3OKEA

Crystal structure of s25-39 in complex with ko
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMNCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFALTISSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERANGVLNSWTDQDSKDSTYSMTSTLTLTKDEYERHNSYTCEASHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeA01
3GNML 2RR3A 3DXAD 2XTJD 1TFHA 2NX5D 3MV7E 43CAB 1IAIM 2MNUA 1I8MA 3ARRA 4ZO9A 1RVFL 1UH3A 4R90L 3T3PE 1L4IA 4KV5F 5IM7A 3WIIH 3PIQB 4Z8FH 3DJ9A 1PX4A 5FV2A 5EUOF 5ABDE 4JZJC 1QLRA 1CZ8L 1FH5L 3HI1B 4FQ1L 4EZMA 1MHPL 1PSKL 5HHPB 1HKLL 4WWKA 3S8WA 3CJJA 1M7DA 2OL3B 3C87A 5L2JA 5IIEA 3HZYB 1YQVH 4OF5A 4AL8H 4E41E 5IMLB 1YJDL 1XGQB 4ELKA 3FB7B 4L29B 1KFAL 4HIXH 3K0WA 1AGFA 1CDJA 2V2WA 2XKNA 1EEZB 4IRJA 4HS8H 3SKNA 3C5ZA 3O8XA 4EI5B 4CL7A 1YN6A 3U7YL 4LOUC 5DJ6A 4WWKD 4PJCA 2Q3ZA 1BGXH 2NY2D 3DVFA 5MEPB 4GMTH 3SDDD 4KTYA 4LAJH 4QHKI 4MJ6B 1U3HD 4Q74A 4PJHF 4X7TA 1A1OA 2P46B 2F5AL 2IPTL 5AAMA 5JNYB 2CIKB 1W2KT 1I3GH 2ICCA 5I1HL 1FYHB 4UIKH 4IRJD 3PWLA 4BYHA 1K9TA 4LSSL 5IROA 5K9OA 1JHKH 1IBGL 3IRZA 3TEUA 4ELMA 2DM2A 2WQ8A 4KI5F 3EDKA 4Q9QH 1WGOA 5FOBA 3FB6B 4HXAL 4CW1A 1YUHA 4GKZB 4NO0B 4NO5A 4PBVC 5T3ZH 4MAYA 1XF4A 3MYJA 2ZNWA 5LWYL 4P2RB 4R4FL 3NCJH 1NPUA 1YEGH 4GAFB 4M61B 5D1QA 2AAVA 1BMGA 3LDBB 3LKQB 3DI3B 5D7IA 4WFHD 5DK2B 4K94L 3CSBA 4UBDC 3IJYA 2CIIA 2WP3O 4JLRA 3BJ91 4K9EL 2A74B 4ONHB 1IGCH 3W0WE 4HIEA 3DUSA 2HKHH 4NZRL 3HRZA 1A14L 1XGPB 5D1QD 3IDJA 1P84J 2XY1A 3G08A 1BD2D 4Y89A 3U46B 4WDIB 1HZHH 1OP5H 3VXRD 3SGEH 4XPAL 5IR1A 4LPXA 5F6HI 2ZZUT 5F88A 3PQYD 1OAZH 4UMGA 2BVYA 5CKGA 1AD9B 4L9LC 1D3CA 4NQSB 4R97C 4NJAH 1K8DA 1CQKA 4OIIH 1YPZB 5HYSA 1G6RH 2R2CA 3C5JB 1AFVL 2GJ6E 4F33B 5ILTH 3DPBA 3P4LA 1ZA3B 3B8YA 1NGYA 2Q8BL 5I8OL 2XV6B 2FDBP 2CDFB 2DLFL 4FNLH 4UDTA 4LQFL 1N6UA 1S7VB 4KPHH 4KDVA 2BDNH 5IHZA 1A7RH 2OI9C 2YKLH 3AS1A 2Z31A 3GIZL 4P4KD 4LLVA 4OUUB 1S9YB 3VXUD 1CVRA 2AXFA 4IDJH 4DW2L 2X4SA 2O61A 3KPPB 1K2DA 2PW1B 4M1GL 1R24A 1FFNA 1YEHH 4FFYL 5CGYD 3MRNB 4GAJH 3WMSA 2BY1A 4M00A 4ZFOL 35C8L 2VDML 4RRPG 3D5OF 3UZQA 5AUMB 1FO0H 4KJWD 1OCWL 4LASL 1DN0A 3D25A 2DKUA 3QNZA 1TZIB 5DVOA 1Q9LB 1CLOH 1FJ1A 1UJ3B 2X10A 3VFTA 4KK9D 2XZAH 1H8OA 1UWEL 3VXTB 5ALCL 5IKCA 4YDVB 2Z8RA 1FGVH 1JL8A 4WI8A 4AEHH 3ZLQC 3MLPA 1RUAL 4M02A 3DTXB 2R8SL 5DFVC 4OGAD 3CPLA 3UPRB 2R0WL 1B88A 4LCCA 5EOQL 2QADC 3JWDH 3PGDB 1FFQA 1S7RB 1MCSA 2NY3C 1GZPA 4NCC2 4NBXB 3FQNA 5DJ2A 3ESVF 2A6JB 3PWPE 5E99H 4NQVB 2RB8A 3E0GA 4AH2A 4XZUA 1Q72H 4KUCD 2V2TB 1S7WB 4HULB 2W07A 3OKLB 1OTTC 2FGWH 4ZO6A 2NPLX 4OZFG 5H2BB 2ZUWA 5KBNC 1FPTL 4G6ML 2MSPA 3JTSA 4BSJA 3QNXB 3HC4L 1EVUA 1A7QL 2GAZA 5LAXB 3BISA 1AKJB 4L1HA 3S7GA 3B83A 3TFKD 3CVIL 5FKAA 1QLFB 1WT5A 2X6MA 5E2TL 5C8JB 3D0LA 2Z92B 2XZCL 2YPLE 2EDQA 2YD9A 3VGDA 2PO6B 2BSSB 1QSEE 1RZJC 4NWTL 3S35H 2XWTB 2YD1A 5SWQB 3TBYA 3B9KB 4IMKA 5IQ9A 4MNQA 5HI4C 5D1XB 5E2UH 5CEZD 3G6JA 3VDBA 1DJSA 3LQAC 5EDXA 4M5ZL 4F7EA 3GSOB 4HMDA 1E6OH 4P57A 4MAUL 3O6MH 4PV8A 1A6AB 4MNQD 1BHGA 2BNRA 4MS8D 3TZVB 1CGVA 1DQQA 5FGRA 5DD6A 4B0MM 1YEKH 3G5ZB 3GSNH 1U8NA 4X4MA 4PJCF 5HDOA 3KXFE 3V8OA 1TZHA 3T1WA 4MJ5B 4PGDB 2WIMA 5C08B 1DQJB 4MDJA 4HG4J 1OSPH 2YUWA 2VDOH 5EBWA 4J6RH 3RDTC 3SKMB 4JHBA 5EU7C 5BZWA 2BNRD 4OV5B 1MCPL 4G7VH 2PNDA 3KR3L 2DWDB 1KTKE 3MNZA 3O9WC 1LEGA 1ONQA 2VLJE 3B2VH 3B9AA 3PWNB 2NY5L 5CCKH 2N7BA 1J0KA 3AXLA 4LLMB 1JF5A 2WBKA 1U41A 4WW1B 2D7TL 2KZ1B 2EE6A 5E5MB 5J1TC 2EKSA 2D3VA 5D7IF 2P45B 4OJFH 4F2MA 4S1QL 3MLRL 4P2OB 5JR1L 5F7FA 3L3DA 4XNXH 5HYFA 1M7XA 1YDPB 4ZODA 4QTHA 3QEGL 2LE9A 3GMLA 3MLVH 4H26B 1MIML 3O4LE 4KK8D 1TJGL 1K3IA 3Q5TA 3WFEH 2H32B 5LQBH 4XCFH 2BY3A 3WKNA 2D4DA 1P53A 3TF7C 1NEZA 2A9MH 2C7UA 1HEZB 3EZJB 3MV01 5FHBL 5AYUH 1VEMA 3HNVL 1OVZA 4D3CL 1JPGA 3SE9L 2UYLA 2NR6D 2DIJA 2W9EL 5FXCH 5GRUH 3RWDA 4NDMA 4KDTA 2J5LC 2P7TA 2DKMA 5C70A 2R4SH 5B22A 1FNFA 4J7RA 4Z7VB 2DJ4A 1BQHG 4UV4L 4AJ0A 1YNTA 2DBJA 1ZGLP 3KHOA 5CBAB 3BHBA 1D5ZB 2PN5A 3CCHB 5ANMA 7CGTA 2Z91A 1C5BL 2GY5A 2WWKO 4U6HA 4NHCH 5F72S 3SGKC 3UDWA 4KGJA 1GGYA 4ZTPH 4KXZH 3VJ6A 3UTZB 4KMQA 1CDGA 1TQBC 2VLKD 4DUVA 2P8MA 3VXMA 4RA3A 3H9HB 1DLFH 4WO4B 1E28A 1T6VN 3BDYL 1ZSDB 4OLZH 4Z7WB 1L0YA 1DE4B 3LRGA 3NIGE 1EO7A 5E4IA 4Z78B 5KSAC 5KS9E 2BHZA 1EA9C 2V7NB 3EIFA 4JRYE 3ARPA 4RFNC 4EI6B 4FTVE 2VUOA 4Y4HA 4UNVA 4RGNB 2ZUYA 1A9EB 3RGVA 4Y5VA 4Z0BH 3VXMD 3HFMH 1PYWB 5C09D 3GI9H 3NMEA 3TBSA 4BUHA 1C5DA 3VWKA 5C0CE 1OAQH 2FX7L 4JY6A 2VDPH 1AY1H 4M6MH 2HMIC 2YXFA 4OKVA 2YD7A 3GO1H 3SOBL 3U2SB 1OP3H 3VI4F 3U0TA 2QR0B 4KRPD 5F7EL 4TRPL 4Y4HD 1N6VA 1NGPL 1V7NL 2BSRA 2CJUH 1HN1A 4YHNA 5GGUA 3RGVD 3UBXI 1R0AH 3TNNB 1MUJB 4HT1L 5L2KE 1OPGL 3BRDA 1R3HB 4BH8A 12E8H 1KPVB 5JORB 4I5BB 4X6CF 2C3VA 4V2BA 2OR8A 2VQUA 3T0WA 5I8CB 2EDOA 3M8OH 4YPGA 2AK4B 1W72L 4YFEA 5BXFA 5GS0D 1X6NA 3ZT5A 3ZKMC 3KJ4B 1WIPA 1U8QA 1BOYA 1TLKA 5J6GA 1I9IH 2EEBA 2O5ZH 5IW6A 3VXSE 2JELL 4OM1L 2P49B 1FZOA 3LEVH 5GJTL 2R69H 1EHLH 3MUY1 4G6JH 4OF0A 2PTTB 5KW9H 3GI8H 4D0DB 5DFWH 2EE3A 1X7QA 3S34L 4EDWL 3OAUH 5ETUB 1NL0L 3LRHA 5C9JB 1FFPB 2W0LA 5IBTH 