3OKEA

Crystal structure of s25-39 in complex with ko
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMNCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFALTISSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERANGVLNSWTDQDSKDSTYSMTSTLTLTKDEYERHNSYTCEASHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-39 Fab (IgG1k) light chain
publication title A Common NH53K Mutation in the Combining Site of Antibodies Raised against Chlamydial LPS Glycoconjugates Significantly Increases Avidity.
pubmed doi rcsb
total genus 47
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3okeA01
5ESQB 8FABB 2HT3C 2DIBA 1NBZB 4N0YL 1IGCH 4UT6L 1RAMA 1RK0A 3MV8B 2UVFA 3MV7A 3RIAF 2CR3A 2DQTH 2DLGA 4OGYL 3NH7L 5IG7A 1AKJD 4XNUH 1EEZA 4MZ3A 1JI2A 1IC4H 3QZWG 3SKMB 2PXYA 4LSTH 5BW7A 3VW3H 3S5LG 2A83B 2EDQA 1CF8H 4AK1A 2WINA 3QEGH 3O3EA 4FQCH 5CZKA 1LGVA 5ENWA 2PF6A 1SYVA 3TBSB 2A74A 3Q3GA 1HXMB 4RAVA 2W0KA 3ARGC 1BBJB 4YHOH 4ZFGL 5FM5M 3QWRA 1MCJA 3RL1B 4PP2A 2CDGA 4NQDA 1FPTH 1NQBA 2O61B 2BNQE 2ICEB 5HSFA 3QCUL 4BKLB 5FO7A 1A4KA 4U1HA 3GRWA 1YPZE 3QIBC 1N5AB 5IMLB 4F3FB 5D6CA 3ILPB 4HUVB 2DQEL 4P2CG 1ZLVK 2VXUH 4YHIB 3RI5F 4J4PD 3EDEA 3QPQC 2A6JA 2WBJC 1LHZA 2D7TH 3PV6B 5KVFL 3LQZB 1U2HA 4BK5A 5I8KH 3EOAA 3MLUL 4POUB 1VADB 5DC4B 5JW4N 2X9XA 3FONB 4LHUA 3KHOA 4NGHL 5CCKL 4ZUTA 4UQ3A 4J3VA 5I18H 1W8OA 3HE7C 3MRLA 5IROC 2X1PA 4FFWD 3MXVH 2VQUA 2X40A 3QUXB 2W38A 3R0MA 1IAOB 1NKOA 1U95B 4DK6A 2HRPL 3BT2L 4UAOC 4UOW0 4PRIA 4NN5B 3SQBA 3LKPB 1HQRB 4LCIH 5INCA 5DEFA 4OFDA 2X4NB 3MRNB 3HKFA 4N1EA 2NZ9C 3O6FD 2F9BT 5FUCE 2BSRB 5D1ZB 4JJ5B 1YNKH 1OCWL 5HYJE 1KEGH 1QQDA 2X7LB 4LDOB 2HP4A 2P7TA 2VL5A 5DJXB 1WCBB 1MRCH 4MHHG 4LCUB 1P53A 4FZEL 4XBPA 3S36H 3PNWB 2LU4A 4R3SA 4CL7A 3BWAA 5M95B 4EVNA 5FCUH 1U8LA 2MPAH 5T3XD 3CNKA 2YPLE 5IB1B 5GJTL 1NANH 2GITB 4W6XB 5KVEH 2H45A 3VG9B 4F9PA 1LE9B 4EDWL 3BXNB 2VAJA 2I26N 1OB1A 1S7VA 2EYRB 5I76A 5TQ2H 4N0CD 2JJSC 1RIHH 1VFAB 3CPLA 4HKXA 1AJ7L 2R1WA 3W0WE 3PG2A 4M8QA 1ZT1A 3MSPA 5HYJA 2G60L 5JOEA 1Q72L 2CIKB 5CINL 3ZYJA 3LS5L 1KPUB 3GJFK 4HBCL 4G6KH 2DI7A 3HMWL 1UC6A 4QWWD 1Z9OA 3FB5B 2ADFH 2H2SC 3V6OC 1AQDB 3H3PH 2X41A 5KSUB 2ITDA 1E27A 2V9TA 1N3NA 5EUOF 4ZUUB 3DLQR 5D7JD 3VFNB 4TVPD 1ZANH 4RX4D 1JZ5A 3S37H 1II4E 3JV6A 5K93A 5IQ9A 3REWA 4MD0B 5HHPA 3OR7A 2W65A 5D2NC 1XF5B 3DRQA 4YHZH 2R2EB 3WFBL 5DUMH 3UMTA 4OKDA 3MRDA 1KIQB 1H8NA 4YDJB 1VFBA 5D2LB 4QCIB 4LSRH 2NZIA 5JHLL 3KNBA 3I75B 4IMLB 3C6LB 4BZ2H 3W9EA 3O2VL 4LLYA 3MROA 3DVNA 4P4KA 3P0GB 1CGVA 2VC2L 3V4UL 1BD2B 3EO9H 1CFQA 1ZWIA 4RIRA 5CIPB 2HFEA 1NAMA 4AH2A 2NPLX 1XF3B 1FH5L 5KS9B 2DKUA 1FQ9C 2P5WD 3SE4A 4XWOC 2Z31C 5L0QB 4JFDA 1UWGL 1KN4H 1YEHL 2EXWD 4M1GL 3S96A 4Z7WA 1BIHA 2OK0L 1X44A 5C71A 1DL7L 3VDAA 3H7LA 4XC3H 1F6AA 4OCWL 3ZDYE 2P8PA 2QBWA 1F6FB 5D1QC 1RUAL 4TQEL 1FL3B 1OTTC 5I0DA 1LEKB 4MNQA 4PJ7E 5ISZA 4DGVH 1MWAL 5I75C 4FTVA 3QNZB 3HFML 1CBVH 2F54A 5BS0A 1IFHH 1YEDA 1HKFA 4OT1H 3MNWB 4U6HB 4ZUWB 4CVZB 3MRRB 4IDJH 5C7XH 3ARFB 5BQ7A 3R06B 3QUZA 3EGSA 4HC1A 3PGDA 1WZKA 1W2KT 5D72H 1U8OA 4OM0H 3BIAX 4ZD3L 5TDNA 4ERSL 4U1SB 1MJ8L 1MY7A 1I1RA 1EHNA 3OPZH 3PWPB 3OJ2C 4LPYA 1MF2H 3KXFE 4FFYH 4DN3H 3RRQA 4MJ6B 5FDWA 1HDMA 3QXTA 1ZA3B 3I84A 3QO0B 2SEBA 5GIRB 5I16B 3S3SA 5D4QA 4TUJB 1G7QA 4WENB 1KB5H 3G5XA 3MJ7B 4M9OA 2AI0H 3OHXB 5EOTA 2DL9A 3IFPA 1KCSH 3KPSA 2NY5C 4K7PH 1EAPA 3B43A 5C0NC 5GRUL 2QR0A 3VJ6B 3L6FA 3PQYA 4PGDB 3ZE2E 1N0XL 1MFEL 2WANA 1LILA 2HMID 2NW2B 1U3HC 2ID5A 5GGVL 3ZTJH 4JRXE 1YJDL 4PJXF 2BC4B 4KRMB 3T65B 4OCNC 4YHNA 1LO4L 4M5ZL 3Q0HA 3RZCD 4EBQL 4Y19A 4BQBA 3OBAA 1K8IA 5ETUB 3DBXB 4ODSH 5JDSB 5JXEC 3DX6A 4NQTA 5E2UL 3EYQC 4JY6A 3FTGA 1SEQH 2PUQT 5DZLA 3DRTA 1ZHBB 3QB7C 4DZBB 4CMHC 4XP5H 3WS6A 4OIIH 1I7RB 2IPKB 4LKCB 1XIWC 4IRSD 2P5EE 4H20H 4OIBA 3RDTD 3S4SG 4Y5YA 4ODTL 4M1DH 5C6TH 1TTUA 5K9JH 1RUKH 1KCRL 1FG2A 32C2A 1N8ZA 1A7QH 2HLFD 1A1OB 4KK5D 3GO1H 4MWFA 1NCBL 5EO1B 4FABL 1WF5A 1IM9A 2DQUL 5IUSA 1IZJA 3I2CL 5DD3H 1KENL 4P2OB 4LPXA 3ARRA 3HC0A 1JHTB 4NZUL 1JPST 3HTLX 5FA3A 2GTZA 1A9BB 1CN4A 1ULVA 4ZNEA 5E6IA 4XXDA 2Z91B 1B6UA 1TQCC 4C4KO 4YXKL 4G3YH 3E6HB 4DKEL 3EYFA 1KJ2H 5F3BB 2UUDH 2XTLA 4MNGE 5DRNB 3BP7A 3KYOA 3CZFB 2AQ1A 1SY6A 3FCTA 4L8CA 1A6TA 4ZS7L 1OW0C 5HVFB 5KJRL 4YUEL 1FFPB 3DGGB 4OZ4B 1MCOL 4ZSOA 2Q8BL 3NAAL 3AM8A 4ZTPH 2VLKB 4MJIB 4QHLB 3HI1A 3PWJA 3VXME 4UUJA 4JFED 4QNPE 1U92A 4NKMB 1KEMH 4XI5D 4F33B 1Z9LA 2K1MA 4KQ3H 4QRSB 3HG1B 3DUHA 3DI3B 1MCKA 2FEDD 1D5BA 5IB4B 4ODXB 2F8VA 2IG2H 5IM7B 3AU1B 4KJYB 3NCMA 2QEJA 4Q6YA 5AUMA 4BH8A 3ULVL 5C9JB 3VXSA 3HUJE 3EJYD 5CBAA 2PTTB 3H42H 5DD5H 3D48R 4X83A 5IMOA 1Q9WB 2BOCA 3OJMB 5KN5A 1PQZB 4G8GA 2OTWB 2V7HB 5GZOC 3MLVH 3VI4E 5C70A 1N2RB 3V6FB 1YEIH 3SBWC 4FQHA 1KN2H 1C5CH 4HS8H 5CWSB 2BNRA 5EOQH 2X70A 5C0AA 5DURB 3HE6A 2EE9A 5HYIA 4KZEL 3DMMB 4V1DE 4HXBL 4NN5C 3V6BR 2H32H 3BIKB 3GDBA 5CSBA 3O45B 1MCSA 4Y1AE 3IGAA 4BSVB 2QADD 3RVUC 3MUZ1 4DN4H 2VWEC 4G6FB 2I25N 5CJ8A 1QVOB 2V2XB 1KFAH 1E4WH 3VD4A 5D1ZC 4UDTA 4OLYL 5E8OB 5HGGS 1HOCB 2FR4A 4OLVH 4XNMA 2OX5A 3GJEA 3MJ8A 1MI5D 1RURL 4HIIB 