5E95B 2EYSB 1IT9H 2A9DA 2QZ5A 1YN7A 1CUOA 4G6MH 4XPFH 3EF7A 3FQNB 1KCRL 4PHXA 2WWOA 2YAPA 1N64H 1J48A 3RILA 4O02A 4JDEA 4K5NA 4E42B 1N6QL 1P5UB 2J73A 2VMFA 4N2MA 4ZPTB 2VQ4A 1JYNA 4JZJB 5SWZD 2MOVA 2HFFA 3LEVH 4LLDB 1GGYA 2V9UA 4OZGF 3BE1L 5HHOA 4APXA 1U4FA 5F9JA 3SDCC 5MI0B 1TYJA 2OXHB 3R06A 5J57B 4I3RH 4OF6A 4YS4A 5CIPB 4UQEA 2OKMA 2FWOA 15C8H 4D8OA 2DM7A 5DHVA 4MB3A 2GI0A 4G8IA 1J12A 2AXJA 5HHXH 4Z3JA 2X2IA 1HYSD 2FX7L 4JCLA 4ZPVB 5H35B 2WZAA 2YA0A 3NQKA 1TQUA 4LPVA 1CXIA 4NZDA 2EIMB 3IWUA 2Z31C 3QUZC 5BXFA 3JWNC 3U4BL 3S88L 5I19L 3TNMB 3O3UN 5FKPA 2WB7A 2VLRB 1YYML 5D7KE 2H1LM 3TS8A 4NRYB 2IFGA 1O0VA 3KHOA 2F54A 4KZ0A 5HHPB 1OQXA 3O4LB 1MJJB 1T2XA 3QJTB 3KVQA 3UJJH 2IH3B 1D5IL 2EO9A 2I24N 2OJZL 3UTTD 5AVYB 2K8QA 5BZXA 4K71C 1DZBA 3DSFH 4TLSA 2XXMB 1CU4L 1UXSA 3RVWD 3KPQB 4BWTA 4FFZA 1V3JA 2Y1AA 4DEPC 4DOHB 1TPXC 5E4EC 4DIXA 3L9BA 4WHDA 4YSTA 1S5IL 4MMYB 5HYJD 4HCIA 1F11A 2WLLA 5HDBB 4AGPA 3OAWA 3ARDA 4PWIA 4LQFH 2X9WA 3SQBA 1PJWA 2YAEA 2ADIA 3FQRB 4X6DF 4EN3D 2DEXX 2YJLA 3RTLA 1GS7A 5J11B 1T5XB 1JFHA 3D0LB 5K93A 1E8ZA 4S0SD 2VLRE 3DXAD 4FZ8L 4NM4L 2UUDH 4XGZA 5AYQA 2WLZA 1XGQA 3KCWA 1H0DB 5AALA 2PO6B 4MJ6A 3SPGA 1RIHL 5DZNA 1P69B 2RCSL 2BRQA 1FVDB 1HWHB 1DDHB 3Q5YA 2IH9A 5FYLL 1AGCA 3CFKA 3TNNA 5BVJA 4W6YB 3ZTJH 1KB5L 3KL3A 5I1KH 3K1DA 2F8XC 4KJPD 3O0LA 3ZN6A 4KKBD 2Z1KA 5D6DA 1JPSL 1A6ZA 2F6AA 3B1UA 3C5ZC 3CJJA 1Z5LB 3QEQD 4G70B 4P59L 4XPBH 5I6PA 5M94B 5ETUA 3RJDA 2OQJA 1MLCA 2XNAB 1GTNA 3Q2VA 4WHYH 4DOHE 4HU2A 4BZ2L 2BPBA 4PJIB 3I3EA 5DA4A 5ENWA 4MLIA 1K5NA 2WUCL 1WFIA 4XPTL 2CZNA 3DETD 4UTAA 4BKTC 2XSKA 3TCTA 4LCIL 5HDBE 2FNWA 1TO4A 3CDGA 4UT7L 2R23A 2ZT9C 3N43B 4MKMA 2WGNB 2YQ2A 