4B60A

Structure of rfnbpa(189-505) in complex with fibrinogen gamma chain c- terminal peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
309
structure length
299
Chain Sequence
TDVTSKVTVEIGSIEGHNNTNKVEPHAGQRAVLKYKLKFENGLHQGDYFDFTLSNNVNTHGVSTARKVPEIKNGSVVMATGEVLEGGKIRYTFTNDIEDKVDVTAELEINLFIDPKTVQTNGNQTITSTLNEEQTSKELDVKYKDGIGNYYANLNGSIETFNKANNRFSHVAFIKPNNGKTTSVTVTGTLMKGSNQNGNQPKVRIFEYLGNNEDIAKSVYANTTDTSKFKEVTSNMGNLNLQNNGSYSLNIENLDKTYVVHYDGEYLNGTDEVDFRTQMVGHPEGYTLTWDNGLVLYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN-BINDING PROTEIN A
publication title Evidence for Steric Regulation of Fibrinogen Binding to Staphylococcus Aureus Fibronectin-Binding Protein a (Fnbpa).
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus nctc 8325
molecule tags Cell adhesion
total genus 72
structure length 299
sequence length 309
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b60A02
4LEBA 2Y7NA 1R19A 2RALA 3IS1X 4FJ6A 2Y7OA 2Z1PA 3AU0A 3IRPX 4B60A 4BBWA 5CF3A 2Y7MA 3IRZA 3IS0X 2F6AA 5CFAA 5IHWA 2Y7LA 4B5ZA 4F1ZA 1R17A 2F68X 4Q6KA 4F24A 4F20A 4JDZB 4MBOA 4LE8A 4JDZA 3V10A 1N67A 4RMBA 4F27A 3ASWA 2VR3A 4JE0A 2YLHA 4LEEA 3AT0A 4MBRA
chains in the Genus database with same CATH superfamily
1AIFA 1E4KA 3D48R 4H1LA 1JUFB 3E0GA 2RD0A 2Y7OA 3FQ2A 3HAEA 3QK0A 1MWAL 3RGVB 3D05A 2R0WL 1ACYL 3C6LA 4PJIB 4BFKA 2OL3B 4DZBA 4XO8A 4OI7A 1A6TA 1NFDB 3ZZSA 1MI5B 2XV2A 4JFZH 1I3GH 2VLKB 4KNSA 5D2LB 1ERNA 3RWFB 3SN6N 4QLRA 1I8IB 3TZVA 1PZUB 4UI2A 4F24A 4YDLB 1UZ6E 3VGBA 4AUUA 2VZVA 1S3KL 4X42A 4M8QB 4LCWA 5I9QB 3X13A 3V10A 4D9RD 1GXEA 4G5ZH 1AIFB 4BA0A 5GGTH 1P9MA 3ZQ9A 2XX0A 1X4XA 2WIIA 4ZFFB 1VZGA 5E1QA 4DZBB 1D7BA 4F8NA 1A6TB 2FECL 3IAQA 5HHPA 1XCTA 3TZVB 2IXQB 4GT0A 2WQVA 4DWHA 5LDUA 4CC4A 5EZIL 3VFNA 1X5GA 4H8QA 1G6RL 5DJDA 1UD8A 4X9YA 4ZQTA 4ES9A 3W9EB 2EKSB 3NPZB 3M17B 5DEZA 4MQ7A 5FUCC 1QHPA 3X13B 4WI9A 3F64A 4YSQA 2WBJC 4OZFA 4DKFL 2NY1B 3EUDA 1YMHA 2OLDA 5DQ9A 4LSVH 2CCLA 1QPKA 4N0UA 1ZJAA 2P45B 2F5AL 2WIIB 3EG9A 4RGOL 3SY6A 4MCMA 2Y7QA 3T04D 3DIDA 5HHPB 2NY4D 4WHYH 2P24A 1EK3A 2PUQT 1YEFL 2ID5A 5CLZA 3UTQA 3W1ZA 3DTUB 4CUCA 1TEFA 3VFNB 5DJDB 2YA1A 4XNAA 4KK9C 2Y6TE 4XVTL 5KSBB 5FUZH 5KSAD 3SDDC 1CYWA 5T1KB 3S98A 1AZZC 1YMHB 2B0SH 3OWRA 5DQ9B 3U0WH 1M9WA 3WIIH 3ARDD 2O5NA 4H8WH 3PWNA 1RZIA 4N0UB 2XWTA 4LLAA 3BFWA 4WFFD 4MNQA 4QOKD 4KK9D 4OGAD 4G3YH 2P24B 4L3ED 1WEJH 2B20A 2YMOA 3I9IA 1UUNA 3WGVB 3ZRCC 3QJHA 4G11A 1OT1A 2NXYC 2ZUSA 2R0ZL 1T0PB 4UT9L 2DJUA 4JZJA 4YDIL 2IWEA 1AS7A 2E9IA 4BZ2L 1FH2A 4Z7WF 3CD4A 2EDHA 2DQTL 2QSCL 2XPYA 3X11B 3BUDA 4XE5B 5E94A 3PWNB 4HH9A 2XWTB 3X3GH 2VQ4A 4EN3B 3T2QA 4P2OA 1Z3GL 1D9KA 1AYRA 2E59A 2IOIA 4ZTPH 1QBLH 1C16A 1ZHBB 2X3BA 3IDNA 4HS3A 3QJHB 1VFOA 2EIMB 3HKZA 4WUUB 1XGRB 2DLTA 4JZJB 1H6FA 5AALA 3NCFB 4DFIA 1ZGLA 3BHBB 3WNIA 3BSZL 2OP4H 5I71C 1XF3B 4DO5A 4QHPA 3IJEA 3MROA 5F9AC 1BVOA 3E2HC 1BZ7A 4HJ0C 4HH9B 1VZHA 2DWTA 5CIPH 3PGDB 4KFMA 3ZKXC 4BRJA 1D9KB 3ESMA 3PFUA 4IOIB 5JHLA 4QLWA 5E95B 3GNML 4HS3B 3QUMB 5FV2A 8CGTA 1CLZH 4LPWA 2J43A 2VSKB 5CZRA 2H2SC 3AITA 3HE6C 3F6IA 3JWOH 1BFTA 1B2YA 1OKEA 3GWJA 4L9LA 5BRZA 2EEFA 2FO8A 2JWYA 3MKGA 5I1IL 1KOAA 2MTPA 5SWQA 4IRJC 3W5MA 2CCVA 3G5XA 4IKJA 5CJQL 1FNLA 1ZGLB 4OH2A 5AG8A 1CGVA 4B9GA 1O0VA 3IJEB 3V2AR 2G2RA 4HS6A 5HY9A 2XWZA 3HS8A 5E8NB 1EHKB 1OGTA 1F90H 3K0YA 2ZQKA 1PL3A 3LH2L 4J3OG 1UOKA 2W9DH 3LEYL 5AVZB 3RWDB 4OB5H 3SYOA 3LSOB 1DSWA 3DI3B 2XJKA 4HIPA 2AV1A 4PVNA 5IV2A 1DN2A 1LDSA 2YWZA 4GSXA 3RTQC 4XP4H 5LBSL 4CNIA 4L9LB 2BIMA 2FH8A 3VM7A 5BRZB 4JRFA 1T5WA 2X4UA 5SWQB 3ARXA 2H9GA 2EDMA 4QJ3B 1WDAA 2Y69B 2G2RB 1YN6A 4HS6B 4Z7VB 4HPOH 3MRDA 5KW9H 1OGTB 1NAMH 1UZ6F 1BXAA 2JFCA 3OXRA 4MGXA 2HKFL 4RDQF 3RTQD 5IBLC 4PREB 1KXQE 5DJ8B 4BXSV 4LHQB 1MJUL 3HBPA 4GXUN 1M1XA 4KK8D 5IV2B 2OMUA 3S2CA 1ZV2A 4MA1C 4AQ8A 1AOHA 1GSMA 3FSWA 3B5GA 1T5WB 4P4RA 2X4UB 1J05B 2H9GB 2J8OA 4MJID 3O6MH 1JHLL 1LWJA 2HJFA 5DS1A 1BQHB 4DVRL 1ZE3H 2IBZY 2W38A 3QFGA 1H0DA 1QRND 2GK2A 2PPCA 4GKOA 4Q6IB 3V9CA 3OXRB 3SYPA 3ESUF 1MG2C 3KS0J 3CHSA 3NDYE 1KCWA 4G9FD 4I9XA 4XPAL 1OARH 3TBCA 2OMUB 3VVVA 3E6HB 4W93A 3RJDA 3LY6A 4L1LA 3G5ZA 1MFDH 3F7VB 5F3BA 3H56A 5FDYA 5GPRA 4OZ4B 5D7LA 4DKTA 2BY1A 1AKJA 2VRAA 4P4RB 1HZHH 2P5WB 3U9WA 5C7XL 4JFFD 2HJFB 2E7BA 4QXGH 1ZTXL 4ZUUA 1H0DB 4HJJH 2FB4H 2F7PA 1JF5A 4GKSA 1MRDL 4YH6A 4ODSH 3ILEA 2DH2A 3FF8A 4HWEH 1KWGA 2PWFA 4LFHD 4LASH 4DGVH 3MHZA 4AIZA 1I8LC 1UOWA 4B5ZA 4O2EA 3AREC 3N1MC 3BH8A 2DOCA 3G5ZB 2DQJL 3CQFA 4JM4H 1ORQA 4JMXA 1FVCA 4D0DA 1E4HA 3GS7A 5GIRB 3RVUC 1AKJB 1J86A 3L5JA 2E5EA 4GO9A 3VXMD 4L29A 1NLBL 2N01B 1MCQA 1PQZB 4ZUUB 4K3GA 2XKUA 2DIBA 5GHWL 2B1AH 4ZS6C 4GKSB 2OTUB 2G75A 4FKEA 3U1QA 1TQSA 3WD5H 1NCNA 3VVWA 1SDDA 4YLBA 3RVUD 3K6FA 4JQIA 1OCWH 4AIZB 3P3TA 4HKZA 4O2EB 3BH8B 4ETYA 2NSXA 3FUJA 5MP6H 3UPRA 2NYKA 1ORQB 1FVCB 5B3JE 1OWRM 3THML 5FLUA 1N2RA 1TEGA 1T22A 4L29B 1S9VB 5HHXL 2AQRA 1TITA 1KLUA 3WIFA 1R33A 4DP9X 1FLTX 2F8XC 1RPUA 1NSNL 2DEYX 2G75B 2RMNA 5DR5H 5HGDA 1BM7A 4I2XA 3RIKA 1TZIA 5BS0B 3STZA 3T0DA 2XN2A 4PTUA 4HKZB 2R4SH 3GMMA 2VUYA 4K3EH 4P2AA 3T2OA 3QEQE 2IPKA 