4KNQA

Crystal structure of 1nt-5'-overhanging double-helical ccg-repetitive rna 20mer complexed with rss p19
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
122
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
total genus 35
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2013-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4knqA01
4JNXA 4J5VA 4KTGA 4J39A 4JGNA 4KQ0A 4JK0D 1RPUA 4KNQA 1R9FA
chains in the Genus database with same CATH superfamily
1F86A 1P5UB 4QHUA 5HPOA 2UVFA 2BCMA 3AXLA 3M7OA 4ZNEA 2CCWA 2J7LA 3IDUA 1EO7A 2Q2LA 4R26L 3SYOA 4NPYB 4D9QD 1MNNA 1OP9A 4QHLB 5CGBA 3WG7B 2ZOLB 3P11L 4ZAKB 5IW1B 1FJ1B 2HX9A 3DX6B 2EDRA 3K4AA 3V0IA 4YDVB 4A63A 4NZUH 5CJXA 2HWZH 5FC9A 2WXQA 4OF6A 1BPVA 3O9WD 2CG9X 5D1XB 3W39A 4X6FB 1FH5H 1QR4A 1V3KA 2G3MA 2QQLH 1ADWA 3HLAB 1LVEA 1Q4NX 1RIVH 4RFEA 4HUKB 1A7OH 4YDLB 4P5KB 2BK8A 5LGHL 3V5HB 5C0FA 3PGDA 3SQBA 5DVOA 4AK2A 2F53E 3ZIMA 2QMKA 2VM4A 4YUEL 1FZMA 1MEXL 4PJIA 5HI5C 3DHUA 3G08A 2OX5B 1KYOJ 5I1GL 1BXAA 4P5MA 1C16B 3SJVB 4G8GA 3RGVC 4WAFA 2FWOA 1XSJA 1FLTX 1RZIB 1G9NH 4AM0Q 4L4VB 1T21A 4QRPE 4N5UA 4FQ1L 4PJ9C 3SDAA 4DKTA 1E2ZA 3FN0L 5HYIA 4ZX5A 1FZOA 2BSBA 3GSWB 1XBRA 4JHAL 3L3JA 3TEWA 2IDSA 2ORBL 5CZVH 5AWNL 4E2OA 1AS6A 1TMCB 3VWJB 4D9RE 2VDMB 1IFRA 1ECZA 4J3OC 1BHGA 4EAEA 1P6AB 2GHZA 2ITDA 4ZUUB 3AVEA 3QIBC 4JHVA 2OJZH 2J1KA 1W72L 5DQ9B 3B7TA 3ULVD 4M5YL 5BZWA 2Z64C 3KPSE 4NWTL 1HXYB 2WAHA 3NIGF 1KGYE 2R0LH 3H9HB 5IFHH 4F7MB 1IQWL 2GCYA 3FMGH 4KKBC 1JRHH 1NWPA 4LKCA 3RWFA 2Y1ZA 1UWYA 3STLB 4AG4H 5LG6A 1E7UA 4RLDA 2FHBA 1ZANH 4OCXL 1HHGA 1JD7A 5CZRA 3T71A 5JXED 3TESA 5LNGA 3CC5B 3TPKA 3DIDA 1GCYA 4YFDB 3QDJD 1MFNA 2EDWA 1D9KC 4WFGD 4Z0XA 3MRFB 3ZKNC 3QIUB 4JO3L 5HHQB 3OAZK 3GTTA 3KLAA 1QQDB 1UD2A 1WZKA 1ZE3H 4X4ME 1NIBA 1XZ0B 3L54A 4DQAA 4UOZA 1SLVA 3CSYB 5IGXL 2AERT 5DHMC 4WO4A 1IAOA 2DMKA 5BPPA 1WBYB 4V1DB 1RUQH 3WXVH 4NKMB 2HTKD 3KXFE 4BCZA 4Z7VA 1QHOA 1CYXA 4CVXA 4YXKL 3IDGA 4N6RB 3B83A 3ZO0A 5C2BL 4KVNH 4Z7UA 3QJHA 3QORD 3LHAA 4R5XA 1PKQA 4XCNA 2IH3A 4L4TE 5DC2A 2NX5A 2P8MB 5I71B 2V3FA 2J8OA 3OG6B 2G60L 3BAEL 3GLEA 3LIUA 2ISDA 3LKNA 4XN5A 3PV6A 4ELMA 3TIEB 1ORSA 3HNTL 4JFFE 3U7WL 1SVCP 4XNMA 1N0XH 3N1QC 4GIOA 2C3VB 3JVGC 2VTFA 1TFHA 3BAYA 4JKWA 2UYLA 2LABA 2ZKMX 4FLHA 1T1ZA 3P3SA 4KROD 4GKLA 4YHLH 1BAFL 3U9UB 4FLSA 1A3LL 5GQBA 3WGUB 3N43B 4NQTA 1IC0A 4LAQH 5FYKD 3WUWA 3ZTJH 5GPRA 5JIQA 3KPPB 4TUOA 1WRFA 4OU3A 3VX0A 5H2BB 3CNKA 4OLXL 1CICA 4YVUA 3ESUF 1IARB 1UXSB 2NY6B 1Q0YH 1ETJA 4O02L 4K7PL 4XCFH 4K9EC 3T8MA 2H2SC 4Y8AA 3V95A 1ETB1 3EXLA 3V4UH 1P5VA 2EC9T 5ANMA 1SDDB 4NJ9H 1AXTH 2J1XA 4P4KD 1BA9A 1L6PA 5IQNA 4LHUD 4R96A 4XMKL 4AQOA 2Q76A 5J12C 4QOKB 2YLHA 1A0QH 1UJ3B 3FT9A 2QT6A 1K8DB 3VGFA 2VR7A 2BZ7A 3QRGL 3N41F 4JCMA 4LESA 4ZZFA 3FUEA 3CFMA 3GS4A 3CDCA 1HAUA 5EMYA 4EZLA 4MTMA 5CJQH 3KJ6L 4TUKH 2J43A 3FKUS 1D5BA 1HU8A 3E0GA 1J1XL 4U4IA 3RWDA 4ENZA 4XBEL 2R2EA 2FT7A 1FWXA 1IBFA 5CEZD 3ARXA 4GKSB 43C9B 4PS3A 5CILH 4U1HA 1JNHA 1K3ZA 3FOLA 1YQ2A 2TSBA 4R2GD 1F4YH 2P5EA 3E3QC 4W9KC 4F2ME 3H55A 2WCSA 1TTFA 1I8IA 3M88A 3VGBA 4IGBB 3GHBL 2WBJB 3QDMA 4OCMC 2WHVA 1UC6A 4HGKC 3BSZA 2JELL 5F44A 3WEOA 3QCVL 3WS3A 4KRMB 2Q8BH 1B9KA 4K5NA 3GMNB 1ZSDA 2ATAA 3P9LA 2B20A 2WKGA 1XL6A 3NCEB 4QHMB 3U6RB 3L4YA 1U58A 3QZLA 4E5XA 3IU4L 2A4ZA 1AI1H 3QO0A 2HKHL 3REWB 4ACPA 4ZNCD 1FE8L 3EJPA 1USZA 3EGSA 3UG5A 3KYOB 1WWBX 4N2CA 5ESQB 3SD5A 4AGQA 2J2ZA 2YRLA 3S4SG 3KG5A 2CRYA 3PIQB 5KBNC 4G8GD 4FQQA 1RSFA 1UXWA 1QRNA 4DN3L 5D7JA 2APFA 4PRNB 3W9EB 5K59F 3HZYB 4DW2L 2XNAB 1PPIA 4QRUA 4QLRA 3BKML 3SDAD 1CLZL 1NGYB 1IILE 3S5LG 1KOAA 2G3NA 2K4AA 4P3CH 3ZT7A 3N2JA 4ZI8A 4ODWB 1KG0B 5KSUA 1V3LA 