3OKEA

Crystal structure of s25-39 in complex with ko
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMNCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFALTISSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERANGVLNSWTDQDSKDSTYSMTSTLTLTKDEYERHNSYTCEASHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
total genus 47
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeA01
5DD5L 3SE3A 1D7FA 2K1MA 4I0PC 4PRHE 2BY3A 2X89D 4JN2A 4PPTA 1A21A 4OCRL 4NC1C 2X4UB 1S7UA 1F8TH 3STLB 4E5XB 5EOTA 1YEJL 3H3BC 3T08A 2PTVA 4CVXA 5ELIA 3UZQA 4PTTA 1NSNH 4AYFA 5IB1A 4WFFE 5FK9A 1J9CT 2VKWA 3QQ9C 3L95B 5ESAA 4ORGB 1ACYH 3F5WA 4HAGA 2X4OA 4NJAH 4HIXH 5DURD 1LP9B 1VESA 4GRMA 3VRJB 5JTWA 4L8SA 1TVHB 2ZUTA 3SO5A 4S1SH 4W6WB 4LCIL 2H45A 1FHGA 3BJLA 5F7WC 1HHJB 5I74C 3UJIH 4JZJC 3P0YH 4U6XB 3CXDH 5F1KC 2IPTL 4XNMB 1FCCA 2O5XL 3TZVA 2LU4A 4NOBA 1KLFA 1VACA 4YBLB 3L6FB 4LSTL 3AXLA 5EUKB 1K8DA 1YMMD 2ZKHH 3IFNH 4PRNA 4X7TA 3VCLB 1FVCB 4BUGA 1JYWA 4PP1D 5I17B 3N1GC 5CUSL 2ZCKL 5DRWA 1TZGL 3ZYZA 1AGFB 4PREA 1MHPH 2P5WD 4BSWB 3CLEL 1PEWA 3C6SB 3O0RH 1CFTB 1T03L 5E9DD 3QDJB 3F7RA 4HF5H 2NX5B 3WNOA 4Y5YA 5MENA 2IFFH 1CGVA 4N0YH 2EEDA 4QYOA 4JJ5A 1P7QD 2VAAA 2VDLH 1AIFA 1FFQA 3I6GB 4NKMB 1XGYH 4R2GC 4FMFA 4HEPG 5B8CB 4DN4H 3GSRB 4Y4FA 4YPGA 4M5ZL 5C0DB 1C1EL 4K9EH 4KDTC 3BQUB 3O41B 1CGSL 5B39G 4JFDB 5HYQB 4ODTL 3WE6B 1H8OA 1U91B 3D39B 1JF1A 3HNTL 4NN7C 2FH6A 1IQWL 4QNPE 1WAAE 1S7SB 3DX7A 5CFHA 3ZHKA 3QT2A 3LB6D 3AMKA 2A0LC 4PGBA 4HQQL 3PGDB 4IRZL 2EE6A 4KK6D 1XFPA 3VRJA 3MV8B 5CGYC 4YO0A 2VWEE 3KG5A 1AHWB 1YJDL 1QA9A 4YC2B 5HHOD 2X40A 3CVIL 4N8VG 4BFBD 5IHZB 5T3ZE 3UJTH 1KJ3L 4P9ML 3VXRE 1NL0L 4OM0L 1MCNA 2B0SH 5FA4A 2PYEB 3EJYD 2X4UA 1D5MA 5JNYA 3QH3A 1Q38A 5IVXF 5ADPL 3KPLB 4DAGH 2MFNA 3C60C 4Y5XB 1NCUA 3BUYB 4JQIH 4X98A 3G5XA 2XKNA 2Z8WC 4CKVX 4Z7OE 4HPYL 4UV7L 3CFJA 4WFEE 3DX9B 3MLUL 3P9LB 2EDJA 2MKWA 4IRSA 4QHKI 3RVUC 1A1MA 3H0TB 3JWDH 1CZ8L 4ZFZB 4FTVA 1F4WL 1S7QA 2EYTB 3QP3A 5SX5H 2EZ0C 4NZRH 4PRPA 3HAEB 3S96B 3H8NA 5GRZA 1MCBA 2PYFA 2FX9H 1AXSA 4POZC 1LO0L 4LDOB 3BP6A 1K85A 5BJTB 1YMMB 5DF0A 4MNQA 4YXKH 4PJ9D 4WVRA 5LGJA 4CL7A 4J1UB 5FO8B 5E9DB 3O8XB 3U7YL 3KHQA 4QRRD 2UY7A 1ZHNB 4GRLB 1FRGH 2A83A 1QYGH 2ID5A 3DVNA 5K59F 2NY6B 1UXWB 2PW2B 5MEOA 3KDMA 4NQCA 4E41D 4WW2B 1SY6H 4JJ5B 1FL6A 4GAGH 3LEVL 5JHDE 3FO9B 1V7NH 4OZGF 1WCBB 3TWCL 1L4IA 4NQXA 3U79A 5H94A 4BK4A 1X7QA 1YNTB 5E6ZA 5I1DB 5EH1A 5DZLA 3MLTA 1JNNH 4ONFL 1OGAE 3DNKA 1A8JH 2LU3A 1S9VB 1SEBA 2IMNA 3VXSB 2CKBB 2ICCA 3T0EC 2GK0B 3AREC 3P73B 4MNHB 4O00A 3ZDXE 5L8JB 1TVBB 1S7XB 3FFCD 2CPCA 5ACMA 4L8DB 3JWOC 1PAMA 2FX7L 3OL2A 4DQOL 5IIEA 4UQ3A 4Q9BA 4BFGA 5I73B 2VAJA 3HZMA 4JO3H 3C2SA 1UXSB 2EYSA 2BVOA 5DHYB 4MSWA 5ADOH 4GW4A 4YIQA 2R4SL 3QEHA 4L9LB 4MAYA 4M4PA 4JPVL 4P4KD 4ELKA 1YN7B 1CYGA 1IMHC 1IAMA 1UEMA 2DLFL 4NCC2 2BC4B 3MR9A 3GNMH 4FXKA 1ZXQA 2WAHA 4GLRI 4QOKD 1A5FL 4CN1A 4QRPB 4HWBH 2MKLC 5KVEL 4Q0XH 5EUOE 2FO4B 1NBYA 2N56A 4XP1L 3WFHB 4KRPC 2AKRA 4R4FH 2LVEA 5I1HH 3ULUE 4NQCB 1FGNL 1NCNA 1RUPH 3JTTB 1YY9C 1M1SA 1NMBL 2NY5L 1J8KA 1UM6H 1D5BB 1WBYB 4UQ2A 1J0KA 2IGFL 4MVBD 1BJ1J 3T2OA 4U1LA 3VXUE 1O5DT 3VXTB 5IBUB 4N8CH 1IGYB 4OKVB 3OR7A 5KTEH 2D03H 5C2BH 4IEFB 1GSMA 3CGTA 5FA3B 2FLBT 3CFBB 4AIXA 5CGYD 5BOZG 2JB5H 3R06A 5D7LD 4CVUA 5F3BA 2YBRB 2LVCA 3FZUD 3RIAF 1RK0B 1UM5L 3GBNH 1U58B 2IWGA 3TBSA 2NY0D 2ZCKH 5A2LH 5KVGH 1A4JA 4N9GB 3JV0A 1DLHB 5CIPB 1HQ4B 4HCRL 3KLHC 2D7TH 4PRPE 5KG9A 4RSVA 3BP7B 1VFOA 4G8EA 3NN8B 5DMYA 4WRLA 4YFLF 5CJXC 5C0BE 3MV8A 3OG4B 4YO0B 4GG6F 2XWTA 3AMLA 5KSAA 1TTGA 2P5EA 1CE6A 1QHOA 4BA8A 5ID0A 3PQYA 4ZS7H 2YN5A 4Z95H 5I1LA 5EZOL 1A7PL 2XA8H 1NMBH 2NY5H 3HZYB 3WDHA 3QUMH 1YPZE 1MEXL 2BJML 5JQ6L 3IDYB 4ZNCD 3FB5A 1BGXH 4OJFH 1G7JB 3U0WL 1GAFL 1IQDB 1FN4B 2A77L 4L3AA 3TJEL 5FYKD 3O4OB 1J7VR 3RPIB 1QSZA 3TFKC 3VFWB 1W72A 5DEFA 1ZGLP 4ODSL 5IFAH 3ABZA 2UVFA 3LKNA 3SGDH 1VGKB 1JMXA 3NACL 3SKJL 3SOBL 4LRNH 4NBZB 1JF1B 3G04A 1AGDB 4S0SD 1RI8A 3LQAC 3H42H 3E3QE 1P7QB 1V05A 4OM0H 2HFGL 2E8ZA 1N2RA 3ZDZF 4MQXC 1XIWD 3H7BA 3I6KB 2JCCB 4Y4KA 4NO5B 5J57B 1FLTX 2P44B 1WAAA 2MCG1 4QOKB 5F7FA 3RZCA 1CLCA 4JO4H 1N8ZA 2NXYC 3ARFA 3V6ZB 1RMFH 3I3DA 3SKMA 1R0AL 5DHYA 1PGRB 1KJ2H 3TBWB 2HFFA 3WS3B 5C08A 1JI2A 2DQJH 5T5NF 43C9A 5A16B 3P2TA 4HULB 1A47A 3ET9F 1J8HE 4GAYB 2FL5A 1HHHB 3O8XC 2OMNA 4G8GB 4GG8A 3PABB 1OTUC 3SGDI 2EXWC 2FATL 3LKQB 4FQ1L 3BZFB 1KXQE 2JJWA 4EUPH 3TCLB 1KGCE 1INEL 3SCMB 4OIIH 5E95B 5F9WC 4ZO6A 4M48L 3PGFL 2ZOKB 1A4KA 4EUPA 1OP3K 3DVIA 5CWSA 4OD2A 4NNPL 4F57H 3KYOA 5INDB 3O3UN 3GMRA 3FT4A 2AGJH 4MWFB 2XWBB 3GO1H 1KIPA 2DMBA 4F7TB 4Y0GA 5JLZB 4S1QL 4XGZA 4C57C 2EXYC 3LN5B 4QTIL 3GB7A 3IFOB 2J8OA 5GS2D 1RJZB 1YMHB 3GSNL 3QEUB 4G42B 5GIRA 2F15A 2BMKA 3FO2A 3CMOH 1FNGB 4UQ3B 1ERNA 2AEQL 3UTQA 2CK2A 4ZFGL 3SGJC 4AL8H 5L2JB 2C7UA 1CGTA 1CZ8H 4RGND 3L9RA 4U1KB 1N6UA 1P7KA 4JR9L 4Q6IA 2H26B 3E2HC 3EDJA 5DGRA 3VRIB 1GZQB 2BVTA 4YWGH 1PG7L 4LF3B 4NNYA 1T0MA 3FFDB 1NLBH 1S7WA 4JO1H 4KZEH 1L7TH 1EX0A 4ELME 1F3JB 2YSSB 4R0LA 1T7XA 4EN3A 2GSIB 