3UPRB 1P5UC 3D09A 3MODL 1B90A 3LS5L 2XKNA 1RUMH 1FBIL 3LB6D 2W1NA 2YUVA 3CDFA 4HT1L 4UV7H 6FABH 2DIAA 5D7SL 3RUGA 4NRZA 1ITBB 4JHWL 1SHWA 1EZLA 3DBXA 1I9RL 4H0GA 2AGJH 4M6OH 3ZE2B 1KLUB 1G1OA 2QL1A 3CN3A 3VG9B 5DK2A 1U8LB 1TCMA 2Y22A 3WNKA 4I2XB 3Q43A 2K8MA 3FUFA 1TZIB 3STZB 1U2YA 3MLWL 2LV4A 4YE4H 3L5XL 5IJVA 4J5VA 3UABA 5HGHA 4YVUA 4BCYA 2XKNB 3RFZA 2DDQH 3ETTA 1UURA 1BOGA 4P23B 1OAQL 3CFCL 1U2CA 3HMXH 1E27A 5DHMC 4FLSA 3L2NA 1AY1H 2V6HA 2JCCE 1A5FH 2X4OA 3CLFH 1JGLL 2YAMA 3NCCB 4L8SC 5HYJA 2PR4H 5DK2B 4G70B 4EVNA 1P4BL 4G6AD 5E8PB 3NGBC 4NAJA 1AJ7L 1BVLB 2NY5L 3T5WA 4N9GA 1LDPL 3MRRA 1SMOA 4BE6A 4Z78B 1DBBL 3U0TA 5IJVB 3HS9A 5HGHB 3JZ7A 1DVZA 2OSWA 3SBQA 1AE6H 3P2TA 1FWXA 3APDA 1AKPA 5D7KE 1VCBC 1FLRL 5FGSA 5GS0H 2ZX8A 2HVJB 3S3DB 4HUCA 2VDOH 3UAEA 2X4OB 1GYCA 4H0HB 5EU6B 5HYJB 3RQ3A 4JCLA 4QYOA 3C5SA 4EVNB 5EUOA 3NRPA 1S5HA 4NPYA 2IF7A 3CLWA 3MRRB 4F7MA 5L2KE 1RIVH 3L81A 3U0TB 1EZSA 5EC2A 4OCWL 4GI9A 3KPNA 3CFBA 1AO7B 5J12B 1O9VA 3MJ9H 1N12A 4FAAB 1T7YA 3T4AC 1J8SA 1QKZH 4A2GA 3TP4A 3CXDL 1UYWH 3OGOE 5E1AB 4S2SA 3QH3A 1ND0B 4LESA 1CB4A 5BZWB 1AZRA 3LHAA 5AOIA 3LQZA 3IGUA 4UZSA 5EUOB 2G2PA 1NJ9B 1S5HB 2RCSL 4P05A 5FB8B 1CDUA 3T4YA 1B3IA 3E80A 4IU2A 2WQWA 3FU9A 4QCIA 2FBJL 3OV6A 4X8XA 2MCPL 2A74B 3QJFA 4Y2NA 4WCYH 2W0FB 5E2JA 5CLYA 5JQ6H 4JO2L 3A6CH 1PNCA 1CF1A 5GRJL 1IFRA 4Y2LA 3FQXA 4PWEA 3TVMB 4GRLD 5I1CH 4S2SB 4TPRL 3QH3B 4BH7A 3GXPA 4L2YA 1JPST 2XDHA 4DW2H 3VFRA 5JPMB 4M5YL 1D3CA 3L8QA 2R1XA 2VKWA 3T4YB 1F3RB 1QFWI 2BX5A 4JANA 5FXCH 5ILTH 3PU7A 4IU2B 1WAPA 2C7FA 5EOCL 4LPXA 4O4YL 3QI9A 3QJFB 4RFEA 5DRZA 4CMHB 4PJ7F 5BV7H 2P5PA 4Y1TA 4CDGC 5CJOL 3WFZA 3MNDA 2L0DA 5DMGC 1I1YB 3FQXB 3S4SG 3O8XC 3E9UA 5EORH 2QADB 2J6EH 1KIQA 1NIEA 3FRPB 2FSEA 3SGKA 4A2LA 1GGUA 2IH1A 4TUKH 3T6ZA 2DQGL 2FGWL 3IJ9A 2Z4QB 5DCCA 5CJ5A 2YD7A 1T6WA 4PQXA 2YGPA 1A3RH 2R1XB 5M94B 1JRHH 3MACL 3O0RH 3T6QC 5K1VA 5FKPA 2L3BA 2E75C 3MV01 5DRZB 2CPUA 4RFEB 5F97E 1F6FB 1UM5L 1UWYA 2KKQA 4NYLA 4NOFA 3FMGH 1NOLA 3FONA 3V0WH 4LNVA 3LTVA 1BXXA 1KIQB 3QEGH 3TESA 2F8OA 2FSEB 3SPJA 2W0KA 5SX4I 3WLBB 4YXLH 3Q6FA 4OD1H 3P9MB 2ADFL 3GT6A 4GKZA 4L5FL 4TQ8A 4LLDA 4ZMOA 4ZS7L 3H9HA 5FKPB 3UG3A 4LLUA 1RY7B 3GHBL 3INOA 3NJXA 1UCBH 3GJFA 3HHRB 2Z8VC 4NYLB 2F54D 1M57B 4MD4B 3FONB 3P4NA 4YEEA 3GGWB 5F70A 1Z5HA 2KZKA 2P42B 3WAJA 2E4TA 4FQIL 4JRYD 3QRGL 1NWOA 1J1OL 3Q6FB 3B2UC 3SDXA 3ZUNC 4U6XA 3UYRL 2NNRA 2I32A 1TZ8A 2PWHA 3DJ9A 4NWTH 1VB9A 2DL9A 2JCCF 4LSSL 2Y7LA 4Y1AE 2MCG1 3UADA 2BIPA 4Y88A 5I1KL 1DBJL 2YMXH 3P4OB 4KX9A 4NN6B 4N2MA 5HGAB 3S37H 1A9EA 2O5ZL 3GJFB 4HWNA 3T2LA 1UXMA 4E9RA 4EI5A 3DKHA 2CLZA 4UAHA 1NBQA 3P4NB 4ZAKD 3PDGA 1H8SA 5BVPL 4YHLL 4U2ZA 4RGNB 1B0GA 3T0XA 4K15A 2ZUVA 3QUGA 2DQDL 4ZSOE 3MRHA 2ITCA 3ULVE 1BD2E 1EMTH 2V7HA 1BJ1J 3FUMA 3S5YA 5E8OA 3WO3B 3ZPDA 1UD6A 1MFCL 4EI5B 4OCSL 4HC1H 2IWGA 4R3SA 3ATFA 2FK9A 3I9PA 3NZHL 3QVAA 2R29H 3SDAD 4CADA 2XZZA 5H37A 5I16A 5ICZA 2UX7A 4D8PA 4Z5RA 4OLWH 1C1EH 4OFYA 5TFSH 4G6JL 2VN3A 5INDB 4ELME 1NAMB 5J6SA 3PIQA 4N2OA 1MOEA 1IKNA 2ALAA 2AV7B 1FIGL 2DWEA 3EO1A 4F2MA 5E8OB 2CLRB 1YNLL 4OF0A 2B1HL 3QHZH 5F0PB 5EBMB 2IADA 4HKBB 4YHNA 4R3SB 4ERSL 1CDIA 1JPGA 3B6SA 4YHIA 4CADB 4JR9H 1HFUA 1QLFB 3HR5B 1BQUA 3PCYA 1JNHB 2X4RA 5I30H 4Z5RB 2MOGA 4JE0A 1WHPA 5AOZA 3QXWA 4OSUH 3QUYC 1IKOP 3QDME 3PIQB 4U1JA 3CFDA 1JF6A 1TZOA 4V2BA 1T5XA 3QS2A 3ZTJG 3ZYIA 2DWEB 5A2JH 3EO1B 2XVKA 2OXHA 4F2MB 4UQBA 2ED9A 1PZCA 1LP9A 1NPUA 3UGEA 5FFGA 3GS0A 1JZIA 3EHBD 2IADB 4MQXD 3M1CA 2EDYA 4F15C 4YHNB 2R0WH 3QUYD 3SE6A 1QSEA 2CRMA 3B6SB 2F74B 3D69A 5CLTA 4YHIB 2ZD0A 2X4RB 1WG3A 1F4WL 3VJ6A 3PV7A 4M93B 1F4YL 4X2UA 3OLDA 1AANA 4LMQE 4QKTA 1HSAB 2FYYA 1S3KH 1TCRA 3M1OA 1XZWA 4FQHA 3V4VA 1T5XB 2JJTA 2IV8A 3SKJH 4OI8A 2OXHB 3PWVB 1LP9B 3BH4A 3TBSB 2PXYD 3GMNA 4XAKD 1RUQL 5J11B 1XSOA 2AAAA 5ECJE 4GS7B 1NCIA 3DX6B 3D69B 1N6UA 3IDYB 3ETSA 4FQPA 4OIAA 4PJIE 3SPVA 3QDJD 4ZJ9A 3VJ6B 2PNDA 1NFDE 2NX5D 4IKKA 1O6SA 5EZIH 1J7VR 3GM0A 1G6RH 4J3BA 2FYYB 1TCRB 5EU3B 3OHMB 3DX9A 4FQHB 3G6JE 4W9GC 1J88A 1HL9A 2HT2C 3HZMB 1LEKA 1KCBA 1YUHA 2AVGA 2DF3A 3AQXA 2E7LA 1TJGL 3KWXA 1OGSA 3GMNB 5DO2C 3TEXA 2DLEA 2YUZA 4WEUD 1PY0A 3HE7D 1ZLWK 2APBA 5DGRA 3BPOC 3BW9A 4RGOH 4MAYA 5A2LH 5FOBA 3VD0A 3SPVB 1UKTA 5F7EL 1NL0L 2HT2D 1O6SB 5HHQA 4CGUB 4OW6A 5C3LD 1DJGA 3CN1A 4P04A 5DO2D 5AAPA 4FKHA 4XVTH 3DX9B 4FQ2L 1LEKB 1MCBA 1YUHB 3WEXA 4QRRA 4HHAA 4LCWE 2F53D 2GUOA 4NEHB 1MJ8H 5KSUA 4AUYA 2J8UA 3BW9B 1FNEA 3QIBD 4MMYA 1QI4A 4HJGA 3ZT5A 5MEPA 1FZMB 2ZP9A 3NZSA 5FOBB 1WGOA 1RD6A 2XTLA 5FYLH 1Z9MA 3K2UH 1BQ5A 2R0ZH 4GO6B 5KVFL 4YDIH 1N19A 1NBVL 2EDNA 3APMA 3LRGA 4Y9EA 1N18A 4X6BA 3LPPA 4WK2B 1G7PB 1WHOA 1XQ4A 3QT2A 4QRRB 2AANA 3CH8A 4D9LH 2QSCH 2HB0A 1H3TA 5KSUB 1WGVA 1G7LA 4NO2A 2XN9A 1K6QL 1I1AC 2JJVA 2X41A 1A4BA 4MMYB 4TV3A 4HJGB 2B9BA 2FLBT 4N0UE 1Z3GH 4K2UH 1CR9L 5EA0L 3ULVF 2ZWLT 4KI1A 4MVBC 4WW2F 4FLRA 2BIIA 2FGZA 1U8CB 3LRMA 3B5TA 3LIZL 3OC5A 5FYKU 3FSOA 3GIZL 3UPCA 1ZHKA 4MYWB 3ECVA 3TA3D 4CC0A 2V3FA 5E9DB 3A4DA 1N6VA 3FULA 1H6EA 3ZL4L 4QKXB 4LE8A 1FNSL 1Q9OA 3ZL1A 4KVCL 1HAUA 4MVBD 2XN9B 4NO2B 5F0JB 3WTTA 1J18A 