2O6DA 5DVMA 4PJGA 4D3CH 4JFTA 5HHOB 4U1KA 43CAB 4E0RB 12E8H 1ID5I 3SDCC 4PRIB 4YIQA 1NKGA 2ZWLT 4MDIA 1LD9A 4B7IA 3VW3H 1C1EH 4ZUTB 1NINA 1UUSA 1WO2A 2RQEA 2UY6A 5B1BB 4EQ3A 4FQCH 5FUCE 1LP9B 5DJCB 2D7TL 4DEPB 1OGTB 3UG4A 1J18A 1QBML 4MNHB 5LBVA 1ACCA 5K59E 1DUYB 1T0OA 3O0LA 2EEBA 3BP6A 4XNYH 3UTQB 2F7IA 1KENL 4RMBA 5DVNA 1ERNA 2CBPA 4O2EB 2GAZA 5CD3A 4L5FE 1YEHL 2D03H 4L9LA 5ID1A 2HT3C 2LE9A 2OJEB 3QHFL 4LP4A 4R7NA 4S1RH 1BWMA 2ITCB 2LAGB 1T1YA 5DVLA 4XBPB 4HG4K 3VH8B 2ADGA 2C3WA 3PGCA 1ZKAA 2VLJD 4PR5A 1P5UC 3AY2A 2F8OA 3LS4L 4JY4B 4DVRL 4DH2A 3CFNA 4HMEA 1J12A 3FQRA 3QJRB 4D9LL 4MGXA 4FXGA 2EIKB 4PBWD 4WO4D 1MIMH 4ZAKC 2DIEA 2Q8AH 5LQBL 5SWSB 1MFMA 5D2LF 5KEZA 3MV7E 4YE4H 3BKJL 3JT0A 3KM2A 3QUYA 3TWCL 2VMEA 4RX4A 4WWOA 3GMLA 3M17A 4HWEL 4JANA 5D1XC 1BQRA 3VFRA 2NX5D 2RFXA 3LV3B 3LRMA 2AJUH 1GMIA 1BXVA 1GKEA 5TK4A 2XJKA 2V9QA 4G8EB 4YDLC 4FKHA 5A3ID 1I1YB 4XPAH 3C2SA 4BK5A 5LKNA 3A0OA 4JZOA 4OV6F 5JHLH 4YXHH 1BVNT 4AVJA 1AQ8A 1MG2C 2VUOA 1MLBB 4JK0D 2HFTA 4N26A 4CMMB 2VRQA 1C8PA 3PJSB 3O6MH 5MERA 1H3XA 3MO1B 4ODSH 4QXTB 3IETB 4NO0D 2YA0A 3O9WB 1E90A 3IGFA 3P2TA 4P4KA 4CSTA 4WFED 4Y2DA 3SPIA 4ZQKA 1CICD 4ZG1A 4U6VH 5IW6B 1SM3L 4EDWL 1TDQA 3J7HA 3LMJH 3JYBA 5BVJB 1IAIH 4MDRA 4G1EB 1NBYB 3R4RA 4G83A 5MENA 1M56B 2X9XA 4G2AA 3VWJC 3RVXC 2L7QA 2EYRB 2VABA 3QO1B 5EBLA 3D30A 1UCBL 1PIGA 1TEGA 4NBXB 2WVUA 2XQBL 3CDFA 5F7MC 1CWVA 3S98A 2ADJB 5F7DB 3Q3GB 2NTFA 1BX2A 3EH4B 4JZNA 4N8CH 1CG9A 2CPUA 1RPUA 3FB8B 2GPZA 3Q1SH 4HSCX 4IHOB 4PJCA 3WIHH 3RWHA 3VFPA 4NT6A 5HD8C 4WSGA 3I50L 3FQ2A 4S1SH 4AQEA 3NJXA 1FNHA 2VIRA 1KZQA 3FZUC 2X1PA 4LLVB 3U1SL 4BFNA 5DJAB 3GSNA 4AENB 3MRHA 5ITBH 3EJSA 3CVDA 4M7ZB 4IU2B 1G6RB 2WWMC 4CU7A 4PBDA 3L9RB 4HK0A 2ZX5A 4M62H 4F15C 3UC2A 2OFQA 3VM7A 4EDXA 3QUGA 2P5ED 3DTDA 1HVXA 3DX4A 4W9JC 3Q5OA 1CFNA 4L18A 5T1LA 3QDMD 2VXTL 2DH3A 1I7ZA 4ONOA 3GSRB 4LDCA 3HI1B 4JDTH 3QZBA 2P24A 3L4XA 5DEZA 3SE6A 3EZ8A 4RGOH 2X70B 5TQ2L 5HVGB 4H8WH 3QDJB 5T3XL 3CZLA 1TT6A 2ZX7A 4A6YL 4PREA 1T0MA 3VH8G 2EVFA 4XVOA 4ZFFB 1VCBC 2B0SL 2VR4A 4B9PA 2RR3A 5LG1A 2XFXB 4ZFQA 1S3KH 4DIXA 1ND0B 3OKOA 4LPXA 3ZUNC 2X88A 3WFBL 4XN9A 4ZO8A 3UIZA 1TZHB 5FLUA 4Y88A 3UPCA 1QEWB 1QRND 3HR6A 3H4FA 2K7PA 3GLZA 1R17A 3PGFH 1WG3A 5I6MA 2IEPA 2EIZA 2ZCHH 1TFPA 1PZDA 4FMVA 5EC1B 4F8LA 3JZYA 5EBWA 1VADB 2B4CL 1HKLH 4MAUL 4AYFA 1W16A 5FWRA 1DE4A 1JZJA 3SE3A 3ZE0E 5KVEH 2EDFA 1AS7A 2IAMA 1SPDA 4GT7A 4CVZB 3GXUB 5C9JB 3QSKB 4Y5YA 4UTBH 1H3PL 3WTTA 2QVTA 3EFDH 1E4WH 2EEDA 1FGVL 3LH2H 1U8KB 1AG0A 3QIWC 5A7EA 4N90E 1BVNP 2H5UA 4Y4KA 4DEWA 3BAJA 4ONHA 3WNIA 2DDQH 4KROB 2AW2A 3DUSA 4S2SA 1XCTA 2BVYA 1WFUA 2ZJSL 3S3CB 4DGVH 3FT1A 2GIXA 1S9XA 1L5GA 4UDTA 4ZUSA 1EJOL 4GW1A 4IK7A 1U8JA 1FFNB 3DSNA 4P07A 2G4GA 1UJ3C 1U3NA 5E2TH 5LBSH 2AJYL 3DGCR 4ZPTA 4F2FA 1XB6A 3RA7H 1X6NA 4BHUA 1ML0A 3FUJA 5D71H 3PDGA 4GRLA 1J5CA 1CLYH 1MW3A 2ICWB 3OR6A 4BFFA 2XACC 4RAUA 4LPVA 3M46A 5DQDH 1IQDB 4U1NA 3BPCA 3FH5A 4LEXH 4WI7A 1JPGA 4PJDB 5E8NA 5F3BA 5DRZA 4EN3C 3GM8A 1MCIA 3MOAL 3QUYD 2WBJC 4RX4D 3EFOA 1EAOA 2VXSL 4QHUB 1P2CA 3AXLB 1MAMH 2PP9A 2DTMH 2DQ6A 2OK0L 1IKNC 3ZE2B 3MGOA 2P8LB 3WLWC 1JWUA 3EJTA 1UD4A 4U6XA 1QLFA 5JHLA 1MFDL 3MLUL 4R2GB 3FN9A 5C0RH 3EGXA 4PGDB 1I8LC 4G8AC 1GTFA 1H6EA 4RMWA 2FO1A 1HL8A 4NO3A 4DN4H 4AC2A 2O72A 2JKRM 2VSKB 5GRJH 5JDSA 1IGJA 1G4MA 4G80A 1X7SA 3W39B 1N3NB 3Q44A 4FZEH 1I1FA 1X5IA 4PJXA 1BZ8A 1HX0A 3FH7A 2ZICA 1GJWA 4RFEB 3FAWA 1HWGB 4OJDH 3PGDB 3UTZB 2Q0ZX 2BW5A 3QAQA 1FI8C 1T66D 1I4FA 2R0WL 1PZUB 2RQ8A 3W57A 4NC1C 4IIQB 5E1AA 4UIKL 1OB0A 4DGUA 4PJIB 3G08B 4K5LA 2NY1D 4BGDA 5GGSY 3N42B 4P5MB 1IKOP 4G8GB 5DMIL 2FWOB 2Y06H 3GXPA 3V4PH 6FABH 5HHMD 2ZZUT 3RAJH 