2Y5TA 4MNQE 2AXHA 1EAJA 4OFYA 2LE9A 5FOJA 2ICWB 5I18L 2IQ9H 5CJ8A 1DN0A 3ES6B 2DBLL 2NY0C 1TCRA 2ESVA 4FHBD 2RGSA 7FABL 2ZUYA 4P9HC 5D93C 3VFOA 3PHQB 4E41B 5F7MC 1H0DB 3C5ZD 4M1CC 5ALCH 1U95B 4EI6B 3U0TB 2K9UA 3T0BA 1KCRH 5JOEA 2QKIB 4OZFG 5B39B 3ARRA 2RHEA 1ZHNA 5HVHB 1YPZA 1BZ9B 4GRWF 4L4TA 4QNPF 1Q1JL 1YECL 1O7VA 1YEKH 2X9XA 3U9PH 4YE4L 3M17B 1ZT1B 3QIBC 3RUGA 3QPXL 2OR7A 2P45B 3Q6FA 5KZCB 3VI3F 1R3IH 4R26L 4WV1A 4HS8L 2GYSA 4E42A 3S36H 4G6JH 3STBA 4YHOL 2X05A 4FQLL 4JFOB 1ORSB 4KMTH 1WTLA 1S9XB 4PJHF 3UTQB 1RZ7L 2R2EB 4U6YB 2A6DA 4R4BB 3P9MB 1S9WA 1I85A 3P77B 3D2UA 2P5EB 4LL9A 3B2VH 4LASH 3VW3L 2VZ3A 3NAAH 1JYXA 3OHXA 4Y4HA 3T4AA 1CDIA 1CT8B 1IGMH 4XGZB 5D7IA 4OZHE 1HHIA 2NY3D 5IVZB 3GSNA 3T3ME 4QT5B 4QXGL 1G7HB 4DVRH 4N0YL 3I6LD 2JJVA 4S1DD 4MB5A 4MAUH 3BH8B 1MHHA 1QSFA 3DI3B 5IHUH 3EDEA 5C0ND 2O5YL 4RAVA 3SDAA 3O11A 5HI4C 3NIDF 3KLDA 5HGBB 5AEAA 4PS4H 4XPGL 1A6VL 2EDBA 4LPCA 4M6OL 4MGXA 4P9HH 3ROLB 3K3QA 4HGWA 5D5ME 1BOGA 1UA6L 2GUOA 1FFOA 3T3MF 4P5MB 5GJSL 3FMGH 5C0CE 3OTTA 2N7AA 4NQCD 2GJJA 2ARJQ 4NCC1 5EORH 5M7QA 3MRDB 2V5TA 4WO4B 2LABA 3EYSH 1IKFH 1R3IL 3L9RB 3VXSD 1JNLL 5D93B 5B38G 3CFCL 3N50A 4I13B 1NCBH 4Y2DC 4OZIB 4PRDA 5HVWA 1BZ7B 2R2HA 4Z7NE 3O6KL 3TYFB 1UADC 4F3FB 1I8MA 5IB4B 2IPUK 2IH1A 3MPCA 2E9WA 4JY6B 1G7LB 1MVFA 1N8ZB 3GUTA 4JFXA 4TVPE 3TO4C 4NQEB 4ODXA 3RWJB 1LE9A 3WIFA 5F71A 5J0BA 1NEZB 3P0VH 2RB8A 2G5BA 2FJGB 4OAWA 3WUWG 1MAMH 1VDGA 2Q86A 1ZS8A 3EYUH 1HHKA 5AAWA 3DYPA 3QUXB 5FGBA 2Q7YB 5FF6A 2BP3A 1X5HA 4IRSC 4KJPC 1W0VB 3OKEA 1A14L 1AGBA 2FNBA 1TZIA 3BEWB 4LCUB 3UTSA 3UDWC 1GCFA 2DOCA 2MQCA 3TCLA 2BNUA 3KPSA 1GH7A 4YHYC 1XR8B 4HUVB 4TNVF 3RWJA 3CH8A 3G08A 3MLWH 1Q9OA 1RJYA 1JZ5A 4ODHL 1FORL 2QR0A 3SDAC 1LE5B 4RGNC 4G6MH 1KT2A 3MA9H 5DVLA 3S4SG 4UT9H 1P1ZB 2BRRL 3E6FB 2CRYA 4K7PH 1YEIL 1BJMA 2E7MA 3MMEA 2DQDH 4JE4B 4HWZA 3CPLB 3FQTA 3QG6A 5FECB 2HMID 4NWTH 4LEXH 3OAUL 2YRZA 3I2CH 1I85C 2RCSH 1K6QL 2VQ1A 3O6LL 4M93B 4F2MA 4MNQD 3OF6A 4L4TD 2WP3T 4Z7QF 2ICWI 3GMLA 4OIIL 5GS0D 1X6NA 1XAUA 1XGPA 1MCOH 4PJ8A 3X14A 3IDYC 2Z35A 2OI9B 3DX8B 3CXHK 5HDQL 4PJ5E 5TPWH 1CR9L 2E6QA 4HCRA 1TITA 4UINL 4ZUVB 3LMJL 4D8PB 4KXZH 1C16A 4Z0BH 1U36A 3LHPH 5KANI 4HAFA 5IMOA 3O9WB 3VFPA 4HZLB 2DB8A 2L0DA 4PP1C 3TBTA 1GC1H 3EFFB 4FFZH 1DQMH 2K7PA 3V5DA 3STZA 5KAQG 1IAKA 3P0YL 2R8SH 1GGIL 1QLRA 3W11C 5KSAC 5I8OL 1FORH 3HAEA 5KSUB 3RZWA 3L5HA 3Q1SH 4LBEA 3HZVB 1HQRB 1WEJH 4N0CC 4ZODA 4UT6H 3DX7B 1N6VA 4RNRB 1YYLH 4NC2B 3S7GA 2Z31A 2FZ3B 3VI4F 4OLXH 4P59H 4JFEB 1T5XA 1T6WA 3L5JA 4EN3C 4V2BA 1A6PA 1PKQE 1K9TA 1KCLA 2VLJD 4JM4H 3TA3A 1UCTA 1AO7A 2L7JA 2NY3C 4CMMB 3AY4A 4L8CA 2H6PA 4U1JB 2Z31D 3TC9A 3I6LE 4JKWA 2A0LD 5TDPB 5FCSH 4ONHA 4ODBD 2R1WB 2P8LA 3EDKA 1BF2A 2Q7YA 4PJEB 2VRAA 4U1MA 2AXFB 1MIML 1A6WH 3HG1D 1MHEA 3HE6B 3BGFB 4OLZH 3GMLB 1U8JA 1M71B 3IU4H 4OD3H 4OLWL 2FECI 3LS4L 4DAGL 2YA0A 3VA6A 4UTAH 3CLFH 3X12B 1NFIA 1S7XA 4HS3B 3ZL4H 4MJID 3HKFA 5FHAH 4YEEA 4XCNA 2OTUA 3ULUF 4JGMA 3MFFB 3P4NA 3MLUH 1RZJC 1HKLL 2ADGB 4U31A 2B1AH 1NGXB 4OGXL 3A6OA 1JGEA 4HWNA 4JPIB 5A3IC 1P84J 1S7WB 4MJ4A 1CCZA 1I3VA 2EO1A 3OR6B 4HXAL 2R0KH 4KWUA 3MJ7A 2IG2L 2MHAA 5DYOB 2OZ4L 1Q72H 4D0BA 5MENE 3ZLQC 2DD8L 4LSQL 3GKWH 4BFIA 3MRDA 4YHLH 2PXYD 4MJ2A 4V1DE 5I18H 1JHKL 2EC9U 4NKIL 3O2DL 3KGRA 5F89A 3CXHJ 1T04B 4NP4L 5JMRA 4NYLA 2ATKB 4U3HA 4PJ8B 4LLYA 1DBAL 4JQIL 1DUYA 4KTEH 3QCTH 8FABB 1MNUH 4I4WA 5E8NA 4UDUA 5TF0A 5JO5A 5CLTA 3S5LB 4YK4B 5D2NB 4EOWL 1D6EB 5I8EB 1UH2A 3GJFH 1YEHL 1KB5L 1N5AB 2IFGA 5GGUB 5I15H 3P73A 1ETZB 1KACB 4RA0C 5DURB 5E8OB 3F12B 3MV9A 3NFNB 1GGTA 4GBXC 3CZFA 2PYFB 3QI9C 3SE8L 4NJ9L 3UTTB 2FHBA 3SGEI 1I8MB 1R3HA 1C5BH 4QLRA 4PGDA 1ZHKA 4X7EC 3TBVB 2EIZB 1RJYB 2GAZA 5FGBC 3E8UL 4FQPA 4XP1H 1I8KA 2IG2H 3PV7A 5CP7A 3O4LA 4PR5A 3PHOA 3VWJD 1H15A 1X5YA 3TVMC 1X5ZA 5HYFA 3GMPB 2P5WB 2AXFA 1P4BL 1ZT4A 4P5MA 1FL6B 2QADB 4RFNC 4MNGE 3FQRA 1DEEB 2VL5B 3LEVH 2DQFA 2AK1H 3ARSA 2UV3A 1ITBB 4OGZA 2HTKD 5ADOL 1FL5B 1KENL 5C07A 3FHAA 1DVFD 3QBTB 3CC5A 4QRSB 4NQVA 3MACH 4KK8D 3RUGE 3MRMB 1KCUL 4LGSB 5C0AD 1UA6H 1LO3H 1GC1C 2ESVD 1AD9B 3CDGB 4F2MB 1MI5E 4PFEA 3CLFL 1CDYA 3GSWB 3QFJE 4U0QB 3PWVA 5IESH 1P4LB 5C07D 1OAXL 2CXKA 3KJ6H 4X6DE 3S9DB 1T21A 2EYTA 3ARGB 5DEFB 2I5YL 4M62L 1J1OH 35C8H 1SVCP 4DUWA 3K1KC 1R3KA 5ESVA 2R0ZL 3UJJH 4U7KA 1OY3B 4WTZG 1FN4A 3ZE1F 3D25B 3MNVB 1RUAH 5I75C 4E0RB 3DTXB 4DK3A 1FVDB 3RP1A 1Q9KB 5EBMA 5SWZD 3T04D 3QHFL 3JWDC 4JO3L 1U8IA 2ENSA 4Y16C 3V7AE 3KPLA 5EBGA 3E6HB 4PLJC 5AWNL 4MA7L 4OZGA 4C4KO 1Q8MA 1NBVH 2YPKA 3MYZA 4Y4HC 5DD1H 2F53A 2YD1A 1N59B 1F13A 1C5DB 3ILQD 5DJZB 4OD1H 1S9YA 5D71L 4OCYH 4F7EB 3DO7B 2HJKA 1IEHA 3U4BL 1EEYA 1JHLH 4WUUA 5FO9A 4CVZA 1G9NC 3U82B 4AY0A 3KPNA 4GSDL 1M7XA 1HQ4A 3BGMA 1BF8A 3QQ3B 1PG7W 4GW5A 1KIQB 3LMJH 1BVKA 1VA9A 5IHLB 3QZWA 1QSFD 2UY6A 2I24N 3KYNB 5BO1L 4Y7MA 3KWWA 1A7OL 5ECJE 3BZEA 1JUFA 1JNJA 4FABH 1BM3H 3VA2C 1G6RB 4JFOA 4M8QB 4ENED 4IJ3C 4PRIA 4L1DA 4XB8A 2O26U 3D39A 1RULH 2GHWB 5I30H 1WITA 3EOTL 3LB6C 4OT1L 3BZFA 1OAUL 2VXSL 1D6EA 1XH3B 1QFWM 1IAOB 1BGXL 5IK3B 