1A7PH 4LHUA 1U3JA 4U31A 4M4PA 4PRIA 2NY1B 5F9DC 3VGEA 3SE3C 2BZDA 25C8L 5FOJA 4LCWB 1LP9E 1S7UB 1SEBA 4YE4H 4JGJA 3QQ3A 2VH5L 1FG2B 3WO4B 1RIUH 5FM8A 4IMLB 3Q6GL 1CXIA 4Z77A 4PRID 3SO3B 2WLYA 5IOPA 4LHJB 5C0BE 1UZ8B 4ODXB 1W0VA 3VD7A 4DUXA 2G75B 3MRJB 3OF6D 4HKBA 4YHLH 4Z7OE 1HINL 4GOSA 4G42A 1TDQA 4N1EA 3EYFB 1AGDA 4QHLB 3G6JF 4YGAB 4L3EA 5BRZE 1KB5A 3B5HA 3F6LA 3IAGC 2AJUL 2R1XB 1F4WH 4M48L 4CU8A 2J88H 4IDLA 1QSFA 3PABB 4F7MA 5I8KL 3DROA 3BGMB 2JIXA 5D5MB 5F93C 4PJXB 5GZOC 1F3JB 1RSFA 5DYOB 3FQTA 3TT1H 3I9GH 3MACL 3V4PL 3QDGA 1MWAL 3P4MA 3H7BB 3EAKA 3D48R 4G9FA 4BFEA 1DEEA 1KLFA 2IANA 5F1KC 3AC0A 3IU4L 2JIXD 5EZIL 3NAAH 3UTTD 5EOCH 2GEEA 1NCDL 2X70B 1P69B 4I2XE 3BKMH 1YY9D 3QDGD 4QHMB 2OZ4L 4JZNB 4PJ8A 1IC7L 3L3HA 1R3KA 2VIRA 3KYAA 1H3XA 5TE6H 1V7ML 4BH7A 4JPIA 1T1YA 1Z9SA 4XVTL 3BUYA 4NP4L 1J8HD 1GHFL 2VISB 4JGUA 2WUCL 3W2DH 1C5CH 2VXVL 3WJLC 1MCDA 3PE9A 5DGQA 2AJSH 3LIZH 3NCBB 4PJ8D 5B3JF 3ET9F 1Z5LB 5A16B 1CU4L 3E3QE 1Q9WB 4WJ5A 5I15H 1A7BA 1EO5A 1BFTA 4G6AC 1TNNA 4JPVH 4JO2H 5E1AB 4X6BB 1CXHA 4B53A 4PD4J 4YHOH 5AEAA 1FL3A 2N7AA 1B0GB 1NLDL 1A6TB 5JXEC 2Q3AA 1OL0A 4G8IA 5D9SA 1A02N 3IRPX 3Q1SL 3QXTA 5ERWA 2VN7A 3VG0H 3B2UD 1J1PL 1MPAH 5EZLB 2BVOB 2Q20A 4U6YA 4YAQA 1EUUA 3N1FC 4JG1L 1YN7A 1MELA 1QEWA 4HDIA 5BV7L 5TH2A 1IFHH 1P4IH 3UTSA 5F1IB 4YDKL 4ODWA 1R5WA 2F5BL 4UTBH 3WDIA 1AH1A 1KEML 2VZVA 5TE4H 1FNLA 4L3CA 1IEAA 1P5UA 2P47B 4U3CA 3TNMA 5L88L 2BVEA 4E5XB 3U0WL 3RIAF 1WBYB 3ARTA 2LABA 3UTSD 1KIUA 2Z35A 5GS3A 2XKSA 3P11H 4RDQF 4WFGD 3EFFA 3T3ME 3KYMA 1LHZA 1TZGL 4OZIB 4XXCA 2GI7A 1T4KA 2C4FT 4EN3B 4G8GA 5E8NB 5D1XC 2ADJA 3MV8E 3JV6A 5M7QA 3LKNB 3HNTH 3OPZL 3BIKA 5GHWH 5SV4A 1T7VA 3ARBD 4FQCL 4OAWB 3QXVA 1GGBH 2E6QA 2ZCHH 3RJQB 2ZSVB 1UKTA 3RL2A 4IIQC 3EO1A 4KZEL 3CSPA 4DKFL 2CKBA 2ED7A 4AT6A 3TZVC 2CO6B 1PKQA 3UAJD 2A6DB 2UUDK 1JN6B 2HT2D 2RQ8A 1I4FA 5I2IA 1CGTA 4CADA 1OQOA 3GK8L 3BH8A 1HSAA 3IFOB 2HH0L 4JFDB 5E9DE 3SJVE 1FZKB 4K3JL 1JNNL 2L4OA 4U1MB 4U1GB 4NNXA 8FABA 5FEBA 5L8JB 4HKXA 3OKNB 1HSBB 4MD4B 1A5FL 4I77L 4L5FH 3ULUC 3MNWB 4K3HA 4TSAH 3O3BA 3QSKB 2EDXA 1ZA6B 4LF3A 1E27A 4PJ7E 2QSVA 3V5HA 2CQVA 4P2OC 3MBXL 2NY4C 3OV6A 1RUKH 5T3XE 2WWMC 2HFFB 4LFHG 4UQ2B 5CMAB 3QEQE 5DJZA 3QFJA 1ADQL 1ZHNA 3BPLC 4LSUL 2NY6B 4Y19A 4OLWH 3W9EA 2P5EA 1LE5A 3S36L 3QJHB 4NZUH 3IS1X 4BFIB 4OFYD 1UM4L 1KENL 2F54E 4N0FA 2OBGA 1MHHA 4FP8H 2AJVL 2QL1A 1PQZB 5GXBB 3P30L 2IPUG 15C8H 5DTFA 1D5MA 2MCPH 3SY0B 5F3HA 2I07B 4RAVB 5DHVB 2Z0BA 2P5ED 4BQ8A 4D9RE 1J0ZA 3VH8B 5IB3A 1X5JA 3ESUF 4NQEB 1IC4L 4TUOB 1I3RA 4NKMB 1NCWH 3QAZB 1T20A 3ARFC 4I0PB 1OWRM 2R0KH 1XGYL 4LOUD 4I18A 1QFWL 1IE5A 1AO7B 3G04B 4OCRL 3A6BH 4XP5H 4FXGA 3UYRL 4LCIL 3PP4H 3AREB 5IBLC 3KNBA 3FFDA 1P9MC 2Z8VC 2EC8A 3OWEA 3DARA 4XWGL 2R1WB 1T2QL 2C1OA 1IQDB 3GNMH 3BDBA 2QQLH 4WO4C 3EYVB 4P2QE 4WGVB 3TO4B 3QFDA 2E9WA 2PKDA 1Z9LA 3OZ9H 5SWZE 1RVFH 4R90H 3DUHA 3SQOL 3MXWL 3TP4A 4BFBD 4GRLC 2CO7B 4XHQA 3ZDYF 2IMMA 3TT3H 3ECBA 4UBDD 1ORQB 1GGIL 4FQ1H 3MZTA 3TO2B 1MHPH 1PSKH 1CD0A 1QACA 5SWSB 5D7LB 4K8RL 4ESKA 1HKLH 3G5YB 2YZ1A 4LSRH 2ZUQB 4QCIB 2VLLA 4M43L 3SCMB 5LGKA 1BQLL 1S7SB 3DRTA 1KFAH 2G2RB 2XN9A 1ACYH 1LGVA 2A73B 4XI5C 2PYEA 1EEUA 2DS4A 2W38A 2OTWB 2VITA 1MRDL 1MJJA 3J7HA 4DN4L 2COQA 3WIHA 1FDLH 5H94A 1XR8B 5F7DB 3BWAB 1BVZA 1D9KB 3MLTB 2F5AH 1UCBL 2IPTH 3KJ4C 4R2GB 5DD5L 4NKQB 5KG9B 3K1DA 4X6DE 4P4RB 5I1HH 1NCNA 4AQ1B 4X6FB 5T1LA 3CFBA 4LSSH 1MCOL 2PYED 4RX4A 3TCXA 3NTCL 1N5YL 4JFFB 1H8NA 4HXAH 3O0RH 4ZS6C 3W5MA 3CDGB 5LWYH 4KKAC 2DQJL 3MRKB 4N8VB 4R4FH 3M17A 1FE8L 1PY9A 2W60A 3IDIB 5T1LD 3OHXB 3VXNA 4JFXA 4DWHA 3RQ3A 4LP5A 4RX4D 4FQ2H 4QHNA 5K59F 4K9EH 3WS3A 1ETZB 3IXTB 3OGCB 5JW5A 3CFEB 1QZ1A 4NZRH 5JOPD 1URLA 3WNNA 4BQCA 2E9BA 5KN5A 3IVKA 3RWHB 3RVXD 1MOEA 1AR1C 5BVJA 4XPAH 1QP1A 5TDNA 1KV3A 2K7QA 4PG9A 4RCAA 4HFUL 3MRGA 5SV3A 1EXUA 4TQEL 3NZ8B 2NYYC 2EDDA 3VRLF 5F7YC 1RY7B 5EU3B 4QXTB 1LILA 2NW3B 1AFVH 2GITB 3KPSE 3NCFB 1H3PH 1X4ZA 2I9LB 4YDIL 1KN4L 1WTLA 4JCLA 3LS4L 1I7UA 3HA0A 2KBGA 2Q8BH 5I8OH 1EIBA 4D2NA 3WUWG 3IGAB 4HIIB 3P73B 3MRDB 1NUDA 3D3VA 4NC1C 5C07A 2DLFH 1DBBL 4DOHB 4CMMB 4FZ8L 4JR9H 3FO2B 5DZNA 3VRIB 5E2WL 5DFVD 3MODL 1SBSL 3BIBX 3GIZH 5T1KB 1OTSC 4HIHB 3D0VA 3DMMA 5IVXB 2YRLA 2QADD 1V8HA 4PJAE 5A40E 5FB8A 3QDHA 4N0CC 4KMLB 3H9SD 1JTOA 3D3VD 4M1GH 5DK0A 4RAUB 5ISZE 4LAQH 4PRPB 5FGBA 4FFYH 4AIZB 1E4KA 2AXJA 4A6YA 4UB0L 2Q6WB 1EMTL 1CIUA 1OTTD 35C8H 2VDMH 4K7PL 1BZ9B 2BY2A 5TQ2H 2FLRT 2FJFB 3IDUA 3FAXA 2CGRL 2AQ2A 3WHE0 3D39A 2LU3A 3X11A 3CX5J 3GBNH 1HH6A 3MFGB 4NRXA 4X98B 4LASH 5CD3B 3MGOB 5J6HA 1IC5L 1ZGLB 3MJ7A 5IHUL 2VDNL 2AXHA 1IGIH 2VXSH 3CSYB 4JHAL 4PUBL 3T8XB 4XCYB 3U0PA 3UJTL 2A77L 4J2XA 4RMRA 1CFQA 3U9UB 1ZT4B 5ALCH 4XBEL 4ZO8A 2E9IA 3KPRD 3BAEH 5CBEA 5CP7B 3W39A 5FECA 4FN0A 1M4KA 2AKRA 4C4KT 3O41B 4PJIA 1RUAH 2XWJA 4QNPE 2FJGA 1TXKA 2I27N 5HGBA 1OB1A 2R8SH 4MJIB 1MCLA 2QHRL 4JO1L 2R0WH 4MB5A 4CJ0A 5HI4D 2HFEA 4HIJB 2H2SC 1ZT1B 3TWCH 5D7KD 2BC4A 5EU6A 1VEPA 1JIBA 2B4CH 4HGMA 2DQEL 1BPVA 3NFPB 4V1DB 3WIHH 1TVHB 3SE8L 1U8KA 