4B60A

Structure of rfnbpa(189-505) in complex with fibrinogen gamma chain c- terminal peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
309
structure length
299
Chain Sequence
TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEGYTLTWDNGLVLYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Cell adhesion
molecule keywords FIBRONECTIN-BINDING PROTEIN A
total genus 72
structure length 299
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A02
4B5ZA 2YLHA 2Y7MA 4F27A 5CF3A 4JDZA 2Y7NA 1R19A 3AU0A 4FJ6A 2F6AA 2VR3A 2RALA 4BBWA 3IS1X 3V10A 1N67A 2Z1PA 4JDZB 4LEBA 4LE8A 4F20A 2Y7OA 4MBOA 3IRPX 4JE0A 4MBRA 4Q6KA 4LEEA 2Y7LA 1R17A 4B60A 4F1ZA 5IHWA 2F68X 4F24A 3IRZA 3ASWA 5CFAA 3AT0A 4RMBA 3IS0X
chains in the Genus database with same CATH superfamily
4XNZC 3CU1A 2P48B 3SKMB 4LXFA 5JNYB 5I1GL 4BCZA 2C3WA 3X2QB 2O93L 4M5ZL 4RFOL 1A3ZA 5TQ2H 1PG7H 3MRPA 4LLMB 4A1RA 4EBQH 1F4AA 5ICZB 3OX8B 2EDRA 2M8XA 3QC5X 3IDXL 3WUWB 2HJLA 2QLYA 3WNIA 2SEBA 2GJZB 4LEEA 3GJFA 4A63A 4WWKA 4RA3A 1FL5A 3BX7C 1KT2A 1AO7A 5BRPA 1L4IA 1BQHB 2A9NL 2J6EH 4BSJA 3K2MC 5DK3A 5GGRB 3QEQE 1W15A 3IJ9A 3OLEA 4KKCC 2W9DL 1ZHNB 5FO9A 2Z35A 1DBMH 4N8VB 4RX4D 2ITEA 1P4IH 4HWBH 4F7TA 2ZOKA 1EZLA 2NZ1A 3PGDA 3CFDA 4ODTL 4UUJA 4CSZA 4GI9A 3FAXA 4PRID 1OB1B 1KGXA 2CR0A 3HVNA 2DJSA 5G4MA 2AXJA 4PI2A 4GUOA 2OCCB 3GSXA 3FQRA 4U49A 4XHQA 5C0CB 3RWIB 5INCA 5D70H 3TZVA 3WNKA 2GBTA 3P30L 1IAOB 2D0HA 4L29B 3V6OC 4BEIA 1BHGA 3V0VA 4P23B 1UM5L 4MLIA 1BF5A 5JXEA 3U9PH 5IB1B 3AT0A 1BQLL 2X5PA 2R0KH 1YSOA 5KBMA 2XRAH 5E9DE 1LO4L 4UYQA 1A6AA 5HJ3A 2ATAA 1AC6A 3WO4C 3BQVA 1HXMA 1UWGL 1TZ8A 4ELDA 1G1YA 2IPUK 4KRMB 3NFPA 3DX3A 2BZCA 3EH4B 1KXTA 3VACA 2B4CL 2OTPA 4L37B 3PGCB 4POUB 4Y16C 4BFRA 2X4OA 2W9LA 1P1ZB 3PWJA 3NCBB 4H26B 4NZRH 1Z3GL 1MJUL 4KVNH 1MWAH 3V0EA 4EN3A 1BWMA 5L8LB 2OULB 5JHLL 4JKWA 1F4HA 4F33A 3MRLB 1VFBB 2WBJC 2YD5A 3HCVB 5TQ0H 1TYRA 2DWDA 2HVJB 2N0KA 3L95A 4B3EA 1GMEA 2JELH 2L7JA 4BCYA 3MBEB 4ZX4A 4N90E 4QTHB 4ELME 5DUJA 1A0QH 2GJJA 2HT2D 3KPLB 4LSDA 1G7IA 3HB3D 1CL7H 3AG4B 3T6ZA 4Y4HA 2ZJSL 5FM4A 4PI0A 1R5VB 1UEYA 3ASWA 1M1XA 4RGOL 3IU4L 3GHBH 4FXKA 1WZ1H 4YSUA 1SQMA 3CSPA 5DQDL 3GSOA 4QXTB 1P7QB 3R4DA 3FMGH 3NYKA 3L4WA 3RUGF 3ZJAA 2F53D 3HUJA 4X0NA 1MFNA 3CFQA 4NHUB 4QRUA 5D7SL 3JUZA 3QUZB 4Y9EA 4Z3HA 1DUZB 2R7EB 3APCA 1A4BA 4OKDA 1TUPA 2OYMA 4NUJA 4UAHA 5F44A 1UB5B 1QFWL 3QO1A 2PMZA 4NQQA 3L3HA 3WAKA 4NM8L 1HI6B 3LEXB 3FFDB 2W80C 3TFKC 2VRAA 1BREA 3TF7C 4RMBA 1FFQA 2YWZA 1PVHA 1UG9A 4U6TA 3QR1A 4L3CA 4LCYA 3FHQA 1RHFA 3EJUA 5H8DA 4LLVB 5G2NA 3CDYA 4XCNB 3T2OA 4WSGA 3ARED 4FHBD 3TIDA 4JPKH 1G0YR 1SM3L 1T4KB 2OW6A 4UNVA 2NY3C 3I50L 4XN8A 5AVUB 4E42A 1JK8A 2VW7A 5IJKA 4AKPA 3K74B 3QNXB 4HUUB 1L6XA 2AK4B 1JRHI 5PCYA 1Q9LA 1RJLA 3CPLA 3KE0A 5JHLA 3BUYB 3DARA 4YO0B 1FCGA 5IQLA 3MNWB 3QXAB 1NC4B 4KX7A 3ZY7A 1KZQA 4HC1L 3U9PL 3WV0A 5EU6D 3QO0B 2X9WA 2XQBH 4LLWA 4UZUA 4IRZA 5SX5K 1MW3A 4LRNL 1XIWD 1NMBL 3IKKA 5EU3B 1U8LB 3MN8A 5AW2B 4H0IA 2LGNA 1M9SA 4NQSA 5T3XD 3SE8L 3HE6B 3VFNA 3VFUA 2QVFB 3LNFA 4Z5RA 2JKSA 1I85C 2PR9A 1PCSA 2Q2LA 5JXEC 1TXKA 4KJWD 1MF2H 2NW2A 4WRLA 2A9ML 2CCVA 1RH8A 4KNUA 1DVTA 2QQKL 3PRZA 4YWGH 4QRTB 5HYEA 2GSIA 2Z0BA 4ODVL 3GT6A 1MFVA 3ILQD 4M7LL 3QR2A 3BWAA 5A40E 2Z7WA 3IMSA 3B2UD 1NCTA 5AQ0A 5C6TH 4ZPTB 5DURD 1YEKH 4TUUA 1SXCA 4UAOC 3OKNA 4M62L 4PP2B 4YNYA 3BP4A 1HWHB 2YO3A 1M6UA 1XXFC 4M7JH 5C09E 1A6PA 2X70A 4PHZA 4NN6C 2ZP0T 4AENB 1WRFA 5KW9H 2EH8L 2HKAA 4GJTB 4UDUB 2ILLA 4HPYH 5CMAB 4AZUA 3NJGA 1G1OA 1X5YA 1ZXQA 1J0YA 1A3RH 2ZNWA 1BFOB 3CNKA 5F1NB 3G5YA 4LL4A 3WFBL 1S7SB 3C6LC 3LKSB 3VGDA 4GG8B 1E4HA 1WZLA 1CDCA 2CLZB 1ZAGA 2OJZL 1AVAA 3E1ZA 4WW2C 3KVDD 1C5BH 3B9KA 2VMJA 4J3WA 1JWSB 5EA0L 1TSRA 2BIIA 4ACTA 1P9MC 1HC1A 3RWHA 3ZTJG 3FQNB 4LGSB 4PB9H 4QTHA 3QEHB 2E8ZA 4DZBB 2MNWA 2IPUG 4AYSA 3LIZH 1RY7B 1KJ2L 4G9FB 4KY2A 4ZYKA 4HC1A 1SVCP 1SHWA 3TA3B 2MCPH 4F8PA 1BD2B 1IGML 3OAWA 4M48H 4F7MA 2WTRB 1JG9A 3AT8A 4BSVA 5C0FA 4P3DB 4U33A 3FU7B 2WMPA 5FFGA 2EXYD 4PM1A 5DO2D 1Z32X 2F19L 4EO5A 2F1BA 3C5JB 1O9WA 1IAII 2PCFB 1A6VH 5BV7C 3BRGC 5I2IA 3CQFA 5ALBH 4NYLB 5LQBH 4TSAL 4Y16D 5GRVK 2EIZA 4FEIA 3NJJA 4UIKL 2AJYH 3U9UA 5D1ZB 2RH0A 3FOLA 3QNZB 4OD2A 1AP2B 2VIRB 4LCCB 1MFCH 3W0WE 4GRWF 3UOAB 4N8VG 1OQXA 4IKNA 4V2CB 2OR9L 5DRZB 5I15L 3R0MA 1QW8A 3STLB 3VFMB 5IB1A 3MUY1 2P26A 1TMQA 4E9VA 1QHQA 1HIML 4J3OG 5JORA 2X2YA 1L9PA 3ULUC 2KDYA 1RQ5A 1LHZA 5H37H 4GKSA 4LKCB 1AQDB 1TQTA 3HE7B 4N9GA 3LKNB 3DVGA 1IE4A 3HRZC 3VG0L 1OCWH 3LZLA 1QYGL 3BHBB 4JHWH 1TZAA 3D4ZA 5FDWA 5JR1H 4AYID 3GLAA 4F7TB 4N6QA 1GGTA 3U82B 3UJJL 2HUEA 1MHHA 2EDHA 3RGVC 1U41A 3ARSA 3D09A 4BQBA 1HVXA 2YOCA 3U79A 1I3UA 4LMQE 4N68A 4HUVB 4L1BA 1HZLA 1EGJA 1A65A 1MFEH 2Y3AA 5F2FA 4CAGA 4OD1L 5SWZD 4AVHA 2P80D 4WWKB 1GOFA 1HOEA 1I1CA 5HYJA 4G80B 4PHXA 1RIUL 4G9DA 2AEQL 2CLRA 2HG5B 5A2FA 3GRBA 4X80L 1OAUH 1PYWB 5CEYB 1KBGL 3MJWA 5C8JB 2BW4A 3CN0A 3KBFA 5FM8A 4K7PY 2XBTA 4L3ED 5FO8B 2EH7H 2WMPB 2BO0A 2H45A 4YHIB 2NY3B 1PLGH 4JPVH 3Q06A 4IRJB 1BQHG 4GRLC 1RUKL 5ACMA 4L8DA 2I60H 4LL9A 