1LK3H 4H8HA 4OAWA 2QMJA 3TBWB 5C8JA 3S35X 2YD8A 1W0YT 1MJ7H 4J8RA 4MNQE 4BFNA 5L4MA 1BBJA 1YN7B 2CJSA 3UDWC 2DWDA 1I8KA 1ODAA 2DPKA 2YKLH 3U46A 2CRIA 2N1TE 1IBYA 2G3NA 1WAAA 4FLOA 4KTDL 1EV2E 3EW3B 5CCGE 1DN0A 1NFIA 3D30A 2EDEA 1K5NB 3WIAA 3AS2A 1IQDA 5C8JB 3LH2H 4RISL 2FLRT 4HZAA 3TIEA 1GL4B 3D85B 5E4EB 4BM7A 3C60C 4NPKA 1KWKA 2WKLA 2WXRA 5EU5A 2BS8A 2PW2B 2CMRH 1N64H 2GFBB 3BKYL 4AITA 4J3OH 2DWDB 1I8KB 1A64A 2PYEA 5LBSH 3U46B 2PW1A 4ODUA 1RVFL 1F2QA 1UM4H 5EOCJ 2OX5A 4KI5D 1FV1A 4Z3JA 2X4NA 1NFIB 4XBEL 1PZSA 5KOMC 1NGYA 5IW3A 2BOBB 2GG1A 3F84A 4AQOA 1IQDB 3HBZA 1FVDB 2E6PA 3TIEB 2HKFH 5C0BD 1HXYB 3AM8A 2VDML 1KJMA 1MFUA 4PV8A 1F4XH 1K4CA 1N26A 1MJUH 4FE9A 1KFAH 5EU5B 3D06A 3AACA 1CXEA 3JTTB 5F1IA 2UYLB 5EV7A 2PW1B 4OT1L 2TAAA 2OX5B 1EXHA 4PJIF 5J13C 1FV1B 3W2DL 1J8HD 2O6EA 4U1SA 4DVRH 1NFDF 5DZPA 5E6IA 5KVGE 5ISZD 2HWZH 5D2LF 3WNMA 3V7AG 3JZYA 4YXKL 3TX4A 4OCRH 3FSZA 3PWUA 1KJMB 2BVTA 2VSCA 4PV8B 1J1PH 5BV7B 3BWSA 4QRBA 1CFQA 3F12A 5C0JA 1EDYA 1YECL 5BJTB 2AK1L 5GRUL 5BZDA 5F1IB 3ZIYA 1CDGA 3CC5B 4DEPB 4QHUB 5C7XH 5FM5M 2JJWA 1JZ5A 4OJFH 5LKNA 4U1SB 4WSKA 1ZTXH 1DUYA 5E6IB 4F58H 5EUKA 3AT8A 4LHJB 5IW6A 1MRDH 1R47A 2WLNA 4JDEA 4PHZA 5C0NC 3OSVA 4QI3A 4A38A 2WP3O 1A9BB 1CFQB 4HSAC 3V5HA 4ABUA 3IPEA 5C0JB 5CM1A 1WFMA 3WFHB 3UTOA 4Y1SA 4GFXA 2NQDA 4DZ8A 1QACA 2DQJH 4KMLB 1INDL 4HVBA 3N0AA 5BZDB 1X5YA 5C3IA 5KBMA 3WN5B 4ZO9A 1Q0YH 2WLJA 2Q2LA 3B34A 5DU7A 1JPSH 4WI6A 1NLBH 3HI5L 1DUYB 3FNKA 1L9OA 3FO2A 5EUKB 5GHWH 4PJ5A 2GJ6D 2VT0A 4JZNA 5IW6B 43C9A 1OALA 1XF1A 1Z7JA 2Y9RT 2VDNL 5D1ZC 3FFDA 3F7YA 4JPVL 1XGUA 4ZYKB 4JDEB 1FORH 4R83A 4F1ZA 3FO9A 4JJOA 3U7AA 2KH2B 5CSBA 4X80L 5KSBF 4F2FA 5EZJB 1B4LA 5A3IC 4G8GB 5T3ZL 4CVWA 1JGVL 1RKRA 2X2IA 4JFVA 2Z7ZA 4G7RB 3THMH 5DK0A 1NGPH 3WIHA 5A7BA 4LCCA 1EGJL 2XG4B 1C8QA 5B4MC 5JXEA 5I0ZA 1U3HC 2YBGA 2FEDD 5D7LE 3WFCL 5J0BA 5J1TC 5HHXH 1BIIB 4WWKD 2WANA 4PJ5B 1V3LA 3VXQA 3EDKA 4JZNB 1KCRL 2PTVA 3D4YA 1NSNH 2EVGA 1R9FA 5IWLC 3O6LL 3SO3C 3FO9B 1PKQA 2R7EA 5HHNA 4J3UA 2JXMB 5B4MD 1NUFA 4DTGH 3WU1A 4H8PA 1KLGA 3FKUS 1EUTA 3ULVC 4HMCA 1RPQA 2EACA 4PW3A 2EDXA 3GSNA 5DK0B 3LS5H 4LCCB 3RKPA 4WW2C 1WC7A 1UH3A 4HT1H 4LL4A 4PB9L 1GYVA 4JHWH 1U3ZA 2JKIS 2XQ0A 1I9RH 3KH4A 2ZWYA 5D1QA 5IJKA 3RGBA 2R1WA 1BD2D 1CT8A 3RWGA 1WSST 2R83A 2R7EB 3PGCA 5HHNB 1HHIB 3VSQA 5MEQA 4BUHA 1KLGB 4IBUA 2JSFA 3MLWH 4UBDC 1FO0A 4WTQA 3L5XH 1GGBL 5E8EB 1WC7B 2FD6L 3Q1EA 4BKLB 1CURA 1OAQH 2VMJA 3N85L 5T3XD 5TDNA 1JZ6A 1PKOA 1VERA 4BCZA 4OIFA 5AFAA 1JGLH 3DO3A 2NNCA 3ZE2E 1LWHA 3PGCB 5MEQB 2JNZA 4J23A 1AJ7H 4JO8A 3TEYA 2HMID 1RIUL 2NY5H 2Z34A 4I2XE 1TG8A 2ICEB 3KBPA 3NP3A 5DUJA 1DBBH 1SXBA 3KPOB 1EFXA 2IPTH 5CEZH 3CVBA 4M7JL 7CGTA 1A6AA 1Q8MA 1YG9A 4XNYH 2NR6A 3RHWF 1J8KA 4E41A 1N59B 2D9QB 5AW7B 1QWHA 3F5WA 3CSTA 2Y6SC 5CILL 1CLOH 4HAGA 3QDMD 3RUGE 2AJXH 2EUVA 2FR4A 3FXIC 1T80A 4HWZB 2CBTA 3EO9H 4WKZB 5LAXB 1E8XA 5DS8A 2Y6SD 1F8TL 4NQQA 4Z77B 2R9HC 1EFXB 1L9PA 3V0VB 1A6AB 3DUHA 4YUEH 3OQRA 2DBLL 3CVHH 3F5WB 2VAJA 1BFSA 4JFOA 3BQUC 5SWSB 2CBPA 2FR4B 2BVOB 1M2OA 3ABMB 2R9HD 3ZKND 3PAVA 4BSVB 4M1GL 1XL4A 2G60L 3QCUL 4HJ1A 1NANI 4HCRA 4WU7A 5DS8B 3T8XA 5I23A 1TNNA 3BMWA 5AEAA 2MCPH 2NQCA 3BQUD 3BZ5A 3I6LE 3QWOB 5I9QC 2ZCHL 4KDVA 3K2IA 4JO2H 4GG6A 1E4KC 1Y6NR 2VM4A 4U05A 4QMEA 5GRJH 3M7FB 5HVGB 4GG8A 1LD9A 3C6LC 3OBAA 4FI7A 1P4IL 4KXAA 2EE6A 3Q8CA 1BQSA 1S5IH 2XU9A 3LXAA 4M5YH 3TZVC 2PF6A 5EUOE 4WU7B 5TPWH 1KXTB 1U33A 2E9JA 1TVHA 3EBIA 3NJJA 3T8XB 1RZ7L 1SBSH 3HS0A 4UT6A 3UBXG 5EOCH 4HIIA 3C6LD 1AHMA 4KHTL 3H53A 5HHVL 3TNMA 2NY1C 1FGNL 3LXBA 3N04A 3EJTA 3ROLB 1I3RA 5H94B 4JY4B 3UYPB 1LD9B 1DQKA 3DBSA 3N50A 1WFTA 2D03L 4Y5XA 2DQGH 2J3SA 3OKNA 2WWNA 5E23A 2JELL 5KBLA 1L9NA 2EADA 5DJ6B 3U4AA 3MACH 4CC4C 3QFDA 3UTSA 4BSWA 5LGYA 1A1NA 3IMWA 2VQ1A 1IGJA 2RHEA 1G0YR 2W60A 2YD0A 5CXPA 1HEZA 3FTUA 3OAYH 3EH5B 1QWUA 3OAUL 2FWOA 2EXTA 4ZO7A 4ANXA 1FL6A 4U1NA 1MCNA 4PTTA 4HDIA 5AOKA 3DLQR 4A66A 1R24A 4YHOL 4ZI8A 2F68X 4LOVA 2AW2A 1XMEB 2KT6A 2P80A 2ADJB 2CJUL 3QFDB 5CSZA 3H8NA 3UTSB 4BSWB 3JWDL 4GAJL 2VQ1B 1O6VA 1JOIA 2OXGA 1HEZB 1JVLA 3AXHA 4PJBA 2JCWA 2YOCA 5HDQL 2TSBA 4P5TA 4YDMA 2ARJB 5GRWA 1FL6B 3VD5A 4U1NB 3N41F 4HDIB 4HEPA 4JG0H 1R24B 2C4XA 3QRGH 4L0PB 2AQSA 2VLJA 4JPSA 3RWJB 4LSSH 4YBQC 3MGTA 4JZJC 3SQRA 2ITFA 4LKCA 3VW3L 3ZT6A 2DLFL 1AZBA 1GYWA 1N67A 2ZG1A 3ZE2F 1DBJH 1ZRUA 1CXFA 4PJBB 4N0CC 5DQJA 2O5ZH 2WWOA 2R51A 1URZA 1NCBL 4JL1A 2X6MA 5JA8B 4P5TB 5F8RC 1IKFH 1A1MA 1Y18A 1CDYA 2ILLA 4ZTOL 3B2VL 3N6YA 5L4JA 4JO4L 4KGLA 1JJUA 3AG4B 3BUQA 4KPHL 1D9KC 3R1GL 4P2OC 4YHLH 5BVPH 3S36L 3BP4B 2VLJB 4N20A 5HHMB 1HC1A 2FH6A 4GMSL 5AOLA 4FCAA 4N0CD 3LNHA 3RUGF 2DQDH 1KCKA 2OKMA 3T3PE 3MGTB 3IWVA 2ATPA 2IBZX 2VIRB 2GI7A 4XC3L 4LKCB 3ZMNA 1WQVT 4KRLB 3ULUL 4HD5A 2VM3A 2BNRA 4MJHA 5DQJB 2GTZA 1BVKB 2IV9A 4NJ9L 4WFHE 1Y18B 5D6CA 3NZHH 4YSPA 1OTSD 1D5MB 1E8ZA 4Z7QE 4L18A 4WVRA 3ETBF 2FT8A 4BQ6A 3WSQL 2Z35B 4XMLH 5CN2A 4FQ1L 4XP1L 4IBWA 3F05A 3SDXE 3LJ3A 3I85A 4G6JH 4I18B 1IIKA 4E68A 2ATPB 4L9LC 3EJPA 2WSKA 3RGHA 1X5LA 4CSTA 1FIGH 1KJ2A 1KNOA 4KRMB 4PRNA 5TF0A 1A7QH 3J27A 4KZEL 2BNRB 1YNLH 2GTZB 