2VUYA 1FZMB 4K55A 4C56E 5L0QC 1EHNA 3TEUA 4ERSH 3W2DL 5DRNB 2DYPD 2F8VA 1D5XB 4JHBA 2HRPH 2R29L 3VD3A 5HGAB 3NZHL 4MDJB 4NHCH 1ZSDB 2GJ6E 1VFBB 3N0PB 4ZUWB 4ISVB 5HGDA 3TV3H 3KVQA 4WWID 5C0AE 1T7WA 1BQSA 3DUUA 6CGTA 3MO1B 4LGRB 3DMMB 5BQ7A 3UX9B 3U4BH 3T1FB 5HHQB 1ZMYA 1WISA 2GTZA 4IMKA 1TMCB 5HYSA 3BPOB 5DJ0B 3HNVH 1PEZA 3O4LD 4U1GC 5E2UL 3OHXB 5T3XL 3RTQC 2AJXL 1S5IH 1G9EA 4U3CA 5JQ6H 1T66D 2R2HB 3KJ6L 3C08L 1IARB 4RISH 4U1SB 3D85B 3PL6D 1EVTC 4JVPA 4HWEH 1M7IA 4CU8A 4ZDHB 1MFAH 1UVQA 3QIWA 5HGHB 4DN3L 4MQXD 5DQ9B 1MCSA 1MEXH 3MODH 1HHHA 3D85A 2AJSH 4XPBH 4TOYL 5D96B 5DUBA 1GIGH 5DJ6A 1CLOL 5F1SA 3SQOL 4ORZC 5E6IB 1LO5A 1XGTA 1C12A 1OARL 4PJXA 4U1MB 5TH2A 1A22B 5A2FA 3MUGB 4NN5C 1KCVL 2X70B 1NBQA 4JRYB 4L4TB 2X09A 3SE3C 4RGOH 5GS1B 4ZOCA 3OKNA 3NZHH 4LLQA 1B88A 1KXTB 1X5FA 3WD5H 3OV6A 5H94B 4NKIH 1NLDL 2HTKC 2R0WH 5CWSB 3OG6B 4PJGE 3REWA 3X3FH 1W2KT 1RMFL 2C1PB 4GKOA 4QXUL 5TGBA 2X42A 1A1NA 1BD2E 4PRPD 4LLDB 3PP4H 3GEWB 4RNRA 5GJSH 4LSRH 4WCYH 1ED3B 2R15A 4RGMB 3ZL4L 1IC1A 2NY7L 1MUJA 1W72B 4G5ZL 1OF2A 4JRXB 5C0RH 1I7UA 1A7OH 3SPVB 1E0OB 3Q2CA 3KPPB 4FABL 2N4IA 4PJHE 5K9OA 2FCBA 1HKLH 1TJHH 2DQTH 4Y8DC 5SWSB 1M05A 1RZJH 1F00I 2WUBH 2C9AA 1EGJA 4MA3B 3G6AA 5H35A 1MJ8H 2YD4A 4P57B 3QDMB 4LPXA 2G2RA 1WZ1L 2W9LA 2D7NA 1SEQH 2EDQA 1IM3A 3BPOC 4NQCE 3TESA 2FGWL 1K3ZA 4MCYA 2VQUA 4WGWB 3K2MC 2J88H 3DX8A 4RDQF 1U92B 3TFKD 1OVZA 5ETUA 3U46B 2F8XC 2XQYK 1BFVH 1GPOH 2F58L 3PGFH 1T03H 1VADA 1L7IH 4AK1A 3UCRA 4DKAA 5SWQB 2VZUA 5KSVA 2OS7A 1EEZA 3UPAA 5FO7A 1C5DA 1SM3H 3VGEA 4YR6B 1WUNT 3W39A 4ELKB 1Q9LB 3TA3D 3NA9L 3MROB 2ZUWA 4NGHL 5IW1A 1TTFA 1XGUA 3R1GH 4J12A 3UC0H 4KDTA 4UNVA 1CQKA 4UT7H 1U8HB 3PV6B 3CX5J 2MQ0A 3KPSD 2EEBA 4B53A 1HCVA 4X0KA 3D3VE 1MFCH 2GIYA 3JBG7 4FA8A 4KK9C 4R3SA 3MCKA 4DFIA 1Z6JT 1M7DB 5ANMB 1QBLH 1UVQB 3KLAB 4MVBC 1S3KH 4HUMB 2B1HH 3SBWA 4V1DA 4WGVB 3SGKC 2CLZB 1WBYA 3GKZA 1G7PB 5BVPL 4YHOH 3BIBX 4MAYD 2CKBA 1CE6B 1NLBL 3EO0A 1KT2B 4BFEA 4J3UA 1BMGA 1HOCA 1UZ6F 3GBLA 2NCMA 5KG9B 1CXEA 1KF9B 4PJBA 4P9MH 1MLCB 2EKSB 2XYCA 4KUCD 4Z7QE 6FABH 1FC2D 3MRQA 4ZD3H 2FHFA 5D1XA 5C0FA 1XGRA 5I76A 1NLDH 1AFVH 3HR6A 1FG2B 1P9MA 5ISZA 4QO1A 3MLSL 4N8VB 3QIWD 4HZAA 1DBMH 3FN9A 5C09E 1AGBB 3HMXA 4FFWC 2FIKB 2X1QA 2UWEB 5HGGS 1IT9L 5C3LD 1KEGH 3RTQD 1IGCH 4PR5B 1GGIH 2VO5A 2VDPH 2J1KA 2CK0L 3FO1B 5EO9B 4KMLB 1WGOA 5KS9B 1VGEL 5FUOL 3BRDA 1U6AH 1RVFL 1HNGA 1AO7E 2PF6A 2MWCA 5J6GA 4JY5H 5L2KD 4I0PA 5ICYA 1BOGB 1N5YL 4YDJA 5EUOB 4M3JA 2PNDA 4D2NA 1HDMB 3QFDB 1HHJA 4EQ2A 3PWUA 3QRGL 5D7JD 3O11B 4ODTH 4X5WB 5DHVB 2AABH 4Y5VC 4TNWK 4NO5A 4X6EB 4GAFB 2R23A 2J8HA 3LPGA 5KSVB 4JKPL 3DBXB 3NGBC 2CIIA 2HP4A 1F3DJ 4M6OH 1A7QL 4TPRL 1JHLL 2Y6SD 3BWAB 4L3CA 4NSKB 3S5LG 1UWXH 4N68A 4LKCA 4S2SA 4OSUH 1A4JB 4W81A 3UTZB 2P5WE 1FNFA 5DSCB 4R97C 4MNGB 1OLZA 5I2IB 4KJYB 3VMPA 1GGUA 3MLYH 2NLJA 3FO0H 4OZFA 4ZOEA 1HILB 4F33A 3CFCH 3ULUC 5DK2A 1NFDF 4UB0H 3GRWL 5E4EC 1BX2A 4FQQB 3VH8B 1JNNL 4JAMB 3ECBA 4X6BB 1NUNB 2YPLA 1YNLL 5FYJL 1OGTA 2X4TB 5KVMC 3WJLC 3GNML 3BX7C 4HWBL 1KPUA 2C3GA 2R2EA 5FHBH 1OHQA 5SWZB 5IMKB 4P2CG 4Z9KB 1CDGA 3GSWA 4F7PB 2BFVH 5IJVB 4KI5D 1OAQL 4PRHA 5C0JA 3BIKB 1OP5H 1UFUA 2CLVA 3WJJA 1WT5A 4M7ZC 3Q1SL 3CU1A 1MAJA 3BEVA 3QH3B 4XTRC 4ETQA 3G6DL 2IANA 4O51A 1MCOL 3NCYS 1OTSC 3PWLA 3LKPA 4EN3B 3SE4C 1GVIA 3E3QC 4XVJH 3BE1L 1JFQH 3MCLL 4JFDD 1MCPH 3MRGB 4XNXL 4JG1H 5AZ2H 4X9IA 5CD5C 5GZOD 5E2WH 1A6ZB 4G6ML 2F54B 1QA9B 2R0LH 1JVKA 4OIBA 5L9DH 3C5JA 4LSRL 1TENA 1FYTD 2BOCB 2VZ1A 1M7IB 2DKMA 43CAB 2FR4B 5L2JA 4PY7B 1WT5C 2D4FA 1T2XA 3GBMH 5D1XD 3MV7E 5EU7C 2PCPB 3QIUB 4KAQH 1WEJL 5ISZD 2LU7A 5JHLL 1E6JH 3LN5A 5HHOB 4XWGH 2ERJC 1PKOA 3T3PE 2FO1A 2BY2A 4GG6E 2IH3A 2I07B 3HN3A 2V5SA 4PRID 4YH6A 1G7MA 5EZOH 4LEXL 2FGWH 4G9DB 3V5KB 1N3NB 1U2HA 3MJ8B 4KROD 1E27B 4AQOA 5IBUG 4OGXH 1FYHB 4X6FA 2DL9A 2V9TA 3DPBA 1XIWB 5EIIB 4LLYB 2A1WL 4KVNH 5EU6B 1T3FB 4GS7C 1ZHLA 2JB6A 5T1KB 1F90L 1DQML 1RUQH 1ZVYA 3QA3A 4XMPL 1EVUA 4ELMF 1RURL 4V2CB 1ZLSL 1S7UB 3SEPA 1QO3B 5F21B 4CNIA 3O45A 4YDIH 2LV4A 4OAWB 3GMRB 1QR4A 3O4LB 1JHKH 3BPCB 5TE6H 3MLPA 3EYVB 3SOBH 4K8RD 5LKNA 4M43L 1YMMA 1LD9B 2APTA 4H25A 4UDTB 3QDJD 5GGTH 5CD3B 3QXUA 5JR1L 4EUPB 1QQDB 1AY1H 4FXLA 1ZHKB 1KYOJ 5DHVH 4NPYB 5E08L 1YC8A 2ZPKH 4LCWE 1EV2E 2PW1A 1FO0A 4Y5VA 1J86A 4I9WE 4OFKA 5C71A 1ZA6A 3QQ4B 3ZE1E 1RK1A 4N0UB 3QNYA 1FZKA 2YA2A 1NFKA 2AXGA 1J18A 4NZTH 3SKNB 5CEZE 3TO2B 3KXFE 5IM7A 3V6BR 3X12A 2QQNL 2O5ZH 2DL2A 1I3UA 4Y4FD 3WHXA 5BVPH 2JCCA 4OLXL 3VE0B 4S1RH 1R3LA 4JRYD 4P46A 1WV7T 1E4WH 3NPSC 1OM3L 5B3JE 1PBYA 3BUYA 4WI6A 2M1KA 4PRIE 1VGKA 4K9EC 5MEPB 2Z8SA 4D0CA 3A6BH 1D5XA 1WBXA 2NW2B 1NCDH 4ZOAA 2GKIA 2WSKA 4PJCF 2JCCF 3UP1A 1S7RA 3WNPA 3SDDA 1HYSC 2E6JA 2J4WL 4JCMA 1JHTA 2BCKB 4WI5A 4XP9H 1EMTH 2VC2L 1MCQA 1JFQL 1K8DB 5DRXA 4BQ6A 4HG4J 2Y7QA 1LQSR 4WI4A 1J5OL 1T1WB 4G8FA 5HHOA 2BDNL 3T77A 4PB0L 4BYHA 2EDLA 1HIML 1MCHA 4Z7NF 2YMXH 4HXAH 4NRZB 4ZFZA 4JQVC 4X6CB 2XQBL 2LFGA 2HVKB 4GS7B 2SEBB 3UTPD 1OGTB 2X4TA 4F9PC 1IAIL 2W9EH 4HLJA 5IB3A 3RQ3A 3NCJL 2XZAH 3MRNA 3LV3B 