2DD8L 1WS7A 1BXUA 2J4WL 3GBLA 3RURA 4OJDH 1GIGH 1UACH 3BP6A 4ZO8A 1V3MA 3QISA 3U9UB 1KJMB 1JFHA 2EUWA 3E9UA 3QXDB 2N1TE 2XV6B 5I66B 4QTIH 1DO6A 5JUEH 2PO6B 2BSDA 1R17A 1RVFH 2CGYA 2QPFA 3FTZA 4RDQF 3TPKA 2GTQA 2G3MA 2J2ZB 3NJNA 4YHYB 3ULVC 4XVUD 2N7BA 1I7RB 1XIWC 2JNZA 2UWEF 5EN2A 4HPOL 4JJOA 2VJ8A 3DRQA 4QDGA 4E41E 5D4IA 5MP6H 4M4RB 2Z8WC 3RA7H 1FBIL 3GMMA 1OAJA 5TH2B 2I27N 1MFBL 2WQRA 2EDDA 5A2LH 4W9HC 3VE0A 3B8SA 5JXED 3HB3B 2XHNA 3P77B 5A6IA 4R2GB 2YR3A 4E5XA 3TCLB 1URIA 4H2CA 1OSPH 3U6XS 4WEBL 1WSST 4OAWB 5DUML 5TDOB 1SOQA 3BKML 3ILQC 5ALCH 1S3KH 4HWBA 1K4DB 5GXBB 1B0GA 4GXUM 5MEPB 4F58L 2Z34A 2W0FA 4FAAB 3BUIA 2K1MA 4FP8L 5K9JH 4BQ8A 2WBJB 1FAKT 3RVVD 3HFMH 2KBGA 1XZWA 2GBVA 4LAQH 5CN3A 3IGUA 5KVEH 4QHKI 4PSRA 5TQ0L 1OOAA 3GEFA 2RFXA 3TA3D 1K9TA 1QNIA 3CXDH 2I26N 3GHEL 1SXNA 5FUZL 3ZT7A 3ARFA 4GI8A 2J6WA 3MBWA 4PG9B 4GMTL 4PJFF 3ULVL 1G94A 3V4VB 2VLKA 3IDJB 1Q9LB 1RJLB 2VJ0A 5DFAA 3VFWB 3IU3A 1P7KB 2X4RB 3P3SA 3LJ3A 2DQEL 4ZMQA 4XHJD 4R2GD 1N0LA 5I28A 3IVKB 4R5XA 3VMOA 3VWJA 3L2NA 3OLGA 3X1FA 4Y9GA 4GW5A 4N2BA 3WN5B 1NGYB 3X13B 5JHBA 1DQJA 4WK2B 4WWPA 4XGZB 1IILE 1E5CA 1G9MC 1E9OA 4WI4A 3RZCC 5ABZA 4DHLA 5HGAB 1TJHL 4HF5H 3IJYB 4JRWA 2G0LA 1BFOA 3W9DB 4NKMA 4Z0XA 1NMCC 2FYYB 3LHPH 2OSWA 3PF2A 2QMJA 5K9KA 4LIQL 1P4LA 5H2BA 1QKZH 2YQBA 3QNYB 5DWPA 3UYPA 4KZDH 4XBMA 4Y1AE 4BH7B 2C9PA 2JKLA 2V17L 3G5VB 4WWNA 3MNVB 5FPIA 1AIFA 3P9WB 3JQOB 2LFEA 3BZ4B 1MWAB 3N42F 5C0BB 4UQ2B 3RWGA 1QBML 4GRLA 3QZWG 5FOJA 1WFTA 4MMYB 4Z6AT 2VABB 4K7PL 3W57A 3QHTC 3FT4B 3UDWC 1VSCA 2QTEA 4PJAA 4CILA 5JHLH 2QQLH 1AR2A 3SJVA 5AKVA 4I0KA 5CINH 1U92B 3KPLA 1IX2A 4JG1H 1KTCA 4HT1L 5DDHB 3UAFA 4BZ1A 2NW2B 3MLTA 5DCCA 3KW7A 3N1GC 3ETBF 3IDGB 3FTSA 3O2DL 1HSBB 1Z9OA 3PUCA 4J6IA 4MLSA 2WQSA 4XGZA 2UUDK 1E67A 3VI4E 2DQDL 3K6SA 4KJYB 3SE8H 2NY6D 4R4FH 3WTTA 4H8PA 1W2KT 4LIQH 2XY2A 3UTPE 5KSAC 2XKSA 1QSEE 2GFBB 1HHKB 4H40A 4ODHL 3LHPL 4XP9H 1UWYA 1DFBH 1CR9H 5GGSA 4NFCA 4U1MB 3N0PB 4GIPD 4DUVA 5ITBH 5IFJB 3MRIB 5LGJA 1OPGH 2UZIL 2XXGA 3GUFA 4WLCA 3QDJE 4GY4A 1C16A 2XV3A 1WYJA 3IAPA 5C09A 1OSZA 4LGRB 1YY8B 4F8QA 3T8MA 5E5RB 2WV3A 4KXBA 2AC0A 5L4MA 1AZNA 1S9VA 4W9ZA 1HHHB 5E8PA 2D2OA 2AKRB 3G3LA 3H6JA 5CHNB 5EOQL 1EJ8A 4N5ED 2R2HB 2C7UB 1HU8A 4CMMA 1WD9A 5DJZB 5DLMH 1R47A 5D1QA 4NQXA 3K6OA 3DBXB 4X4ZA 1VCAA 3LX9A 3SE9L 1JPGB 5FHAL 3AQZA 5EO9B 4GEJA 1ZGLM 1IFHL 5FYKL 3UCQA 3T4AB 3BE1L 3AS0A 5D96B 3NCXA 5I18L 2XWDA 3GI8H 4BZ1L 3C75A 4HIIB 5DZAA 1TFHA 2G5BA 2N59A 2E76C 1NSNH 3FB7A 3OAYH 2I5YH 3IDIB 5C1MB 3OTTA 3WO3B 3P11L 2J8HA 3QRGH 1FNGB 4PRPE 3SO3B 3OKMB 1AXTL 2D7PA 1W0VA 4RFEB 3IK2A 4YDJB 2QVKA 2FEEL 2NY2B 3O6FC 1QR1A 1S6NA 1JZ3A 3NFSL 3O6KH 5I75B 2E9IA 2JELL 3QB7C 5AWNH 3K4DA 3AQYA 3GBML 4U1GB 3FCSB 5KOVC 5A7BA 2X2HA 5LGYA 5H37G 3I9PA 3HBQA 1XGYH 3SEPA 4GUPA 2W65A 2XIIA 3L54A 1SOXA 5FHAH 4LLAA 4MQXC 3CLFL 2KC0A 3K71B 5EOCL 3V52H 5JQ6L 3CDZB 5H37A 3PWUA 4CVWA 3HRPA 3GSWA 4ZW5A 1BPLB 2EZ0D 3ZDYB 1EERB 3MJ8B 1U8NB 3PPSA 3TBYB 5I75C 3H4HA 4L4VA 3CUPB 4E2OA 5T8IA 1N6QL 5LDUA 1CI3M 4BGLA 2BS8A 4M7LT 2X4SB 4JW3A 4JLRA 2X28A 5IJKC 4NOBA 4JN2B 1G7QA 1HL5A 1A9BA 5EUOE 4GQPH 5DURB 4PRPA 5LBSH 2XIBA 5E23A 1WIPA 1QSEB 3GEWB 3D18A 2ZD0A 4JFDE 3UBFA 1IARB 3V0FA 3VJ6B 1KCBA 1XEDA 5JPNB 3HLAA 1T7VA 2CKBH 4F7MB 2LE9A 3S36H 3JXAA 4YBQC 3IDNB 2C9QA 4PPTA 1GY2A 1ZSDA 2DWEA 1H0DA 4FOMA 1HZKA 1A1MB 5IEHA 1QX1A 4BFIA 4JE4B 4R83A 1J0JA 1U3HD 2MWCA 2VMFA 4PJ9A 1MDTA 4PD4J 3RNQA 1H6FA 3L4CA 4ZD3H 3ETSA 2VAJA 2F0CA 4Z18A 4G6ML 3P77A 2WQAA 4E9QA 3CU7A 2K70A 2HMIC 1YY9D 5AVSB 4IGBC 1HH9B 4K2UL 2BP0A 1UJ3A 2XBZA 4DIXA 4ABWA 1FFOA 4FX5A 1EVUA 2AJVH 2WCPA 1DLFL 3IJSB 5FM5O 5CCKL 3LD8C 4N1CA 2YD8A 3IWUA 1M4KA 4PJHB 5IHZB 2Z92A 4FLSA 3EFFB 1AQMA 3IJ8A 3QA3B 4OCNC 5GRJL 2VL5A 1G7QB 4R90H 8CGTA 2R1WB 2DKMA 2HTLC 4JM2B 4OF8A 3DA0A 2H32B 3NCFB 3KYNA 3H9SA 3QC6X 4NRXB 1EHAA 4XBPA 1KYAA 4CNIB 2AMUA 1EHKB 3JZ7A 3KH3A 3KBPA 5G4NA 4RRPG 1GS8A 1K2DB 2R0ZL 5KVEE 4HIHB 1AHWA 2VXQL 2PPFA 5F7DA 2KHAA 1ODAA 1JZHA 1H5BC 1XGTA 5FYJH 2P3YA 4TTDD 1BF2A 4FI6A 3ZKNC 2XNAA 3NTCL 5DWUL 3PE9A 4TQHA 1I8KA 2IDQA 3ARGD 2AEQH 1R34A 4ATWA 1XBDA 4DGWC 5A6MA 3KLKA 1CU4L 2NXZB 4HVBA 5CAYB 2EE9A 3RJOA 3BPLB 4DVBB 5DEGA 1F6LL 5D6CA 3DV6B 2HFGL 4HK3J 5CCGE 3BT2H 4TKWA 2HJFA 2PP9A 4YFLF 1KG0A 4AC2A 1MNUL 3HNSH 5BOZG 2F8OA 4V1DB 2ZG1A 4NQDE 3RI5K 2Y7NA 2UXTA 4YE4H 5EH1A 4FFWD 4Y5YA 5EUOB 2OM5A 3DWTA 4PQXA 2YMXL 4GKZB 1I9JL 3GJFH 3GXMA 5FYLH 3C5ZD 3O3EB 2VERN 1J5OL 4IRJD 1NBYA 3N55A 5ICUA 3DTDA 4XMLH 4N0UA 2BSRB 2C34A 2IWKA 3G5WA 4P2QD 2YSSA 2AEPH 1E4WL 4O2FA 2AQNA 4NRYB 5F97E 1JRHL 3U2JA 1ZT4B 1DDHB 3MRFA 4IHOB 4P5TA 3EGSA 2MH4A 5LWYH 2FJFA 3QNZA 4UQCA 4PWGA 3MGAA 2B1HL 1COBA 3F7RA 4ZFZB 5I1AA 1BQKA 3LKPA 3NOIA 5D7LA 4B9YA 1QWNA 3O2VL 3OMZA 2DKUA 4Y4FB 2Z4QB 3CXFA 4MTMA 3MUGA 3C5JA 3IMTA 3V4UL 4PJGA 4WDIB 3TO2B 3D0AA 2EVJA 2PXYB 4K0OA 2QQKH 4OKVB 1T20B 3GHPA 3P0GB 3WY3A 4HMEA 4FQCH 4A7SA 3U46A 5CD5D 4NQEE 5AZEL 5E8NB 3O45B 4DEPB 4HBCH 4FQQB 4BBWA 3SPHA 1GJWA 1HN1A 3DXAA 5EU4B 3WUWG 1SN2A 5GSRA 4KTDL 1GIGL 1YYML 