3O6LL 2YMXH 1QBBA 1MLBB 1FPTH 1ZANH 1ZVYA 4G6MH 5B8CA 3NA9L 4LARL 4G9DB 2WANA 4HHAB 3RWEA 1A3QA 4JVPA 3HC4H 4MCYB 4XX1G 5F9AC 3V0VA 3OJDB 4M7LL 5HYIA 4EXPX 4H20L 4H0GA 4P0DA 3FONB 4FQXA 5HD8C 1HHIA 3CVIH 4P9ML 5L7XL 4IRSA 1BWMA 2BVUA 1HQRB 1X5AA 4IOFC 2ZOKA 3CFJB 3RDTD 3CGTA 1QA9B 5E2TH 1MCIA 4PJ9B 5KVEL 5DJYB 4J4PC 2GIYA 4KMTL 5KSBB 3HZMB 2FR4B 2XZCH 3DX6A 4G3YL 5J1AA 5CJXA 2DL9A 4YWGL 3GM8A 3O4OB 5DRXA 3B4NA 4OFVA 4FQXD 3J8F7 5I19L 4IRSD 1OAYL 1QTYT 1CDHA 2ESVB 1CGWA 1HHJA 4HWUA 2YD8A 2I26N 4TTDC 4XC1L 3TA3A 4K2UL 3ISWA 5CINL 1W72A 4G43B 5DJ0B 2UWEF 3ZZ1A 4Y16A 3C6LB 1HIMH 3ZKXB 4OD1L 4MAUH 5CIPA 4NQDA 4PJEE 3OMZA 1KCRL 3S96B 2LAGB 3C9NB 4LRNL 1G1CA 3WE6B 2XFXB 2H8PB 1LO4L 2V9TA 3F7YA 1U92B 3MNVB 2EE9A 1SJXA 3X13A 3CH1B 2R2BB 2CDGA 3PDGA 4HX1A 4KUZL 1U8IA 4NQDD 3MUGB 4I9WE 3WS6A 3GMQB 2VMFA 3BGFB 1ZS8B 3T0VA 3WNOA 5E00B 3D2UA 5FO8A 1MCPH 4ONOA 3T0EB 2Q76B 4JEGB 3KR3H 1OLZA 3N9GL 2D7OA 1JK8A 3UJIL 4U1GC 1BLNA 3LEYL 2ZUSA 3MRMB 4P46A 3VCLB 2NY5H 1U95B 3KPOB 2UZXB 4K7FB 3TGXA 2IGFL 2LQRA 3SDAC 2HLFC 2D7TH 2I24N 2VR5A 1FNSL 3MLRH 5D8JL 1SYVB 3HI1A 5CJQL 3HHRB 2LVEA 3QEGH 1OQXA 5BS0B 1JMZA 5HHPA 5EN2B 4L4VB 5GPRA 1MIMH 4ORZC 2OL3A 1QVOB 4L9DA 3TBVB 1TJGH 3IJHB 3JXAA 3X17A 1NMAH 2Q8AL 5IMLA 1XGQA 3FB7A 4PYGA 4L29A 5EORL 1WFNA 1T0MB 2V7HB 2Z4QB 3UO1L 5CILL 1EEZA 3QDME 4JJ5B 5FHBH 4EI5A 4JDTL 3STZB 3HNVH 4D3CH 2Z9TA 3SE9H 2BY0A 2HMID 4Z7UA 5B3NA 3MFFA 2W9EH 1DQTA 4MJ6A 1T0PB 2HJKB 3PDOB 5JNYA 4AYFA 3QZWG 4L4TA 4UV4H 3QAZC 4FG6C 5D2LB 4EI5D 3HMWL 5CSBA 2F53E 1C5BH 3MOQA 2OCFD 3ZKMD 3HPJB 3FB6A 2GUOA 4LSTL 1DCLA 1YEJL 4GKZA 4NO0A 3AREC 1F02I 4P2RA 1LDPL 1OAUH 5T1MB 3LKQA 4LLDB 4JB9L 1K5NB 5DK2A 4KRNA 1XFPA 3PL6B 3BN9C 4OF3A 2OJEB 2PTVA 4LSDA 2A74A 3P2TA 4ONHA 4NIKB 5F1OB 3ZSTA 4ZXBB 4NO0D 1QPXA 1XGPA 1B9ZA 2EDNA 2FATL 1V3KA 2FX8L 4JN2B 4P2RD 4HXBL 1DL7L 1F6FB 5FYLL 4WDIA 3T1FB 2D4FA 3QUMB 5I8EB 2G9HB 3UCRA 2C4FU 2FX7H 4JFHE 1AD9A 3SOBH 4NQSA 1A7OH 1D6VL 2JTDA 1DBJH 5F7EH 2ZUQC 3MCG1 4YXKL 4TRPH 3V6BR 2IQAB 1NGPH 1V7NH 3C5JA 1GOHA 4AIXA 4HT1H 3WFDL 1OPGH 4F33A 1I7RB 1SVCP 4JFPB 1ZA3A 4ODSL 2GK0A 1JPST 5A2LH 1W72H 4OZ4B 5F3BA 3NZHL 4PJIF 3WHXA 3T2PA 3H9YA 1F2QA 2CDFA 2LTQB 1IKFL 3FFCE 4R2GC 4X8JB 1S7VA 3R8BB 5MEQB 1U3YA 2JELH 3QUYB 4OM1H 4IEFB 1U93B 3T0DA 2X44D 3EOTL 4Z7QE 4JQVA 4OUUA 2R9HC 3EOYG 2DQTL 5TF1L 3KPPA 3OBAA 3S34H 4XNMB 1J1OL 2PW1A 5K9JL 3L7EB 4C58B 4EDWH 1NL0H 2EDEA 1P6FA 1FYTA 1WICA 3MRNA 1NFKA 4XP6L 3RL1B 1AJ7L 3KDMB 1ZWIB 1GPOL 3BIAX 3ZKSD 2UY6A 25C8H 1N3NA 3OAZK 5AUMA 1VERA 4NQCE 2W9DL 4ZQKB 1O5DT 1FP5A 3P4OB 5ICXB 4HUMB 4I4WB 4RWYL 4XVSL 1TZIA 3Q6GH 5C0JB 1Q9LA 4PS4L 5JHDE 5GRWA 5B39B 5IVZB 1UJ3A 4P5TC 4OV6F 1H9VA 3FKUS 4JY4B 1I7TA 4YDVA 3FQUB 4EIGB 4FQJL 3AU1B 3GRWA 1C7SA 1HINH 1M71B 3DTXA 3ZHKA 2ATPB 3UPRA 5FUOL 3CFDB 3W9DB 5I18L 1ZGLM 3PGFH 3PGDA 3K4AA 1N8ZB 5EULV 3KGRA 5EH1A 1KXVC 4U6XB 4M48H 5IMMA 5I8KH 4PRDB 4R0LB 4DVBB 5GGRA 4G6AD 4NQVA 3TYFB 4EQ2A 1EHXA 1MCRA 5C0EB 2V2TA 1S7WA 2VSDA 3OKLA 3O3DA 1AHWA 3MACH 4KV5E 1JV5B 3L5JA 1VFMA 5DQDL 1FORL 2XG4A 5H2BA 4GH7B 5A2IH 1KJ2B 3L3JB 3HS0B 5EUOE 1CGSL 1RZGB 4RQQB 3RWGB 3IU4H 2V5SA 5EZIH 1F58H 1EJ6A 1PD6A 1QSED 5HHXH 5LAXA 1NCDH 1AKJA 4H1LA 4L8DB 4NM4L 1XMWA 5KAQF 4G8FB 3ULVH 1EAPB 1MFCL 2OZ4H 4ALAH 4P3CL 1QLFA 5FDWB 3MPCA 3KLDA 1V7MH 4YEEA 4XVTH 3BGAA 2X5PA 3MMEB 2EXYD 4NP4H 4F37K 3MXVL 4ORGA 4OKDA 1IGJB 1N0XL 2PO6A 4Y4FB 2BSSA 2WUCH 3FRPG 4ZAKB 4YHML 2VXVH 1AKJD 4PJHE 1F11B 2EXWC 4ONGL 2XWTA 4RISL 1OT2A 4HWZB 5SWQA 4HK0B 4EEEA 2VDLL 2D9CA 3B9KA 3ILPA 1MH5B 4O51A 5CKAA 4F3FA 1A3LL 1CU4H 4DZBA 4LMQI 2BFVL 3F7PC 3FOMA 3RNQB 2PO6D 4JANB 4KI5E 2W0FA 4M8VA 3U6RB 4POYA 2A0LC 3INUL 4X6EB 1PEWA 4HUXB 4MA1C 4F7CB 3FQRB 4MNGE 1FLTX 1A6AA 1EPFA 4X8XA 3JV4A 5D1XD 5FYJU 3KAAA 1Q94B 3VWJA 3Q1SH 4UIMB 3LQAL 5D2NA 4EIZC 1EJOL 5F7NC 4U0RB 2W65A 1BJ1J 3DI2B 3G5ZA 1LK2B 1ZAGA 1J1PH 4FTVB 1P2CB 4MJ5A 1F97A 5C08A 1DQJA 1TCMA 4QRRB 3IFNH 3MLSL 2UUDH 4PP1D 4JG1H 3L5IA 3SKMA 1ERNA 3WFBH 5FUCC 1I75A 1LO2L 5FYJD 3TZVD 1GGCL 1CS6A 2DWDA 3U7WL 1KF9B 2DM4A 2F5BH 3RIFK 4X5LA 1NFDB 5C08D 3OR6B 5HPMB 1KEMH 4GW5B 4H8WH 3ULVF 4ZFFB 3GJFA 1FC2D 1KTLB 4BSVB 5L88H 2FBJL 1KT2B 5C0RL 2NTFB 3U0WH 2QKIA 5J56B 4PR5B 5C0AB 4Y1AE 1YDPA 5JA8B 3ULUD 1IGTB 3NCYP 4M03A 5C2BH 1TZGH 5DMKB 3I6KB 4H26A 1GGTA 7FABL 2ICWI 4NWUL 2H32A 3MRHA 4PLNC 3IDGB 3PWJB 4P2OD 3OPZH 4NT6A 2NY4D 5CAYB 4LVHC 2KKQA 4FQCH 1O0VA 2FLBT 1HEZA 2WWMD 3CAFA 4F9PC 4Y4KA 2CRZA 4PJFB 4XX1E 3FO0L 1WZ1L 4GG8A 2VL5B 1YPZF 1G6RB 3K1KC 1J0JA 5GGSB 4KZEH 4LLUB 3WDHA 5J57B 4NRZA 4DKFH 4Z7VA 4TUJB 1ZHLB 4JM2B 1YNKL 3V8CA 5HVHC 5E2JA 2BP3A 5CBAA 1CICB 1J12A 1D5ZA 3GSUA 1T0NB 2Q86B 2VR4A 3TVMB 4UAOB 3T4YB 3BGFC 3Q5OA 5DUBB 3BN3B 3UTZA 1TJHL 1HKFA 1JNNH 3T0EC 3IFLL 1S9WB 3H9HA 4WO4A 4U1JB 1J87A 1OF2B 1A5FH 4I77H 5FGSA 1DQLL 2VLME 1ZSDA 5J11C 4XRCB 5IB1A 3OKDB 1DE4A 3DETC 1L7TL 4YK4C 2V7NA 2BCKB 4HF5L 1RZ8B 4J12A 4H1LH 4U1LB 4BK4A 1Z0NA 4EOWL 3MBXH 1A9EA 1EGJL 3RX7A 4RZCB 4EJ1C 3CFKB 4WO4D 1PYWA 5HVGB 1MEXH 2R4RH 3HMXL 1FO0B 2YD3A 