1YQVL 5TE7H 2WXFA 3GQFA 3QIUA 5EU4A 1OWWA 5D6CB 1CK0L 1ACCA 4ERSH 2GUYA 2VN7A 3LPOA 1OY3B 4IBYA 4BKTC 5D6DA 4AYDC 1F13A 1NBYA 3AWFA 5GS1A 1A22B 3KW7A 1QNZL 3B3IA 1KCSL 5DQDL 3LXCA 5FYKD 1COBA 3CHPA 1TTBA 4APQB 3VD7A 1PG7X 1QR1A 1KNOB 1XGQA 2HG0A 4AKOA 5DFVC 4M6MH 1KV7A 3MCG1 5KBPA 3QIUB 2I07A 5EUOF 1SMAA 5ACZA 4C59B 1YAZA 1UXWA 1BGXL 3E6FA 1JPFA 4P59L 3ZTJH 1S7XA 2R2EA 5BO1H 1P7BA 2W07B 3NSXA 1FFOA 1ZOXA 2CKBL 1F4WH 1ZPLA 2NY0B 3Q8BA 5IJDC 5DFVD 1MCJA 3RHWK 4FCHA 2DI8A 3O6FD 3UBFA 5JO5A 2JIXB 2E27H 3NFPB 1QR1B 1XGQB 5FF6A 4N86A 4CMMA 5IBUB 4F2ME 1RUQH 5ACZB 5C09A 2Q3AA 2NSQA 3KJ6H 1UXWB 3DO7A 3E6FB 1JPFB 1SJMA 2H32H 5EBLB 1S7XB 1ICTA 2R2EB 3FQTB 3O2DA 1FFOB 2EDKA 3QJSB 4LIQE 4C8XA 5GRVK 4JRXA 3K3QA 4Z7NB 2JLLA 1OP3H 4NQEB 2Q7AA 4KKZA 1K8DB 5ICYA 2B4CC 4P57A 3Q5YA 1TJGH 3BKML 3R0NA 1VFAB 1X3DA 1UWGL 4K94L 4X6DA 5FF6B 5GGVL 4CMMB 3L7FA 1CXHA 4XO3A 5C09B 1VEOA 4KKBD 3ME0A 1SLWA 4UYPA 1QG3A 3PJLA 1NUDA 1QSEE 1R46A 2MH4A 2VJ8A 1XIWB 3AW5A 2QKSA 4JRXB 5F7EH 4WHTA 2WYZA 5I1HL 1T5KA 4MRCA 4J2XA 3SJVB 4RNRA 2Z92A 5ADPH 4KH2A 1AR2A 4FQ2H 4MX7A 4P57B 4GRWB 5EIQA 4ZXBB 4JVWA 2MEJB 4XMXA 2CAKA 3UERA 4GEJA 3QJTB 4HK3J 3L7FB 2Q7YB 3CIQA 1NMCC 1U8QA 4MNHB 3ME0B 5AKTA 1GMIA 5H2BA 5BUPA 1F11A 2GK0B 5BMFL 4YDNA 4MMXA 1NGWA 1TOXA 5LGJA 4OCNC 2TRYA 3E3QE 1OIOA 4WHTB 1CTOA 2BSCA 3ZDZB 5KVFH 1C8PA 1NBVH 2Z92B 4K7PH 1X4ZA 4MX7B 3MOBL 2YOAA 2V8MA 4TSAL 4Z23A 3FQ1A 4N85A 4LSUL 4ZPVA 3QS3A 1SVBA 4IRZH 5KWYC 1ZVSA 1AHKA 4N8CL 1K6QH 5C71A 1B4JH 1JVKA 1U8QB 4N4YB 4DK3A 1PZAA 4AYFB 1CR9H 5EA0H 3VG9C 1F11B 1A7OL 3OKMB 4OLUL 2XPZA 3U0PA 4MMXB 5LGJB 3PLYA 1UD2A 3GSVB 4DP6X 4TUJA 1T0MA 2IGTA 2CO6A 4XN2A 4AJ0A 4PMFA 3GIZH 4J8QA 4PW9A 4Z7QF 3F62A 2ZOKA 3ZL4H 5IF0A 3TCLA 4ZPVB 5CGMA 1KACB 3SDXF 4KVCH 4LCIL 4TL5A 4XP9L 1ZVSB 4LXFA 1U9KA 3E1ZA 5E1HB 3KR3H 3P69A 5JHMA 4D3CL 3TTYA 2J8UE 4OD3L 3WNOA 1VENA 3OXSA 5HPMA 4YSSA 5C2BH 3IXTA 4DP1X 3ZLQC 3W5NA 1T0MB 2DKSA 1F18A 1IX2A 4K8RL 2DQFA 3X17A 2XZQH 4A6YL 5JYMA 4GYBA 4KTDH 3RFZC 2YQGA 1VZIA 1CFNB 3QISA 2ZOKB 1QLRA 2V2WA 4LCYB 4DKDC 1J0HA 2QR0A 2Y7NA 3MV7A 1OK0A 4RISH 2A6KA 5FGCB 2XN9E 3TO4A 3CX5K 4UQ3A 3RVVC 4A2FA 1Y6KR 1SQMA 3CVHB 3IXTB 4MYPA 2FATH 2Z31B 2C7UA 1GZPA 3WI9A 4U33A 3BKYH 2H5UA 1GGYA 4N8PA 1RVFH 2OR7A 4Q9QH 3SDCB 1MHEA 5FUOH 4XBEH 1QLRB 4DJMA 3LKNA 2V2WB 4N0FB 4ZUSB 5I6NA 5IMMB 1ADWA 3MV7B 3S0PA 5T5FL 2A6KB 4JNXA 2VDMH 3D39B 3TO4B 2EVJA 1F00I 3IVKA 1WBYA 4GNKB 3OLGA 1Q9WA 1GZPB 2WIMA 3P0VL 3A3YB 3B9EA 4Y9FA 3VWJD 3OLEA 1RUKL 2M2DA 4JKKA 1WAAE 2Q76A 4HX1B 2VE6A 1DE4A 3O45A 1S78C 3LKNB 5J9PB 1WA0X 4ODTH 3ARWA 4KTYA 3PHSA 4XZ4A 1HKFA 2IFFL 2UY7A 4YXKH 4A1RA 4AJVA 5JTWA 4PM1A 5BNXD 4K8RD 2CXKA 1VKXA 5I19H 2OCJA 2NCEA 3ELAT 3QQ3A 3IVKB 1KEGH 1Q9WB 2W5PA 2QQQA 1QI5A 3GM8A 3LMJL 1RSYA 3QXAA 1OT4A 1SM3H 3NJNA 4MLIA 4K3JL 2AK1H 2GJRA 1LP9F 1YYLL 3OB0H 4HUKB 5GRUH 5B39G 2F7OA 5DFTA 4LSRH 4FYRA 2MOVA 2PYEE 1HI6A 3PWJB 1IMHC 3SD2A 3SDYH 3KVDD 2VE6B 1DE4B 3O45B 1Z1WA 5F1OB 4I3SH 2OYLA 4NM4H 3K74B 1GC1C 1CGUA 2R2HA 1ET8A 5F7HA 1NBZA 3B9DA 1XAUA 1H6UA 15C8L 4Z7OB 1MY5A 3W9DA 2NY2D 2GABA 4GSRA 3N40P 3QCTL 1ZLUH 4BQ9A 5D1XA 1PX3A 1BJMA 4F8OA 1X5KA 2YEZB 5DZ9A 4N8UA 4WI3A 4Y5YA 4AIEA 2GHWB 3QI9C 2BSBA 2FO1A 2VXSL 4P5RA 1SHXA 1RUPL 2IG2L 3EYFA 1MQ8A 5EIVA 1NCCL 2CUIA 5JOPE 3MBXH 1FYHB 2R2HB 1DVUA 1NBZB 2HVKA 2VDNH 1TYJA 5C0CA 3GXNA 3NSFA 3TEUA 1HTYA 3JV4B 3QI9D 2OMTA 4X80H 4Z7AA 5D1XB 5T3ZH 1JGVH 4LPVA 2DV6A 2F18A 2YHGA 2H8PA 1JE6A 1OAKL 2YFOA 2WXHA 3L5WA 3PQYB 4MAUH 1XD0A 4Y5YB 4ZMLA 1EGJH 3UBHA 5BOJA 5EMYA 1CD9B 2F9BT 3RX5A 4W6XB 1KIPA 3IRZA 3WFCH 4H88H 1KDIA 4AY0A 4ACPA 3NH7L 1KCRH 2HVKB 1YJDL 2Z4TA 1FE8L 1WD9A 3BWUF 3V8OA 5C0CB 2WO2B 4EXKA 1M6UA 1PGRB 3RAJL 3V4PL 4IS6B 3ULAB 3NPSB 4B9PA 2N1KA 4Y5XB 2H8PB 4B95C 4KDWA 2YA0A 2J8UF 1NC2D 5HYIA 3MRQB 5C2UB 4DGIL 4TNGA 1U8PA 3VFWA 4NN6C 1KIPB 3BSHA 2GC7C 4LVHC 4JM0A 1FSKB 2OMXB 1P6FA 2KZ1B 3LOWA 4ZDHB 3NIDB 4QTHA 4UDUA 4DQAA 1KELL 3IU3A 1CL7H 4FFWD 4PJ5E 1LE5B 3NCYS 2E6JA 5KOVC 3BGAA 3QGVA 3SCMA 1E4XL 4L3CA 4GKLA 2GSGA 4PRIB 4WFHD 4EUPH 2BNQA 4UOQA 3K8KA 4PLOB 4M4PA 3BD5A 3B2XA 5LWYH 1OEZW 3BGFB 3OGCB 3ZE0B 1UB6A 4DKAA 2FD6H 4ZMVA 1QYGH 1G84A 4JGMA 3N85H 3F04A 5KYYA 1IJ9A 4N2EA 1FHNA 2L7JA 2XI9A 1JWUA 2A83A 4M00A 4N1HB 5M95B 2CM6A 2GT9A 4X9GA 1TTRA 1NBCA 4L3CB 1MCFA 1PKQE 1RIUH 3CGTA 4HIXL 4U0RC 2WYTA 3WHXA 4AEIL 2F2HA 3NIGE 5I5IA 5EIIG 1NICA 3UZVA 3FO1A 4M7JH 2YRZA 4G1EA 1S9KC 2O5YL 3HC0A 2F8IA 4YGVA 3LS4H 4A2DA 4P3CH 4ECNA 1DANU 4RDQG 4BEIA 1PFCA 5JW4M 1D7CA 3CV5A 3WEOA 5KYYB 2BJML 5I1GL 5K9OA 1BCIA 5HP5A 2KQNA 3MV9A 2Z1PA 2B9AA 3IRPX 3VFUB 2HLFD 3FN0L 5J89A 2A83B 5D1QE 3IEAA 4NQSB 2F6AA 2GT9B 3A4FA 3GJFK 3LXUX 5FECA 3KLLA 5D7JC 3WHXB 3BDYL 1F8TH 2IGFL 2VW7A 1EVUA 5EWIL 1E5YA 5FYJE 5CD3B 1DQTA 3UZVB 3HC0B 1IKNC 1ZCRA 1TXKA 3SE8L 2Z9TA 5EDXA 3JUYA 3P9WB 5SV4A 1NFAA 3FRUB 2SEBA 1JPTL 3OPZH 2VUKA 3AMLA 3QC5X 4WTZA 4H26A 3MV9B 5D7JD 1MCEA 5CEYA 3EJYC 1KN2L 1N0LB 4M1GH 4KJPD 3HLKA 3G6AA 3CQPA 2G60H 3QCUH 3GTTA 3ZT7A 1BQRA 1XB3A 2V9RA 4P46B 4I1RA 5C0AA 4LBEB 1VPOL 3E38A 3HKFA 3M7OA 1PCXA 4Z3EA 2VL4A 4UQ2A 5EO9A 5HJ3A 