4I77H 4N22A 4X6CA 3RG1C 1WBXA 3IGFA 1NDTA 2B5IB 2KKQA 4B7IA 1MH5A 1EUTA 1S78C 4FFVC 2ZXAA 4N28A 2IAMD 1HI6A 3LEXA 3BAIA 3ZOAA 1WV7T 1KTLB 4FDWA 3N40P 3QAZB 3CVHL 4UQ3B 4ZOBA 3T4YA 1T04A 4EMZA 5K33A 1TYJA 3C60A 3PHQB 5E2UL 5IROC 4P5MB 2YAEA 5D72L 3ZDZE 3CQPA 4PTUB 4RAVA 2OFQA 2AHIA 1IM9D 4D3CH 2CDFB 2CR3A 4G8AC 5DK0B 4NM8H 1KTDA 4IJ3C 1IIKA 1S7VA 5EORL 4BWUA 2B1OA 2NNAB 3S96A 4MNQA 5BOPA 3V79C 3NN8B 4HGMA 1OAKL 2QHRL 4ODVH 1OZUA 4ZUUB 2FJHB 3PGDB 3WFHA 3FT4A 4JM4L 1G7PA 4IGBD 4UT7H 3PJNA 2HFTA 4ZD3L 3ZYIA 3WS6A 2BJMH 4U6XB 1AXTH 1FL6A 4ZFFB 4S2SA 5DQJA 4PGCB 2JB6A 4IOFC 4R84A 4ZSOA 4XMPL 3A67L 2DAVA 3QJRB 2OI9B 1JRHH 2XVGA 3EYVB 2BOCA 2FO4A 3L3IA 4AYFB 2AEPL 1HCFX 3RZWA 1DQIA 2B16A 4PJFB 1Z5HA 1AZVA 2W92A 4IMKA 4EZLA 4AYMC 1CXEA 4UNIA 1MHPH 1VPOL 3II3A 3KH4A 3NJHA 4R3SB 4HJUA 2QSQA 4IBUA 4HKXB 4JE0A 5DZPA 3IFPA 3ABLB 3Q3GA 3FPYA 3KPMB 3T2NL 4F9LA 5L0QC 3LS4H 4XT1C 4BKLA 4D2NA 1FFPA 3CZFA 1U9KA 4DOHE 1HHGA 4P59H 2W94A 1HXYB 2B1AL 3JV6A 3BH9A 1LP9A 3QFJE 5D1ZI 5ABDE 5CWSA 3ZO0A 3HC3L 4WW1B 2EVGA 5FUZH 5AENA 1MW1A 1W72L 2FUQA 4OQTL 3QJTB 1WGOA 1U8HB 1XSOA 4FFYA 5CZXC 2Y69B 3QFJB 1I1AB 1QFPA 2CBQA 4ONGH 1G4MA 3TN0A 3H6AA 1WZKA 3US9A 3SKUD 4YMPA 5HYQB 3GBMH 1T03H 2FK9A 2NDFA 4BUHA 5D6DA 2PO6C 5EU6B 5ADPH 1NGXA 4KDTA 4N0RA 1Y1DA 1DBAL 2WXRA 5KVFL 3VNZA 3EO0A 5JZ7C 4G11A 2E4FA 1LDPL 4WVRA 1IIIA 3DNKA 3M8OL 4D8PB 3RVUD 2FX8H 3ILPB 2WP3O 2Z8RA 3DYMA 1R5WA 4R4FL 3VI4A 4JPQA 4Y4KA 2YPLD 3WIHH 4LIQE 4RESB 4C57C 4XZUB 4HK0A 4BXVA 1NEUA 3MLYH 1L9NA 1XZ0B 2WXQA 4MAYB 1IU1A 4IRJC 2JQMA 2I9LB 2P5WA 1TYEB 3LPPA 1B2WH 5DJAB 3GSNA 1OVZA 2KMWA 3LPGA 1E3FA 4U1HB 5C2BH 2C9VA 4JFWA 4RDQG 3Q6FB 1OT1A 2DQUL 4PLKD 5LN4A 2Z7YA 4PY7A 1KWGA 4OKVA 5C6TL 2BHFA 4FS0A 4MXVF 2XWTB 5LDSA 2A9CA 2Q5BA 1SZNA 4KKAC 4D0DA 1A4CA 3V5HB 2FQGA 4UV7L 3GJEA 3N9GL 3BPNC 1P9MA 4OF7A 5DS1A 2K8MA 9PCYA 1QEWA 3VRIA 5MEOA 1YMHB 4ELKA 3ZGHA 1WFOA 2FBJL 3IKCB 1X5LA 3CDCA 2IADA 3LXAA 2EABA 3MJ8A 3DIFB 4LCUA 5EC1B 1ECYA 2Y24A 2NMSA 3BWUC 4LKXB 4HJGA 3N42B 2XY1A 1OP5H 1MHHB 1EZVY 3MBED 2C1OB 2XQBL 4GUPB 5F9WC 4J3TA 3A21A 2R2EA 4OZFB 5E4EC 4OGYL 1JFQH 5E4OA 1KMGA 2WWMC 2Z7UA 5J11C 4UOJA 2AGJH 1XCXA 3N50A 3MC0A 1BZOA 1DQMH 2Y72A 4TOYH 4ZNEE 4DEWA 3ECBB 4O51B 1NDMA 2Y3NA 5TH2A 2CLRB 2HG5A 4LCCC 1LJMA 1CXIA 3CIAA 4FQCL 2H3NA 2XN9B 4G6KH 4JGUA 5EUOA 4OUOA 3S5LG 4UWQB 1N6QH 5EIIG 4AVIA 1A2YB 3Q13A 5DS8A 5JHDD 5F1KC 4Z77A 4ISVA 2A9NH 3BPNB 4ZMOA 4L8SC 5TDPB 3GDBA 2EDKA 2NX5A 3LRKA 4X5XB 5KYUB 4L3EB 4BM7A 2VLJE 1DP0A 1SPDA 1CT8A 2V7HB 2VITA 3B2PA 4QHNA 5AAMA 4J23A 3K6IA 1IC7L 1XH1A 5BS0B 4AWJC 3ULUF 2Z1PA 3MTRA 4XOEA 2Y7QB 3PWNB 2IBGA 1FSKC 2WWOA 3U7WL 4RFOH 5TD4A 2YBRA 3DBXA 3PAZA 4FG4A 2QGEA 1FL3B 4OI8A 4XXDA 5HHPB 5MENB 3O3BA 5I15H 4LLQA 5E6UB 1OAXH 1FLRL 3F01A 5C0EA 5ANME 3JTTA 2BS71 2GTZA 5IJDC 1MJJB 1JV2B 3CLEH 4B27A 3PWVB 1T5XA 3S34H 2Y7QA 5ERWB 1I31A 4WO0A 4MX7A 4RIRB 4B0MM 1S9VB 1YEHH 4IW4C 2JMRA 5I5RA 1V7NH 2XKNA 3QJXA 4I0PD 1UOVA 2J1WA 4QXUL 4OCSH 3MV9B 5IOPA 3OQRA 4LDCA 1HOCA 3P2TA 2GY7B 4OV6F 1PF3A 2BSSA 3VD5A 2NRDA 2YXWA 3OXSB 4Z7WB 3HE6D 5JW4M 4LK4A 4DK6A 4DVRL 2UWEA 5D2LE 1Z3RA 4G7VH 2DB8A 4M6MH 3NPSB 4JCWA 1VFOA 5E70A 2E0PA 4TLTA 2OA9A 4LVEA 2WK2A 4O51A 4AC4A 3QQ4B 4B7LA 3W11C 3QPQD 4XXCA 5F7YC 3OF6D 5J1TC 3PQYA 1AKPA 1PLBA 4M6AA 4V11A 3ARFD 3KEDA 2R2BB 4UOW0 1DJSA 1KCKA 4H4NA 5JW5B 2BIMA 2DD8H 3EXJA 1TDQA 1BQ5A 4PJ5A 1IEHA 2HUHA 3CQQA 3ET9F 1CICA 4I2XE 3B8YA 4CJ1A 1A4JA 1KGCD 2CUAA 1U93B 2QSTA 3J2PA 3LZFL 3QDJA 3T2LA 4AEHL 5E6ID 4UIMA 2MQGA 3H7BA 3H53A 4L23A 4I2XA 4NIKB 4Z3IA 4ALAH 4PV9A 1EZVX 2A6DA 1BX2A 4HBCL 4F7KA 4B9GA 1QLFB 1P7BA 1AGCB 4APXB 4WUUB 1HESA 3TWCL 3CH1B 4M62H 3MV9E 4JGMA 5IB2B 4FQ1H 2Q3ZA 3RVUC 2WXIA 5KVDL 4PP2A 3BD3A 3NRFA 3RY5A 1HHJB 5GZNC 4OFDA 1NBVL 5D2LB 4U3XA 1DJGA 3IPEA 3IGKA 3B43A 3Q44A 4LQFL 1BVOA 3VYPA 2K45A 4Y0GA 3RWDB 3DUUA 3HC4L 4C54A 4JRXE 4OFYD 4PW9A 3FO9B 2IOMA 5BUPA 3EOAB 3QE5A 3V6ZA 3VXMB 4LSVL 1NAKH 5JW3L 3GSUB 1NCCH 1BJMA 4P5SA 2GHZA 2G3XA 4XBGA 4PRHE 4XNMA 3HJEA 5CSGA 3VTMA 2F7QA 1SFDA 2EEFA 5KS9A 2VN4A 3OD3A 3WIFB 4LU5H 4Y8AA 1QFOA 2EDMA 1RUKH 1ZLSH 4ACPA 2ADGA 4LDOB 4Z7UB 1RFDH 5CR8A 4G8GE 1CIDA 5I9QC 5HDQH 2J7LA 4DQOL 4Q9QH 4S1QL 4IRZL 1IBGL 4N8UA 4LVHC 3C9NB 3MRQA 4RSVA 2X05A 3WFZA 1IKFL 2DEYX 4G72B 2P5EA 2DLGA 4TVPH 1AZZC 4ALAC 4NLAA 1XF2A 3RP1A 1U8PB 2EIMB 4JPIA 2EXWC 3KR3H 1B9KA 4N8PA 4JY6B 4M61B 2FWUA 3IM1A 7FABL 3ECVA 4HKBB 4YX2H 2NNXA 1J86A 1ODUA 2ZQKA 3EIFA 4HJSA 4CUCA 5CIPA 2P80A 5D93B 5D7HA 3WJLA 5JPNA 3HZYA 3SPVA 2EYRA 1ETZB 1ID2A 1XF2B 1KBKA 1JP5A 2D7TL 2VMDA 3KBEA 3QQDB 1D2OA 3OKKB 5GS0C 3P0VH 4NQSB 2MPAL 5EZIL 3B9VA 4HH9B 4XB8A 1N8OE 2VM9A 2VXUH 4Y4FC 3DIDA 4JO1H 5C71A 7PAZA 5FEBA 4WNSA 1CLCA 4OBRA 1CTNA 3V8CA 1P7QA 5LNGA 3OZ9H 4LU5L 4AK1A 5ADOH 2WVVA 2MOVA 2G9KA 4DP5X 1F18A 2ZG3A 4K8RL 1FGVL 4UOZA 1QHPA 2J56A 1JZ5A 2CU9A 2WUCL 4TXVB 3VQ2C 2CRMA 3EOAA 2XDHA 2Z8SA 3CMGA 4G8GB 3VXMA 2IGFL 4F9PA 4XCCL 1R33A 1JYVA 1I1FB 3TBVB 3QG6A 1ND0B 4MVBD 1X5KA 5TF1H 2ADYA 2RAMA 3L3OC 5BVPH 1HINH 1RK1B 4HCRH 1M1SA 1GY1A 3ILDA 