4G7QB 1ZT4B 1T21B 2KLRA 2R15A 4I7ZC 4PUBH 3SDAB 2AABH 4ALAH 3NPSB 3MACH 3WIHA 3PXHA 3W56A 2VQ1A 1B3JA 1FZKB 5JOFA 3L3JB 4JFXA 1K6QH 2X12A 4NRYA 3O4OB 4ICWA 3SPGA 1GZQA 3C6LA 3T1WA 1JWMA 3RIAF 4FYSA 4IRJA 1I3UA 3D5OF 4GO9A 2ZXWB 2DMBA 4LLYA 2ITDB 4AIXA 2B59A 2CO1A 3PREA 3II1A 4ZTPL 5F8QC 4MZ2A 3UTSE 2DIJA 4ICXA 3DO7A 1AKJA 3S37H 1AY1H 5BZWB 4KVCL 3WIAA 4RGNB 3IRZA 4IBSA 3IJ9A 4H8PA 3E2HB 2GCYB 3CHPA 4LKCB 5CKGA 3RWFB 3R19A 5DEJA 5T1LD 3PNRB 3HN3A 1YY8A 2LVCA 2I26N 5I75B 1XX9C 1HXMA 1PL3A 4AT6A 2D7NA 2Z6FA 3P11H 4O00A 1OLLA 1Q9LA 2YUVA 2ZCZA 1JK8A 1YEGL 5GZND 2ZP0T 2DD8L 3T0EE 3MNWB 1JYVA 2VLJB 4UINL 4Z3TA 2YARA 1BZQK 4KFMA 4KDVA 2DEWX 3KLAB 2OSXA 2E4FA 1A4KA 1BOGA 2G0KA 4EI5A 4BKTC 4MRBA 2DWDA 1BBDL 2WXFA 3IMUA 2BSRA 2WXOA 1M71A 1DVFC 5LGHH 1CGXA 4EI6B 3S2AA 4Z7QF 4JQVC 4LLWA 2COVD 2EUZA 1RL1A 3Q9PA 5D93C 5IHLB 4CVXB 3IDGB 5HBBA 1JF5A 2WCGA 4YUEH 4YLQT 3APFA 1MEXH 4AQ8A 3BLKA 4Z7UB 5C08A 1M3JA 3QJHB 3O9WC 5I1GH 1N5YL 1QFUH 2IH3B 2NX5B 2IPUK 2V3EA 1GC1L 4Z77B 1AD9A 1GYCA 2IAMD 2JKLA 1TO5A 4NRZB 3TVMB 3LKNB 5EN3A 2DIBA 4ELMB 1ORSB 5AL8A 3FFOA 4XNMB 4UTBA 4FQ1H 2DZEA 3FN0H 2IQ9L 5DMJB 1X9QA 1SMDA 2UYLB 5FGBA 1DLHA 1KBWA 1RK0B 5DK0A 4Y4KD 2ORBH 5EO0B 3ZDYE 3IM1A 1NC2B 1R5VA 3DV6A 3TV8A 3MCLH 3RLSA 4Z7QE 3IDNB 5EO1A 4N1HB 5F1SA 4HAKA 3U30C 3WUWB 3K80A 4NO0B 1MCKA 4HUUA 4ZK8A 4TUOB 3RKDD 1R0AL 4L3FA 4A67A 1D7BA 1CICB 3BJ91 1W72H 3C5SA 2NW3A 5DS1A 4M5YH 5LBSA 2H26A 1BJ1H 3LIZL 4Z3IA 3S96A 1CFTA 2YWZA 4GRLD 2IVFC 1EEYA 5ICYA 4W68A 5B38B 1P5VB 3CG8A 4OCXH 5ANMB 4MNGB 5K9KB 4EKJA 1WTLA 2QSVA 4R96B 2JJTC 4M7ZC 5JHDE 2Q76B 2WTRB 3CDYA 2XHNA 1K2DB 5CAYB 4KJPD 3NQKA 2EH8H 4NP9A 2CO6A 2K7QA 4M00A 4LEEA 3MREA 1SQMA 2F19L 3A4FA 3C08L 5EV7A 3WJMA 2FLRT 3NFSH 3P9MA 4LGSB 5IGXH 4HCFA 4A2FA 5C0BE 1S7UB 4ZMTA 1DANT 5JXEC 2HLAA 3RWDB 1KNOB 1GS7A 4WUKL 3GSQA 5D7SL 4WW1A 1XAKA 4NAJA 4YXKH 1I3VA 4LP5A 1C9SA 1OCWL 1JNHB 2XV2A 5C2BH 5IG7A 3FOLB 4KKRA 1HYRC 2DYRB 1AZZC 2P5EB 2AEQL 5DZOA 1I8IB 4LOFA 2ZG3A 2G60H 2FT8A 1GYWA 3WNMA 4N2LA 1E9PA 1KIQA 3A47A 3L4UA 4PS4L 3T6WA 3WBDA 3HNTH 1AQKL 5GXBB 4X5PA 5AOJA 3JWNE 3ZQXA 1YEJL 5EU6E 5CUSL 2HTKC 4QPEA 3EYQD 4ZQTA 1J0HA 4KTDL 2W81C 3L2LA 4OLWL 5J1AA 2Z4QA 1KGUA 3P9LB 1A3LH 4QY8A 3QORC 1U58B 2BXYA 2UWEF 3IPFA 4E5XB 5DLML 3VQ2C 4P9ML 3IU3A 3DROA 1B0GB 3EGSB 5CS7A 2JJSC 4EE2A 5K9JL 4WDIA 2I07A 4OLXH 3P4MA 1R5IA 4HKZA 1CGVA 3RBSA 5TE4L 4FQQB 3UGUA 1UXWB 5K39A 1QRNB 2XDHA 3V4PA 3EHBB 5EOTA 2X4TA 4O02H 4K7PH 1MJUH 5J3HD 4QRUB 4KROC 3SDDA 1ETZA 4Z6AT 3M86A 5C0CE 5IVXA 5JOPE 4OFPA 5KSUB 3LPPA 1XSKA 1JGVL 2EDBA 4XMKH 2CLRA 2QHLA 4U1KB 4HH9A 3F58L 1VERA 4RRPG 4YIQB 5GJTL 4MDIB 1LD9B 2JK5A 2CDFA 4KO5A 4IRJD 2QQNL 2X28A 3C60A 2KPWA 1E8WA 3UGXA 3MRLA 1MFBL 1LMKA 1AKJD 1SHWA 4KMTL 1WZ1L 1HEHC 3KJ6H 3PDOB 4IBLT 4QLWA 5T1KA 1QG3A 1CXLA 5F96L 1G9HA 7PAZA 4P4KC 2BIMA 4BFBD 2GVYA 3OAZH 1LK2A 3K7UA 5ILTL 4N0UA 5CD3B 5ID1B 4L9LB 1MFAL 1RUPL 3I6GA 2H3KA 5LGJA 1T1YB 3T3MF 1N6VA 4BK8A 1CL7I 4YEFA 2VR8A 2ADGB 4HBCL 3V6OE 4GXFA 5J13B 2QFPA 2E8YA 3PGCB 3GHBH 4PR5B 3ESPA 2QVMA 2CA3A 2XWJA 3QWQB 3DX1A 4POYA 5SWZE 2EXTA 2J1ZA 2VRAA 2X0WA 2JELH 3QCVH 1QW8A 3H8NA 3QQNA 4G9DA 5B38G 3LKPA 5AFAA 1CDBA 1N0LB 2ZKXA 2MOGA 4LCCA 5HDLA 1KGXA 4KKCD 2AKRB 2VC2L 3HR5B 3OJ2C 4R2GC 3ZQWA 4DO5A 3IU4H 3WKMH 2HKHH 4JFZL 1YECL 2VWEC 4M5ZL 3T9WA 1FE8H 5F1NA 1UWGH 5EF1A 4POZD 4LU5L 5CJXC 3ARUA 2LVEA 5IHZA 5C08D 4HLEA 3BPOB 4JANB 4MCZA 3VFRB 2RFXB 1FDLL 2O5NA 4QTIL 1X5MA 4DN3H 1OIOA 3UPAA 1BSIA 1KWGA 2OBGA 1CCZA 1R1CA 1NIAA 3E6HA 4DW2H 4HUWA 4C58B 4MHHI 3J8F7 3ZL4H 4PP1D 3EOAB 1YZZA 4DUVA 4NCDA 1JF1B 5B1KA 3WKQA 4I48A 2OV0A 1TZOA 2CXKA 5DZAA 5MERB 3ML8A 4G6KL 4U3SA 1WYJA 