1ADQH 4LSUH 2LAAA 2VJXA 5L9DL 4IJ3C 5T5NG 4JREB 3S36H 1X3DA 2QR0A 4XGZB 5GGTA 1UM4H 2HKFL 1KENH 4FMFA 4XC3L 1NCCL 4GMSL 2AJVH 3SGJC 1DSFL 1U2HA 1PBYA 1R3HA 1P1ZB 1KPVA 5JORA 2G5RA 4NHUB 5I8CA 2AK4A 4M4RA 2DD8L 3DXAE 2FH6A 3LZFL 2XTJE 2NX5E 3RU8L 1IC4H 5IIEB 3QNYB 2X4QB 3CZJA 4LPUA 4BKLA 3GBLA 3MYZA 3LN5A 5GZNC 1DVFB 5T1DL 1CBVL 1XGYH 3UYPA 1AGFB 2V2WB 1QFWH 2XKNB 4OCRH 3SKNB 3C5ZB 2MOVA 5JIHA 1GC1H 4BJLA 3UYRH 2AK4D 3LY6A 2XACC 4LCIH 5DJ6B 4D0DA 3ORJA 1WEJL 4PJCB 2DOCA 5F44A 5ETUA 1JFQL 5C9JA 5AG9A 4JO4L 3RVWC 1CE6B 1FFPA 3QCVL 1YY8B 1QQDB 4QGYA 2H6PA 5GS1B 1NAML 2Z8SA 4ETYA 3OKEB 1KELL 5I9QB 4ELMB 3QG7L 4LCWA 1S7UA 3SQOH 3MXWH 4P23B 3F12B 5I66B 3BZFB 4DGVL 1C7TA 1FG2A 1YUHB 3EJZC 4QRQB 1XF4B 1GGIH 2KZWA 3GJFH 3TN0B 3KYKL 4TTGA 4K8RH 5D7JB 2OR7A 2IMNA 4XNUL 4KVNL 1UZ8A 2BNUB 1NMBL 4ODXA 1IMHC 4LCWD 2HJLB 1BQLH 2APVA 1CGUA 1ZXQA 2OK0L 5ECJE 2G75A 3MRJA 1X5HA 1AR1D 5E4EC 3E2HB 4PJGE 5EZJB 3BKJL 4J1UB 5IEHB 2YA0A 2Y6SC 2DF3A 1OT1A 3G08B 4FOMA 4XPFL 4GKNA 5EU4B 1ZLVK 4DN4H 5IR1B 4WFHE 3E8UL 4QHLA 1AI1L 3MRQB 2L7UA 1NJ9A 1RHFA 5CD5C 1S5HB 5DD5H 4GO6B 3I84A 1BP3B 1CL7I 4U6VH 1K8DB 4PJXA 3DBXB 3OXSA 1MCOH 4UQ3A 1GAFL 5DYOA 2YSSB 5IBUG 5D70L 3NTCH 3RKPA 1BD2E 1N5YH 3VXRE 5FUZL 4XNYL 4XWOC 1MJ8L 1DZBA 3P0VL 3H7BA 3PQYE 5JZ7C 1OP9A 4HV8B 2Y7QB 4GSDL 4X83A 1UEMA 1INQA 2DQJH 3GSNB 1KXTB 2G60H 1FE8H 1FLRH 3HUJB 1G7MB 3UEZA 3I85A 5LBSL 1QRNB 4UDTB 1MY5A 3TYGL 4DQOH 1RZKC 3O6FA 3MCLL 2X70A 4MD5B 1NCUA 4N0CD 4QHMA 1JUFB 3EBAA 2Z31B 4JZNA 1NAKH 4L8CB 5IV2A 2AXFB 1K2DB 4WTZG 4NUGL 2PR4H 1FFNB 4ZSOA 2VISA 4HFUH 4YC2B 2JKXA 4BSWA 4TQEH 5HDLA 5HHNA 2R29L 1T83A 4X9IA 4HS6B 1Q9WA 1UWGL 5E9DB 3QHTC 4UTAL 4YPJA 2QBWA 5AWNL 3PHSA 5E1AA 1LD9B 2DLHA 4X6BA 5I0ZA 1KN4H 2WUBL 1T7ZA 1C1EH 1FJ1B 3T2QA 3VFTB 4QRPD 1A6TA 3ARZA 1A1NB 1NGZB 3KYOA 5IKCB 1DBBH 4KAQL 2FEEI 4FZ8H 1RJCA 1GYAA 1KIPB 5E2WH 2CKNA 4HUVB 1SBSH 1B0RB 3MJ6A 2PUQT 1VHPA 4GAGL 1H8SA 3DURB 5EZLA 1T89A 2H2SD 3VFSB 4Z7VF 2XI9A 1JNHB 3MR9A 1JWUB 3IF1A 5HVFB 3ZYJA 2DB8A 3K2MC 2AP2A 5JW3L 1U58B 2GYSA 1MSPA 4K7PH 4KI5C 1YECL 1BAFL 1OAXL 3VI4E 2FX9L 2WW8A 2F54B 3RWJB 2RIKA 2CGRH 1EV2E 2WP3T 3N0PB 1PZ5B 1UM5L 3S6CA 4J4PA 4WWID 3V4VH 2JCCB 5EBMB 1IC5H 4E5XA 3WFZA 1WBYA 4X6CE 1FAIL 2VDNH 1IARB 5D72L 4JHAH 1UB6B 5C0NC 4PUBH 4OI8A 4RBPK 5BVPL 4Y4FC 5HD8D 2B0SL 4U1IB 2OQJA 1L0XA 2A77H 2C1PB 4AZ8A 3GKWL 3HB3C 3AAZA 4W6XB 4OZIA 4W4OA 2QJDA 4J4PD 4EN3A 1J9CT 2J8UB 2DAVA 1AIFA 1IL1B 4ODBD 1A4JB 2J4WL 4TNVK 3LKNA 4UINL 3TIEB 3D0LB 4OAWA 1MREL 3LKSA 2QHRH 3LEXB 5C0IB 2X9WA 4JO1H 1K85A 2ZSVA 4OT1H 4D0CB 3ALXA 5HYQA 1AR2A 2QSCL 3V52L 3VD5A 3SJVD 4TTDD 1CGYA 4EN3D 4P2QB 3U4EB 4KZDL 2FH8A 5IQ9B 1DFBL 2YWZA 2DQEH 5SWZB 1WJ3A 3KYNB 3UZEA 4NBZB 2A6DA 1JN6A 3SE8H 2E9JA 1WQVT 1KBGL 1CFSB 4PGBB 2JJTC 3IFOA 4I0KA 2DQUL 3NA9H 2YR3A 4LARH 5E1HB 3QPQC 3ZKQD 2XY2A 2VQ1A 2DIAA 4PV8B 1FZKA 3C60C 4M7LH 5FYJL 5E94B 4KHXL 4U1MA 1BQHB 4H20H 1INDL 2XICA 3O2WH 5CEZE 1XAUA 3OKNA 1HSBA 4M6NL 1SEQL 4MD4A 3I6LD 4P9MH 5L7XH 3TCLB 4G8EB 3MNWA 4OUOA 4QOKA 4JFDD 2QQQA 4X4ZA 4MD0B 5GRVL 5KVEH 3T65B 4KMTH 1JZ4A 1ZA6A 5DEZA 4XCCL 1BVLA 4MNQE 3EDJA 4YWGH 5EO9A 4KWUA 1EDQA 1NBZB 3ILQC 3G6JE 1PG7X 2NNAA 5I19H 2HFFA 1NGXB 3MNZB 4UQ2A 1OAYH 4OI7A 3ULUL 2HLFD 2F19L 3ZSSA 3HLAB 3AXLB 1GH7A 1S3KL 4XC1H 4K2UH 4XNQB 5CINH 2CUHA 2EKSB 1UKSA 2GHWB 3BPOC 1TJIL 4Z5RB 1MCBA 5GRJL 2BNRE 3BX7C 3SY0A 3U4AA 3FHQA 1OW0A 2I07A 4BUGA 4RAVA 4X4ME 4YHPB 1KCRH 3VU2A 5J13B 5DHVA 1DUZA 4LRNH 3WO3B 3VH8A 3GMLB 5HXMA 1MFAL 4NQEA 3F62A 1LO4H 4BQBA 4PY8I 4TUOA 3SDXB 4NKMA 3WXVL 5CEYA 1RFDL 4JM2C 2OX5A 4I0PA 2VZ3A 4JVWA 4KUZH 3QIBB 1AO7A 1YNLL 2AXGB 1JPGB 1K4CB 3BKYH 2N56A 2UYLB 4P48A 4NQED 5D5MF 3AREA 4PJXF 3RWDB 5E8EB 4OBRA 2P7TB 3LB6D 5JTWA 3N9GH 3EKCA 3UJIH 1RAMA 2R1WA 3LEYH 5EUKB 5D6DA 3SBWA 4I0PD 5GRVK 1IQDA 5B3JE 3EYVA 1AO7D 1TCRB 2IGFH 3TO4A 4PB9H 4YHZL 3BHBB 4LSQL 3FCTA 4UDUB 4H25B 1CXKA 3DLQR 4U6HB 3ARED 4P9HC 4ISVB 5FGCB 1AGEB 4UUJB 5D8JH 3FB5B 3RTQC 3OKOB 3ZDXE 3BQUA 3VJ6B 1IKNC 1ORQA 5I1GH 3TO2A 5CJQH 3BN9D 4F9LC 5D7LA 2GSIA 3LRSB 2Z93B 3SGEI 3DV6B 3REWB 1I1AB 2Q8AH 4QCIA 4XPHL 43C9A 4JREC 4R6UA 1F42A 4PD4K 3SCMA 1JWMB 4R7NB 1S7SA 3R4DA 2G2RA 3BE1L 3UO1H 1PEZA 1FRGH 5CILH 5TQ0L 2VLKE 3B3IB 3GJEB 4CVZB 5SWSD 1P4LB 1BEYL 5D7LD 3TBWB 3WSQL 3TBSB 3WJJA 3VWKB 4I3RH 4OZGE 1XR8A 5F7DA 4GUPA 1D9KA 4WWKC 3SCMD 4C4KO 5KG9A 4PFEA 5DJCB 3VFUA 1VACA 4NNYB 4P4RA 4X6FA 1I1YB 3HMWH 2HTLC 2BSRB 5GGUB 3SEPA 3C8KB 4PYHA 1HYRC 1KJ3L 3VXME 1WC7A 3C5ZC 3O8XC 5C09E 3LV3B 3ROLB 1O7SA 4LSTH 5HVWA 4ZOCA 5E03A 1QBLL 2DQIL 2VC2L 4YPGB 5BXFB 2HFTA 3GHBL 1MF2H 4R2GD 3CUPB 4N8VA 1LDPH 1R3JB 1ND0A 5L8LB 2HP4A 3IDIA 3LD8C 3OHXA 1TQCC 4CBPA 2HVKB 1FG9C 2R9HD 4LLQB 4EBQL 4JFFD 1ETZA 1G7IB 2A6KB 3IXTA 5IROC 3HE7B 2QSQA 3R0MA 3OGCA 2UY7A 3CFEA 1FVDB 2EIDA 2FX8H 4HXBH 3RWHA 5FYLH 1KCSH 3OAZH 5J06A 1A6WL 3F7RA 5I73B 3O45B 4MAYC 5TPWL 3VXPB 3BZEB 2GY7B 1CTOA 4LHUB 5M94B 5MENB 1INEH 4LLWB 4YXKH 4OCSL 4PRNA 5JDJA 1HH9B 2NXYB 5EU3A 1N7ML 4JN1L 1SEBB 2GITA 3WFDH 3WLWC 2I9LA 4OZIF 4RNRB 