4PJ8A 2E3VA 4OIFA 2G0KA 1W16A 2L7QA 2W59A 2P47B 4N2MA 3T8XA 2E7LA 3H2WA 4LDEB 1MCNA 3KYKH 4N2CA 3D3VD 5SWSE 4D9RD 1TZOA 4RAVB 3UTSA 3CN2A 5D1QC 3NJVA 4QTFA 5CN2A 2F8IA 3NCJL 2XTSA 1KB5B 4YLBA 2J88L 3LKOA 4YXLH 1UTDA 4X5WA 4G8EB 5AB2A 5GZOD 3HEIB 3UPCA 1UXSB 2ZWYA 4P4KB 3NDYE 4PJCB 3M6DA 1AANA 4IBVA 2JIXB 1DBBL 5C0AE 1J5DA 4E5XG 5IEKA 3QORC 1N59A 2MJWA 1FORL 5DUPH 4XAKE 3BGFB 1U8QB 2H26A 4DVBA 4X9BA 1H3PH 1A3LL 2YPVA 4J3OF 1ZVYA 4Y2DB 5IROA 2MNUA 3VFRA 1YAZA 3MCKA 5EU4A 4HU8A 1NC2A 1VGKA 4U3HA 3PQYB 4NS0A 3TO4C 3NBNA 1DBJL 4JO8A 4AIXA 2CD0A 1DQJB 4D0CA 4F2EA 3P40A 4F20A 3N9GH 1AGBA 4I85A 2R2EB 4GP4B 4GG6B 1OTSD 4KOBA 2W0LA 1YY8A 3W56A 4A68A 1LO2L 3DVNA 1G9HA 4N0FB 1CXKA 3GIVA 1E50A 3DK2A 3KYKL 3U0PA 1ETJA 2ZE0A 1KC5H 3SKJH 4N20A 3RL2A 3HS0C 5D6CB 1M3JA 2FAUA 3VGEA 2D03H 4DSYA 1EBPA 1JHKH 3N41B 4LRIA 3SGEI 3IXAB 4X4YA 1BZ8A 4BV1A 5HVHB 5C6WH 4UTBA 1KEML 2ZKYA 2EC8A 5ENWB 2XTLA 1OGTA 1MJ8L 2WCSA 5E0FA 4WKXA 3V4VL 3VG0H 3OPZL 5ERWA 5IVZB 2V5YA 4DKFL 2WKLA 1E6JL 5M7QA 1TJXA 5HVWA 4R7DB 1TQSA 1D5BA 2IH9A 4M29A 2YN5A 2IQAB 1VGEH 2QV4A 1WWWX 4U1JB 5DZLA 1SY6A 2ZX6A 1BSIA 3MV11 3S36L 2QKIB 1TOXA 2WZPD 1SNRA 4WEEA 3RWEA 1CLZL 2J6EA 5HYJD 3ZR5A 1UVQA 3OB0K 3JWOC 3MRBA 4EAEA 1MQKL 1KFAH 1XH3A 2YS4A 3VVVA 1IC7H 2OI9C 3VWKB 3EYQC 4K3JL 4JM2A 5CJXC 1UFGA 1YNLL 5EZIH 4Y4KB 3RDTC 5HJDA 2CLVA 4WTXA 4KI5E 1B6DA 1SXAA 3VW3L 2PLTA 1PZ3A 1T5WB 1ET5A 5SWSB 4GMTH 5J3HD 1PZAA 4KOCA 3CV5A 5E00A 2OW7A 1KCWA 5IWLA 1A8ZA 1JNHA 1JPSH 3ARRA 1R5IB 1RUQH 2DJMA 2H1XA 1QLRA 3BYTA 4AENA 5DD5H 1VACA 1TZGL 3OAYK 3QRLA 2CLVB 2JWYA 5C0JA 1N6VA 3RGHA 1DQML 3NACH 2UVFA 1W8NA 4GMSH 2ATKB 3SKMA 1O7DC 2L3BA 3QYNA 5CJOH 5DEJA 2B3IA 2AAAA 4K9EC 4Q97A 2EXYC 1JGLL 4TNVF 2FB4L 3Q2NA 1BIIB 5DC4B 3TBTB 1VJSA 2COVD 2F53A 1EJOH 2X4RA 4UTBL 3UG4A 1IC4H 5IK3A 5MERB 2V9QA 1MCEA 4MDJA 3P9MB 3SDDB 3T6VA 4XCFH 3EO1A 1MCDA 1UXLA 4MCYA 5KSUA 1LQBC 4UBDD 4GW4A 3U36B 3AACA 1ZDSA 1HL8A 2H6PA 3SN6N 1B90A 1L7TL 3UXFA 2ZYRA 1H5BA 3QA3A 3TU6A 5KYWB 1MFBH 3CZJA 1SY6L 4JFHD 4DP4X 4UV7H 3TBCA 1BZ7A 1L3NA 1QWHA 3WKPA 4QLRA 1F4WL 1KIQB 3B7TA 5HHVH 3UCRA 2BVOB 3GB7B 4HCRA 1EAPB 4Z76A 2FL5B 2UWEE 2YARA 4LSSH 1CYXA 4DP6X 4PRNA 5HHMD 3C2AL 1LO2H 1I7UA 3WS3A 2ZUSA 2DRUA 4XRCB 2QELA 2XYCA 4EOWH 1XXDC 5LB1A 2E27L 1T4KA 3B4NA 5AVQB 1B2WL 2YRZA 1HAWA 4MKTA 3ARDC 5F1SA 5E2TH 1NCWH 3MLPA 1GTNA 3ML9A 3M46A 5C7XL 3N44B 2IALB 5D1XB 1KIRA 1QVOA 3IGLA 4OTXL 5E6YA 3QQXA 4TVPD 3T65A 3VDBA 3GWJA 2VN7A 5ESQB 2A77H 1K8DB 2R1XA 4D8PA 5IOKA 2WSKA 3I6GA 1EJOL 4UTBH 2ZP8A 3CVIH 4U1JA 4Y2DA 1W6WA 1EWHA 3KPNA 4IMLB 2CKBL 4IRSA 4UQIM 1HSAA 4YFDB 5FGCB 2AEWA 2WXOA 5FW7A 1YYMH 4HKJB 3AY4C 4UT9A 2QHLA 4M5TA 1KYOJ 4JN2A 2Z91A 3PDOA 2QVTA 4QHUB 3U1PA 1QI4A 2EIZB 4YXLL 3QORD 4XP5L 5C09B 3RUGE 5FFLA 3L4VA 3KPPA 1XH0A 4OD1H 3S2CA 2DM3A 3JT0A 4GS7C 1H15B 4FKEA 2XFGB 3F62A 3EYOB 1YYLL 3SGKA 4EOWL 5ID0B 4JZOA 3OR7A 4OJEH 1FC1A 4PP1D 4DEUA 1M7DB 1Q1PA 4TNFA 2H7WA 4P46B 2ENJA 4OCYL 5EUKB 2D2CC 4NENA 4CMMB 1MLBB 3UTZA 3L4TA 5LNDA 5HXMA 5BNXD 2ENPA 2LQRA 1AO7E 4R0LA 3Q8AA 1NUGA 2DQ6A 2QR0B 2WCGA 3UTOA 5DEZA 2IPKB 3Q1SL 4NBZB 3REVB 3UG5A 3M1BA 1KCSL 1JYNA 3UO1H 2IO5A 2WVSA 1CLZH 3QJZA 1NCOA 1ETA1 4BFGA 4Z3EA 1MOEA 3MOAH 4WU7B 2WINA 2WXNA 4OD3H 3MBXL 3B5HA 1HYSD 1NQBA 1K5NB 5FIEA 1N7ML 1S2EA 3JTSA 4FI8A 1E30A 1QFUH 3PHSA 4EPSA 3GKZA 4HWEL 4F27A 1ACXA 5MI0C 2KS0A 2X0UA 3ZL2A 5ACLA 1KGCE 1GGIL 3LRSB 5IB5B 3LKOB 3QDGD 1KEMH 3VA2C 1KBBA 4BH7A 2CM5A 3KJ4C 4E9RA 1N68A 1VF5C 2NXYB 3HNTH 1T0NA 3LH8A 4GQ9H 4E41A 1C9SA 4JJ5B 4B9KC 2ZF9A 1F1DA 4KQ4H 3LEVH 1MI5A 2V33A 3KPNB 4CRPA 1QLEL 2G4GA 1CDJA 4WGKA 3D50A 4XMKH 1BVLA 3MO1B 4GRWH 3RWIA 4NGHL 2X3CA 1CVRA 2HRLA 1LVEA 4AG4H 4JK0D 4BIKA 4Y19B 1BGXH 3DMMB 3EJPA 2GK0B 2XICA 5CJ8A 5D1XE 4KV5F 4IRZH 1JNLL 5I8EA 4ELMF 1T4WA 4IDJL 4DT2A 3QYMA 4HS6B 3WNLA 2OQJB 2XXCB 3HE7C 3IN2A 1A64A 1PZ5A 5FK9A 2ZCKL 2Z4TA 1ZTMA 1NOLA 2YK1L 4XPAL 3ISWA 3NSJA 1EAPA 2ZOTA 2CALA 4QRAA 4XPFL 5K1JA 3ZHLA 4BFEA 1LNUB 1T3FB 1YC7A 4DNLA 2CQVA 1NMAL 1OLZA 1RJZB 4BD4A 4RMSA 2EH8H 4X8GA 4NB7A 5C92A 3NIGB 2DQTH 1PZ5B 3PWLB 3HG3A 3SPIA 1OSPL 1F2XK 3J27A 2UY7A 3BZEA 2ED7A 2RB8A 1F13A 4OT1H 5DFTA 1TJGL 5F8QC 4LPUA 3PNRB 2CBMA 1LP9E 1YEFL 3MODH 2CRIA 2N3JA 3GIZH 4ETQA 3KWWB 3BZDA 3WEMA 4F8LA 2Y5TA 4E9YA 1DLHB 3JWNE 4JZOB 3V4UH 1WAAA 2VUOA 4QOKB 2C3VA 3V10A 2DYSB 1URZA 3TVMB 3CCHA 4U6HA 5E6RB 1OALA 4KFZC 2MQCA 5DK0A 3H9SB 3MSPA 2YMOA 1OKEA 4KK8C 4BQ6A 1LQSR 3NK4A 3QJFA 4GXFA 4YSDA 5DJ0B 3F12A 1TNNA 1P53A 4FMFA 3WL9A 5E2WL 2VLKD 3VYOA 3OAUL 3ZQXA 2D3JA 3QUKB 1XF3B 4OLZL 3DGDA 4AIOA 2V17H 3OKDA 2ZWLT 3EF4A 4JREC 3QDHA 4CN4A 2EEBA 3GGWB 4MAYD 2BNQB 1Q94A 3PP4L 2X1WL 1L6PA 2ICWB 4F37K 5BRZA 5GZND 3GTVA 2GSMB 3AMKA 3LXCA 1IGTB 4Y2DC 1ED3A 4UIKH 5D1XA 4AGPA 4DGVH 2VLLB 1DVFA 2PYFA 3LRGA 2V2XB 1MVFA 1MFDL 4H88L 4XVTL 1BBJB 3HKFA 4NT6A 4ADJA 2X2JA 1YPZE 4B9FA 1TQBC 3BWSA 3FCBA 3DOSB 5L8KB 3GMNA 5HHNA 4Q7DA 2HJFB 3QS2A 5D2LA 5FYLD 4G71B 4IRJA 1GZQA 3GS7A 3IFNL 4M4RA 1AS7A 4M8VA 3LMJH 4W4NA 1SDDA 3CDGB 3OJDA 4A2EA 1BPVA 3LEVL 5DS2A 2Z65C 