4HBQA 3VDAA 3RPKA 1HILA 2LAAA 3QEGH 1TQCB 1MREH 5K9OB 3O9WA 4PV9B 5INCA 4PJGF 1DLHA 5JNYB 4KROB 2A9NL 3PGCB 4XH2B 1HCFX 1UWXK 5DA4A 5I1KH 2BVUA 1J88A 3MLSH 3FQRB 2W91A 2XN9A 3WHE0 4JHWL 4KH2A 1Q0YL 4POZD 4W68A 1PZ5A 3I75A 4U33A 5GS0H 1IGIH 5CSZB 1GOGA 4MD4B 3O9WD 3U48A 4HUXB 5I19L 1Z5LA 1JL8A 3C6LA 5CIPA 1G7QB 4I0CC 4YUEL 1LO3L 1M6OB 1FO0H 3AAZB 3RVWC 1T2QH 1RK1B 3P77A 1QR1B 3O8XD 2FEDD 2XN9D 3NA4A 4PJFE 4KTYA 1KPVB 5EO0B 4G9FE 1RVFH 4POUB 3PWVB 4R7DA 1V3KA 3T4YB 4CBPA 1EEUA 3UBXG 3MCG1 5J11C 2H3NB 2VLRB 2FO4A 1TJIH 3AVEA 3QO0B 4G8IA 1I8IB 1QNZL 3H9SA 3QRGH 1LP9A 3AM8A 4R96A 5DFVC 2XXCB 3KR3H 4KHXH 2AK4E 4I1NB 1U93B 4K3GA 1YN7A 2GEEA 3DYMA 5C0DA 2RIKA 4GXVL 1JYVA 4ONFH 3QDGE 1LO4L 2BNRD 2W0PA 4PJXE 2XRAH 4D0CB 2C3VA 4X80L 1KG0A 2PO6C 2V17L 4H1LG 4NUJA 1P84K 2X4QB 5GGRA 2DTML 4BZ1L 2A6JB 3HZKA 4K3DH 4Y2OA 1U8QA 5ALCL 3K4ZA 4X7SL 1OD9A 2VNCA 2VXVH 5CILL 3RGHA 2Z93B 1Y6NR 3TNMA 2FHCA 4XCEA 4ZAKC 2H2SC 3S3PA 3V0VB 3QFJD 3ZDXF 3MLYL 4BH7A 1UH4A 5J3HD 1T83A 4OV6F 4D0DB 1A7PH 2QSQA 3CNKA 1R3HB 4XNXH 1U3ZA 4K8RC 4C83B 3QDJE 4OI8A 5EOCJ 3B6SB 5C09A 5C0EA 5DUPL 2YMXL 5BRZB 2C3XA 5FYJH 4OZIA 1CDUA 3SJVD 1K5NB 2I9LA 1FFNA 4P9HL 1U8MB 4ZUUA 5TQ0L 3CU7A 4RAUB 1P4IL 3GO1L 4JJHA 3FRUA 1FGVL 5FYJD 5F9JB 4S1QH 4QRUB 1DP0A 5I9QC 1DQLL 2R1XA 2VXTL 1YY8B 3QXAB 4K3JL 4KAQL 5C6TL 1F11A 1JPFB 4JDVB 3QDAA 5GIRB 2PXYB 3MYJA 3MGOB 3I3EA 4FNLL 4ZFGH 1JNLH 1S8DA 3U6RA 5L2KA 2I27N 3K2UL 4HXBH 2VZOA 4JR9H 2ZUUA 2VLKA 4ETQB 2XWBA 3O6KH 2Z31C 4CMHC 4LLVA 4JG0H 4APQB 1W0WA 1F2XK 5CJBA 1WWBX 4JY4B 1FFPB 3FB7B 3TV3L 3JVGC 3TIDA 1I1CA 1NAKH 3BIKA 4MA1C 4AIOA 5TDNB 3ARVA 3F7PC 1A6VH 3TNNB 1BQUA 4NGHH 4GSDH 5F8QC 5GRJH 4UUJB 4NNXB 5E2WL 4JN1H 1QLEH 4J8RA 1TNMA 4J1UA 1VFAB 3RGVC 4ZMAT 5LWYH 4URTB 2A6IA 2G2RB 1HI6A 4M1DL 5IFHL 1CVRA 3NCCB 4Q7DA 2XKNB 2PUQT 4LIQE 1J1PL 3BP5A 3HMXL 5IQ9A 3ORJA 5EN2A 5ESVB 2Y23A 3IVKA 3MROA 3MRHB 3AROA 1IGFH 3FQXB 3QZWB 2DWDA 3HG1A 1UQSB 2N7BA 2BRQA 2A2QT 3UXFA 4JDTL 3K2UH 4OFPA 2WUBL 2CDFB 4XPGH 4ZXBD 2GY7B 3T0VA 1WC7B 4HIIA 3VWKA 5EOCH 5FEBA 2UZIH 4G9FA 2OL3B 1CN4A 5EU6D 5AD0A 3JTSA 3WD5L 3G04B 4PJFA 5IB3B 3T8XB 1RURH 2OLDA 1ZLSH 4X9BA 3FB8B 3SQBA 2BVQB 4RCAA 1U8PA 4H1LB 5FYLE 3GHEH 3I9GL 1N64L 1D9KC 4LCCB 3VG9B 1JWUA 3WEXA 2BSSA 3PG2A 2DQFB 5BCAA 3TPUB 5T5NG 1QOKA 5T1MB 2NY7H 3EUUA 1NAMB 1JZ3A 4MA8L 1TPXC 4XVUC 1CE1H 4LRNL 2JIXB 1LEIB 2V2TA 2EIEA 2DQTL 4JFDA 3KPQA 2DI7A 2XTJB 4O58L 2A74B 1ZT1A 2UYLA 5IVXB 2YA1A 3VXNB 3TBVA 2IADB 3CD4A 4Y4FB 1Y6KR 4D9QE 3TJHD 5MERB 5TDOB 4YXLH 3V79C 5KVGL 3IFOA 3NFNA 1QFHA 4WNQB 5DZOA 1KCVH 1T1WA 2L4OA 2C3WA 2M8XA 1NBYB 3IXTA 1UKQA 5HYQA 3GM0A 3N1PC 4U1IA 1I1AD 3BYYA 3RFZC 1FL3A 3FT3B 4L4VD 5DMKA 3FB7A 4DZBB 3SKOB 3MLVL 4K7PX 4NQDB 1DVFC 2D3VA 4N1HB 2YPLE 4KK8C 4QHNA 3V8OA 5A3ID 3U7AA 2R9HD 4MB3A 2XWJB 4XPTL 2JJTC 5HI3C 4U1NA 4QXWA 2OK0L 3SE4A 4KZDH 3WNKA 4XVSH 4QYOB 3ZE2E 5CEZL 4XNUL 2A6KA 5ALBL 1AKJB 1RY7B 2VQTA 5FUZL 1GGCH 4K3EL 1EUTA 3GMMB 1BHGA 1MJ8L 4NNPH 3S36L 3U30C 5CKAA 4RFOH 4RMUA 1NFDE 3EYOB 4PJ5D 1VFAA 4C56D 1X5XA 4BQBA 2W38A 3GHBL 4R3SB 1U8NA 4HUUB 1WICA 5ILTL 2DQUH 3I3BA 2OI9C 1YZZA 1CFNA 1MY7A 4TULH 5KVDH 4JB9L 2WQRA 4LRIA 1J1PH 1UZ8A 3E1F1 4NZJA 3L7FB 3MRLB 3VMNA 4JCLA 5FHAL 1AE6H 4QRTB 1KJVB 4KKLC 1PQZA 3PWNB 3UTTE 3HC4L 1U8PB 3TF7C 4NHUB 3MR9B 4FQ2L 4BQCA 5K9JH 3MOBH 4XXCA 3W0WB 3O3EB 1X5LA 1KLUA 5DO2C 3O4OC 2HG5A 3O45B 5EU4B 2HWZH 2A38A 3UZVB 4JFFE 2Q8AH 5KOVC 4R8WH 3VU2A 1DFBL 1TQBB 2ZOKA 3WUWA 4XZUB 2V7HB 3IXAB 4JO4L 1MLBB 1TZHA 5CMAB 2JJSC 1RIHL 5EIIA 3DVNB 4JFZL 2IPUG 4YHLL 3SDXE 2X1PA 2DBJA 3JZ7A 4LDLB 1IFHH 3MBXH 3QIBA 3DXAE 1O0VA 4P4KC 2MCPH 1CF8L 2B5IC 2CDGA 3Q0HA 2AJYL 1R5WA 3F7VA 4WHYG 1U2CA 4D0BB 1ZA3B 2ZG3A 1X4XA 2FEEL 4OUUB 4M1CD 5IJKC 3BO8A 2B1AL 5ISZE 5D6CB 1BQLL 4Z76A 1S9VA 3ZT6A 4GUPB 5LGHH 2OMBA 4OQTA 1QFWI 1Z9LA 3LKPB 1JWUB 3WEXB 4ODWB 3G5YA 2HJLB 2OTWA 1H3VA 4OB5H 3VFMB 12E8H 1A1NB 3VMOA 2DI8A 1U95A 3VJ6A 1YEDB 4EI6A 3RGVA 1RZKC 3GSNB 4TRPL 1BVZA 3HE6A 5E1HB 4NUJB 4HFWA 5D2LF 2VB5A 4W6YB 4JREC 4K71C 2CDFA 3JWOL 4YJZL 4JEGB 4N8PA 3IDJA 3U0PB 4OF8A 5F8RC 1OWWA 1P53A 3VXRB 5IP4A 4X8XA 5FO8A 3D3VA 1AC0A 3HE7A 4R0LB 1K8IB 4LVOC 1MI5A 4YDLB 3GM8A 2YD7A 5KW9H 5EU3A 1FIEA 4E42B 1G7JA 1P9MC 5E70A 4WHTB 3X3GH 2GFBB 4M6NL 2JLLA 1H15B 1UWEL 1AY1L 4OLYH 1X5JA 3OJVC 4F7PA 1NMCC 1LK3H 5T1MA 2R1YB 3GRWH 1QLEL 3NGBB 2O5XH 4NUGH 2MJWA 1BD2B 5EC2B 3UYPA 3BE1H 3VXOB 3HE6C 1XEDA 1ZEAL 4KPHH 3OAUH 5CCKH 4QOKE 2BVQA 4H8WL 4OBRA 4OCWH 5BZWA 4OQTH 5HYJB 1QKZH 2Q76B 2YUZA 2ICEB 5DK2B 4G9FB 5CZXD 1A7QH 3TNMB 2R0ZH 4YX2H 1I9EA 4RQQB 3CCHB 5F1NA 9CGTA 1S78D 4DKEL 3QCTL 4I2XE 2W9DL 1ZOXA 2XA3A 3K7UA 2VSCA 5JPNA 2YS4A 5DA0B 3CVHH 5I75B 3U4EB 1L6ZA 1RJLB 1TXKA 3HPJB 4Z77B 1UKSA 3ULSB 1U8LB 5HGAA 1QZ1A 4O5LH 3AS1A 1XGTB 4Y16B 3PWJA 1IGJA 5IG7A 1T0MB 4KRPD 4G43B 5HI3D 3CVHB 4FQJH 2ZKHL 3HNTH 2EC8A 2NZIA 3IFNL 5T1LD 4WJ5A 4LLWA 4QRRB 5HDBF 3IJHB 4LQFH 1XIWC 3VXMA 1TVBA 3CK0H 1G6RH 1SJEA 3HB3C 4Z0XB 4IIQB 2P49B 3ZKNC 4APQC 1VCAA 1WAAF 3JXAA 5D1ZA 1AGCB 1H3UA 2GY5A 1UJ3B 4Y4KC 