5DJ6A 5GHWL 4C56D 1U8PB 1VACB 3MYJB 2VAAA 5HI3D 4J6RH 2FECL 4N0YH 1JK8A 2BMKB 3QO1B 4WU5B 1VGEL 5DJYB 1IL1B 4UT6H 4WTZA 3TJHD 3HCVA 3PHOB 4PY8J 4WCYH 3VG9C 4CW1A 4FQXC 4OGYH 3L9RA 1IGTA 3NH7H 5A3IC 3X12A 1QZ1A 1BZ9B 2AGJL 1KB9K 4O00A 1C8PA 2IBZX 3O8XA 3U4EA 5C2UB 3IJHB 1EGJA 2UWEA 2UY7A 2YHGA 4PTTA 3QDMD 5DJ8B 1T1XA 4O5LL 1ZAGA 3VMOA 2XQYK 2VZTA 1BBDL 4ZFGH 4LSPL 3QP3A 4JKPL 5I8EB 4LNVA 1NGWA 4IOFC 2HN7B 1TVDA 5K9QI 5ID1A 4MD4B 1A9EB 3QCUH 3RVTD 3ZDYF 1ZE3C 4LLQB 3W9DA 1WZ1L 2C3VB 3EYOA 4GRLB 4N0UA 3LV3A 3OAUH 5HYSG 4PJ7F 3ARDC 4LSQH 2DLHA 3O4LE 5D1XD 3NFNA 3TBTB 1NCCH 3M17B 1UWXH 3DPBA 4Y5VC 1C16A 4LDEB 1RV6X 1NFIB 3OL2A 5KVFH 2AABH 2EDKA 5HGBA 2IFGA 4LP4A 4R4NC 3MLUH 3KLHD 3M07A 3U7YL 2Z92B 4NHCL 4NGHH 1J11A 1OLLA 5BJTA 5CCKH 2GJ6A 1E28B 4U3HA 3AB0B 1D9KD 3VRIA 3RNKA 4P2QD 5IB5B 5JLZA 1UH2A 2HRPH 3BT2H 5T33L 5JIKA 4P46B 5IW6B 5GS3A 1AY1L 5C2BL 1AO7E 1IC5H 4YBLC 2BY1A 1ZHLA 4N9GB 4U6TA 1ACZA 2R2HA 1FNAA 1Z2KA 4YZFE 1OF2A 1ZLUK 1FFQA 1SVZA 5GSVA 3L3HA 1KSRA 1CD8A 4ODVL 3QCVL 5CZXD 2ESVE 3QQ9D 4W6YB 4RSVA 4DUVA 5F3HB 4M8VA 4FZEH 3GSNA 5TH2A 3VFWB 2AEWA 1XGRB 5KAQG 4I0PA 3IKCB 3I6LD 3ZE2F 1SBSL 4J8RB 3MRBA 3L95B 1F5WA 3ARFC 5C0JB 2VQ1A 3DXAB 4RWYL 5GGUB 1XF4B 3STZB 2AV7B 5IJVB 5GJTH 3FB6B 4NKOB 1A4JB 4EDWH 4YHLL 5ICZB 5DJZA 4HHAA 3WSQL 4EN3D 4M5YL 1UM6L 2H9GA 4WUUD 1FRGH 3ULUH 3GMNA 3NCEB 4L29A 1I3RA 3QIWB 4F37F 4GFTB 1UA6H 4KGLA 3FQUB 3LS5H 4HBCH 2DM7A 3C5ZD 3HC3H 4DK3A 2FRGP 4KDVA 3QQ4A 3G6JA 3O11B 5EOCL 5I1EL 2X4QA 4O2CA 5F9OL 2HJLB 2YD4A 2H2PC 4TVPL 3A6CL 5DEGA 4U6XB 1MFCH 4C55A 3VCLA 2PXYD 3BN9D 4P5TB 2AW2A 2EC9T 3NCYP 1S7XA 1GGUA 2AP2A 1P84K 5HI5C 4GH7B 3HAEG 2YWYA 5IWLA 4LIQE 4MJ5A 3QWRD 4ALAH 1HINL 1KPVB 4NYLB 4X6DE 1H3UA 3LQAC 3GJFB 4PUBL 2FBJL 2VC2H 3V4UH 1FNSL 5IVXB 3BP6B 4PY7A 3EO1B 1F11A 5DS8A 5CILL 4M1CD 4GAGL 3UTQA 1UWGH 1ZGLP 2MKWA 4GS7C 4R96B 1HHIA 5MEQB 2LV4A 4QNPF 4RFEA 1JMZA 2OK0H 2XKNB 1ZGLA 5DHXB 1DL7H 2VXTL 4TTDC 3DETC 3EHBD 3X3FH 1JTPA 1QPPA 3K4DA 4HS6B 4OCWH 4R4BB 3GMLA 4Y4HB 5AG8A 4ODWA 4LHUD 2B0SL 1RUAH 3HRPA 4PV9A 4TQEH 3HUJF 3RWJA 2QSCH 2BNQD 1MWAH 3IDMA 2HJFA 3ARGA 2FEEL 3T1WA 1PSKL 1Q94B 4BH7A 4DVBB 3SCMD 2Q8AL 3VFTB 4XCEB 3VFVB 1GIGL 3R8BB 4N5UA 1JGLH 1A8JH 2APFA 1B0RA 2CDFB 2FIKA 3OJVC 5F6HJ 3O9WC 2BHYA 5B38A 2VLJB 3QIBA 3BO8B 4ZD3H 3TIDB 1MJ8H 3B6SB 3LKQA 1FZKA 1WAAA 3TVMB 4Z5RB 1WISA 5JZ7D 2ZKHH 3ESVF 5DMYA 2WBJA 3MYZA 2FX8H 4HK3J 4QTHB 3RUGE 2OQJA 4KY1H 1IGJB 4NO2A 2Q76A 4Y16B 1W72A 4JM2F 2IALA 2XV6B 1CICB 3HE7A 4I3SH 3RPKA 5IROA 1JTOA 5GRUH 5HDOA 5SV4A 3V52L 4PRPA 4JRYA 3EYVA 3K46A 2IPTL 5HYJD 1MFEH 3N85L 4H5SB 1RZJL 3O2WL 5GGVH 5DRZB 2NY3D 4EJ1C 2XG5A 5DD1H 1YJDH 5LWYL 4H26A 1ED3A 4X4YA 3F7YB 5ESVA 4BUHA 1LO4H 1RUQL 4EBQH 4EQ3A 1KXVC 3OGCB 1S7WB 3MR9B 1PX3A 1VGKA 3BD5A 5JDJA 1OAYL 1ZLWH 4M48L 4P2RA 5FKAA 4RA3A 3PWUA 4RBPH 2VUOA 3IDIA 4ZFOL 1RZFL 3CVIL 4N8VB 4H0HB 4OZFG 4S1DC 1DBAL 3QQ3A 3W0WD 3MRGB 2ARJA 3CXDL 3QJFA 4NQVB 1LE5B 4WNQA 2E8ZA 2CMRH 4ODTH 1XGPB 2FZ3A 2JJSA 5DSCA 2XPGB 2YRPA 3MLRL 3QJHA 1R3LA 2EDBA 4PGCA 4HKZA 4RRPG 4OSUL 4PJGB 1NCBH 4WHTA 5EWIL 4FABH 5EB9A 5K9KB 4FXKB 3FOLB 2DQUH 1Z5LA 4XMPL 1JYNA 3I2CH 1TNNA 1KENH 1CXLA 4JFDD 2DQJL 2YEZB 3GMMA 3EDJA 3V6OA 3WLWD 4KVCL 4NZUH 1IEBB 1JRHH 1E4JA 5B8CB 1BGXL 5EH1A 4JZNB 4LMQI 2WQ8A 4MCYB 4PJ5E 4ZOEA 4FQLL 2CGRL 4UV4L 1FVCA 1UENA 1G7PB 2M26A 5D2NA 5IFAL 3PP3H 3IDYC 3OXSB 3F58L 3CFJA 5I19L 4JFYA 4I3GA 4ZFOB 5KJRH 4YUEH 3MFGB 5ADOL 2YN3A 4FTVD 3SO5A 2IH3B 1JBJA 4YZFF 2F54D 5DJAA 5BS0D 4OCLC 3OV6A 2AK4B 3MRKA 2JIXA 3EFFA 2G2RA 2QJDA 1KF9B 3QUZD 4WVRA 3RWEA 1QD0A 2G5BA 2QKIA 4LEXL 3UPRB 3VXRE 1YQ2A 4QRUB 2GSIA 4Q74A 3ULVH 4GKSB 1J12A 5E1AA 4KXZH 2DM3A 3RVWD 4Q9RL 3WNNA 4ZYKB 4XPHL 2Z31A 1BREA 5IQ7L 4OZHE 1UB5A 1A6UL 1T5WB 2VL4A 4NJ9H 2BVPB 2HJKA 4N0FA 4NJAL 3AB0C 4X7TB 1VENA 5LGHL 1F58L 5LXGL 3KPSD 1DN2A 4KKBC 5D1QA 2X5PA 4KZDL 5EORL 5J6HB 4Z7VB 3RIAK 3CVHB 1J8HA 5GGQL 3ELAT 1MHEA 2EDWA 2FNBA 1CXHA 2EH7L 2H8PB 1CS6A 4HULB 4MA1C 5ACZB 4UB0L 2BSTB 1DR9A 1HWHB 4OLYH 1QSFB 2VABB 3QEQA 4G42B 1B0WA 2BVYA 4OZHA 4EIGB 3KXFD 3FQNA 3VFGH 1JZ7A 3OR6A 3VH8A 1FYHB 5GHWH 4JDTL 2XI9A 2P4AB 4N68A 4NM4L 3GSOB 2NXYD 5FM4A 1FBIH 3LVEA 4Z7OE 1BMGA 1CL7L 3BKYL 3FN0L 1VGEH 3GEWB 4QT5A 1EMTL 3JV4B 3C60B 1HEZA 4OB5L 4ZQKA 3TCLB 3WE6A 1HWGB 3WNKA 4IIQB 4QHNA 1ONQA 4XAKE 1IVLA 1BVKB 3H0TB 2BRQA 5TGBA 4X6DF 4GKOA 2AGJH 3UCRA 2YRLA 5J13B 4I0KA 5E2WH 3BMVA 2DD8H 3TNNA 2Y36L 4I1NB 1UXSA 2QQNL 3O3BA 3S9DB 2C3HA 4Y5XB 5HHQA 1NL0H 3TO4D 4YDVA 4LLWB 5FHBL 4NO0D 3SDCB 1UG9A 3L3IA 3VGFA 4O5LH 4ENEC 5DO2D 1IM9D 4LSPH 3WO4C 1U3HA 4JKPH 3VFRA 1NANI 4AQOA 3UX9B 2D31A 4X4XB 2C4XA 2WIIB 5KAQF 3MV8E 2R8SL 3WIHA 5IHUL 4P5TC 1QR1B 1WZ1H 4QGTA 4Q6IB 5IF0A 5E6ID 4LHUG 1ES0B 3P73B 4LCCC 1P9MC 5F7WC 2P49B 2P5ED 1EO5A 5JXEA 3TO2B 4L4TE 4YHKL 5EC1A 3OAYK 2QL1A 1T0PB 4XHJD 5EU4B 2LTQB 1AGDB 3D0VA 3TBWA 3T4AB 4QY8A 4ZFZB 3K81A 1GGTA 1W0VA 2CUHA 1XIWA 2VXQL 5B39A 1BVLB 3U7YH 2BVOB 5EU7E 5ESQA 4KMQA 1NBZA 4L3EE 1X5GA 1QRNA 4BFIB 2BXYA 1INEL 2MTPA 4U49A 1G0DA 5FO9B 2N56A 5T33H 3ZSTA 3RWIA 2UUDK 4KUCF 