4KNQA

Crystal structure of 1nt-5'-overhanging double-helical ccg-repetitive rna 20mer complexed with rss p19
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
122
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
total genus 35
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2013-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4knqA01
4JGNA 4J39A 4JK0D 4J5VA 1R9FA 4KQ0A 4KNQA 1RPUA 4JNXA 4KTGA
chains in the Genus database with same CATH superfamily
4UNVA 5AB1A 4DAGH 3V10A 1MCNA 3P30L 4RGNB 4KI5D 1QFHA 2XVBA 4E41E 2GSMB 4JDEB 2WVVB 4Y5XC 4F33B 4F57L 4KRNA 1QFUL 1R3IH 3LPPA 3QWOB 5HDWA 3GHPA 1MUJA 4Y4FC 2AFNA 2J1YA 4X6FA 2UZXA 3C08H 4KO5A 4U6HB 2YA1A 4KO7A 3CFIC 4HGWB 5HHPB 1IBHA 1JMZA 4Y5YA 2AVGA 3LZQA 4QRUA 1D5MA 3DROB 2RTTA 1KJVB 4KX7A 1F02I 3BAYA 4WY7H 4MB4A 1U4EA 1UM5H 1WVZA 4LMQE 4OGQC 3P9MA 4HS3B 5TF0A 1J1XL 4YN3A 2O6CA 35C8H 2WKOF 3RZCB 2CH8A 1WEJL 4PJCE 1MFAL 1QI4A 1SEQH 2HT2C 1Q4NX 2FJFA 5JHDA 1UD8A 1R3KA 3QZOA 4UQAA 4MNQE 1BZEA 3EJSA 3TNMA 4PJ9D 3ZL4H 4BINA 1MNNA 1EWHA 1T21A 1VEOA 5CWSB 2VWEC 5F0MB 2V9RA 4UOZA 4X6BA 1MI5B 3GYRA 4MDRA 3ZY7A 3G5VB 3F7VA 4A63A 3MV8B 1ZK9A 3QUKA 1SF3A 3BKMH 1MCJA 3CDFA 2HN7A 3PXHA 4YDJA 5I1LA 1WFNA 3MNVA 2Y2WA 4XNQA 3WFCL 2P8PB 1GSKA 4PJIB 2JJSC 4LGSB 3ZRFC 4NQDA 1J10A 3DV6B 4C4UA 1NC4B 3RE0A 3UBXG 3ULVD 5ESVB 1JZ2A 3O41B 1JOIA 3SBPA 2ERJB 1MPAL 4WUKH 2YA2A 4GKZB 1YNLH 4W1TA 1ETA1 2K1MA 2YWZA 1FH5H 3L3DA 1DHKA 3EFOB 5FCUH 5GRJH 3FONB 2APXA 3ECVA 2VZTA 5C7XH 2DOCA 2R7EA 1F6AA 3MLYL 2A83B 2G3ZA 3P9LB 3GUTB 1DQDH 4KPHH 1WWBX 5AL0A 1VCAA 1SXBA 2DV6A 2K78A 3HBPA 2FECI 4MAUH 1LEKA 4YSOA 3FT2A 5DO2C 5I24A 3HG3A 1AZZC 4J28A 5E8OA 4F8LA 1CDYA 1OAYH 3EFDH 2EICA 2FEDC 4HWEL 1F3RB 4XZ4A 3C6SA 4P06A 4YWGH 5PAZA 3PV7A 2ZPKH 2VLJE 3GXUB 4J3BA 3TN0C 2ZICA 1RK0A 3QDMD 4QUOA 3BIKB 3BWSA 1O0VA 4RLDA 1EHLL 3NIDF 4ZFQA 5KSBB 1GOGA 2DQIH 2IALA 1JUFB 4BZ1A 4NXSA 4BFJA 4POZC 4HKZA 5JORA 2J8UB 4PUBH 2ZXAA 3KPOA 2CO1A 1C8QA 3Q2NA 4OLYL 4TUJB 5CZXD 2TSAA 2GI0A 4NNYA 3DVIA 4JG5A 4IKNA 4DP1X 2I07A 1GC1L 2ZYSA 3VFSA 3T65B 1H5BA 2HJKA 3QA3B 5C0DA 3VXMA 1ZS8B 4JGJA 2XLLA 1A3QA 3BXNB 3KLHD 1J9CT 2WMPA 5C6TH 4Q9QL 3IFPA 1HOCB 5BRZD 1MFCL 1JGDA 1NEZG 1TVHB 1U3HD 1ZCRA 5D6DC 1TYJA 2CXKA 3IE9A 5EIQA 2R2BA 4B0MB 4YHYB 3LXCA 3GMNA 4NZTH 5IR1B 4E9LA 3BIAX 4KTEH 4XXDB 3M6DA 3EOBB 1V7MH 5D96B 3U0WH 2GPZA 2MHAB 4GEJA 3CVIH 3TVMA 4IRZA 4M4RB 3S97C 2BNRD 3T4AB 1SBSL 3G04A 4A6YA 4F93B 1CK0H 3UMNA 2E27L 4N1EA 5ITFA 4Y2OB 2XYCA 4FG2A 1D5XA 2WY3B 5A6LA 1F41A 5K9JL 4G43A 4XXCA 4BUHA 2R2HA 3MOQA 3KPSB 1OPGL 5DQJB 5DEJA 4ELKB 5KVGE 3ZO9A 1OAJA 1DQJA 2YZ8A 2OMVB 1A02N 4HCRA 3D4GA 3K5RA 2EDNA 3BPOC 4ZZFA 5BVPH 4CC4C 1SDDB 5LXGL 4GY4A 3RFRA 4XP6L 4I77H 4X6CE 5T5FA 4N2KA 1SOXA 3BWZA 5IT2L 3VGEA 4ZI8A 2FO4A 3W9EB 4AL8C 4Z7AA 1HZLA 3LRSB 4KI5C 2JXMB 1HHIB 3ULVE 2UY6A 5TK2A 3BO8B 5E8NB 3UMTA 1TYEB 1G6RL 2IBZX 1Z7JA 5IP4A 3VFMB 2RAMA 1I1AA 3IDXL 1CGXA 5IVZB 2A0LD 1M57B 4XMZA 3RI5F 4BDVA 3NDZE 1UFGA 5FA4B 2BSTB 3RVXD 1P84K 3MRIB 3JWNG 3TFKD 4LKCA 1T03L 1U21A 5CHNB 3T2QA 2W8CA 1EAPB 1JWSA 1DLHB 2PWEA 4Q9CA 1PMYA 3F5WA 2H3KA 4U3XA 3L54A 5JIDA 5IMKB 3LZPA 4FNPA 1I8MA 2E8YA 4HAGA 3T3PF 2XFGB 4ZAKD 1LXMA 3QSKB 1MSPA 5GRWA 1ED3A 4CVZA 1U8QB 1PLBA 5I8KL 4CGTA 3BYTA 4PCSA 15C8H 4HK0A 2W94A 4TUKH 3VFGH 4PJ9C 1XQ4A 5EBWB 1QWNA 4P8QA 4WTWA 4XCNA 3MLXH 3QS3A 3QDME 5LDSA 3UTZB 5HJDA 3GI8L 1UM6H 5D70L 5EO1B 5D1ZI 4ABUA 2A6DA 4YDVA 3DTXB 3SYOA 3MPCA 1QFWH 3UZQA 5FECB 1AQHA 7PAZA 3JUZA 2NXZB 5D7SL 5GGUA 4BFNA 1AO7D 4ZMNA 4Q2ZA 2N0KA 4OIAA 3L3KA 4DPCX 2BNQA 5FK9B 1QTSA 3DYMA 1NBZB 3ULVC 1RZJL 2X2JA 4P2RD 3HZMA 4LSUL 4U6TA 1KG0B 3OZ9H 4Z7VF 4P9HC 2OW7A 3O2VH 3WDHA 2GT9B 2CO2A 4XWOD 5GRUH 3SO3B 1DP0A 2CHWA 2FBOJ 1KYDA 3DGGB 4KRMB 3U4EA 2JIXB 3VFUA 2CKBH 4I85A 4AC4A 1BG1A 4OLVL 3UC2A 4YX2L 2R0KL 2Y4SA 4JN1H 4KXZI 1JDCA 3FT3A 2F7RA 3NOIA 4P5TB 4FA7B 3IAPA 4I4WB 1JF1B 3MRKB 1UA6L 2ZAIA 4LSPL 1T1XB 5DEZA 4JB9L 5B21A 3MJ9L 2BNRE 2NSMA 3BP5B 4PJDB 4YZWA 3BVUA 2V7NA 5I8OL 4LLYB 1J0IA 2KI6A 1PS3A 2GYSA 3JVGC 2D2OA 1D5BA 1OAUL 3DLQR 3FB7B 5KWYC 1GKOA 1DBKL 1PD1A 3C6EA 2BVEA 4N9GA 6FABL 3LEXA 3O4OB 1XH3A 4NQUA 2JKXA 3ARDA 4I0PB 4IRSD 3RNKA 1L7IH 4NP4H 3RG1C 3KCPA 4TVPD 3H9HA 3WN5B 4XNDA 4PRIA 4KKBC 4LBAA 4QMEA 5DT1H 3ILDA 3ARPA 2BJMH 2BS9A 5CZXC 1XVSA 1GY1A 3BVXA 3AY2A 1AP2A 5FOBA 3APFA 3CLWA 3SKOA 2AV1A 4FZEH 4ODTH 5K69A 5JZ7D 1HKLH 4KJPD 3MUJA 3T4YA 2ZOWA 4G7VL 2EE6A 3BN9D 4JANA 1JZ8A 3QUGA 4RFNB 2XQYK 1E2ZA 1OCCB 1DQMH 2HWZL 2YEZB 2H26B 5C8JB 3KLHC 4XN1A 3CQFA 3L5WA 5HI4D 4GRWF 4KUZH 4M8QA 5IMOB 3C2SA 2BOCA 3QFJA 1U3HC 3UTSD 5EUOA 4M61A 3D06A 4X6DB 3O3AA 1FDLL 1GTFA 5HXMA 1L6PA 3TS8A 4NO0A 4YQXL 2CU9A 4GJTB 1ZVNA 2OCFD 4J8RA 4K23L 2WQVA 3B9KD 1U8KB 1ACYH 3FU5A 2A1WL 1RIHH 3QQ9D 3WUWA 3QWRD 3UYOD 3JBG7 4ZUUB 3G5YB 4NQVB 4AMKH 1KC5H 2RCSH 3KS0J 4OTXL 5C7ZA 4RETB 3LH9A 3IPEA 4PRNB 5GRYA 3OXRB 5DTFB 4F1SA 1T1WB 2KYIA 1TSHA 4JMNA 4TSCL 2WW8A 1P1ZB 1PCSA 4B96A 4LF3A 4LNRB 4M00A 1N18A 4GRLB 2E86A 3V52L 3D0AA 3J2PA 3CG8A 3RDTA 1QPPA 1AO7E 3LHPH 4CMHB 