3KW8A 3RJDA 2X1XR 1WFJA 2NZ9D 3D39E 3IFOA 3L5HA 25C8L 3QQ3B 3P30L 1CGWA 1QRKA 4ZQKB 1QATA 3QR1A 4PJFA 1W72A 2D7TH 3SDAC 5EORH 2YSSA 3WEMA 1QBMH 1KV7A 1GYVA 4JFEB 4JFQA 4WHYH 1XMWA 2ID5A 2J5WA 1KENH 3HIZA 4RAVA 4P0DA 3FAXA 3WFDL 1YEHH 4HUMB 2ZKHL 3QHFH 4WK0B 2D4FA 2VABB 2LW3A 5EBLB 4XE5B 1O6SB 4CU6A 1LE9B 2EDYA 4N2EA 4ZO7A 2ZWZA 3Q01A 1J87A 3D51A 5HHMB 1IEBA 2NTFB 2XPYA 1G1OA 1CG9B 4TNGA 3VQ1C 3E2HC 3RWHB 2BNUA 2E7LA 3H0TB 3VFPB 1DJZA 4AE0A 3BO8A 2H47C 1WAAA 5I75C 4D9LH 3HRPA 1V5JA 4HZLA 3MODH 3QWNA 3VGHA 2DJMA 3LQZA 5B7FA 5B8CA 1AO7E 1YNLL 4TV3A 3FRUB 5LQBH 2GKIA 3MRHB 2XWZA 3LSOA 2OR7A 4NO5B 3C2AL 3BKJH 2QPUA 3WEAA 1UH4A 1BEXA 3TWCH 3I2CH 4JDEB 2VLME 4HWEH 3CDGA 4X4KA 4FFTA 3QW9A 1CFNB 3TF4A 4MD0B 4WO4C 1H3TA 3NJGA 1I7ZB 3HE6A 2ZPKH 2NUTA 1YEIH 1EH9A 1Z6JT 2DF3A 2P24B 1G1YA 5A6IA 4MSWA 3VI3E 1E2VA 2GITA 2EVJA 4XMPL 5DHYA 4KMQA 3NESA 1AGEB 4PREB 4F7PA 4RBPK 3TBTA 3OSKA 2CBOA 2CCVA 4PIBA 2APWA 3KMDA 1EBPA 1NDMA 5J7CC 2IOMA 1VZIA 3PFQA 3RL1A 4Q6YA 3BLBA 2R1YB 3HPJA 4CC4A 2MCPL 3OKOB 4ISVA 3GZKA 2Z7WA 1DCEA 3AUWB 5A3IC 5EG6C 3TJPA 1SM3H 4FDWA 5JIKA 3KPQA 4EDWH 4B0MB 5ALBL 5KSBF 1JE6A 4P2QA 5EF0A 4P2AA 4O02A 2EIZB 1LNUB 3SDDD 1OSYA 3ZGHA 2DIAA 4L1DA 1OLZA 1RVFL 5EBWB 2OL3L 5E5RB 3BDYL 3BZEA 4ETQA 5MHSE 3F64A 2NOYA 1EXHA 1UCBH 2A99A 3BH8A 4GAGH 4WHCA 1TJMA 1CICC 1YPZF 2IAMB 3IBEA 4LSVL 2GK0A 1FRGL 3SN6N 2YBGA 3K2IA 2CIIB 3F83A 1JGLL 4PJEE 2VQTA 3NIFB 3OKNB 5CR8A 5DQJA 2VDRL 3C60D 4E9YA 2G2PA 3L7EA 4Y4KB 3UIYA 4OIBA 2XUWA 3RIAK 4ONHB 1T2XA 4XPFL 5T1KD 2XSKA 1JPSH 1XCTB 1A9VA 3U1SH 5EEZA 1S9XB 2B8OT 3P0YL 1L5GB 4ZUSB 4GW1B 5ISZE 1U8JB 5E4IA 4YJZL 3CU1A 1BQ5A 2X0VA 2PABA 1YPZE 2OYLA 4ZPTB 4NQUA 5C07A 4JO4L 4DPCX 3RDTA 5DD1L 3FQNB 3VXME 1A6UL 1QUNA 2P4AB 3BMWA 2AJXH 1CO1A 2NXYB 4GRLB 3VWKA 1E5UI 2VXTH 1MCNA 4PW4A 4UM8A 5D5MA 1KN4L 5CEYA 5I1JL 4LARL 4U1NB 3NSFA 4XGZA 5TQ2H 1A6ZA 2JCCA 3BPCB 4G71B 4A6YH 4CN6A 3VYOA 1TZ8A 2FVNA 1GOHA 2C9UA 4PS7A 1PDKB 2QSTA 5E8NB 1L0XA 1RD6A 4PJHE 2DLHA 4AGPA 5ABAA 4X9YA 1CD1A 2B0SH 1GGYA 1XGTB 5ICXA 4N8VG 3VRIA 4YC2C 3TYFA 1BZ7A 3EFOB 4WWKA 5IMKA 3UYRL 3WFBH 4I2XE 2NY7L 1NGPL 5GRWA 3OC5A 3EH1A 5I6XC 3ABLB 3U2JA 5AZEL 1ZPLA 5C0JA 2LHAA 3EYSL 4DOHE 3MGOB 5E4EC 3CFBA 1OCOB 4AGNA 3BT2L 4U6XB 1QLFB 3ZLQC 1QASA 2LFGA 1IV8A 1IAIM 1Q8MA 3ES6A 3L3GA 4K2UL 3EGXB 3L8QA 3MV9A 1E40A 2EDOA 4NYLA 5KOMC 3IKCA 5JYMA 2IOIA 4NO3B 2AF2A 4WTQA 3N0PB 4KPHL 3LXBA 5D7JC 5C0EA 2VDKL 1I1FB 4GSRA 2DQGL 4XMZA 1FGVH 1G9NC 1BLIA 3DX8A 3LXCA 1HE8A 4HKBA 4M5SA 3ATFA 4YBQC 1NLDL 1PIFA 4J3UA 3GSVA 2WNKA 3UBXA 2W59A 2ZJSH 5FM4A 4R84A 1I4FB 1EJOH 2W65A 5E1AB 1Q90A 4FNRA 4WHTB 5JW4M 3BQVA 1UM5L 5JPMB 3MLYL 4OZFG 1BVLA 1G7HA 3JTBA 4MA3A 4M8VA 4OD2A 2AJYH 4PCSA 1N59A 1AXSA 1IC7L 3AUVA 3D85A 4QWWC 1ZDSA 5B1AB 4OQTL 5BS0E 4KKAD 3EYVB 2VQ1B 5JOFB 4W9CC 4NRYB 3LRLA 4JFXB 1GZQB 2EE2A 5GZOA 2P5WB 4L9LC 5GGVL 4FTDA 4PSPA 1JWMB 1UACH 1MJ7H 1WAPA 1NDTA 4L3CA 3FSOA 2AQPA 4PD4K 1S8DB 1I3RA 4JCWA 3F3HA 4LBEA 2PWDA 3AU0A 2Q87A 1Q0EA 1UM4L 1ZVSA 2B59B 3FTGB 4OD1H 3BUTA 3LD8B 4HAFA 2OZ4H 3N91A 1AKJB 3DO7B 2VXSH 3LQAL 1FVCA 5I0YA 1ZE3C 5BZDA 3DURA 3FQXA 5FAAA 3VQMA 1PKOA 2V2WB 2OK0H 3VMOA 2XN9B 3AC0A 5GGRY 4FXGC 1YY8B 2L0DA 3HE6D 1OAYH 3CHOA 1FYTA 1HXMB 2CJ3A 3VXUE 4BFRA 2VZTA 3ECQA 5C7XL 2LOEA 3MLUH 8FABA 5AVQB 2XTSA 2D3VA 2UVEA 4Q14A 1JK8B 4C57C 3QUYC 5FHAH 5BRZE 2OSLA 3BPOC 1GR7A 4GLRH 1SDYA 4UQCA 2OTUA 3D05A 3JV6B 3NIDF 1N12A 4U1GB 3UYPA 3GMQA 3KWWA 6TAAA 3L2NA 1LXMA 3CLWA 1A4KB 5B3SB 4WNJA 2QSCL 2ZXBA 4P46B 4BK5C 2DWDB 5C0AA 3BWAB 2BSRB 4KI5E 4X6CE 5FYJU 2BNRA 4P2QD 5D7IE 3S3BB 1KGWA 2HLFD 2VSCA 4LLWB 2R0WH 4NBZB 3P3TA 1C5CL 2AEWA 3LH8A 5E7FA 4IBUA 4UIKH 