4G9FE 1AY1H 1WTLA 4PLOB 5C2BH 3RUGF 2HH0L 4HGWB 4Y4HC 5C07A 2F8OA 4O2EA 1PDKA 1TTGA 4FNLL 1RUML 3S34H 4HFWB 3QCVH 4ODVH 1GHFL 1F3DJ 4F7MB 4E41A 3TBSA 4YPGB 3HE6D 4XX1E 3CFKA 4GAJL 1BBJA 3VXMD 1R5VA 1TXKA 1AIFB 3X13B 1S8DA 1V3KA 1SBSH 1CDIA 1TJGL 3RL1A 4DW2L 2A6IB 2DI9A 1OW0A 2NX5B 2R39A 5T3XH 1JNHB 4HT1L 4RWYH 2O61A 2ICCA 2ICEA 5CBEA 5F7MC 4BKLA 3NCBB 3TN0D 3VXQA 1OAKL 1AGFB 4C83B 1QKZL 4YHLH 5IMLA 3KYNA 4F3FA 4LLVB 2E8YA 4Z8FL 3O6KL 4JKKA 3ILPA 3DSFL 3T2QA 2WBWB 4HUVA 3IT8D 1UM6H 1G7IB 4YHIA 2KDGA 3H9SA 5F6IB 3V7AE 4Z7UE 4OBRA 4EEEA 3QFDB 3PV6A 3LQZA 1MEXL 1X5LA 2Q86B 1OTUD 5E7FA 1O7VA 5C6PB 1L0YA 1KIPA 5EOCH 4H8WL 4HJGB 1FE8L 2XXCB 3FONA 4N0RA 5C3TA 4D0CA 5I1LB 5SX5K 5I1EH 2Y7QB 4CVUA 3SBWA 1CXIA 4D9RE 4Y8AA 1CICC 3MBED 5DJ2B 5FAAA 1HYRC 1CLOL 1QP1A 3A6CH 5CEZE 1MHHA 1IAOA 1U95A 3IDUA 4OZIB 1G9EA 2OSLB 2NY0D 3I50L 5ILTL 5I8CB 1EHAA 1RIVL 1KELL 3BQUB 5CUSL 1E6JL 3LKPA 2V6HA 2G9HB 4XWGH 1UB6A 3BW9B 4X6CA 3T0AA 1K8DB 4GW1B 1MVUA 3W82A 1WK0A 5CEYB 2YD8A 1KGCD 2X4NA 2EDLA 1WGOA 5I74B 2Z8VC 3BDYH 5D1ZA 1HINH 5BV7L 2X7LA 4LVHB 3EZ8A 1VA9A 2IFFH 3BI9X 4LCUA 5DGRA 4PUBH 2FBJH 5F7HA 1KTLA 5F70A 2YPKB 2VYRE 1DSFL 5GGSB 4JG1L 1TLKA 3MRMB 4AG4H 5CILH 2GITA 4E9LA 4GAGH 3QDGB 4KRNA 5IW1B 4FQXA 3MGTB 5D7IB 3HRZA 1D5MA 1ZA6B 3TT1L 5KZCB 2AJ3B 3P0VL 4S1RL 1EHLH 1QFPA 1FGVH 3WXVL 2F5BL 5D2LE 3JV5A 2OXGA 1RK1A 1T7VA 2B0SH 2CIKA 1A2YB 1H3PL 2GJ6D 4L9LC 3PJSA 4EI5B 4QHKI 3AAZA 4M62L 1ORQA 3UTTB 5JW3L 43CAA 1OP5H 1BD2E 1DQQA 5B8CC 5C8JB 5AAWA 2Q8AH 3U7AA 4XHQA 3LN4A 4L8BB 3MLPA 1GIGH 1S78C 1UWXK 3IFOB 1CK0L 1G6RH 5KW9H 1HE7A 4K55A 1CZ8L 4POZD 5HVWA 5ICXB 1MJJA 2R2EA 5DTFB 3DOSA 2VXVL 1DLFL 5ICYB 1KIQA 5DLMH 3ARDA 4QCIA 1S3KH 3O4OB 1BWMA 4I0PD 5ADPL 3I75A 4Y5VA 1OWRM 3EJZD 1JWSB 1OTSC 3DYOA 3SE9L 5FM5O 3HR6A 4OV5B 5E9DE 4P99A 1X7QA 2VLME 3QI9C 4KTDH 4BUGA 4PB0L 5CIPA 2BOBA 1VPOH 2APBA 3O0RL 1AO7D 2XTJC 4WWKB 4KJQD 1XF3A 2FGWL 1A47A 4FQPA 4UQ2B 5KS9A 4NWUH 1NAKL 1M6OB 3DX9A 3MTRA 3V52H 2VDRL 5IBLD 1FNEB 4XAWL 2IPTH 3ISWA 3RGVB 2KL6A 3FHQA 3N85H 4IRZL 3F8UB 4NRXA 4MJ2A 1A6VL 5EDXA 2NY1D 3PWPE 1RUQH 2FGZA 3D39A 4QXTA 1ETZA 1F02I 5JR1L 3BPOC 4M48H 4X6FB 1FAIL 2J8UB 2ARJQ 3WFZA 2PNDA 5F8QC 2CRZA 1RZFH 4W68A 4I8DA 4ZUWA 3ZYOA 3MRRA 1D6VL 3ARFA 1DBAH 3KLDA 3JVGC 1KTDB 4U33A 4DUXA 4XVSL 3CXDH 5IR1A 5MERA 2E7HA 1FIGL 4YX2H 4Y4KB 3B4NA 4UBDC 4BFBD 1QNZH 2DIJA 4OF6A 2J5LC 1KC5L 1R3HA 2ZUVA 3BESR 3EYSH 4PGBB 4B5EA 1G7LB 5F7NC 3V5HB 2GJZA 5TDPA 3C60C 4OSUH 3C5SB 4MJ6A 5EWIH 3V0VB 3MLXL 2HT3D 1ZA3A 3BH8B 1BP3B 3ROOB 2YSSB 3QO0A 1JWUB 5I16A 4JJHA 4NRZA 4P3CL 5H8DA 1LO5B 2DQJH 5J13C 3UBXG 3OHXA 3ARPA 4NC0B 2D7OA 4PR5B 1UKQA 4NQEA 3DTXA 1MFAL 1ZVYA 3HR5B 5C08B 2Z4QB 2CGRH 4UV4H 1QSZA 1A64A 4PGDA 3SDCC 2A0LC 1CFVH 5I66B 4YHPB 1OQXA 4HWEH 3UJIL 3F58H 1JMXA 5HD8D 3H8NA 1BFOA 4NHUB 4ZS6C 2BC4A 4JCMA 3T65A 3ARGD 5ADOH 4XNZB 3BP5B 1BF2A 4L1DA 4BFEA 2XZAL 3DBXA 2EXYC 1WFNA 4R90L 2X4TB 3IS1X 4OJFH 2E5EA 2NCMA 3SY0A 4ELKB 1QR4A 4JY5H 3CH1B 3N9GL 5AZ2L 1ZHBA 2KKQA 1U91B 3UZEA 4DZBA 3QIBD 4JEGB 4KHXL 1KNOA 1I7RA 1T7YA 4Q9RH 1IRAY 4LKCA 5JO5B 4MXQC 4XPHH 2VDQL 4H0GA 1A6UH 2ADGB 3AY4C 3QPQD 4MQTB 4P5MA 4R7DB 1YEGL 3CFCL 1Q0XL 1J0IA 3CLEH 5EO9B 3WFCL 4I2XB 2PKDA 3RGHA 4KROC 1A1OA 2DQFA 2B1HL 2WUCH 3CIQA 4JFQB 5LGHH 2R23B 3CFDB 4XCFL 5LXGH 2ZCKL 4JLRB 3MLZL 4R8WL 4Z7UF 3RP1A 5EORH 5BXFB 1BQSA 5GGQH 5FCSH 4JANA 3HG1E 1UACH 1BQHB 2IBGA 4JFPB 2EH7H 4NKIL 4JRYD 2VDNH 1JHTA 2A9ML 1ZHNB 4WTWA 2VKWA 3PABA 4UB0H 1JFQL 5D7LB 2Y6SC 2Z91A 3I9GL 1NFKA 4NKDA 5E1HB 3PE9A 2BY3A 2CDEA 3VXOB 5F3BA 5F89A 5MEOB 1P6AB 4IM8A 4G6AC 3BZ4B 5DRNA 3FN3A 3MLTB 3SO3B 1UM4L 3VFPB 3CZFA 2Z35B 1NKRA 1CL7H 2ZOKB 4LEOB 4F15C 1FFPA 4P2RD 1WBXA 4OZ4A 3FN0H 2VUYA 1TCRB 1EMTH 4PD4J 2VLKA 4MJIA 4QHLA 1QFWL 4KUZL 4B50A 4FXGB 4NKMA 4MAYB 4F33A 1BEYL 4PBWD 1Q9KB 1UZ6E 2WQRA 3HG1A 3ARVA 3U0TA 5DD0L 1Q9OA 2GY7B 4G7YL 1F4WL 1H5BB 3MXWH 2GUOB 3AU1A 4OD3H 4KJYA 3M8OL 3F7VB 2FB4L 5C9JA 2GSGA 3WLBB 4M6ML 2PTTA 1KULA 2H41A 1AD9A 1UZ8B 1K6QL 2OTWA 4APQD 2DMBA 2V7HA 3V6FA 4JQVC 5M94B 1L7IL 2HWZL 3B2VL 5CWSA 2ITCA 3S3JA 1FSKB 3LKNB 3B9VA 4GXUN 4ORGB 3ZT5A 2H2SD 4WGWB 1NSNL 3O2DA 5D2LF 2R8SH 1DEDA 4XCYB 5IHUH 4JPVL 1VERA 4S2SB 3BQUC 3BIKA 4XVTL 3O45A 1MUJA 2FYYB 4BSVA 1ZGLM 4RGNB 4ELMA 1QVOA 5IVNA 1B6DA 4YHKH 2LVEA 4LLMA 3R4DA 4JB9L 4ETYA 2UZIL 5KG9B 5E8OA 3KPRB 4WEUD 1AXSB 1U93B 5FOBB 7FABL 3MRJB 2O5XL 2VXQH 4Z95L 1U8PA 1VACA 3ES6B 1MFDL 4KI1A 2CUIA 3T0BA 4E5XA 5GGTH 3DSNA 1GXEA 4KK8C 1NC4B 3QO1A 5DJYA 1IL1A 2BDNL 3OKDB 4F58L 4NC2B 2O5YL 3QDHA 1JP5A 1WFOA 1AHWC 1EK3A 1H0DA 3Q48A 2NY4B 4I18C 5E94A 1LO0H 4LPUA 3QULA 5BZWA 4ZOAA 3IU3B 3NCJL 4J3SA 2YXFA 2Z31D 3E3QE 3U9UB 5FYJE 4YQXL 3PP3K 4JY4B 4NQCB 5HHOE 2HH0H 1FAKT 3IJHA 2F5AL 1NGPH 2Y4SA 3BEVB 4G8FA 1RUMH 4QLRA 5EU3B 4TOYL 4EDXB 4F37K 2HTLC 4XPTL 1JYWA 5D1QD 5I1IL 3U9PL 3TT3H 4L9DA 5I8EA 4NC1C 1J8HD 1TJGH 4WTXA 4DEPB 4DW2H 5F9DC 4MD4A 2MCPL 1A7RL 4XMLL 1A9EA 4QYOA 1AD0A 3VXPA 2RFXA 4DWHA 3ABZA 3K2UL 5T1KB 1YN7A 1AP2B 2C3VA 1OAKH 4GRLA 5IT2L 1QKZH 1I7TB 3LMJH 3A67L 3STLA 3DSFH 3SDAB 2RCSL 