1IVTA 3X3FL 5C9JA 5D7JA 3MUZ1 3PQYE 4AIEA 5KBKA 3ROLA 4AM0B 5C0AB 4UQ2B 2CJUL 1OM9A 4LARL 5T3ZD 1RJLB 2WVTA 2AC0A 4KNUA 1UHVA 3QQDA 3VI3F 3S8GB 1H15A 3DGDA 1OE3A 3PU7A 1J48A 4AYBA 4WF7A 4LEOA 4XC3H 5F7HA 1E65A 4AQAB 5DUML 2A0LC 3IS0X 3BDXA 4Y5VC 4UV7H 3FH7A 4EDWL 2H3NB 2OJZH 3RWJA 3GO1H 5AOKA 1D6EA 3RVXC 3TFKC 4ELMA 2Y5TA 3VW3H 2GY7B 3S2AA 3KH4A 2I32A 2IG2L 4P2QD 5J89A 5CLZA 4E9VA 2YC1B 3BP6A 1XGYL 3EGDA 2FQDA 2VXUH 3CCHB 4Q6KA 4ZAKC 3VM5A 4UQ3A 4R90L 1ZSHA 5ID0A 1AJ7H 3OLIA 3WY3A 4Y88A 5EOQH 3A6OA 1AXTH 4OD1H 1TO4A 3DPDA 3Q7JA 5EZOH 5LB1A 3T0VA 3NCWA 5IK3B 1DVUA 4AZUA 4GINA 1A3LH 1HQ4B 1KYUA 4HIHA 2G75A 4CILA 4L48A 2AK1L 5HHQA 1DDHA 4WHYH 4ZS7L 2BZCA 3MOAH 5EIIG 2IADA 4QT5B 4MKMA 4AC2A 5IMLB 4W9GC 1OGPA 4FI8A 4L8SA 5J3HC 4A2HA 3C87A 4XTRD 2G60H 4JNXA 1L9NA 3I50H 1Z9SB 3CDZB 1BMWA 2BHUA 4OCWL 1E67A 1QQDA 3TEXA 5I8EB 1DQVA 32C2A 5TPWL 2AMGA 4JS7A 4TL4A 4L4VB 1PLCA 2WOBA 1FG9C 1E9PB 1FL6B 3AC0A 1U8MB 4FTVA 3AB0B 3UTTD 3WN6A 2CRIA 4J4PA 4OJEH 3UTSE 5BZWB 5HJ3A 1PZ5B 3QEQE 2DQJL 1JHTB 1RVFL 3OVUB 4R2GB 3U9WA 4AX3A 4LSDA 1NM4A 4JREB 1SJHA 3GSOB 4NKIH 4PJFB 4TKWA 5E8EB 2P8LA 3RILA 5E00B 3ZDYE 1HSBA 4ZMZA 2OSLA 5GGSY 3APCA 3I02B 5I8CB 1P7BA 3THMH 1ILUA 2Q86B 3WJMA 3SE8H 5K9OA 1YEKL 3ARWA 1JZDC 4KAQL 4S1RL 1RZKC 2WTPA 4TVSa 1MHCA 4MWFB 1U8CB 1D7CA 3FHQA 3IGAA 3ALPA 4HJ1A 4B9IA 2H7WA 4ZTPH 3NJIA 4YBQD 4AKQA 1MZZA 1BOYA 3NRFA 4MCNA 3DVFA 5C86A 2WXKA 4N0UE 2BCKA 2NY2C 3QZWA 5FGBC 5BOZG 1AHWC 3K3QA 1T0OA 1BQHA 3NEEA 4OJCA 4HZLB 2CKNA 4Y19D 1IBFA 2R56H 3IBOA 5F1KC 5GGVL 5T1MB 3RI5K 3HC3H 4RAHA 2J88H 2MTPA 5DK0B 1OSZB 3QIWD 5JZ7C 4KJPC 2V8MA 5AVUB 5T3ZE 3BN9C 2DMKA 1W0WB 1JE6A 4H26A 4HEPG 3TA3D 1IT9H 5HI4C 2J1ZA 5I6PA 3EYVA 3PHAA 5EO9A 1UZ8A 1J8HE 5AVZB 2CDEA 1KB9K 5DZJA 1TVBA 3C09B 2CCLA 3EYFA 4NUQA 5L88H 2VSCA 3SE4C 4P2QE 3D69B 4E0RB 4OGZA 1F4AA 1AD0A 1IBDA 3B9KC 1C12B 1DCLA 3QQ9C 1NLDH 4Z7UE 4U1LB 2WB1A 5E4EC 2WQUA 2K6WA 1PZ2A 2Y2YA 3ARYA 1A5FL 1B0GB 3L6FB 5FUCC 5JXAL 1KJMA 1ZVHA 3Q5OA 5DHEA 2FBRA 2QSTA 2F61A 4G8GD 4LHUA 3W2DL 5F71A 4QIRA 5B7EA 3NQIA 3AQZA 2F53D 3K72A 2VL4A 2AJVL 3OGCB 1NOAA 3CC1A 4TQEH 3O9WB 4WHTB 3OMAB 4GKNB 4W4NA 4P4KD 1DZBA 3KYOA 1XIWB 3LMJH 2BVPA 4L3EA 5BV7H 1WZ1L 3S88L 4JFHD 5F9JB 4N2IA 3OBAA 5AG8A 1J12A 1E3FA 3BUYB 2E47A 4K3DL 1LM8V 4MQXD 4TVPH 3DX9B 4XOBA 5FKPA 3S7GA 1UJTA 2HFFB 2K7QA 5C0CA 1CF1A 1T04B 4RMWA 4FXLA 1E2VA 1EHNA 1LP9E 4QRQB 3ALWA 3OSVA 3FTUA 4FQIL 4FQHB 1QLRA 4TUOB 2W60B 3QULA 3N40P 1NOLA 3UTTE 2D0HA 5DDHA 4FL4C 3OZKA 2APVA 1NM9A 1P4LA 2YJLA 1CD9B 2W65A 4Y4FA 4OFPA 1DEEB 2XN9A 3DSNB 2CJSA 2R0ZH 1WHPA 4U1NB 3U6RB 3MTXA 4M1GL 1AXSB 4X5RA 2GEQA 1UT1A 3VO0A 4LE8A 3KYKL 3PGCA 4OQ1A 4DOHB 5IMMA 1RZ8B 2VERN 1N70A 4FLHA 4XNYL 2XZAH 3B5TA 4ODUA 5C0FA 3WEXA 3QDGB 1QSFD 1A9BB 2P5WD 3R7QA 1HCZA 3MYJB 2MRYA 4PRHB 4JFFB 4HSQA 5EU7C 4IBUA 1ACCA 4WO4C 1HCVA 3T6VA 3BLKA 4XTRC 2UZIL 2XQBH 5IB3A 5F7EH 3V9CA 4NN6B 2QKIC 3QG6B 2ITFA 5F70A 1NFDE 4PAZA 1U8LB 1LMKA 3ZZ1A 5AVVB 2JJSA 1UVQB 2PCFA 1RV6X 3LKSA 3O3UN 5DO8A 4Z3JA 1LO3H 5K39A 5JOFA 4Z3TA 2O5NA 4ZW5A 3ZMEA 1U42A 1VACB 1WCBB 3FQNA 5IVXF 5GS0D 5JYLA 5BJTB 3DBSA 1AHKA 4NWTL 1SJMA 1V10A 3FO1A 1ODUA 1QFPA 1YQVH 3L1OL 1JTTA 5HVWA 3LB6D 3M8OL 4OZ4A 3QARA 1SJEA 1C5DA 5F3BA 1OSEA 3DIFB 3B2VL 4K2UH 2Y25A 3UADA 5I1CL 4L5FH 4RDQG 3RBSA 1L6ZA 3CFQA 4OZIB 2KQMA 3QO1B 2C3VB 1ACXA 3JTTB 1GGYA 2P8MB 1R5WB 2MEJB 3HHRB 2Q10A 1S6NA 4G8GE 4WGWB 4YBQC 3O45A 1PLAA 3MA9H 3U1SL 2Z91B 4JPWH 3SD2A 3T9WA 3SOBL 4E9WA 3H9SD 1EJ8A 2F53E 3T6QC 1H9VA 2F54B 4O58L 1K4CA 2D03H 3MJ8A 4G9DA 4F58L 4RFEB 3TN0A 2VR7A 4QY8A 3G08A 5D72H 2R0WH 4JY5H 1AKJB 2ITCA 2V33A 1UXLA 1QSZA 4UZUA 2KT6A 3QIWC 4D8PB 2B1AL 3O4LA 1MWOA 2QFPA 2Y7OA 4HH8A 1MCOL 3OB0K 5DJ8B 5B3SB 1TSRA 1T22B 3TA3C 3DOSA 4N5UA 2NLJA 2CR0A 3PCYA 3ILPB 4JJ5A 4MAYC 2YRPA 4JFYA 4Y0GA 2IDSA 3QCVH 3SKUD 1MDTA 4NQXA 4RMUA 2B1HL 3FQXA 3MRPB 4N90D 4Q56A 2HFGL 1VCBC 1BJ1H 3X2QB 2F2HA 1XR9A 3MRQA 1IAKB 4JY6B 4OM1H 3B7SA 2OV0A 5D6DA 1SHWA 5HHOD 3VD2A 3GMOA 2VXSH 1R3JA 3FTSA 3U2SB 1IGCH 2YUZA 5KBNC 1X7TA 5DD3L 3TBCA 2DMBA 2HJLA 1LDPH 4OZGB 5E6IC 4U7MA 5IHZB 4NAMA 5MEQA 4L8CB 1ZLUH 3ZSTA 5FW7A 3RIFF 3RVVD 2APBA 1ZT4A 3U0PA 3BWUC 2AK4B 1QSFE 3QFGA 2KZKA 3RWDB 3IGLA 1I8KA 2A9NH 1F3JA 3RY4A 2EE9A 2GTWA 3WJLC 3I2CH 2FWSA 3GRWL 5ALCH 2V17H 5FV1L 1RUML 2P24A 4HWZA 5DFAA 1CQKA 3BH9B 5I74C 2Q87A 1QR4A 5E1IA 1SQMA 4ZFGH 1TG8A 4BA8A 4MQXC 1PTZA 4ZMLA 3LDBB 3CGTA 5A2AA 4CC4A 3EO1A 3UJTL 2J6EH 1W80A 3P02A 4JX0A 4XO4A 1YN6A 4WU5A 2CKBA 3PRZA 5B1AB 3IJYB 3Q01A 1GJUA 2RB8A 4NC0B 4QXTA 4YSPA 3KLQA 3TIEA 5AW9B 2N01B 3MROB 4KJYA 1BZOA 2A9CA 1XWVA 3MRLA 5A7BA 1YJDL 3X3GH 4APXB 3CSYA 4ODXA 1DJWA 5J0BA 4S10A 4AK1A 5EBLA 3LNGA 3MV9A 2WC7A 2X6MA 5GS2D 3PL6B 3LZFL 2IFFH 3IETB 3IWVA 1EIBA 5GRVL 2HRHA 3DETD 2R0LL 3ZZQA 4FQCL 4LLDA 5FYLH 2VN3A 3TBVB 5LG6A 2VABB 2XYBA 4PIBA 4PJHE 3MC0A 5D5MA 4BUGA 1Q90A 5FO7A 4X9GA 4XRCB 3TBTB 4DKFL 1SOKA 2DLHA 4J3OG 5BVJB 3C6LB 3H9SE 5KANI 2PXYD 2J2ZA 5D7IE 2IPTL 2WIIB 4PJ9A 2K8QA 4YE0A 2ZG3A 1S7RB 3D2UA 4J3TA 3X12A 1FVCA 5CBEB 3O11B 