1FC2D 3VSTA 5C08B 4CL7A 4OZGA 5D70L 5DMIH 3LHPL 1Z5LA 1KBPA 4Y2DC 5F72S 4F1ZA 3NCJL 1AD9B 1B4RA 1XZWA 1LEIA 3IGUA 3NIDE 3WNOA 2WANA 4HGWA 3S3SA 5LDSA 3AMKA 1TMQA 4PGCA 1T66C 4C4BA 1BFSA 3D9AL 4IMKA 1DLHB 3O4LB 1T22B 2HFFA 1TNMA 4P2RE 1R5VB 2C9QA 2QQKL 5CMAA 2NY1C 4GAAA 5IQ9A 1MRFL 5DGRA 1L9RA 5EO1B 3BIKA 2I7SA 4Y7MA 1SVBA 4XPBL 4HUUB 4LP8A 4H1LH 2K6ZA 3LH9A 5D72L 1WWAX 1FLRL 1HHKA 4OZHE 5K93A 4AZ8A 3VFGH 2KPNA 3UO1H 3KPRA 4KVCH 4BUQA 1E27A 2VDOL 5C07D 1I82A 3RDTD 4NQVA 5DS8A 3VWKD 3HS0A 4GMSL 1EEYB 3MA9L 4C55A 4JLRA 4OFKA 3LNIA 5KTEL 2NW2A 4HSAC 5IB1A 2E7CA 2R0ZL 4JKPL 4TVUA 1YEGH 1FZJA 2DD8H 3FU6A 4A6YA 4F33A 4UINH 5BQDA 2CO6B 3EYOB 3MR9A 3MREB 4G42A 3WJMB 3P9MB 1Q9WB 5D1XE 2BFVH 4WWKD 5K9OA 2VAAA 3FO2B 4KH2A 5EDSA 5IB3A 1BBDH 1JF6A 3CC1A 4X99A 3DTXA 3UBFA 5L9DH 5C8JB 3GSQB 5JNYA 1UH3A 3H2PA 3PAVA 4WW1B 5C3IA 4K0OA 2ICEA 4JN2A 4JKNA 4L1TA 1F90L 2WWOA 4FNPA 4XI5D 3RG1C 3GRWL 4DF9A 2ZYSA 1N5YH 4O5LL 1Z5HA 3MV9D 1ITBB 4OY9A 2EKJA 3TOPA 4UOW1 1GC1H 4R7LA 1MCSA 3SJVE 4F80A 1E9PB 1KIQB 2HG5A 3TBSA 3X2QB 1GGUA 1TXKA 2JWYA 3ARVA 4W9IC 1UZGA 4JEGB 4HPOL 2WXRA 4L4VE 5HXMA 2IQ9H 3ERXA 3IJHA 3SPVA 2UXVA 4YSCA 3OMIB 3PWVA 5JPNA 2A9ML 2K3HA 2Z4QB 3SKNA 1GSKA 4TNVK 1SXAA 4QY8B 3A4AA 3SE3C 3X1BA 3CTTA 3MRIA 3S9DB 4HJGA 5HYQA 5DJDB 1INQA 3DROB 3IU3B 2IAMC 1R0AH 2YGVA 3GBEA 4WDIB 1MUJB 1Y0LA 4XNZB 2WLKA 1ZHLA 1T7VA 3CQQA 3P4MB 4PVNA 4Y5YC 5HYJE 5LWYL 1R24A 5I1AA 4OCWL 4R5VA 3V4PB 4X4XB 5EOTB 4I9XA 2A74A 4Y4KC 1ETZB 2C5DC 3D85D 5F9WC 1QEXA 3IGKA 5EOCJ 1TSHA 2ICWJ 1L0PA 1O0VA 2BIIA 2JF1A 3MNDA 5IVXB 2BOBA 1BZDA 1QI3A 4I13B 3V7AE 4QRAA 1C08A 1DQVA 4M7LL 3RKDC 1NDGA 5GZOD 4HH9B 1WC7A 1YA5A 3MX0A 2JK5B 4A68A 2CDFB 2C4FU 1V10A 4FJ6A 4YDKL 1S9VA 2F19H 3C08H 3GDCA 3MBXH 1F18A 3C60B 3E6FA 3RUGF 3MV01 3MRLB 5IR1A 1KIUA 4GRLC 1PJ9A 4KJYA 3VD2A 5KZCD 2DJ4A 5T1KB 4ZUVB 1MRDL 3VYPA 4WUKH 2P28B 3MTXA 4U3XA 5C0IA 5D7SH 4V1DE 1LK2B 3MI6A 2FR4A 2H0PA 4F8OA 4N0UB 2FBJL 3KL3A 3VGGA 1FYTD 3MOQA 1TF4A 2W07A 2CIKB 3JBG7 4KJPC 1OAXL 1OCWH 5LGJB 2HT2D 4JFWA 2FB4H 3QNXA 3KWTA 1FO0L 3DVIA 2AEQH 1UOKA 2AMUA 2ZXCA 1CXKA 4PS4H 2CUAA 1AQKH 4JY6A 5DJ8A 4G9DB 1YEJH 5CUSH 4YH6A 1PY9A 5IBLD 2D0HA 4LE8A 5C0AD 3T2NL 2NXZD 4KTDH 4M93B 4OLWH 1ZOXA 4LCCB 2BNRD 3P02A 4ZMZA 1O7VA 2I9TA 4KHXL 3BUYA 5DLMH 1UJTA 3SEPA 1KCVL 4HJUA 4P9MH 5LXGL 2MOVA 5F1NB 2LU5A 1CJYA 3B3IA 5EZIL 5IHZB 2J71A 5K9JH 3NCFB 4AYID 1BPLB 4MCZB 1C5DB 4AUYA 2QLVB 2X3BA 3RP1A 5A1AA 5KUKA 2EE9A 4FCAA 2JE8A 4GI6A 4LVOB 5TF1L 1U30A 3EYQC 3VRLF 4JFYA 3CUPB 4NAQA 4P9HL 1HYSD 2PCYA 5GGTL 4FLRA 4DP9X 3V9EA 4GBXD 3VXRB 1T0NA 5DD5L 1JGVH 3U4BL 2MNWA 3DTUB 2Y2WA 3F58H 3VG0H 5GJTH 3Q06A 1J11A 1MFUA 2YBRA 4U3SB 4XMUA 4H13C 4QO1A 3HFFA 4PLJD 2AXFB 4QOKE 5C7ZA 1T5KA 4GW5A 3EFFB 4H1LA 2QQNH 3IFOB 3T2PA 5J0BA 1HS6A 4KO9A 3WTSA 1EZVY 4OD3H 2X7LA 1W72B 1EO8L 1MFBH 4NRXA 1AACA 4F8PA 2EECA 1BXXA 3KPRD 3QNYB 4KMTH 2O5XL 1RK1A 1WF5A 1D5XA 3D08A 1CDJA 2VN5A 4B9JA 4MMXA 1S7QA 4OAWB 4Q89A 1KDJA 4N1EA 3D2UA 3OAUH 4AGMA 1T83A 2YRZA 3HBQA 4CKQA 5ILTH 3C6LC 4YPGA 3B5GA 2FEDC 1MFAH 4FQHB 3VX1A 1RUPH 1G0XA 3I6LD 5CZKA 4IRJC 1L3NA 2GSGB 3IDIB 5ECJE 5E8EB 4YGVA 5I8EB 3W3BA 2XOTA 1SRDA 1BW8A 4U7MA 1HAWA 5F1OB 5JZ7D 2MQ0A 1TETL 1H5BA 3HEIB 4OLYL 1HOEA 1QNZH 2SODB 4ZW7A 5EF3A 1KACB 1Z9LA 2PO6B 4PTTA 5E99L 2ALAA 2BNUB 1JYXA 3BO8B 1AMYA 1E4XI 5DJ2A 2IANB 5KBPA 4V33A 1KLUA 3ASNB 1CURA 3FONA 5B8CB 2VC2H 1PEZA 3L1FA 2J1YA 4H8WC 4IJTA 5I76B 4JFZH 1YECH 3LSOB 2B15A 4M5ZH 5D6CA 3PAZA 4LU5H 2EDXA 4XCEA 1NICA 3EUDA 4V11A 3CDGB 2OMVA 4MX7A 4N0FA 2AK4A 4U1GC 4YEEA 5FW7A 3MXVL 1MHHA 4QTIH 5H4ZA 2MKLC 4EI5C 2RACA 4ANKA 4Z7NB 2X1OA 1E4HA 4L37A 3S35H 3ARZA 2FUQA 3T6XA 2NUTB 