4QWWC 3TBTA 3M17A 2X4PB 1HHJB 3OF6A 1A14L 5E5UB 3DVGB 5L2KA 4C57C 4L4JA 5D7JC 5H37H 4H8WH 1FE8H 3OB0K 5JIHA 1IAIM 4WWKC 5C0CB 5F1NB 1E28A 4R7NA 2R4RL 5KVDH 4CRPA 1MQKH 4HCRL 1CU4L 2IPUG 2MWCA 1CLOH 4G8IA 1M7DB 2ZWLT 1WBYB 4ODUA 3V4PL 4YDLC 3RGVC 1SYSB 5ILTH 3I50H 5C09E 2EE3A 5IW6A 2V5SA 1RIVH 1KELH 5CUSH 5EUOB 1E6JH 1EGJL 4WO4B 1ERNA 4N9GA 3PIQA 3WJJC 3N1MC 3MZGB 1P7KB 2UZYB 1U3HD 1JF5A 2J4WL 4L4VA 2AKRA 2M8XA 3VFWA 1XGRA 2M2DA 1NGYB 4EUPB 1T1ZA 4I0CC 4YR6B 3WL9B 4Q0XH 2EXWC 3GRWH 4J8RA 2ORBH 3L95A 3CSPA 2ZPKL 3DXAA 4JG1H 4YEFA 4PV8A 8CGTA 5BRZB 1XF4A 5JXED 3STZA 5IJVA 1BOGB 2CR6A 3EYQD 5LCVL 3FB6A 4NKOA 5KSVB 4FQ2L 3LPWA 4Y4KC 1S9XB 5E5RB 3T0EB 5ICZA 3TT1H 3FT3A 3S97C 1BFVL 3QXUA 4K3EH 1ZT7A 5GZND 3P0VH 4PGZA 1IM3B 2R0KH 1XIWD 3D3VE 3P4OB 2F5BH 4F9LC 5GRJL 1YMHB 2CRYA 4OFPA 3L7EA 1S5IL 1FDLL 1H3PH 4UTBL 3RA7L 4UINL 4OCXH 5B38G 2AERT 4MCZB 3MV8D 4M62H 5L6YL 3OG4B 1X4YA 5IVXE 1BIIA 2HJLA 4G6ML 5JIIA 2X4SA 5HHVL 3CGTA 5TJWK 4KKNA 4U6XA 3BPNC 5MEPA 3V0WL 4CJ0A 12E8L 5C07D 5KSBE 1YY8B 4P5TA 3P2TA 1BJ1J 1FYTE 3L5WA 3VXTB 4LCCA 1P9MA 4K3JH 4K2UL 1DLFH 2XA3A 1KJVB 4WW1A 3GSNL 2CD0A 5D96C 3WS3A 3DROB 1KYOJ 3FL7A 1KPVA 4X6BB 4ONOA 3IU4L 3X3GL 3T1FB 4LPWA 2ZSWA 3SKNA 1A7BA 3VRJA 4DGYL 3VWKB 1X5KA 5IVXA 3EW3B 4GMTL 1I3GL 1ZT4B 3BP6A 1HI6B 3O0RH 1RD6A 4C58B 5E00B 1RZJC 3EO1A 5BZDB 3BE1L 4HZAA 1NAKH 1OPGL 4WY7L 5HHMB 4ZOBA 5E6ZA 1I9JL 1DP0A 1EDQA 4XBGB 2VDRH 3KJ4C 4P3DB 2XN9B 3TP4A 3BAEH 4H1LB 5HTSA 5K9QG 3RZCC 2VLJE 2XKNA 4MNHB 5DJ0A 1A6VH 5MENB 1I8MB 2J2ZA 3PHQA 4HS6A 4Y4HA 3TH3T 1GZQA 1IBGL 1DE4A 4YGAB 2CKBB 2AXGA 3WN5C 4CVXB 5I73B 1QA9B 2VITB 1MQ8A 2HLAB 3QUXD 4MVBC 3MCLL 1KJMB 3IAPA 4HK0A 4PJXB 1Q94A 4KXZI 4I9WE 4IRSC 4LKXB 4DVBA 2PW1A 3IRZA 1PG7W 3DX7B 4XCEA 3ROLB 1JJUA 4X99B 1U8IA 4PJIE 4XPGL 1D6VH 3H9ZA 2FJGB 1AI1L 4D9LL 5EA0L 4I3RH 4XVSH 1UVQB 4KK5C 2Q7YA 1FIGH 5D1ZD 1XR8B 4OQTL 4R6UA 1JNNL 5C0BB 3KPQA 5FF6B 5AG9A 4WWID 1UADC 1OLZA 1KC5H 5J1AA 3TVMA 4JG0L 4Z5RA 4CAGA 1DUZB 4HKJA 4D9RD 3MLYL 1M71A 3MLXH 1CYGA 1SMAA 3HB3C 3TM6A 3P9LB 4QTHA 1NAMH 2FH8A 4UU9B 4XRCA 2EIBA 1IGJA 1BQUA 3TESA 4KKLD 4P3CH 1QACA 5CEZD 2YUZA 3DUUA 4U7KA 1LDPL 2ICWI 4KV5E 4Y16A 2HFTA 4FQXD 3ARQA 2EDNA 2Z93A 2W9DL 5A3ID 1CICA 1MFAH 4HPOL 2XA8L 5E8EA 1T1WB 4Y88A 2IJ0C 3FB8B 5F96H 1GPOL 4Z76A 3F6LA 4LIQL 2FECI 4JN2A 2DL2A 3MRHA 2CK2A 3VXUE 4B0MM 3FRPA 4LPTA 5HXMA 1CXEA 4NBYB 3Q1SL 5DRZA 3IRPX 2BZDA 4XI5C 4AT6A 3QUML 5KVMC 1Z9MA 3BDXA 2JB5L 4LLUB 1DDHA 5TE4L 2FEDC 4PYHA 1U8QB 3JZ7A 1UEMA 4PJGE 1VEOA 4GAYA 1Q8MA 3OGCA 3FFCE 4YWGL 3MR9A 3CUPA 3SJVA 4R90H 2UWEF 2ED8A 3EJYC 3JSSA 4NO3A 2GT9A 4D9QD 3GSQA 2CIIA 3BZFB 4HC1H 4PTUA 2X4RB 1CFTB 4G7VH 3TYFB 3N9GH 5AZ2H 2ZUQC 4HFUH 5EZLB 4NUJA 1J0YA 1T21B 3MRGA 2VDQH 5DFWH 1P4IL 1FZOA 4NQVA 5GRVL 2PYEB 1LE5A 3VD3A 5GS0C 1ZK9A 3C6LD 1U8NB 2OL3B 4PJ8B 1OSZB 1YEGH 3CFCH 1N26A 1Q0XH 2XPGA 2IEPA 4JO3H 3HI5H 3WFCH 2F19L 1OP5K 3RVXC 4OD1L 3QZWB 4MDIB 3NIGF 2B1HH 1ZXQA 2KPNA 4JFOB 1QFOA 3S5LB 5E99L 1BD2D 4R0LB 4XCFH 2ZCKH 2NY4C 3RWFB 5ITFB 4R8WH 3FOLA 4DAGL 2AK4E 4L9LA 5EBMA 5J11B 2V5RA 3W5NA 1U8MA 2YEZA 4NKIH 3QUYB 1PKQE 1HIML 2A9MH 1JE6A 5B8CA 3QT2A 4JZNA 5JORA 4MCYA 2D03L 4PRHE 5HI3C 4WW2F 4MD5A 3V5DA 3C9NB 4ODBD 1UM4H 3ZKXB 5DMKB 2BVTA 4X5XA 1NC2A 1JYXA 4UMGA 1J87A 3MUGB 1SQ2N 1E4KC 2IH3A 1N4XL 4GXVH 4P5KA 2UZXB 3PDGA 1I9EA 4IJ3C 2P8MB 1MCPL 1WZMA 2AK4A 1BEYH 1IAIL 4PJAA 3MRPB 1XF1A 4Z7VE 4XNQB 5AWNH 3ARFD 5DD0H 4WDIB 5DMGC 3SDAC 3U0PB 3QI9A 1UM5H 4ONGL 2FB4H 4K9EC 1A02N 4U1GB 4GKSA 1FO0L 1QSFE 4M6MH 4OFKA 3PWPD 1B88A 1T5WA 1K6QH 4XNXL 3WD5L 3BRDA 3W81A 4RFNC 5CP7B 3RVTC 3AREB 1L7IH 2HWZH 2BVPA 4AEHH 3ARUA 3B2VH 4HX1B 1WJ3A 2EKJA 4LSSL 3SPVB 3TBYB 3U2SA 3WDIA 1NSNH 2ZG2A 5B39G 2BY0A 4JPVH 5I9QC 4XVTH 4OLWL 2H2PD 5F71A 1DQML 1NMBL 4X80H 4MX7B 4M7LL 1EFXB 5LG1A 1JGVL 4JB9H 1T04A 2UZIH 4Z77B 1X9QA 2VABA 3EYUL 1SJEB 4G42A 4Z7NE 5K9OB 3JVGA 1RVFL 4ZXBC 1LK3H 2O5XH 2XNAB 1A3QA 1D9KC 2DIAA 4Z95H 5KSBF 1A3LL 1I8LC 1T3FA 1YEJH 2MMXA 1LO2L 1MFDH 3WFDH 3GSOA 4K7FB 5DHVA 1CE1H 3LD8C 1JPSL 3LDBB 4YIQB 2BDNH 3C60A 4F58H 3J7HA 2O5YH 3TCLA 3Q5YA 3BD4A 3RHWK 1FVEA 2BSED 5B3NA 5FYKD 4PYGA 3GMRB 4MS8D 3MREA 3H0TA 4PG2C 1JWMA 3TPUA 4G5ZH 4YQXH 3KWWA 5BCAA 5E6YA 2H6PA 3IDNB 2F5AH 3OJDB 2ATKB 5D9SB 4TOYH 3RTQB 4TTDD 3DETD 4XPTH 2B2XL 4MGXA 5GS2D 3SDCA 2YD1A 1HNFA 4JFXA 4OF0A 5I1IH 1EUUA 4JHAH 4U6VH 4N90D 1ZVSB 4NFDA 3OKEB 3L3KB 4P2OD 1T7ZA 2A9NL 4QXGH 4X4XA 2DWDB 2RIKA 1CGSL 2MCPH 1A7RH 3AS1A 4XMLH 5AYUH 2CJUH 3THML 5ANMA 4Q6IA 4MJ4A 1A1NB 1ES0A 3P73A 4U2YA 5IT2H 3A67H 3FRUA 4JRXB 2NQCA 2NTSP 3C5ZC 3TO2A 1YQVL 2RCSH 3QPXL 3GGWB 5EU4A 3RWDA 4XXCC 1S9YB 4KHTL 3WIIL 2FBOJ 3T4AA 1DQLL 2FEEI 4PJIF 1BVLA 2VLKD 1B4JH 4MJID 2BVOA 3AY4A 1WT5C 3TGXA 2VLLB 3HG1D 4F7EB 2R4RH 1U3YA 2NX5E 1CU4H 4WHCA 2X9WA 5FO9A 5CEXB 1WAAF 3JWDC 3JXAA 3V4PH 1F00I 2JE8A 3LKOA 1HNGA 2AK1H 4RGOL 3ZO0A 3NA4A 5IFJB 2ICWA 5BV7C 1EGJH 2CO6B 3GI9L 3IF1A 1EEQA 2NY2B 3LKRB 3BPCA 2UV3A 3H7BB 1CLCA 2XWTB 4F7MA 4MB4A 2J4WH 3C5JA 2YK1L 1K2DA 2JCCF 2HFFB 3KAAA 4YPGA 5DURD 4UT7H 3DMMD 3L5JA 4M1CC 5GJSL 