4JFDB 1ZKAA 1PNCA 1GSMA 1CLYL 4HZ1A 4UILH 2O26U 5D8JL 5DK2A 3X14B 3AXIA 4IRSD 1B4JH 1DANT 1ZK9A 3BMWA 5GPRA 3HPJB 3GS0A 5BRZE 3VD4A 2V37A 5D5MA 1NCDH 2VERA 1NCAH 3HW7A 4AGOA 2AJZB 4U4BA 1HILA 1KV7A 3PXJA 5D7JD 3HRZB 3VXME 1EO7A 2APXA 5JDSB 2NNAA 2YD9A 1QHOA 2QQNH 3S96B 1BOGB 4ZX5A 5DJ2B 3N0AA 4OZIA 2A73B 5LVEA 4JKNA 5CXPA 4GAJL 4YAQA 1FPTL 2R39A 2XN1A 3O3EA 4JS7A 5DD1H 5AUMB 1J5CA 2AQPA 2CJUL 2WBKA 2V9UA 2ZXQA 3WTUA 2DWYA 3MCKB 4I7ZC 1OB0A 1CIUA 3I9AA 3FHEA 5FHBH 5GJSH 4NZTH 5IMLA 3MLZL 1HYSC 5CLYA 4YHOH 4EUPG 4QPEA 4UILL 2C1PB 3KDMB 3WY4A 1TF4A 2OXGA 3INUL 4WTQA 2UXFA 3FTWA 2BP0B 3RX7A 2HFGH 1JWUA 2HFFB 1RJCA 2XA3A 3PXLA 4AIZA 1OOWA 3GRWL 5JO5B 4WCYL 3ARXA 4TVPL 1ADQA 4PD4K 1SMDA 4J3BA 3FF7A 4ZJ9A 2M26A 1CCZA 3OKLB 3UC2A 4HJ0C 4ZAKB 1VRSA 5DWUH 3RAJH 3IDNA 3BW9A 4Q89A 2EZ0C 2FX9H 2QKIA 1UM5H 4MMXC 3SDDA 1KDJA 5B39A 4E9SA 1DVYA 3PP4H 5E6SB 5B7EA 1OIOA 3TO4A 5IG7A 2PPAA 5E24E 5DRZA 2VR8A 4TUKH 3VX0A 4DPAX 3D85B 3VXOB 1T7YA 3I50H 4YSOA 3QZWA 2R1YA 4OVVA 3UYOD 4IIZA 1KLFA 1UASA 1LGVA 4FRWA 1Q1JH 1FSKB 1U8JA 2ZAIA 5I30L 3L3JA 4KKQA 2RBLA 4QHKJ 4X5XA 1BM3L 2CWRA 4X99B 1ZLWH 2AV1A 5BZDA 1M05B 5C0JB 2E7MA 3EDEA 4GQQA 1FVCA 2YJQA 4D94A 5KG9B 5LGJB 3LKRB 1JUFA 2EUXA 3VXOA 1KB9J 2YAPA 4APQA 4P5KA 4LRIC 3OZKA 1BQSA 1L0YA 4X9GA 4PG2C 1OGPA 1XT5A 3EZJB 4GI6A 4J1UB 4BSVB 5C0AD 1ITBB 3IEAA 3AU0A 3ZE0B 2FGZA 2A1WL 1JF1B 4JFYB 1U8IB 2IDUA 4UUJB 4K3DL 2BHZA 1XGPA 1R0AL 2F61A 3PP3K 1CGVA 4LRNH 5GGUB 5KBDA 4YZFF 4I5BA 1ZSDB 2XJKA 5JDSA 3MJ9H 1N0XL 5I17A 4PLNC 3RILA 4Y2LA 4HC1H 1QI5A 4OD2B 5GS0L 3RJDA 4AGMA 2J12B 2GT9B 2Q7AA 3OZ9L 4HFWA 4OZGF 3ZYOA 1WGVA 1EZSA 3FSVA 4TSBH 5E7BA 5BCAA 2WLMA 3MUHL 4KKBD 1R19A 3VFNB 1Z2KA 5LCVA 4UDUA 5CMAA 3MRGB 2EDWA 4JDZB 4XCEA 1I8IA 2C9SA 2NR6C 1FAIH 1XH2A 2MQ0A 2ZOOA 4XPGH 4YE4L 3IYLW 1CZ8L 2QADB 4MCYB 3VGHA 5KSUB 5FA4B 1CFVH 2W91A 2QKSA 4NC1E 4PB0L 4WW1A 1GS7A 3RL2B 4QAMB 3MV01 4G1MA 1DEEB 2XV0A 2C3VB 2XTJD 3NCCB 1RK1A 4Y5VA 2OMBA 3BPCB 5DVOA 2K7PA 3C6EA 2WYZA 3KXFB 5G4OA 3HPLB 5AALA 1LO3L 2AQ1A 1WF5A 4AJVA 3H8NA 4YOKA 1WAAF 3GZOA 1NFAA 3U4EA 4LLVA 2XVKA 5C0CE 3L1FA 4RMTA 2IC2A 4U1SB 1VFUA 3E6FB 2WAQA 5DQDH 1G9ML 4N6RA 2V5TA 5EA0H 3F7QA 1DJWA 1ZHKA 4JFDA 4Y1AA 1UB6B 2R23A 2WNGA 1J9SA 1XO8A 3LN4B 2R56L 1TT6A 2QDVA 4V1DE 5EPMB 1UJTA 3HI5L 3MNWA 1P5VA 3CZNA 1CXFA 1GZHA 1AMXA 2OTUA 1S7TB 3MRGA 2OCJA 2BSTA 4FQJH 1UZ6F 4B9IA 4K15A 5AVXB 1I7ZB 3DLQR 4H8HA 4NT6B 3TCXA 2UZXA 2B2XH 1I1AC 3IDGA 5D7JC 4DKEL 2X10A 1FZJA 4YDKH 3U4KA 4G8EA 2J8UE 2VM3A 3LPFA 2BY3A 2LOEA 3RDJA 1TKWA 5I17B 1YQVH 1WHPA 2DWEB 1R3HA 4XP4H 1ROWA 5HGHA 2GSIB 2BFVH 1JDDA 5FCUL 1SJVA 2BK8A 4ZTEA 1KTDB 1GOGA 4CVUA 4NPYB 3C6LD 3C8HA 1KPRA 3H1ZA 4L9LC 4Z5RB 1FZOB 4QXVA 1D5XA 1EMTL 4M5ZH 2VUYA 1ROCA 3HN5A 4S10A 4NAMA 3GMMB 3QAZC 4UM9D 3WTSA 4PY8J 5E08L 3LRSA 1G9NH 5ENWA 2F5BL 5DI8A 1N70A 1YCSA 4A7QA 4NUMA 3UJTH 3O6FA 3D06A 1LK2A 4KI5D 4ZS6D 1OM3L 1UOWA 1U8NA 3TBYA 5CD5C 4ZSOB 3GKWL 3S8FB 1F3JB 2GEQA 2VQUA 3FUMA 3A22A 4L37A 1FA4A 2DLFH 5BS0D 1QP1A 4LF3B 4JBSA 3TIEB 1ZPUA 3L3JB 1KXVA 1UD8A 4HJ0D 4EQ3A 4ZSOE 5GSRB 4NZFA 3E9TA 3ZXAC 2FHBA 2HKFL 3RB5A 4U6YB 2WBWB 3EGSB 1P0SE 4LQ1A 3OKKA 3A4AA 3O9WC 1W8OA 3GBDA 3MV8D 6FABH 4Y4KC 2KT6A 2ZWKA 4FQXA 3TFBA 2C4FT 5CBAA 4JR9H 5HHPA 5MENA 1RPKA 4FLRA 3ARBC 4ANVA 2CA4A 3L7EB 4TL4A 4ZMXA 5CLXA 4G1EB 3IPBA 4LP4A 9CGTA 1TFPA 2YJLA 2QJDA 2PR4L 2X38A 3BIKA 3Q5TA 1B6UA 4J2QA 3PAUA 5KYYA 2MIZA 3ZHDA 5T3XH 1PY9A 5FUCE 1Z9PA 2IFGA 2HCZX 1E27A 4QXTA 4UU9A 1CDGA 4M43H 3SYQA 1BF8A 3MNVA 5EN3A 5FM5M 2LAGB 4G7YH 4QWWC 4HWNA 4LDLB 2VDOL 4XN2A 5DMYA 4AJ0A 1JHTB 2H2SD 3ZE1F 4FULA 4KRLB 1OQOA 4G6JH 3T6QC 5AVRB 3RFZA 3IU4H 3H3BC 4H8VA 1WIOA 3L17A 3UTQB 1PAZA 2LABA 4B6ZA 3IJ7A 4ILDA 1TPXC 3UTTE 1KJ3L 4JFSA 4WEBH 5IQ7H 3FOMB 4JFYA 4QY8B 2J25A 3HS0B 4FQQA 3MRPB 4JDTL 1RZGB 4LLMA 4E9TA 3ARDB 4MJIE 1JL8A 1CICD 3T5WA 4ZMZA 1JF5A 1WC7A 3FQ1A 3O81A 1T20A 1RI8A 1P4BL 1GYWA 2F54E 3S35L 1MSPA 4NPKA 5D2NB 2VUKA 3ARUA 4TLSA 4HXBH 4KI5F 1TQCB 3PGFH 1J1XL 4X9HA 1CU4H 2DTML 5LXGL 4OJFH 3KPRB 4IIQA 2WIMA 2ZCLH 3UBXG 4ZFZA 5CKAA 5EOQH 4BA0A 2NDGA 5J9PB 2GW5A 4NP4L 5EBLA 5AYTA 4Y5YC 3CPUA 1HNYA 1AFVH 5JW4R 3QZWB 4F7CA 4G6AD 2X4NB 4NNYA 6TAAA 1HQ4A 1PNDA 2IXQA 4JFFA 2OJZH 3RZCA 3FUKA 1FIGL 1MHCA 1OXYA 4NPYA 5ETUB 4Z78B 4UIMB 4NQCA 3EDFA 3GKWH 3DDGA 1E8YA 2E9WA 5F7NC 3RE0A 3FQWB 1EIBA 2KDGA 4N2HA 1NKOA 2YZ1A 5A2JH 1OB1A 3ULVD 4XVUC 1XMEB 2DQIH 1ECZA 2O5XH 5F9AC 3ZGIA 3QCTH 2PO6D 4XMWA 3SOTA 1FUNA 1E6JH 4PGEB 4POZD 2A6IA 3ZIYA 1L7IL 3KNBA 4M4PA 4YDLC 2FBJH 1IUZA 5I1KH 1Z9MA 1JF1A 4UYPA 4MASA 1U21A 2Z91B 1RZIB 1DN0A 5FW8A 1QABA 3W9EB 3LD8B 4DW2H 1W72A 4YFEA 1EEZA 2AI0L 4IS6A 4LLUB 5FB8A 2W5PA 4ZFGH 2JV6A 2CHWA 1ZWIB 4DGUA 1XR9B 1K4CB 2O4EA 2DMCA 4PN6A 5L6YH 3LQAC 2DI7A 1MCKA 3WTVA 2HLEB 3O8XC 4OF5A 3LKRA 2XYBA 3EOBB 5HDRA 5IR1A 1RZIA 3SCMB 4XNMB 2OAAA 4M7ZB 4N2EA 4X0KB 4Y2OB 5CGYD 2X4SA 4KKLC 1VKXB 4HG4K 4ZUTA 4KJQC 1AC0A 3IWVA 3BAEH 3LQMA 1Q1JL 1M6OA 3MLYL 5KVGH 4ZPTA 1BW8A 1JZDC 1EUUA 4GXUN 3T1FB 4HOXA 3KLQA 4K8RH 2PCPB 4GBXB 2J4WH 5IEHB 1DDTA 1HXYA 