1ZLUK 1J1XH 1P1ZA 3E6FA 3O6FD 2W9EL 1EK3A 3AM8C 3UAJC 1II4E 3CVIH 1JJUA 1XGYL 4JZOA 2AK4A 2ED9A 5L8LB 1CTOA 1F4YL 3DURB 3ZO0A 1CFQB 5HVFB 3GJFA 2V2XB 2A6JA 3HZKB 5BXFB 4CNIB 2UZXB 3DIFB 1SQ2N 4OF5A 5CP3A 2OXGA 1G0YR 4I5BB 4YHKH 3S88H 5I1KL 3IJSB 4U7MA 25C8L 1AIFB 1BLNA 4QTHB 5IQ7L 2FJFB 5J6HB 4YAQA 4PLKC 3DVGA 1ZLWH 2DWEB 4QWWD 5J1TC 1K4DB 3MRPA 3B43A 4H0HB 3MLVH 3O3AA 3V0WH 1INEH 2X1OA 3D5OF 2PR4H 3Q5OA 4G9DA 2NY1C 4O02L 5CEYA 4DQOH 5AG8A 4PJBB 4GRWH 4R4ND 1FFNB 1DANU 2AJVL 2WW8A 4GKNB 1RIUH 5DGQA 1VACB 5C86A 3KYAA 3RIFK 4X0KB 4Y4HB 1OGAD 5HXMA 2NW3A 5JHDA 1KBGL 3RBSA 1NCBL 2SEBA 3PNWB 5F7HA 2AI0H 5F6HJ 4NUGL 4XRCA 1QQDA 3HZVA 1J1XL 4LCCA 1R5VB 2D7QA 2IPTH 4UIMB 3W39B 4WHYH 2WBJD 2ZSVB 4NN7B 3BPCA 4Y1AB 4I48B 3LQAH 3TPKA 4WDIB 5D7IE 1HIMH 4BM7A 3MRGA 2BNRE 5FGRA 4HPYH 5GRVL 2HN7A 1TVDA 2XFXB 3CH1A 3O2DA 4F37K 1SVZA 4GBXD 4M62H 1FBIL 3MC0A 1DBAH 4YWGL 1EHLL 3NCBB 1V7NL 1JYNA 3PWLB 3CZJA 3QDME 2VDLL 3FOLB 5BV7C 4HUKB 3S34L 1I4FB 2HT3C 2R56H 4UU9A 1YYLL 5CJQH 5BS0E 2OZ4A 1U0QA 2HWZL 3X14B 5E6YA 5BW7A 3KPTA 4YBLC 1XGQB 3N85H 4I3GA 3OX8B 4P57A 3ZTJH 1NL0H 4KZDL 3FN0L 1YEFL 3QUKB 1JP5A 2FLRT 5D70H 4A6YH 3HNVL 3B8SA 3IS1X 3VWKD 3VFRB 3RL2B 2NY0B 4OZFH 1NBVL 3P0GB 3FTGB 2P8MA 1N6QH 2EH8L 2FX8H 5C7XL 3IF1B 7FABH 1S9WB 5EO0A 2Q87A 4XBEH 1OSPH 5ADPH 4AH2B 4FTVB 3KPOA 4K7PL 4RMTA 4XPAL 4WUUE 3UO1H 5D1QB 4NZTL 3RWGA 3SDAD 1XF2B 2YSSA 4ERSL 2D7TL 2R1YA 3HC0A 2R29H 3P4OB 4LF3A 4OF7A 1HINH 3VRIA 3OX8A 4LEOB 1MELA 3GI9L 2MTPA 5IB2A 3DGCR 1JGVL 1MFBL 4MJIB 1WFTA 3SDDB 1TETL 1G9ML 3VI4E 3P11H 2BERA 3VFTB 2FJFA 5E0QA 5J6HA 4GKZB 4P4KA 5GZND 4TUJB 3CFEA 1MH5B 3IJSA 4MQ7B 3ILPA 3DV6B 3WLBA 1KCUH 5E6IA 3GGWA 5JOFB 3KR3L 3V6FB 2W0KA 3MJ8A 1TCRB 2ESVB 2QQLL 3VXQB 5H8DA 2QSVA 4XC3H 3EYFB 3RX5A 5INDA 4YDVB 5IM7B 4I0PD 4D3CL 1YEEH 4LLQB 1U3JA 3VD5A 3M1BA 1P7HL 3BKML 3ZKQD 5BRZA 2Q7NA 4NP4H 2VDQL 5DC9B 1GJIA 3JVGA 4BZ1H 1CL7L 2NW3B 1FAKT 1IM9A 3MLZL 1MF2H 4H0GA 1HSAB 3DUHA 2VXVL 3MRBA 4ODUB 1JPSH 5CILH 1QVOA 1XF3A 1I3GH 1LP9E 4LCWD 5DJAA 3ULVE 3ARZA 1TVHA 3RVTC 3IGAB 3ZT7A 5E7BA 3MJ6A 3EAKA 2UUDH 4MNGA 4JZNB 4G43A 1AKJA 3TM6A 1T1YA 1IM9D 1RUKL 3DARA 3DRQA 2UWEA 4DGVH 3LOWA 4ESKA 2DLTA 5KOMC 4TUOB 2BVOB 3RHWK 1U8LA 1RJZA 5D71H 2EDRA 3ZTNL 1ADQA 4YHPA 1QRNE 3JWOH 4N8VA 4E5XA 3NCEB 2F5BH 1MOEA 1OGAA 3UBXI 5HPOA 1HXMB 1R3LB 2EO9A 4P46B 3BW9A 4Z7WF 1F6AA 4UV4L 4HV8B 3H9SB 1AGFA 4HIJA 5DMGD 1G7HA 1TJGL 3ALXA 1TNNA 5EWIH 1PQZB 3V52H 3QFDA 1T6VN 4O2EB 2XN9E 4K94H 2AEIT 2ARJB 1AI1H 3WUZA 3IYLW 5DJYA 4ZAKA 1NDMB 3MUJA 1NGXA 5CBEB 4HMCA 4PRDB 3S97C 1N0LA 3OJMB 4FQLH 4NKOB 43CAA 3AB0B 1KENH 2FR4A 3HA0A 4IRSB 4JFFA 3T3PF 2FEEI 3HUJB 1M7DA 4LHUA 4RIRA 1LP9F 1K4CB 4JAMA 1OQXA 4KRNA 2YXMA 1LILA 4LARL 3I50H 3ARTA 3DGGA 3QUKA 2GFBA 4ZAKD 3STZB 5DMJB 1C7TA 4ODSH 5D7LE 5D7JB 1B4JL 4I18A 3L3GA 4HJJH 4A6YB 4PJIE 5IESL 2C1OA 3TIEA 1AXTL 2X89A 5F6IB 4JO2L 3E6HA 1B0GA 4FQXA 4CMMA 1E27A 1U8KB 1BVKB 4Z95L 3QI9A 3HI6L 4HHAA 3V5KA 2NY2B 3CH1B 4N1EA 4O2CB 5EC1A 1SEQL 1FFRA 1OPGL 4Z7WE 1SMAA 1ZANH 1GOHA 4KJQD 4X5XA 3HCVB 1BFOA 4WNQA 3RBGA 3QPQD 4HMEA 2C4XA 5J1AB 4ZPTA 4JFEE 4Y19E 2VE6B 5DUPH 5IMKA 2OP4H 2A6DB 3VWKC 2IF7A 1BVLA 4HCRH 3PL6B 3IDGA 2FSEB 2ED7A 2RJMA 3HMWH 5F70A 3GIZH 5HDQH 4L3EB 2F54A 2X6MA 5FUOH 1I1YA 2GT9A 2EDDA 1CK0H 4KQ3H 3CFDB 3VGBA 3G08B 4JY5L 3IRZA 4Z7UB 1I8LA 4R97B 1MI5B 3AS3A 3HUJF 1R3KB 4HKBA 5EU7E 3K4AA 5DS8A 1DQDH 1EFQA 3RAJH 3CSYB 2ZP0T 3GSOA 2B8OT 2L7UA 3IDJB 1MSPA 3ARPA 4LIQL 1MAML 2FD6L 4YHNB 1AXTH 3KPMA 2Y36H 1BJ1H 3D2UD 3C9NA 5JW4R 4F9PA 1PLGL 4Y8AA 3PWPB 3DVFA 4TSBH 3DXAA 3MXVL 1YMME 1RZ8B 1HH9B 4YPJA 3RGVB 3RUGF 1NCCH 5I8KH 1IBGH 4FG6C 4DVBA 4KJPD 3RWIB 4N5EC 4UIKH 3TBYB 3BVNB 4L8BA 1NGWB 1FCGA 4OZHB 5DI8B 2FYYB 1SYSB 1AHWC 4YC2C 1MCWM 3FQXA 2CKBH 2VR5A 4TVPH 5F7EL 3ZHDA 2PXYA 4F3FA 1CBVH 3BD5A 2P5WA 2YEZA 3CFBA 3AY4C 4X7CC 2VSDA 2WUCH 2XQYG 3WE6A 3SDDC 1U41A 2P4AB 4MZ2A 3EBAA 3MRCA 5DMKB 4J2XA 1G9MC 3HI1A 3RDTD 4HIJB 2IBGA 3LKQA 3S5LA 1ZKAA 4F58H 4Y1AD 3CFKA 3B9KB 4HLZH 5E99L 3HMXH 5C08B 5D2NE 3MV7A 3OKEB 2JE8A 1G0DA 1T66C 2QV2A 4UUJA 3TT3H 3RDTA 1RV6X 4KVCL 3MGTA 4OCNC 3E2HB 2O61B 2NXZC 4PLJD 4Q9CA 5FCUH 3B3IB 3QNXB 4KK9D 1OOAA 1AXIB 5T3ZH 3MRBB 4ODUA 5CSBA 4XI5D 2AK4B 2OSLB 4NQEE 4B7IA 1URLA 4F80A 1NGPL 2JK5B 4LSPL 5F3HB 1YEFH 5D70L 3IAQA 3AC0A 5KW9L 1CE1L 1E4XH 4OFIA 2OP4L 2IANE 4Q9QH 1YNLH 5EIQA 3KPSE 4C58B 1KJ2L 4RFNB 3QNZA 4PJ8C 3L3IA 3BYTA 3NMEA 5J12B 4FTVD 4L1HA 1NFIB 4R2GB 5B8CC 1RFDL 2YPVH 1DBBH 4NRYA 2MHAB 5DYOA 1FVEA 1MCFA 4GOSA 1QUNA 5CINL 3L95A 5DRZB 3SDCA 2ITDA 3DV6A 5AAMA 4Z7OF 4I18C 4U0RC 2ZSWA 1CQYA 1Y0LA 3V6ZA 3T2NL 3KNBA 1RHHA 1D5IH 5B21A 2EE9A 4IOFC 2DQHL 2EIBA 4DW2L 4YR6A 4LMQI 4GW5B 1G9MH 4PJ7E 4RAVB 1PG7X 4PJFF 1IGTB 4HQQH 3VFUA 1NUFA 4QHUB 1HH9A 3VFOB 4E41A 3Q5TA 2JTDA 5DR5L 3QDMD 3D69B 2DN7A 2FB4H 4LSVL 3KDMB 3EO0B 2F5BL 1S9KC 3BKJL 4JHZA 4D9LH 3OXRB 3ZKMC 5SWZA 2VXQL 2R4RL 3TBSB 2B0SL 2H6PB 3OKOB 2ZSWB 1U93A 1OP5K 5IK3A 4KK5D 4KY1L 2ZOLA 3V52L 4GMTH 3QDMA 1U6AL 1IGML 1Q9KA 1PD6A 1G6RL 2HYMA 5EBMB 1KCRL 2GQHA 