4WEBL 2I07A 3UTPD 4LK4A 2A6IA 1OP3H 1BLNB 5HGHB 1AKJA 3U79A 2ZPKH 5T1DL 3F7QA 5LCVH 2NY6B 3TZVB 2D2OA 4PJGF 1L7TL 4FQ2H 3VGAB 4OZIE 1AGFA 3V7MA 4C83A 4LLVA 4S1DD 2GHWB 1BFVH 4GG8A 1B0GB 4ONHA 4Y2OA 2VDOH 1HXYA 5GRJH 1K3ZA 1YC8A 4PJEA 1A6ZB 4JHZA 3SCMC 4UTBH 2Q86A 3RA7H 3AS3A 1HH9A 1MCLA 3UC0L 3IFNL 1UJ3B 4TN9A 3TA3B 5L6YH 4HJGA 1G6VK 1Q1JL 3K1DA 5TE6L 5I1LA 3S8WA 2Y7QA 1OAXH 3W39B 4QHUB 5JMOC 5DR5H 3OKNB 5F7UA 4WFFD 5L9DL 4WI7A 5HHVH 4OLXL 2NNAA 2PR4L 4JREC 3V0WH 3GNML 4POYA 3QDGE 3G6AB 3BH9B 2OSLA 4XPFH 4GG6F 5I8CA 3IDJB 4N1CA 3BQUA 3Q2CA 4KQ4L 4UDUB 3WNLA 5JZ7C 2VO5A 4XGZB 3BW9A 1FG9C 3P30L 3PP4L 4GW1A 4K2UH 5HDQH 2X89A 2VERN 4XVJH 4FQQB 5CEYA 3GSNH 4LBEA 5JPMA 1KG0B 5ALBH 1VKXB 2ICES 3LIZH 4V1DB 5EZJA 1SMOA 1C1EH 1DVFB 1UCTA 4KK6D 3VFSB 4PRDB 4Y1AB 5E2JA 3X3GH 5T1MB 5JNYB 1MLBB 1AR1C 3INUL 3S4SB 3U1SL 3HNVL 4GRLD 5FUCC 4NNXB 4GMTH 5GGSA 1I3GH 1MCIA 2VR9A 1GZPB 2EKSA 3BE1H 3MRMA 5MP6L 1OPGH 4WY7H 3P11L 1U8HB 1JGDA 2WUBL 2JK5A 1AHWA 3WFHA 4JZOA 4JM2B 2IANA 5D7IA 2X1QA 1MJUL 3HNSH 4I18A 2XZCL 2OI9B 5HBBA 3OF6D 4RGMB 2AJ3A 1JGUH 5L2KD 1NUGA 2FX9L 4KJWC 4QXUL 4Q7DA 3ZYZA 3T3ME 1T03L 2BXZA 4U1JB 5IBTH 4DQOL 2WV3A 4UV7L 4NRYB 4QO1A 2HVKA 4U1KB 3CK0L 3BFOA 3PWVB 4KI5E 3IXAB 3QUYC 3UTTA 4Q9QH 5GS1B 3MCLH 4TNVF 4G9DA 4M9PA 3TIEB 4P46D 3MJGX 1BAFL 3NFPB 3IFOA 4XPGH 4DZ8B 4HPYH 5F7FA 1UQSA 3FJTA 4RMTA 1TMCB 2NW3B 3KDMA 4ZODA 5EA0H 5ICXA 4U3XA 4ZPVB 5EU5A 4X9HA 3O6FB 4OQTH 4FQJL 1JNNH 4S0TD 5E4EC 4DJMA 4WFEE 5ICYA 4JG0H 4ISVA 4WJ5B 1IKNC 1RJLB 2CLZA 1I9RL 3MZTA 1PYWB 1JWSA 1NPUA 1UGNA 1IGIL 1NGZA 3MO1B 3FO1B 4M03A 4IS6A 3DXAD 1I7ZA 5EIQA 5D7JA 2GW5A 5CEZL 2OR7A 1R24B 5DD6A 3O4LB 1LDPH 4OZGA 2E6PA 4O58L 4U1GC 3PL6B 3EDFA 2NLJA 5I8OH 2W9DH 4WWKA 1DZBA 2HT4D 2XA8H 4PG9A 4P9HL 3MNZB 3X11B 4RQQB 1M6OA 3U46A 4LSUL 1XR9A 3NZHL 1GPOH 1PLGH 4LIQH 1FNEA 5C0EA 4XP4L 3U36B 3QIWD 1CL7I 5C0DB 3RGVA 1NCUA 4QHMB 3Q1SH 1NLBL 1W0WB 4TSBL 5IHLB 5LQBL 3LSOB 4HWZB 1DQJA 3QUMH 1DN0B 2W07A 1JL8A 3WJJA 5INDB 2AAVA 1T0MA 1YZZA 3AS2A 1A6AB 43C9B 4YHML 2YPVL 3BUYB 5FK9B 4YWGH 1MCBA 4ZFFB 1NMAH 4X6FA 1WIPA 4PB9L 3KHQA 2J8UA 4HUNB 1JPFB 4GMSL 2IAMB 4P5TD 1JF1A 3B3IB 2NTFA 5DRWB 1N6VA 3FQWA 1Y0LA 2ESVB 5C08E 2GI7A 1KTDA 3AROA 5C0RL 1P4IH 2FO4B 5A1AA 2QQKL 4Y4KA 2P24A 4JO2H 4KMTH 3D18B 3LEXA 4PRAB 3UDWC 1NUDA 2DLIA 4OF8A 5HY9A 1NMCB 2F19H 4X6EB 2DRUA 2W0FB 3C5SA 5DQDL 5D7KE 5E99H 4F9LA 3NCFB 3V0VA 1XGTB 1CTOA 1CVSC 1HCVA 4GRWH 5HGAB 2YSSA 1JWUA 4X98A 3UAJD 5HVHC 1LO5A 4EI6B 2P5WB 1NH6A 4JDVB 1HIMH 4PR5A 2DI8A 3T2NL 4M93C 3HR5A 1RJYB 2WSKA 4UILH 5H35B 3RIFF 1HQ4B 3BEWB 4Y4HD 1U8JB 5I66A 4YHPA 3RKPA 5HDLA 5HYSB 4I2XE 3ZTJG 1T22B 5A2LH 3VE0A 3MACH 4HWBL 4P23B 3BP5A 3VU2A 4OCSL 1KCUH 1MCPH 5F9JB 1IAIH 3BJ91 1F3JA 3GUTA 4W70A 1J8KA 2GCYB 5SWSB 5DC9B 5DGQA 3VGHA 3TO4C 3CH1A 4ONGH 2VLJD 5DO2C 3SDDB 5D70L 5JO5A 5FB8B 3TVMD 3KR3L 3WD5H 4XNXH 1NGXB 1HHGB 1NCAH 1LNUA 4MA3B 5LGJB 1CDBA 5I1AB 4R7DA 3IVKB 3RZCA 1A22B 5EO9A 4XCNB 5A40E 4F7PA 3Q5OA 4X4ME 3UPAA 1EXUB 4LSSH 2R23A 5DUBB 3CFDA 2C1OB 1E6OL 4Y16D 5CGMA 3V0AC 4ZPTB 4JLRA 2LAAA 4NNYB 4XHJC 4ZFOA 1CICD 5EULV 4GSDL 5BXFA 3WN5A 5I15L 4OLWH 35C8L 3FMGL 3QDJB 4JFPA 1FVDB 2NY2C 4Y7MA 4GKZA 5C9KA 1RSFA 5GGSY 4LOUC 1DQMH 1ZHNA 1FZMB 3NFSL 1NMBH 5D7LA 4M7LH 5DF0A 1LD9B 1JGVH 4U1NA 5DYOA 4Y89A 5GQBA 1TZGL 3RPIB 3VXOA 1RVFH 4UOJA 5GISL 3H3KA 1M7IB 4M61B 4D0DA 5HHNB 2R1XB 4XVUD 2M1KA 3MLTA 1A3LH 3DV6A 5CMAA 4M7ZC 5TDOB 1T66C 1N6QH 2ZOKA 1EVUA 4LEOA 4X6CF 4M6AA 1TCRA 4AL8L 2YA0A 3TZVC 4DCQB 5FA4B 1X5XA 2L7UA 4FXGA 5IMKB 1Q9KA 5FYKL 3GSVB 1P5VA 4HIHB 2FD6L 4PLKC 5AZEL 4DGIL 4RGNE 4EIZC 3QFJB 3G04B 5L7XL 4PJDB 3F7VA 3HE6C 5F8RC 2QSQA 4HJJH 4YE4L 1YYML 4HDIB 1CIDA 2V5YA 3KPRE 1UZ8A 3TA3C 2DDQL 3MOBL 3BP4B 1INQB 4M3KB 4O2FB 1EEUA 3C09B 3TN0C 2R1YA 1G7MB 4M7KL 1F2QA 5J3HD 3S35X 2A9NH 1KB9J 1LK2B 3STBA 3HAEB 1NBVH 1CGSH 1CDJA 1VESA 1Z6JT 2OTUB 2MQCA 2BP3A 5IGXL 4XCYA 3WDJA 3T3MF 4KK9D 3THMH 2VZSA 1TZIB 4S2SA 3SDXE 4HLJA 5FECB 1HSAB 5T1LB 3F12B 3FT4B 5J06A 5HJ3A 1S78D 3HS0A 1FO0B 5LVEA 3HC4L 3W11C 4KI5F 2P44B 3A6BL 1YQVH 4IOSD 4K23H 3QPXH 2VN4A 1C7SA 2VXSL 2VLRB 4E0RB 4KHTH 3MRCB 1DVFC 3OZ9L 3WIIH 1AXSA 3VXNA 1U93A 1DQLH 5FOBA 3ZDZE 3MBEC 3MRJA 2B39A 3PDOB 2W92A 4M3JA 3ES6A 1LP9B 2AK4D 5E08L 1NC4A 2DM2A 2NY0C 4Y0GA 3OKDA 2VDLL 4RA0C 5FDYA 2OMBA 5A2KH 3NGBB 5CHNB 4JM2C 5JHDB 5SWZE 4X4ZA 2OJEB 2OI9C 2I60L 1LVEA 3MUHL 4RGOH 3GI9H 3U9UA 3JTTA 4JY4A 4NQCA 4YNYA 2EIZB 1IEAB 4LAJH 1KLGB 4OLZL 2ADJA 1OGAE 2R0WL 1MH5A 4KVNL 4WV1C 3S35L 4ZTOH 1GAFL 4GBXC 5EU3A 2R29L 1L4IA 1KT2B 2I9LA 3QA3B 5F7LB 1IAKB 4KTYA 3BVNB 4LCWB 3UTSB 4W6WB 1C08A 2EDFA 3O2DL 4NWTL 3WIHH 3M45A 4WEBH 1MRDH 4HIEA 5GJSH 4XTRC 5GSRB 4HF5H 1G1CA 1MFBH 2YD6A 4G8EB 4ZUVA 4L5FL 5C0CE 4PJ5B 2R2CA 5DFVD 5DXWA 5CJBA 5T1DH 2VE6A 1E4KA 3WUWG 3S98A 4GQ9L 4ZNCD 2PW2B 1L7TH 4RMRA 3G08B 4PJBE 1QSFD 2BNUB 2V9QA 3G5YB 4WFHE 5EUOE 5IOPB 1MCEA 3QWOB 3SDAA 2B4CL 4X5WB 4Q2ZB 5E5MA 3IAQA 3X14B 4HIXL 4PJHB 3DO7B 1HHJA 1PFCA 1DBJL 2YOCA 3K4ZA 3U4BL 3DVGA 5I2IA 2AJVL 3GMPB 3TNMA 3UC0H 3C60D 3IFNH 4JZJB 3FKUS 4POZC 