5AYUL 2ZCHH 1CICD 2J72A 4EQ2A 4N6RA 3CFMA 2ZYIA 2SEBB 4TVPL 3BX7C 4E41E 3VXOA 1YC8A 4H26B 4YFLF 4GS7C 1DQLH 1EBAA 4JPQA 4LDCA 5GGUA 1P4IH 5CEYB 3BIKA 2AJYL 4XN4A 1AIZA 1KGYE 3VGAB 3G6AB 5IB5B 3DV6A 2PWEA 4I5BA 5B1JA 3RU8L 4JLRA 3K71A 1LE9A 4LPUA 1K2DA 4OM0L 2IOMA 5C0AB 2WB1A 1EWHA 1RZ7H 4RFOH 1YUKB 2CQVA 3KEDA 2RJMA 5IMLA 5EPMA 4FG6D 5LQBL 4QXWA 4UQ2B 2JJTC 1OAXL 3OR7B 1P5VA 4KHTH 1QSED 1UEYA 2BXZA 5EO9B 4Z0XA 5HHVH 4N6RB 1FGNH 3H9SB 2VC2L 3VXOB 1OGAB 1F86A 2VDLL 4G43A 4IEFB 5DMYA 1S7QA 2NRDA 1YEWA 4QF1A 4RMBA 1FC1A 3EJZD 3QQ9C 3BIKB 3M8OH 3E3QC 4WJ5B 3IWUA 5K69A 1N6QH 1J9SA 1C7TA 1TVBA 2E4FA 3DV6B 4I5BB 4POZC 3UL4A 3K71B 1LE9B 4WO4D 4PSPA 1JV2A 3ULSA 1JHKL 2WBKA 2C3GA 4TOYL 1RZKC 5IVXB 5L6YL 5IMLB 1NCDL 2CO4A 3O9WB 3KYKL 2E7LC 4Z0XB 2A9BA 3OAUH 1DJIA 2BSRA 3GI9H 1H9DA 4G43B 4MNGB 5E7FA 2I5YH 3L54A 4U3HA 3VH8G 1S7QB 5IHLB 2HLEB 3U7YH 4GG6E 4QF1B 3BVXA 1HCZA 1LVEA 4YHOH 2Z1KA 4MAYC 4ZX5A 4E5XA 1R75A 1TVBB 3SZ6A 3LH8A 2NXZB 1OSPL 3P3SA 2EIBA 3GBLA 1JV2B 3BWUC 5IFAL 4TVPD 1THCA 4LPCA 1T2JA 4HIHA 2X05A 3JWDH 3RZWA 1QA9B 5AG9A 1JMZA 4PUBL 5A43C 2BSRB 4MAYD 1NDTA 4MMZC 5IROD 1QSFD 5HDQH 2Y1ZA 1TO5A 2WXGA 4PVMA 2DL2A 2WXKA 4JX0A 3HNSH 3MV8A 4FLHA 1XEDA 4HUWA 4KJWD 4YSAA 3ATDA 3B9KA 3SE9H 1F1DA 2BRRL 4E5XB 3SGDI 4U1LA 4U3SA 2OCFD 3LQMA 3NJVA 3ESVF 1ZIAA 4FGMA 4TQPA 4HIHB 1GOFA 3NA9L 4CDHA 1MW0A 2QVIA 4LSQL 1J9CT 2J1YA 2F7RA 3NZ8B 4LF3B 3TYGL 3BZDA 1AZNA 1JNNL 4IKIA 5J7CC 3F58L 4UTAA 4WU5A 1M7UA 4ZTOH 3UYOD 3KXFD 4JO4H 3ATAA 5CEXA 4KPHH 3R1GH 4E9YA 3IGAA 3B9KB 3S36H 4KNQA 2OTWB 2CHZA 3MOAL 3A0OA 4U1LB 2JQMA 4PJHE 3MLZL 1RIHH 2Z6FA 4Z3FA 1ZJBA 3MBEA 4GY4A 3WS3A 2DM3A 3CZGA 4XC3H 1OAYL 4ZQKA 2BIQA 5ITBH 5ESVA 1WZAA 3BP6B 4DOHE 3VWKD 5FFOA 5IESL 4NJ9H 1U8MA 5E6SB 4WU5B 4PJBE 1ZIBA 3C9NA 5D93B 2PO6A 2ZONA 4W9CC 5EO0B 3D34A 3CDGA 5CEXB 2Z0BA 3GFUA 3IGAB 4P3WA 5I0XA 3KPQA 5E4EC 1IM3A 2LR4A 4FQXD 4R7XA 4GB9A 5I0YA 3WSQH 1JWSB 5HTSA 4FQ1H 4JBSA 4XP1H 1O75A 2EVFA 2Z3FA 3MBEB 3RX8A 3WS3B 2IDSA 3DJTA 5FHAL 3K4ZA 1B0IA 1DBKL 4ZQKB 5F96H 4L8DB 1KUMA 3TN0A 4MWFB 1OAZL 4AGQA 3MUY1 4KZEH 5ESVB 1TKWA 4L4TA 1JGEA 5CSGA 5DWUL 1YQVH 3FTXA 1V54B 1U8MB 2JVUA 3C08L 3KL3A 1E5BA 3L4TA 3QHFL 1H8NA 3C9NB 1CK0H 1JFHA 3B1UA 4OLEA 5C0EA 2EVHA 1C5DB 4R7LA 4AGNA 4OQ1A 3GK8L 1V5JA 4TUOB 1IM3B 4Z3IA 5DMJB 1W80A 1QNZH 4XT1C 4R96A 2B8OT 1GOGA 1KCSH 3QFJE 1F3DJ 2R59A 1MSPA 3OKEA 5I8EA 3PJNA 1S9XB 1GW6A 5DUML 2N0MA 2NMSA 1TKWB 2QBWA 4L4TB 2C3XA 3O0LA 3PHQA 1YHPA 4C54A 3K2MC 3EH3B 1MZYA 1SLUA 3BFQG 1BGXH 5C0EB 2WLKA 3FFCB 1JZGA 4H25A 5C6TH 1OD9A 4F5CA 3AM8C 3PDOA 4TLTA 2CKBH 2WKOA 1E28B 1PTZA 1GY1A 2A2QT 2BZ7A 2ICWI 2LTQB 3ISWA 3POHA 4WNQA 3CSGA 3ML8A 4RDBA 2ENJA 5GSVA 2UUDK 2QVTA 3HIZA 3OKEB 3ES6B 5I8EB 1LK2A 4AVIA 4X7FC 4JKPL 3HOGA 2EH8L 4ZOAA 1HQRA 5E6IC 3SKNB 4H25B 3WY4A 2X0WA 4RCAA 4YSEA 5KZCB 3PDOB 2ZAHA 3N40F 4Z7UB 1NGZB 2H6UA 4XNQA 4KK5C 1EEQA 2W9EL 5E2WL 3K0WA 5CGBA 4XPFL 4ZX6A 4WNQB 5I5MA 5GSVB 3TWYA 35C8L 3L45A 2XWRA 5D71L 3U4EA 3VA6A 3ZTDC 5E08L 2ORBL 4K9EL 4KROC 2VDNB 1LK2B 1PZ3A 3PP4L 4AMKH 2VO8A 5JORA 4YS4A 1UWGH 5GGVH 1HQRB 1U36A 4X0KB 2H26A 5FX3A 2N7BA 4GIAA 2IEPA 3I6GA 2GCYB 2MCAA 4R2GD 3II1A 3HW7A 1OE2A 2EO7A 4JS7A 1E6JH 1QABA 1FA4A 4YX2L 3FAWA 4OLZL 4S1DD 4U6VL 5M7QA 5I8KL 5I1HH 1AGEA 4HA1A 2Z0UA 3QZWG 2WXQA 3U4EB 2P8MB 5JNYB 1ZGLM 5LXVA 5AKVA 2WP3T 1CXIA 1IAIH 5JORB 4FQQA 5AVTB 1B6UA 1YEHL 2H26B 3FC8A 5DZJA 4EUPA 2VB5A 4M43L 1V3KA 3I6GB 4E9XA 4XMTA 4G8IB 2VXVL 2IAMD 3CPLA 3Q0HA 4AV0A 3BN3B 5BMFH 3DRQA 2DJSA 1L9SA 2UWEB 2VZSA 5HD8C 1AGEB 2ZXQA 1CBVL 4JHAL 1HIMH 1AFVH 3EFOA 1MREL 1XR8A 3RPKA 3MOBH 4LCCC 4LSDA 2K3HA 4BK8A 3RZCC 1IFGA 4FQQB 3P30L 4LKXA 3LPFA 4GRWE 2FZ3A 4EUPB 2W81C 4M1DL 4OFKA 5HD8D 2L8AA 2B59A 4X6DE 3INUL 2NZ9C 4LVNB 3CHXA 3IDGA 4XC1L 5EZLA 3CPLB 1A7OH 3IYLW 3BRDA 2MQCA 2A9ML 3WGUB 1I1FA 2H6PB 3DRQB 5HHOD 3RZCD 4GAYA 4PJBF 1UJTA 3QDGA 3KD4A 2HLAA 3FQUA 1NDGB 1U91B 4V1DB 3W3BA 5BVJA 5I1AA 4L4VA 4AK1A 2WQAA 2FZ3B 4LCIH 5EOTA 4JGJA 4XP9H 2AF2A 2PCYA 5IFHL 5D1QC 1DJWA 4D3CH 5IJKC 2IQAA 2WYIA 4OD3H 3IDGB 5EZLB 1CJYA 3BDXA 4QTIH 1YEKH 4ELKA 1I1FB 1NPJA 3CHQA 4GAYB 3BEVA 1MIMH 3ASWA 5CGYD 1DHKA 2HLAB 2L4OA 3FQUB 5PAZA 1NEUA 3TLRA 4GW5B 5BVJB 1TZAA 5I1AB 3V6FA 4YWGL 5TE6L 1EZUA 3MRKA 1GJUA 4JQVC 4KKCC 3WE1A 3STBA 4XI5D 4F8PA 3POCA 4ABVA 3U4BL 1PZBA 2D0HA 3D0LA 4AT6B 2FJSA 2IQAB 4MS8C 1Q0EA 4OIIH 1M05A 1PIFA 5TE4L 3UACA 4ELKB 5IVZA 1W8EA 3BEVB 3FTSA 5AW2B 1THAA 4Y5VA 4KKCD 2ZAGA 1MCPH 2AQ1A 3FHQA 1L4IA 1VIWA 1M3IA 5JA9A 3DI2B 1T66C 4WW1A 3TH3T 2NR6C 3ZTEA 1WBZA 3NUKA 4ZMAT 1ASPA 5E8DL 1MAML 3L4UA 1TPXC 1NCUA 4HOWA 1UTDA 3PWLB 2ZCKL 5MENB 2ZWZA 3WFDH 3D0LB 1PZ2A 3V0JA 5KJRH 3HHMA 4PD4K 5T5FH 4JG1L 3W0WD 3HZVA 3HN3A 5EB9A 2P4AB 3ILQD 4LO9A 5FGCE 5HI5D 5AVVB 5IVZB 1LJMA 5L0QB 4Y5VB 1R5VB 2WM0A 2Y36L 1IVTA 3O4OC 1SGKA 4XXCA 4DP4X 1WBZB 3BT2L 5A2AA 1ZA6A 4NP4H 4RLDA 3SZKC 2NUPA 1KTCA 2WLHA 4IRSD 2IFFH 3ZR6A 3G3LA 3MFGB 2Q2EB 3HZVB 2CU9A 2P5EA 3MV7E 2BWDA 5E7BA 4O58H 1J0IA 2MHAA 3V0FA 3RWIA 3QJRB 1KCVL 1HJCA 3OR6A 3ZJAA 2OBGA 3UBXB 1A7PH 1AS6A 1MW3A 4K3JH 3W11C 1YYLH 2D9CA 3K6SA 5GSRA 2K4AA 4WNJA 