3MRHA 4MCYB 3RWEA 5FO9A 5BQDA 4NO2B 4QJ3B 1VFBA 5D1ZB 5DD1H 2YD0A 3HR5B 1WK0A 4IOFD 2EYRB 1MHPL 2Y07L 2BVYA 2ED7A 5AL8A 5I23A 2YK1H 4FFYH 1DLFH 2JCCF 2WLNA 1BVNP 1U8OA 2JK5A 1YYML 1TXKA 2VIRB 1KYAA 1I3RA 3K6IA 1H8SA 2WQWA 3FTGA 4XVTL 1YEGH 5GS0C 1ZTXH 3FMGH 2R4SL 2ZNWA 4XOCA 4G6KL 2LQRA 4FFZL 1Q9OA 4HPYH 1NDGB 4N90E 1V3KA 3LB6C 4JQXC 2OAAA 3QYNA 1GY2A 1EAJA 1GJWA 4HOMA 1NGZB 1JWMB 4IBZA 3A6BH 4LOUD 2NUTA 2YS4A 1S5HA 3QIBB 4KMTL 1CTOA 4BSVA 1FO0B 1LYQA 2B0SL 3VH8G 1XGQA 4W4OC 1MRFL 1MW3A 5JIHA 1S7UA 3NJFA 5C2BL 3D39D 1FP5A 1TFHA 4LHJB 1I1YB 4Q6IC 4B3VA 3CX5J 3JYCA 1U6AH 1LO5A 3U83A 5L7XL 2BVOA 4QGTA 3VXUD 5GPRA 1ZPUA 4DGUA 5JMOC 1IM9A 2B39A 2NUPB 2VMDA 3JVGA 3ZTDC 3REWB 5F88A 1OF2A 5GGSA 5SX4H 1ZV5A 1YYLL 3K6NA 3A4EA 4PJXB 1NLBH 4GKOA 2RMNA 1D6VL 1N64H 2WQAA 2IAAC 4X7EC 5EOCL 1G0XA 5I26A 4S2SB 4UAOB 2CR6A 3DSFL 2K3TA 2HH0L 1U95A 3U36B 1HH9A 5DWUL 1UQSB 5DRNA 4GMSL 3IJ9A 3QUZD 3T0DA 4G6FB 2WJ5A 4M7LT 2X09A 4OM0H 4TULH 3MLSL 4ZXBD 3CBJB 4HZAA 3DJRA 4NYLA 4XGZA 3FU7A 2EUWA 1UEMA 2JB6A 2DH3A 3POCA 2Y23A 4RBPK 5BRZA 5C08D 2WQRA 5J1SC 4JK0D 3P4MB 3CZFA 3U4BL 1U3HA 1DVXA 2HPOA 5KJRH 2CUIA 1BEYH 4HMDA 3AITA 1G1YA 1M6OB 3RU8L 5HI5D 5GS0H 3JTSA 2VLMD 2A9AA 3Q6GH 4GQ9L 3SDXE 3V4PB 2ZUVA 4YSAA 1R24A 1HN1A 3OR6B 5D8JH 2P44B 1S78D 1B3IA 3LKQA 4GT0A 5AW0B 1SOQA 3GS4A 2BNRA 3ECBB 4NGHH 1GRWA 4NZJA 2YWYA 1I85C 2ZUQB 1A3RL 1ZLVH 3RVVC 4X98A 4XO5A 4DFIA 1F0LA 5LWYH 2WBJC 3HZYB 3B9EA 5E5LA 4QHUA 3DX7A 4TXVB 5F1NB 4DAGL 4A04A 5ID1A 1Z0MA 3QJXA 1U2HA 4LPTA 3T2NL 1NDMB 1TETH 4H8HA 4YHMH 5F93C 2EVJA 1JZIA 2X44D 1B6DA 4M7KH 2N3JA 1UOLA 1A6TB 1RP8A 1N3NA 3CFJB 2MFNA 5EBMB 5T1LD 1FORH 1MWAA 5HYJA 4P5KA 1V3MA 1BWWA 3K8MA 4DEPC 5DFWH 5AFAA 1NIBA 1ZA6B 2DJUA 3L95B 5D1QE 4TOYH 3GPSA 4UTBL 4IBQA 4DESA 2VDNB 1OGAA 4YC2C 3OG6B 2CALA 3DX6B 1MFVA 1F18A 2A74C 3GM0A 3EDJA 4JM2B 5HHXH 4Y5VA 2W9EL 5BO1L 1AS8A 4K7PY 5T1KA 4X7TB 4OGYH 1CMOA 3DETC 3D39E 2IAMD 1FYHB 4XPFH 1SY6L 1BQUA 2BHYA 1IKNC 2ZOOA 1SZNA 4YR6B 2VXVH 4GP5B 4PJGA 3KW7A 2J5WA 4MNGE 1TTAA 3V0IA 4HG4K 4ZAKA 3MJ6A 4OLWH 2NNAB 2VAJA 5B38G 2AJSL 3VXUE 2FJHA 2D7TL 2UZXB 2P4AB 3J07A 3NTCL 4M1DH 5DJCA 5EO0A 3VXSE 2XA3A 4ZUWA 4F1ZA 3FT4A 3NUKA 3QXUA 3W5MA 4Y5YB 3E6FA 1MY7A 2X4QA 5D1XB 4BK8A 3UX9B 1CFVL 4NQTA 4BE6A 4I2XB 4S1SL 2PNDA 4IOFC 4EI5D 2ORBH 5EZJB 1CLYH 2VLLA 3MRDB 4XCCH 4BFIA 4OU3A 2QTVA 5JQ6L 2GJRA 5KUMA 4B9PA 4KXBA 2X88A 5F1SA 5LO7A 3AREC 4M03A 2EKSA 3EYSL 3OV6A 1YPZE 4P2RA 2QVKA 4FF9A 1A7PH 2F19L 2WO2B 3CH1B 1UZGA 4HMEA 3WE6A 3O6MH 4YDIH 5IW6A 5HGHA 5C08E 2AW2A 4ZSOB 4YFLF 4XB7A 1R75A 5TE7L 4MA7H 2XV2A 4KTGA 5DC0A 4RMQA 2NY1C 2Z8RA 4IOIB 1KJ3H 3IFNH 4TRPL 2V7HB 3P2BA 4HBQA 5GS2H 2Z64C 3WNKA 5AVYB 3M1BA 5I9QC 1WZAA 2WXMA 1T7XA 3W39A 1U8NB 4XPBH 3Q8BA 3OM3B 1T6VN 4X7SL 5T3XL 4IKJA 2AJYL 2R7EB 3C9NA 4UTAH 4RMBA 2PYEA 3KLAB 4GO9A 5IB2A 2C9PA 4Y9FA 2Z93A 4LMQI 2EDOA 4P3DA 4JG9A 1MAMH 5FGBA 1AHWA 3JXAA 4U6XA 3F7KA 4UIKL 1MRCH 4XVSH 2X6VA 4BEIA 5JW4R 4AWJC 4CVWA 1SLVA 1BD2B 3PJNA 3QUZC 4ICWA 1E8ZA 4NNXB 4LEXH 2C7UA 3C6SB 4DQOL 4ZW8A 3U0TA 1AOHA 3K2KA 5I5JA 4ZXBC 4DKTA 1G4MA 3EH5B 4HUVA 3UYPA 4WJ5A 1EH9A 4IJTA 3NSJA 3ARZA 2DMHA 2C9AA 3HE7D 4OY9A 5INDB 2ZYHA 4OBSA 2YD1A 3WHE1 1UT2A 4QJ5B 2EACA 4HKZB 5C6WH 5JORB 2BZDA 3D0LA 1QNZL 5HI5C 4C4KO 1UYWH 2EAEA 4YBLB 5DJAB 3SE3C 3MNWB 1TENA 3SE4A 1S78C 1KNOA 4GG6A 4K7FB 3GMMA 4G72B 2I07B 1KIRA 2DI9A 3KLDA 3VFSB 3B9KA 2EXWD 4NC2B 5E99L 3VXMB 3CFUA 4X4ZA 1KT2A 3QWRA 3G6JE 4PS8A 5GXBB 3GBMH 2VUYA 1IEAA 3NJLA 1UGKA 4G83A 5D6CB 1WTLA 1GHFL 1CR9H 3WLWD 5K59F 2YKLH 3FFDA 3BQUD 4N26A 2V5YA 3ELQA 3DX8B 4C47A 3CFKA 3FU6A 3FFCB 3LVEA 5E2JA 3C5SA 2HX7A 3FUKA 4DO6A 3P40A 1DN0A 1XAUA 3BGAA 4JQVA 1JNJA 5CM1A 5ITFB 3JUYA 1OM3L 5MEND 1JBJA 5ICUA 1BZ9B 5J6SA 2XFXA 4RVBA 3FB5B 5FM5M 4I0KA 3Q8EA 4IGBD 4ZW6A 5AW6B 3BDBA 5IG7B 5SWSD 1ZLSL 4UM9B 4O2EA 5J11C 5KVDH 1AI1L 1M05A 2B59B 4UANA 5DJXA 4X4XB 5T33H 2OZNA 1LO4H 2HRPH 1DBMH 2IAMC 4HOZA 5DR5H 2FO4B 2R83A 3WXWH 4K15A 2UY6B 3A4DA 3V2AR 1N6UA 2QV4A 2XG4A 4JRYE 1X4XA 1FF5A 3TJEH 5JW4Q 1KN2L 3ABKB 3A0OA 1KTDB 5JDJA 3Q6FA 4TYUA 3L7FA 2ITDA 3FO0L 5T1JA 1U8HA 1Z9OA 4RWYH 2CCWA 4XNUL 5BUAA 4JFOB 4LZKA 1DE4B 1AR1B 4KVCH 2V9QA 2YUXA 4EI5C 1ITCA 4X80H 1ETZB 2P48B 2DB8A 2BWDA 1ULVA 4WO4A 5JDSA 4ZG1A 4JN1L 1A8ZA 4WI0A 3LQAL 1JHKH 5B3NA 1BHGA 3AQDA 2EIZB 4OF3A 5DGRA 4HK0B 2EVFA 2E7DA 3WS6C 4OI8A 3V5DB 1FL3B 2QKIA 3I6KA 2IDQA 1ONQB 5F6HI 2YD7A 4ZO7A 5HGAA 2PTTA 4J1UA 5TQ2H 2FATH 1J1OH 4L0YA 3FN9A 3RRQA 1JK9B 3CLEH 4JHAL 2A6DB 2C1OB 3DRQA 3SJVB 4KHTH 2FX7H 1WG3A 2OMUA 1FG2B 2DL2A 1QBAA 5DU7A 3SO5A 1UXWB 4QHLA 3UTTA 3BZFA 2E8ZA 5AAWC 3Q1SL 5DFVC 3ESVF 3V5HB 1VGEL 3D85B 5C09B 4QNPF 5HSFA 5HHVL 1YUHB 1MCQA 1KCVH 4YE4L 1IB5A 1MFDL 1CXFA 2PTVA 2IANE 3O2DL 5DVLA 2WYHA 4MD4B 3SQOH 2E4FA 4ZNEA 1VADA 3AABA 3SB3A 2V5MA 3NIFB 4L9LC 4KQ0A 4HV8A 1TOXA 5DRZB 4Z3EA 5CMAA 3U4EB 4NUGL 5KG9B 2FB4H 1W9XA 4PRBA 3P0YL 3FT3B 2F7IA 5AW1B 1A7QH 2XPGB 2K0RA 3QFDA 2VSMB 3TESA 3AVEA 2ZOUA 2IGFH 4HIQA 3WE1A 2NXYB 4QTHB 3ESMA 4LDEB 4PTTB 2J6EA 5EU5B 4KC3B 1TUPA 1UENA 