4KNQA

Crystal structure of 1nt-5'-overhanging double-helical ccg-repetitive rna 20mer complexed with rss p19
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
122
Chain Sequence
b'HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
total genus 35
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2013-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4knqA01
4JK0D 4J5VA 1R9FA 4JNXA 4KNQA 4J39A 4JGNA 4KQ0A 1RPUA 4KTGA
chains in the Genus database with same CATH superfamily
1B9KA 1EEYA 3ZGIA 3KEDA 5D6DC 3MODL 4I0PD 3QNZA 2JKRM 2BNRD 4O2CB 2H1LM 3ECQA 3QUHA 5IOPB 5GGTA 1KCLA 4X0KA 5HSFA 3V4UH 5AVTB 2EE6A 4YC2B 3R0MA 5AB1A 4P23B 3ARDD 2BNUA 2K70A 3WD5H 3F58L 2GCYA 2WWKT 1QA9A 3PV6A 3SY0A 5JHDB 4M8QB 5GRYA 2KC0A 1IM9A 4AL8C 5I1HH 4PUBL 2PR4L 5DF0A 4LDOB 4M9PA 1SF3A 4FYQA 3TO4A 5L2KB 1MDTA 2DQUL 2BK8A 3O6FB 3RAJH 2VXQA 5T1LB 3BH8A 4L5FE 3VG0L 1FGNH 1GGCL 3QORA 2WSKA 4G5AA 3K72B 4MCZB 2XKUA 3B3BA 2OMBA 1UM6L 3MNWA 4NZTH 3C09B 4JL2A 5C6WH 4XXWA 1BFSA 4YHIA 5KVGE 1NFDF 1OW0C 2P1YA 5DD1H 3B2DC 3U9PL 1MFVA 4LCCA 3UZVB 1BF2A 2VDKL 2ZWKA 1XR9B 2ARWA 2P48B 2O6EA 2R0LH 1MCSA 2W65B 3SQRA 2LLLA 4HZLA 4JFFD 1G9MC 4MJ5B 4P2OA 5INCB 3S5LB 4AQ1C 3M45A 4KDTA 4QRFA 5E9DB 3BUBA 5HGDA 2MKWA 4KJYB 5TDNA 3UC0L 3CSYB 4UV4H 4AY0A 2WINA 4Q9BA 4IBUA 1IEAB 5E56A 5ABDE 1MNUH 1T3FB 4JPSA 4E9VA 4I18C 1QLRA 4URKA 3RWFA 5B3SB 3VFVA 1RUMH 1TXKA 1BQLL 3SKJL 2D4DA 4HPYL 4NGHL 4OLWL 3QDGB 4KXDA 4NLAA 3OMNB 1C5CH 4BDVB 3GIVB 4YSTA 2YGQA 3CSPA 3IB4A 1A3RL 1WT5A 2ED6A 3PWUA 3ZTJH 3SN6N 4GSXA 3F01A 1KGXA 4NPKA 3FC8A 2XG5A 4RFNC 3TA3B 4ERSL 4CW1A 5CEYB 1O7SA 4GW4B 1KTBA 1NGQH 4LCWD 4TUJB 3L45A 2OK0L 2BSCA 5CZVH 1EXGA 3EH3B 4G8EA 4LU5H 2ZOTA 2YZ8A 4PRBA 5F9JB 3NRQA 3Q9PA 4WSKA 3AS1A 4OD1L 3NQKA 4DPAX 3MAWA 1TR7A 2X70A 3LKPB 1GZPB 3ZE2B 5I0XA 1LE5A 5FYLL 3GZPA 4OM0H 4UAOC 2Z91B 1I7ZB 3L9EA 3DMMC 3PQYA 4F2MA 4OFQA 2KDYA 5KYYA 2VRAA 5GS2D 2C4FU 1I31A 3AJ7A 3PPEA 1S5HA 4G6FD 4B9PA 4GBXD 2FGWH 4WIQA 5DVMA 2A7BA 4E9XA 3OMZA 5CAYB 4RCAA 3SE8H 4I48A 4IIZA 4JHUA 1BG1A 3D85A 4H8UA 1YYCA 4QHUA 4Q8BA 3CFUA 4FLQA 1XEDA 5IK3B 2KI6A 3GBDA 1I8KA 5ICYB 3RVUD 2CALA 2NNAB 3K8KA 2FT8A 2DLIA 3BP4B 2XTJB 1ZHLB 4UNUA 2XX0A 3BPLB 1QO3B 4TSCH 3EDDA 3IDYC 5FCUH 4WCYH 1L0YA 1QSFA 2JXMB 1CICB 4KKLD 2VC2H 1YQVH 3O6FD 5DJDB 2BP5M 4W9DC 4WY7L 4ETQA 5MHSE 4OCMC 2NSMA 4DP4X 3WEBA 2X88A 1Y18A 3DIFA 4OCSL 3US9A 4IS6B 4OI8A 3F3HA 4HA1A 5T3XH 3O4LE 2UUDH 1BZ7B 4ODTH 3H56A 4Z7VA 5E5MA 4PRPE 2COVD 4H8VA 1FRGL 4M5YH 4YLQT 4W4OC 3OKMA 4TVPH 1YEGL 4KUZH 2ZAIA 4GQRA 2VDKB 4FQHB 5E9DD 1D6VL 4MKMA 4XXWC 3DUUA 5TK4A 3DXAB 2X1XR 2BNRE 1ROCA 3OXRB 4LCCC 3Q6GH 4NI6A 4Z8FL 1JZ2A 3N50A 4JAMA 3ULUE 4IKNA 2OJZL 1AC0A 4KVCH 3WJLA 2WYZA 4XB8A 3S36X 1XV8A 3KPMB 4ZYKA 1FL6A 3DVNB 7PAZA 5GISL 4KOCA 2I9TA 3VFNA 3CMGA 3N40F 4P4KA 4KROC 3UAEA 2G2NA 5HDBB 1UURA 2DM7A 2R2HB 1NBYA 1NZRA 4OGYL 3TA3D 3MRNA 2Q7AA 3WE1A 2QSQA 3U6XA 1MWAL 2WXQA 4GSQA 5A2JH 2WLYA 5HHPA 1JF5A 3IDNA 3TXAA 4JHAL 2AEPL 1SY6H 5FDWA 3F2LA 1ZIAA 2HPOA 4TKWA 1ACYL 3KE0A 5C9JB 5ESQA 1U8HB 1S46A 3WY4A 4ELME 4YHNA 2P24B 1UWYA 2BIHA 5C0EA 1BGXL 4WJKB 5F21B 2HKFL 3WFEL 4NNXA 4M48H 1NEUA 2ZSVA 4JFFE 4PJAF 2IVFC 3DX8A 3SZ6A 1GIGH 1KLFB 1WIUA 1EPFA 2ZSWA 3KM1A 4HWNA 5KBDA 3CVHA 4M6OL 1LO2H 4XP6H 1JXKA 1N5AB 3LSOA 1MREH 4ZUUA 4W6XB 1QNZH 4UTAH 1T2QH 1FNFA 4HK3J 1Q72H 4RMTA 5AW8B 3BFWA 2WQXA 4JRFA 2YRLA 5KVEE 2IPUK 3FU6A 2I32A 4WGWB 2FZ3B 3H9HB 5DT1H 4K8RL 4ENZA 1NCWL 1NC2A 3SPGA 5B4MC 4H0HB 4XXDB 5I1CH 5KTEH 4A38A 3ZHDA 3TONA 4LKCA 2EDEA 3FTXA 5FS5A 1XGPB 1ZT7B 3N55A 4AVKA 3HI5L 4PGZA 2QHRL 1GJIA 1HSAA 4H5SA 3HNVL 1J5OH 1E5BA 5CBAB 3R06B 4HX1B 3HC0B 2YR3A 4IOFD 1S7SA 1FSKB 3CD4A 4PJGA 3V5HA 5IJKA 2OMYA 4HWEL 3FCTA 5HYJA 1L9SA 3VE0A 3C87A 4F8OA 3L5WA 3HRZA 4UF7C 4NKIL 3MZGB 3UBXI 3RIKA 1QRKA 4ZFZB 2CU9A 4GFXA 1KJ3H 3P77A 3WIIH 4O00A 1SEBA 2EDXA 3W9DA 3IE4A 3QCUH 2G5BA 1P1ZA 3QAQA 2QZ5A 4N2NA 5EN2B 1IJNA 2ZYRA 3MJ6A 1N7ML 2R29L 2GABA 2IMMA 3FRUB 3GSNH 3JWDL 3L3OC 3MQIA 4K3EL 4HFUH 3V4PH 2ZWLT 2EXSA 4ZUWA 3PS6A 3CDZA 1T1YB 3DUSA 2VZTA 3FH5A 4FF9A 4QTHA 2OMWB 1X5LA 1T1XB 2BH0A 1HEZA 1VAHA 1XSKA 3U6RB 2GHZA 3AT8A 3NP4A 5IJCC 5I9QB 2BNQB 2NY4C 1KYOK 1RSYA 1IE5A 4JFPA 2LW3A 1ITCA 1XCTB 2DQFA 3SBWA 3B2PA 2MNUA 1MWAB 1B4RA 2PTTB 2NT1A 3CXDL 1N3NB 4GO9A 3AXLB 1MCFA 4U1MA 3QW9A 2AV7B 3QNYA 1WS7A 5EZLB 4FA7B 5I6OA 4G6KH 5IB3B 2ICWJ 4P9HC 1Q0XL 1ICTA 4ZK8A 1I8LA 4S0TD 4KXBA 4Z77A 1M7DB 2XZAH 3O9WC 3O6KL 1NEZG 3KPRE 4YXLL 3ZYZA 3GM0A 3HE6B 1EDYA 1AR1B 1R24B 5KSUB 2VDOH 3GRWH 2CMRH 2G75B 1F4YH 5BXFA 4NCDA 4GYBA 3DV4B 3U9UB 2F08A 1V3LA 2UY6B 3GBML 4EI6B 4MBRA 2LAGB 2OSLB 3IDJB 3RTLA 3D39A 3QEGH 4ZXBD 1WAAA 4O9HH 2E8YA 1BPVA 5I1IH 1EO5A 3DV6A 2DWYA 3QC6X 4M6MH 4MNHB 1JPGB 3LQAH 3TJHD 3WHE1 4WW2A 4X5WB 1A4CA 3EUUA 3CN3A 1YEEL 1CTNA 1QABA 4M3JA 5DC2A 5FX3A 2Z92B 3MUY1 1T21B 1NBVH 4OT1L 4ZSOA 3SIKA 4AIZA 2EIDA 2ZCHH 5DTFB 4ZW8A 1IGFH 4XPAL 4LP8A 1H6EA 5HDWA 2Y7QA 4DN4H 4JW3A 5CEZH 2JCCA 3UACA 4WWKD 5DJ8A 3LH8A 4L0YA 3H1ZA 3RDTB 1G9NC 2JELL 1R3IL 1S7VB 2YHGA 3EFFB 3MRIB 