1RZKH 2IQAB 4XX1E 3WXVH 1ND0A 4H88L 3C5SA 4U1LB 4JPWH 1ZLUH 3H3PL 1B6DA 3SPVA 3RVXC 3U1SL 1L7TL 4UAOB 1BQLH 2C26A 3J8F7 3PQYB 1F6FB 5F7LB 2GCYB 2CSPA 3B5GA 3EHBC 4S2SB 4JRXE 5IBTH 3RL2A 1FZOA 4Z8FH 2R69L 3AUVA 3DUSA 2XICA 4PB9L 2D7MA 5SWSE 4MQTB 4PGJA 3X17A 3NBNA 5GHWH 3ULUD 1EXUA 5L7XH 3UYRH 1T0PB 1JTPA 4NQVB 4FQCL 3VFPB 4LOUC 3QEQD 1U92A 2KBGA 3BISA 2OJZL 1W72L 5IV2B 1A14H 2VLRE 1A3RL 5FGCE 4OCWL 3K8LA 3VXUD 1DFBH 4XVTL 3PXJA 1V5JA 1OPGH 3C8KB 3C60A 3EJZD 4I0PB 4O9HH 3ILQC 1L0XA 1QFUL 2ILLA 2QR0B 3MUY1 1FP5A 5F6HI 4PJEE 3FO1A 3L3IB 4PJGA 5ID1B 3VCLA 4XBGB 2HJFA 1E28B 5F9DC 5FUCE 2CGRL 3QG6B 5FECA 4ZS6C 4P46C 3WNLA 2VWEC 1JGLL 2V6HA 4R90L 2F19H 4MJ5A 2YHGA 3CUPA 1YY9D 4YAQB 2X9YA 2Z0BA 4ZAKB 3UTTA 5D5MB 1J0ZA 4P5TC 1J0YA 2RFXB 3MV9B 1LHZA 1EO8H 5E2JA 1U91A 3REVB 3NAAL 2QSTA 3VXPB 3THMH 3O6MH 5IMLB 1XZ0A 2ADJB 3G6JB 3HPLB 4XCEB 3V0VA 5CD5D 2GTZB 2DLEA 3MGAA 5FYJU 4XP4L 1OSZA 3RAJL 5JO5B 1TFHA 2XTJE 4LCWA 4KKBD 2CJUL 1ES0A 4CVZB 5TE7H 5MI0C 3UMTA 2O61A 5A2KH 1YUHB 2Y36L 3T2PA 4X4YB 3T0WA 4G6AD 1OAUH 4B50A 3IDNA 4BK5A 3DRTB 2KDGA 5TH2B 1OB1B 3NA9H 2F53B 1JWMA 3FFCE 4XI5C 1JK8B 2VZTA 2XZCH 2VLLA 4Q9RH 1IAIM 1CFNB 3QXAA 1EFXD 1YNKH 4P2OA 2G5BB 5BV7H 1K4CA 1E4WL 1I8KB 1HWHB 1CXKA 2VH5H 2JKXA 1FO0L 1UYWL 5E8EB 2I9LB 1F45A 2FBOJ 3QDGA 3GIVB 4GAYA 4MS8D 3WSQL 1G7LA 4PJ8D 3UROR 3GBML 1MFNA 1REIA 3RKDC 3C8KA 3EZJB 5E7FA 1HNFA 1KEML 5D1ZB 4ZXBA 5I8CA 1FGNH 1RUPL 2OSLA 5M95B 4Y5XC 2CUMA 2X1WL 4ZSOE 5C0GA 4CU7A 2Y06H 5JOPE 3V6OE 3C5JB 1RIUL 3QQ3A 4QRRA 5J06A 4DZBA 1IVLA 3JWNC 1MFBH 3HCVA 4JFFD 3OAYK 4NQXB 5ESAB 4WO4D 4DGIL 5DJ8B 6FABL 1JN6A 5J89A 3HB3D 4I9WD 4APQD 1V3MA 3MXVH 3HTLX 5LBSH 2XNAB 3L3KA 3MODL 4Y88A 1T04A 5FDWB 2JB5L 5CKGA 1XF5A 2HLAA 5IQ7H 2Q8BH 4FQJL 5HTSA 3S36X 5HSFA 1HSBB 1MHHB 1QSFB 2XZCL 1KJ3H 4OLVL 4O5LL 4HDIB 4MA3A 4X7FC 4TVPL 5F7EH 3ZYOA 3W0WE 3FQNA 1E4JA 3P4OA 4O02H 2ZG1A 5DUML 3L3DA 2VDKH 1VKXB 3L3JB 5DVKA 4ODHH 3QB7C 5DHXB 1XF4A 1I7ZA 3LRSB 1HQRA 4PLKD 1QG3A 1S9XA 2PO6A 2X44D 2AJZB 4ZFFB 3MLRL 1F4YH 3OXRA 1WFNA 1Q72L 2EDEA 1BFSA 5C0BD 3MZTA 4G8EB 5LGKA 2IALB 5JA9A 4Q6YA 1AJ7L 3N1FC 2NLJB 2BC4A 4GRWB 4X8JA 4J3XA 2PO6D 5GQBA 1F4HA 1JE6A 3AREB 4ZNEA 2GW5A 1JBJA 3UTZA 4U05A 3S88L 2RBLA 3ZYJA 2VDMH 4PV9A 3R06B 3LEXA 4ZYKB 3S35L 2F53D 5JHLH 4ONGH 1A5FH 4PGCA 2WNGA 1JN6B 3FONB 2DKUA 3OKMB 1JGVH 4AT6A 1MIEH 2YR3A 2X2YA 1FYTE 3C6LC 3H42L 3FQWA 4CW1A 4UB0L 3BP4A 4NFBA 4HWBA 5C0GB 3PWUB 4PY8I 3FKUS 5DEGA 2G75B 4NQTA 3FTGA 3GRWA 4K3JH 4XBEL 5KS9F 1NJ9B 3BO8B 3CDYA 1NPUA 3TNNA 3KXFA 5C9JA 1S7TA 4JLRA 4I3SL 1QACA 5DC0A 4Z18A 3B9KD 3O9WC 2MSPA 3VWJA 2OM5A 2J8UA 2Z92B 5I1GL 4XC1L 3NIFF 2FATH 4D8PA 1IL1A 1MHEB 3U0WH 4EDXB 1VFBA 2E27L 2Q20A 2XACC 1T1XB 1WBZA 3GB7B 3WDJA 1LEGA 1ZT7B 3RX8A 4FQCH 3MV8D 3ZKXB 4BFIB 1U8NB 1NEZA 3DO3A 4RIRB 2VXQH 3L3HA 4TTGA 1KTDA 3K4DA 2ZSVA 4WW1A 2ADIA 1XZ0B 2ADJA 2I07A 1B2WH 1T0NB 1HOCB 2AV1A 1J1OL 35C8L 1YEJH 4MMXC 43C9B 5B38A 5EUOA 5GZOC 5CBEA 2Y9RT 2Z31B 3QCVH 2H32H 4CMHB 2HKHH 3Q6GH 3FQUB 3JUZA 4I77L 2M26A 1F3DH 4JPWL 2AV1B 2B2XH 2AERT 1GZPB 4S10A 2AXJA 4XPTH 5E8EA 1LD9A 4UDTA 4HIXL 1R6VA 3HE6D 2VN4A 5EWIL 1G7QA 3RNQA 4WFED 3UEZA 5T5FL 2NY5C 3LD8C 4LLMA 5IB5A 2HFTA 4PUBH 2C4FT 4QRPE 5HHPB 4NT6B 4LCUA 4LLUB 3RVVD 1G7IA 4ZUSA 2FIRT 1UM6L 5IEHB 4LSSL 5DT1H 3THML 3D3VD 4MXQC 4WO4C 2R2CA 3MRJB 2PW2A 4PRBA 1OAXH 1MRFL 3ZHLA 3STLA 1SM3L 1W72H 3W82A 4K3DL 2Q6WB 1CU4H 4HH9B 3TA3B 4XPBL 2EXYD 4F8QA 3IGAA 4ONGL 3CFDA 2DQEL 3EO1B 3DTXA 1AR1D 2CKBL 2DDQL 4EI5D 4XC3L 5D2LB 5C07E 3QUZC 4CJ1A 4PJ9A 2HVKA 5CEZH 3TYFA 1WLHA 2GCYA 5BZDA 4Y4HD 5FYKH 1Q94A 1EHAA 2Y4SA 4HJGA 1UM4H 1VEMA 4MJ6B 3RPIA 1SJEB 4Z0XA 1P4IH 1A3LL 2UZYB 2E7BA 4HS3A 5IGXH 4LCYA 5C0CD 4G8FB 3VFRA 1AD9A 2DQGL 4WEUD 1IAKB 4AT6B 1G1YA 4PJBE 3PDOB 3QCUL 4HKJB 1TIUA 3PWJB 3SDXF 3WO4C 4W4OA 5I74B 1IJ9A 3LEYL 4P2QD 2PTUA 2CLRB 4PGEB 5GRXG 3P4MB 4DFHA 4E9LA 1QSEA 2I5YH 5DXWA 2DYPA 3C8HA 5K9QI 3PDDA 4N9GA 1AE6L 2ZG2A 5F1IA 3CJJA 4GBXB 1JZ7A 2DWEA 5FDWA 1Q9LA 4RMSA 4NKMA 5EZIL 2E27H 1JRHI 2VAAB 1MCDA 1UCBH 3WFDH 3FL7A 4ALAL 3LDBC 1T89A 1EEZB 1J05B 3RWCB 4M5YL 4Y1AE 1BP3B 1JTTA 3SCMC 4KTDH 3KYMA 4QHUA 1PKQB 2EDKA 5FYKE 3EOTH 3NFSL 3C6SA 3NPSB 4QTIH 3MREA 5H2BA 3HC0B 5E9DE 5EPMA 4ZTPH 2P7TB 1S7VB 1ZA6B 3QQ4A 1DZBA 4MAUL 4R4BA 2O5YH 5GS1A 3MBEC 4PGDB 1FRGL 5HHXH 5IF0A 5AG9A 2P24B 1QHPA 4TULL 5JXAL 3U9UA 3RWDB 3NABL 3I50L 5ICZB 1DBBL 4LP4A 2DI9A 1A3QA 4QHKJ 4OKVA 5GJTH 4FZEH 1CGXA 4PG2A 4OZIF 4PP2A 4FP8L 3IJHA 3VFNA 1HXYA 1Z0NA 3BW9B 1VFUA 4U1GB 4NCDA 1BREA 3O3DA 5LGHL 1QD0A 2BNUB 4LARH 1INQB 1S7RB 4KI1A 5F44A 3R1GL 5K9JL 1IKFL 5E8PA 1T7ZA 3ZT5A 1B4RA 4MD5B 4XAKD 1JWMB 4G6JL 3VH8G 4DW2H 1JPGA 5AWNH 1MFCL 3D0VB 2EDOA 1DUZB 1R3JB 5KJRL 3IXAA 3DX6A 1C7SA 5C0NC 3D18B 5I1AB 4RBPH 4OZIE 4F7TA 3O2WL 2ZUSA 3K8KA 3BDYL 1TCMA 2ITCA 4JZNA 3EOBB 3T1FA 3C09B 1W0WB 1Z2KA 1FH5H 3V0AC 5J9PA 2WWMD 4JFED 1YA5A 5EUKA 2Y25A 1F2QA 1CF8H 1KIUA 4JZOB 2GSIA 2Y5TB 1QYGL 1KC5L 1DEDA 5ITBH 4XNMA 4OCRH 4PJXB 5JUEL 5CZVL 2YKLL 3P9MA 5JORB 3RKPA 1ZE3C 3N06B 2JJUA 4PJAA 2FEDC 