5TE6H 3VXRB 2DWEB 1JCKA 3OKYA 3T4YA 4WRLA 1KCKA 4WIQA 1DFBL 3KJ6L 4OLXH 1WEJL 1K3IA 2PR4H 1WBYA 1Y18A 1J5OH 3G6DL 3GNMH 4JGMA 1XF2B 4NDMB 5DHYB 1SYSA 4QRRB 2GAZA 4KQ4H 2N4IA 3T0EE 4LGSB 1DBBL 2VZ3A 3SHSA 3P30H 5JOFA 3PP4H 2YBRA 4GAFB 3SDCD 2QHRH 3T8XB 1P7KA 5J8OA 1X5FA 1WCQA 1NEZA 2Q6WB 4OKVB 3GK8H 4AZ8A 4OZFB 4HMEA 1WBZB 4ZXBA 4KJQC 2Y23A 4LF3A 4WEMB 3INUH 4EUPA 1D9KA 5IW3A 4P2QA 4CDHA 1I8LA 3GBNL 3U1SH 3WL9A 3HNVH 4ODHL 2R4SH 1P84J 3O3DB 4UIMB 5J56B 2EXYD 1OL0A 4XCCL 1XFPA 3D0LB 5BRZA 3OGOE 1BOGA 1KIRA 3MRIB 5TPWL 3P11H 1LEGB 2WUBH 4YAQA 5F7YC 3AXLB 5L8KB 2E9IA 3GZKA 1S9XA 2B5IB 3GI8L 4YDIH 1RJZB 3B9KB 4PG2A 4NN7B 4MXQD 1S9WB 1IM3A 3HZYA 1FCCA 1EEYB 1OP9A 3P4OA 4QXUH 2A1WL 5H94A 5C92A 4LASH 4L8SB 3KPLA 4DQOH 2JTDA 2OMNA 5F1SA 4UV7H 1I8KB 3HPLB 3PWLA 9CGTA 1IKFL 1D5XA 2D9QB 2DB8A 3G5ZB 1S9VB 2LQRA 2ATPB 3HZMA 4OTXH 5ACLA 5E95B 1BAFH 4WHDA 3DIFB 1P1ZA 4WI9A 3VA2C 1SEBA 5JW5A 3E6FB 5DK0B 3PGFL 3N0PB 3GBLA 4L8DA 1YY8A 1JZ2A 3P9WB 1AE6L 2XN9E 4WUUA 2BERA 4O4YL 5F6HI 3CC5B 2ADIB 4P4RB 3C5ZA 5MENE 4Z0XA 4G6AD 4Y4FB 3DROA 3WJLC 4P23C 1I9RH 1K4CA 4XXCA 3B5TA 3HN3A 3LCYA 4HUWB 2NX5D 3FRPG 4PGEA 5K59F 4PGJA 3IFLL 3BKML 3T1FA 4MMZC 5CEZH 4PJXE 3L3JA 5FUZH 4L4TB 4FP8L 4S10A 1WT5A 4JFFE 1X5AA 4P2YA 4O58H 2HG5A 3KYKL 1ZT4A 1NBYA 3MFFB 1HI6A 3SDDC 3GIVB 5E00A 5E2VH 5IB2B 5BZDA 4P9HH 4NPYA 4NP4L 5C0GA 4LSUH 5HD8C 1ROWA 2UY6A 2FLRT 4XP4H 5DWUH 3K74B 3VDBA 4OFIA 4JGUA 4MNHA 4K3GA 5LQBH 1XAUA 4TSBH 5C0BE 4L3EB 3QEUB 1QFWI 4IHOB 1XZ0A 3S88L 1OP3K 3MV7B 4KRPB 1M7XA 2ERJC 1RZKL 5J89A 3FO0H 2R2BB 4YHMH 2YPVH 2YUXA 4CVXA 1EEZB 1IGMH 1QA9A 2VITA 4G9FB 1U2CA 3VDCA 2HLAA 4PJXA 4PB9H 4BA8A 4GMSH 4UIKL 2ZZUT 3CDYA 4WFGE 3MOQA 1M05B 3BQUD 3ZHDA 2WINB 4X99A 4DTGL 1M4KA 1DQDL 3OXRB 4QOKB 5ENWB 2X89D 4P9ML 1CD1B 1MCFA 2A74B 3DWTA 3Q3GB 1UVQA 2P47B 2XY2A 3ULUE 3QHZH 1XR8A 2CK0L 4OAWB 2DQHL 3SDXF 5FF6A 3VD9A 4U1IA 1MAKA 1QHPA 3B2UC 4JHWH 2CDGB 4NQDB 5F7DB 2QSVA 3D69B 1WC7A 4ELMF 2BNQA 5EU6E 2W60A 2BCKA 2DQIH 5CIPH 1A4KB 2XXMB 4U1HB 1L6ZA 4KK8D 1YPZA 5E70A 3SCMA 1T1YA 2R0LL 4LRIC 3B5GA 5D6CB 3ZDZF 3QDGD 3LRSA 1BM3L 3EO0A 2IAND 1ZHKB 4UI2A 5E24E 2FLBT 4LCYA 4Z7UB 2A6JB 5FV2A 3T2NH 5KZCD 2ZUUA 2NYYD 1KBGL 3RFZC 1DBKL 2XWJB 4EOWL 4GW4A 3EOAB 2PYEE 1R3JA 3C09C 1AXIB 2C7UB 4LSDA 4ZUTB 4UQ3B 4EI5D 3BZDA 2HTLD 3MRLB 3N06B 3UTTD 5E8DL 3VGDA 1DBML 2H26B 4RAUB 4JQXC 1G0XA 4HWBH 4PRIB 2APWA 5BVJB 3T77B 5T3ZH 3CAFA 4KTEL 5INCB 4HJ0C 1CFTA 4LSVH 3HNTL 3ZMRA 4APQC 2HYMA 1QQDB 1CXFA 5D70H 1T21A 1H3XA 4OFYA 2VOTA 3LRGA 3NPSC 2C26A 4R3SB 1QBML 1U8NA 3BZEB 4EVNB 4PJ8A 1OSZA 4PJBF 3MNVA 1LDSA 1JZ6A 2W9EL 1C12A 3QZWA 4JFOA 2YPLA 3NGBC 1J7VR 5F1OB 5J1SC 1E6OH 3D1MC 3GB7A 4K94L 3RWFA 5ITFA 1TVBB 2HKHH 3ARTA 4WWKD 4GSDH 1S7VB 5I15H 3TBVB 4J23A 35C8H 3FMGH 4GRMB 5FXCH 1FFRA 3QUYA 3CPLB 2DLTA 4X7DC 5HVGB 3NFSH 3W0WA 2IPUK 2P45B 3RGVD 4M8QB 1ZT1B 4U1LB 1F4YH 4OI7A 1TZGH 2WIMA 4ORZC 3B9DA 1RZ7L 3O6LL 3O3UN 1CLZH 3IS0X 5FEBA 5GISH 3C9NA 2EC8A 5HHXH 1ND0A 4IBLT 1HK6A 4E42A 3GKWL 1G9NL 1LMKA 1OVZA 4K8RD 2ITDB 1E27B 3N1FC 4WI5A 5DQJA 2EDOA 3MUGA 1R3IH 2EDYA 5DUPL 3E1F1 1IKNA 3LQAH 2VR5A 4AL8H 1E4XL 1I1AB 5IQ9B 2P8MA 5HHPB 1J88A 3CZJA 5FYKH 3WMSA 2FD6H 1INDH 2BJML 5D71L 4WDIA 4DGIH 3U0PA 4BZ1L 4JN1L 1VFBB 4FOMA 4Y4KD 1CR9L 4K71C 4N8PA 4TYUA 3TH4T 2CXGA 2IMMA 1LO3L 3ALXA 4ZOCA 3W9EB 4DVRL 2AXFB 1S7SB 5E9DB 4LLYB 1BJMA 4JZJC 3DVNB 4P4KB 2DDQH 1BZ7B 3MOBH 5BVPH 5GS2H 2A73B 1CFQB 1E0OB 1ZWIB 4RIRB 1JN6A 3VWJB 1XGYH 4UNVA 4TRPH 4M7KH 4M7JL 3E2HC 3SPVA 1A7OL 3TBYA 1G9ML 4JFDB 3LZFL 1NEUA 4NT6A 3S96B 4Z7WB 5C08D 4CADA 2R9HD 3HC4H 4FFVC 4KAQL 4QEGA 4OD2A 1F6AB 5D7SH 3MRFB 2P8PB 5FO8A 2VXSH 1TPXB 3HZVA 4Z77A 3OZ9H 1I9IL 4X9GA 5K9OA 1BX2A 4PJ7A 4MNQB 3HI6L 1MELA 3OKLB 5ISZB 3GMOA 5E08H 3UDWA 3PUCA 1YYLL 4YIQA 2DQGL 2A6DB 2VDLH 3EGSB 3PGDB 4ZDHB 5JPNB 1URLA 2ZOLA 3IDGA 5EFIA 3GKZA 1IT9L 2FSEB 1U8OB 3WHE1 2DYPA 4U4BA 3GMRA 4FZ8L 4WI8A 5TDNB 3LB6D 5B22A 5J1TC 5EO0A 5CLWA 1PKOA 4LFHD 2OZ4A 1A21A 3KXFA 3VMNA 3IDNA 4Q9BA 4L8SC 3UYOD 3OAZH 4OLZH 2R0WH 3S35H 5FDWB 4QRTB 5D5ME 3ZKMC 4KPHL 4OI8A 3OTTA 2R29H 3LEYH 4PP1D 3DECA 1FC2D 3MGOB 4NN6B 2JJWA 3O2DH 4NWTH 5EOTB 3ORJA 3CVHL 3OKEA 1AGBB 3L3KA 2KBGA 3BYYA 4L3CA 4L5FH 4R2GB 3AVEA 1DQTA 2DWDA 1C7TA 4MVBD 5GZNC 3L6FB 1Z0MA 3PQYB 2FJHB 5D7LD 4GQ9H 4K3DL 4Q58C 3ULVE 4JRXA 3KLSA 5L8LB 2B4CH 4Y4FC 3TO4A 3BPLB 4D8PB 4NO0A 1CG9A 1CFNA 1DBJH 4Y19B 3U4BH 2Y25A 2AEQH 2AJVH 5T5NG 1HZHL 1MAML 2YA1A 1GC1C 4JY6B 2V5MA 4MAYD 3FTGB 3ULUF 3SGKC 3DRTB 3HB3D 3IXTA 2OBGA 4J3TA 3REVA 4OCRL 2I5YL 3KPOA 1WEJH 2G75B 2VJXA 3G6DH 4PJCE 2J12B 4LARH 2P5EA 5EU7C 4D3CL 3LOWA 4X8XA 4Y5YB 5F72S 1DBBH 3GM8A 1N8ZB 1RHHA 4UTAL 2BVQB 3MV9E 2V9RA 2YZ1A 5I30H 2O5ZL 5B4MD 2DBLL 4NNPH 2DTSA 2JJTA 3BJLA 1UKSA 2CLVB 1AH1A 1D5ZB 2FX7L 3HC0B 3GBNH 4TNVK 2GTZB 1RU9L 4RGND 4XCCH 2IQAA 5E2TL 3ME0A 4OM1H 3EYFB 1EBAA 1UJTA 5CJOL 3CD4A 2H1PL 5TPWH 3TZVA 4YDKL 5AD0B 4I77H 1YUHA 4MNGA 3BP7B 3KPRD 3KYOB 3GI8H 3I3DA 3CSYA 3FCTB 4L8CB 1B0GA 5C0IA 1CE6B 4NFCA 3UBXB 5GRXG 1AQKL 4ZSOB 2A1WH 3QUXC 5GS0D 3MUJA 4KWUA 3CDGA 3VXMA 