3MYJB 5AW0B 2YD8A 4OCXL 1SLUA 4R6UA 5C0GB 4K15A 2WLIB 1ZV2A 4QO1A 3GSWA 1L6XA 2A74C 2B1OA 3IMSA 3L7EA 2ZOOA 5BS0B 3WGUB 3ZE2E 2AXGB 3KHQA 1KBBA 2O93L 4XPGL 5EWIH 2ATPB 1BVKA 3MV11 2HFFA 2YPKB 3BUYB 2HH0H 2DMGA 3IYLW 1BAFH 3LD8B 1OY3B 4QI3A 4PG9B 1AH1A 1P5VA 1NEZA 3WS3A 4BELD 2L4OA 5D8JH 4MAYA 3VQ1C 4ELDA 1BM7A 1I75A 3DX3A 3P9WB 4I5BB 2Q20A 5D4QA 3HRZC 2X5PA 5KSBA 1F00I 5ICZA 3L13A 1OIOA 1LVEA 3V5DB 4HGWB 5DGQA 3ZVVA 5F6HI 3QWRA 2EH8H 4Z3TA 4ZUVB 2ITCA 4KFMA 4CU8A 2AQRA 5D1ZI 4HJGB 2HXAA 1BOYA 1J8HE 2F7IA 3EBHA 4UTCA 2BNQD 3KJ4C 1XSIA 2Z8RA 25C8H 3K74B 4BXSV 3OKNB 1UKSA 1R5IA 4YBQC 3ULVC 2X6BA 4WRLA 5I6PA 4JPIA 1SN5A 4P48A 1JWUA 1VFAA 2OSYA 1MCEA 1PNDA 3H53A 3HI6H 1M1SA 4N4YB 5KYWA 2XWJA 4FTVA 1SYSB 1A21A 3P2TA 2GB2A 3VFUA 4L8BA 1DJIA 1H8LA 4MDJA 4X9FA 3STLA 4DTGL 5LBVA 5HHXL 4QLWA 3GQFA 1IUZA 2BY0A 3GHBL 3IAQA 3QJXA 1UT2A 4P05A 3CFEB 2DYPA 2PXYB 4FQCL 3BRGC 3S98A 1XIWA 4MA7L 2F8XC 2NXYB 5F7KC 2ZD0A 5KN5B 1XAUA 1CDBA 1YUHB 3O6ML 3Q2LA 5D6CB 1DQJB 3PABA 4U1KA 1P84K 1T20B 4HOZA 5KVFL 4QHNA 3CSBA 4PW4A 1B9ZA 3ZIYA 3QEHB 1AJ7L 3U0WL 5IP4A 3BSZH 5DMIH 2V2WA 5C1MB 1JXGA 1OT2A 4JM2F 1AD9B 4U05A 2NZ1A 1JD9A 1U9KA 1PKQE 4X5LA 3S35H 3BD4A 5I6LA 4OQTH 1E5ZA 4FGMA 2LR4A 2WXHA 3N9GH 4BZ1A 4K8RD 3UPRA 2QADC 1KF9B 1ECYA 3G5YA 5A2CA 3BP7A 1K6QL 1I7RB 2VDLH 4M62H 3T3PB 3ZTDC 3MLPA 3BP5B 4EZMA 3I85A 1F3DJ 5IKCA 4GT7A 3I3DA 5J1AB 4F80A 1U3HB 4GRWE 1QYGH 4NKMA 1E9PA 1X4YA 1CI3M 1YMHA 4XN1A 4UILL 5IHUH 5LAXA 2YARA 1ZLWK 4M4PA 1FFRA 4XVUD 3DYPA 3PL6A 1ML0A 3VWKA 1DBJH 1XF4B 5D1ZD 4U2ZA 1KB3A 3HUJA 4EI5C 4AMXA 2C9AA 1AHKA 3EFDL 4PJHA 4I1NB 1LO5A 4RDQF 2WTRB 3ENEA 2O5ZL 4OLXH 4TNWF 2IH3A 4NC2B 3GUFA 2E59A 5EZPA 4P06A 1JGLH 2PO6A 1KFAH 4UM8B 1SNRA 4FQIL 4MYWB 1FHGA 4YQXH 4LKXA 3LB6C 4DKEL 3B9KB 3WS6C 2AI0H 2X7LB 3K2MC 3MRFA 4XMLL 1MI5A 3ZE1B 1K9TA 1BLNA 3GBLA 1G7PB 4HW6A 4KMLB 2P28B 1KN2L 4K3JH 4NERA 3BKMH 2Q76A 2Q7YB 3QDAA 1UT1A 2OMVB 3QA3B 3W5NA 4OV5A 1LO3H 1EJ8A 1HL5A 1UXWA 5I8KH 1IEBB 1X5GA 4KHXL 3WTSA 4LCVA 4OZIF 3SDDA 3BAWA 4KKAC 4HHWA 1JNNH 4U33A 4N2BA 1AKPA 2IBGA 1NAML 1FZMA 1OQOA 2EDRA 2IJ0C 2M26A 1T04A 4ODXA 4BXVA 5E2VH 1QI3A 2ZOLB 4XR8C 4Y2DD 5DSCA 3X1EA 1FE8L 4JN1H 1BQRA 3VI4F 2JLLA 2EXYD 2QT6A 2XWXA 1FNLA 2PXYD 2H2SD 4OCYH 1NFDB 1LEIA 2QPUA 1IBYA 1AKJA 1XT5A 2BPBA 1Z9PA 1SJVA 3M7FB 4E9QA 2O5YL 4Y4HC 1OAUL 1FWXA 4JKPH 5EEZA 3HZVA 1I3RB 2QSVA 1CPUA 1Q4NX 1CFSB 4ZFFA 1MRDH 2ZKWA 3F6JA 4KQ3L 4YPJA 2B1HH 4YSUA 2YPLD 2Z64C 4M3KB 1U33A 1VPOH 4S11A 5K9OA 35C8H 3E9TA 4P2CG 1EX0A 1LILA 1SXSA 1WCQA 2HG5A 3MRMB 4D7PA 1URLA 5D2NC 4WDIB 2GVYA 5C0IA 5J13B 4F1ZA 3X11A 2BOBA 2BNQE 5FEBA 3NSFA 4XMUA 5I2IA 4FFVC 4U1SA 3BGFC 3JUZA 5CILL 4ZX4A 3X3GH 4DQAA 5A40E 3JXAA 1GKEA 4NQVB 3EOBB 2D03H 5CBEB 1U3HD 2JSFA 5T1JA 1X6NA 4FQ1L 4AQEB 5FYKU 4UANA 4P4RA 3QPQD 1VGEL 2Y2YA 2H9GA 2W95A 4WWID 2F5BH 3VAEA 2E7CA 2EUVA 3CWGA 3L3GB 4ZW3A 5FM5O 4U1IB 1I4FB 4Z5RB 4HCIA 3KPSB 2APFA 2FJHA 3DBXA 2ZOKA 3G5XB 5IVXF 3KLHC 3F12A 3PL6C 3V6OA 1A6ZB 4KRPC 2R83A 3TV8A 2QHLA 3NCJH 3KG5A 1I1AB 1TPXC 3LQZB 4L18A 5E8NB 3OPUA 3K2KA 1RLBA 3HS0C 2Q8BH 3V4LA 3HPJA 2V3DA 3NFNB 1JPTH 5CCKL 3IDGA 4AJYV 2AV1B 2V9TA 4GI6A 4LEOA 4OVVA 1BVOA 4Q9QH 2RMNA 1ED3A 2DJ4A 3EYUL 4NIKB 1GOGA 2W0FB 1BAWA 2DQJL 5A2IH 1FORL 4YFLI 3DSFH 4JFXB 1DBML 1J7VR 1BWWA 4E41B 2HJKB 2WLHA 2V5SA 1AQHA 5BRQA 1S78C 2GBAA 4PSPA 1M2VA 1A2YB 1C8QA 2GTZB 4MX7B 1AP2A 2CLZA 2WLMA 1FFOB 1MG2C 4BHUA 4AMKH 2XFXA 5JDJA 1NAMB 3I6KB 3TNMA 3L3HA 5DZJA 3QUXB 2C3XA 3QQXA 1V55B 1NCJA 3KDMA 5DHVH 4MQSB 4DGIL 3SDXA 1AYRA 4MD0A 2K45A 2FRGP 1OE1A 2PMZA 5EUKB 2D7MA 1JGEB 3MJ7B 3WKMH 1R47A 5D7JC 1H9DA 5IREA 4GIAA 2EYRA 4JL1A 2YAOA 1CDCA 2R2BA 4K9EC 1HHKA 3C60B 1AIZA 2ADIB 3HB3D 3BVWA 4G8IB 4XBPB 4F15B 4YJZL 1Y7VA 3OKDB 4IU3B 4R7DB 3TIEA 3PWJB 4YPGB 4GXFA 3LKRB 2ATAA 2OI9C 4XRCA 2AEQL 3WMQA 1ONQB 5KSAA 2BWDA 3X1FA 5C0BA 2O72A 3S8WA 3GI8H 3VJ6B 1M9WA 4YFDB 1E8XA 1RFDL 1WJ3A 2IANA 1S9XB 3H85A 2GJZA 3MV7A 4UQ3A 2AK1H 1A5FL 5HVWA 2DMHA 5C09D 1KY7A 3HJEA 2KZBA 3EGSA 2AP2A 3D4ZA 3T0EB 2WSDA 4LRNH 4XC1L 1JZ6A 2VXVL 4WUUD 4Y5VA 1Y1DA 4NZRH 1Q9LB 5ISZA 3FAXA 3TPUA 4HAKA 2VM9A 1HYSD 1UJ3B 1Z0NA 1YY9C 3GB7B 3IJYB 2W60B 3CUPB 1YYLH 1KPUA 3PRZA 4M1CD 3KGRA 2DI8A 4FYRA 3ZKNC 4LLVB 5I24A 4P3DB 5CLWA 3OAUH 3APDA 3MNMA 5EIVA 5HYEA 1G7MB 3E0GA 3RUGE 1I1AD 4PJAB 3Q48A 1WQVT 2BSTA 1HNYA 2EDQA 4XPFH 2UYLA 3LPFA 4BFFA 4PJFF 4N8CL 2G5UA 1BX2B 4IGBA 5MP6L 2YPLE 1NGXA 3GXNA 3V6OC 1PFOA 1SY6A 3QUZA 1BDYA 4C58B 1M2OA 4OIFA 4U4IA 2ZKYA 5I18H 4XBEL 3LS5L 3DI2B 1LWJA 2YGNA 2IV9A 4R7NA 2OMZA 1TLMA 4AGOA 4U1NB 4F91B 3KWWB 2NY2D 1L7TL 4UIMA 2WNWA 5I15L 4OLYH 1WHPA 3WV0A 2WXJA 2QZQA 5AW6B 3C2SA 1KIQB 3B2MA 1H15B 3KCWA 3P9MB 2WC7A 4OZGA 3BH9A 3VTAA 4P46C 2GK0B 2CR3A 3WKQA 3OZ9L 1N6QL 4KAQH 2A6KA 5I71C 1TZGL 3TN0C 5LG1A 3CZFA 1CYWA 4UTAA 3OL2A 4QHKI 4TLUA 1UT9A 5FM5M 3QUMB 2KHAA 5C3LD 1JZ7A 1FGVH 4JB9H 4IRSA 3NGBB 1VACA 2GEEA 4JFUA 4Y2OA 3MOBL 43CAB 3H6AA 1HEJC 2EUXA 2YN5A 3NDZE 1MFMA 4IBLT 1J86A 4AXWA 3B2UD 1DVFA 2P46B 5FO7B 4GQQA 2V5TA 2HVKB 4LVEA 2HN7A 5JIKA 1CFQB 2ZP9A 