3HE6B 3TEUA 5GIRA 1YEWA 2H8PA 4MSWB 4P2YA 2GITB 4AVHA 5DHYB 4L1SA 1FGNL 4POZC 4UQ9A 3L4TA 3FYEB 4AQ8C 4KKPA 1Q9KA 2FYYA 4G6KH 4F7PB 3NVQA 1BMGA 2DH2A 4W9HC 5HHOE 2NQDA 2EACA 4PRIE 1P6FA 4U1MA 1NDMB 2HX7A 4NCC2 1XMEB 2F1EA 4UM9B 3VI4F 2DRUA 3TLRA 3HPJB 3CFTA 2YGQA 25C8H 3P30H 4ISVB 3SODB 1ZLDA 1TTCA 2L04A 1UKTA 4NM8L 4H5SA 7PCYA 4PQXA 4PP1C 4UT6L 5EB9A 3OXRA 1MCBA 2IC2A 4GYBA 4NI3A 5TQ0L 4P2QB 4WHDA 5FGBC 3SKMA 1U3YA 5ID0A 2GSMB 5F7WC 2W9LA 3EO0B 2IWEA 4LOVA 5IESL 1IAMA 4NQCB 2BW4A 2I9LB 2VLKA 2ZKHH 3BZEB 1JI2A 3BH8B 3B3BA 4NFBA 1NTDA 2W0LA 4LIQH 4W4NA 4YVNA 3OJDA 4A66A 3L7EB 3IFNL 5BUPA 2K6WA 3IN2A 2A5UA 5JHMA 5DA4A 2WOBA 1YNLH 3GYRA 2AQ2A 1A66A 2XC8A 3K71B 3GS7A 4Q9RL 1BP3B 1ED3A 5FYJL 2D3JA 4HS8L 1OE2A 3C2AH 5SWSE 2R2BA 1U3HA 5FFGA 3K6FA 4K07A 5C07B 1GOFA 3CPLA 1NGXA 1QUNB 2JLPA 4X7EC 3M1BA 2GJPA 2HKAA 5DUJA 4JGUA 3VWKB 3IMSA 1F3RB 4N9GA 1FVEA 3WNPA 5CEYB 4D9QE 3Q9QA 4HJSA 4N2GA 3IMBA 3ZY7A 4XGZB 1A6ZB 4XMPH 2JCCB 4W9ZA 4OFQA 2J6WA 1KT2A 2V7NB 5F70A 2WLNA 5F89A 3QWRA 2B2XL 1RQ5A 2HRGA 4I88A 5ICXB 4RVBA 2MCPH 5DC0A 3VRIB 3WLBB 1IL1A 1BZ7B 1PTZA 3WKPA 4WWKB 5IMKB 4E9RA 1ESOA 1IC4H 4LGRB 1G5AA 5F7EL 5ALBH 5BV7B 5C0JB 3O3EA 2H32H 1IUZA 1KB5L 3B9EA 5IMMB 2ZUQB 2WPGA 2XIBA 1A7NL 1RVFH 3CFBB 5IEKA 4MQ7B 2UZIL 1H15A 1LEKA 1KBKA 3BDYH 4YHNA 3BD4A 4CSSA 2EUVA 3L3GB 3ZO9A 4LF3B 2DMGA 3MV9B 4NYLB 4QCIB 3DGDA 3IKCB 4O58L 1X9LA 1UFUA 1N8ZA 2VDQL 4HP5A 4LSVH 1AZBA 1FRGH 2EVHA 2PLTA 1HN1A 3AQDA 4DKEL 1JGLH 1M6UA 1X9RA 4I18B 5C0EB 1OZTG 2VDRH 1JCKA 3WTWA 1BLNB 3DX8B 4XR8C 3SDDC 3NZ8A 4HKBB 2VH5H 5AW5B 4ALAC 4XPFH 5JLZA 3KPMB 3S5YA 1UZ8B 2DEYX 3UBXB 1HFUA 2NSXA 3P0YH 1JOIA 5T1MA 2W65B 3ZMRA 3W2DL 3AREB 1BVLB 1G7HB 4QRBA 2KL6A 5HY9A 1F3JA 4CVWA 4OD2B 2PYEA 3U0WL 1YAIA 3WKYA 4FOMA 3PWNA 3C60C 3CH1B 3ULVE 3ILDA 2G3ZA 3J2PA 4JO4H 5D2LA 4RH4A 8CGTA 1A6UH 3D85B 4KTGA 3P69A 3ISYA 4ODTL 1ACYL 5SX4I 5AW4B 2V37A 3ATAA 4APXA 5I1JH 4LARH 5MEPA 2PTVA 4WEBL 2VN6A 3W0WA 4HPYL 2A73A 3F7VA 3QDJE 1JMXA 1MZYA 2HX8A 2ZSWB 5EIIG 3DOIA 4L3CB 1D6VH 5CFAA 3ME0A 1I3RB 4RESB 2GJZB 1SQ2N 3SQRA 4XODA 2EDMA 4HJJL 3L4ZA 2Y5EA 4DK3A 4DVBA 4G43A 4PRAB 5KZCB 3UYRH 1OM3L 2AK4D 1FVCB 3QUZB 5BZDB 2NY7H 3DURB 1NGPH 1ZTXE 2MTAA 3FQXB 4QD2E 4NQDA 1HE7A 4Y1AA 4RBPH 5DFWH 4IU3A 4OF8A 4X0NA 4X80L 5DUPL 5AZEH 1CN4A 4CAGA 5IJBC 3IDMA 4M93C 1MHCA 3DV4A 4LCCC 3ESOA 4AYBA 4D7BA 3BT2H 5J89A 3MDJA 3QZPA 2A6DB 8FABB 5ANHA 4I1NB 2WIMA 4JCLA 4K2UH 5FLVA 4HIPA 1V05A 2CHDA 5DFVD 4JO8A 5T3ZH 2VR6A 2WN3A 1MSPA 1CVRA 2VLRA 4KPHH 1MQKL 5JUEH 2BSSA 4PYHA 3UYPB 3GMQB 3KWWB 4IIZA 5T33L 3P0VL 1KXVA 2DQGH 3TASA 2QHRL 1V7NL 5C0AB 2NXZB 1NLDH 3QXUA 5DO8A 4NIYE 1MF2L 2BNRB 3L48A 3CXDL 3RNQB 3GSXA 3CSBA 1KSRA 3E80A 3IJSA 5ENWB 5FYKE 1ZMYA 4Y4FA 3VMNA 2VLKD 4PJDF 1UM5H 3G5VA 2DBLL 3CZNA 3MLYH 1D6EA 2WLLA 4TQ8A 1Z5LB 3NJJA 3PABA 5MEQA 1LEIB 1F4XH 2BSDA 1IC7H 4L3ED 3CN4A 1WA0X 3UADA 3MA7B 2DQCL 4HGWB 4MJ2A 1VA9A 4PGCB 3V52L 4GBXB 1EXGA 1MCRA 2HFFB 1R3HA 4I5BA 4J4PA 2X6VA 3MUUA 2X1WL 3FHAA 5GGVH 5CMAB 3GBML 1AIZA 3NK4A 4U0RC 3BIKB 1H6TA 1A47A 2YXVA 3RURA 4PJDE 2LAAA 2BM3A 5D1QA 1UM4H 1CI3M 4LL4A 3GZOA 3VXOA 3KJ4B 3FSWA 1U3HD 4AZ8B 1QBLH 2YUZA 3KPRB 1TZGL 2V8LA 4Z1PA 1I31A 4KKAC 3HC2A 3TXAA 4CW1A 2E7LC 5DHDA 3F7QA 2AJZB 4XNUL 4OB5H 3WHE0 2P52A 5DS8B 5IFAL 4GUCA 1BQHA 1PBYA 1UT1A 3FF8A 4X0KA 5E6RB 3VSUA 3ZE2E 5B8CC 5CEZE 3KM1A 5C7XH 2X9ZA 3D4GA 1PZBA 4TVPH 5IB1B 3DSFL 3MN8A 1X5XA 4PSRA 3Q2VA 4A6YB 4F33B 2DLGA 3FB7B 3VD0A 1J86A 2VWEE 2V9RA 5FDWA 1BV8A 2D9CA 2VN4A 3QWRD 3NUKA 4JPVH 4G42B 2CKBL 2ZXDA 4M6NL 4XCCH 3WNKA 4IMLA 5FW6A 3OAYK 3HC0B 4PPTA 3BUDA 5K9OB 2QSCH 4WU5B 2VAAB 3HE6C 1FVDA 4JJ5A 5TGBA 5IB3B 3DTXB 4L3AA 5D6DA 