4UUJB 1NC4D 1A6ZA 3DNKA 3QXAB 3T2PA 1FZJB 3RVXD 1IKFH 2AJZA 3OKOA 2X1WL 3RY6C 4Z78B 1D5BB 3TA3A 1YECH 3QRGL 3NA9L 5IVOA 1TVHB 2NY4D 3W39A 4QHUA 2QQQA 3G5VA 3TN0A 3HUJA 4RZCB 3VXSB 4HV8A 2Q87A 3G9VA 5CS7A 5E8NB 4NQCD 1OSPL 1TDQA 5IMOB 2BOCB 4G8GB 3BH9A 4PJFE 5CSGA 4AYFA 2VDPL 1AE6H 4UDUA 4BFGA 5EBWB 4FQHB 4XGZA 4O4YH 5IKCA 1ZLVH 2BRRL 3C87A 2P46B 4UNTA 2BNRB 2DQCL 2X70B 3IETA 5C0AB 4XZUA 2XFXB 4KKLC 3OKMB 1VKXA 4V1DA 2AJXL 2XICA 1QLRA 1DVFA 2Y07L 4QRPB 1UXWA 4LAQL 3IFLH 1EZVY 3AS0A 4P9HC 4PRDA 4Y1AA 3P77A 3MBEA 5T1MA 5JNYA 1MLBA 4HCRA 2H3NB 1JZ8A 5T1KD 1KACB 1GVIA 4FP8H 3CDCA 3FB7A 3EOBA 3OSKA 5DRXB 4AIZA 2FHCA 1XH3B 4NNXA 3KYKH 1V7ML 1KOAA 3Q6FB 4MQ7B 4NP4H 5DMGD 3SDAD 5I1DB 3GJEB 1U8HA 5DJ6B 4JM2A 4G43B 4YLQT 4LVOB 4KC3B 1S9KC 1GGBL 1JK8B 5IVZB 2XKUA 2YA2A 3HCVB 3R0NA 1IAII 3IAGC 4CW1B 4WV1A 1RZKH 5C0CD 1IGTB 4GBXA 1CVRA 3RY5A 5LAXA 3K3QA 4U1KA 4M6NL 5T3XE 3PWVA 3X12B 3IXAA 1A5FL 3GSXA 4XPAL 5HHOB 5DJCA 4HUXA 3O8XB 4UIKH 2DQEH 4OCMC 4V2CB 4WFHD 3NFPA 3C6LC 3H2WA 3HZKA 1KXQE 4DZ8A 2UWEB 1IAMA 5T5FL 4P9MH 2VDKL 4PTTB 1QO3B 3UTOA 3ZSSA 1OARL 3QNXB 1BECA 3I6GB 3RIFK 2CK0H 3J8F7 2DQHH 4FFZL 4ZXBD 4XB8A 3DVIA 5ID1B 5L0QC 4XNYL 1I1AC 3QCTL 1R5WA 3JTSB 3W9DB 2F53B 1P4BL 3WO3B 3MO1A 1H3TA 3EYOB 1YN6B 2BSSA 2R0LH 5BRZD 4U05A 3O4LA 3C2AL 1YMMB 2FJFA 3ECBB 1BM3H 3B9EA 3T0ED 3RAJL 1KBGH 4RQQA 2Z8SA 1OCWH 1V05A 1TFHA 1DBKH 5EZIL 5HGBB 1AGCA 2DMCA 4EOWH 5CJXA 5C0DA 4JHBA 2JLLA 3VWJC 1Z3GL 5BJTB 3LSOA 4QF1B 4WW2B 4JFZL 1H3GA 3EAKA 5HGDB 3LN5B 1MCRA 2DQTL 4OF7A 4ETQB 1F90L 2VN7A 4LFHG 4OFVA 1MLCA 2I9TA 4N8CL 4U0RB 5FK9A 5C0FB 5C09B 5D5MF 1EJOL 4OGXL 4ZFFA 3TFKD 2ZUYA 4Z9KB 1AO7A 4QRQA 4YK4B 1ZHLB 4KTEH 2P5WE 1JPFA 1OF2B 1AJ7H 1X5HA 5DRWA 3MOAL 2ESVA 2G60H 1Q72H 5CINH 4UZGA 3UYRL 3HMWH 1P7QB 5TH2B 3BYTA 3P0YL 4YHOL 4I0PB 1QBMH 3D18A 4PRAA 2BFVL 3L1OL 3ULVF 3MRBB 4X6EA 2CPCA 1NDMB 4G80B 2W0FA 3MA7B 3UZVB 3VWKD 5FHAL 4K94H 1XGTA 3CFEB 5HGAA 1U8KA 3X17A 3WFBH 5HHMD 4HHAB 4JDVA 5SWSE 2WP3T 3FQXB 3D3VB 2XN9D 2IH1B 1P4LA 2IADA 4ZG1A 5JHLH 4OQTA 2WWKT 5MEND 3O2VH 3O6LH 5H35A 1F4AA 3BGAA 4CMMB 3MV01 1U8JA 4PJCF 2D0HA 4J3UA 3GKWH 4O2CB 1J1OL 1UYWL 3IKKA 4R2GC 5HYSA 4K8RL 1TTFA 3SQOL 3MUY1 4MS8C 1FH5H 5DUPH 3VCLB 1Z0NA 3WJLA 4P23A 5KSBB 1E4XH 1YEHH 4M1GH 5B21A 1FYTB 1GJIA 4YGVA 1S7XB 4RCAA 2BJMH 3C2SA 3QDJE 3B8SA 4XT1C 1CDCA 4BZ1H 3HPJA 1CR9H 2COQA 2EO1A 1DANU 4BQ8A 3NN8B 5C0BD 1YNKL 3BGMB 3SDDA 1LO3H 4DVRH 1HH6A 4X6DA 3QUMA 4X9IA 4P2OC 3NOIA 3S36L 1KCLA 2AXHA 3ARBB 4MA3A 2F8XC 5I1AA 4J1UA 3HFMH 1TZHA 3FQRB 4XCNA 1QOKA 5HYQB 1EXUA 5IEKA 1K4DA 1CCZA 1F11B 1A7OH 3UTQB 5E7BA 4ZPTA 3LKSB 3TCXA 4NNYA 3CCHA 3K8KA 4AM0B 1TENA 3DJ9A 5F1IB 3GSUA 4PJEF 1ZLSL 1RIHL 4ERSH 1FZMA 3QFJE 3ULUD 4AY0A 4PJDE 4AENB 1YY9D 2A6KB 4KH2A 2OJZL 3OB8A 1RULL 4PV9B 1I9IH 1F4HA 4K3HA 3RPIA 3HI6H 3RWJB 3KYMB 2ADFL 1M7IA 1CD9B 4X8JA 2HJFB 2HTKC 4PJFF 4BH7B 4I48A 3H3PL 3U30B 1KYOK 1I1CA 1G0YR 1G1YA 1ZTXL 4CU8A 1YYLH 2XACC 4PJIB 4AEFA 3O3AB 2DQGH 4NQSA 1AR1D 1ZANL 2WLZA 5FA4A 4JO4L 1B0RB 3QR2A 1CXKA 2FIKB 1IT9H 1N0XH 5ERWA 4LRIA 4TUKL 3ARYA 2C3GA 4OFYD 2CXKA 2PYED 4LVEA 4IOIA 4YBQC 3DMMC 4PJ8D 2VLRE 4WU7B 4JO1L 2GK0B 2X4OA 1WTGT 2WBJB 4M5ZH 4HDIA 2ED7A 1Y6KR 3RUGA 5FGSA 2KH2B 2YPLD 4KJWD 1RJCA 4NO2B 1INQA 4O2FA 5E2UH 1W72B 1LP9E 1G7MA 5DFTA 2IALB 5DI8B 3OKKB 4GT7A 3HE7B 4IRJB 2JCCB 3QUYD 2V7NA 4PRPB 2B4CC 4JQXA 4I5BB 3VXUB 5JHDE 5T1LA 1S7TA 3FT4A 4K3DH 1FO0A 2DTML 4B53A 1I1YB 1HHHA 1KCRH 2XWBA 1MVFA 4X4YB 5KBNC 4F7TA 5ESVB 3E8UL 4APQA 5CJ5A 2FWOB 5DHVH 3FFCB 1VGKB 4LCWE 5FKAB 3UTSE 4PIRF 1HZHH 1MAMH 3PWUB 4PREB 3HLAA 1EA9C 2E6JA 1QFUL 1NEZG 1WLHA 1NLDL 4IEFB 4IDJL 1U3JA 3QQ3B 4YXKH 2ARJB 4DKEH 5JHDA 4EUPG 3G9AB 4OM0L 4D3CH 3EDDA 5CD3A 1ZS8B 3QJHB 4ZS7H 2EIZA 4UTAH 4KK6C 5JQHC 1MFNA 4DN3L 3ARED 1MCOH 1MI5E 1TCMA 4FQIL 4GG6B 3NAAH 4PJHE 2Q8BH 4C56E 4UOW1 1KT2A 1MY5A 4GRLC 1IAKA 3BRGC 3E3QC 2QLVB 4CN6A 4H0IA 3SOBL 4U0QB 3U48A 1PKQB 2AI0L 2FX7H 3ESUF 4DKAA 5GGRA 4JAMB 5GSRA 4G8EA 1T20A 4BSJA 4PJ5A 4PRHB 1NFDE 2P8LA 3RJQB 5E2TH 4MQXC 5CJOH 1JGEB 4YDKH 1RZ8A 2PW2A 4QRRE 2BNUA 7CGTA 5D2NB 3G5YA 5IOPA 3CFJB 2V2WB 4Q2ZA 1QLFA 5J6GB 1MCWM 3X14A 5GS0L 3QDME 4KZEH 5DJAB 5BOZG 4HXBH 3MRKB 4ZO8A 4P46C 2JIXB 4PLNC 3CJJA 4JZJA 4ZAKB 3IJSB 3F7PC 3RWEB 3QRGH 5ALCL 2QKIB 3NA9H 3VXRA 2DWEA 2W59A 5H37G 2GSIB 2DYPD 1PX4A 2GTWB 4XP5L 5TF1L 4OIIL 1EFQA 1N59B 3UPCA 1OSPH 3N1QC 1UB5B 4YH6A 1J0JA 2MOVA 1RURH 2VDPH 4O51B 5C6TL 3L5XL 2RAMA 4WW2C 1HYSD 2HJKB 1FC1A 3RTQD 2KUTA 2DQCH 2F74B 1MHPL 4OV6F 1R3KA 1QBLL 1VEPA 1MHCB 3I3EA 1BF8A 1N64L 2Q6WA 1I1FB 5EBLB 4Z7QE 5IHZB 1ADQA 3V6ZB 3RL2B 1WBZA 2HT4C 3GSWA 4LAQH 4YHYB 5I75B 5DVNA 5KOVC 1XCQA 3VD7A 3O3DA 3QIWC 4UIMA 1V7MH 5DVMA 5ID0A 4RMUA 3OAZK 4JRXD 1T4KB 3FZUD 3QEQB 2DLFL 1EH9A 4MMXC 3MRIA 1LEGA 3OR6B 4F7CA 3MJ6A 3DX8B 4K9EL 1JUFA 5DDHA 1RZKC 3WUZA 1BBDH 1MNUL 1GGBH 1FN4A 1ZLUH 1S9WA 1Y6NR 4HZLB 1EEYA 4DFHA 3NABL 2PCPB 1NCDL 4HH9A 4ZTPL 4ZQKB 4L8SA 5A2JH 2BX5A 4HUUB 4QHNB 4URTB 1I8KA 1B9ZA 1ONQB 3HPLA 1T5XA 4B7IA 2HVJA 2MQ3A 4XPAH 3JBG7 2IG2L 3NIFE 1J0KA 3AMLA 5TF0A 2ATPA 