4UT9L 4A66A 2Z0BA 3PJSA 2Z9TA 2RCSL 2JE8A 1TU2B 3QIWD 3T9WA 5E5UB 2N01B 5K1NA 3FUFA 5D2LA 1CLOH 5F7UA 1FG9C 4Q74A 3FKUS 3RFZB 5SWSB 5I8OL 1OAYL 4NUPA 2AMUA 5KS9A 2I9LB 1TEGA 1MJ7L 2HVJA 3QFJD 1WHOA 3H3PL 3FQWA 5AVWB 4MJHA 4X99A 3RVXD 2WXLA 5DVOA 1ROWA 3KPPA 3FQUB 5AL8A 4YSPA 1BMZA 1UZ6E 4HXBL 4YGAB 1DQLH 1T7YA 2Z4QB 2EDJA 4L1SA 4RQQB 2Y1YA 1OGTA 1Y0LA 1VB9A 3V4PA 1LD9B 3EBGA 1J8KA 1U30A 2ZXCA 3C6LC 3UAAA 5I1DB 1RZJH 4HJJH 1DUYB 4XO5A 4JFWA 4HV8A 3DX4A 2EKSA 4M7ZB 5F0MB 4GRLA 4ENEC 3HC3L 4W1TA 3AS0A 3TCTA 2FSEB 1MWOA 1THCA 2X4NA 3DA0A 5DA4A 1IGTA 4WFFD 4FFTA 1JUFB 3VMPA 3OXSA 5C08A 2J5LC 4G3YL 1AHWA 3DHUA 5DQDH 5AFAA 5DD3H 2GYSA 4ILDA 3T04D 3QUYB 3INUH 2BP0A 3B2VL 2C7UA 3D18B 3KDPB 1P4BL 4L29A 2DQGL 4Y9GA 5IW1A 3MCYA 1EO7A 4HFWA 4ZFGH 1NAKH 3UYRL 4KPHL 3QPKA 3V7AG 1QEXA 2R1XB 5ECGA 4PVBA 4JRXA 5I8EA 2PCFB 2NDFA 2EYSA 1JERA 2VM3A 2XV2A 4D0BA 2E7LA 2YAQA 3QG6A 1QNIA 4HIEB 4RZCB 5CD5D 2WJ5A 2HFTA 5JIIA 3IFNH 3CFNA 3SDCA 3CX5K 3SY6A 2V9UA 4AQ8C 2RACA 3GRWA 3RTQC 1UACL 5C09E 3GRGA 4NRZB 4XNZC 1KXQE 1HXMA 5DJ0B 3HG1D 4U1GB 1L9OA 4R0LB 4WUUE 4EDXB 3EO9L 4WNQA 5JXEA 3HI1A 3K6NA 4KMTH 1FNSL 4XMPL 3BYYA 1HZHL 3QIBB 2JB5L 4WNJA 2VT0A 3PNRB 4ZS6D 5J6GB 1DP0A 3ZPDA 4WW1B 4JY4B 2G60L 2G4EA 1G7JA 3HPLA 4Z7VF 2ENPA 2BVQB 3K5RA 2LU5A 1XF1A 2BHFA 2UVEA 4NQDA 4UBDD 4EIZC 1GCFA 1BFTA 1NBZB 2X4UB 5F72S 1IGMH 5F7LB 1KWGA 4FG6D 3LN5A 4I8DA 4AOFA 4PWHA 3KL0A 4XBMA 2A9CA 1NCOA 4CRPA 5D55A 4QOKB 1R3KB 4R97B 1GL4B 5CFHA 1XL6A 5EIQA 5SWSD 2A77L 4L4TB 4Y4KA 3FN9A 1H5BC 3VD5A 2K9UA 2VN7A 4CADA 1DVYA 4E5XB 3GI9L 4Z7WA 1GRWA 4IKKA 4X6BA 4BE6A 3MRLB 1J5DA 4P5TC 1W2KT 1EEQA 1ZHKA 4S2SA 5HGAA 3E6FB 4F3FA 3VXUA 4XI5C 2Y7NA 1OP5K 5GHWH 5C6TH 1J48A 3RJDA 4CMHC 2AEWA 2QPSA 3MRRB 5F6HJ 1KGCD 1P7BA 2BMKA 1DJXA 3CMOL 2HTLC 4NN7B 2GTWB 1A7RH 3EFOA 4DO5A 1N18A 4NNPL 3SB3A 1A1NB 2D3VA 2UXGA 2HRPH 3OJMB 5DZ9A 3HLKA 1ZXQA 3MBEC 4ONHA 2H1PH 1Y07A 3L3KB 5D7LA 2X1OA 4KTGA 3CZLA 4D8PB 3QUYD 4HIHB 2EVFA 2GTQA 4GRLC 2IBBA 2OAAA 1U91B 4M8RA 3KWVA 4GP4B 1D5MB 3T8XA 3LEXA 5FV2A 1RJYB 1CE6A 1KCVL 4MHHG 4OCWL 2ESVA 1KEGL 5BO1L 2HJLB 1ZHBA 4HS3B 3DJZA 3N1MC 4N26A 3ARGB 3A4FA 4JM2B 2Z31C 4NKOA 4D0CB 2HT3D 5AL0A 3UXFA 3RZCD 1YN7A 1EGJH 2XBDA 4IKJA 1TKWB 1VFUA 4M5TA 3UROR 4KZEL 1KT2B 5LXGH 2K4WA 1OB1A 2YSTA 3S8FB 1U6AL 4TUOA 2B3IA 2N0KA 3W38A 3D1MC 4PCTA 3QFJE 4P5MB 2FX7L 1X9LA 2VUKA 2APSA 4M29A 1TJMA 4K71C 3OSKA 4UDTA 4A2LA 4F1SA 3QEUB 3IRPX 3DETD 1O5PA 4I3SL 2IQ9H 3ATFA 3EO1A 4JZNB 4Z7AA 3US0A 1VF5C 5HVHB 2GBVA 3WFDH 3PWLA 4HSCX 1TZHB 4WFFE 5C70A 4OQTA 3FTGA 3FO0H 5IFHH 2AS5M 4LO9A 2IAAC 4JZOA 4MZRA 4G1EB 4APQD 2FH6A 2ZUSA 3U36B 4LVOB 1WG3A 3QRGL 4YHLL 1JGUH 4IKLA 2JQAA 4FLOA 3ZTNH 3GSQA 1WIPA 5CCHE 4ZT1A 1HE7A 1E4XH 1U41A 3OAYK 5L2JA 5IESL 1CK0H 1HH6A 3K91A 2NNFA 3L5JA 2P26A 3MOQA 1X7SA 5J4MA 1I9RH 1LO0L 3V8OA 2Y5TB 3DHJA 4IU2A 4DPBX 1KBGL 1NUNB 2DH3A 3HZYB 3J2PA 4IBSA 2I24N 4BV1A 3N40P 5I28A 2B59B 1BP3B 4K4KA 4M61A 3NZHL 5DHYA 3QFDB 4N8VB 3PFQA 1A4JA 1GA2A 2XPYA 2WOYA 3MNDA 1YJDL 2CHNA 3ARWA 3ULVF 4OZIB 1IKNC 2ED8A 2G3XA 3P0VH 2YA2A 1LP9A 2MNJB 3RVVC 3VXSA 3VFMA 1R4XA 2B15A 2D2CC 3FSAA 5I8CB 3MLRL 4YHKH 3HG1E 4F8QA 1QFOA 1DN0B 2XWBB 5F3BB 3VXMB 2E5EA 2CJSA 3VI4B 2GJJA 4FABH 1YNLL 1OE2A 3RY5A 3BVNB 3SGKA 4ZX6A 2WP3O 3AG4B 4HS8L 1V27A 5DYOA 4LEXL 4OFVA 1S9VA 3DTXA 3P2BA 5LGKA 2PTVA 3BHBB 3GPEA 3ECWA 5K9QI 1ZHNA 3FU9A 5EBGA 3TWYA 5CZXD 1YPZE 5D1QB 4HF5L 4PJ8C 1FHNA 4OJCA 1MNNA 3SPHA 4YHMH 2YBGA 3ARGD 4PMFA 1CD8A 5F7DA 3I02A 2QR0B 4J3OC 4PGDA 5HY9A 3ZHLA 2GUYA 3HE7C 3L4XA 1OGPA 4P3CH 1JK8A 3QDJA 3WTWA 1GR7A 3A67H 5AVQB 2WPGA 4WW2F 2LU3A 1FAIL 4AJVA 2EVGA 4F57L 1Q90A 1G0DA 5CHNA 3ETBF 3PAYA 3BSGA 5IEHB 1AY1H 4HUWB 1FFPB 5CKGA 5F1NB 2C9QA 1QOKA 3FQ1A 5SV3A 1KGCE 2KERA 4ZNEE 1GTFA 3DJTA 3BVTA 1ZPUA 2JCCF 3H2WA 3GNMH 3MZTA 4PM1A 3RUGF 4EKXA 2XG4A 1YEIH 1U8CB 1U3ZA 2IADB 1LDPL 4JKWA 1TFPA 3BAEH 5CIPB 3TVMA 1RXLA 1SJEA 3D09A 5GSRB 4FNLL 4U6VL 5IVXB 4Y19A 3L5IA 4M7LH 2NNXA 4W9LC 3OKOB 4X9YA 5INDB 1CGTA 5E6UB 3RVTC 4NYLA 2XLLA 4GO6B 1N68A 3H0TB 4FZ8L 4G72B 3SDYL 3QRBA 4MTMA 2E3VA 3OG4B 3U25A 3LHPL 4TUKH 3N5AA 5GGTL 4XP5L 3RX8A 2VGLM 1ZV5A 2X1QA 3OKYA 3Q9QA 4X4ME 1QX1A 4G7VL 2G2PA 3QDMA 4RESB 3NA4A 1FFTB 4ZG1A 4IHOA 3TO2B 3IGLA 4IOIA 2BVOA 4Q6IA 2VLLB 2IXQB 3A47A 3NH7H 4XMTA 1G7HB 3UZEC 2V17L 1PQZA 5KSVA 5HP5A 4AMWA 3FCGA 1R3HA 5HDLA 1HK6A 1JZ8A 4JY6A 3JYCA 4L9DA 4N9GA 4FLSA 2R69L 2VDRL 4QRRD 1YVLA 4W9FC 4HIPA 3ASWA 4TTDC 2YRZA 5AWNH 5LCVH 3WN5A 3VXMD 2VXQL 3LZOA 4QKXB 1MVUA 1G6RB 3S96B 5IHZB 3QEQA 4XWGL 1FN4B 2QTVA 3F85A 3I9GH 2A6JB 5IBUG 4K94C 1J0HA 3U6XS 5F9OH 5EEVA 3N0PB 2DWSA 4AQ1B 2P80D 2V7HA 2XKNA 4AQAA 3ZMRA 2B9AA 3C5ZA 4Y4FC 1JGDA 4GJTB 4LRIA 1KN4H 3I3EA 3MJ8A 1A7OL 2XWTA 4G7YL 5D7EA 2X4OB 3QQDB 4MSWB 1S7QA 1R17A 2AERT 4I18B 3APFA 5E2UH 5E6IB 3SQBA 4N2LA 1GH7A 4HEMA 3HKFA 4KHTL 2D31A 5DHVA 5GJSH 2KZKA 2CSPA 3AUVA 2JK5A 4FG0A 5E1HB 1UZ6F 3DX9A 3QWNA 5F9AC 2BOCA 1EDQA 1JZDC 4X6DE 3MJ9H 1NM4A 1EO8H 4XWOC 5DO2C 3OR7B 2VRQA 1P4IL 2G0KA 4MKTA 1L5GB 2VLJA 1ES0B 1MIEH 2XOTA 5I1JH 