2AK4A 4YXLH 1YECL 4QHKI 1OWWA 1JZ3A 4HXBL 1DQJA 1F6FB 1O7DC 5DRXA 4CW1B 1T7WA 3TWCH 1FZOA 3OLEA 3VI3A 4NRXA 3VXSB 5A2AA 3T2OA 3HUJF 4MAUL 3E8UH 1JI2A 4RISH 1RL1A 5E8NB 5A6LA 2QTVA 4JNXA 2G0LA 1U8IA 2FZ3A 5IMLA 3JTSB 1MFEL 4Z7OB 3TT1H 5E6IB 4IBUA 4FQCL 4QXVA 3WNJA 5I16A 4E9LA 5IW3A 3EO0A 3D50A 1E5CA 1RJYB 1F41A 2BSRB 4AEFA 3GEFA 5CCGE 2B1HL 1R19A 5L7XL 1PBYA 2RMNA 5IW6B 3QUXA 3L3IA 4NRZA 5FM5M 1VGKA 1CB4A 2KC0A 2V8MA 5D7HA 3A0OA 1QRKA 2K7PA 1R5VB 4IDJL 5F44A 5KVGE 3T1WA 3G5XA 4G3YL 4PJIE 3LNGA 2LQRA 5MEQB 3TBYA 5GS0L 4UB0L 3CCHB 4GRWB 3GRGA 3MLZL 5TQ0H 1NSNL 2V33A 4Y19A 2G2RA 5KS9A 1HKLL 4IMKC 4PY7B 3ZTEA 3TA3A 1JP5A 4PGDB 1GKEA 1UD3A 2PPCA 5DUML 3C6SA 4LCYB 1CI5A 1OCWH 1XGRB 5C0RL 5IHUH 5JNYB 2PP9A 1DQLH 1UT2A 4XB7A 3SJVA 1S9VA 4XBPA 1QWUA 2JF1A 1HXMB 3ISWA 2BWQA 3QAQA 4WDIA 1JZDC 3NSFA 3QHZH 4QF1B 1MH5A 1TJHH 4HZAA 4Z7OE 1WZAA 2R0WH 2WJ5A 2JKTM 4PS3A 2AABL 3VFGL 2CHDA 1UGNA 3NH7H 3PPEA 3QJQB 4MAYC 1IVTA 2X4QB 2V3DA 4OFKA 4YHKL 5AQ0A 3U46B 1ZEAL 3ZIMA 1WCBA 1SPDA 4CKQA 5C2BH 1E9QA 1JOIA 2J88L 3GJFA 1UVQB 1AXTH 1UJ3B 3DX6A 2B1OA 2PCFA 1R3KB 5FGRA 2EDBA 3BAWA 1MFMA 4U1HB 4GXFA 3WHE0 2E27H 1M71B 4F2EA 1QLEL 2NY1D 1R3IL 5IJKA 2QHRL 4TUKH 3CD4A 5BZWB 4QRRE 5IF0A 4GRWE 3HPLB 3FFDA 4KUZL 1MG3C 3GYRA 5FYJD 2HMIC 2W9EL 1E6JL 3MLRL 5F1OB 4PGJA 2VNCA 4JM2D 4NWTL 4XNQA 3TV3L 3RVVD 4D8PA 1KXVA 1G1KA 4KKZA 3TFKD 2HJFB 3BMWA 3OL2A 4AQAA 4AV5A 1YY8A 3C60D 4OKDA 1AZVA 3G5VB 5H94A 1LE9A 3MV01 4ABVA 5TTRA 3LH2L 3VB8A 1OAUL 2R8SL 3L6FB 1GIGL 4Q14A 3K4ZA 2LFGA 4XE5B 2GSIA 2XN2A 4Y1SA 1SMOA 4IOIB 5EU7C 3FT3A 2ZXGA 3T0EB 2ODHA 2YSTA 3QR2A 1A6VH 2VSKB 5D4JA 1BF5A 3KPRD 4Z3HA 3KVDD 4OM0L 1BVKA 3M45A 2AEOA 