3BIAX 1MLCA 2QSTA 4HUXA 4M56A 1DSFL 5F21B 4KO7A 3QIWB 3X1EA 1MCHA 2W65B 4XOAA 2AEWA 1E5UI 1ZA6B 1ZY9A 2DN7A 3UO1H 5B8CB 3CFIC 3W11D 3NQIA 4XH2B 2LLLA 15C8H 4QAMB 3QRBA 2DEXX 4IGBD 3RWIB 4BWTA 3B8YA 1H5BC 2FUTA 1ETA1 1BWWA 1F3DH 2NT1A 3BFOA 1HH6A 4KU1A 1FAIH 3NSYA 3K6SB 2GHZA 3HS0C 5GSRB 1JYVA 4HG4K 5L7XL 1MLCB 1DVYA 3V6ZB 3NJGA 5F6HI 4MZ3A 2IG2H 4UF7C 4JW3A 2AQ3A 5JXAL 1YDPA 5F1NA 2DW5A 3WEAA 3WMPA 1YEEL 1SF3A 1KN4L 2VXUH 2X5PA 3FZUC 1BOYA 3QJVB 4FX5A 4E0RA 3KPSD 4CL7A 3C6SB 4XPTH 3MXWL 3PV6A 5JQIB 4C47A 4GRWF 4YFEA 3FW6A 1ZLVK 1HH6B 2BHUA 2EILB 3DTXA 2EC9U 1QI3A 3VI3A 3ZHKA 4X6DF 2ATAA 3IGKA 1NTDA 5JHDE 2YD9A 1W8OA 2KS0A 4AQEB 4RSYA 4XPBH 5TH2A 2HJLA 1TF4A 4FNTA 4YK4B 3WFEL 1ZSDB 2CZNA 5FV1L 3ARFB 2RTTA 5CP3A 1YDPB 2R2BA 3NH7H 4P2QA 3V8CA 2B1OA 3BO8B 3B7UX 1HE7A 3AUWB 3DARA 2WHVA 4QRUA 4X9BA 3FT3B 3H6AA 1XSJA 2DQIL 3ULVL 1OCZB 4XVSH 2YWYA 1G7QA 2QT6A 1QOKA 3RAJH 3MBWA 3RWHA 1PZ5B 3VI3B 1BAFL 4JPWH 4U6HB 5D1XE 4Z18A 5I6PA 1FG2B 1ZHLA 1JYXA 5GGSY 4F7EA 4JFPB 5TH2B 2HJLB 4DGIH 3MJGX 1YPZA 2XY1A 2WC7A 3RVWD 4NQXA 5CWSA 1BEYL 1YNTA 3VYOA 5GZND 4QEGA 4P5TC 2RIKA 2R2BB 4HQQL 5IREA 1FDLH 1UD5A 1VRSA 2WWKO 1KELH 3FUEA 3QAZC 4QRUB 5C6WH 2MTAA 1L5GA 1R3HA 3MLRL 2GIMA 1FNGB 2X1XR 5CO1A 1MUJA 1I9JH 1RZQA 5C0CE 5IOKA 1E4XH 1JCVA 3MBWB 4NERA 3RWHB 2ZCZA 4DP2X 1CTNA 2NW2A 3N55A 4S1QH 5FGBA 3D25A 2LVEA 4FQLL 4IJ3B 2LLGA 5HPOA 4NQXB 3NFNA 5AD0A 5CWSB 1YNTB 4W9LC 2OS7A 5IB3A 4ORGA 4UT7L 5IR1A 2V5YA 2HN7A 3ML9A 3F6JA 5ITFB 2AEQH 3ARQA 3PAYA 3SBRA 5JR1L 3NIDE 1R3HB 3NRQA 1B3JA 1E30A 2AFNA 1USQA 1MUJB 4UYQA 3ZHDA 4U7KA 1DQML 3OKYA 4UUJA 2AKRA 2B3IA 2JKXA 3QJOA 5DVLA 2NW2B 4O2FA 1W72L 5L9DL 1TTFA 2IWFA 5A16A 2O5YH 3D25B 3MRCB 5BQ7A 5ESAA 5B38A 5LN8A 3CIAA 5DJCA 3C12A 5AD0B 1MFEL 3U83A 2MCMA 4XX1E 1MY7A 5E00A 1QFHA 1MCRA 3CMOL 3QFJD 4I13B 2H2PC 4ORGB 5IB3B 3SBWA 2DQUL 4FMKA 4O02A 1S9WA 2X4SA 2VLMD 3KHOA 3M07A 4FKKA 5GGRA 3RWEA 4AQEA 1XZ0B 4BQ8A 3GZOA 5JUEL 2HXAA 5IHZA 3LNDA 2XWJA 2AKRB 4ZMTA 2O6DA 3BDYH 3LKRA 5HGBA 5EWIH 4O2FB 3OG6B 3AMKA 1IEAA 2BNQE 2H2PD 5E99L 2ZE0A 5BQ7B 3SE8H 2FHBA 5B38B 3EDDA 3DYMA 3KBFA 2E56A 5DJCB 3CXFA 2OL3L 3WUWG 2W0PA 5E00B 4BGDA 3O2WL 2A9NL 1ZLSH 3FHAA 1KN2H 4N5EC 2X4SB 4XHJC 3KG5A 3MOQA 5GGRB 1SY6L 4UILH 4G8FA 4YLQT 4GUPB 5D6DC 4NKOA 3RWEB 2MQ0A 4NQCD 4UTBL 5GS1C 4JHUA 2EDQA 3U36A 4DETA 4E9QA 1H6TA 4U49A 4EOWL 1NCWL 5IHZB 1FAKT 5KSAA 2HTKC 2JI2A 1JZDC 1XGZA 4ZUVA 1NPNA 4E42A 3LKRB 5HGBB 3ARDA 4XP6L 4PJDA 1IEAB 2WLYA 1K4DA 3B5HA 4QOKA 4ZW7A 1K9TA 1F6LL 4N5ED 4JL2A 5F7NC 2NY4B 4L3EA 4FHJA 2KBGA 3P2DA 4H0IA 5KAQF 1WZ1L 1Z0NA 2WBJB 4E9SA 4FNLL 1FJ1A 2MQ3A 2VLRA 3LKSA 5KANG 5LGHL 1IQWL 3PG2A 4XTRC 3WDHA 3R4RA 1KG0A 3MV9E 4NKOB 2OSYA 5KSAB 4O9HL 5KS9B 1QATA 3X14A 5I1EL 4LQFL 1Y1DA 1ZT4A 4E42B 3ARDB 1P0SE 5DJYB 1RV6X 4QOKB 5LQBH 2H3KA 4JFXB 1FNFA 3CZFB 3D0VA 4A63A 4NO0D 3NCEB 4L3EB 4OM1L 4PJ9D 5SWZB 3SDDB 4POUB 3SGEH 4JN1L 1FJ1B 4HJEA 4PBXA 2PWDA 4EI0A 1KG0B 2FRGP 1OB0A 3VXSE 4S0SD 3CFKA 4ZMPA 3LDBB 4MXQC 3AJ7A 4DPCX 1JHKH 4KOCA 2F8VA 2YEVB 5A2FA 4TOYH 1MCOL 5E5UB 1MI5D 5L6YH 2WBWB 5C0AE 2VLKD 2DI9A 1BFVL 1XBRA 1XF4B 1RHHB 3KYKH 2VZUA 1J5CA 4FNPA 5F2FA 3MPCA 2AXJA 4ILDA 3L3DB 3LQAC 1RSFA 4I48B 2YRBA 5T1MB 1J9QA 2OMBA 2FHCA 5IB4B 3LYRA 4H2AA 5FKAB 3CFKB 1FZOA 1V27A 1OSPH 2EH7L 2WBXA 1NCJA 2QDWA 2OR8A 3DMMD 3PL6C 3L17A 1SN2A 3ARVA 3OKLA 5KVEL 3L7EA 1YYML 4EZLA 4PUBH 1DVFA 1CG9A 2WY3B 4HLZG 3E8UH 3T6VA 5E70A 4AH2A 3LZQA 5ANMA 4J3VA 3EYOA 1QEWA 3B2MA 4RAUB 4RFNC 4QXUH 2YAOA 1W15A 3GJEA 5I71B 3PL6D 1NM9A 3E2HB 3H42L 3APNA 1DQDL 4XBPB 1KB5H 5EEYA 1IV8A 1WA2X 4LPYA 1KCLA 1PVHA 2X3AA 4BFFA 4YHML 5KJ7E 4XXWA 3SPIA 4P8QA 4GRMB 3NA9H 4NZUL 3D2TA 3OKLB 3L7EB 3NIDF 4FA6A 2JH2A 3VNYA 4C83A 4MA3B 4LSQH 4NRYB 4DFHA 3TYGH 4OZGE 1CG9B 5I28A 1IBGL 4GI8A 4AH2B 4IRJB 5LG1A 2HKHL 3EYOB 1QEWB 4XGZB 3BSZA 3QUML 3PJSA 1ONQA 4YBLC 1D5BA 4PJGE 4OF5A 3BAYA 1INQA 4DVBA 3MOAH 3VE0A 3ZE0F 3CPUA 4MJIA 2ZJSH 3MLZH 1HESA 3X2QB 4TQEL 3V7MA 2BHZA 2XPGA 3GDBA 2WCPA 1OAYH 2J20A 2VNCA 3RTQB 1SEBA 1PW3A 3ZDXE 3JVGC 4Y4FD 1MEXL 4PRBA 4QHKJ 2K6WA 4Y9BA 3WFBH 4G9FA 5IESH 1T1YA 3Q6GL 2I7SA 4AK2A 1HVXA 1T20B 2YAFA 4NDMA 3NTCL 1ONQB 2HCZX 3MV8E 1BMWA 1D5BB 4TUUA 2IC2A 2OM5A 1U4FA 4XZUA 1INQB 1R0AL 2P7TB 1CYGA 2FWUA 4JFFA 1WLHA 1WIOA 4IHOA 4MJIB 5FM8A 4EN3D 4X8GA 3BOVA 1G7HB 2HFFB 2IDTA 3U9UA 5FHAH 3KLHD 2XPGB 1QRNB 5GRVL 3UTTB 3PY9A 3CBRA 2QLYA 1MJJA 1OAZH 3GEFA 3PNWA 5JW5B 5ERWA 1LMIA 2H0PA 2DJ4A 4PRBB 4CU7A 5L2JA 4G9FB 2YPLA 3C08H 3WS6A 2VLLA 3QHFH 5C70A 4OCMC 5F72S 3R4DA 4JFWA 5CHNA 4AL8L 5I5RA 1ILSA 1NC4A 3PNRB 3I74A 2ZSWA 1BQHG 3TO4C 3GK8H 1MAJA 5C07B 1ZLWH 3SIKA 5JW3L 2CA4A 3TNNA 4B9YA 1OLLA 5DJZA 3VXMA 4JFFB 4IHOB 3PP3H 4B3VA 2XNAA 1AVAA 4E9TA 4YNYA 4BA8A 4I7ZC 3UX9B 1MJJB 5DUMH 2VH5H 3MRIA 3PNWB 4FD0A 1DVTA 5ERWB 4QGYA 1G9HA 2VLLB 1ORSB 4O2CB 3VD9A 3REVB 2ZSWB 4J3WA 2NY6D 4EXPX 4OVUA 5T1DL 3CDYA 3TNNB 3WTUA 5DJZB 4FYTA 1QTPA 4JMNA 5F7LB 3VXMB 2VW4A 1PLGH 1NCHA 2XNAB 5FPIA 2V33A 5F7DA 4PP1C 1ET5A 1EEUA 3RY6A 2I60L 3MCYA 2NT0A 3VMNA 3MRIB 4K55A 1MNNA 1KGCE 4EDWL 3K6OA 4AGPA 4L4TE 2NTSP 3VRJA 3RFRA 3GKZA 