4G8GD 1QVOB 3RX7A 5DQJB 3FL7A 3OAZK 4HDIA 5FKPB 3ECBB 5DUML 5HYSG 1CR9H 4M7JL 5DWUH 4TQPA 4HLEA 1J5IA 1J1XH 4O2FB 1UH4A 2D4FA 3RPKA 3RWIB 5DJ2B 4N0UA 3MRBA 1P6WA 4X6CF 3L9BA 1URZA 1YZZA 2YEVB 3RGVB 1B2WL 1WIOA 3I6GB 4PBDA 1P7KB 2CO7B 3K80A 4M93C 4H0GA 1CXLA 3A4AA 2AQNA 1F2XK 1NANI 3DMMB 3X12A 4JO2H 4AIOA 1HE8A 2DM2A 4TM9A 3WDIA 1NOFA 3HUJF 4S0SD 4N2FA 3DVFA 1HCVA 3HVNA 1SHXA 3ROLB 2BSSA 3KPNA 2OP4L 2CLRB 4XVOA 3H3BC 4OW6A 2QLYA 2CIIA 2QKIC 4PJFB 4UINH 1EHLL 3WAJA 2PABA 3TBYA 1EEYB 2XQ0A 1SJMA 2YOCA 5K9KA 1J1PH 1J11A 2FD6L 3QNZB 1I1CA 4JVWA 4BRVA 4LIQE 4GS7B 3OGCB 4GRMA 5T8IA 3ZDZF 1DR9A 4F8TA 4I7ZC 1T1WA 1MRCL 3M86A 1ASPA 4J27A 4M1GH 1B6DA 2VDPB 3IDYB 3QQ4A 4X0KB 4E9WA 3GSXB 4RWYL 4FZEH 4NO3B 2BW4A 4UB0L 4ZMVA 3S35X 1YEHL 4GAJH 4JHBA 3DTUB 3FUMA 1IC7L 4B9KC 1BJ1H 2GCYB 3EYQD 4DP6X 1MQ8A 1QA9B 3R19A 3PV6B 4LF3A 4DQOH 2XWDA 3SY0B 4YFLF 4Z76B 4ZMAT 3P30L 1U93A 1IM9B 3QFGA 2VDRB 3ZHKA 5LNEA 5HYSA 2FX8H 2ZJSL 5ALBH 2FEDC 2MEJB 4RFOH 2ZX5A 5L4MA 4AQZA 1L4IA 3BH8B 4GKSA 4FXKA 3UTQB 3KLDA 3PU7A 4XN4A 4RAHA 3FT9A 2CNYA 2ODIA 3FH8A 2AJUH 3QORB 3OPZL 3RNQA 3L4ZA 2EKJA 3B9AA 1NMAH 2WSPA 3MNWB 3ROOA 1E90A 4GKLA 2FQDA 5SX5H 4YHPA 1I1RA 1S3RA 5FYKH 2XIDA 4LCCB 4MNQA 1A7PH 1LNUA 1MW2A 4RGOH 5DMKA 3SYAA 5ABZA 4MQXC 4QHKJ 5E6ID 4LSRL 3PG2A 2VLKE 2F2HA 3ASNB 4TN9A 3OJVC 3LNFA 4LSVL 1T0MB 2WN2A 4LRIC 2KLTA 3TFKD 2J1YA 4AGNA 4U1LA 3GINA 4JPVL 4KTDH 5CLZA 4HUMB 3GS0A 4MA3B 5IQLA 2WINB 3NIDB 4QAMB 1CMOA 1QLRB 1T7VA 1SHMA 3OWRA 4NEHB 2AFNA 2VYRE 3M1BA 4DZ8A 4XX5A 3QO1A 3CFQA 4QRRE 3GUTB 5JHBA 3GXUB 5EU7E 4OFDA 2PR4H 4PUBH 4M5SA 1Y6MR 5G4OA 2R9HD 1U2YA 2VDNL 1UYWH 2XG5B 4AK2A 4YDJB 2Y7OA 2KPWA 5A2KH 3MLSL 3PDDA 4MCYB 3ARBD 1FDLL 5D1XA 3RGVD 1H0DB 5BVPL 4LHUG 2IALA 1SXNA 4ZBJA 5FM4A 2WO3B 3O3EA 4G8EB 3RJOA 4ZMZA 1GW0A 5EU3A 1WGOA 2C9RA 4XPTH 3RU8L 5HHVH 4L05A 2EQDA 4R7VA 1HHGA 1K8DA 1QZ1A 2RR3A 1K2DA 3TZVD 3U9PH 1MY5A 2VDKH 5I30L 1LE5B 4OJAA 3WCYA 5CP3H 2HLFC 3PQYB 3SKNA 2BIQA 3BCFA 3TTYA 1BF8A 3US1A 4JDZB 3U7WL 3CVHL 1S7WA 3O3AB 3UC0H 1S5HB 5TD4A 1NC4B 3WO3B 4KOBA 5C0CB 4XMZA 1U21A 3CJJA 4YDIL 5KBKA 4WU5B 4I48B 1XDTT 1JGIA 3HG0A 4MS6A 3DGCR 3W0WA 3D85B 5JLZA 1OGAE 3N6YA 4FQXC 1BQLH 3SKJH 4QHUB 3U79A 3D50A 4NGHH 3A21A 3POHA 4X8CA 5D9SA 1I8KB 5H2BA 2P5WE 4G8GE 5D70L 5EBWB 1Z9MA 4NPYA 2VJXA 4LAJH 4N1EA 4NJAL 4ECNA 4OD3L 3W9EA 1IM9D 1MCDA 4RAUB 1QSFB 2VSCA 4NWTL 5IB5B 5C07A 3TO4D 1T03L 3FN0L 2J4WH 4ETQB 1BD2A 1VDGA 3F5WA 4N5UA 2X87A 4HWBH 3QORD 2DBJA 2H3KA 1Z3GH 3HAEG 4LHUA 2BVYA 5L8LB 1E4JA 2VDML 2CCLA 4KNTA 4Z7VB 5E5MB 5FYLH 1NCGA 3CLEL 1Z3RA 5E99L 3IS1X 1GZQB 1ZT1A 2OTWA 2OZ4H 4ZZKA 5AAMA 1GCYA 3D0VA 3L3OB 4P2OD 3VI3F 4WUKH 1RK7A 3R4DA 1M71A 4PV9A 4TQ8A 4N0CC 4AV0A 2DWXA 3MFFA 4POZD 4OLZL 4NQSA 1INEH 1EHXA 3RY6A 1QFWM 3PGDB 4PJCF 1YO4A 4JAMB 4H40A 1MFEL 5EU6A 2CHDA 4NAJA 1BXXA 5EUOA 3ULVL 3T2LA 4ZYKB 2NY4B 5CGYD 3LXAA 1L9MA 2I9TB 2V0AA 3VFNB 1CL7L 4P4KB 1ZD6A 3C5JA 5LGHH 4NFDA 2B0SH 3S37L 1NBYB 2N56A 3KBEA 3VDCA 1RJZA 1ET8A 2SEBA 5LLIC 5HHPB 4ZOCA 4QYAA 1YNTF 3WMPA 3ZZSA 2VDNB 3RWCB 1QPKA 1YPZF 2CAKA 2W5PA 1GYAA 2E9WA 1PLBA 5C2UB 1A1MA 1XF5B 1QATA 2H7WA 4KKBD 5FDWB 4JO4L 2IGLA 5ESQB 1E42A 2R51A 3EYSL 1JSYA 1SJXA 2R23A 2XCMC 3NSYA 2KKQA 2NY1C 5JO5A 3HAEA 4YHNB 1KELL 1Y6KR 5E8DH 2JB6A 5GGQH 2J57A 3PQYD 3QPXL 5C0EB 1QAWA 1DEEA 1D6VH 1FZOA 3RHWF 1GSMA 2ZSVB 3FB6A 3WELA 3DX8B 4ZPTA 1VA9A 3CX2A 4FI7A 3GMNB 4NO0A 4GLRH 1Q9WA 4N25A 4Z8FH 4QRTA 5LQBH 3CVHB 3D85D 1JOIA 2OJZH 2GPZA 3LSOB 3BJ91 1TQWA 2V9QA 2WQAA 3EW3B 4YS4A 2BS8A 5GISH 3VFPA 2GUOB 4PREA 2DPKA 1ILSA 3AMKA 4NJ9L 1DQTA 1RZKC 3UJJL 2EDMA 1WUZA 2WAHA 2F5AL 3A6BL 4EUPH 5HDQL 3GKWL 1NC2B 1ZVSB 3HJ0A 4FKKA 3DC0A 2J8UF 4FA6A 4X9GA 2MWCA 1U8QA 4JHAH 3IGUA 4MRCA 1OTSC 4QCIA 3W11D 5E08L 3MNZA 1X5JA 2VXUH 2DMKA 3H3KA 1XF3A 1EGJA 2E56A 4AYID 1HSAB 3ESOA 4H5SB 4HJ0C 3DRTA 1UFUA 3V5HB 2OMYB 3WFEH 2HKFH 3FCTB 5HYJB 5BVPH 1UA6L 4JHWL 3UDWA 2VDMB 1XGYL 3L5WB 2J2ZA 3HRZB 4DP8X 2XNAB 3BFOA 2DS4A 2EDHA 4F20A 2EC8A 4B96A 4GUQA 1Z7JA 2NQCA 4PN6A 4JS7A 4N24A 1MF2H 2E6PA 3P77B 4UDUA 1GC1H 3BEWA 5IT2L 3QZOA 1GTNA 1SEBB 4IBTA 3RKDD 1JFHA 1P1ZB 1JRHH 1DSWA 1RL1A 3VFRA 1NDTA 3F6LA 4KK8D 1Q0YL 4XAKD 4GUPB 1Q9KB 3KJ4B 2NLJA 4PJ5A 3FUEA 3CDZB 1CTOA 2XY1A 1WZKA 3DUSB 4AT6B 4PB9L 4P4KD 4QTHB 4E42B 1HI6A 4ABQA 1HSBA 2FR4A 3QAZC 2E8ZA 1NCWH 2N7SA 1MCIA 1HEZB 1KG0A 3V2AR 1F0LA 4ISVA 1T80A 1PBYA 4W9KC 3NCCB 3EH2A 1I8MA 5JNYA 2EXTA 4RETB 5C7ZA 1ZTXE 2ZE0A 2DQFB 1ETA1 5D4IA 1KV7A 2F1EA 5KBMA 2QHRH 9PCYA 3WNNA 3HNVH 4YBLB 1XGQA 2IGFH 5DA0B 2DZEA 2CRZA 1UD8A 5B3JF 5I82A 2XA8L 4TLTA 1ULVA 3WUZA 1NKRA 4B7LA 1EERB 1JTTA 4Z77B 4NKIH 5TE6H 2X6AA 1MCBA 4ZMLA 3ARFA 3VM5A 4PG2A 1HILA 4YXKH 3O8XA 4O58L 2CNZA 3CDFA 5BXFB 2IMNA 3BQUA 1AMYA 1N7MH 2R29H 3JWDH 4K3EH 3VACA 1MY7A 3KBFA 1F5WA 5JIMA 2WLZA 3D39B 4GSDL 2BHUA 4KV5E 4ABWA 3VU1A 2F8VA 1E50A 2QADB 5DJZA 4BKTC 5GGUA 4WW2B 2J6WA 5EHFA 3WO4C 3DUHA 5EORH 4BZ1L 5D5MA 4ZSOB 1NC2D 3GHPA 4AIZB 3PGFH 3ZDXB 1TG8A 5I6MA 2JJVA 4QTFA 4I4WA 3SE3A 4IEFA 2R1YB 2Y7QB 3J7HA 3QRLA 4RIRA 3G08B 2JCCB 4NQEA 