1DL7H 3BPCA 4AYID 1EUTA 1H3VA 4JFXB 4Y19A 3IU4H 4GQPH 1DFXA 5ISZA 5MENE 3UO1L 5CJQL 4HIIA 3QIWA 2YXMA 2O5ZH 2OMZA 4P46C 3WFEL 1TQVA 3LEXB 1QR1B 4QHMA 2YBRA 5AKSA 4ABVA 3CBRA 4DUWA 1BBDL 2BDNH 3RNKB 4EQ2A 3TA3A 4ADIA 2BIPA 5SWSE 3HE7C 1CJYA 2R29L 2NTFB 5E4OA 4MAYA 4R4FL 3MO1A 5EU4A 5A1AA 1XCQB 4PJIF 5B7MA 4Y7OC 5EORL 1F1DA 1FV1A 4W81A 4F8PA 1FVEB 3PP4H 1AP2B 2AXJA 4AG4L 3SPJA 3ARVA 2QR0A 1MNUH 4HW6A 3H2WA 1OQXA 4OD3H 4E36A 2EXWC 4ONHA 1IAOB 1NOFA 4P3CH 1ZHKA 3VE0A 5JOPD 1KBGH 3HI6L 5DA0B 3JV0A 5I6MA 3X17A 1ZHNA 4E42B 1PDKA 4I18C 2FSEA 5BMFL 1KEGL 5E6IA 2YD3A 3WLWC 4ORGA 4IJ3B 4DKEH 3ZE1F 3QJOA 3BQUC 3LN5A 4V2CB 3EHBD 4F7EA 4NKDB 2NTSP 4J8RB 1Z5YD 3WJLA 4JG1H 1F97A 1X5KA 3LNFA 2D2CC 4WCYH 4FFYA 4XB3A 4N20A 3WUWB 4HD9A 5GQBA 1DVFD 3KBFA 2DQFB 2NSQA 3BKJL 4JHZA 5D2LE 3FF8A 3QCTH 4IGBC 1DBBH 2FZ3A 3MRFB 3R4DA 3V7MA 2ZXQA 4M9PA 3ULUD 4U3CA 2CIIA 4MHHI 4WW2C 3VWJB 4QYOA 3ZIYA 4BQ9A 2J8UF 3VUAA 2EZ0D 4POUB 1S5IL 2HLAA 1ACZA 2DTML 4IIQB 4GW1B 3K4AA 3F12B 3X14A 1HILA 3BGMA 2GFBA 2WXOA 1RU9H 3GSRA 2CXGA 1EEUA 5JHLH 2VB5A 3KJ4C 3BSHA 3VSVA 4NPJA 4MCZA 1UD2A 1CZ8L 4PBXA 2B9BA 3F7QA 1JRHI 4F3FA 5C0JA 3PWVA 4L4TD 3K2UL 5E24E 2W0KA 3ROOA 4LVHC 1R3LB 3PABA 3SHSA 4A37A 5I16A 1MCKA 2YPVH 8FABB 4FNLL 1R5IB 4MBOA 1D6EB 3EZ8A 4QEGA 2DLFL 2WXGA 3MKKA 2FECL 2P5WA 3OAWA 4FGMA 3VFNB 4DO4A 4B95C 1T1ZA 3HRZC 1WIUA 3D4YA 3QJSB 3VA6A 3HE6B 2X4RB 1JZEA 4Z7OE 1JK8B 4JFED 4TQPA 4ABWA 4BQ8A 5KS9B 1W16A 3BAIA 4LAQL 3C5ZD 1GZQB 4FQXC 4JO4L 4KY1H 2OSYA 3FRPA 3BE1H 3QPXH 4NKIL 4N68A 4RZCB 4V2BA 3SGJC 3KZ8A 5DHMC 2VN5A 4EF3A 3G5XB 1IBGH 4HIHB 2G75B 5DJDB 2DS4A 3O3BA 3WIIH 1F1AA 2Q9OA 3MCYA 2PF6A 4LCWD 1G9NL 2GSIA 4JPKH 3V0VA 2ADJA 4K3EL 5LAXB 1E28B 2EE2A 4L05A 1RIVH 4OD2A 4XNXL 1NCCH 4CU7A 1KENH 4K0OA 3IJ7A 1EZUA 4JQXA 3US0A 1H6UA 2ZUUA 3TZVB 2I26N 4C4BA 2DBLH 3CFDA 4KMLB 3WXVL 2VH5H 1QQDB 5JOPE 4W4OA 1MFUA 1A7BA 4FQJL 4RA0C 5AW7B 4YDLB 1OP5H 3WTYA 1M71A 4Q6IA 1KGCD 4PJHA 4YPGA 7FABL 5HJ3B 3VMNA 5ACZB 4JLRA 1FNGA 1EX0A 3V0WH 4OAWA 3VFVA 5CILL 2D31B 3H9SA 4OZFH 4CW1A 5DVKA 2VZVA 2XWTA 2NCEA 4PMEA 5D7IA 4YSQA 1OKEA 5IOPA 5HYQA 4N0FA 5B3JE 1ERNA 2PYFA 1O7DE 2CJ3A 4K8RL 4H1LB 5ETUA 2VLRD 2X4TA 2VN4A 4OKVA 1CICD 3SDDC 1TTRA 2XWBA 3IGAB 2CO3A 3FQWB 4LDLB 4PG9A 2MNUA 4KNQA 3ULUE 4G8IA 2CDGA 1SN5A 2FL5B 4Y2DD 3BRFA 4HS8H 4KTDL 5HYSB 1DR9A 4HH9A 2Y2TA 3PPSA 1Z5LA 1YY8A 4D3CL 4LPCA 4XMTA 2NW2A 1YN7B 4YGVB 2V2TB 4JZJB 4L29A 1IEBA 3UPRB 4EJ1C 1XD1A 4HYTB 3CFBA 4LSTL 2D9QB 3TYGH 3MJ7B 1XEUA 4OGXH 4ZQKA 2Z4QA 4PRAA 5I18H 2UWEA 5HHOA 4R26H 3ZE0E 3K5SA 3EO9H 4L4TE 2OK0H 3NBNA 2XXCB 4I13B 5E6ZA 2QV2A 3P4OA 5DUPH 3BUIA 5HGDA 5J7CC 2C8NA 4WTZG 4DK3A 1TVBB 3OJVC 5I6LA 5L2JA 1I85A 2XY1A 3EYFB 1SM3H 4U7SA 2X5PA 3MX0B 2WBJA 3MFFB 3RGBA 1HTYA 4B41A 4KZDL 5KVFL 2DQUH 5EU3B 2EIDA 3MGTA 1BYPA 2BLFA 3BVWA 4MGXA 4OCSH 1SEBA 3DO4A 1G9HA 2A77H 5LGYA 1DVFC 4B9KC 5JO5A 3NPZB 1KTJA 5GHWH 1KJ2B 3FTVA 5D7LB 1BVOA 1F3DJ 1KJMB 4HOXA 1JS4A 5HPMB 1OAXH 5E4IA 2P5EA 4LRNH 1TTFA 3LS5H 3ULUC 4B60A 3RWFA 1I3UA 4BKLA 1SVBA 2VT0A 3U7YH 4JO5A 1AC0A 1G7QA 2EZ0C 4Y8AA 2K70A 3TH2T 5BUPA 1BX2B 4QRAA 1BA9A 3P3TA 5EC2B 5C0BD 5EC1A 1QHPA 1WFUA 1CYGA 2YGQA 5IHUL 3KVPA 3LEVL 1T1YA 1KACB 2ICEC 3QXDB 5I1GL 2NRDA 5EOTA 5F0JB 2GJ6D 5LJYH 3K6OA 1LDSA 2A74A 3HNTL 3W0WB 1D3CA 2XZAL 3BVNB 2YMXH 1CGSH 1U4FA 1XD0A 4QTIH 2WTRA 3RPKA 1A6ZB 2MIZA 3HTLX 4ZOCA 3SDXA 1XGTA 5I1AB 1NWPA 1FO0L 4H7VA 1UWXH 2ZUYA 4PVLA 4OQTL 1H8OA 5IHWA 4GAYA 1V7NL 1IKNA 1OOWA 4UTAA 3UBFA 4OB5H 1NL0H 1KGCE 4BZ2H 3TEWA 2I9TA 1NCWH 4Y5XB 4F9LC 3OKDA 3TA4D 2VDPH 4MQ7B 5KVGH 2FWOA 2VL5A 3GMPA 5AVWB 3IMTA 4G3YH 4U2ZA 3TF4A 5IFJA 2PR4H 3KBPA 4MSWB 3S3SA 2XN9B 3QDJA 1Q9LB 3MACL 4UB0L 1JFQH 1P6WA 1CDGA 4G6JH 3ESPA 1NTDA 3C5ZC 3INUH 2P7TB 1KBWA 2CM5A 1MF2H 1H3UA 3PGCB 2NNCA 1AYOA 3QJQB 4JFDD 3FH5A 4YHNA 1NEPA 3M17A 2Q76B 2MPVA 1MVUB 2ENSA 1AE6H 2V9UA 2H2SD 3GBNL 2WQ8A 5BZXA 4PS7A 1MG2C 1U8IA 2ZSWB 3AREA 3VMOA 2M83A 4AUUA 1MFNA 3D1MC 4NZRH 2G2RA 1D9KD 4X9FA 5ESAB 3MCKA 4XNMA 3D25A 3O81A 4PYHA 4O2FB 1LNUA 3OZLA 3ML9A 2AJXH 3GGWA 2E9WA 4H8WC 4XVJH 4NFDA 3CHOA 1URLA 2H3XC 2D7PA 2W81C 3NK4A 3ZQWA 5MHSE 2IFGA 2L04A 1I9JL 5LBSL 3MNZA 5IROD 1HEJC 4DZ8B 2GBTA 3LKSB 2EDDA 3X1EA 5KVEH 4JM4L 1KLGB 3HZKA 1FJ1B 5CIPB 3DMMB 3VI4E 2OMNA 2R0WL 3I6GA 2O5YL 3V4PL 4IOSD 2OMYB 2FLRT 5FFOA 4E41B 5JMRA 2HLFD 2Y1ZA 3UCRA 3TURA 5BUGA 1B2YA 1G0YR 1U3YA 3V4VB 1E8YA 2YXFA 4DTGH 1FWXA 2B4CC 4UQEA 4R5XA 2WLHA 4G42B 1C5DB 1U8JA 5F3BB 1AS7A 1CLOH 2IXQB 4A39A 4F2MA 4E68A 3VXOB 1GAFH 2MKWA 3P11H 1YY9D 1RLWA 4PIRF 5DVPA 5IUSA 2OYLA 3BQVA 4JHWH 4YHOL 4WO0A 1F58H 4GXFA 1W8EA 4HIJB 4U3HA 5IEHB 2PWFA 4DN4H 5F0LB 2W0FA 4AXWA 2ICES 5D7KD 1JN6A 4PJCB 3FBQA 4PWKA 3IXAB 3MI6A 3QWQB 1WZMA 2XZCL 3QUZA 4Y2DC 3QHFL 5EIVA 4E5XB 4JCMA 5DMIH 4MNQB 4RX4D 4IU3A 1OAZL 4WK0B 5IBTH 3X1NA 3S3BB 5C0BE 1ML0A 2UV3A 3TN0B 3ULSA 4ZXBA 1BVKA 1K3ZA 4GLRH 5IEKA 2C4FU 4URKA 3WY4A 3NSFA 1CU4L 4RAUB 2GJ6E 4GOSA 4LLUA 3NAAL 5C08A 2VDNL 1WWWX 4GAGL 1F00I 4UNUA 2NR6D 3IDNA 3RGVD 1ZA3A 2ZXWB 5DS8B 4YSEA 2NX5A 3AGWA 3DOSB 5I1KL 