4NRYB 3T0EE 1RZKL 4O58H 4TVSa 2KZWA 4JG0L 5K9KB 3Q5YA 4RFEB 2MOVA 3HI1B 4NDMB 3VXQA 1DE4A 4PJAB 4C55A 1CGSH 1GOFA 3QWOA 4F15B 1VERA 4NJAL 2OR9L 4TSCL 3RUGB 2VR4A 1IFHL 1CGYA 4TTDD 4HT1L 1NUGA 1WIPA 5GGTL 1BFVL 1GPOL 4DN3H 1PYWA 1KPRA 3H9HB 4P3CH 1Q0XH 1LDSA 1IBGL 4L4VB 4UIKL 5FV2A 1RZFH 1NMAH 3FOMA 1ZLVK 1G7MB 2CUIA 1PLGH 2VDML 4PRAA 2BRRH 1T4KB 4P2YA 1Y6MR 1UH3A 3OBAA 3D0VA 4EIGB 4MXWL 4H8WC 5DRNA 3GSXB 4HK0A 4DGYL 1D6VL 1I9JL 1HZHH 5HHMB 3RL1B 2OBGA 3L1OL 5T3ZD 1FIGH 4CAGA 3KLAA 1IAOA 2NQCA 1X5GA 1ND0B 5JW5A 5C3TA 2XZZA 3FFDA 4ETYA 4M6AA 4LP5A 1MFAL 2V2TB 5GRVK 5DO2D 4KUCF 1AQDA 5D1XC 3WV0A 2A9ML 2D31A 5HYEA 3EZ8A 1QSFE 4OZGE 4Y16A 1QLFB 2F19L 4TUKH 2R4RH 2AJSL 5D4QA 4HGWB 3TA3C 4YDKL 3QWRD 2EDNA 3OPZH 4UU9B 1ADQH 5HBBA 1C16B 1MQKH 4ZFOA 1SBSH 4O51B 3IJYA 3BKCH 3QEUA 1HKFA 4L3CB 1B3JA 2ED8A 3D85D 1CG9A 4PJFB 5KAQF 1ZHBB 3ARED 3QJHA 2B4CL 5A40E 1NCTA 1YJDC 4LVHC 3QEQB 4WUUB 4RWHA 3IXTB 5DK3A 5DWUL 4NO2B 3VFUB 3CC5B 4QRSA 5HY9A 5FYLD 4UNTA 2E7LA 1YJDH 1S3KL 2P46B 1CLZL 5K59E 4FFYL 2Z4QA 2FB4L 4Z8FL 3TVMB 1TQCC 1LGVA 4XRCB 3QXVA 1I7ZB 4UTBH 2DQEH 1QSEB 2X4SA 2EYRB 4Z7UA 2ZCLL 1XCTB 2W59A 4GRLD 1U42A 3QG7H 2MPAH 3NACH 3SKJH 3EO9H 2R39A 4AG4H 3SDCB 1A9BB 5DJ6B 2OJZH 1R24A 2EDFA 3QUXD 4F33B 1DL7L 1OLLA 5EO1A 3L5WB 2ZOLB 3EYOA 3UAJD 4DOHB 5GS0L 3N1MC 4NKQB 3NFPA 5DC4B 1LDPL 2C5DC 1R5VA 3N9GH 3HG1E 4NOFA 2DM4A 3DETC 4LLDA 3HLAA 5ABDE 2V5RA 5C0IA 2KKQA 2VISA 3Q3GA 3QUXA 3BAEL 4AMKH 5TDNA 1ZS8B 4PJDE 5L8KB 2LQRA 1ORQB 5TQ2H 1LMKA 1IEAB 3UJIL 4UNUA 4A2LA 4KKCD 5J1SC 3ESUF 4NHUA 3WFEH 2JF1A 4APQA 3NOIA 1EHLH 5D7SL 3OB0H 2YWZA 4ODWA 3H6JA 2ZUXA 2AJVH 5KVFL 4U1HA 4WTZA 4OGAC 3B9DA 4KTDL 2CO7B 1OP3H 4LVNC 5EZLB 2CLZA 4MCZB 1QRKA 2AS5M 4WW2C 3UDWA 4W6XB 5I1EL 3WHXB 4G6FB 5EO9A 3SKNA 3ME0A 1GHFL 1CFVL 4MCZA 1UB6B 4GW1B 2VOTA 4EOWH 5C0CB 5JORA 3HR5A 4KC3B 4TN9A 4ZO8A 5FK9B 4YK4C 4U49A 1KTLB 4PTTB 5HJ3A 3QO1B 3K80A 2CO6B 2X4SB 3PJSB 1NDMA 1KB5A 2WP3O 4D3CH 1RIHH 3U36A 3RX7A 3G5ZB 3HAEH 4FP8H 2AEPH 2ICES 3QUZB 2HG5B 2H8PA 1BAFH 4L8SB 5I15L 2EDHA 1DDHB 4XCYA 3BVNA 4L8BB 2FJHB 5GGVL 1A1OB 5A2JH 1XF1A 2HT3D 5KS9E 1N5YH 3IU3A 3IDIB 2VMFA 2ZPKL 1YDPB 4Y2DA 1PY4A 4U2ZA 5TQ0H 3P11L 4P46D 1AP2B 1LK2A 1P2CA 1I1AC 4ODVL 4BSJA 5AUMA 1N59A 2C3VB 4MX7B 1KJ2B 4O9HL 2AJ3A 1SBBA 2E5EA 3KS0J 5J56B 4NIKB 1CLZH 2A83B 5CJXA 4ZFOB 3LKSB 1C5CH 5D7LB 1MIEL 2R2BB 2ZCHH 4MJIA 3NFPB 2YBRA 2DQIH 4XMKL 5TE4L 4HMDA 2J8UB 5ALBH 4WTWA 3MCKB 1BPVA 3C87A 1OAQH 4GG8B 2DBLH 3HRZB 1R24B 2H9GA 2FL5B 4ZPVA 2CK0H 2Q76A 3V5HB 1LNUB 4AEFA 2FZ3A 3LIZL 2MNUA 1E6OH 5FIEA 1WZLA 3IB4A 4WWKD 3CMOL 2FWOA 1LDPH 4JRXA 3QR2A 5EU5B 3QWQB 5E56A 1ED3A 3VWJC 5EC2A 5ID0B 2IANB 4K8RL 4ENEC 4HBCH 3RU8H 2QJDA 3AU1A 1N7MH 3TYGH 4X8JB 2WWKT 1ZGLM 3EGSA 1BFOB 5ACLA 3MLXH 4BELD 4EUPG 3IETB 3BP7A 3FONA 1OTUD 5JW3L 4PRAB 4MD4A 2B20A 5IFJA 3QIUC 4KZEL 1LVEA 1MJ7H 5JXEC 3O2WH 4WW2A 5MHSD 4HW6A 1PSKH 4JZJB 4F7CA 3MOQA 2BK8A 4GW4B 4OFYD 5SWZE 2H2SD 3FJTA 1NANI 2IAMD 3P4MA 4M61A 2FDBP 3R8BB 2D7OA 3NIGE 3F8UB 4OFDA 4JM4L 5HHPA 4XHQA 4KQ4L 3PE9A 5GSRB 5JW4M 3EGSB 4HDIA 4NO0D 5CP7B 2VQ1B 3MSPA 1I9JH 2FBJL 3CDCA 2W9DH 3QNZB 5EOCL 4JM2D 3TGXA 3QUXC 2B4CC 1YECH 4QEGA 3LRSA 4M7KH 3S37H 2YUVA 4LKCB 3IFLL 1QLRB 2WIIA 5B38B 2BOBB 2JK5A 4NO0A 4PJHB 4POYA 3FHQA 5E2VH 4UBDD 3EO1A 3MNZA 3FQNB 5GGUA 3BWUC 3UTSD 5EC1B 4H5SA 5J9PB 3UJJL 3ARWA 2FJHA 4LRIC 1A7RL 2YZ1A 4UDUB 2KQMA 1JMZA 2AP2A 3DHMA 3L5XL 2HA1A 5GS2H 2BVEA 4OGYH 3QHFH 1K3IA 3VXME 4NZDA 2Z91B 4MX7A 4OZHF 5DMGC 1BLNB 1PSKL 4NYLB 1P2CB 2XKSA 1NGQH 3MGOA 3WUWB 4Q97A 5IROA 2EKJA 3VD7A 2FX7H 2CIIB 4IRJB 3B9EA 4DVRL 3PF2A 4JN1L 2Q3AA 3LKRB 3HUJA 2AXGB 4EI5A 1FLRL 3LS5H 2EIZA 2HRPL 1D5BA 3UPRB 1QPXA 4XPAH 3I02A 5DZNA 2XQBH 3BFOA 3KAAA 4N5UA 3TO4A 1NSNL 5IF0B 3FMGL 2NXYB 3KWWB 3BZEB 3UPRA 1CD1B 2GJ6A 3WLWD 4NM4L 3OAYH 4HJJL 4L29B 1FG2A 4KQ3L 4PV8B 2KPNA 1KFAH 3HHRB 4IMLA 5DMIL 1IILE 1IGFL 3C08H 2YC1A 3RWIA 3RNKB 5I6XC 2ITCB 4U1IB 4UI2A 5EZLA 1UT9A 5E2UH 5GGRB 5H37G 2A6KB 1RD6A 2AJXH 1OAYH 4RFOL 4ZYKA 5JMOC 1W0VA 4HUWB 2E9JA 1UXSA 3CVHL 3HPJA 3C2AH 3VGHA 2GITA 4Z77A 3WIHA 1MWAA 1TTUA 3NTCH 2AI0L 3U83A 3PUCA 4GXUN 2AJUL 1T5WB 5CEZD 1P5VA 3DV4A 4HKBB 2BVPB 2WBJB 3NFSH 1SMOA 4XMPH 5IWLA 2A74A 2UYLB 2ERJB 2APFA 4G80A 1FL3B 3BH9A 3FT3A 4IMLB 4MNQB 4ZG1A 3G6JA 3HPLA 1XF3B 5DJAB 1H5BA 4IDJH 3LQZB 5HPMA 1I1YB 4LQFL 3QRFM 3BDBA 3EYUL 2BSTA 2BOBA 4NO0B 4BQ9A 1IRAY 4JHAH 5LVEA 1CLYH 2PCPA 5HI4D 3VGAC 3S96A 3MXWL 1UJ3A 3MLZH 1MJJA 4HJGB 4K7FA 3ARGA 3F58L 3UTPE 4XBGA 4Z0BL 1OAZL 4H1LA 5DI8A 4OT1H 5A2IH 4G6KH 3LKRA 4WWKC 4WFFD 4L5FH 3BXNB 3O6FC 2ORBH 3ZKXC 3FB6A 1WK0A 4IIQC 1VADB 4RMRA 2DJUA 1U8HA 3TZVD 3ILPB 3WLBB 2P8LB 1ZHLB 3LPFA 4KU1A 1UXWA 5MEOB 1YEGL 5DLML 25C8H 4GJTB 4X6DB 4OZGB 5BS0D 4PRBB 5ACZA 4WW2F 1EBAA 5D1QD 3SDAB 2XY1A 4I18B 4U0RB 2W60B 2CRZA 3OKYA 2AJUH 1TJGH 4HFUL 2DLGA 5IWLC 1FZJB 3B4NA 3ESVF 2E7CA 3C8DA 2ICEA 1T5XB 5GGQL 4OB5L 1F5WA 2H3NA 3D6GA 4LKXA 3QFJA 5D7IB 1IC7H 1CT8A 5JW5B 4MA7H 1FE8L 2A6IB 1WIUA 4OV5B 1A6UH 3OXSA 3IKCA 5I71B 5D1QA 1RUMH 1OQOA 4WU7A 