5C8JA 5DJ8B 3UPAA 3CXDH 1ETZB 2X41A 1AGEB 3VNYA 1Z9SA 1CDJA 5IQ9A 3DX1A 3DARA 1D5BA 3UGEA 3MLTB 5DMGD 2CBOA 4QRPA 2Y6SD 4WHTB 1F1DA 3R8BB 1U8MA 3GSWB 4M7KL 3F7KA 5HYJD 4YXLH 1BQHG 5AOMA 4WWPA 4K7PL 2NY3B 4X8XA 4A2DA 1HH9A 4G80B 1BVKB 2H3NA 3PP3H 3PQYE 2HFFB 4N9OB 4F2ME 4L23A 3ZT5A 1NQBA 2VMJA 3ZLQC 2RTTA 4AGMA 3S9DB 1P5VB 1NEZB 3WS3B 1F4XL 4M56A 2ZKHL 3CVCA 4MAYB 5DDHA 2VNCA 3L81A 2VR7A 1KJ2H 1P2CA 4Q4IA 4Z23A 4G7SB 4DEWA 3CC1A 5ICZB 3X3FL 2CRYA 4K07A 2ATKA 3NIFF 1A4KA 1UHVA 3P69A 3X1GA 2XX1A 3GBEA 4OT1H 1NUDA 3BW9A 3U0TA 2DH2A 4R96B 2CJTA 1M05B 4NN5C 4XPAH 4PYHA 4X5PA 3KS0H 4PWFA 1XBDA 4DOHB 4XT1C 2DL9A 3JV6A 1LXMA 4PTUB 1MHPH 2VMEA 1R5IB 2JELH 5I1KH 2YEZA 2ZUXA 3H9SA 4OUUA 4YLBA 3AT0A 3SGDI 1JWUB 1VFAB 5I0DA 2OYLA 2XWJB 4FTVB 3GDCA 4Y5YA 4NRXB 5FHAH 1KNOA 1RZPA 3CFDA 3VFUB 3KLLA 2HAZA 3SPJA 2Q3ZA 2Z8VC 3WD5L 4L8BB 2ZKMX 3BIBX 4Y4HB 5SX5K 1F58L 4XPGH 4R4ND 3UGUA 5EA0H 1EZLA 3P2DA 1ZE3H 3G5ZA 2NSXA 3L2LA 4E9SA 3HC2A 4LT7A 4UV7L 2DKUA 3FU7B 2DYPB 4ZO8A 3QXDB 1BQHA 1WFJA 1XIWB 4A39A 5A2FA 5LCVA 2XIBA 3HEIB 4J3OF 3AACA 3PABB 4U1KB 4G2AA 1T7ZA 2IO5A 3D39D 3MUZ1 4L8DA 3V6FA 5D2NB 4QHNB 4GW5B 1Z9NA 2AJSL 2WBXA 1HDMA 1TQCC 1VFBA 2K6WA 4NZTL 3ALPA 4XAKE 5KWYC 5E1IA 3BQUC 2VLRE 5E94A 5IMMA 1C5DA 2E27L 1LEKA 4LASH 1BBJA 5CKAA 3BGFB 2Y07L 2YAEA 5F88A 2RH0A 5E00A 2G30A 5SX4H 2FWOA 3ISYA 4KUCF 1KBPA 4I3RH 1PL3A 1RULH 5FYJD 1FIGL 3EYVA 1PLAA 3FUDA 2K4AA 3NG5A 3UPRB 4XO4A 3G5YB 3BP7B 4YK4C 4UV4L 1DQQA 4NBXB 4W93A 3SHSA 1D9KC 3KH3A 4X6CB 4R7XA 1MNUL 1TITA 2MQ3A 4P23A 3LKQB 4H7VA 5MENB 5EC2A 4RGND 3WSQL 4NKMB 1E9PB 5LAXB 5D93B 5JHDA 3BN9D 5BW7C 3CVIL 1ORQA 3PL6B 4JG9A 3VWKB 1SMAA 4KRPB 3WJJA 5HHXH 2NY3D 5DEJA 3HUJB 2A9DA 3CFIC 2OS7A 4PJHB 1TPXB 2JKNA 4FQCH 3C2AL 1RVFL 4HUUB 3G6DH 3GLDA 5L2KA 2IH3B 4E2OA 1XBRA 1NCCH 3KBHE 5ELIA 4GOSA 3O6MH 5T1LA 3FUIA 2PO6B 4L3EB 4LNVA 4PQXA 1NGQL 5HVGB 4MAYD 2NW3B 3WIFA 2ITFA 5CZVL 5KVFH 1UWXK 2HZHA 5J06A 2DI9A 3K72A 4LKXB 3EHBB 2XT1B 3WEXB 1CLVA 3MRFB 3ZDZB 4X42A 2A6IA 1MI5B 3HRPA 3QWRD 4HXAL 3D25A 4OU3A 5A7BA 4BFNA 1X5FA 5I76A 3B1TA 4OM0L 4MJ5A 5INCA 4A63A 5B3NA 1XGRA 2P44B 4JQXC 1CYXA 1DVSA 1UXWB 2A3TA 2QEJA 2FGWL 1K6QH 5SWZA 1S4IA 4RMRA 2WWKO 4LPTA 1IEAA 3EBIA 1T3FA 3DPBA 1E67A 3QJVB 1GJUA 2VE6A 2MOGA 1IVTA 4OAWB 5CS7A 4JUSA 4FTVD 4AV4A 3MRJB 1RUAH 3T2OA 5DO8A 3UG5A 4AE0A 2YLKA 4B9GA 5DSCB 1ZS2A 5GRZA 4BDVA 1UA7A 4KX8A 4PJGE 4WQOA 1EQWA 5DJXA 5LBSA 5HYJE 3SKUD 4TSCL 4FXGA 2O5ZH 2CJUL 5F7HA 3F7PC 2DYPD 4X5XA 1FC2D 4PJEE 1LEIB 1XIWD 2ZIDA 5D4HA 1CVSC 2AABL 3M17B 4L3CA 1YEJL 4QT5A 2BSEA 4FQIH 4PJXF 1R33A 3HFFA 5F9JA 3UAJA 4DUWA 2OI9B 3PPSA 4DKEH 4KVNL 5D7IA 4HUVB 3HZVB 4LSTH 4L8SC 3IJEB 3TPKA 2EJ1A 1XB3A 4ZFFB 3VFTA 4N2CA 2UV3A 1JYVA 2B77A 3BH4A 3LKPA 1KN2H 3I9AA 1KSRA 4EE2A 1I7ZA 5K9OB 3M7OA 3MCKA 1ND0B 2BW5A 1X5HA 2D7PA 2PWHA 4KUZL 5DC4B 4KHXH 5C0IB 2BOBB 1WFIA 1YMMA 3BGMB 1ZA6A 1UVQB 3Q06A 1NCIA 4WEUD 3D9AH 5I74C 3VMOA 5L8KB 5I2IB 5AG9A 5FGCB 1AXTH 1N67A 2HKAA 2XQYK 5GZND 4F9PC 32C2A 1KGIA 4KVCL 1FE8H 2NNAA 3IGFA 4B9CA 5AB0A 5A43C 2PW2A 3BP4A 4UIKL 2ZZUT 1ZHLA 5I6NA 4P4RB 3VWKD 1SYVA 1CICA 3AQYA 1XTMA 3MU3A 4ZW7A 4KGJA 4FQLL 3ZQ9A 1JHKH 4BWWA 3V52L 2O5YH 2ZOKB 1OAUH 2PO6D 2VM4A 1I3GH 2NR6A 3F12B 1B88A 6CGTA 1SMDA 3H8NA 4WKZA 4KQ3H 3EHBD 4HMDA 1EAOA 1BZ7A 1SY6L 1C8PA 1MI5D 1WAAE 1CWVA 4L9LC 3HPJB 3P4OB 3RVWC 2C7FA 2GFBA 3QO0A 4WI3A 5JHMA 4KK6D 2QKSA 2BXYA 2DQ6A 3KR3H 4LEOB 4NSKB 1ED3B 1IFGA 2P43B 5LXVA 3HTLX 1CDUA 3NFPA 2PWGA 4P46B 1XD0A 4M48L 4MQ7B 4UYPA 5IGXH 2R4RL 4H8HA 3SDAC 5CP3A 3ZDXE 5I71B 4YL4A 3DXAA 3SDDD 1J87A 1GIGL 5FYJE 3IJHB 2GJ6D 4P5RA 1KENL 5CILH 5I0YA 1IIIA 4HZAA 4X9IA 1AP2B 4BINA 4YZFF 4FQ1H 4ODSL 4MJID 3FULA 3KPMA 4UTAL 2I69A 2WXKA 1D5XB 2XFXB 4EZLA 2OZNA 1BFVL 3FQNA 1CFTA 1M57B 4E9RA 3L3HB 4RGNE 1Q72L 3L8QA 2O5XL 1S9YA 2VZ1A 1WA0X 2ORBL 3KDMB 2V2XB 4KI5C 4R5TA 4AZ8B 2ITEA 1YC8A 3SDXB 1LO4L 1VFOA 2FEEI 2R2HA 4MD0B 2K3TA 2GY7B 4OCLC 1WD9A 3JWNC 4FQ2L 2DWTA 2XWRA 4J2QA 3VH8B 1AKJD 3NCMA 4S0HA 4HG4K 5KTEL 5AAWA 5AOLA 2X3CA 3VI3B 1IL1A 2H4EA 3NACH 3T8MA 4FXGC 1E2VA 4RRPG 3LMJH 1HHKB 3WN6A 1ANUA 2YAHA 1KPVA 5KSBE 1IX2A 5AB9A 1U8HA 5CCKH 3TIEB 5EH1A 4HWBA 2YUXA 4PJCB 1KULA 3EYUH 5F7NC 3A5VA 1KACB 2DQMA 3TH3T 2FAUA 1O7DC 4YEFA 1DANU 1DBMH 1KJ3L 2OZ4A 1UKTA 1MIML 2W0KA 2IANB 2GJZB 3QCUL 3QXTA 4UQ3B 1MFUA 4JBSA 3MI6A 2WBWB 5T1KD 2WBJC 2KL6A 3OB0H 5CP7B 3EGSB 3QUMH 2ISDA 4K7PY 3KLQA 1LK2B 2C5DC 5J9PA 3VFOA 4Z7IA 3VUAA 2QTEA 1WCBA 5DJYA 4YSCA 2H0JA 4JQVA 2W92A 3TPUB 5ISZB 2FEJA 1E5YA 1A1OB 3H9HA 4MFHA 5F8QC 2YKKA 4A6YH 4EUPG 3ML9A 3NP3A 3IT8D 1HL8A 5T33H 4I9XA 2X4RB 2VUOA 4G7QB 2NY0C 1RUQL 1ETJA 3BXNA 2CE6A 5B1CA 4HHAA 3LV3A 1ZT7A 2XWEA 2DMBA 1AVAA 2BSTB 3P0YH 3W5MA 5HD8D 2UYLB 5FECB 4L4VE 2CCWA 1OO2A 2R4SH 1RU9H 2CDFA 5D7SH 4PJFA 2UXFA 5F1IA 3BPCB 4RRPA 4G6KL 2AEQH 5IFJB 3BUQA 3KLSA 1E6OL 3RTQB 3L3DA 2W9EL 4H8WC 4M6AA 4XNZB 4C83A 4OGXL 2CO3A 2VDOL 3GRWL 4PS4L 15C8H 4AEHH 1A5FH 4UIMB 2Y69B 1A9BA 2TSBA 2XN9A 4EF3A 5J12C 4NZUH 4JO3H 4OZGB 2J8UB 2XXGA 3BH9B 4XC1H 2C3WA 1EMTH 3VMNA 2EICA 3QJOA 