4JVPA 5DI8B 1P4IL 4DP8X 3X17A 3NCWA 2H32A 2MHAA 1RIHL 2IPKA 1GGBL 4JN2B 3UCQA 3VA6A 1C5CH 2VJ8A 2OL3A 5D1ZI 2QELA 2XWBB 2CMRL 2WK2A 2CJTA 3ARDD 4KAQH 4PJIE 1I7RA 5D70H 3WDJA 5JQ6L 3EIFA 4CC4C 5I0ZA 1VJSA 1SXZA 3NCJH 3QUXA 4G8GE 5F3HA 2BCKB 4B95C 3JSSA 3QCUL 4XNQA 3UAEA 4JFHD 2VMJA 3HB3D 3R7RA 1NCBH 2BRRL 3VVWA 2HLFC 2HPOA 3T0BA 3C6SA 3KYKL 4ERSH 1UEMA 3D9AH 5JPNB 3L95B 4QTHA 3KNBA 3RU8L 4F8TA 2QQKH 3CN2A 3LZPA 1MRFH 4PJ8D 4EUPA 2E86A 4GQQA 3QNZB 4F3FB 2G2NA 1GVIA 4XPBH 2OMNA 3TONA 5ETUA 5HYQB 2BLFA 1INQB 4LQFL 2HVJB 5CJOH 5D72H 4WI6A 3ULSA 1Y0LB 1ZHLB 4RRPM 4GKZA 4U6YB 1A2YA 2YS4A 1R24B 1E8ZA 1P84J 5I1AB 4ODUA 2VDOH 2FH8A 3BVWA 4IKIA 4DSYA 4RGNE 2H45A 4UQ3A 4FQ2H 2A74B 5I8OL 5HP5A 4F5CE 1O9VA 3QUML 4GMSH 2V33A 3NCYP 2L8AA 3KYNB 4R8WL 4TQIA 3TBCA 5KTEH 3L08A 5E6YA 4Z7VF 2XIDA 2EP6A 4FX5A 1MI5D 4N2DA 4W9DC 1NDGB 2R0ZH 3D18B 1U36A 2XZAL 4JKPH 5EWIL 5FF6A 3W0WD 2H2PC 4Z7UF 4XMLL 1KXQA 2WOYA 2XN0A 4M8QB 2E7HA 5AB0A 1R47A 4N2HA 3VD9A 1S9VB 2EDKA 2VLJE 1E3FA 4PCYA 3FQTA 1KB9K 3AT8A 3MRBA 3RDTC 1XSOA 3E6FB 3OHXA 1KIUB 1ILSA 2DQIL 3IF1A 3VWKC 4ELMF 1BEYL 2Z8VC 3LNFA 1RUML 3PUUA 1ORQA 2IGTA 4Y1AD 2ZYIA 3ARYA 1F2XK 4NQDD 2MRYA 5M95B 1ZLSL 5F7BA 2M2DA 5C0IB 1R75A 1JXDA 1NBZA 5E6UB 2FR4B 1UD3A 1OF2B 4LOUD 4BXVA 2IV8A 4QRSA 4FNLL 2W07B 4Z7VE 1MY7A 2QZQA 3VYNA 4F7TA 2CLZB 3GRWH 3QNXB 4O5LH 4Z7UE 1IAII 1UTDA 2NX5E 4LPCA 2VLRD 4QYOB 4WWKC 3MYJA 5HYSG 4GNKB 3O3AB 4OUOA 1E9QA 4ELME 2IOOA 4HPOH 4JY6B 5DJ8B 3HE7A 3ZMNA 3ZKXB 3PWPA 2ZUQC 3EG9A 1XHHA 1JDCA 3X11A 1X5KA 4EI0A 2A9MH 4XI5C 1WWCA 1H6UA 3IPBA 5I1IL 3IDJA 2I9TB 1JIBA 3OKDA 2R8SL 3FSZA 2GI7A 4JG0L 1CLOH 1F1DA 3VB9A 4MQTB 4N25A 5FDYA 4WEUD 2PUQT 2CO2A 4Y4FD 2OMXA 5FYLE 2YD5A 5EFIB 1EJ6A 3DRTA 5LWYH 2XLLA 3W38A 4WFEE 4C4KO 1J0IA 4PW3A 3WELA 4OCWH 4Z5RB 5AQ0A 1BQLL 4YHMH 4KXBA 3RWCA 2K45A 4DJMA 4GT0A 4JFYB 4YDIH 2F74B 2BP0A 2YZ1A 2XPGA 3Q48A 4N24A 3QQ4A 5I8CB 2PWFA 3NIGB 4W9GC 4OQTA 1AFVL 1U6AL 2QDWA 5I82A 1FL6B 1MRCL 5G55A 4YXLL 4J4PD 3ZSSA 4HJEA 1T0NB 2RBLA 3IAPA 1AGDA 5IB4A 5ANME 4M7LH 4MNGE 4KV5F 1I8UA 1KMGA 2YBRB 4X9HA 3QP3A 1J1OH 1XGPA 2VMCA 2XQYG 3PHOA 4TXVB 4H1LB 1IFHL 4YDKH 4YN3A 5D1QD 1YEKL 2Y69B 3L45A 3D69A 4GIAA 1QBAA 4NRXB 1RK1B 4Y1SA 1FNEB 3QPQD 2YEQA 4GSXA 1SNRA 5I18H 5DWUL 1S7QB 2ZUTA 4EXPX 1FL3A 2BMKA 2EDNA 1MRDH 5GZOC 2JCWA 5FO9B 2NLJB 2FX8L 3ZKQD 4IJ3C 4NKIL 4XP5L 3NK3A 5E9AA 1OAXH 4L5FL 4XVJL 3K3QA 3AWFA 5CCGE 1EAJA 4LNVA 1FO0H 5L2JA 1S9KC 2BS8A 4M56A 3NTCL 3VFUA 2NZIA 2P5EE 4JHWH 1MELA 4OJAA 4PB0L 5I17A 3KD4A 4PTTB 3CVHL 2C7UA 1FPTH 1KN2L 1E4JA 2W60B 5GRXG 1DJIA 1W0VB 2QVFB 1H3VA 1BCIA 2MIZA 2XFGB 4YR6A 3FONB 2HT2C 1QTPA 3UFIA 4J39A 2OI9B 4PJGF 5IVNA 2XVGA 1KCVH 5LXGH 3P77A 4F93B 4N3TA 4MZ3A 5D6CB 1HI6B 2UXTA 3FFCA 3ARRA 2Z0UA 4Q6KA 4X6BB 2Y25A 5EZIH 5AZUA 3TC9A 1DQDL 2F0CA 2J55A 3MRDB 3B56A 3NCMA 4MX7B 4N0FB 2AK4B 3KCPA 1MHHB 3WIIH 2JJUA 3JUYA 2ZWYA 4RIRB 5IBLC 1QRNE 2IGFL 4L37B 1EO5A 1PZ3A 2NXZC 5B4MD 1ETA1 4M7LT 2ZAIA 5GIRB 1ROWA 1M05B 5GGTH 1GZHA 1MCWW 1RZGA 3GJEA 2Q2EB 1L7TL 4M4PA 2IH9A 1ZJBA 5DD5H 2XTJD 1Q9KB 4K3EL 2HMID 1ET5A 1HSAA 4U1MB 4R0LA 1G7IA 1VPOL 3RIFF 1NMCC 2K1MA 1D7CA 4HYTB 1BMWA 3BIBX 4BFGA 1W15A 2VERN 3S97C 2BVQA 2D3NA 4HH8A 3OXRB 4XN8A 3C9NB 3KGRA 4IMKC 3N41B 1Y18A 3Q2CA 4KZ0A 3SKMB 1OGAD 4X4YB 1R5WA 1S78D 3AROA 3GWJA 4J3TA 5DVPA 3BVUA 4EIZC 4P57B 2DQUH 1GYUA 2VLKB 3GIZL 4BQ8A 4PLJC 3V0HA 2ADYA 1GCFA 1HNYA 2K4WA 4NZDA 4M1DL 4MJIA 4J27A 1KCSL 1CXFA 1XH1A 3C5XA 3I3BA 5H37G 1B4TA 1TETH 3KJ4C 4BDVA 1D2OA 5G5DB 4L3EB 1I1CA 1NWOA 2MPVA 3V0GA 2DWEA 4OLYH 5I5MA 1FH2A 3QZWA 2C9SA 3HA0A 1SBSL 3ARBA 4GP5B 3VG9C 5E99H 3T6ZA 4OKVA 3K72A 4JJOA 4S0SD 3U4EA 1HINL 4BKLA 1JGEA 