4ODSH 4Z77B 3NZHH 1VGEL 4HIIA 3P73A 32C2B 3MRDA 5DURB 1YA5A 1IKFH 1QBMH 2X89D 4ENEC 4CMMA 1UXSB 2D7NA 4MXVE 3FO2A 4N9OB 2JJUA 2BXYA 4YDJB 4UNTA 4XB7A 1M7IA 5T1KA 5EIVA 4CMHB 3EOTH 3BP7B 2WSKA 5DRZA 5ADOL 2DQTH 5ITBL 5IVXA 4QWWC 5TF1H 1LQSR 1WIUA 1DQDL 4YFDB 1J1OH 5K9JH 4PRIE 4TVSa 4W81A 2DN7A 3CMOL 4RAUA 4PRPA 5IB4B 4KGLA 1XIWA 4L3EB 4NCDA 4UILL 5F8RC 1MI5D 4XP6H 4ODHL 2FWOB 4PY7A 3DGGA 3CVHL 3QHFL 2B1AL 1J86A 1AJ7H 1BZ9A 2WINB 5GGVL 1BZ7B 1CTNA 1W0WB 5CGYC 2FJFA 5DWUL 5F7UA 5D1ZB 3FQTB 2Z31C 4JFEB 1PFCA 2W9DH 4N0UB 4LDLB 3P40A 4PRPD 4WI2A 3R0NA 2YBRA 1OD9A 4FA8A 3UTQB 4RWYH 5E5UB 2Y1VA 5IFJB 4G9FB 1MJUL 2WBWB 4OTXH 3CSYA 5IWLC 3T8XA 1SY6L 1E4WL 4XCYA 2DTML 4YC2C 3U9UA 3BEVA 1ZT4A 2X4NB 5CP7A 4YIQB 4P99A 3IJSB 5ELIA 4FQJH 3O41A 2FGZA 3FTGA 5FO9A 1T1YB 4ZUSB 4MJIA 3ARXA 1T1WB 1ZTXH 4JM4L 5I18H 4N68A 1G9MC 1ZT1A 3QDGE 5F9JB 2VZ1A 3V6OE 4OLVL 5ACMA 4V1DA 3LH2L 4YQXL 3IDYB 3MO1B 5J12C 1J8HE 5DQDH 1F90L 4OQTA 1MLBA 2D0GA 3BD3A 3X3FL 1CGSH 3ZDYE 2A38A 4G9DA 3MOBL 4HHAA 2WV3A 2FZ3A 1JVKA 4UOW0 3BMWA 3EO0B 2B7DT 4R26H 5FYKD 1TITA 4E41A 3H3BC 3FB8B 3FONA 4NM4H 3DIFB 4OF8A 1HQRA 3CFJA 1HCVA 2WBJA 1QA9A 3H3PH 4PJ9A 3F7QA 5DJYA 5KSBA 1PGRB 2R2EB 3HZMA 2FR4A 4CN4A 4NQTA 1FGNH 5EBGA 4HMEA 4YHMH 1N0XH 3VFMB 4R9HA 3ZYIA 3QUKA 2GT9B 5FV1L 4WFED 4Y8AA 2VDLH 2ESVA 1MQKL 1KCKA 4Y2OA 4PJ9D 5BW7C 2BFVH 4Y2DA 4MDIB 2D7MA 1WT5C 4NZTL 4QEGA 2NQCA 5DJ0A 2IG2H 1HK6A 3C6LA 2Z35B 4JY5H 3NIFF 2ESVD 1B3JA 1WFTA 3DGCR 3TPUB 2XFXA 2H8PA 5E8DH 3GSWB 1U92A 1NDGB 3LQAH 4G8GB 4IMKC 3W0WA 1D5XB 1UFUA 1OARL 2ADJB 5MP6L 3P0GB 4HLZG 3JV6B 1JPSL 4JPWL 4YHKL 3CH1A 1G84A 3QDJB 3UTSE 1KC5H 2R1YB 4NC0B 4TVPD 2NMSA 1JBJA 3L3GB 2ADGB 4HAGA 3GMQA 2FJHB 1ZS8A 4WFGE 5E00A 1LO2H 4KJYB 1QYGL 4PGZA 3CX2A 2RHEA 4KXZI 4AT6B 1T7XA 3MRMA 4U05A 3RVVC 1XF1A 3VRLE 4MLSA 1U95A 3KPOA 4BQ9A 3UTPD 4TNWK 2XRAL 1BVKA 5E08H 1I7ZB 1HSAB 2FBJH 1WCBB 3HRPA 5C0RH 3T0ED 1SYVA 5F9WB 1YEFL 3Q5YA 3MRPA 4NNXB 4MA3B 1MFDL 5BS0A 5EN2A 3DETD 2MHAA 4L4VA 1QVOA 7FABH 4TULL 4NWUH 3HC3L 4ODUB 2DQGL 2X7LB 3ZTJG 2EDHA 3O3BB 5GSVB 3D87B 2V7HA 2Z4QA 1KJMA 2VKWA 5KSVB 3CSGA 1CD1B 4JJ5A 1I9JL 1TPXB 3STZA 1PKQE 2X05A 5BS0D 4L4VD 5J13C 4KKBC 3QFJB 4MYWB 3D85B 4PJDB 1Y18B 5B21A 2HJKA 5L0QC 2NR6C 4QO1A 1ULVA 1YNKH 4NQCB 3HKFA 1Y6KR 3VFNB 4LIQE 5D71L 5FA4B 1WF5A 3EW3B 1D5MB 3HPJA 3BPNC 4HH9A 1T1XB 1TJHH 3QCTL 4NGHL 1V3MA 1F6LL 4KDTC 1T22B 2DQCL 1U42A 3BJLA 3CX5K 5T1MA 5IVXF 1K5NA 3ALPA 4G6FB 4QF1B 3U4BL 3OTTA 1DQLH 3PL6A 1ZEAH 3GMMB 2OJEA 4LPTA 2FB4L 3PGCA 3VDAA 4I18B 2GJJA 1L7TH 4HF5H 4ZXBA 2CK2A 3RAJL 1LO0L 4FXGB 1SQ2N 4ZFOB 3UDWC 4QY8A 1LNUB 3RVWD 4GRMB 2P5EE 4LGRB 1FNEB 2E6PA 1GOFA 5TDOA 3T1FA 3IAPA 1AE6L 3QUMA 5I1IL 3HMXH 4OLXH 3PL6D 3TJEH 2R0ZL 1WWAX 3QFDB 3FFCD 4Q9CA 2IQAA 3AY4A 3EJZD 4O02L 4R3SA 1NCCH 4GMSH 1DSFH 2AJZB 1OHQA 3ZTJH 1I7RA 4JFPA 1MY7A 1JNLH 3ECBB 4Y5VC 4NZDA 2D31B 3RGVC 4OZ4A 1BIIA 3LZFH 2XZQH 3VWKC 4HWNA 4FFVC 3LQZB 3PV6A 1TTFA 3RU8H 3SDCB 1YC7A 3O2DA 2XA8L 3MX0A 1ZLVH 1RJYB 4X8JA 5GS0C 5HHVL 4TSBL 1CN4A 5MEQA 1G0YR 3F58L 4U3XA 3QUYA 1VENA 5T1DH 1U93A 1CBVH 3DUUB 2Q7YA 2DMKA 3PWVB 2HWZL 2ERJC 4NNPL 4X9BA 3CZFB 4PRHB 3R1GL 3MBEB 1WEJH 2VITB 3P9LB 3L7EA 1DEDA 1HXMB 1JFQH 4OCLC 4JO4H 3QUYD 4JQXC 3RL1A 5EFIB 2D03L 4KK5C 5CP3A 3KDMA 1NAMH 3RKDC 3CFBB 3QH3B 1ZWIA 4LKXB 4XWOD 1A6UL 5JZ7D 1Z3GL 3L6FB 3QG7H 4KQ4H 1YC8A 2UWEE 3RY5A 4ZQKA 1JI1A 4GLRI 4AEFA 4DGVH 5B38A 3P4OA 5ICXA 4I4WA 5GGSY 5JXAH 3ARDA 5C0JA 2R56L 2KUTA 5B39A 1MJ7L 5JUEH 2VAJA 2W60B 5ENWB 5JPMB 4XNUH 4KVNH 5KSBF 5FM5M 2PYEE 1NMBH 4K3EL 4JY4A 3WS3B 2EIEA 3A0OA 1N0LA 3FQUA 5CLWA 2OK0H 4RGMB 4LVEA 1DBKL 5JW5B 2QQKH 3AU1A 4YFLF 3LOWA 3BKJH 1PZUB 4MJ4A 1M71A 2MMXA 5KN5B 2YWYA 4XPFH 2ATPA 1L9MA 4MXWL 1RHHB 3FT4B 5HYJB 2VR9A 3CFDA 3W9DA 4PG9B 1AI1H 2VLJA 2NLJA 5CHNB 2P8LB 4U6XA 5H35A 4PRDA 4R0LA 2FEDD 1ZV5A 4HCRA 1UYWH 4ZO7A 5JOPE 5C0EA 4OD2B 1GAFH 1X5LA 3HE6B 1HI6B 1WAAA 5D70H 1LO3L 5JIIA 2ZP0T 4IHOB 1LVEA 5FUZH 3KPMB 4WHTB 4XNYH 1KJ2A 1MJ8H 3P0VH 1RZGA 3MGTB 4LP4A 3CXDL 4EUPG 3Q0HA 3NPZB 3RWGA 5F97E 5F96L 2EC9U 4V2CB 5C07B 3BP4B 2VERN 3OQ3B 4RSVA 1YEDB 1F13A 2EZ0D 3TYGH 4P5MA 1QRKA 4L8DA 3BVNB 3MCLH 2XWBA 5DQJB 4G8FA 1EAPA 5E6YA 1EEQA 2B2XL 2DI9A 5GJSL 5FDWA 3DMMB 3O3AB 4FRWA 5FB8B 1HWGB 1VDGA 4JQIL 2HAZA 3PV7A 3MMEA 5DK0B 3VFRB 3B9DA 4YHIB 4KI5D 1IGJA 1CT8B 4ZAKA 2UV3A 1F11A 5JOEA 2J7LA 1DDHA 4HWZA 4QHKJ 1QNZL 1ZVHA 3M1BB 4LEOA 5BCAA 4HK0A 4YO0A 4RBPH 4HC1A 5K9KA 1MH5A 2C3XA 4MWFA 4I48B 4PJ8C 5DHYA 1UWGH 3H9SE 3X11B 3D3VE 5C0ND 2VDQH 4BK5A 4NRXB 3HZVA 5E8PB 5AWNH 4JANA 4Y4FD 3V0AC 1CK0L 2EDRA 4GS7B 2WUBH 3U6RA 4X6EA 3HB3D 5I76B 4OB5H 4F7CA 3P9WB 2DQFA 3RA7L 5C3TA 1I1FA 1YYML 2P8PB 5A2JH 1CFQB 4D9LL 4KAQH 3LHPH 1NCTA 1Q94A 1ZLSL 3RZCB 5DQ9B 3ULSB 3W39B 1MAML 1FN4B 4UIMA 1I3UA 4M93C 4JRYA 4QXWA 1LK2A 3M07A 4FTVA 1LDSA 1P2CA 4GAGH 3IDYC 5HGBB 4QHUB 4QRRA 2ZSWB 4ZMAT 5C0CA 5D2LF 3W11C 3D39E 3EGSA 3KPRE 1F8TL 2XOTA 1YECH 5F6HJ 5KANI 5FKPB 1OAXH 2R15A 2FX9H 5F6IC 1QD0A 4QRRD 5HPMA 4GW5A 3L5XL 1U8KB 4LRIA 2VWEC 3QPQD 1UM5H 