1XH3B 1RD6A 3DJSA 4IIQC 4KJPC 4OVUA 2H6PB 1S7UA 4CL7A 2ERJC 1B6UA 2XZCL 4CDGC 4N8PA 4IMLB 3VNZA 2CRIA 2R0ZH 3U6RA 2DLFL 4FXTA 4PJHE 1I85C 3BT0A 4WV1C 1DBKH 1JN6B 2NY5C 2AANA 1VACB 1Q38A 3GS7A 1IGFL 1ZDQA 3PP3K 5LN8A 4XXCC 3FU3A 5ANHA 1ZANL 1XWVA 2A9BA 4LSDA 5FFGA 3T2QA 4EUPA 4N5ED 4FMKA 8PAZA 3AREC 2PTTA 3B7UX 3BVVA 2W80C 3FT1A 4F9LC 1DVZA 1DVFB 1R34A 2AV7A 12E8L 4JM0A 2J55A 4JY5L 4PS7A 1JHTA 2MPAL 2AJ3A 2XZQL 5MP6H 3TTSA 1MAMH 2F7OA 5DU7A 4YLCA 1QHPA 1M7DA 3HIZA 5T3XD 1UENA 3BISA 2K7PA 4Y1AA 5CFAA 2X9ZA 4P5TB 5DLML 2VN3A 2GJRA 3GZQA 4MB3A 5KSAD 5EWIL 5C0BD 1AIFB 3LS5H 5D2LB 1SRDA 3S3PA 2CO2A 5KSUA 4EIUA 4BK4A 3VYPA 1L7TH 2XVBA 3T6ZA 5I15H 2HH0L 1CC3A 3DV4A 2G4GA 2OV0A 2IAND 4NUMA 3MV7D 4XMXA 5KS9B 2B08A 4AEIH 2UY6A 2HVJB 2GJ6E 4WI4A 2OSLA 3FQWB 3T0VA 1E7VA 4B9YA 3OZ9H 5DFVC 3KPPB 3OHXC 2WHVA 3MRGA 1JPGA 4MJIE 1OGTB 2WMPB 2EH8L 5ISZD 1T21A 3SCMA 3I6SA 1EH9A 1JPST 3RIFK 4HV8B 4GRLB 1ILUA 4MJ2A 5AYTA 1OPOA 3MBXL 4PBWD 4GI8A 1QP1A 4FKEA 4TNVF 3AAZB 4Q6YA 25C8L 1IGTB 4WI8A 5KEZA 3IFLL 5C08B 2WYHA 4JPKL 3RDTA 4N28A 3ZE0F 2AGJH 1S7VA 4HMCA 3L5HA 4JN2A 5C0GA 3WNKA 2BP0B 2WLIA 3APCA 2C7UB 4UT9H 1ZK5A 5L4JA 4IGBD 4JCMA 5IW1B 1T6WA 3EJZC 3U4EB 3I3BA 4BEIA 4HFWB 5BS0A 1PEWA 3QUZD 4QXGL 3TM6A 1MKFA 2EO1A 3BC9A 4HYTB 2F7QA 4HGMA 4JUTA 4BFIB 1HU8A 4PJ9A 4YFEA 1N70A 1KTJA 3RP1A 4JRXB 3BUYA 5I8OH 4YSAA 1UM5L 2EYSB 3II1A 4PG9A 4K71B 2QVKA 4D0BB 1MJ7H 3QG6B 4JFEA 2R27A 3H3PH 2JWYA 4LSQH 3VRJA 3GSRB 4I5BA 5ERWB 3SDCB 1TYRA 4K5NA 5F6IC 4HXBH 2XWZA 2VDOB 1IAIM 4HSQA 4AX3A 3ARPA 3FN3A 3V5DA 1MCPL 4ZW5A 5ANMB 2AKRB 1K4DA 4CNIB 3TH4T 4KK5D 1HXMB 2WZ0A 2NZIA 5DMIL 4HJGA 1PD0A 1OARL 3IPBA 1SF5A 3EOTH 5F97E 1QRNA 4WNQB 3HI1B 2BVPB 5LO7A 2WQWA 3BAYA 4IRSD 3UP1A 1F8TL 4L2YA 4OQTL 2WXGA 3N9GL 2O6FA 2JKWA 4KI5E 4RRPM 1G7JB 4DP0X 4TXVB 1ZLEA 3WFCL 1EEZA 3B2VH 1BZDA 1DVFD 1A0QL 3V9CA 2XVKA 1P4BH 4NQDB 4OFPA 3IGKA 1NIDA 2DQGH 2HT4D 3L2MA 5CMAB 2EUZA 1PY0A 2G3ZA 1FIEA 1QYGL 3UYRH 3KGTA 3LN5B 4PYGA 4UOZA 4ZFOL 5IHUL 4PWJA 4KPHH 4DVRH 3OJ2C 4Z7UE 2G9KA 5E9NA 1TTUA 3VB8A 3BPNC 5E0FA 1IQWL 5JW3L 3Q2CA 1OALA 1MW1A 3V0WH 4XOCA 1H3PH 4FEIA 4Y4KB 4D9QD 2RQ8A 4CADB 3VGAC 3D3VA 1KFAL 5D6CA 4PHZA 4X6BB 2QMKA 4ZPVB 5BUPA 1LEGA 2HTKD 1UACH 3FB5B 5AW4B 4F7TA 2LGNA 1ZHKB 2NOYA 3K2UL 4S2SB 4K94L 5HGAB 4F3FB 3LQAC 2AI0L 3TEWA 3O0RH 1AD9A 1KJ2A 7PCYA 2A0LC 3NIGE 3EO9H 2BMKB 4PJEF 4K3JL 1QKZL 2FATH 1E8YA 3BKML 3EFOB 1OKEA 4HLZH 4PJBA 2JB5H 3SDXE 5C0RL 4RMWA 3QH3A 2E6JA 3ZSTA 5A7EA 4PJIF 2X53A 5DEGB 2G60H 1IGCL 5D7LB 5C08D 3X1BA 4OY9A 4EAEA 4BSJA 1YEKH 1G0XA 4IRJA 4WHYH 3QARA 3PFUA 1JYNA 3T8XB 1HQRB 1F3JA 2HT2D 2NW2A 1XXDC 4EKJA 1HL9A 4LBEA 4F7MA 5ENWB 2HB0A 5MI0B 3N41F 1CE6B 3HE7B 4JN1L 4YXHL 5T3XE 2WTRA 1RQ5A 3B9VA 1ZHBB 3GJFK 4JRXD 4GG6A 3GXIA 4BFEA 2D7TL 1LGVA 4OCYL 5AKTA 5IROA 5C0BE 2UZPA 5I23A 5IMOB 3TF4A 4UM8A 2Z1PA 5J56B 3QQ3A 2C1PB 4FMVA 3ILQD 1I1YA 3ILEA 4TVPE 3SDCD 4TUOB 3MV7E 3LNGA 3QHFH 3B9KA 5GS1C 4QF1B 2Q0ZX 2QDVA 3LXUX 2X7LA 1WO2A 2HX8A 1MRDL 4HIXH 4HD9A 1G7PA 5IIEB 1XCXA 3O3DA 3CMOH 1MHCA 2Q7YA 2OMVA 3QA3A 35C8L 5JXED 2YSSB 5DC9B 1P9MC 1X5AA 4FKHA 2Z3FA 1IEBA 1U36A 1WWWX 1J0JA 4TMPA 5CJBA 2P7TA 4JMNA 3LZPA 2Y5QA 2P4AB 1KIUB 2APVA 3FTGB 2IBZY 4W6YB 4EN3C 3K2IA 1N26A 4BFKA 1KYOJ 2Z65C 4NQDD 1OTUD 2NZ9D 3RNKA 4B50A 2D03L 2Y72A 2ZOLA 1AZCA 2IPKA 3QHTC 1CTMA 3DYMA 1KCVH 4EO5A 4OCWH 5B8CA 2WP3T 3GSQB 2EACA 4PRHB 5BO1H 1M7XA 4PLJC 5HHMB 4XHJD 1Z5HA 5L2JB 3DOSA 3JV4A 1HH6B 2EADA 1W9XA 4ZFOB 5BRZA 1KWKA 4Y4KD 5BQ7A 1U6AH 1B4JL 4OBRA 2PCPB 4NDMA 2SODB 1I3RA 2FX7H 5DHYB 4M61B 1NMBL 3NCJL 4DJMA 1CFSA 3T4AC 2ZCKL 1HNFA 4OZGE 3VXUD 2KYIA 4WEEA 1BV8A 2R59A 1JPTL 3VFMB 1T66C 2YS4A 1QBAA 3RA7L 4LVHC 3MRMA 3FU8A 4Q9QL 5ETUB 3BWSA 2ALAA 4WDIA 5KBLA 3O41B 2IAMC 2JH2A 5FC9A 4U6XA 5A6MA 4WK4B 4MHHI 4PAZA 1RMFL 1M53A 1CURA 5D7LD 4Y4FB 2W07A 4CN6A 2R8SL 3MBWB 4Z7NB 2X0VA 3OKLA 5F89B 3CZNA 4UM9D 4LPCA 5CBEA 3VVVA 3KWTA 3QRGH 1IFRA 1N2RB 3WENA 2WLNA 1P5UA 4AQEA 3DTXB 4AMKL 1EANA 4M02A 1HL4A 1ZHNB 1JZEA 2Q3AA 3EJRA 2WTPA 4MZIA 5K9JH 1U8IA 1NGZB 4HIJA 4KO5A 2ESVD 2EABA 2X6MA 5IESH 4NBZB 5B1JA 4N2IA 1FVCB 2JKSA 3L3GA 3ZKXC 4QTIH 1LO0H 5D2LE 3KPSA 1XH0A 3WKML 5F7DB 5D96B 3G5XA 3MC0A 2HFEA 2ICCA 5HHOA 1IO4C 5K1VA 1KBGH 2FO4A 3LTVA 4PGDB 5HY9B 1A6ZA 3FQXB 4AH2B 1V3KA 4Z7QE 5FWRA 4MAUL 1JK8B 3FCUB 3TYFB 3QDJB 1SHWA 2V5RA 2AK4B 3ARYA 2P52A 3CFKB 2PYEB 2E6QA 2HLAB 2D3JA 4WK2B 4AGPA 3NFNA 5D5MF 3RWHA 3OB0K 2GIYA 5H94A 1G6RH 3PHOA 1RLWA 1MCLA 2AV1A 2CUHA 3NN8A 4I89A 3GGWA 2MTAA 4M93B 2W1NA 2ZF9A 2XZZA 3S8GB 1IC0A 1F3RB 1YNLH 1BXUA 2XG4B 1G9MH 2XRAL 3AFLA 4JFXA 2C9PA 5F3FA 4E41A 4IBQA 2HJKA 5EU4B 1ZIBA 3SD2A 4HS8H 3ABMB 3QJHA 1SJEB 2AK1L 2DLTA 4LEXH 1JIBA 1NGYB 1RZ7H 4L2LA 1OK0A 2QKIB 2AF2A 2KQMA 4Y19B 1F41A 5FO8B 3OJDA 2BZ7A 3NJHA 4NYLB 2O4EA 3CFTA 1MOEA 2ETWA 1UWGH 4PP1D 5HHMD 3BLBA 1MCOL 3ETSA 2OXGB 3KW8A 3Q3GA 4WTZG 5AW1B 3TCLA 1MHEA 1WFMA 4XE0A 3QDMB 1BVLA 4DK6A 3CCHB 3OAUL 3NTCH 4IHOB 1FAIH 4BRJA 4IOIB 3C60A 1CD1A 5C7XH 2WXNA 1DZ0A 1HAUA 4RVBA 4R7DA 1QFWL 3QXAB 4DO6A 4YPGA 3X14B 