3FSOA 1INQB 3SGDH 2XU9A 4OIIL 2F54D 1A6WL 3MRDB 3GSNL 4XXCC 2OCFD 5HDLA 1SLVA 4NBYB 3PV7A 4XMLL 3VMPA 5AL0A 1E4XI 1JXJA 1JTPA 1AZCA 1MIML 2XC8A 1F3DJ 1DE4B 2JTDA 3B9KC 5DD0H 4JM2C 4O02B 3ZZLA 5CJXA 2CDGA 4G8FA 2VW4A 5I8OL 2ED6A 4YDJA 3S5ZA 2BNRA 3UEZA 3U36A 2WO3B 5IHLB 4WCYH 5DFVC 2VLRE 5EOTB 2R69L 5ICYA 4Y9CA 1JZJA 2XZQL 3NQKA 4HXBL 3JVGA 4PGDA 1IRAY 4MJJA 3V0GA 5B4MC 3NSYA 3X3FH 1IT9H 2WTPA 5EZPA 5I9QB 4P3CH 2GAZA 1X5AA 1FNLA 5T1KA 5I0YA 2J5WA 1J9CT 2I9LA 1GTFA 1QPPA 2H3NB 2XN9A 4I18A 3W0WB 2Y2TA 1FO0L 3ULSB 1JN6B 4JFXA 1OCCB 3TCLA 1T1WB 4Y19A 2VMCA 1A1MA 1C08A 1UD2A 5BQDA 1BZQK 1RZGA 1INDL 4OFIA 2AVGA 3FN9A 2NY4D 4N9GB 3TH4T 5IESL 4NAJA 2VZTA 1Q94B 3ZPDA 2DH3A 3AJ7A 3QUXC 2R0LL 2DLHA 1UB5A 3V5DB 3Q8FA 2R0LH 3D18B 4FC3E 3PABA 1K3ZA 4P5KB 5I1JL 1ACZA 5I0WA 4LKXA 4B41A 2I07B 4NHUA 3LS5L 4QRUB 4WWOA 4IMKC 5SX4H 5D1ZA 1OGTB 2Z6FA 4QT5A 5F7WC 5BZDB 3QJFB 1V3JA 2DWSA 1SVZA 4UQ3A 3T4YB 3PU7A 4G5AA 4LSQL 5D7KE 1YZZA 2J1XA 3RGVA 4JFFD 4JFEA 2YEQA 3I75A 4JFZL 1VEOA 4QO1A 5CWSB 5CSBA 4JRYE 3CVCA 1ZS8B 5F7MC 3L5IA 4A7GF 4YDLB 2EUVA 2O1AA 3C5XA 5HDBB 3WU1A 3MODL 3ECUA 3F5WB 3QEQA 4OZHE 1CBJA 2AK1H 4Z0BH 1U91B 1JNNH 4JKPL 5I24A 5BRZD 5LXVA 3NCYS 1EAQA 4PBDA 4FJYA 1MI5E 3S5LB 4F9LC 4ZYKB 1G5AA 2AGJL 4QIRA 1M42A 3MMEA 5EU3A 1S7RA 5F89B 1BMWA 3CAFA 4JN1L 4JKLA 1F6AA 4HCGA 1AGDB 1SBBA 3JWOL 4QOKD 3I6KA 1FNSL 2O72A 3FDWA 4IEFB 4Q74A 3QFJD 5E95B 3DI2B 5DUBA 3RIAF 2V5MA 5ECGA 2WC7A 5DHVA 2A0LC 1A6WH 4ISVB 4ODHH 4XP9L 2GVYA 3PGCA 3SKOA 3U0PB 4X6CF 1FO0A 1U4FA 2PYEB 2ZCKH 4Z7AA 3GGWA 4PP1C 3CK0L 2CO6A 5E03A 1EZUA 4K9JA 4PJDB 4OLWH 3DHUA 3N85L 4OGXL 5MEND 4WI2A 1CE1H 4J3XA 1YNKH 5EU6A 1NEZG 1JGVH 4KK6D 1Q8MA 3PY9A 3VXSE 1T6BX 2X70B 1QMUA 1WP6A 5A3ID 1HSBA 1G7JB 4AM0A 3R7RA 5AVVB 2EVFA 2AK1L 4Z0BL 3GMLA 1UWXK 1FGNL 4D9LH 1EHXA 1ILSA 1EFQA 4UT9H 2R2HA 4F7PB 2GB2A 2WKOF 3OKOA 2H0PA 5FA3B 3UIYA 3EZ8A 2P5EE 5KTEH 2P46B 4POZC 1BDYA 1Y6MR 1B88A 3JSSA 4M8UA 4NNPH 3Q01A 3BVNB 1LD9B 4P2CG 3WBDA 1MF2L 1HT6A 4LVHB 4G8GA 1R46A 2ENSA 5IT2L 1X5XA 2GSGA 1YEHL 2XETA 3AU1A 3O6FD 4HEME 4DETA 2RQEA 4AQ8A 2WJ7A 4V1DA 3CX5J 3HA0A 4YDNA 1UGKA 4QKTA 4MMXB 3V7MA 1HFUA 2YOAA 1FQ9C 2DQIL 1E65A 3OMAB 5AB9A 1RJYA 1TTRA 2Q2EB 1J9QA 4DKDC 1S7XB 1YMMA 4EKXA 4LLWB 1HJBC 3LB6C 1KDIA 1MVUB 3BKYH 3IETB 1CLVA 1S9WB 1U4EA 3LIZA 4JDEA 2VQ1A 5CCJA 4BK5C 4WI9A 1G84A 3D12B 4L8SB 1BAGA 5C0BE 3ZE2F 4E0RB 5DHMC 2HTKC 5E9DB 1J0IA 4XCNA 3LOWA 4OLXH 3L08A 5J13C 3H9YA 3P4OA 4E41D 4AG4L 5HGHB 2PWFA 1MNUH 2G9HA 1ZS8A 1H3TA 2HKHL 1X44A 2ADJA 2OL3A 5TFSH 1ZA6A 1FDLL 1XDTT 1BXAA 1MI5B 2CBTA 2P5EB 1DQLL 1IBYA 1R24B 1Z1WA 3VWKC 4C58B 5ICXB 2EXWD 5CJQL 5DGRA 3VCLA 3L81A 3VXRE 5KVEL 3SGEH 5I0ZA 1A6AB 1QLRB 3VWJC 1HZHL 1U3HC 5DJ0A 1DDHA 1YRKA 4DQOH 3EW3B 4ABUA 3CFBA 4J3OC 5KSBE 2VZSA 4KY1H 3V0VB 4F1SA 1GAFH 2BPBA 5B4MD 5D7LD 3DX9A 2TRYA 3SPVB 2FATL 1EGJL 5FF6B 2P7TB 3Q48A 4AMKL 4P48A 5DEFB 1IBBA 4LEXH 4R5VA 1GYAA 2NY2C 1QI3A 4GAGH 1FE8L 4AYEC 2DBLL 2RTTA 1DLHA 3EGDA 3KPSE 4PS7A 1JPEA 3KPMA 2QVIA 4Y4FD 4I3SH 2XFXA 4I1NB 4FZEH 1U8PA 3VI3E 1NGQH 2PCXA 4TQIA 3CD4A 4R26L 4NI3A 4X7TB 2UY6A 3EAKA 4R3SA 1E9QA 3HCVA 2PR4H 4UDTB 2IANA 5BMFL 1TTAA 3MCLH 3WS3B 4QCIA 1IBHA 1MG3C 3DYOA 3HLAB 2OTUB 3SE9H 3ATFA 1S9WA 1TCRA 5FO8A 2V4LA 2XPYA 2GIMA 3RDTA 5I1EH 1N3NA 5IMKB 1YJDH 3BVUA 4M7LH 3UROR 2ARJQ 5KVGE 2X4OB 3DGCR 4P2QB 3FXIC 2AXGB 4QXGH 4OGAC 4OCWL 4Y2DD 4Y2NA 4ZXBD 1OK8A 1P69B 4C83A 4W9DC 3R1GH 5B1JA 4XNUL 1J87A 2YXMA 5HJBA 3D1MC 3RGVD 2OL3L 1FE8H 1SEBB 3QDJB 4GUCA 4OZ4B 1RK7A 1JGUH 5CEZD 4XPHL 2YPLE 4JY4B 5MEPA 5EIVA 1SRDA 5AW4B 4JFPA 1P5UC 5KAQG 4G1MB 2J1YA 4YK4B 4AQ8C 1M6OB 2G30A 5D70L 2NT0A 2LU4A 2WXFA 1P7HL 3BP7A 3ARDA 3AZUA 1PAMA 4GB9A 1SMOA 4HSQA 4P4KC 4JO3H 3TT1H 2LU5A 4M56A 4PMEA 3VFVB 1A7RH 3HZKA 4QHNB 1YNTF 3BAYA 3C5ZC 2OMXB 3BUTA 4AQ1A 5GGTH 3L9RB 3NPZB 3G6AA 4BSWB 3T1WA 2AV7A 4YHYC 1AP2A 2VIRA 4H8QA 4PWKA 3O9WB 2NTFB 1L9QA 4MMZA 4AY0A 3BP5A 3L3GB 3KZ8A 4KZCA 3QAQA 3OVUB 1MCSA 2K0RA 3HZKB 3OWEA 3H9HA 1DSFH 3FFOA 5DD6A 3UTPD 4JRLA 2EEAA 2BXZA 3L4ZA 3NABH 1S7RB 2X9YA 1F3RB 2YKLH 3M17B 5ICZA 4LLYA 1QO3A 4A6YA 1RXLA 3UEQA 5J1AA 3RFZC 1KLUA 3P4LA 4M93C 2GC4C 3L4UA 3PAVA 3QWNA 1O6TA 4Y8DC 1KCLA 3BW9B 3VXQB 1MFCL 2QZ5A 3GXDA 1MG2C 1SOKA 2UWEB 4G9FA 3M17A 1HILB 5J5EA 1KGJA 4G7YL 5KVFH 1CD0A 4GIAA 4XVSL 5C86A 1NMCB 2BVUA 3TT3L 5HYJB 4QUOA 4U4IA 1KB5H 4RMWA 5JTWA 2F18A 3P3TA 2A4CA 4JQIH 5TDPA 4WWKC 3VXRA 3V4PL 1N8ZB 4BSWA 4KQ3H 5HYJE 3VGAC 1CBVH 2WKOA 4OLUH 1PKQB 4B96A 2D4FA 4IBYA 4OCYH 3VD3A 1QPXA 1SJEA 4TNVK 3LRMA 3MOQA 3LPOA 4FFVD 2HVKA 4XR8C 2P5WE 3TA3C 2KLRA 3DVFA 3EYQD 3AS3A 4L4VD 2IANB 5EBGA 1FAIL 2D7MA 2X12A 3GO1H 4LLYB 3KPSA 2QTVA 1EVTC 1KPRB 3H3PH 2QGCA 1NUDA 1DBKL 4JHUA 1KFAL 1FC2D 1E7UA 1WBYA 5JIQA 3NSXA 4HK0B 3RFZB 4AUYA 2XRAL 3T0EB 4JMNA 4TM9A 3EADA 4XO8A 5EZLB 3SDYH 4DGIH 1JBJA 4H5SB 3NCWA 1HDMB 3CFIC 2BM3A 3RTQB 5T3ZH 4N3TA 5CLWA 3EJYD 4R4NC 3GLZA 1NCCL 4UQ2A 1KIQA 4XNXH 4GKOA 1GPOH 1QSEA 5KVMC 2BNRB 2DIJA 3BIKB 3LQZA 4DKFH 5HPOA 1CK0L 2UZYA 5C7XH 3D48R 5H94B 4AV4A 1TZHA 4PJEA 4K8RD 