4ZFFA 2EIZA 3V6FB 3BP6B 1OWWA 3C60D 4O2EB 4BSVA 1KT2A 5CP3H 4O9HL 2V5TA 1FAIH 4DEPC 1QFUL 3V7MA 2XTJB 4KK6C 5I1AB 1MRFL 4WI6A 5D7KE 2OTUB 2B0SH 4PJIE 3RHWK 3GKWH 1IGTA 4HH8A 5T3ZD 5DMKA 3I6KA 2NXZB 4WEUD 1VADB 2AERT 3QWQB 3GM0A 4DZ8A 5JOFA 2ZOKB 1G6VK 3IDGA 3TIDB 4UINH 1BREA 4GJTB 1XGUB 1X6LA 5C0AD 1MREH 1CFBA 3DX6B 5DF0A 1K6QL 1OD7A 3V52H 4PJFA 5H37G 3NIDE 2EYSB 3K81A 5GGSA 4LLUA 4KZDH 3T2NL 3MRFA 1DFBH 4PIRF 4XXCC 3ABZA 5EU7E 1ZHLA 3TA3B 1J0IA 1CDCA 1W72B 3SDDB 5SX5K 3ZO0A 1CICA 1KBGH 4Y16B 3UAJC 1T0NA 2EKJA 3NOIA 2Q86A 4PGJA 3TVMA 2VLRB 2DQUH 3T4YA 1IM9A 3HI5L 4NN5B 1Z0MA 5DUBA 5BJTA 3IDMB 5ID1A 5HDBF 1S9WA 2EDWA 4JM2D 1IEBB 4Q0XL 3CH8A 4U1JA 4LCUA 1OF2A 1CICD 1UCTA 4XRCA 3TVMD 3OKDA 4HX1B 2SEBB 4MSWA 1RZ8A 4XCCH 4U1LA 5HTSA 1UM6L 4I13B 3CD4A 4OGZA 4RZCA 5F9WC 3CFKA 1A4KB 4K9EC 3NGBC 5EPMB 2Y23A 3UC0H 1JK8B 1FO0A 4XBGB 1BLNB 1VPOL 3ULUH 3WD5L 3V6ZB 4P46B 2BNQB 3S37L 1FNGB 4ZUWB 4NQDE 1OGAB 4XGZA 3VXRB 1PX3A 3RTQD 1KCVL 1NLBL 2IAMB 4L3AA 5L6YL 1TJIH 3MJ9L 5GRJH 1OSZB 5DFTA 1EK3A 2I9TB 4HC1H 4Q7DA 5HHOB 2XQYG 1P1ZA 1TPXC 2ZWLT 3OGOE 4KH2A 4NHUA 3QQ4B 1FBIL 1TETL 1NC2A 1MFAH 4R96B 3QNYA 2X4QA 1NEUA 2ZUXA 1RFDH 5FDYA 1DVFA 3QXDB 5I74B 4JRXB 3MQIA 3N1QC 2IADB 4Z76A 2B1HL 2OYPA 1YNLH 3C09C 1EBAA 1RUML 3G6AB 4F7PA 1QKZL 3R06B 3UROR 4Z7UB 3MFFB 3CFIC 1NH6A 3OJMB 2MKWA 1WAAF 2ICEB 1CE6A 4OFIA 2HTLD 2YOCA 1DVFD 1YY8A 3EHBC 3RRQA 3S4SG 3VXUB 4L4TB 1QQDA 2X40A 5KVDH 4RMWA 5GS1A 1T03L 3C5ZD 3O8XD 4YHZH 2JB6B 3OKEA 1AXTL 2CMRL 4H88L 3SKOA 4I18C 2NZ9C 1W0YT 2MWCA 4P23A 3F12A 5I66A 3BZFA 1BJMA 2GUOB 2IQ9L 1T5WB 4QRQA 1FV1B 3TN0A 2DYPB 1U8HA 2K3TA 1MCJA 5D7JA 4RRPA 2APTA 4FXKB 1NMCB 2BNUA 2H3NB 5DRNB 1G7HB 4P23D 2HJLA 4ZFGL 4HJ0D 1U3ZA 3BE1H 2RAMA 4MAYD 5TQ0H 5EZJA 4J1UA 4I3GA 5IEHA 3TN0D 2X4OA 1B90A 1Q8MA 1BEYH 1NUGA 1S7TA 5EU4A 3WUZA 4PBWD 1IILE 1CVSC 3MRQA 5I1LB 2Y07L 4WI9A 3KPNB 1S5HA 3JWOL 5IQ7L 1CI5A 4J8RB 3WLWD 4M7ZC 4F15B 3DBXA 4GQ9H 4P2RE 5CUSL 2YSSA 1RJLB 4F8QA 2X4TB 1KJ3H 1SBBA 2IPUK 4JPKL 1QR1B 3FL7A 4HWBL 3VI3F 2GK0B 1UVQA 3QUXB 2B4CC 1QBLH 2VC2H 4HV8A 2Y7QA 4AEIL 1RIHL 3GHBH 4ENED 1IAII 5F3BB 1P7KB 3GSNA 3WHXB 1U8LB 1X9QA 4MA7L 3HUJA 3U82B 1G7MA 1LMKA 1QSVA 4Y5XB 1T1ZB 3QI9B 1QRNA 4CN6A 2FEEL 1RUQL 4EBQH 5EU5B 4QWWD 1PKOA 4MD5A 4KKNA 3CC5B 1JUFA 4OZFA 1TVDA 4L8CA 3DO3A 2HTKC 3SHSA 4PJBB 3LKPB 2R23B 1CQYA 1KIRA 2HN7A 3H3KA 1A6WH 1NFDF 5IWLA 4U1KB 1VEOA 2DLTA 3QEUB 1QRND 2YC1B 1YPZE 1N2RB 5DZOA 1FYTB 2CUMA 3RVXC 2APXA 5MI0C 1NQBA 3WNLA 1N26A 2Z31D 2XYCA 3R8QA 4OCSH 3BPCB 1WITA 1N3NB 3F8UB 3QRGL 1N7MH 4KU1A 3T09A 2FNBA 4HS6A 4RGMC 4CAGA 4MQXC 5E9DA 3WDJA 4GBXA 1KN2L 1MRCH 4OF7A 3STBA 5FK9B 1LD9A 5DC9B 1JGEA 3FQXB 5KVMC 1A1NA 1NGZA 1NUNB 3ZE1F 2J12B 1I7TB 2V17L 1PLGL 4OQ1A 2PXYB 1KIPA 5JO5B 3FRUB 4HUVA 4PJFF 5IVNA 3IB4A 3RPIA 1B0RA 4PJ7A 3BH9B 3HE6C 3DURA 1U8MA 5DMIL 1DQDH 3VFSA 1JNHA 4I8DA 3CMOH 4LGPB 1JWUA 4JM2F 4I1NB 5E70A 2F74B 4Q6IB 1KTRL 5FHAL 4UILH 3JWNC 4E0RB 5IMMB 1U58A 1JZ5A 3CVHH 4TPRL 2B1AH 1HQ4B 5GGRB 5GGVH 1W8OA 3E6FB 2F54A 3RWJA 5DWUH 1SM3L 3OXRB 1NSNH 3O3DB 1AHWB 1PZ5A 2R2HB 4NQXB 4ZS7L 3DMMC 5JQ6H 3N1PC 1XEDA 2JCCA 5EBMA 1KGCD 3L7FA 3THML 1MJUH 2PW2B 4K3DH 1IT9L 1UB6A 5FGBC 1E4KC 1LEKB 2DTMH 3NPSC 4U1IA 2C1PA 3NFSL 3TM6A 4D0BB 4H1LB 5ADPH 4WW2A 5BW7A 2J8UA 3U30B 4S10A 1IL1A 1A4JA 5I1EL 5KZCD 5DZLA 2QV2A 3TIEA 4X5XA 5IGXL 1NUFA 3I6GB 3LEXA 4JM4H 5C0IA 4ORGB 4GS7C 4D0CA 4NO2B 3WIIL 5C0FA 4Y5YB 4P2QA 3U4EA 4APQB 1F00I 3ILPB 2X1OA 4OLVH 3WIFA 1GCFA 4O51B 5C6PB 5SWZA 5C3LD 3RZCC 3WBDA 4F3FB 3KYNA 1E4XH 4DZBB 1JZ7A 1FZMB 2GTWB 2WK2A 3FOMB 1F90H 2W0FB 2MCG1 1CFSA 4PGBA 4AL8L 3X3FH 3RY4A 3MOBH 5D96B 4H5SB 3WNKA 3JV4B 5E94A 1BQHA 2Y06H 3VG9B 3WL9B 3VWJB 4CVXA 1X5ZA 5D2NB 2E5EA 2W65B 3TCLA 5IK3B 4G8EA 2B5IC 5IG7B 2W91A 4MD0A 3T65A 3CDFA 2YK1H 4UIKL 4HUKB 5B8CC 5DD3L 2BMKB 4NKIL 4OZFH 5F70A 3RVVD 2DQDL 1NBZA 3RBSA 4AQOA 1NANI 1NGXA 4ELMF 3EDEA 1U91B 5D4QA 5DDHB 3PNWB 3V7AE 2HG5A 4FQXC 3HLAA 3RWFA 1AC0A 1UB5A 3DWTA 4IRSC 4J3WA 5K33A 2OR9L 3GJFB 4XNQA 1RZ7L 5C09B 4NZTH 4C56B 1AD0B 4Z5RA 4OCXL 4M9PA 5FYJE 2QKIB 5ALBH 4F80A 5CJXC 2V6HA 4YHPA 4KRPB 1JGUL 4CGTA 3MV9B 2GW5A 4HMCA 5C08E 1L7IH 2X1XR 3SDXA 5MERB 3MRHB 1OARH 5MP6H 4XPBL 3TA3C 1T66C 4YHKH 4JPWH 4NT6B 1I85C 2E8YA 4POUB 4P2YA 3HG1B 3VH8G 3QIBA 1FHGA 2L7JA 4Y16C 2AXGA 2ENSA 4KKBD 4X9HA 4OIIL 3AROA 1K4CA 4Y4KB 3VGGA 1G6RL 4NN5C 3ULUE 3VD9A 1C12B 4GG8B 5E8EA 1RZIB 4ZPVB 3C5SA 3QO1B 2BXZA 4NRZB 5T3XH 2NY0B 5EUKA 3AB0B 2CR6A 1NKRA 3QIBD 1TCRA 3A6CH 1QHPA 2XRAH 3GSUB 3HUJF 4UDUA 4H25A 2VXUL 3WS6C 4KPHL 4XP4L 1TIUA 1ITBB 4K3GA 2BDNL 4ISVA 1AGEA 3QPXL 4UUJA 5F7KC 3FB5A 3OKOA 3DVGA 1YMHB 4NPYB 2EICA 3C6SB 2XKUA 4JVUA 3LRSA 3OB0H 1HHHA 2Z93A 4GG6B 3DV6A 4P46C 5E6IB 3HR5A 1DR9A 1YEHL 3REWA 1ZKAA 1I1AA 2BERA 2B39A 5IB1B 2DQGH 3O81A 4P9HL 1JWMA 5I75B 4R7NA 1U8OB 4PJAA 3QWOB 2JJSA 3Q3GA 4QXUL 2YPKB 4JFZL 1I9JH 4HQQH 5ISZA 5IP4A 4Z7VE 3GJEA 3B3IA 1TTGA 4CVZA 1P4LA 3P0YH 3AUVA 3TBWA 1I1AD 5JDSB 2LU7A 3SKJL 1ZT7B 5DJCA 1M6OB 1CLOL 4NNYA 4OGXL 1KCUL 2YS4A 1I1YA 