3VXSD 1P84J 2NY6C 4HJTA 4JY6B 1DBAL 3UTSA 3LKRA 1XL4A 1AXSB 1ONQA 1WFOA 4W9EC 1EXHA 1G5AA 1KLUB 3R18A 5J7CC 1DO5A 3WN5B 5I18L 1LDPH 3QEQB 4ZDHB 2FJFB 4AYSA 3TBWB 4FULA 4U6VH 2OJ1A 3O0LA 2V9RA 3I2CL 4FFYH 1MQKL 3VFSB 2RB8A 3T0EA 1N5YL 2A99A 4KAQL 2XKNB 4NQDE 4AQAB 5CEZE 5IJVA 1J0YA 2Y23A 3C5ZB 4FZ8H 1UD5A 1JGDB 3FB8A 3SDYH 1PEZA 1NBCA 3MJ8B 4F37K 3GB7A 1S7QB 2YD3A 2W60A 3CUPA 4EQ3A 3VU2A 5MEOA 5GGTH 2M1KA 3B56A 3EO0A 5AENA 2VDPH 4G7VH 1E4WH 3NJJA 4LQFH 4JB9L 3T0DA 2Q3XA 4P3DA 5DHVB 3D06A 2J25A 4CC4A 4JEGB 4TVUA 5E4AA 3LDBC 1BJ8A 2BJML 4PJAA 4WTZA 1Z9OA 4Z7WE 3QDJD 3VXTA 3TL5A 4WU7A 1PZSA 1DQVA 1GW6A 3TBVB 1UB5A 2VLJB 4FI8A 3CNKA 4J5VA 3PWVB 3T0BA 3BWUC 3U9WA 1BX2A 5KYUA 3VXUE 1IGIL 2R69H 4H1LB 2FECI 4J39A 4M00A 4HDIB 4WFHE 1G1OA 1S9KC 2YGOA 4AEEA 4R2GB 2VXQH 3C8DA 3FFOA 3NPSC 3T09A 4W6WB 5JOFA 2WOBA 3B83A 3NPZB 4N0UB 5EO9B 3VA6A 4XWGH 2WIIB 4B0MB 3MSPA 4O4YL 4F92B 4ZTPH 1K4CA 5BZZA 3TVMD 4N2GA 1KIQA 4X6EA 2J88H 3D4GA 1C16B 3KYKL 3P9MA 4OUOA 4Y19D 2GK0A 4QY8A 4EI0A 5EFIA 3VX0A 2X2UA 2HWZH 2OL3H 1DQKA 4FQPA 4DCQA 4G7YH 3OZKA 5ID0A 1EDHA 1QPPA 2HX9A 1ZGLP 1CGVA 2BSSB 3QUMA 3KPNB 5EOCJ 5J57B 1IZJA 5JPMA 2ESVE 4FQXB 2CIIB 2VR6A 2MTPA 4O5LL 4KHTH 5K93A 3TBYB 4YDKL 43CAA 4E9LA 1RZKL 3QDMD 4MNGB 2F53A 3UADA 3BCDA 4A6YA 3GMLA 5GSVB 4PRIE 4XTRD 3PREA 1T5WA 5DQDL 2EIBA 1P4IH 2WUCH 5DD3L 4DKFL 4XNUL 4IRZH 3QQ4B 1IFHL 1E9QA 3K4ZA 2HVKA 3PYCA 4XC3L 3TWCL 4MB1A 3BZDA 1IM3D 4MVBC 1KXTA 1J8SA 2Z7UA 1A7QH 5DUMH 4M7JH 4LF3B 4XNQA 1KIRA 4KY2A 2DQEH 2B2XL 3ZL4L 4TS6A 2YD0A 1M7UA 3GMOB 2Z7ZA 4KI5F 2GT9B 3QEQD 3OM3B 4GKZA 5HYSB 2XTSA 4K3DH 2I9LA 4NN6C 1MH5B 3C5SA 3MV9A 1EEUA 4GKSB 5DVLA 3T2NL 4JR9L 4A2MA 4FI6A 4IDLA 3RNQB 2Y6TE 3C5ZD 2CDEA 1UXMA 4YHPB 1LD9A 3FQRA 5I1DA 2OP4H 3SE4C 1DUYA 3D34A 4MNQB 1LNUB 4U0QB 2QQKH 1SGKA 2X89A 2WWOA 4DPRA 1FO0H 1OPGL 2FD6H 3P73A 4U0RC 4LPXA 2OPCA 4KO9A 1E5AA 4GP5B 4U1LB 1NDMA 3ZDYF 3D30A 4FDWA 4RWYH 2B3RA 2ICES 1OSZA 3VWJC 4NAQA 4I1RA 2VLJD 3QBTB 3NIGF 1GKOA 2W9DH 4IQHA 5J11C 3M1BB 4DW2L 1LP9E 1CDIA 3QO1B 3VXSE 2CPUA 2QV2A 1FZKB 3P30H 4R2GD 2BERA 5EIIG 3LZNA 2EXWD 3TBSB 3AMLA 4BQ8A 4KJQD 5IWLA 1INQA 1KTCA 3NAAH 1XXFC 4TNWK 5JMOC 3FUJA 5D1XB 2MSPA 1C7TA 3WIAA 4MMZC 5EZJB 3HHSA 3VRLE 3O3EB 1PTZA 3OPZH 5EU3B 2GSIB 2HUHA 4ZUTB 3QIUC 3U30B 3U2SA 4LGPB 3ARZA 4AYBA 3NVQA 1I8AA 1K2DB 3ZE0B 4Y16C 5GHWL 5C6TL 5EOTA 3CN1A 5D7HA 2DJSA 2QGDA 5C0NC 1TETL 1JGVL 2VXSH 4LSRH 2XPGA 4EDXA 1ZVHA 3MRCA 4Y7OC 5DD0L 9CGTA 3SKNB 3QIBA 1F1AA 4GUOA 4LSVH 1CXKA 3ULAB 5DI8A 1S7WB 3WKYA 4JPVH 3FO9A 3D2UA 2H1PL 3ZRCC 3W0WB 1N12A 5JPMC 4RSVA 5JLZB 4YOKA 4QWWC 5M94B 3TURA 3QJTB 2X4UA 2DTSA 2ZNXA 1L6PA 5D9SB 3I50H 4NHCL 1QACA 4MMXA 2ZP0T 4I0KA 4NPYB 5DJ6A 3HR6A 4UT9A 4C56D 4QOKA 1R3KA 3DX2A 2BIIA 2K7QA 1USZA 2VDNH 2EZ0D 3NCXA 3WBDA 4QJ5B 2V8LA 5BRPA 4PV8A 2D9CA 5C07B 4B7IA 2I26N 2QVFB 2ZX8A 5DUPL 1W0WB 2F8IA 1EGJL 1WEJH 3GSUA 3MRLA 3RZWA 5EIIA 1BD2B 2FHBA 4JO1L 3RU8H 3CTTA 3E6FA 2OMXA 5EN3A 3SYQA 3UIZA 4Y19E 2P8LA 4YDLC 3WDJA 4LHUB 5ALCL 1JP5A 4WO4D 2ICWA 5FB8A 3BO8B 2EVJA 3C6SA 4D7BA 1TLKA 5F70A 1A1NA 3U7WH 4RDQG 2HA1A 3D0VB 3M6DA 4DFHA 3MMEB 4A7GF 1M71B 3AW5A 3V0VA 1RAMA 5E8PA 1GYCA 3WTUA 2CO1A 1YN6B 2UWEE 4YDIH 1CT8A 3MFFB 3D6GA 5I73C 1U42A 4NQSB 1MCQA 4OB5L 3FO0L 5IFHL 1G4MA 4WHYG 3LVEA 5EU6B 2EIKB 4JG5A 4P2AA 2R2CA 2I25N 2PPFA 5F1OB 1ZSDA 1JGUL 1IGJA 4DN3H 5JQIB 1DYZA 4OD3H 4PGBB 1ZWIA 2WB7A 2ZF8A 1CDGA 1E4XL 1LQBC 2AJXH 4NWTH 3NSXA 4JM2A 4LCUB 3AS2A 5IVZA 3FN0H 4D0CA 4Z78B 1N0XL 1W8NA 5D1XD 1KT2A 1RJZB 1UD4A 2SEBB 2XU9A 3QEQE 1T6VN 1G1YA 4RGMC 1BYOA 4DUXA 4P07A 2XUWA 1N6VA 4OIAA 4FN0A 5GZOA 4P5MA 4PJIB 3CFBA 1JZHA 3WE6B 1XQ4A 2V7NA 3WNOA 2VDMH 1A1MB 3KXFD 1WLHA 3F84A 4YSQA 1H3XA 3CLEH 3TV3L 5B38G 5E99H 1BIHA 1F4WL 4OCRL 1QR4A 2R23B 3HAEB 1XR8A 2JB6B 1J1OL 4XCNA 3VTTA 1E5UI 2J8HA 4JZNA 1DEEB 4Q9CA 2K8QA 5JPNC 3FB6B 4JLRA 1FCCA 4LCYA 4OLZH 5AW2B 4NO0B 1Q9WB 2HRLA 2JFCA 1WTLA 5HJ3A 1EJOH 3W0WD 1E40A 2ED9A 1MFEH 2PLTA 4NZ8A 4G1EA 3WO4B 4DAGL 4UQDA 4XVTH 4DGUA 1MHHA 3ULVH 1FG2A 2WCGA 1M3IA 1TJXA 2VLJE 4UMSA 4HEPG 3VFPB 2EE9A 1CL7H 3KD4A 3OMAB 2ZUQC 4PREB 4YIQA 3FT0A 5DD5H 4NM8H 2DQDH 2ZONA 3ZSSA 1ZJBA 5KJ7E 4FP8L 5JXAL 1CD9B 4N0UE 2Y5TA 4UNIA 5C07D 2O30A 4KZDL 2Q6WA 5KG9B 4MMXC 1RP9A 1JDCA 1BD2D 1YG9A 5T3ZH 1DL7H 2B59A 4QCIB 4P2YA 3MNZB 4U7MA 2DD8H 5DURB 1XF3B 3LY6A 1X4ZA 4LHUD 4NQCE 1PY4A 1O6SA 1T89A 5FGBC 4PJ7E 4X50A 4PRPA 1WZMA 3E3QE 3EJTA 1KELH 4NCC2 2WNGA 4FNUA 7TAAA 3QPXH 1RIHL 2ROYA 1MFDL 2A83A 3FFCD 1UASA 5GGVH 3MKKA 2PCYA 5EPMA 1DN0A 1FJ1A 1QPXA 5F3BA 2BIPA 5TK2A 1FNAA 3QJUB 4MCNA 3OAWA 4UDUB 1YEIL 2ZYIA 3NCYP 5GS0C 5BVJA 3BAEL 4KRLB 3D05A 3Q1SH 4JVUA 4Y9BA 4DVBA 4G8FA 4GXUM 4TQIA 2BS9A 1W16A 1KCUL 5EU6D 4M7LL 4KKNA 2LT9A 3AGVA 1PZ5B 4PJ5B 5D1QA 2NX5B 4NJ9H 3QK0A 3UJJH 2QSCH 2F15A 4UI2A 4M8UA 5I6XC 1HI6B 4B41A 1HSBB 5I26A 1XZ0A 4C56E 3GKWH 2JJSA 4HEPA 1J5CA 4V2BA 1BLIA 1KG0B 5G5DB 4F8LA 2O5NA 4TUKL 2ZT9C 1CBVL 3W56A 4WGVB 2LFEA 5E08H 2M2DA 3L3JA 2JF1A 4OF8A 1OF0A 3GS4A 2CKBA 2G2RA 4J4PA 1E4KA 3NH7L 1XGQB 4KWUA 1KC5H 2AJYH 1DLHB 