5JIKA 4GSUA 3MA9L 3JWDL 3MOBL 4G3YH 4I88A 2NY2D 3CCHB 4U6HB 1WQVT 1FYTE 5DJZA 5I1CL 2ZYIA 2ADJB 5L2KD 4YHOL 3R0NA 2X6MA 5ILTL 2CO4A 3JYCA 4Y4HC 4HIHA 4DQAA 3EXLA 3WN6A 5EC1A 1ZLEA 2P5WB 2I24N 1JXGA 4YDKL 1NGYA 3AC0A 2WZ0A 5JLZA 5CGMA 5ES4B 1JGVL 1ILUA 2B7DT 2XG5A 1RLBA 1GZPB 25C8L 4KKBC 3MUJA 1MJ7L 2F7PA 2VH5H 4L8SA 3MAWA 4LHQB 3HI1A 4JFUA 1GKOA 1S7QB 3AVEA 3ARWA 3HNVH 3S7GA 4XPFH 5IHZA 3VFRB 3H2PA 4D0DB 2WXJA 3FQTB 3ZBMA 3ARFB 2L7EA 2CZNA 1AQHA 1IM3A 5C0DB 2VT0A 2AJYL 4ODUA 5ISZD 1SM3H 1E3XA 4Z7QE 1RZ7L 3ZRCC 4X4MA 4X80H 3G9AB 1GHFH 4JO2H 1QOKA 1EHLH 4L4VE 5JPMB 2YGOA 3GSNB 4M93B 1BGXL 3TIDB 1IEAB 1CLYH 1ZV2A 2PYFB 2VLLA 3I84A 3WFHB 3MJ9A 2XQYA 3MLVH 3WEXB 3LH9A 2NY1B 3QQNA 2NQDA 3IFNH 1FV1A 4W9GC 3FFCE 1U2CA 1RU9H 4JDVA 4DVRH 2B1AH 4PRDB 1P4BH 1U8KA 2P7TA 4M1CC 4OCRL 2Y07L 2PWHA 2CGRH 2OYPA 2XTJB 4JFZH 4ONOA 1KCRH 3F58L 1SHMA 4TS6A 1ZLUK 2DZEA 2AJSH 4FYSA 2X53A 1IJNA 4N87A 2UYLA 4LEBA 4FN0A 5DSCB 1DQDL 2A38A 3U7YL 1AR1D 4MBOA 3TN0B 3F7LA 1OW0C 3IETA 1WZ1L 1MDAA 5TK4A 2R4RH 4P04A 1IBZA 3Q2LA 5FXCH 2P1YA 3QWQB 4W9CC 5CILL 4NUQA 4M8RA 3II2A 2AEOA 3CDFA 3ZX1A 1U3HB 2JH2A 3EBHA 1FO0B 2PYEA 3NRPA 4WGWB 2ITCA 3MJ7A 1G7HB 1VLXA 3MRIA 2OK0H 4U1SA 2LFGA 5D2NA 3BAEL 1FFPB 3CZFB 3H54A 3RVWC 3BE1H 4K5OA 4H25A 2W38A 4KKCD 5DF0A 1EJFA 1ZVNA 2JCCA 1U36A 1UXWA 3QULB 4KO9A 4LARH 1KIUA 3QZNA 5GRVL 3SJVD 1GGYA 5AEAA 3HBGA 1RUPH 3PWLA 5IQOA 4P3WA 3O45A 4W81A 1P7KA 3BKJH 1LE9A 4GSDL 3T71A 3V7AE 5DHYB 1NFDE 1OAKH 2QHRH 4M00A 3L5WA 1MCRA 2EO9A 3E1F1 2R2CA 4NENB 5I1CH 4KXZH 1RU9L 3FBQA 1RZFH 5AVZB 3S2AA 5DR5H 1SLUA 4MDRA 5IFAH 3TJHC 2UX6A 1N59B 2LTQB 5CS7A 3DETD 3NIFE 3OKLA 3BQUB 1W9XA 3QYCA 5LGHL 4P5TC 3U1QA 4JPIB 5DD3H 2IG2H 3HUJB 3QUZC 2VLRA 1GPOL 4JRYB 4PV8A 3E2HC 4EI5A 3Q6GH 3K2UH 1YYCA 1NOFA 1VB9A 4MSWA 5KYYB 4DGVL 2GJRA 3AITA 2QVMA 3BVNA 1K5NA 2ZPKL 5DJXB 2Q0ZX 5L4FA 4ZDHB 1FN4B 2F5AL 1ETB1 5B1BB 2VL4A 4W6YB 1HL9A 2G60H 4AW7A 3KWXA 4YR6B 4ODWB 4LHUD 2EDYA 2IDTA 3DXAB 3KLDA 4LFHD 3DX7B 1FNSH 1GOHA 2H32H 4P49A 5K9OB 4G83A 1E9OB 2AFNA 4LSUL 4OCWH 5F7BA 4ANXA 1OWWA 3MRLA 2H8PA 4LE8A 1ZHBA 3ULSA 1D5MA 1I1FA 3TBVA 2K78A 2HT3D 5F7UA 4N5UA 1OSZB 2ZNXA 4FQXC 4PJGB 3WJJC 1ZE3H 1NIAA 4XP4L 7CGTA 1SFHA 3DDFA 1CE6B 2QQQA 4JCLA 5EDSA 2BNQE 2IADB 1T5KA 1OF2B 1MVYA 4Q8BA 3ARZA 4MAUH 3PJSA 3SYOA 1HINL 4EIGB 2AXWA 2WXKA 2Y23A 2DMHA 3VRIB 5JR1L 3C87A 1M2VB 3WHXA 3NH7L 3B2XA 2IH1A 1YN6B 2CIKB 4W9FC 4GAJH 1XSKA 2DIBA 3NSFA 2JKNA 4P2OB 1CICC 4ALAL 1T2XA 2WQVA 3GHBL 5BO1L 2G2RA 3N6YA 5KVFE 1MLBA 3UTZB 5IGXH 2XN2A 1BFVH 4C4BA 2X3AA 3T4AC 1A4JB 2R4SL 2LVEA 4KK8D 5DJ8A 3HHSB 1M7IA 3PV6B 3D0LA 3F85A 2X6AA 4X98A 4M61A 4DTGL 4KROD 5INDA 2ZUWA 2GAZB 3BD5A 4POYA 3W5NA 4Y19E 2R29L 1CFBA 4XWOC 3AREC 5KBLA 5KWYC 1E5UI 1KCRL 3T04D 2XN9E 2OTWA 1Z3GH 4XE0A 4P59L 4M6NL 4PB0H 1J1XH 3T0EA 2YMTA 3BSZA 1JE6A 4D7BA 4JANA 4B5ZA 3VFOA 8FABA 1ZY9A 3RY6A 2XZQH 5BQ7A 4A67A 4K3JH 5HHXH 1CVSC 2N0MA 1KV3A 4S1DC 4XPTH 1SUJA 5I1IH 1D7CA 5JHMA 1RUML 3HZMA 4FLHA 1PFOA 4L4JA 4XNBA 5JHDB 1AZBA 5E51A 4LNRA 4F1ZA 1ZK5A 3KG5A 4MJ5B 2WP3T 3HHSA 1IGJA 1MAMH 2EDTA 3S3DB 4GEIA 4PGDB 1L9OA 4WTZG 5F9OH 2ZX8A 5GIRA 2FL5A 3HZMB 1MHCB 1TO4A 3DSFH 3VI3F 2BNQD 1FYTD 1ACYH 3RWJB 2FR4A 1RIVH 2WYIA 1DHKA 4MWFA 5I2IB 1YN6A 2CIKA 5C2UB 4YDIL 3GF8A 1VZGA 1OGSA 3NABL 3EFFA 3DMMC 3G7TA 2Y6SD 5EF3A 4MNGE 4R90L 2P24B 2HLAA 5D6DC 3D69B 3OJDB 3NGBB 4DERA 4GYBA 1NBQA 5GIRB 1YEKL 4KTEL 1YECH 2JI3A 3SBWA 1VEPA 3DX6B 1A2YA 1E5YA 2HX8A 5FV1L 1JXKA 2WYTA 3AS1A 4R26H 3R8BB 1WBYB 3T6XA 5TQ2L 1ANUA 1WC7B 1CK0H 1S46A 3RLSA 3PREA 1FH2A 3GMOB 4DPRA 4UTAH 3N91A 3CSTA 4OBSA 4MMZB 5C3LD 4CU8A 1JWMB 1SXBA 4WENB 2N7AA 5IZ7A 1WH0A 5IR1B 3FC8A 1H3PL 1VGKB 5AD0A 4Y16A 5KS9E 3VX1A 2P52A 2QV2A 4RRPA 1OM9A 4YR6A 4P2QE 4YH6A 3ENEA 4PRBA 2BP5M 2VDRH 4QF1B 1XTMA 2EDLA 2QZQA 4LSRH 4ZOCA 3CFNA 3DX4A 4DN3L 1JXFA 1PKQA 1QRNE 3QZLA 4PRPB 5KUKA 4J27A 4H20H 3FN0H 5I76A 5KG9A 5IEKB 1ZA3B 4Y5VC 1WTGT 4A38A 5LBSL 1IQDA 1N4XH 4K3EL 5LGHH 1TQVA 2YPLB 1E5BA 2HRGA 1KTBA 5DHEA 3WKQA 4AOFA 4PJ8C 3KXFE 1MZZA 5FOBA 1RCYA 2N7SA 1OARL 3I9GL 3EYUH 4PW4A 2PXYC 2BZDA 4YL9A 5JXAL 5HHOA 4HYTB 1RZKH 5F3BA 1HHGB 5FC9A 1B9ZA 2X0WA 3MUUA 5CD3A 1UM4H 2AJUL 2DQFA 1EAJA 3MRNA 4MNQE 2XLLA 2DMGA 4FQXB 3O3BB 5HYIA 5IROD 2ZIDA 5A2AA 1F4WH 5BMFH 4KMTH 4L4TE 2MOQA 3TYFB 3ULUD 5F93C 5FYJD 3HS0A 1CDYA 3NIFF 4RGNE 4FNUA 3MRKA 4X50A 3GYRA 4F33B 3GZKA 1UXWB 3DX8A 2R15A 4XXWA 2G75B 2PKDA 3KGTA 3D0VA 2MKWA 3JVFC 3K0WA 4GT7A 3QZMA 2J20A 1UWXH 1E0OB 2RQ8A 3EYVA 1ZLVK 2NZ9D 4ZDHA 4Q9CA 2WLJA 3B9KB 3RTLA 1OF2A 4PBWD 4CKQA 3HAEA 2Z4QA 4L9LA 1QSFD 3QIWC 4GSXA 4F7EA 4JO5A 1HKLL 4P05A 3EGXA 3BI9X 4M3JA 2HH0L 2A74C 3FONB 4GAFB 2ATPA 4TPRL 4MA1C 5CJOL 3FO0H 5IQNA 5D1QD 1BXXA 1G43A 1MLCB 3F65A 1KPVB 5HDWA 3E2HB 4FTVA 4OU3A 3WELA 1CUOA 2V9RA 2ITFA 4P5TB 1I3RA 1LO3H 3JV5A 3QJVB 5FA3A 4GKSB 4LKCA 4N25A 5F8RC 1R3KA 4NQXB 3RIKA 1J5HA 3PYCA 2EILB 1EEQA 1AJ7L 4J3VA 3F3HA 4XAWL 5I82A 3O41B 1GSKA 4J7RA 4X6EB 3CFEA 1R3HB 4RAHA 1FYTA 2I7OA 5I6PA 1OAYH 1ND0A 3UP1A 5IKCB 2GTWB 2OZ4L 4WW2A 1FHGA 1T04B 4N8VA 