4JFPB 3SDDD 5IHUL 5TE4H 1KPVA 4PJ5B 4ZXBB 5DR5H 4Y5YC 4DKFL 1L7IL 2UZIL 1BIHA 1DSFH 3P30H 4D9LL 3GK8H 2EIDA 1CICB 1A6ZA 4U7SA 2X4RA 1WCQA 1BQHG 5IGXL 4IOSD 5FXCH 3V8CA 3F7QA 2H26A 4KJQC 3RI5F 1Z3GL 4M61B 4HIEB 1O7SA 4PTUA 1MRFH 2DQJL 3O3AB 3EYSL 5SX4I 4JZJA 2BMKB 4TYUA 2YD3A 4HS8H 1T1XA 1EFXA 4R8WL 1AP2A 3BGAA 4P59L 1MVUA 1ZGLA 2YD2A 4D9RE 2A77H 1QBLL 5HDLA 1P69B 2DM3A 4LCWB 1KN2H 1CU4L 5DQDL 3TP4A 4RAUA 4L4VA 5F93C 3PP4L 3OKNB 4UIMA 2QADD 4JLRB 5FFLA 2VDOH 3NCYP 4H1LH 4NRZA 1QTYT 1IM9B 2WQ8A 1KPUB 4QXGH 1S7SA 4U6VH 4Z7VF 2WV3A 5CSGA 4KJWC 2HTLD 2NX5E 1FAIH 1LO5B 3I85A 3ZTNH 3TWCH 1C08B 1LE5A 4NQDD 3ULVD 5E94A 1DE4B 3QCUH 2A9MH 4RZCA 2V7NB 3EYVA 1OAZH 4MAYC 5F9JA 2ESVE 2G9HA 4FOMA 2G60L 4P23D 3QUMA 5CGTA 5DSCA 3U1SH 5GGVY 1WSST 3ARQA 4IRJA 4IOFD 4TNWF 3A67H 1PZUB 3T2QA 1KLGB 2QTEA 4PJIF 1MCKA 1U3HC 2HFFB 3WS3A 3OGOE 5E2VL 3KPRE 4GAJH 4Z7VB 4IHOB 4PJCB 2CMRH 4ELMA 1CGUA 3U4EA 3CSBA 2IJ0C 5KJRH 5BRZE 4WI8A 4NQUA 3AREA 3D48R 4P2RB 2DLHA 2QLVB 4JVUA 5C6PB 2NZ9D 3T1WA 4HPOL 3BZDA 5GSVA 3SQOH 3VFNB 1P6AB 3ARFC 4ALAH 4JFYA 4N8CL 2ZUVA 2AABL 4XCCL 4QY8A 5KSBB 5DD3L 4H0IA 4TQEL 3EJJX 1IC7L 3U9UB 3X3GL 4YDJB 4HF5L 5JIHA 3BN3B 5C1MB 3EO9L 3HR5B 4AG4L 1LK3L 3QXDA 3P4NB 1XCQB 2Y5EA 3OJDB 4Z5RA 3BP4B 4X9GA 4RRPG 3P4LA 4M5ZH 1JV5A 3EOAB 4C54A 1I7TB 1QP1A 3GK8L 1NQBA 1JGUH 3L3DB 1NDGA 3NABH 1ZVSB 4FQXD 4N90D 4QRPD 4XMLH 3F5WB 3UZEA 4P4RA 2X4NB 4XNZB 5JPMA 2IAND 2UVEA 3TBTB 3E0GA 4DGYH 5DJZA 4G5ZH 3GMQB 3A67L 1MAKA 4NZUH 4L9DA 2EH7H 1I4FA 3I9GH 1MFDL 2ADFL 4BZ2L 1FDLH 4ZUVA 1BQHB 3QXWA 3ZDYF 1S7VA 4J7RA 2IGFH 4I3RL 5B39A 4F9LA 1HH6B 1NCWH 3CFIC 4JKKA 4N0UE 3LZFH 5ERWB 3D69A 4NO2A 1FH5L 2YN3A 3B8YA 5E00B 4EVNA 3S4SA 1A7NH 3D0LB 1NMAL 1RZ8A 2IALA 3G9VA 4L4TE 3PWPA 1CK0L 32C2A 1DQJA 1I1RA 2RFXA 1GAFH 1RZIB 1ZTXH 2AK1L 2FSEA 3RTQA 4YXHL 3PGCA 2BNQE 3KXFD 2Y72A 4OFVA 3VXNA 5IFAL 4PBWD 1HHGB 4J4PD 5BOPA 3OXSB 4PGEA 4F9LC 1D6VH 4HEME 1X5IA 4XCFL 4OD1L 3GHBH 3ZYIA 3QDHA 2W0FB 3KYKL 3QDGB 4XBPA 5LWYL 1SYVB 3L7EB 4B7LA 4Y4KD 5T33H 4N5ED 2AV7A 3UYOD 3ZTJG 1EUUA 5IBLC 3LN9A 1UGNA 3MNWA 2V5YA 4RBPK 1N0XH 3O41A 2BSRA 1T2JA 5C0BB 3WIHH 3ZDZE 3DOSA 2R9HC 3UC0L 3GSXA 1K4DA 4HK0B 4TSAL 3U30B 4FXGA 1TZIB 3UTSB 2C1OB 3TIEB 3RTQB 3B5TA 5IT2H 2O93L 3AB0C 4M6NH 4HT1H 4LCIH 1T4KA 4NT6A 3ARBB 5J7CC 5I16A 1MRDH 4YFEA 4L3EE 1CGWA 3TIDB 4O2CA 3QDJA 1CXFA 4MWFA 4XWOC 2QQKL 4FXKB 3MRMA 5DFWH 3VJ6B 3G5VA 3N9GL 3F7YA 1YEGH 4YHIB 2OZ4H 2F8OA 1IC4L 2H8PB 3MRIA 5CJOH 3FAXA 4OD2B 5DFVD 4M6ML 1RHHB 2MMXA 4H8WH 1HDMA 3WMSA 4XP6H 4JB9H 1FIGL 1H5BC 1KB5B 5I6XB 2WWMC 3PJSA 1CFBA 5IVNA 3WIIH 3FO0L 4LLUA 3P0VL 3T65B 5GZNC 4U6XA 5J8OA 2ITDB 2D31B 4KVCH 4IOIA 1OD7A 3OKDB 1A6UL 4N90E 2HJFB 1GZQA 4LPTA 3WL9B 5TFSL 1Z0MA 1U3HA 1F8TL 2VLKE 3TH2T 1UWGH 1FC1A 1MJUL 2LTQC 4WUKL 1OT2A 4OTXL 5TF1H 2I9TB 5L2KE 5C6WH 3K0WA 3V9FA 3K74B 2QQLH 3KJ4C 2VLMD 5J3HC 3B6SA 5C09B 3TBWA 3RWEA 2ATKA 4FFVC 5DJYB 5AUMB 3BQUC 3CZFB 1I75A 1A64A 4XZUA 2E9BA 3RWFB 3F12A 3QIBD 3MLWL 2VDPL 1U3HD 5HHNB 3T0EA 5TE6L 3JV5A 3AS2A 1AJ7H 2BXYA 2V2XA 3HC3H 2VDQH 1A1OA 2JELL 3LN4B 5SV3A 2BHYA 1MRDL 4R2GD 4YEFA 2HFEA 2RR3A 4FFYH 2X4QA 3VXPA 5JDSA 3LKOB 1HSAA 4JFHE 2NZ9C 4Q6IC 5E5UB 4ELMB 3VXUB 1DR9A 4IRZH 4QF1B 4XVTH 5F88B 3SCMD 4UZGA 4LDEB 1S8DB 5DWUH 5F96H 4AZ8A 2HVJB 5DK0A 5LJYH 5EBWA 3DWTA 3ULVH 4NHCL 2MPAL 4DCQA 3S35H 1NGYA 4X6FB 3I02B 4U6YA 5C0CA 3O3BA 5I73C 3MFFA 4PBXA 5GGVH 2QQNH 4XVSL 1CDJA 1YY8A 4NZRL 5MHSE 5F7KC 4DGIH 1IM3B 5IROC 3WFBL 4PP2B 3ROOA 5DDHA 4JGUA 3QO0A 4OLEA 4FQIL 5C92A 1DVFB 3BUTA 2IBZY 3MACL 2W0FA 1MCWW 4AEIH 1IEBA 3DJ9A 3EW3B 4X6DF 5HDOA 2UUDK 4Q0XL 4G6AC 4DN4L 4WUKH 4R7DB 4GLRH 4PRPB 3ULUL 4KUZL 4TNVK 2WLZA 1IQWH 3MLTB 5HYSB 2R8SL 3MRIB 1M6OA 5IV2A 3ARGD 3PDGA 3B3IA 3DUUB 4X5XB 5EOQH 2FGZA 3LY6A 4ZUWA 5HGDB 2OL3A 3CX5K 3J7HA 1OARH 3DX6B 2D03L 2R1WA 4EIZC 3LKNB 3RKDD 3BZ4B 4X4XB 1A02N 3MV8E 3HS0A 2DWDB 3TH3T 1QBBA 4M93C 5C70A 4FXGB 1MREL 5I9QB 4GBXA 3DSFL 4MHHI 4QGYA 1P4BH 1D5ZA 4KPHL 2CR3A 5D6CA 1C12B 5AZEL 1UYWH 3WIIL 4X6BA 5EFIA 4P3DB 4JHWH 1FBIH 4IOIB 1NBZB 3WNNA 5F7YC 1WWCA 2DJ4A 2BXZA 2WIMA 1KEMH 4PGZA 5D1ZD 4PBVC 3QUYC 2BSSB 1A6WL 2VR9A 5CJQL 3O6FA 4LBEB 4K94C 4PJIA 3MRFB 4N0FB 3ARUA 2BDNH 5HYIA 4KQ4H 5HY9B 2YPLB 3MREB 1NC2D 5I19H 5TGBB 2VXUH 1V8HA 3VXUA 2R4SH 3QAZC 4Y2DB 3DETD 4AIZB 4YQXL 4KHTL 1UJ3C 1OAKL 1J0IA 3FT4B 2H2PC 1Z9SA 5DJCB 4JFHD 3JWDL 1KN4L 5JIPA 2X9WA 4TRPH 3FT2B 2EE3A 4EQ3A 5FKAA 2XZQL 3H9HA 4UILL 4KGLA 4HX1A 1E4KC 3MMEB 3B2VL 4LASL 3BOVA 1DEEA 2PN5A 4I3SH 1CDHA 5BW7C 1IEBB 1F11B 3CMGA 5JPMB 3V5HA 3QCVL 1A7RH 4I77H 4WDIA 1F58H 1Q9OB 1NEUA 3QEQE 1G9NL 2VUOA 3ROOB 4OGYL 4JRWA 4Z5RB 3X11B 4N0UA 3PABA 3KPRA 3V95A 4I2XB 4NQSA 3LH2H 1FNGA 3ARBC 2J3SA 2VLKD 5F3HA 2ARJA 2NY4C 1T2QL 4L5FL 2DQGH 4Y89A 4YHML 5JLZA 3IDXL 5IBTL 3V4PL 1SYSA 5DRXB 2X7LB 1EERB 3NZ8B 2HT2C 1J8HD 4JFYB 1MJ7L 1IGCL 1T80A 3GSQB 5E8DH 1J87A 2X4OB 2P48B 4WY7H 1BEYH 1HH6A 2AQ3A 4DUXA 4XAWH 2COQA 1IC5H 1DQTA 3MLXL 1VGEH 1FGVH 3T0EB 3R0MA 3GSRA 4GKSB 4YPGB 5LAXB 1AGDA 3G5ZA 1ZSDA 4TOYH 1ZANL 2YD9A 4QTHA