2EJ1A 4Z8FH 3SE3A 1OAQL 4F8OA 1B9KA 5SWQA 3EH1A 3ZGIA 5AOLA 4H88H 1NC2B 4NQXB 4AVJA 2MSPA 2VDOB 4ZFOB 4B9GA 5B1CA 4F7PA 1D7BA 3MMEB 3N1GC 3M46A 4RDBA 1JV2A 3HCVA 2R2EB 2Y6SD 3INOA 3MRQB 3NFNA 4NQCA 3W11D 3ZTJG 5HY9A 5DHYA 2DY2A 3SPIA 3TO4D 3HJ0A 2OTPA 2WWMD 3NIDE 4B5ZA 2Z31C 4PS3A 1MVYA 2F1AA 2IQAA 5AYUL 1R3JB 2JKJA 4O4YL 5DRXB 4WI9A 3WFDH 3U2JA 1NICA 2TRYA 3NPSB 1J8KA 1RZGA 2GIMA 2VQUA 2HJLB 3F85A 2OMTA 2B4CH 1TQBC 1A4AA 1F6LL 1E4WL 4JFDE 1WAAF 5T1LA 3K71A 1MIEH 4PJBE 4OV5B 2WINA 3GB7B 3U0PB 4L3AA 3SKNB 3PJLA 4XMKL 5B8CB 2GTWB 1QSEE 1FN4A 2VLJB 2NSXA 2J20A 4K07A 4ONGH 3CK0H 3LS4H 5D55A 3CUPA 3MBXL 2C34A 4XPHH 4BH8B 4DW2L 4X5XB 5HVHC 2V5RA 3IFLH 1DQLL 1FLRH 1J5OH 2YRLA 1OWWA 1J05B 2OR8A 5A3IC 3II2A 4R96A 4KK8D 3GIVB 4WENB 1RMFH 1OQOA 4H8PA 2IAMA 4I9XA 4N2FA 1TZOA 2X0UA 1FFOA 4P05A 3L1FA 2H9GA 2A5UA 1ZEAL 3MRLB 1YAIA 4O9HL 4DJMA 1DDTA 4JY4B 4LPUA 2VERA 5C3TA 3LKPA 2E7LC 5EBLB 1P5UC 1HQRB 3DBXB 3GZQA 4K94C 3U46A 4AGMA 4CJ1A 5KYYB 4BA0A 4X8JA 1DLFL 3B1UA 4U05A 2ZXDA 4HKJA 2IMNA 1GS8A 1FBIL 4Q7DA 5EG6C 1PG7L 3QZBA 1YEGL 3QUXB 5DA4A 3BH4A 3R1GL 1INDL 1RJYB 3DJZA 3Q48A 1U3NA 2YBGA 1IEHA 1ESOA 1PY0A 5LGJB 4HBCH 3AQYA 2AF2A 1TLKA 3A6BL 2H2SC 1MHEB 4TVUA 2EIEA 2WBXA 3SQBA 3Q44A 2CUHA 1U92B 2OFQA 4UT7L 5IB1B 5IV2A 3QRGL 1T3FA 3EG9A 2AJUH 4GG8B 5ADOH 4MJ4A 5FOJA 3K6FA 2X4PA 4XP4L 2ATKB 4HKBA 3RLSA 2BSRB 5KYUB 4OJYA 3GF8A 2JVUA 3CZUB 1KBVA 4U2YA 1SFDA 2NW3B 4NSKA 4ZT1A 4X6CB 1TPXC 5IROC 5AAWA 5E94A 5F7MC 1I7RB 1WFIA 3LQMA 4G1MB 5GS3A 5I76A 5IB4B 4F15B 5E8DH 1TF4A 4JFVA 4MNHA 4XN7A 1I3RB 4HEME 4XP5H 3LZOA 4YK4C 3VXQA 3MRNA 1L7TH 4PV9B 4QXUL 2OTWB 5TQ0H 5KW9H 5KTEL 2HLFC 2VR9A 4AEIL 3ARQA 2XT1B 4NUJA 1QEXA 4L9LA 5DZPA 2ADGA 1KBPA 4PJEA 4WK2B 43CAA 3AACA 1IVLA 1S5HB 2Z34A 1XGQB 3VFTB 3S3JA 1AGDA 1EO8H 3DDGA 1S7SA 1WHOA 3RURA 1VEMA 2BC4A 1JHLL 1G7MA 3H0TA 1Q0XH 2C9RA 5FPIA 5FYJD 1CE1L 3QHZL 4N2MA 3FPXA 3OHXC 4JRWA 4Z7VE 4XCYA 2VISB 3AS0A 3MRBB 4HGKC 5E7FA 3RL1A 2XETA 1KYOJ 3MR9B 5HVGB 3L5JA 4P46A 4NRXB 1TZIA 1INEL 3U4KA 4ZPTB 1MCDA 5TF1H 4I1NB 1FE8H 5EU6A 3QDMB 1BXVA 4HFWA 3N41F 4JG0H 4JRXE 3HAEA 1IC4H 3HE7A 3VGBA 3BHBA 5AWNL 2NR6C 3MLRH 3RGVC 4R9HA 2CGYA 4GUQA 1T6BX 1WGOA 3FFOA 3QDHA 1JI1A 4X5PA 3FT0A 5DRNB 2YPVA 1ADQL 4XPTL 4C8XA 2YEVB 4LLVB 4L4JA 4YHML 4ANVA 4V1DA 2DQDH 2DYPD 1A7OH 1RPQA 3PIQA 1HL9A 3BUDA 1ZHLA 4M7KL 3K91A 4RGOH 2VCOA 1NQBA 4DT2A 3MKGA 5I0XA 3V79C 2JB6B 2Y6SC 3TCTA 3W11C 3CSPA 4JR9L 1PLGH 5F7DB 3WMQA 5CSZB 4HIXH 5IM7A 1R0AL 3CZFB 2WWMC 4I18A 1KGIA 4EOWH 3CLFL 3O0RL 2FE0A 4PV8A 4QLRA 1F8TH 4TSAH 1R24B 3FN0L 3BQUA 2FYYA 4OI9A 4YIQB 1WITA 3U4AA 3LKQB 5TJWK 1K5NB 2BNRB 1IGTA 3P73A 3OX8A 3GHBH 1RZIA 3IB4A 4EBQL 3S36H 2FJSA 4X98B 1Z2KA 2BX5A 1K6QL 2GHZA 2OR9L 2VKWA 1KGWA 4G7YH 4HXAH 1SN0A 3SYPA 2GBAA 3DX7B 3VXNA 4ZMQA 1LK3L 5EF2A 1R1CA 2NY7L 1XF5A 4IGBA 4QHKI 1N10A 3DVGB 1ZV2A 3PWPD 4KO9A 4D0CB 3L4CA 4ECNA 5SWSA 5BS0D 1UUNA 2FJGB 3L7EB 3D33A 4WW2A 5E8PA 3E8UH 1LEGB 3S37X 1KCRL 4XMLL 4KK8C 4ZZKA 1MWAB 5IESL 3HUJA 2AXGA 5ALBH 4PHXA 4MB1A 5ENWB 4W9ZA 4YO0A 3NFSH 4WQOA 4AJYV 1WS8A 3DURA 4GIOA 2H45A 3NCYP 1JGLL 4Z3IA 4EI6B 3UGXA 2QVMA 4JCWA 4OZFA 3HW7A 5D2NE 1A1OB 2IPUG 1FZKA 4NCC2 1E9OA 1M3JA 4QXGL 1A4KB 3QQNA 5DSCA 1SUHA 4KRPD 3EXJA 4ZMAT 3TO2B 1A7NH 3DKHA 1CLZL 5EB9A 4KJQD 5AQ0A 4EKJA 4LU5L 3MODL 5H37A 4AEFA 1IRAY 3ARFD 1N59B 5H94A 1B4TA 2PO6D 3ZTEA 1A4JB 4H5SA 3HRZA 3X13B 2DQCL 2QADB 1EJFA 1JGEB 1I1RA 1F4XH 5FYJE 2Q6WA 4ZAKB 4BHUA 5I5RA 1N9PA 3UJJH 1QBLH 1ICTA 3LXUX 3I9GL 2X4NB 3AG2B 2ZTBA 3B34A 5EZLA 3VI3E 3BRDA 2ZKWA 2ZP9A 4FQXA 5DJCB 4G8AC 1BLNB 3CHRA 5D2LA 4OT1L 4BK4A 4MA8H 1J9RA 1M2VA 2WB7A 3HLAB 3HHSA 1JPGB 4CN6A 1M1SA 1CD1A 2ETWA 1SXAA 3GSQB 3KVQA 2X6BA 4ZODA 4CNIA 3FS9A 4LCYA 2BP0A 5FYKH 1JF5A 1NDTA 5EEXA 3HC4H 1KFAH 3V6FA 1AO7B 3TEUA 4XT1C 4DH2A 4WUUD 4BSJA 1L9QA 2HKFL 3PQYB 4F7TA 3MUY1 1EJOL 5DQDH 3CN1A 4GXVH 2EKSB 1XL4A 3CSGA 4LVEA 3D51A 2BW5A 1WUNT 4E9YA 3HZVB 2JV6A 5D2NC 1FNEA 1KXTB 3QNZB 2H2PD 4YUEL 4UINL 2AJZB 2VITA 3HB3B 3L4UA 1V3JA 4OUUA 5IW6B 1AGFA 3VXPB 1AS6A 4LCCC 2ZNXA 4TN9A 3ZRCC 1OALA 5CP3A 5DZNA 3T0EE 5C07A 1OB1B 4ZMXA 5BZDA 4G2AA 1O6SB 2B2XH 2XIDA 3NSDA 4I48A 2WGXA 2BY1A 5I5IA 2N56A 3Q8CA 4GI8A 3QEHA 5F7UA 3NK3A 3GK8L 3SDDA 1SMOA 4FNTA 4NOFA 1QUNB 4FE9A 3BZEA 1ID5I 1S9XB 3NCMA 2IWFA 3FU9A 4IRSB 1C1EL 1H19A 5IB2B 1CXIA 2H6PB 1HHJA 5ICXB 2R15A 2Z93B 4HQQL 5CLYA 1NGPL 4I88A 4LXFA 4P3DB 3KGSA 3M7FB 3P4NA 5J1TC 5I1HH 1OSYA 4FD0A 4R8WH 1MLBB 1XF2A 5GGTH 4MJID 1IGMH 4PRDB 4GRWH 3HPJA 2VAAB 5KYXA 3BPLB 1FPTL 2VQ1A 4BZ2A 3HMWH 3DTDA 3TBWA 3U0TB 3GSWB 4HF5L 4XVOA 3VRJB 2FQFA 5EMYA 4WJ5B 3FB8B 4CBPA 5EWIL 3IE4A 3CWGA 3FQRB 4KZEH 4LIQH 2KERA 4GBXD 4LSSL 3JWNC 4BK5A 3MRCB 3K2IA 5J56B 3UTSB 4W9IC 2FDBP 2X41A 2YSSB 2Z35A 3QEQB 4UWQB 5E2WH 5FW8A 4UM8A 2D73A 1W2KT 2X53A 1JZGA 4FQ1H 2I85A 1PZBA 3TXAA 4U1SB 2F5AL 4MJ5A 1UD6A 5GJTL 3ZDYB 3GMMB 4P04A 1BF8A 5L4FA 1TZHA 3OC5A 4LL9A 3TM6A 3FT1A 1KT2B 3CPLA 3HS0C 4Y16D 4NC1E 3N43F 1DVFA 5T33L 1QKZH 3LSOA 1S7VA 5DMKB 1AFVH 2XV0A 4FQLL 2IH1B 2EIKB 2P28B 1A22B 3W81A 