2V5RA 3TO4D 5SV4A 3BGFC 3MRQB 1A22B 2AXGA 2AZUA 2OMVB 2DJ4A 3MZTA 2XACC 3FFCD 3V5HA 4B60A 3P4MB 5DJ6B 1FORH 3HMWH 2D7OA 4JQXC 3TNMB 4N9OB 3WIFA 1H9DA 3BUYA 4YO0A 1W0YT 2DYRB 3GZQA 2DQHL 4PJ7F 5KW9L 4L4TA 5HY9B 1XSIA 4DFHA 2YUZA 2IG2L 3FQXB 2M83A 4NCC1 1F4XH 4F2ME 4FABL 3MGTB 1NLBH 4MAZA 3LZOA 3X1GA 4Q2ZB 4GXVH 2V2XA 1XGZA 3MU3A 1A5FH 1VA9A 2PXYA 4YLQT 5MERA 4QGTA 3GXNA 1FV1B 5D9SB 2VRQA 2XJLA 2MCAA 3B6SB 3IVKA 3I02B 3BPCA 2DQGH 4AEIH 2DQCL 4NP9A 4Y88A 2LR4A 1KIPA 1Q72H 2ICES 4NZTL 3ELQA 4MJ6A 2VABA 1J12A 5MHSD 3MXVH 2ZCHL 3EJCA 4RMRA 3H4FA 3ZKQD 4KWUA 1U3YA 2X1QA 1IGCH 5CGBA 1IAIM 1KELH 2FD6L 4XCEB 3T3PF 2RJMA 4PAZA 3S6CA 4ADGA 2IH8A 1P1VA 4MDIB 4WFFE 5E1IA 5KSVB 4FQJL 2E9GA 4LPTA 2H47C 1QNZL 1IZKA 1KTLA 1R3IL 4IU2A 1GW0A 5TK2A 2P49B 3NP3A 2I60L 4YHPA 3DRTA 2RA1A 1SN0A 1J8SA 2A74B 1VEMA 1YUHB 4DP7X 1UWEL 2UX7A 2EC9T 3BAXA 4AE1A 2G9HB 2BMKA 4MD4A 4KGLA 4UB0H 2P4AB 1DBKH 2XVBA 1NIBA 1UWFA 3BGMA 3CFDB 3GLEA 2C4FU 3QS3A 4I77L 3GNML 2FT7A 4XHJC 2DWXA 1NCNA 2OLDA 3EBGA 4R2GC 4Q2ZA 3D08A 2EINB 1RZJL 4O5LH 2DYPB 3LVEA 4DP1X 1BV8A 2Q8BL 3AUVA 3DBSA 5A43C 1A3QA 3SPCA 4U2ZA 3WGUB 2O30A 3PDGA 1AY1H 4XMXA 4WV1A 1QASA 5C0DA 5CZVL 5A2BA 3SCMD 2UVEA 2ORBH 5CZVH 1X9LA 3U30B 4KQ4L 3VG9B 5LJYH 3NSCA 4DN4L 4ZFGL 4JRYD 3SOBL 3L5XH 3W9DA 1SYSA 1BA9A 2UV3A 5F21B 4Y4FA 1T89A 4GSDH 1UGNA 1H9VA 4Z7WA 1DE4A 5SWSD 4PY8I 4MMXA 3KW8A 3FB8B 3QH3B 4NDMA 5GZNA 1QBLL 4TPRH 4Q9QL 1J11A 2YA1A 3N1FC 2EIDA 3ATDA 1LK3H 5IQ7L 4HIQA 5I6KA 4HSCX 1P2CB 2B8OT 5EHFA 5CSZB 4TVSa 3D8MA 4XXWC 4TUOB 5AAPA 5D2NE 4P9HH 3WIHA 3A67H 4OLZH 4MD0B 1MJ7H 3BEVA 2EE2A 4X7SL 1KLUB 4ZMWA 3RBGA 2DQJH 4OW6A 5F7EH 3MVSA 4MXQC 1Z5LB 3S35X 5IQ9A 4MXWL 1T80A 2R1WA 2C5DC 2EQDA 5LQBL 3P0VL 4NWUH 1ZGLP 1BVKA 4NZ8A 1SJHA 4LOUD 3TX4A 3VD7A 2OYKA 1T1XB 3FQYA 2KQMA 2E9JA 3N2JA 3Q7JA 1QTYT 1D5IL 5AD0B 1MEXH 1KC5L 3MLRH 1JUFB 3B34A 5AAWC 3MRJB 1HH9A 3O11A 5DHVB 3DC0A 2EE3A 3ZIMA 4X7FC 3Q2WA 4OT1L 4B9JA 5JIPA 5CEZE 2CK0L 1EDYA 2BX5A 2KPWA 3MX0A 5JIMA 1Q9KB 4BFJA 3IJHA 4QHLA 2SEBB 1AGDA 1N26A 1RIHH 1KJ2H 3BP6B 3FZUC 3GC3A 3MRKB 1GA2A 1SXSA 4X98B 1NCHA 2X4TA 3C6SA 4DUXA 3ECBA 1IBGH 3DROB 4JGJA 5FO2A 3VXPB 1UACL 2KI6A 3FQWA 5L2KB 4H0HB 4HX1B 5I74C 1AHWC 3KGRA 2EICA 3ZDWA 5GS2H 1NGWA 4L3FA 2P8MA 1SBSL 4G9FE 1PMYA 2F7IA 2QADD 3APDA 3T09A 2ROXA 4F80A 3EYFA 4MJHA 3WKMH 1NL0L 1IVLA 4OB5H 3NP4A 3HG1B 1AHWB 1OP4A 5H35B 4X83A 4ODTH 2NOYA 3ARFC 3L9BA 2BXYA 2BY0A 5IMMA 1PX8A 3HBPA 4JLRB 1CFNA 4GQRA 3DUSB 2V7HA 2VITB 3K1KC 4LSVH 4PRHA 3NPSC 2VKWA 2FD6H 4JKMA 2IQ9L 3QDAA 4UZSA 4AX3A 3VB8A 4MB1A 4FCHA 4YSEA 2HFFA 4TNGA 1I3GL 3TPUA 3CVHB 4KO7A 2MNJB 2CO7B 3L48A 3RL1A 4GG6F 2WVVB 1YHPA 1C5DA 1YN7A 4YSRA 2ICEB 4HKJA 1CF1A 3FUHA 3V52L 4L8DB 2CJ3A 4N4YB 2W65B 1UT9A 5E99H 1A14L 3ISYA 1KY6A 2Q7YB 1NKRA 5I5JA 3ZUNC 1LYQA 2VR7A 2ZAHA 1D5MB 1XV8A 4G3YL 4LPVA 4AYGA 1X5FA 1UJ3B 1TTFA 5DMIH 1TJMA 4U1HA 4NZUH 4KJWC 3AQXA 3OJVC 3OL2A 3HE7A 4EDWH 4R7NB 3QJQB 4HOWA 3PNWB 1FF5A 3S34L 4XCCH 4NKDA 1CTMA 4JFDD 4PJIE 1H3GA 3POCA 1HKLH 3FQUB 1IGIH 3OHXB 4B95C 5B3JF 2F53E 3CFJA 5KYUA 1K4CA 1E4JA 1T89C 3RKPA 3LCYA 1J8HB 3S98A 4YK4C 2Y06L 3LTVA 3R19A 4FTVD 1NGZA 4Z1PA 3HR5A 4LCCA 1AQ8A 3N40F 3VXUA 1MCOL 4HV8A 1KPUA 1WT5A 2VNCA 2EKJA 4CN1A 4DFIA 5I8CA 5DEGB 4FYQA 4TNWK 3WNJA 2WLKA 4LZKA 5HI4D 4Y1TA 2OMWB 2O61B 4E68A 1IQWL 3VCLB 2HFEB 1A4AA 1HE7A 5DJ8B 3TH2T 1Y1UA 3QHFH 3I3EA 3BEVB 2JE8A 4GO9A 4NGHH 5GRWA 1I85A 1F41A 4MQSB 4Z7VA 5DZNA 3KJ6H 3GFUA 1LE9B 4OJYA 1DJIA 1G6RL 4WO4D 3ZQ9A 1I9RL 4M02A 4AQAA 5IBTH 4Z3FA 1BIIA 1WE5A 1X5HA 1TTBA 2FQDA 3IE4A 5E9NA 2QEJA 4NPJA 3X1BA 2AQ2A 2LAAA 3KL5A 5E9DA 2Z31C 1IKFH 4OGQC 5DGQA 1KZYA 3GSVA 1K85A 1F45A 1YEIH 4FTDA 3VH8G 4M1DH 3IDJA 3B3IA 4B97A 1HS6A 4N2GA 2OP4H 4U6VL 2B59B 1NC2D 5DA4A 4A55A 1KGYE 1OCOB 1K3IA 3C8KA 5HDBE 1FVDA 5F7HA 4HH9A 3CFMA 4OI7A 2OQJA 3SDAD 3SKNA 3NCYP 3WDHA 2GSGB 3AU1B 4NNPL 4BHUA 1DO5A 5EEXA 5EC2A 3NZHL 3OWRA 1NCBH 1DVUA 3O4LD 4KMTL 3HC4H 3QEHA 1HAUA 5GJTH 3MLXL 2D3NA 3VFGH 4LLDB 1L3WA 5C3IA 1B0GB 3KXFD 3MRCA 2ZUTA 3WE6A 1MJUH 1BVLB 3WEXA 4K07A 5EF1A 3BLBA 3MRHA 3BIBX 4AW4A 5C2BL 2CCWA 3O3UN 3QXWA 3US0A 1WAAE 1QRKA 1E8ZA 1JS4A 4MJID 4NUGL 1F56A 1MUJB 4JY5H 4YDIH 2IXQB 4RFNB 3UAAA 4OGXH 1YEDA 5C70A 1Y07A 3CK0H 1JZ6A 3LDBB 4YPJA 5IB5A 1XD1A 3K72B 1LWHA 4NFDA 4NN5B 5J6GA 5EPMA 3ULUE 3FN0L 2HPTA 3ARGC 5ITFA 3IMVA 3WNOA 3STBA 1N5AB 1NGPL 2E59A 2JI2A 3TBSB 1NAMH 3TVMA 3L5WB 2VB5A 4FQ2H 5FUOH 3SQBB 4GUQA 1JPTL 5HTSA 2OMZB 3BH9B 4KK5C 3GIVB 2Q87A 3QXDA 4BZYA 4X6DF 2YEZA 3MROA 3VSUA 4A7TA 2KLSA 4HS8H 4HOMA 4L0YA 5F6IC 15C8L 4JFVA 4GW5B 3U6XA 4KJYA 4FYTA 2VDRB 1TZGH 1D7FA 1XGRA 2FJHA 3L5HA 3NCJH 1NCWL 4WNJA 1WA2X 1T5XB 3IMUA 3ILEA 2JCWA 4HEMA 1XR8A 2OMZA 2GITA 3TN0C 1DBML 3L1GA 1JI2A 5L2JB 3HC0B 4DUWA 3F5WA 4WUUE 1AYOA 3C60D 3QVAA 4KI1A 4AITA 4UOQA 2L0DA 4TYUA 5AVTB 3DJSA 2DI9A 4LGPB 1QFWH 1TETH 1FVEA 4WAFA 2HFEA 4CMHC 2YPVL 4WV1B 2EDEA 3WG7B 4OFKA 2O5NA 3RNKA 1QBMH 5T1LD 4TNWF 1MI5D 3BESR 4MKMA 1G7LA 3GSOB 3A6CL 4EZJA 4ZUSA 2WBJA 2HH0H 1JF6A 3AB0C 5I1GH 5EZJA 4EXPX 3MRCB 1FVEB <