4HD9A 3LPFA 1I4FB 2NXZB 3T0XA 5HPOA 1UXSB 1H3WM 5DK0A 2NY2D 5DD5L 2X4UA 2VDKH 4HIJB 2OTPA 4LOUD 1MCWW 1RIUL 3N1GC 3W2DL 4U6YB 1OARH 2LE9A 8FABA 2BVEA 3PF2A 4NHCH 5DMJB 3D9AL 4FFZH 4P4RA 2E9WA 1BWWA 3UAJC 5EUKB 2WWMD 4FN0A 4Y4FA 4XNYH 3MV8A 5IBUG 3MV7E 4PJDF 4YFEA 1NCNA 1P4BH 5IF0B 1WVZA 1T66D 2QSTA 3AMKA 4BYHA 2NY6D 4L4TA 3SKMA 2CRMA 2AQ2A 3TZVD 3C2AH 5J7CC 4O9HL 3MBXL 2A83A 3SGKA 1VCAA 3GIVA 3RAJH 3D0VB 4PLKD 3TBWB 4CMHB 4CJ1A 5I1JL 4F8QA 3ZHLA 1EVTC 4QOKE 1W0VB 1T0NB 3ARBC 4HXAL 5FGRA 1HXMA 5MI0B 5B39B 3A0OA 5L2JB 4J6RL 3QIUB 1Z3GH 3LPGA 4L3EA 3QEUA 4W4OC 1XCTB 1QRNB 4IHOA 3SE3C 4NQDE 3TA3D 2C4FT 4JFZH 3RHWF 4WCYL 1RI8A 1F90H 2HFGL 4A6YB 4Z0BL 4N8CH 2X09A 2R2BA 2OP4L 1EJOH 4OGXH 3RWIB 4G9FA 1N5AA 3DHMA 3WSQH 3TVMC 5C1MB 5C07B 3DYPA 2X44D 4M5YH 4O2EB 4D94A 1M05A 1IQWL 3MOAH 3HMXL 1LP9F 3NZ8B 3OXRA 3KPPB 5CJQL 4QOKA 1TQCB 4E41B 1CD1A 3W11D 3UYRH 5AEAA 3FAWA 4V1DD 1VADA 3CFKB 3P0YH 4K94C 4Y16C 1QFWM 3U30C 1R5VB 4OAWA 2J88L 1DVFD 1S8DB 2BFVH 2Z0BA 3L1OH 4Y1AD 5F9OH 5F7DA 5DVKA 2ZJSL 3D69A 2VKXA 4JRWA 5CBEB 4TVPH 3QUXA 4JPIB 5FHAH 2C3XA 3VXQB 4N1HB 4PRIE 5AYQA 3WV0A 3KYNB 5GGRY 2FL5B 2VNCA 3OAUL 1HQRA 3RY6A 4LSQL 1WIOA 4PLJD 1CGUA 3JWDL 1NCCL 4JM2D 5BOPA 1ZHKA 3MRNA 3H9SB 4Z7UA 1WFUA 4XVUC 1RMFL 2BSRA 4JJ5A 1G9NC 5HYFA 3VGEA 2AABL 5DJXA 2XWJA 1WCBA 3EOTL 1KIPB 4ONFL 3I6KB 3UTZB 3MV11 2ZSVB 3PNWA 5KOMC 4D0CB 2CKBL 2C7UA 4GBXD 4LL9A 1FNSH 1J1OH 1UYWH 4NZJA 4IRJC 4K8RH 1EBPA 3LEVL 3SQOH 3BN3B 3D2UB 4QKXB 4R9HA 5JW4R 5IB1A 2H26A 4RAUA 1MHHB 4XTRD 2JF1A 1LE9A 5BVJA 4PJHF 3T77A 1YC7A 3BXNA 1JZ4A 4HW6A 2E9BA 2EYRA 2L4OA 1IC5L 1UB6B 4X6CB 5L88L 1VFAA 1QSEB 1MVUB 2VXTH 1CD0A 2RJMA 4YFLF 4DFIA 3UBXI 2OR9L 3EOYG 1PGRB 4CNIB 4A2MA 1KPUA 2X10A 3MODL 1NFDF 3OX8B 1WZLA 5J3HC 3FB5A 4KRLB 4N9OB 3L3GB 1G9MC 3BZEA 2XQBL 1PSKH 1ZSDB 1AQDA 4KK9C 1KTLB 5KSUA 1IGFL 4ZUUA 3VFNA 1NDGB 3O4LD 5ITBL 4W4NA 4S1QL 3ZE0E 2Z9TA 3PL6D 3V79C 4Y8DC 4MD0A 4FQXB 1TVBA 1JHLL 5IP4A 1RFDL 1XF5A 1D5MB 3HRZB 3TBVA 3OQ3B 1ZLSH 2HRLA 4GRMA 3IDXL 1ORSB 1I3UA 3C6SB 3QG7L 4YDJA 5D2LA 1FRGL 3ULUL 4BSWB 1JTTA 1RK1B 1KUMA 4U1LA 5F7KC 1UA6L 4IMLA 2OJZH 1RULH 3C6LA 5IHBA 4J2XA 3HC3L 3PJSB 4LDLB 5F88B 3AAZB 3ET9F 1ORQB 1TJHL 4GOSA 5A2IH 1L0XA 43CAB 1BD2A 5E4IA 1DQQB 1U41A 3LN4B 1ZTXH 5DVLA 1MFCL 4OF3A 4KJPC 1JPTL 2IAMD 4JFDE 1I1AA 4JO4H 3DO3A 5SV3A 1MJJB 4N5ED 4Z7WE 2ESVD 4Z7QF 1WITA 1RZJH 3O2WH 4TUKH 1MSPA 4KKAC 3ARDB 5LWYH 1V7NL 2OL3L 4ALAL 5E0QA 3MRQB 4Y5VB 4JO1H 5FGCE 1FL3A 2AXFA 1ITCA 3I85A 1S7SA 1LEKA 5E9DA 4MNQE 1B4RA 1YDPB 4ZAKC 5DFVC 5ISZE 4AEEA 1BZ7A 1OAYH 1X7QB 2HT2C 3RKDD 1T2QL 2KZWA 2A73A 2QQLL 3QNZA 4FTVE 2BOBB 2F54E 4HWBA 3VWJA 5BS0E 3MNWA 3CVIH 4U6HA 1EZVX 4CVZA 1CGTA 5J0BA 3R06A 2CUMA 3DX9B 4H88L 4TNWK 4QGYA 2C9AA 1Y6MR 4KGJA 2DTMH 4NRXB 2I24N 1DJSA 3ALWA 3DHJA 4YBLB 4U1SA 3X3FL 3MLRH 1TETL 1H3VA 3PWPA 3MRFA 2GKIA 3NIFF 2XG4A 5IEHB 3E8UH 3TJEL 4FRWA 3D39B 4IIQC 4QXTB 2B7DT 3QH3B 1ETZB 2X6MA 4GUPB 2QSCL 3OKLA 5GIRA 4YHYC 4XMPH 3GSRB 4MB3A 4TUJA 4P23D 3MJ7A 3LS4L 4KVCH 3KPSE 3ARWA 1J1XL 1BGXH 1JGLL 1NLDH 1QFUH 2X1OA 1V3LA 3V5KB 2PN5A 4Y5XC 2A6DA 5SWSD 3ZYIA 4FQLH 4HMDA 1L0QA 3VJ6A 4ZDHA 2EDXA 3PQYE 5JPNA 1S7UB 5IR1B 3RZWA 5MERB 2FSEA 3RVVC 3QUKB 3SDDD 1ZVHA 2NW2A 5IFAH 1DLHB 1UH4A 1R3HB 4WHYH 3GHBL 5I19H 2GJZB 5TDPB 1CGWA 1TIUA 2ZKHL 4TULL 4FQIH 4QRTA 2FX8L 4Q6IC 2IF7A 4Y19E 5ETUA 4KY1L 4NRZB 3MGOA 5JDSA 3TPKA 4NO5B 2CKNA 3SOBH 3SE8L 5I1KL 3DYMA 4LEXH 5JW4Q 1HKLL 2LTQC 1KLFA 1F97A 1BFSA 2KZ1B 4NQEB 1AGBA 3DTXB 4X7EC 5A43C 2NXZC 4GW5B 4I3SL 3QDJD 3N1PC 3ARZA 2IPKA 4IMKC 2FJHA 1IILE 1GCFA 5IQ7H 2PO6B 1FL6B 4LVNB 1FJ1B 2EYSB 5DD1L 1BFOB 4NJAH 5GXBB 1SBBA 4D8PA 1F58H 5EO1A 3RWHB 5GS0H 5DT1L 4JVUA 4KZDH 3B2UD 3MMEB 1AGEB 4P2OA 4AIOA 5ALCH 3SY0B 4WTZG 1FNGB 4RNRB 1A9BA 5TF1H 4ZNEE 4X5LA 4B41A 5H2BB 1KNOB 3QFJD 2G75A 3E6HA 2OZ4L 5MI0C 1HILB 2VZOA 4GS7B 3QIUC 3DURB 2CMRL 2AJYL 4JDTH 4P5MB 4KUCD 3L5XH 5JOPE 5SWQB 1YPZF 3OAYH 4NM4H 2FH6A 4M7LT 4J3XA 5CAYB 2BVQA 3MQIA 1MHPH 2DQFB 2OLDA 1JI1A 3BKYH 3DGGA 1QBLH 4ZSOE 4MA7L 4OB5H 1N64H 3KPMB 4QTIL 1FL5B 5CFHA 4QRSA 1JV5B 4JANB 2WNGA 2CLVA 3TV3L 1D5ZA 5I1HL 2DKSA 4JPKL 5F7EL 5IB4A 4ODXA 1JRHL 3PABB 5IM7A 5F6IC 5T1LD 3SGJC 4DUWA 2J6EL 3VXSE 1CI5A 4LU5L 4AQ1B 2Y36H 3ULSB 5GRZA 2QQNH 2DLFH 2WM0A 4NKDB 2CDEB 4PJ9B 1Q9WA 4HJ0D 5F89B 5AD0A 2VLRD 1PQZA 4G8GE 3CXHJ 5FHBH 4K9EH 1N2RA 1ZLWK 4OBSA 3O9WB 5EG6C 2JB6B 1MNUH 4RBPK 1CE6A 2BNRE 1WQVT 1WBXB 3UBXA 4NOFA 3IJYB 3NABH 5C0AE 1NCDH 3WXWL 3OMZA 2APXA 4F2MB 1KB5B 3DMMA 4M6OL 5CGTA 3QXAA 2E6QA 1FZJA 4QRPE 3U0TB 4GKNB 4EQ2A 3BGFB 4Z78A 1Q9OB 5EZOL 1TVHA 2V2XA 5JHDD 3SGDH 1Q9LB 2XZZA 3GM0A 1T80A 5I74C 4RZCA 2A77L 2GSGB 4LVHC 5E8NA 3T08A 1EO8L 1HOCA 1PW3A 1AD9B 5IFHL 1JPGB 1RIUH 3ZE0F 3W2DH 4HIIA 4S11A 4MAUL 3MYJA 1MIEL 2ILLA 5EBWA 4NJ9L 1BHGA 3RJDA 3D9AH 2BMKA 2ITCB 4LCWD 3UTSD 2YXMA 4WU5A 2V2TB 2XFXA 1INEH 3OKMA 3PHOA 4KDWA 4EUPH 1QRKA 5EBGA 3SDXB 4PJ5D 4QRPA 2AEPL 1MUJB 5EC2B 1FNHA 2NYYC 1MJ7L 5SX5H 1BZ9A 2H3NA 4ELMB 4HWNA 2C1PB 4XP9L 4O9HH 4LLMB 5DRXA 1XH3A 3MBXH 3D25B 3WFEL 4AIXA 2B1AL 4FNLH 2NR6C