3Q3GB 4N0UB 3GIZL 5ESQA 2EIJB 3JT0A 4UT9A 3KGRA 3TBYB 3CFKB 3D3VD 1SBBA 1S9WA 1UZ6F 4ODSH 2BW4A 2AQQA 1BZ7B 5TDPB 1DN0B 2YXWA 4PV1C 4LSRH 4WUUE 2ICEA 3MV7D 3E2HC 3E7JA 4PW4A 3V0AC 2KC0A 2X6CA 4Z7QF 2FHCA 2P26A 1E8XA 3VGGA 2QHRL 2FBJL 3ZT6A 5J8OA 1UB5B 3IJHA 3D9AH 1GYVA 1LO2L 4M5ZL 4O2EB 4PY8I 4KRPC 3IJEB 5CFHA 2D4FA 1J8HB 3KPTA 4JDTL 4N8CH 1B9ZA 4QWWD 5DJXB 4M5YH 3GSXA 2W80C 3QI9A 2DQ6A 1JYVA 2EC8A 4F9LA 4FL4B 3ZYJA 1D5IH 2ESVD 3WAJA 3ZIMA 3IGFA 3JV5A 1JXGA 4P2QB 4PW9A 1MRDL 1KIPB 3CZGA 4HAKA 1J1OL 1CPUA 2A6JA 3JWNH 3KPNB 1RFDH 2ZXBA 5AEAA 4Z7UB 4JFEA 4NC1C 1S3KH 1RXLA 1YNTA 3GKWH 3HRPA 2ITDB 2CJTA 3ERXA 3H2PA 1JXJA 3OPZH 2H0EA 2V4LA 3ZSSA 5DMJB 3Q1EA 2EH8H 4H4NA 4DVRH 1JYWA 1YEHL 5TE4L 2D7QA 5DEGA 2ZKXA 3GD1C 4M5SA 1YCSA 2BVQA 1AQKL 3TWYA 3FTWA 4WV1B 4R0LC 4LCWA 2UVEA 4NKOB 2HJFA 4G1EB 3VSUA 2PCXA 4ONFL 1G7JB 2R1WB 3FCTB 2XWCA 4MJIE 3NCJH 2Q1EA 5F6IB 5CFAA 4QHPA 1SJVA 2CK0L 3ARXA 4ZMYA 4JGMA 3T77A 4ZX3A 2IGTA 1G1OA 3GSNA 4XPGL 1ET7A 2IPKA 1OW0C 1RUPL 2J56A 4M48L 2H2PC 2O26U 4J1UB 1DJSA 2CRZA 4G9FD 2VOTA 2WXNA 5HHMD 5IJVA 1LP9B 4LLMB 3AAZA 3UTTB 1P9MC 5CF3A 1EXUA 1J9QA 2FQEA 3O8XC 3AFLA 3ABLB 2Y69B 2PW1A 3IM1A 1Q72H 2XXMB 4LASH 2SEBB 1W91A 3FO2A 4UOJA 3KXFD 5CEZH 1IC7H 3HG1A 1QEWB 1UJ3C 1UUSA 4HJJL 1BWMA 2Q7YA 2VLRA 3FW6A 4HDIA 1HHGB 2F74B 2OXHB 1R3HB 5GIRA 4GI9A 5JUEL 2D9CA 2BSDA 1P4BH 4R4BB 2E6JA 1KJ2L 3GTNA 3QFDB 1XMWA 2MNWA 3C8KA 1COBA 2V0AA 2RJMA 3OJ2C 3GLAA 4R7NA 4P4RA 3ILQD 2ZOKA 5D9SB 5IVXE 3HNVH 3V95A 3BKCL 3D3VE 3BPCB 2JQMA 2GK2A 5E03A 5E1QA 1XHHA 3RX8A 3MV7E 3JYBA 3P30H 4EXKA 2X2UA 4F5CA 2CGRL 2YQGA 4F57H 4QRPD 1NFDB 5CO1A 4PGJA 4QHMB 3GBLA 3RWIA 3L3OB 1QFUH 1ASQA 4XH2B 1EUUA 2MCAA 2XV6B 4GBXC 3N1PC 2AXWA 1U36A 4JDVA 4AI7A 3QR0A 3VXRD 1LE9B 2Z8SA 4MJ6B 1F4YL 3P4LA 4NXKA 4PJ5E 3QAZC 3MUHL 4NRZB 1MFBL 3IJSA 2ESVE 1WP6A 2FUTA 5MERB 1SFHA 1R34A 1J1XH 3NCYS 1BFOA 4IHBA 3B37A 4YFEA 1KTKE 1WEJH 2Z31A 4TL5A 1NINA 4Y16C 5TDOB 4MD0A 4NNPL 5JW5B 4Y4HD 5E1AB 4ZUVA 1DBAL 3KPPB 1A2YA 12E8L 1WSST 4G8GB 4W70A 2WLLB 3EO0B 4ORGB 2VW4A 5ABAA 3UG4A 1QZNA 1GC1C 1B4RA 4N0YL 2YOAA 1X5XA 2AQNA 2F53B 4F7EB 2FH8A 2CO7B 3FZUD 2UXFA 5C0BA 3M45A 4TPRL 4JVUA 4P4KB 5I74B 1WZKA 2AABL 4HHAA 1OHZA 2K9FB 4AIXA 4GKSA 1P7QD 3PFQA 2GBVA 1MPAH 1ORSB 4G11A 4FMVA 1OZUA 4W9DC 5DZ9A 3R0NA 2EP6A 5HHME 4JZOA 3CU1A 4R97C 3VFRA 3O3DA 4QWWC 3LKOB 5EFIA 3SPVA 4YSTA 3L13A 3MLYH 3G6DL 4WKZB 4BM7A 1H8LA 3LIZL 4X5WA 3GSRB 4NHUA 2ED6A 3BAWA 3X11A 5HGBA 2XWZA 3H7LA 1MH5A 4WEBL 4DEUA 3M7OA 1W72B 3OKOA 2E7LA 1P5UA 3WUWG 1VHPA 4OZHE 3ZT5A 1HYSD 1N0LA 1YHPA 1H3TA 2RFXB 4L37A 3V4VL 3K6SA 4DCQA 1EFXD 4AH2A 4UAHA 4F3FB 4HWEH 2NYZA 2JSFA 3ROOB 1XCTA 3PWLB 4A2LA 5I16B 2CAKA 3EH2A 3O6FD 3D6GA 4F9PC 1KENL 3CHXA 4AUYA 4D0DB 3T71A 4JFDA 4NBXB 3E9TA 5IFAL 1EHLH 2FSDA 4YOKA 2QQKL 4QCIA 5INCB 4AQOA 1QSFB 2ZF9A 1EBAA 4NQEE 5CGBA 3IPBA 3NIGF 1L5GB 4X42A 1T1ZB 1ZWIA 5C0RL 1N6QL 1A1NA 2ZG1A 3QP3A 3SDAB 1P5VA 1HXMB 1JXDA 1K72A 1K4DA 3FQUB 4OLYH 1H0DA 2EUVA 4ONOA 2ZZUT 3B7TA 1Q94B 3ARGD 3EGXA 3WNLA 1MCBA 4UDTA 1GC1H 1BOGB 4QRPE 3BEWA 5EN2A 4XP9L 3QGVA 1BF5A 1P0SE 3OC8A 5IROA 2J12B 4Q9QH 4PGBA 4Z7IA 1JZ3A 1F90L 1MFCH 3NEOA 4PBVC 2CLRA 3O3BB 1UASA 3A67L 4D2NA 4OLEA 4IOSA 4KJWD 2GSIB 2ADJB 3JWOL 5IB5B 3KYNA 5KANG 4HUUB 1IZKA 4N0CD 1A7RL 5C70A 5KYWB 1WFOA 5ANHA 2VDOL 4ZFOL 1SBSH 2QPSA 3CFDB 4FS0A 5FO8B 3DHMA 2E27H 5A2KH 1YMHA 4GIPD 2Q5BA 3MA7B 1NBQA 5KBMA 5K9JH 3PV6A 1DJZA 3CFEB 4Q6IB 4PJHB 1OPGH 2BP8A 2JCCE 3OKMB 2XKNA 2ZT9C 3WFHA 5EUKA 3OHXA 5I0YA 1RZJC 2XWRA 3ILQC 1L9TA 4N6QA 2I60L 1PZSA 3H9SB 4NLAA 4EVNA 4XAKD 1JVLA 2E0PA 2XXGA 5D7IB 3T0AA 3GSVB 5LXGH 4RX4A 4J23A 5LNDA 4XP6H 4N0FB 1HT6A 5H4YA 5IT2H 5KVMC 3NT0A 3L9RB 5F7BA 2GUYA 4OKVB 3K7UA 5JQIB 1SHMA 4FG4A 3PDGA 4L0PB 5AD0A 1PKQE 3RGVA 1G6RH 3L3HA 4LVNC 4PG9B 4QRSB 1BJMA 1QO3A 1QLEB 3I74A 4G8IB 3RFZB 2CDGB 3IDXH 4BUQA 1NMCC 4FQQA 2F15A 4FMKA 4FULA 2DLTA 2I5YL 1YEDA 1GS7A 2QGEA 4FERA 4MA1B 2XNAA 4WNQB 5DURB 1T03H 4CN1A 4AL8L 2FIKB 2C1PA 2W38A 3SPGA 3CFBB 4LLWA 3P3YA 5T1DL 4S0TD 1XZ0A 4R3SA 4H1LG 3WL9A 2VLKB 4C83B 1JPTL 4FN0A 4AGOA 2GI7A 3U25A 3GLEA 5FDYA 5I8KH 2QTEA 4FFVD 2EDXA 5C92A 4Y4HC 3ME0B 2G5BA 1Q1JL 1HESA 2N7BA 4NFBA 2AZUA 2DMGA 3EJTA 4XBMA 1EHAA 2VMEA 3FSOA 3KYMB 5LGKA 5HYSG 1ZLUK 3GI8H 5D70H 1IQDB 4ZUSA 5I0ZA 5DZOA 4YHKL 1IGYA 3MYZA 1M53A 3JSSA 3FZUC 5AUMA 3STZB 3VCLB 5KN5B 5DJ2A 4CN4A 5D7SH 3MGTB 5F72S 4YSSA 2G9HB 5FHAL 2JJWA 2W9DL 5KOMC 5JO5B 1ZVYA 4U3SA 3QJFB 4HXBL 1RZJH 1GYWA 4LSUH 4NI6A 5KSAD 5KVGL 3TJHD 2X1XR 2XY2A 4G3YL 1UT9A 4BBWA 1W8NA 2L7UA 2UXVA 3FYEB 1CURA 4OUOA 3I75A 3RWFB 1S8DA 4LQ1A 2J7LA 1BQLL 4OLVH 4Z7WA 5CLTA 2R0KH 4DEPB 4YX2H 4RISL 4FZ8L 2YPLD 2HVKA 3TBSA 5LLIC 1ORQB 4H8VA 3DK0A 4TNWF 5EC1B 4JAMA 4DIXA 3H7BB 5TDNA 2H0FA 1OANA 4XBGB 1I7UA 1JV5B 3ULVL 1UA6H 3LH2L 4LSPH 1RPUA 2QPEB 5EOTB 4P9HL 2A74B 4JB9H 3MJ9H 1HYSC 4JFUA 4FKEA 3S2CA 1MXDA 5I8OH 2PW2B 2WYIA 3L9EA 4N1HB 3PFUA 4UQCA 4YFDB 3SDXB 3VDAA 1GL4B 4PLJD 1DBKH 4WGKA 3O6FC 6FABH 4IS6B 4OBRA 2HVJA 3BH8A 4GH7B 5K1NA 4KK5D 1TJHL 2X4OA 2GB2A 3MZGB 