5IEHA 5J5EA 2HFGL 2C9SA 3QQ9C 4HUWA 1GMEA 5F1NA 1UA6H 4JHWH 4ELMA 1B4LA 2NTFB 4Y5XA 5MEQB 4DETA 4IMKA 3V4VA 2IDTA 5KYXB 4GIOA 2MOQA 4ODVH 5LCVL 5IT2H 4HBCH 3EIFA 4H8PA 4FLHA 1HILB 1TQCB 4YVUA 1VIWA 2LHAA 3I9GL 2IG2L 3BQUB 3UTTB 3V6BR 4LHQB 2ZWSA 4U31A 3MV8D 5K59E 2KPNA 2ZTBA 2OULB 5F9OL 3EDKA 1QBMH 5D6DA 5INDA 4AWJC 5I5MA 3H55A 3L17A 4BSWA 4PB9H 2XPZA 1UTDA 5E5RB 5AQ0A 4N2EA 5DJZB 1KN4L 1U8JA 4YK4B 3BZEA 5CN3A 5HXMA 1A9EA 5D5MB 5DEFA 5FGRA 4EPSA 3LNHA 4BD4A 5G4MA 2W8CA 3BGAA 2L7JA 4G9FE 3VDBA 3IK2A 3TFBA 1VKXA 4NQEB 5C8JB 5DURD 2VLLA 5GXBB 2IXQA 5E5LA 2IGTA 3EJYD 1G7HA 1MAKA 1Z9SB 1ASQA 4YN3A 1XZWA 3LH2H 3HBPA 5I1JL 4QRPB 1KZQA 3KXFE 5FW6A 3QJZA 1F02I 1U8MB 3CK0L 1MCWM 5DS1A 3FXIC 5BJTB 4J3XA 5JZ7C 1JXDA 4TSAL 5DWUL 2C1OB 1G1CA 4HUCA 2GEQA 1G6RA 3S96A 1HN1A 3W37A 4QKTA 2EVIA 4JRYB 1FN4A 2A6JA 3VSQA 1CXHA 1P6FA 1FPTL 3UERA 5JA9A 4XP9H 2FCBA 5DDHB 3QULA 3Q44A 4GSDH 4AQ1A 1P2CB 1K5NA 2NYYC 4R4FH 4PJ5D 3OC8A 1G94A 3GXDA 1A4KB 2Y7MA 2GSMB 4I0PC 3QQDA 1G7LA 1I9JL 5IB4A 4S1QL 3IDUA 3LQMA 4WGKA 3BW9B 4I18A 1DDTA 4HOXA 1L7IH 2EDBA 3HN8A 1NCUA 4UINL 3RYMA 5G4NA 1LTXA 4ATTA 5HI5D 4S1DD 3FBKA 5L0QB 3G5VA 1YRKA 2UXTA 4K23L 3ARDC 3MGOB 3JV6B 5KVDE 2N7BA 4FJZA 4OGAD 3GDBA 3OR7A 1BD2E 2X9WA 2YO3A 4OUUB 1L5GA 2FLMA 3CLWA 5LBSL 1HS6A 2APTA 3INOA 5DQJA 3L4TA 2OX5B 4M7KH 4PJBF 4GAJL 4Y5YB 5AVSB 5FKPA 3ECBA 5B8CB 4A37A 1MJUH 4DQOL 3RWIA 5LJYH 1KB9K 3KPRA 3ARFD 3G5ZB 3FFCE 4JREC 5DJ2A 2H8PA 3Q13A 4L8SB 5ICXB 5T5FA 1FVEB 1NIEA 4MXQD 4X4ZA 3IN0A 2WVUA 2G3NA 5C0JA 3GHEH 1ZRUA 3O8XD 1BQHB 3PY9A 1F4XH 4OJEH 1H3TA 2ZKHH 4HISA 5ALBL 4E9TA 2HUEA 4RFOL 4ZQKB 5F9WB 3HMXH 4J3BA 2BVEA 3DMMA 4IMKC 4JNXA 1UGKA 4Y1SA 5F7EH 4L8DB 3X3FH 3V6FB 2AJUL 2M8XA 1K72A 1NMAL 5EUOE 1HDMB 1VFBB 4FG4A 4BK5C 4BH8B 1OQXA 4GG6F 2NXZD 4QGYA 1NPUA 1KTDA 1TZOA 4FFYA 5E94B 5FYKL 1LEKB 1A7PL 2L7UA 4LOUD 1IZKA 5F88B 5E00B 3W3BA 1IBZA 5SV4A 3K8MA 4WFGE 2FWOB 2H32A 2RAMA 3N3EA 3KYAA 4GY4A 1PAMA 1QFUL 3EYVB 3OGCA 4UUJB 2F54A 4MCMA 4KTDL 4YMPA 3NZ8A 2BDNH 4ZJ9A 1DQQB 3ZKMD 3GSXA 3MCLL 5A3ID 5HI3D 3RBSA 4NO3A 1JYWA 1MELA 2QVTA 4FADA 3CE1A 4K9EH 4QRPD 5EC2B 3V0HA 1F58H 2N59A 4DGYH 1ORQB 4Z76A 1A8ZA 2G3MA 4UV7H 2R69A 3F65A 5DUJA 4G42B 5EC1B 3RURA 3L9YA 3OG6B 4UQIM 1UYWL 4G6JH 3CZUB 1HWHB 2QQNL 3UTQA 3WIFB 4W4OA 1ZLVH 1CLZL 1SM3H 4ICXA 2BS71 3MV8E 4XPTL 2AJSH 4AM0A 3F7LA 4ZMYA 5HHVL 2YK1L 4QRUB 1KBWA 4UAHA 2YMXL 4Z7OF 2VAAA 2A6IB 3D25B 4GBXC 2E27H 4W9CC 1BAGA 2FGZA 2Y07H 3N85L 4B3VA 5I76B 2OL3A 5FOBA 1XGRB 1J8HA 4CA4A 4OF6A 3APNA 1FIGH 3AG1B 2PUQT 1T0MA 4YC2C 3UTPD 4HK3N 4PWKA 2Z7WA 3WKNA 1EFXA 3K81A 5SWZB 3RVUC 3CZGA 3WKPA 4MA3A 2B20A 4B9IA 4MMYA 3H9SD 2NY5L 3DPBB 3NRFA 5DZLA 2VE6B 2EUWA 3KPTA 3WSQH 5DRWB 1K3ZA 3EGXA 1Z0MA 2XA3A 4AQOA 2FLRT 3T65A 2UVFA 4KI1A 4KKLC 1YHPA 2J43A 3DIVA 3CVIH 1OOWA 1QLFB 4IRZA 5JW5B 3O6FC 1XB8A 3V0JA 3MLZH 3R7RA 5DJXB 1ITBB 3GUTA 1T83A 5IV2A 3VD2A 3C2AH 1RVFH 3DURB 4FXGB 3F05A 1IAMA 3VQLA 3I84A 1IIKA 4X5XB 3QJFB 1FH5L 3CHPA 4YDJA 3P9LA 4MCYA 4PI2A 2H0PA 3HMWL 4L3CB 4OZHE 1H0DA 3IXAA 4DT2A 4NXKA 2J4WL 4QT5B 1WYJA 1U8OB 3WG7B 4XVSL 2EDNA 3BFQG 5D7IB 5E23A 4HWBL 5E2TL 4NCC1 1Z3GL 4HXAH 4N2KA 5B1KA 5C0AE 3VFTB 1HXKA 2EE3A 3WJMA 3ZDYB 3IDXH 3IETB 4PJ5E 3NYKA 3UBXG 3BWUF 1DHKA 1TZIB 1IC4L 4B3EA 1PKQA 3NJVA 3MCKB 3JTSB 1GJWA 2OZ4L 3NK4A 4JDZA 5DHEA 3O3AA 2WB1A 4WUKL 1KZYA 1QWUA 2V8MA 2JKTM 1NC4A 3QG7L 1YMMB 3ME0B 5C0CA 1ZA6B 4WU5A 3EDEA 5EEUA 1FO0A 1E27A 1INEL 2AXHA 2ZUYA 3ARVA 4GXUN 1Q8MA 2XQYG 3ZTEA 4P23D 5KW9L 32C2B 3UL4A 4QXUL 3TA3C 4XNDA 1IAIL 1RSFA 1D6EA 2PW2B 3FQTB 4MLSA 5EBWA 1OP3H 5JHDD 1VJSA 3JYBA 1RHHA 3ERXA 3NJGA 2CJUH 4HH8A 1BMGA 3N04A 1SYVB 3N2JA 4RAUA 2CCVA 2OQJB 5LGHL 3DJ9A 1JZFA 4ZTOH 3C6EA 2B0SL 2AABH 5IB5A 5L2KD 2AVGA 1YEJH 2D0HA 3A4DA 5T1LD 2JQMA 4KVNH 4PJDF 3CIAA 2IWKA 2WY3B 4ZTEA 4WKZB 5LBGA 4AKOA 4TOYL 2DJMA 4ZXBA 4ES9A 5DFTA 2GFBB 3QO0B 1GZQA 2H2PD 1SDAB 3L3OA 5J12B 5E8DL 5GGQL 4U1HA 3DRQA 4YDVA 1UOVA 4QJ3B 3NFPB 4EDWL 4JKKA 3UBXA 4OLVH 5EZOH 3ULSA 2OR9H 3IRZA 3CGTA 4IIQB 5SWZD 4NQTA 3D4CA 4UOW1 5CN2A 1PJ9A 3PGDA 1XSOA 3QCVH 3BPLC 4K5LA 4N1HB 5LQBL 1ACZA 3GBNH 5CZKA 4R5XA 3P3SA 4UIKH 3QDGD 4XP1L 4ANXA 2NCMA 3FQNB 1CFTB 3TS8A 4N20A 4QRPE 1DLFL 2APBA 2XQYA 1S9YB 1FUNA 3WNMA 1MW3A 4XPBH 2NUTA 3D69A 2QFPA 4FQLH 4P2QA 4WFED 1I7TA 2YPVL 3AGWA 4P2RA 4N87A 3SD5A 1CFMA 3V52H 3RGHA 2BFGA 2AQQA 2LE9A 3PAUA 4DSYA 3NJFA 1ZS8A 1IBBA 2BSED 3CHRA 4IOFC 3RWCA 3UAJD 3TESA 1IL1B 1T83C 1N8OE 3O9WA 5KAQF 2VXUL 1XF5A 3T3ME 1KPVB 3FW6A 3U4BL 3BUTA 1O9VA 2WWMD 5IQ7L 5AUMB 5L9DL 1NLDH 4EVNB 4N2AA 4ZUSA 1G43A 5I17B 2R4RH 3P0GB 1A6VH 1ADQH 4FYTA 5FYKD 2CQVA 3GMNA 4KXAA 1KENH 1MF2L 1OSPL 3RI5K 1GC1L 4BK8A 2RD0A 7CGTA 2EIEA 4KJWD 3AM8C 3ILPB 5K33A 1NSNH 1XGZA 3IJ9A 1JRHL 2WANA 4ODSH 3BN3B 3H9SE 1BFVH 2ZAHA 1X6LA 4NAMA 1CVRA 2P5PA 2YA1A 3ZKQD 3FT4A 4OLEA 2O5XH 1E2WA 2XTJD 2GUOA 5J9PB 2ORBH 3K0WA 3VFOB 3G6JF 1WCBB 5DJYB 1OL0A 1PIFA 1XMWA 1LO4H 2CJ3A 4PCYA 1CICD 4D3CH 4FQ2H 4KX9A 5A6LA 2YOAA 1ZVSA 2WVVA 3O45B 1AD0B 5K59F 1AE6L 2NR6D 2KBGA 3B5HA 2A74A 3V0FA 4AW4A 4C8XA