2N1KA 5D71H 2EYRA 4DVRH 3C8KA 1A6VH 3VWKD 1T3FB 3LV3A 4EI5C 4FFVD 3ROLA 1QUNA 3QCTH 4NGHH 4Z7WE 2XQBL 3CUPA 1R3JA 2DQCH 3RUGB 4PJ7F 3SN6N 5A3IC 4JQXA 3WHE1 1ORSB 4BKLB 4NN7B 2D0FA 2C3WA 3LN5B 2HVKA 3F5WA 5C6TH 2FB4H 4LLQA 3QWRA 4XNZB 3I2CL 1G7IA 2A6KA 4N8VG 3HE7A 2ZPKL 5E99L 3RAJH 1LO0H 1FVDA 3GMNB 3D9AH 2C3GA 4WV1A 3UTTB 3CK0L 4JFQB 1FZJA 2FSEB 5IJKA 3CIQA 3O45A 4KK5D 3ULVC 3VXPA 3RKDD 1KLUA 3F65A 3BZEA 3LDBC 3JVGA 3QWRD 4KTDH 3CLEL 3RNKB 5MENA 3F7VB 2H1PL 2H6PB 2JCCF 2R0ZH 4LLWA 1S5IL 1NMCC 4ZOBA 2IBGA 3VD4A 1HH9A 3WEXB 1RU9L 2AK4E 4O02H 2WMPA 2VZUA 3NABL 4JCMA 3C8HA 4XHJC 4AG4H 2AEIT 3A67L 1IGFL 5DI8B 4RNRA 1IEHA 4LHUD 3T77B 4WW2F 4F57L 2J8UF 3GIVB 2J8OA 4N5UA 32C2A 3WN5B 4MZ2A 1D5IL 2AEWA 2XA8H 2NXYD 1S7QA 3H6JA 3S5LB 2HFGH 5HHVH 4JHZA 1UXSA 4TSBH 3F58H 3WKMH 3S35L 4YDJA 4F15C 5GISL 5DJXB 2HWZH 3BP7A 5JW4M 3ZE2E 4GKNB 3OSKA 5DURD 1CLCA 1IGMH 3QQNA 3NFNA 5IB4A 4KI1A 2GJZB 1NJ9B 2VYRE 4LCWE 5EOTA 3K3QA 2CDEB 4J3UA 4PLJC 2M8XA 2FWOA 4G6KH 5E7BA 1KULA 4F7TB 2WINA 2EDTA 4HKJA 3H42H 1RMFH 1BZ7A 1W0WA 3OXSB 3NACL 1NBVL 1A6UH 4UQ3B 3QP3A 3BYYA 3BUTA 3ARGB 1CG9B 1Z3GH 5D1ZA 2KQNA 4XB8A 4JFEA 2XXMB 4JQVC 4N0UA 4PJEA 1DUYA 4L3ED 3UTQA 5IFJA 1INQB 2R56H 1QSFD 4MVBD 1MJ7H 4RFOL 4H8WC 3GEWB 4ODTL 4J6RL 5EBLB 5D1ZD 3O6FB 4K3EH 4JFED 2X4NA 4B41A 4G7VL 4RIRB 2AEPL 3MUJA 4YIQA 3IJSA 5DO2D 1DBKH 5IV2B 4NC1E 1F5WA 4DCQB 2Y36L 4G9FD 4ZUSA 2IAND 1JRHI 5CCKL 1T1WA 4MXWH 4ZSOB 4LU5L 5D5ME 5BOZG 4PJXE 3QUZB 4RMQA 5EC2A 3BOVA 1UJ3C 4OJFL 4BSWB 5DMJB 1C16B 5F9JA 5HHNB 4Z9KB 3ARBB 5DHXB 4HGWB 4LKCB 1OAKL 2FIRT 2V5RA 2OM5A 1LO3H 3MO1A 3HPLA 4Y88A 4XCFL 3SDXF 1G9ML 3CXDH 5I71B 1DBML 2X4PB 3LVEA 3EO0A 5F96H 2A9ML 5AYUL 3IYLW 3MGAA 3KYOB 4PB0L 2B20A 3FB8A 6FABL 1UA6L 4U2ZA 4GAYA 3IAQA 1FFRA 4G7YH 3V9FA 3DIFA 2B2XH 5GJSH 4ZTOL 4R4NC 1AHWC 3EOAB 4M7KH 4RFEB 4JQIH 2VQTA 3DVNB 2CLZB 3W11D 1HWHB 2R2EA 3S88L 4QRPE 3MR9B 1VFAB 3FMGL 3IF1B 1G9NC 1CWVA 1Z2KA 3VFMA 2AJXH 3TV3L 1Q0XL 4JAMA 2YD6A 4NOFA 4PJ5B 5DUPL 4NHCL 2EXYC 2RJMA 1A8JH 1F6AA 2GT9A 3MJ9A 1QNZH 2QLVB 5GS2H 4ZTPL 2VL4A 4Z18A 4XP9L 1A22B 4BA8A 2HJFB 1YMMB 1AQKL 4MDIA 1DLFL 4KK6D 5HI3C 3E1F1 3RWCB 5HGDB 2FD6L 2ZG2A 3TJHC 1CK0H 2J6EL 3GMOA 2PO6C 3HAEG 4PJAF 2OSLB 2W1NA 2OQJB 3RA7H 1YYMH 4JZJB 3AAZB 4D9LH 3TPUA 4S1SL 4Z0BL 1WWWX 3B9KC 1MAMH 3GSWA 3JUZA 1NDGA 1C08B 3REVB 4KQ3L 1D5XA 1OAQL 1AIFB 5C0DB 5CEZL 1AY1L 1HNFA 3T0XA 3QDJA 1TMCB 5A2KH 3AS0A 4MX7A 2JLLA 2R1YA 3PHOB 5TGBA 3LKSB 5HHMB 3L3GA 2ADGA 4GRWE 3ZHLA 1XF3A 3O11B 2FJHA 5HYQB 5SX5H 2CJUL 2ARJQ 1R0AL 4R4BB 4KJYA 4PP1C 4G8GD 12E8L 4FQIL 1I1CA 1GC1C 3VWJC 3IDXL 3QDJD 5C9KA 5D2NC 4I3SL 4XAKD 5JQHC 4FXLA 3L5XH 1FFOB 4HGKC 1I7ZA 1WCBA 4O9HH 5DGRA 2X42A 2HT4C 3VE0B 2VQ1B 1QFUH 2WLZA 3LEVL 1MRFH 2VNCA 4ZNEE 1NCAL 2R69L 1EHLL 4G6JL 4DFIA 3WFCL 4MA3A 2M26A 5KW9L 1WSST 3LKRA 3DYOA 2IFFL 1I9RL 4ODUA 3MCKA 4QOKB 2X7LA 1FL6B 4WFFD 5GSVA 2NY7L 4MMXC 4ZDHB 1SMOA 3OKMB 1H3TA 5KSVA 1CD1A 4N8CL 1BVLB 5EO9B 4WUUB 2P42B 1BBDH 2NNAB 2ZOLB 4P3DA 4YE4L 3RFZC 3I6LE 3KHQA 3D85A 4PJDA 1RIUL 1Y18A 4JFDE 3HAEH 5AYQA 3U9PH 1MIEH 3Q6FB 1ZLUK 4NQCA 3VFNA 2VE6B 4C57C 5FA4A 3E6HB 3TH3T 1U6AL 2HLAA 3LQMA 3HI5H 5F89B 2FIKB 3MUZ1 1J88A 3QFJD 4U49A 1T1XA 3D85D 4Y4KC 4Y19D 1DUZB 4N9GB 4YHLL 1H5BA 1T22A 4XMLH 3IDNA 4XH2B 4Q0XH 4JKMA 5ACZA 2NY0C 4QF1A 5CEYB 3PHQB 3GMMA 4R8WL 2YD5A 5LGHL 4PGEB 1D6EB 3WXWL 1N6QL 2OI9B 2BRQA 4ZFOA 3HTLX 1LNUA 1UM6H 1VFOA 3QHZL 4GRMA 1FNEA 3EHBD 3TT1L 5IESH 5EIQA 2O5XL 4G6FD 4FQQA 4N90D 1VPOH 1WFOA 3WD5H 2K9UA 2P44B 4RWHA 3S37H 4M1DL 5E6IC 1G7QB 2NZ9D 3VGHA 1MCFA 1R5VB 2F9BT 4JHWL 4U7MA 4D9QD 3GMPB 3FCTB 1KCVH 1NLBH 3GSXB 5I75C 5L6YH 5DC0A 3MJ9H 5DRWB 3CU1A 4NQEE 2AJZA 3BKML 4RGNC 3BQUB 1CZ8H 5IB5B 1FH5H 2D31A 1FBIH 1CDIA 1TETH 5TE6L 3P9MA 2GSIB 1G0DA 3LQZA 1AO7E 3SDCA 1WVZA 1BJ1H 5LGJB 4LGSB 1RJYA 43C9B 1YJDH 1C5CL 3EFDL 4IS6B 1KPRA 3QYCA 3DUUA 3PWVA 1I8KB 3U7YH 1J05B 3CZFA 1OY3B 4PRHA 4XVUC 3MBEA 3WUWA 3P9LA 2DLEA 3SDCD 3IS0X 1HXMA 5IB2A 4GUPB 5GS0L 4EKXA 3VFUB 4WHYG 2XN9D 5E2VL 1WTGT 1VACB 5EFIA 1KIQB 4NN7C 1T03H 2NY3B 1QG3A 3QH3A 4LKXA 1AXTH 2CMRH 4H88H 4MJ2A 2FYYB 1IBGH 4PRHD 5SWSE 3MBED 3L6FA 4F8TA 1WC7B 5D7LE 4UT7L 1ZHKB 3S36X 4MNGA 3VG0L 1MPAL 3FQWA 1MFBL 1ND0B 2Y5TB 4K94H 5ENWA 5JPMA 4HEME 2EH8L 2HTKD 1XCTB 2A83B 2R0LL 4Z7NF 2NY1C 1Q9OB 4ZFGH 1F4AA 4N0YL 4OFKA 1A14H 1MLCB 2P5WB 4N5EC 3VA2C 5CEXA 3WO4C 1RHHA 4X0KB 3FT4A 5HYJA 5AG8A 3QA3B 5EWIL 5F7HA 2MQ0A 2Y07H 2WIIA 5CHNA 1XR9B 2P8LA 4NC2B 3SO3C 4B50A 4JFFE 3JWOH 5IQ7H 4MQXD 4PRNB 3SO5A 5KJRL 1JPTL 4AMKL 4OD2A 5CUSH 4OZHB 3HE6A 3TH2T 1ZE3C 1HI6A 3CNKA 2DWEA 4JPKH 5HYJD 4IHOA 1L6XA 1FIGL 3KPMA 4PLOB 4WHTA 4JDZB 4AEIH 3MGTA 1RIHH 3O2VL 5KVFL 1BBJB 2UVEA 1YYLL 1CLYL 3DX9B 5E8OB 3BP4A 3QULB 1YEDA 5B4MC 5KSUB 4LQFH 1FL5B 3HE6D 3QIWB 1RUQH 5I6XB 3BVNA 5DQJA 3ZT6A 1M7IB 4RGOL 5DRZB 4E9LA 1OOAA 3O3AA 4DW2H 4X80L 4JDVB 3I50L 3VFRA 5C07D 1LEIB 4S1DD 4YHIA 1KB5L 1XIWB 1ITCA 5FM5O 1CT8A 5C0GB 5JW4R 3RY6A 5HGHA 1MCWM 4PY7B 3DGGB 3M1BA 1AGBB 4LMQE 3QRFM 2CLVB 3DMMD 3O6FC 3O9WB 3QRGH 4I48A 