2V2XB 3HNSH 2PPAA 3F8UB 3GNML 3KDMB 4NDMA 2PXYB 4XCEB 4YHIB 1WFMA 4POYA 5GGTA 2RA1A 4FQ2L 3OJMB 2ITEA 4CSPA 1HXYA 2OL3B 1EGJL 4UBDD 5DJYA 4YS4A 4H25B 2Q7NA 4HIEB 3VD5A 1XF4A 2C4XA 3OKYA 2ZUTA 4G7VH 2CMRH 4PEEA 1P2CB 2HWZH 2WAQA 2X4SA 2D3JA 2O72A 1ZGLP 1RUAL 2GUOA 5MEOB 2KH2B 1YMMD 3RZWA 4M7LL 1CD8A 4M62H 4OCXL 1GGBL 1U41A 3KH3A 4FXKC 2A6KB 2LTQB 4KJWC 1XV8A 2VDQB 1UKQA 4MS8D 4GUPB 5D1QB 4CSZA 1N67A 1FDLH 5D4QA 4MMYB 1LE5B 1YDPA 3IDIB 5DD6A 5D2NA 1NEZA 4YQXH 1MIML 4Z23A 5I71B 3FCSB 3IRZA 1NSNL 1A25A 4RESB 4K23H 3ZKXB 2XTSA 3RA7L 5JPNC 4LCCA 1EZLA 1OL0A 2Z6FA 4FJ6A 1SLWA 2A1WH 3QNXA 3WY1A 4GAAA 5L2KD 5K9KA 3D39B 2EQDA 2NZ9D 4OTXH 3MBED 1I7ZA 2UX6A 5GRZA 4NQDE 3I6GB 1ZRUA 1IAMA 2DWTA 4MNGB 2BSBA 2K7PA 2E4TA 5BXFB 4TSCH 3S37L 4K55A 3VXUB 2JELH 4U1GC 4AYFB 1LHZA 4PRPA 5CSGA 3VI3A 3VXSB 4Y4KC 4UMSA 3HN3A 3KPMA 3FYIB 4ZUTA 3V52H 1UA3A 3GWJA 1C7TA 3QUYA 3X3FH 4Q52A 5EF3A 4NPKA 2D8KA 3PAVA 4PLNC 3NJXA 1WUZA 2CJUH 4L23A 4XHQA 4LARH 3VNYA 2BIMA 1L9MA 3EADA 3ZE2F 3GXPA 4ETQA 2E9GA 2IQ9L 2R23B 5C0IA 3GSUA 5DUMH 3C2AL 2C9XA 2AMUA 4LFHD 1MWAL 4M3KB 1C08A 2ICWA 4EDWH 4IU3B 1YPZB 4QXWA 3SDCD 3D50A 3A22A 1FFPB 1H6EA 1B3JA 1OTSD 4X8XA 3T0WA 2VSDA 1SYVB 1NAMB 4K5NA 3EJZD 3SGDI 5HDQL 2IG2H 1MQKL 4GW4A 3RJDA 4LLUB 1XGYH 5C08B 1RK1A 2ADFL 4HJUA 2EADA 1JRHL 1RD6A 4M7JH 4R90H 3RKDD 4FFVC 4ALAL 3Q2VA 2I7OA 1OD7A 3IS1X 2CIKA 5SWQB 5E7BA 2EUXA 5EZIL 2BNQD 1GIGL 1K8IB 1NBVL 3G7TA 1U58A 3UC0L 4BRVA 2FD6L 2DQTL 1EEYA 4E5XG 4JO3L 2R59A 3F6JA 1SNRA 3HS0A 1ZLVK 4AQZA 4WKXA 1LTXA 2DJSA 5DHYB 1TZ8A 4ZS7H 2FVNA 4ZX5A 1XGRA 4FAAB 1LQBC 3OKKB 1NFAA 3PWPA 4ODHL 3GJFB 4DP7X 5BS0A 1DSFL 1S7XA 3DUUA 4TSBL 2FIRT 5KSAC 2OMTB 1OB0A 3Q43A 1YC7A 4OCWH 4P2OB 1I31A 2X7LA 3TF7C 3K71B 1GGTA 1X6LA 2D4DA 1FCGA 3ARRA 2BRQA 5TPWH 2HTKD 3BAEL 5FF6A 1YMME 5LN4A 4NRYB 2YKKA 3W56A 1VF5C 2ZCLL 4MS6A 1OSPL 3NP3A 2DQJH 1RVFH 2KUTA 3VQMA 3WG7B 2ATPA 4FYSA 1G9EA 5KBPA 3RJOA 4AYGA 3ARDD 2GJPA 5J11B 1J86A 2LVEA 3L08A 5KSUA 3JV6B 2R51A 1OARL 4BYHA 4YSUA 1JZ7A 1FYTA 4JZNA 5E9NA 2ZP8A 3GS7A 3L3GB 4QO1A 1YEKH 5I5MA 3PF2A 2IAMB 4PLJC 1CYWA 1DUZB 1VEPA 4KAQH 1E0OB 4S1RH 1CT8B 1XL6A 1QVOA 2ZWZA 4KK5C 4PPTA 1CIDA 1XGUA 2GJJA 3S35L 3KNBA 4CSTA 3WTWA 4B97A 1MREL 2X1PA 4DSYA 1EHXA 3G6JB 3IT8D 2J73A 1ZLWH 5K9QI 1TQCC 4L18A 1KPRB 3SD5A 3QFJD 5CP7B 2GCYB 2X70B 1DVZA 5F3HB 4J3OH 1RZKL 5GGVH 4AY0A 5E6YA 4UBDC 2XG5A 4LBEA 1OIOA 1RAMA 1NKGA 4EI5B 1XF3A 3L2NA 4R0LA 1Y0LA 3U48A 4U0RC 1YEIL 4WUUA 2WAHA 4HVBA 1TTCA 2NOYA 4F7MA 4MS8C 4FDWA 2CQVA 1IUZA 1OW0A 4N2LA 3UGEA 5I75B 4K9EC 1KSRA 2X4PB 3HR6A 2JWYA 4MXQD 4PJEF 2GC7C 1VFMA 4N8UA 2P43B 3STLA 1JZJA 2Y7QB 1P9MA 2OI9B 1VLXA 4KITB 3WS3B 3O8XA 2NZ9C 1A5FH 3MBEC 3RDTD 5JXAH 2YD6A 4ZOEA 3ETBJ 1FI8C 3MRNB 3BSZL 5D7JD 3F7YB 1TVDA 2BNQE 4F8QA 3E80A 3N44B 4PP2A 5CZKA 1CL7I 4JRYB 5DXWA 3FOLB 1TKWA 3W2DH 3IVKA 3KR3L 5DYFA 4XNAA 5DMYA 1UJ3A 4XNZB 3TNNA 2W0PA 3I3DA 2VNCA 1HHHA 4KV5F 2AJVH 2FT6A 2G3MA 2X87A 3EOYG 2K6YA 4AKOA 4RGMB 2J4WL 3FHAA 2HUHA 1AGDB 1WZ1H 3S88H 3GXTA 1JZHA 3RGHA 1S7SB 2DWYA 4K3DH 3NG5A 5CJBA 5EEZA 4TNWK 3H0TB 4RNRB 4QNPE 1FSKB 1KIUA 3R19A 1MCEA 1PLGL 1T5WB 3B3IA 5FA3A 3IAGC 4MJIA 4GRMA 4LCVA 4U1JB 3HPLA 4OVVA 4FQIH 1JPFA 4YSDA 2A73B 3P0VL 4ODWA 4TF4A 2V2WA 3SDCC 4CVXA 3APMA 1UWGL 4BJLA 1MCWM 1Q0YL 3GEWB 2DWSA 43C9B 3CE1A 5DHDA 3EJZC 2EDMA 3HAEB 5T3ZL 3HE7B 3BOVA 3KM2A 4GBXA 5FHBL 3WIFA 1E5YA 1A6AA 3QORB 3BFQG 3RNQA 5EH1A 1UWFA 2O6DA 2V3DA 2XBZA 5GGVY 4F24A 4PRIE 1EJ6A 3RKDC 5FV2A 5IGXH 1J0KA 2MQGA 3F58L 2Z65C 4M1GH 5B1KA 5IKCB 4PJAA 3KYKH 3OAUL 3GXMA 2IANB 3PJSB 5B39B 3CN0A 2WXPA 3IFOA 2FEJA 4XNYH 1EV2E 3GXDA 3IDJB 1T83C 2CE6A 4K71C 1E27B 4Y16A 1AOZA 5IIEA 2HMID 3WHXA 1I9EA 4DVBA 2NY4B 4BWTA 1BM3L 4UOQA 1CYXA 2N0MA 1CFQA 2EECA 2X38A 5BO0D 1SHSA 3QFJE 3NFSL 4ZMWA 3ETSA 4FTVD 4B9FA 4YGAB 5EUOE 4WW2F 3GMLB 5IVXA 2UZIH 1LK2A 4RGNC 3PWJA 3GBDA 4PJCF 2IWGA 1MLCB 3DARA 4Y8DC 5L4JA 3QH3A 1IM3A 3HUJF 4JFWA 1G7HA 1Y6KR 4KQ4H 2HTKC 2QZ5A 1Z3GL 5MENB 1PQZB 4LLQB 3TT3L 1CXHA 5HDBF 1Z6JT 3GINA 3QNFA 1XF5B 4NWTH 2BNUA 5EEUA 3MLVL 3L1OH 4N6RA 2Z92B 4HK3N 3B6SB 1AMYA 3FQTA 2XICA 5SWSB 3ARDC 3M8OH 3VAEA 4ABQA 3VGAC 1ND0A 1TQUA 4MB5A 1KZQA 4PJ7A 3B2VH 3ZE1E 3V6ZA 2BK8A 3NGBC 1KLFB 3D30A 5I1CH 2PABA 4FFTA 3RZCC 3FAXA 2GBUA 2HYMA 3PHSA 3ZHNA 5HYEA 1HOEA 5LKNA 3U1SH 3HKFA 3SOBH 1FZKB 2MJWA 4O58H 4LVHB 5DC2A 1J9SA 3BZ4B 4F58H 2ICWJ 4FJYA 4F9PA 2QELA 2NXZD 4OLUL 4X83A 4M4PA 4MHHG 1LQSR 1CVSC 3LD8B 4ELME 5DZVA 3BP4A 4GIAA 2WZPD 1NGWA 1GYCA 2B1AH 3REVA 1A4CA 4GXUN 1G6RA 1MCOH 3BLPX 3BD4A 4X4KA 3FXIC 2EYSA 4OFQA 1IKOP 1F4HA 2VDKH 1MFEL 2IDFA 2JIXD 2VDMB 4HEPA 3T0BA 2B1HH 3EYUL 1QPKA 1I8AA 1D5ZA 2A9BA 2HFGH 5CEXA 1OCWL 4G9FA 1ZSDA 2VUKA 4MXQC 2PP8A 3UZVA 3FRUA 4CNIB 2CGZA 5F9WB 4LCYB 2CLZA 5GJSL 2BP0B 1P53A 4M6NL 3T6ZA 3V6FB 4OGAD 1PD0A 1E5ZA 2DAVA 5AKTA 1NUGA 3BRGC 2EEFA 3L4VA 3H85A 4F7TB 2QGDA 3OKNA 3IKCA 3KWWA 5DD3H 4IBTA 5D7JC 4L3ED 3KXFA 4ZMVA 3EXLA 5KSVA 4Z5RA 5JIMA 5DHXB 4HMCA 1FNEB 3R06A 1MCPL 4BXVA 5FUOL 4PR5A 4AENB 1NCHA 1GS6X 4HCFA 5C0CD 1IGML 2H32B 3GRWH 3T1WA 