3B4NA 2R69L 3UCRA 3FT2B 4ODWA 1SFDA 5I6XB 1T21A 5ID1A 4NUQA 1Q94B 4BKSC 1JXDA 2W9EH 2WVTA 4WFGD 2E7MA 4GUOA 2ZKHH 2B4CL 2IWKA 2GBUA 4JJ5A 5IJCC 35C8H 5D71H 1W9XA 1ZA3B 3MJ8B 5F7DB 5E08H 2ORBH 1PD1A 2A3TA 2WXPA 4X6CA 3P11L 3T1FB 1P5UA 2UV3A 1WUZA 2X09A 5ABZA 1EH9A 1CFSA 2EEDA 2WXOA 4E9WA 4Z9KB 2G0LA 3VRJB 1HYSC 2BOCA 3IT8D 1OTTC 2CWRA 5DMIL 5IVXF 4YX2H 4U6VH 4F5CE 4AM0Q 3QWRD 5I8KH 4JJ5B 5D1XC 5CP7A 5A6MA 2ZPKL 2QKIA 3L3KA 1EUUA 5L8LB 4KWUA 4Y5YC 2XLLA 1OPOA 1KLFA 3CZUB 1P5UB 3QQ4A 1TQBB 1YEHH 1RU9H 2WUBL 5CINL 4AEFA 2GTQA 3HEIB 3PUUA 3MGOA 4MXVF 4IKLA 4BH8A 2BOCB 5ETUA 3CSYB 4J4PD 1GS7A 4N5UA 2Z8RA 3QP3A 2QQLL 2VSMB 1Z5YD 3P02A 4L3AA 3AG2B 5CP7B 5G5DA 3VSUA 2QKIB 4JHAH 3RP1A 1ZVHA 4Y5XC 1CBVH 5ESQA 1MREH 3TN0C 3ESNA 5AW0B 1J12A 1J5OL 1KLFB 1MFBL 2ZSVA 5AOMA 1W2KT 3LRLA 3QQ4B 3I75A 4D0CB 3GHPA 3NCBB 1F4AA 5I0DA 4KHXH 2FNWA 4N6QA 2WNGA 4M1DH 4DPAX 1AGFA 3CSPA 4HBCL 4KK6C 1NDMA 3DUSA 5ETUB 1L7IL 1SN0A 3C8HA 2CJ3A 4XC1H 3LEVL 3TN0D 1SDYA 4XBGA 3ZDXF 4APXA 4EE2A 3DETD 4WK4B 3NA4A 4ZUTA 4L8SB 2NLJA 2ZUYA 5F89A 1LQBC 2EXYC 3UEQA 5EEVA 4OGYL 4NFDA 5ESQB 3K1DA 5HBBA 1BF5A 3FTYA 1EXGA 1BW8A 3OG4B 4NENA 1WH0A 2R8SH 4KXCA 3BXNB 2WNKA 3VXRA 2ZSVB 1DEEA 1AXSA 4QUOA 3RURA 2QZQA 5CBEA 1P84J 1JI1A 4PLJD 4B41A 5IFHH 4OUOA 1AGFB 4NCC2 4R4FL 1D5IL 3DUSB 2HRGA 1UA6L 1UT1A 2BFVL 4APXB 4PLNC 3B7RL 2RR3A 4ZUTB 3S5LA 2NLJB 2C4FU 3SCMC 5IVOA 5F89B 2V9QA 5IEKA 1T6VN 2Q1EA 1NCAL 4NENB 4AJWA 4GRLA 2PCFA 1MFMA 2ICCA 3QULA 1Z5LB 3W81A 1AXSB 5KN5A 1GAFL 4YWGH 3M1BB 4LP4A 3AAZA 5CBEB 4I8DA 2D31A 4H20L 3SCMD 3U4BH 5TD4A 2V5SA 3CE1A 4JB9H 3T4AB 1BWMA 1I9IL 2XTJD 3N42F 3QARA 5TE4H 4OBSA 1FNAA 1SNRA 2WQXA 1O7VA 4OBRA 5IEKB 3WNPA 1DLHB 4JFZL 1I3GL 3QDGE 4J39A 4NSKA 2PCFB 1IJNA 4XB8A 1MAMH 2Y1AA 2YZ1A 2YUWA 2OSLA 3AAZB 1T2QL 3ARGD 4L4VE 2D31B 4S1RL 4G5ZL 1FI8C 3CN4A 4JVPA 4LRNH 2D7MA 4P23D 3GXFA 3D12B 1VDGA 3FCSA 1IE4A 2R1YA 4PGEA 3KWVA 4AQZA 3CCHA 5DHXB 1X5JA 3BZFA 2Y07L 5E1IA 2AK4E 1E9OB 4FG4A 3MRFA 4NNXA 4YPGA 4HBQA 1E9QB 4PV1C 2X7LA 3BT2H 2D3NA 4NB7A 2OSLB 2EYTA 2GQHA 3VX0A 5HJDA 2OK0H 4LSVL 2HJKA 4GI6A 4H5SA 2R39A 3ABLB 3GMQA 2WW8A 3FCSB 3FTZA 2WJ5A 5EU6D 1WBXA 3FRPG 3V9FA 3VXUA 4LQ1A 4XCYB 1EEZA 2F54A 2ATKA 4P5SA 1L9RA 4NNXB 1TSRA 1GC1L 3RPIB 3BVUA 2XWXA 3VXSD 4JAMA 3J2PA 2X7LB 4JRYA 5DJ0A 1R5WA 1A2YA 3SE4C 2A4CA 3CZEA 2OJZH 2WKOF 3EFDH 1DDTA 4FABL 3MV11 3Q13A 2YARA 4MQTB 1G7MB 3U0WL 1N7ML 1IZKA 4NO5B 4LLQB 2HJKB 4H5SB 12E8H 4N2LA 1RP9A 5B1JC 2XA8L 5DWPA 4X7SH 3ZN6A 3DHMA 5C6PB 1WBXB 3HN8A 4PJAA 3N43F 1D6VH 4NWUH 4G3YL 1EEZB 1W0WA 2ATKB 2F54B 2NPLX 4M9OA 5I1LB 1GZQB 2B15A 3P54A 4ZAKA 2Y5TA 1UT9A 4NZ8A 4JAMB 1KB5A 1R5WB 4M1CC 4MZIA 3ALXA 1H3XA 2Y06H 4NXSA 4X6FA 3ILDA 3JWNE 5JXAH 1OAJA 3LZRA 4U7MA 1BA9A 4WI8A 4LOUC 4XN8A 4HIEB 2AC0A 1EJFA 2XXMB 3C2AH 3MXWH 1E7VA 2P5EE 1WITA 3RVTC 3TVMD 5IM7A 3E8VA 3ZHFA 3NIFE 1QBLL 1W0WB 4Y16D 1PF3A 4K73A 1LO3L 4X4KA 3H7LA 3QZBA 3FQWA 4HCIA 4XRCB 3GZKA 3I2CH 3SDAA 2DYPD 1KB5B 2P28B 3WFEH 5LHDA 4XHQA 1G9MC 2GITB 2WXMA 3HG2A 1JXFA 3IS1X 4TNVF 4B96A 3U82B 4X7EC 1WF5A 3I3DA 4NC1E 2DQIH 3ULVH 3B1TA 4UIKL 3OKKB 3PUCA 4XVJL 4JO5A 3IMVA 2B2XH 2QADD 3KLKA 2XSKA 2MMXA 1GSKA 1R3KB 3TJEL 1CLZL 1ZWIA 2XXGA 3CH1B 3JWOL 1FZKA 3TBYA 1MDTA 3MCKA 1BEYH 3MAWA 4WDIA 5AAWC 1KENL 4NZJA 4HQQH 1BZQK 2A4ZA 5I17B 4U1IA 3U6RB 3L4VA 5CCKL 4PWHA 2AQQA 4LHUD 2JF1A 3AG3B 2W9DL 2ZP0T 2YR3A 5E9AA 2EDJA 1I53A 3B2DC 3QUYA 3VI3E 5DD0L 4FQLH 4Q6KA 4KXBA 4XP4L 3TBYB 3UO8B 3MCKB 3ROOA 1B4TA 3GO1L 1VGKB 5K39A 4TVSa 2EDTA 4PR5A 5CZVL 4P07A 4P2QE 4W9FC 5JR1H 4HPOL 4DAGL 1W0VB 3DX8A 2H1LM 4A55A 3TBTA 3L4WA 4ZBJA 3MBEC 5EC1A 5H37G 2PXYA 3EHBB 2RQEA 5CF3A 1U8IA 2WKGA 3VXPA 3QUYB 4ISVA 2G4GA 3MZTA 2YQ2A 4W9ZA 4B5EA 1VFMA 3ROOB 5HYSA 5IOPB 3QDJA 5K39B 2VITA 1YPZE 4JDTL 4OCLC 4CJ1A 4FOMA 2NX5A 2PO6C 2YC1A 2Q3ZA 3O6ML 4OZIA 1XVSA 2FQEA 4F15B 3W56A 5EF0A 5CLXA 3DX8B 4GFTB 1XGYH 1K5WA 4U31A 1BFOB 4NUJA 5C0GA 5EC1B 2ZAIA 2PXYB 3D50A 3K46A 4QRPD 5IQ7L 1OARL 3HE7A 2PO6D 5AW3B 5KEZA 2D7PA 3MFFA 4ISVB 3K5SA 2LAAA 3R06A 4Y9GA 3LKQA 3D87B 3JV5A 5CZXC 1E2VA 4P06A 5IB1A 3BE1H 3QDJB 4M02A 2VITB 4PY8I 5HYSB 1HZHL 2A9NH 2NX5B 3UTPE 4OZIB 2YC1B 3GTNA 4KTEL 3FTGB 4QXGL 2Q6WA 1ZXKA 1SY6H 4F91B 2FB4L 5DZOA 1KGCD 3GF8A 4ODSL 1QPPA 1MKFA 4EOWH 1NCWH 4URTB 2ESVD 2F53A 2LE9A 5DDHB 4AV4A 4DGVL 5C0GB 4D9RE 1AQDB 2OZ4A 1R5IA 4H1LH 2F7QA 3HE7B 3QIBA 3HAEH 3R06B 2CBOA 2FEEI 3LKQB 4JM4L 2BSED 5D96C 4R4NC 2QGEA 2WTPA 1WZ1H 4G42A 4FNLH 3BLBA 1MCKA 4IU3B 2ZUWA 5E2UH 1E3ZA 1PLCA 1LEGA 4O9HH 1KYFA 4A7TA 5DJAB 2F53B 4LQFH 2CGRL 3CX5J 3QEQB 4KZDL 3NSJA 1UASA 5TQ0L 4B9IA 3AVEA 3QIBB 8FABA 3B37A 3GRBA 4BZ1A 1K85A 2Y24A 3HC2A 1KTLA 3HG4A 3LZNA 4GO8A 4H40A 2WD0A 1WIPA 2NYYC 4OM1H 1T4KA 5E51A 2WV3A 3BLKA 4HULB 1FCCA 3NIFF 5MHSD 3N44B 3IKKA 4G42B 4M3HA 4MB4A 1I7ZB 4ESKA 4HUVB 4LSTL 1QASA 5IK3A 3VSVA 1ZSHA 4HF5H 1PY9A 3TA3A 3AC0A 2MRYA 3GMPA 4I0KA 3SHSA 1G87A 2XTSA 1OV8A 4OZFH 5F7MC 1I82A 4LAQL 1MCOH 3ZHNA 3CG8A 4IK7A 3O3BA 3A5VA 4IOFC 8FABB 4HSCX 4M62L 3DSFL 5J56B 4PJDE 1KTLB 3IBOA 4QOKE 4WFFE 2W59A 2VERN 1RUML 2BO0A 5CKAA 3PWPA 3LNEA 5C0DB 1FN4A 1UWFA 2JCCB 