2CGRH 3MXVH 4H0IA 5BRPA 5FKAA 3BEVB 5DU7A 5HGDB 3FHQA 1DCLA 3WGUB 4EPSA 3AG4B 1E50A 4DNLA 3BAIA 4YLBA 5ECGA 1HI6A 3O2DA 2ITDA 3UZVA 3X17A 4GS7B 3H53A 3QORC 1T2JA 4JFSA 2CKNA 3PF2A 4KKCC 2IWFA 3OG4B 2NOYA 2OJ1A 4JFFD 4PW3A 2P1YA 4JDTH 5D93B 1F58H 4H8HA 3WIFA 4FQHB 5B3JF 4KX9A 4LLVB 2P8LA 4NP9A 4TUOB 4G43A 1E3FA 1SMAA 2QEJA 3MNMA 5LN4A 4KXAA 3L1FA 3OG6B 3OKNB 4JGUA 3ZDXF 3FFOA 1S7RB 3BKJL 1GY2A 3HZVB 5INCA 2ZZUT 2Z93A 2PYFA 4GP8B 3LTVA 1SN5A 4JPQA 4QHLA 2Z65C 3GSUB 5LLIC 3VFPA 3FTSA 2XFGB 3LV3B 5ID0B 1KPVA 1M1XA 2OSLB 3F7VB 3Q1SH 4UTBL 4XBEL 3T0EE 1JGVH 5DHVH 1DVFA 1EEYA 1J10A 4JZOB 4NQTA 4PCSA 2HLAB 2YOAA 4WWOA 5D70H 5I23A 4EKJA 5D7SH 3IDXH 3PAYA 1E4KA 3QG6B 4HUUA 3UP1A 3ASWA 4BEIA 3DSNA 5DLML 3DECA 2R15A 3QQ3A 1NIFA 3WTUA 2GJRA 2FL5B 4K5OA 2ZG1A 3OKLA 2HLEB 4OB5L 4BDVA 1NGPL 1UUSA 4ZS6C 2GUOA 1S5HB 2W91A 1BEXA 3UX9B 2GYSA 5KYXB 1X9UA 4Z0XA 2V4LA 3KYKH 5D6CA 4G5AA 2WXIA 3DHUA 3ZKSD 4BQ9A 1BF8A 1OLLA 1B2WL 3BLPX 4G8AC 5EFIB 1A9BB 2ETWA 1SOXA 4FN0A 2WB1A 1UZGA 5DQDL 2FEEI 4MRCA 5BQDA 4QAMB 4BE6A 4WNQB 3V0DA 1MDAA 4H4NA 1J1PH 5JQHC 4FFZH 2AJXL 2Y7QB 1Z9SA 3U7WH 2ZXAA 4YGAB 3RHWF 4OCLC 1AJ7L 1KTDA 1R1CA 2XXCB 4H8UA 1O9VA 4R4FH 3WO4B 1EHNA 1IGML 3GHPA 3MSPA 1P53A 2QFRA 3GTNA 3QIBC 4RZCA 2BDNH 3H7BB 1ZLSH 5JOFA 4OI8A 1XB3A 4RMBA 3EDDA 3H7LA 2RBLA 1R3JB 2OZ4A 1LDSA 3LKQB 3T09A 4TNFA 5LDSA 2LFEA 1GGCL 3ULUE 4JCMA 3H2PA 3W3BA 3VM5A 1PTZA 2QQLH 2X6MA 1FL6B 2FBJL 2FYYA 3LXUX 3DIFB 3Q3GB 5F97E 1N68A 2ZOLB 3MR9A 1GGIL 3KPLA 1U8OA 2YPKB 1WEJL 5DO8A 4P5TB 5MP6H 1NBYA 2DZEA 1MCPL 2HUHA 4L9LB 2X3AA 3VFOB 4HG4J 1FNGB 2GEEA 2IPKA 3LRSB 3HZYB 4YH6A 3TO2B 3UAFA 1DEEA 1JPST 4B41A 1QR4A 1MFUA 5IFHL 1ZS8A 2GIXA 