1VKXB 1RUMH 4FTVE 5BZDB 2VR4A 3QEUA 4NN7C 3SGDH 2AQTA 2EDLA 1PEWA 4I48B 3UJTH 3FB6B 4Q74A 2ZG2A 3QEHB 5F1OB 4XMPL 5CU5A 1NBYB 3S96A 4WWID 4WLCA 4RSVA 4FCHA 4KMQA 3LX9A 4NAJA 3BZEB 3L9BA 1YJDH 4YHYC 5F0PB 1OWRM 2BY0A 3UEQA 4A2MA 4HC1L 4AQ1B 5D96C 3N04A 4M9OA 4N87A 5LG1A 3VXRA 4ERSL 3HN8A 1DQQB 1KCKA 3LZFH 4I5BA 4JFQA 4Q58C 2R0LH 1I7TA 2AKRA 4AE0A 4UI2A 3UPCA 4WEMB 4XOAA 3LOWA 1KIQB 3JVFC 1SXCA 3RWGB 1W72L 1HEZA 4DKFH 1MDAA 5FGRA 1S9YA 4NI3A 1X4YA 3B7YA 2EEDA 2IPTH 3B9AA 4Y4HA 4G80A 5TH2A 3MRJA 4F80A 3V6OC 3UL4A 1XZWA 3WO4C 5T5NF 25C8L 5KZCD 1X5JA 1PD6A 4K7PL 3TASA 3MUGB 4ES9A 3SKMB 3EHBB 4NT6B 3MV01 4MJ5B 2CNYA 4XXWC 2DQGL 4WU7A 2Y07H 1MHPH 4IHOB 4A7GF 5JNYA 4N8CL 4M43L 1NANH 3CVHB 1YYMH 4LKXA 5SWZA 5DVOA 3WKML 1UD5A 1Y1DA 2AV7A 4XVTH 5CCHE 4F37K 5GZND 2R4SH 4FHBD 2UZYA 4G6KH 4FFZH 4S0SD 3KPRA 1FFRA 5DO2D 4AKPA 4YXHL 3VFWA 5AVXB 4WW1A 4GEIA 4KMTH 2RACA 1L9SA 5SX5H 4WGVB 4MDJB 1X5AA 2B0SH 3MLTB 3LVTA 1MRFH 4KXAA 4WI3A 4WTQA 5C2BH 1FNSL 2I69A 3OPZL 3ES6B 3UG3A 1XF1A 2YRZA 1WWAX 1L0XA 3DPBB 2EH8L 2VW6A 4KOBA 4L3EE 2FGWL 5L7XH 3O4LD 2PPDA 4MAZA 3IF1A 3ZE0B 4TM9A 1YNTF 4POZD 3RWCB 4FLOA 2ALAA 5A43C 4L4TB 2Z8VC 5AB0A 4NO3A 4PTUA 4ZMTA 5C0CE 1XCXA 3O6FA 4JBSA 3GKZA 1YYLH 3MHZA 4HA1A 4NJ9L 4NM8L 3WEAA 2NXZC 1I1FB 3MNMA 3MJGX 3I6LD 2XUWA 3T1FA 1UURA 1D6VH 2HKAA 3E9UA 5H2BA 1TIUA 1USZA 3DV4B 2R4RL 5EOCH 3PE9A 4ISVA 4KU1A 3DSFH 2HH0H 4JL2A 2ZCHL 1BGXL 3K4ZA 1PZAA 4NCDA 2IBGA 3DHJA 5DWUH 4WJKB 4BSWA 4GMSH 3SO3C 1E5CA 4J3UA 3SE9L 2EDYA 3C5ZB 1EAOA 3I3EA 4MD5B 1IGIL 2C3GA 3L4XA 4ODBD 3MLSH 2QPDB 3KPLB 2EH7L 3N42B 2ATAA 1JNLL 1SF5A 1U8PA 3NZ8B 3U4BH 1QLEL 5J6HB 5EBGA 1TT6A 4FXKA 1EDHA 3ZUNC 3RU8H 4OGAC 2BMKB 4RQQB 1NCBL 4GQ9H 5EF1A 2BP5M 3BIBX 5FYJU 2YEQA 1MN4A 2OYMA 2WQXA 3OPUA 1I4FA 5BRPA 1FRGL 2VWEE 3EH4B 1OK8A 4LCUA 3IYLW 3UAAA 5JPNA 2DD8L 2IO5A 3GSNB 2XWXA 4CADA 2MOVA 4ZPVA 1A3RH 1H3XA 2O6PA 1GZHC 1HHKA 2VDKB 1XSJA 2EXYC 3QHTC 4P3WA 4KVNL 3MRMA 4HJGA 1JL8A 4GYBA 3QXVA 4M5TA 2B7DT 4N2DA 1DZ0A 4XAWL 1F11A 1OP5K 1MJJA 3JV4A 1Q8MA 4L8BB 3T2NH 4KH2A 1AY1L 2TRHA 3MNDA 1EEZA 4GPVA 4PLKD 3CHQA 2WSDA 5DLLA 3ATBA 1BIIA 1PYWB 4IDLA 1GKEA 4Y4KA 5FB8B 3VB9A 2O5XL 2B5IB 4EN2A 3MV9D 3PWUA 4HX1B 4PS4L 2H1LM 4RFNC 3HLKA 1CDHA 4N8PA 3KDPB 3PPEA 3SCMD 1CICB 3T8XB 5GIRB 2FAUA 3AXLA 5CBAA 4PU2A 5AKVA 4UTBH 2XOTA 3C8KB 3BAJA 2DWXA 3D8MA 2VZ3A 3G5ZB 3GJEB 1LD9A 3Q5TA 3RL2B 4P4RB 5JR1L 3LEYL 2WBWB 4Y2DB 4QRBA 2W9EH 4DNLA 4DN3L 4YSRA 5BO1H 4KQ3L 4ACTA 1M7UA 1HJBC 2QMKA 4IMLB 3COOA 4G8EA 3D2UD 1SY6H 3TTYA 2IBZY 2MKLC 4UIMA 5MEPA 1Y7VA 5CLWA 4JDZA 4IDJL 4WI8A 3O4LE 1NFIA 2AJSH 2C9UA 3PDOB 2D7TH 5PCYA 2A6IA 4AQEA 1JGUL 3NTCH 2H8PB 4NENA 5AOMA 3VI4B 4DP4X 1BBJA 1AANA 5J1AB 3H55A 2HVBA 3L4YA 3O9WD 4GRLC 4ZFFB 1JNHB 4X4YA 3OAYH 3VG0L 1TEYA 4CMHC 3IJSB 1CFVH 1O75A 4S1SH 2E76C 3BP7B 1XMEB 1BM7A 5JQ6H 1NMBL 2FHBA 3WNOA 3QVAA 3EYSH 5DQ9A 2C9QA 2Q3AA 5KSAA 2DKMA 4WI7A 3DIVA 5GZNC 2OL3L 3O3EA 4HCGA 2F19H 4OIFA 4XBPA 1CIUA 3BJ91 2ZOLA 1I8IB 3CHPA 3N6YA 4PG2C 1UTDA 1B2WH 4PY8J 4UYQA 4X7CC 1Q9KB 1HC1A 3U30B 2BSSA 2YPLA 1IM9D 3ZKSD 1QHOA 5C0BB 2Y06L 1IV8A 4ETYA 5I73B 1QRNA 5TE7H 2VDQL 5DHVB 5HVHB 3IU3A 2GJ6B 4N2OA 2NY6D 2YIHA 2C9SA 4TRPH 2HRLA 3QG7L 3NDYE 3BEVB 1T5KA 4KKBD 3QPQD 4A1RA 2R69L 1AGCA 2TAAA 1DSYA 2X6UA 3MGOA 2LE9A 1WAAE 4JKKA 3VVWA 4HLJA 1UWXK 2UYLA 2Y24A 4LPWA 4PRHD 4X7SH 1UH3A 5T3XH 2AJYH 2GAZB 1BFSA 3H2QA 1RSYA 1UM4L 5HBBA 2NYYD 4KI5E 2IH3A 4NHUB 4NQQA 4XZUB 4Z7NF 2JKLA 1EK3A 3NIDB 4UIKH 3MV9E 5IZ7A 1EFQA 1OT1A 3IDUA 2QVFB 3K8KA 1M7IA 2IH8A 4DQOH 2N7SA 3NVQA 4AW7A 2VMFA 1CFNB 2EKJA 3WY2A 1E40A 3AB0C 3LQZB 1QA9A 4JFDB 1F56A 3CFTA 3VG9B 2FCBA 4UNTA 2FR4B 4Q4IA 5CJXC 4PY7A 4PJBB 4R2GC 4EAEA 1KDIA 3NJGA 3O6KL 3LCYA 4P57A 2P3YA 1AQMA 1CG9A 3AWGA 3CDCA 1YMMA 2YD8A 4JREC 4L1BA 5D5ME 1QSEB 3RUGA 1U93B 1D9KB 1QNZH 3ZXAC 1P5VB 2YGNA 1RJZA 4PBWD 3OG4B 4TNVF 3VXTB 5BQ7B 2O30A 2YFOA 4YHZL 2XBDA 4BIKA 5JPMA 1KTLA 2K9UA 3II3A 1FFNB 2VRAA 1NAML 4YHPA 4UQDA 5E99H 2JB5L 1NZRA 1P4IL 2EDKA 1QUPA 4ZMPA 5L2KA 4NBYB 4PGBB 5HYJD 3MBEA 2VM4A 4G8FB 1BEXA 2F54D 2R1YB 4GFTB 4OFVA 3LQAC 3B2DC 1GHFH 1REIA 5TGBA 5IQNA 1VPOL 5JOEA 1ZGLA 4PLKC 1OGAD 4WEEA 4M6ML 4HUCA 3DTUB 3AG3B 5L0QB 4G82A 2E59A 5GS1B 4DGIL 5L6YL 4YMPA 2R8SL 4FA6A 2OTUB 1TQTA 1OM3H 5T1KD 1KXQE 4ZYKA 3SCMC 2FQGA 2YAQA 4JN2B 5AKRA 3R7RA 2MQ3A 2BP8B 1HNFA 1HS6A 2DWEB 3WFHB 3CDGA 5EUKB 4ZTOL 1JWUA 2V9TA 3U2IA 3C09C 1ZLSH 3ZDXE 5E5MA 4PREB 4UUJA 3BW9B 3AWEA 1AI1H 4OJFL 2KMWA 3GFUA 1GZPB 2XN1A 2YD2A 4AT6A 4ADGA 3SDCA 1ZT7B 3L9YA 2EYTA 1P4UA 3UBHA 5JYMA 5CJ8A 1TJGL 4X0KA 3ASNB 3OQRA 5ILTL 5J6GB 1VSCA 2FRGP 4Z77A 4PB0L 4H2AA 3V55A 5AD0B 3OQ3B 3E6HA 5AZUA 3UZEA 3RGVB 4JFZL 4MYPA 1LP9F 4PP1D 1KN2H 4MMXB 1OCZB 2AK4D 4HLZG 4KKRA 5ERWB 1E3ZA 1WC7A 1NIDA 3FO0H 3C8DA 5FFGA 5J3HD 3Q05A 2ARWA 5B38A 1QZ1A 3O9WC 2GABA 1OHQA 2V6HA 4FNSA 4XNUH 5LNEA 1T83A 3C60D 4NAQA 3LKNB 1B4JL 4BCXA 3F62A 4IU2A 4YNYB 3TO4B 4KKAD 3DVNA 4LB8A 3UPAA 2H1PL 5FUZL 5I1DA 5BRZE 3C5JA 4QHNB 4EEEA 1CFSB 2GJZB 4CBZA 1IC1A 3LQAH 5IW3A 1CBVL 3ETBF 1V5JA 3QIUD