4JGMA 2BVPA 3K2UL 1OCWH 5JLZB 4JFOA 2YBRB 2Q1EA 4DK3A 5E8PA 4U1SB 4DOHE 2BVQA 4A2MA 1MI5E 4OCMC 5I76A 4JKWA 4Z7QF 5CJ5A 1ZLWK 1MFEL 2P8PA 1UWEH 5IVXE 4P5KB 3BEVB 1AGCB 1RUKL 2V17H 3D39D 5ACLA 3BP5B 5DQ9A 3ULSA 3RZCA 4Z95L 5HI5D 1FN4A 1T83C 2DBLL 4PRPE 1FVEA 3FTGB 3X12A 1WWCA 5FO9B 2H26B 4OLWL 3ARYA 4QHUA 4PJDF 5DMIH 2ZSWA 5EOQH 3IKKA 4UNUA 5FHAH 3RZCD 3BWUC 3MV7B 4HPYL 3UBXB 4CJ1A 2APBA 15C8L 4HZLA 5L8KB 5FKPA 2J5LB 1JF1B 2L0DA 4YEFA 1EHNA 4HUNB 1SM3H 5J7CC 3V6FA 3BP6A 4L1DA 4PG2A 3S3PA 4ZS7H 1F4YL 4O2EA 1T89C 3THMH 1RJZB 5FO7A 2R0KL 1IT9H 2FZ3B 5I1AA 1CE1L 1UKQA 1JHTB 2NX5A 5EU6D 1A7QH 2OTUA 3A6BL 4FQLL 4BZ1L 1A47A 1JZ8A 1WBXB 4UT9L 4WNQB 4E41B 3GHEL 4OIAA 5CLTA 1TQBB 1VADA 2CRIA 3VMNA 4KROB 2WBJB 5INDB 5I1EH 3TIDA 3QXWA 2QQLL 3HI6L 4XCNB 1XGUA 1NGQL 1MHCB 5IGXH 5KSAB 3OAYK 3OZ9L 3ALWA 5FYKE 1SJEB 4V1DE 3NCEB 4PREB 3TPKA 3QUKB 4RFNB 3DYMA 2M1KA 4NWTH 4Q6YA 2ADFL 2NXZD 1RUPL 5EO0B 2EYSA 4WENB 1VGKA 3TT3L 3Q48A 4X4XB 4W4OC 5FCUL 5FUCE 4HUUA 4EN3C 3DSFL 4Y2DB 1I85A 3FT2A 3SDDA 4PPTA 4LSRL 4K7PX 4M5ZH 3ZE0F 1U3HA 3KLSA 2VXQL 1S7XB 2VLRA 4YBLB 5IF0A 5DJ8B 1RULL 4RMSA 1RURL 2DMCA 4M62L 1ACYL 1II4E 4WFEE 3ROOB 3IDMA 3QZWA 1R3LB 3TA3D 1T66D 3ARWA 4LLYB 3K8MA 1I8IB 5KSBE 1IEBA 3RP1A 3W0WB 3OL2A 4YX2L 1FDLL 4Y16D 1KB9J 4PJGA 1KNOB 1FCCA 2VLRD 2SEBA 2ZNXA 4M7LT 5HJ3A 2ESVE 5DD3H 5K93A 1NAMB 4K23L 4NKIH 4Y7MA 3WLBA 2DQDH 1SHMA 3PWUA 4MCZB 3K4DA 1A4KA 2CKBL 5EPMA 1HE7A 3PJSB 4XBGA 3V6ZA 3O0RL 2BNQA 1FNGA 1JPFB 4UI2A 5BMFL 1HHGB 4ZUWA 1Q38A 1OGAA 1SVZA 2GJ6B 2OR9H 4TVPE 1BD2A 5FF6B 1BVKB 3VXRA 1RZ7H 5HBBA 1RD6A 2IAMA 3D2UD 4FQ2L 3OJVC 4OCXH 3PQYA 1OSZA 1FC1A 4S1QH 5JR1H 2I9TA 4LIQL 2CK0L 2YD4A 5HHOA 4KKLC 4D8PB 4P46D 2BNQD 2K1MA 1JGUH 3QQ4A 5GGRY 3MRPB 4M6OL 4U33A 4M3JA 1GGUA 4OCYL 1OGAD 2MHAB 3UTPE 4R96A 2IBZX 2NY6C 3AFLA 2VOTA 2IAMD 3IKCA 4XPBH 5IFAL 1YQ2A 2C26A 1HYSC 4WI3A 3QXDA 4JRXA 3T0EE 5HHOD 2WAHA 1KJMB 4JRWA 2W0PA 2IADA 3FOLB 3G6AA 2QSTA 3LSOB 3R06A 3HNSL 1OW0C 1H3PL 2ICEA 4P4KA 3VXUA 1MWAA 4JRXD 3I75B 3LB6C 2DTSA 2JB6A 4I0PC 3LCYA 2VXUH 4FS0A 4XP4H 4JR9L 5BS0E 4LDEB 2VO5A 1GRWA 4L4VE 3QPXH 3GSQA 4HH9B 3V95A 5A3ID 3QO0A 1T5WA 1FV1A 3DOSA 4BFGA 2OZ4A 3L1OL 4L4TD 1IAIL 4GXVL 1CLZL 2DYPA 1VSCA 4RMUA 5D6DC 3SBWC 2JB5L 4LAQL 4FXKA 3BDYH 4NO3B 1IM3A 3KPQB 2H3NA 3PGCB 5DRNA 1G7HA 3TO4C 4P9HH 4PP2B 1GZQB 2CLRB 4QXUH 2ZCKL 4JFZH 1QFOA 5TQ2L 4QY8B 3ULVD 2DYPD 5TDOB 3BQUC 4ZNCD 3PP3K 3O3EB 4NCC1 1NFIB 2KH2B 5D2LE 1QO3B 4AY0A 3PWPB 2VZOA 3GBNL 5I1LA 4O00A 4GW1A 3VFVA 3KPNA 3SKJH 2VXSL 1IGIL 4GXUN 2V5YA 4OGXH 1KCUH 4J8RA 1S9VB 4XHJD 2AABL 3SCMC 3BZ4A 5GIRB 4R3SB 1RJLA 4X7EC 2X4TA 4X6CA 3BAEL 1QR1A 3L5WB 3QUXA 3WJJC 1BIIB 2XQBH 1P7KA 4NFBA 1CGXA 5HYSG 2YUZA 1U8LA 3CMGA 3PV6B 2NZIA 2IH3B 1D9KC 4YZFF 5A43C 3MUHL 1U8JB 3FN0L 4Y5XA 1T1ZA 3NN8B 3QI9A 4HPOL 1B4RA 4U4BA 5EU5A 2E7MA 3I2CH 3ZMRA 3CC5A 2ICWJ 3TWCL 4XXDB 5GJTH 2Q7YB 2ZPKH 2YPLB 4MXQD 3QUXD 2B4CL 1K8IA 4PJBA 3LKPA 2BRRL 1QSEB 2R23A 4EUPB 2YD2A 3GKZA 1KUMA 3LPFA 3B6SA 3CK0H 3BT2L 4MNHB 3WIHL 4LNRA 4PLJD 4U1KA 3QEUA 3QI9D 2YMXL 2YC1A 1GOGA 4RMTA 1VKXA 5C92A 1N2RA 3GSVA 1ZANL 1JZ3A 2C4XA 3CLEH 4J3XA 2H1PH 1J8KA 2XTLA 4NOBA 2E27L 1S5IH 2I5YL 2J6EA 3BPCA 1MQ8A 2HRPL 5D6CB 1RU9H 3NABH 5B38B 2VH5H 3A67H 1IGFH 3FRPA 1FYTD 2Y72A 5FK9A 1EH9A 4PRAA 3ARDB 4F57H 4FQHA 2ARJB 3FQXA 1IJ9A 2YUXA 5HDBE 1N5AB 1D5IH 3G9AB 3KXFB 5DEGA 5DMYA 3T08A 5MEOB 2PXYA 4EDXA 5JO5A 3FRUA 5K9QI 5GISH 3DRQA 3BH9A 3RZWA 5F1NA 3MRLB 3V4UL 4ETQA 1C8PA 3KLHD 4DAGL 1JZ2A 1TTUA 2W9LA 2DKSA 2F74A 3QJFA 4Q6IA 3VXQB 5GRYA 2VLJB 2NLJB 1HIML 4E0RA 2AJUH 2PXYD 4QT5B 4IIQB 5H35B 3UX9B 3EYSL 4H0IA 1HQ4A 2E7BA 1OM3L 3E6FA 3QIWC 5I6XC 3DX7B 1NBVH 3NACH 3OXRA 2I60L 2R2HA 3V4PH 4NQXA 1MWAH 4KJPC 4W6WB 4DUWA 1HOCB 1V5JA 2PW2A 3HZKA 2D7PA 2XPGB 1UG9A 2A6IB 4PJGF 1XIWC 3O4LB 1LEKA 4RFOH 3VFOA 3GFUA 4ODTH 3SE4C 2GQHA 4P5MB 4EVNB 3MLWL 4MLIA 4D0BA 4R4ND 2XWBB 2APFA 1QPPA 2AEPH 2JK5A 1IC7H 1KTDB 2W92A 2Y36H 3CXHK 4OLUL 3UP1A 1ADQA 2N4IA 5ESQB 1ZHBB 1KYOK 3I6GA 5FCSH 4A6YL 4KHTL 4LU5H 1GHFH 4GW4B 1VCAA 4NO2A 2AV7A 3ARQA 1WAAE 1DDHB 2EYTB 4Y5YA 1RQ5A 2NY4B 4APQA 4LEOB 4YO0B 3MRBA 2DM3A 5K9KB 1OAKH 5HI3D 2EEAA 4MWFB 3ME0A 3BPLB 4K7PY 3TJHD 5DHYB 5C7XL 4O2FA 1FZMA 2GTWA 3HZVB 1NMAL 4X5WB 1RZJL 5HHQA 3H7LA 3PF2A 2IC2A 2IEPA 1G9MH 4APQD 1DBMH 2JE8A 4ZPTB 4XMPL 1NLDH 3B9KD 4H5SA 2DQFB 1I1FB 3MJGX 3UYOD 1H3GA 4PB0H 3WL9A 5KS9B 1T7YA 5FAAA 1AP2B 6FABH 3G5XA 1UA6H 2QEJA 2ED8A 4OCWL 4JRYB 4Z7UF 5IK3A 4ZTOH 4LDOB 2VLKA 2JF1A 3V5DB 5IG7A 1T04A 3SGDI 3EOBB 3ARFB 3S88H 2OJZL 5DJAB 5C0CB 3FMGH 4OZGA 2BMKA 3G9VA 3MRRB 5IMKB 5BV7H 3DO7B 5IW3A 1Q0XH 1F2XK 3TV3H 3VWJD 2YHGA 2PF6A 2KQMA 3EGSB 5DUPH 4CDGC 4YDKH 1A21A 2HVJB 1U91A 4NRYB 5DDHA 3PNWA 4XP9H 3C2AL 3L3IA 1OAUL 2CH8A 2OP4L 1AQKH 2HT4D 4KROC 4DN3L 5L2KB 2EIZB 5C09A 2WBJC 4C56A 4WY7L 1MCWW 1AD0A 4PJ9C 2FD6H 3VFPA 3VI3E 5HDQL 2J6EH 3I02B 4PV9B 5F9OL 4G80A 5EZOL 3O4OC 3KPTA 4GRLB 2KPNA 2IBZY 4NKOB 3MV9A 4WU5B 3VXSB 1ED3B 4QRRE 4S1SH 4W6YB 5E95B 1KCLA 1XZ0A 5DVLA 4BELD 1B2WL 4C56D 4DZ8B