3QG7L 3RB5A 4FF9A 4KVNH 3HMXL 2UY7B 4UQIM 5I0VA 4J3OF 5CLXA 5HYIA 2QR0A 1CGTA 4PP2B 3LKRB 2EIZB 3PV7A 1BYOA 3SY0A 4AQEA 1HH9A 3L4YA 5JPMC 2OV0A 3BO8B 4H1LB 1ZLUK 2UWEB 3VD5A 1MFCH 1IGIH 1LQBC 1PZDA 3LX9A 1CBVL 1YUHB 4V2BA 3F85A 2BSBA 1J05A 2F19L 4QTFA 3RLSA 1X7TA 4B0MM 3VW3H 4XTRD 2UZIL 4LXFA 4PP1D 5CLTA 3GMLB 2AF2A 2A83B 3I6KA 5MEOB 4XHQA 3BXNB 4ANKA 3G9AB 4A04A 2CRMA 3Q06A 1PIFA 4JR9L 3QNZB 5JORB 2H7WA 3ARFC 2VW6A 3MYJA 5EPMB 25C8L 3NIDF 4Y4HB 1IC5L 5GGRY 3GZOA 1QYGL 3UL4A 5FF6B 4BSVB 1V7NH 1MUJB 1AFVH 1MRCL 4KUCF 4YXHH 3QR0A 5I17A 3AQZA 1CBJA 4YVNA 4LP8A 2VXQA 2EUWA 5GZOD 4ZMZA 5CHNA 1MWAH 3CDYA 3CLFL 1FYTE 2IAMC 1BQKA 3HLAA 2WVVB 4PB9H 3MV8B 1IGJA 2C3WA 4PS7A 3LS4H 3W9EB 1KBPA 4GBXB 1RZ7H 4IRSC 4PUBL 5EUOA 2OMVB 4ES9A 3SDAA 5GGQL 2CJUH 2OMXA 3QIUB 4WIQA 2HPOA 2GVYA 3QPXL 4CGUB 5LDUA 3JWOL 2UWEE 1XCWA 2XU9A 4BM7A 3RIKA 1EGJA 1F3DJ 1XCQB 3ERXA 3MCLH 5B1CA 2ITFA 1K8DB 2J21A 4JPIB 5I0ZA 2OMUB 1OAYH 1QRNB 4HEPG 2E7BA 3CDZA 3BUQA 3FTWA 5FM8A 5LO7A 4IU3A 3SDCD 3WJMB 3WNKA 2MRYA 3FONA 4L1BA 4K94C 4PRNA 1SOQA 3EH2A 3D0VA 4UDTB 5EWIH 3I9GH 2ICWI 2DQHL 3P54A 2I07B 5F3HB 1T6BX 3T0XA 3BPNB 4QYOA 4L8SA 5F7AA 5CSGA 5IP4A 2X7LA 5LKNA 1DQIA 2PCPA 2X42A 3ESNA 3GS7A 3IJHB 2WUBH 2DWSA 3ZHDA 1C9SA 1QLRB 3PJNA 2DQDL 1PDKB 2Z31D 3WJJC 4G82A 2F5BH 4RMUA 3FF7A 4PYGA 1FNSL 1G7LA 3CK0H 3GJFH 4HIXH 5BW7C 3US9A 5L9DH 2I27N 4TQ8A 3PWPD 1KC5H 2ZCZA 2VLLB 1OAXH 1QWHA 3LVTA 2D3JA 3MV8E 1LO0L 3BWUF 3D51A 5FFGA 1HQ4A 3GJEB 2A74A 2X4OA 2B1AL 4HOZA 1OIOA 3QZOA 1KYUA 2OTUB 5GISH 4L4TB 2P4AB 2H41A 4KRMB 3FQTB 2RFXA 5DWUL 1KGCD 4KITB 3E6HB 1CTMA 3QCUH 2A77L 1V55B 3WOVA 4B96A 3FTYA 3RQ3A 1WIOA 4KO6A 2XACC 1H3XA 1AO7A 1QR