2JMRA 2AHIA 5IK3B 4LEOB 3GRWA 4POYA 2VLRE 2J88L 3GMPB 1ZLUK 4IOFD 1LMKA 3CVIH 1RERA 3ETBJ 4CU6A 1AGDB 3O3BB 1YYMH 3WDJA 5AZUA 3BCFA 3QNYA 4BWWA 1PIGA 5G4MA 3WKML 4L48A 1N5YH 5KBDA 4Q97A 5E03A 5BOZG 4DEWA 4RGMC 1FN4B 1NCOA 4P2RE 4AGMA 1Z9PA 1QQDA 4AQ1C 4IIQA 4DT2A 3VI3F 3H42H 4HWBH 3Q44A 1AY1L 4HLZH 3KPPB 4HP5A 2X2YA 3CLFL 5F9JA 2BVPA 3L6FA 2LAGB 2LQRA 2PR4L 2WTOA 5E0QA 2G3MA 3P73B 4MLSA 3UZQB 1OSZB 3KL5A 2W88A 3IJ7A 4YHMH 5JW4N 5CAYB 2DIEA 5FO8A 5L2KB 4C56A 4NZUH 2FEJA 3KPLB 5C0BA 3ZR5A 3QNYB 3LIZA 4PV9A 1UWEL 4ZTEA 3MN8A 3X3FL 1XR9B 2O30A 2GYSA 1KCUL 1ML0A 4YO0A 4KITB 1EZVY 1BYPA 1E4JA 1QQDB 4IIQB 3N2JA 4RWYL 5GS0L 2AQTA 5HXMA 5D9SA 2N3JA 5F9JB 1AD0A 2ZX6A 3SQOH 2BVPB 3L6FB 5D2NA 1Q1JL 1SUJA 1YPZF 1J8HA 3C60B 4PJEA 5ISZA 3VYNA 4CSPA 5CD5C 1YNTF 1EXUB 4G6MH 3CXHK 1OW0A 4BFGA 2O6PA 4X0NA 2Q86A 3QORA 1L9MA 3P0GB 3VM5A 2JK5A 2ERJC 3AQZA 1G5AA 4PV9B 4HIJA 4TNVK 4A37A 3Q6GH 1GH7A 2LW3A 3MJ9L 4YO0B 5E5MA 3T6XA 5I24A 5JHLH 3QDGD 5ANME 4DQOL 4ZFOA 3MTXA 3GBDA 1UYWL 5D9SB 4R5VA 1AD0B 2XVLA 1IC7L 3VI4A 4YDKH 4HKJA 4G7QB 1J8HB 5KVGH 3MVSA 1CGXA 3FFOA 3FUDA 1DZBA 3DX2A 2NDFA 5I73B 4YLCA 2Q86B 4ZFZA 1KIUA 4HIJB 3ZXAC 3VXNA 5J13B 5E5MB 3WJLA 4HWUA 5LXGL 2VMFA 2AK4D 3HRZA 3T08A 3RYMA 2XBTA 4ZFOB 5DD6B 1SYSA 3TTSA 2FVNA 7FABL 5JW3H 1JG9A 3VI4B 4DGWC 5FO9A 3WENA 4HKJB 5L0QC 4Y5VC 4DW2L 1N8ZA 2WSPA 3MRGA 4MJIE 1IC0A 3HUJE 3O4LD 3QXUA 2GJ6A 2HH0H 4YFDB 4YFLI 3D51A 5ILTL 3MLUH 2EIKB 3NJLA 4ZFZB 4QAWA 1UC6A 5EBGA 1MFAL 3VXNB 3TM6A 4G9FE 3QR0A 5B21A 2FX8L 2J1WA 2AMUA 3C8KA 3KGSA 1JRHI 1SYSB 5KVMC 4K7PY 5JZ7C 4YBHA 5LNGA 3FO0H 3II3A 5D7HA 2BSSA 4F7PA 5FO9B 1ETB1 1QX1A 7TAAA 2XIDA 3FTVA 1ZDQA 1N8ZB 4WWKA 4JFFE 3MRLA 2I60H 1A3RL 3O0RL 2GIXA 4FF9A 4XXCC 5A2IH 5EEXA 4OY9A 1FFQA 1T1XB 3JWNC 4U1MA 4E2OA 4EDWH 5FS5A 1D7FA 5JZ7D 4X4ME 2NNAA 2YPLE 3ESOA 3C8KB 4B9KC 1KT2A 1N4XL 2ZG2A 3V0WL 3BP7A 4D0BA 1EAQA 5D1ZB 2B4CH 4F7PB 3HG1D 3MO1A 4YXLL 1HOCB 4WWKB 1YNKL 3VXME 3MRLB 5JDSB 3L2MA 4DN3L 3IJHB 4MKMA 4AYEC 2C26A 1OTUC 1BD2A 1UUSA 2AJ3B 5DRNA 2P5ED 2DI7A 4U1MB 3SQBA 2EEXA 3OJMB 5CNHA 1KZQA 4NC1C 1UCBL 4XNUH 2K4WA 2XHNA 3F8UB 4LDEB 1U21A 4L4JA 1DQQA 1SXZA 1I85A 1WWAX 1PAMA 1CZ8L 1XTMA 2XA3A 1JZHA 4P5MA 1G9NC 2ZPKH 3SO3B 1IEHA 1XF5A 4MCZA 1XBDA 1SJHB 4CAGA 5LB1A 2CNZA 4HS8L 4WO0A 1AS8A 3MLXH 5DRNB 1BD2B 4N90D 2C34A 1E2WA 2LU4A 3SQBB 2WUBH 4XNMB 3NN8B 2F15A 4WW2B 2YMXL 4UB0L 4FI6A 3TF4A 4JQIH 3S37L 9CGTA 1DQQB 4QO1A 1M71B 2VYRE 1MVUA 1CS6A 1QBMH 1REIA 3EYSL 2X4QB 3ALWA 3U2JA 1ZT7A 1URLA 2LVCA 3MNZA 4YHYC 1XF5B 4MCZB 3FU8A 3QDMA 1JZ4A 1U58B 4EIGB 4ELMB 5A2CA 1TTUA 3VB8A 2R0KL 1J5OH 4NN7B 2YLKA 4X6CE 2QSQA 2WWMC 3FU5A 3TO2A 3BWAA 2YUXA 3L3HA 2PP7A 4HC1L 4HW6A 1MVUB 4PFEA 2EE9A 3TXAA 5AB9A 5IQOA 4QRTA 3VRIA 2WWMD 3MNZB 3HMWL 3QRFM 4M8VA 2OV0A 3QDMB 3RIFF 1C1EL 2FHFA 1C12B 4B6ZA 1P4LA 4K0OA 4G8GD 3K8MA 4H8UA 4KH9A 3FCTB 4XE0A 2WK2A 2ZICA 1KULA 4R4FH 1OP5K 3ZKMC 1WD8A 5FYJL 4LRIC 4OLVL 2BFVH 2O93L 2RGSA 3HNTL 1DSYA 1OB1B 1S7SB 4GSDL 4QRTB 4ETQA 4JR9L 4QY8B 2G9HB 2WWKT 4G7YH 2VMCA 3S8WA 2VAAA 3VD3A 1NCAH 4KO9A 4OSUL 2TRHA 5FGBC 3RNQA 3DV4A 2EYRA 5DHYA 3ZKMD 1P4LB 4KJYA 3T3ME 1GAFH 1U3YA 4JN2B 2J2ZA 4OLYL 1LYQA 5H8DA 4H20H 1IGML 2V3EA 5FM4A 4NRXB 1I9IH 3CDZA 2X53A 2C1PA 2VN4A 1NGXA 3BQUB 2VWEE 3WN6A 4Y2DD 4ETQB 3UTPD 1PY4A 3CHOA 2VAAB 4HU2A 1EJOL 4M3KB 3AZUA 3MREB 4KV5E 4ZPTA 3RNQB 2EYRB 5DHYB 3G6JB 3WUWB 1I3VA 1XV8A 2J2ZB 3VXRE 1T2QH 2FECI 2FQFA 1YYCA 4S1RH 3SKJL 1ZK5A 1AHWA 2BMKA 3SBWC 3UG5A 3KPMA 4H1LB 3C5XA 4RAHA 2F19H 3CDZB 4RX4D 4MDRA 4OTXL 3T2NL 2C1PB 2CG9X 3HAEB 4DGUA 8PAZA 4HHGA 3AABA 3C6LB 3CFJA 3VTAA 2EINB 3GKWH 4ZMZA 2Y07H 4LU5L 4ZPTB 4AJYV 2MPVA 3S96A 3SKOA 4KX7A 2NY4C 4LCWB 5KYWA 2BY0A 3FSVA 2ZOLA 1LO4H 1MPAL 1JAEA 3KPMB 5GISL 1OE1A 2P46B 4HCRL 3EGDA 4KDTA 3CFJB 4UM9D 1ZTMA 5KSAC 3IETA 2ED8A 3LH9A 3UC0H 1XCTB 2D4DA 1V3JA 3ARDC 5KYNA 1OAUH 4BHUI 4N2HA 3QG6A 1GC1H 1HWHB 2RFXA 3FB5A 1X9QA 3S96B 1L6XA 1TIUA 3FPXA 4U3XA 1N68A 4OGAC 1LGVA 5AVYB 3GLDA 4MQ7B 3DDGA 5CBAA 3T8VA 3ABGA 4FABH 4OZFB 3TT3H 1N7MH 3IFPA 4LGSB 1MJ8L 1VESA 1IGTA 4MS6A 1MG3C 4W4NA 5L4IA 3ZZLA 2C9QA 4UT6L 3EG9B 3EGDB 3GSQA 3MNWA 1HHHA 2MKLC 2XA8H 4N2GA 3SPHA 5SWSD 3IETB 3LDBC 2Y7QB 2FX9L 2RH0A 3LVEA 3AS0A 3DXAE 4L1BA 3NFSH 5FYLL 3K2UL 3V52H 3UTQB 5E6YA 4JKLA 3QZMA 5BW7C 3QG6B 2FLMA 4HWBA 2VLRD 3MNVA 3SY0A 3VU1A 2KLTA 1ZDSA 5AB2A 4FJYA 5I0WA 1FUNA 3CTTA 5CFAA 1B9KA 5CBAB 3RNKA 4AIXA 1PD6A 4D9LL 3IFPB 4Q52A 4YSOA 1A47A 2ZYRA 1IGTB 4PJXA 3IE4A 1RZIB 4BGLA 4FJZA 3H2QA 3MNWB 3N5AA 4MNQB 4X6CF 1HHHB 1GTFA 4K2UL 2OMNA 1CLYL 2JI1A 4P2RD 1LO3H 3T0EE 3VXUE 1PYWA 2H45A 2AI0H 2F54E 1WFUA 3BD4A 3MNVB 2YK1H 3ILPA 3QHTC 4HPHA 3EOAA 1XF2A 4AI7A 4JRYE 3RNKB 1BPVA 4GXVL 4PG2C 4PJXB 4TLKA 3OAZK 5E94B 1LK3L 4UIKH 3MX0A 3DUUA 4B9FA 4P2OB 4XVJH 3ZTCC 3D3VD 3LKPA 1MJ7L 2JKSA 1C16B 1RULH 2K7PA 2ZOUA 3GJFH 3IDNB 4RETB 3TJEH 1PYWB 4OF7A 4PJAE 2L7QA 3IDMA 1A6UH 2YKLL 1DVFC 4KRPD 2DMKA 3RVXD 4XMKH 3L3GA 3QG7L 1IT9L 2F7IA 1KENH 2ENSA 3MLYL 3MSPA 5TDOA 1KJ3L 5LJYH 4ZOEA 1YCSA 3MROB 4NAMA 5D7IA 4FFYA 5FYLD 1BZ7B 3TBVA 5CCKH 4BFEA 4FNQA 3MX0B 5EZOL 3T3MF 3NSCA 2A6