5EA0H 3CWGA 3HS0C 3RL2A 1J05A 3C12A 2Z3FA 4MNQA 4OJEH 1NBVL 3MJ8A 5BCAA 5IVOA 3ETTA 5L7XL 4FE9A 1GA2A 5JZ7C 1ED3B 3LTVA 4ZFZA 3CHXA 2R2BB 3DVGA 5CIPH 3PWUA 3GRWA 3KCWA 4M8RA 3CX2A 2WGXA 2UWEA 2WP3O 3KH3A 3A5VA 2JJVA 5EIVA 3MXVH 3CPLB 5DRWA 2Y7SA 1NGXB 3VE0A 4MA1C 1WA2X 3VFWA 5T3ZD 4NS0A 5HHVL 4JDZA 3M1BB 4CADA 1KEMH 2H41A 3N04A 4L05A 3T4AA 1QX1A 4TVSa 3OG4B 4Y19A 4HIEB 2ICEC 3PWPD 5I19L 4UU9A 1FGNH 2F7PA 2B4CC 5CP3H 1KT2B 1RAMA 4G8IA 2ZQKA 5F89B 4IS6A 2B7DT 3PJLA 2DL9A 1U95A 3K2UL 1IL1B 1IMHC 1SZNA 2V2XB 5DDHA 4Q6IB 4PJCF 4KY1L 4NM8H 3FO0L 2ED9A 4UT6H 5TQ0H 1PAZA 4JAMA 5KVDE 2B14A 3BSGA 3O3EB 1AP2A 3QJUB 4PRPA 1DFBH 4UZUA 1BZOA 5JPNC 1B9ZA 2DYSB 4JFEE 1E28B 5IEKB 5IESH 1LEKB 4MMYB 1GY1A 4JRXA 1N68A 4YHNB 5HGAA 4XX1G 1SJVA 3VFMA 3ARDB 4DP6X 3F7RA 1IBGL 5DJ0B 3VCLA 4Z3JA 1N8ZB 3Q7JA 1SXCA 2NNRA 1U93A 2PXYA 4CNIA 2WUCL 2CR0A 2VR3A 3AY4A 1PG7L 5HHME 3EJUA 1XF3A 3SBPA 2A74C 4G7VL 1TQTA 1A1OA 3IFNH 4YL9A 3HG2A 1FV1A 1KPVA 2F58L 1RUKL 3RVTD 3WAJA 2KQMA 2B77A 2KLTA 4PJ8B 4F37K 1HNFA 4FHKA 1EAQA 1GYAA 4PCKA 3D09A 4Q9RH 5FYJH 4HFUL 4HS8H 1TQBC 4ZX6A 2J44A 4MKMA 4HOMA 1G7PA 2EC9U 5HY9B 1F3JB 4TVPD 3WFCL 1FO0A 3KPLA 2BH0A 5D2LB 5E03A 3UCRA 1T7XA 5KBKA 4N5ED 3BRGC 2O93L 5GS0L 3HC4L 4Z3HA 1PCXA 5TF0A 3FU0A 3GB7B 1GGIL 4PRHB 3RNKA 1DQKA 4APXB 4LCWA 1MVUA 1MI5B 3TPUB 3GKWL 2F54A 4NP4L 5KBMA 3RX9A 1BJ8A 2OA9A 3W0WB 3NBNA 2A73B 2XXMB 1A14L 2PETA 1NCAL 4O4YL 1LWRA 1E50A 3EBGA 4NKOA 4F91B 2B2XH 3INOA 2DM3A 2JV6A 4URKA 1Z3GL 3FFCD 2YEZA 4B60A 4DVBB 4LVHB 2VO5A 3NIFF 4NXKA 3RRQA 1OD9A 4M9PA 2G30A 4I0CC 4J12A 4Y1AB 5F7EH 4GQ9L 5INCA 2AHIA 1JGUL 4FRWA 4IU3B 1YNKL 4NSKA 2ZUYA 4MXQC 1V27A 3MLWL 4K73A 3IDMB 1KB5H 5I6PA 2EUXA 2K70A 4B9GA 1A7NH 2NNAA 2UZIH 4PWJA 4DO4A 2ARJQ 5GGTA 4WW2A 5LUMA 3MRNA 4ZMLA 1UWFA 2ED6A 2E75C 1XEDA 2PYFA 3RPKA 2GBUA 3TA3B 3V4VL 1GTNA 4QHPA 5DURD 4IOFD 2VDQH 2VZ3A 1AR1D 2VLRB 3NRFA 4GG8A 3RVWC 4WWID 4RCAA 4DKEH 1DL7H 3F6LA 2WLIA 2BSSB 4MWFA 5DWPA 4J7RA 4PJAA 4KX7A 3NIFE 2R2HA 2UY7A 3HG4A 3OV6A 4Z3GA 1WK0A 3RX8A 4P99A 4XWGH 9CGTA 2R69L 1BJ1J 2CCLA 2R1WA 5DJZA 3GO1H 3GSXB 3Q6GL 4PMFA 3AT0A 4BH8B 1EK3A 5KG9A 2CO7A 3ZDXB 3IJSB 2BIQA 4Y4FB 1ACXA 3L3OB 3S37X 1NBCA 3APMA 3G5VB 4GPVA 3W2DH 1D6EB 1UUNA 2WLLB 3A6OA 4MJID 1KYFA 1OSZA 4QTFA 3VM5A 3U0WH 4FF9A 4NNYA 3PABB 4KKQA 2F7QA 4GAJL 5B39G 4J3WA 5DA0B 4C59B 3N3EA 1WIOA 4YHPA 4ELKA 3DUUA 4UDUA 4FJZA 3ZKMD 3ARBD 3ILEA 1KPUB 4MMXC 1DVYA 4OI9A 4ODTH 1ACYH 5DFAA 2GJ6A 4I5BB 1R3HB 1T83C 5JW3L 4MNQD 5IQMA 1URIA 2Y4SA 4HF5L 1A8ZA 2CM6A 3FT4A 2Z35A 3F7LA 4HPYH 4K9JA 5FB8B 3U0PA 2C1OA 3GMPB 4EZMA 4M3HA 1IBZA 4GMTL 4NCC1 4OF7A 1H5BC 2X41A 5D1QB 3R0NA 2GTZB 1WZLA 4HJJH 3VXOB 1OPOA 3DRQA 5CIPA 3DI3B 1RIUH 3MV8A 1OM3H 5EEYA 4AJYV 3QHTC 1JTOA 4CW1B 2GABA 4TLSA 4PJXF 2X38A 5KAQF 1PFCA 4X80H 5DUPH 5TDOB 3QI9A 1ET8A 3TBBA 4TNFA 2ZONA 4X0KB 3CU7A 1QW9A 2OI9C 4Y19D 5KSBA 1EZUA 1U8LB 1KTDA 3BOVA 1PQZA 5EZOL 3SO5A 3QQDA 1PGRB 2OMZA 5AAPA 3WY1A 3LEVH 1T04A 1EX0A 3POHA 2A77L 2CDGA 1QSZA 5CP3A 1FAIL 3EJRA 5FDWB 2DICA 3LN9A 3MRMB 4L8BA 1HJBC 5CU5A 1MQKH 2X3AA 3DDFA 1GC1C 4GI9A 2N1TE 1DBBL 4IMLB 5D7HA 5T33H 1HHHB 3DHMA 1NM4A 3P0VH 3UO8B 4B96A 1CC3A 5IV2A 1OTTD 2QHRH 3OPZL 1OXYA 4NZFA 4JJ5B 1FVDB 3FCTA 3GXMA 5TGBB 2DMCA 2EXYD 4XPTL 2APXA 1MF2H 1WEJH 1WQVT 4UT6A 3EADA 3CXDH 4PRPD 1K8IA 3T77B 1A7QH 3V0EA 2H32B 4KY2A 4E9WA 4NO2A 3HNVH 4MD5A 5DFVC 1BIIA 5EU4A 2V5TA 2OW7A 4JRXD 2MSPA 3HZMB 4WI4A 3FPXA 2DBLH 3L2MA 4OM0H 4NUJB 2PNDA 5F3HB 2PXYD 2A6KA 3L16A 3FF7A 1SLXA 1X5HA 3IFPA 4A2DA 4XNQB 2L7EA 2A9BA 1B3IA 4C47A 2VDRB 3V52H 1ADQL 4LMQE 4ZW8A 4BBWA 4QTHB 3KNBB 3V0AC 3GBMH 4KRPD 4OF5A 5EDXA 2WBXA 3D8MA 3GF8A 4AV4A 2AEPL 1SEQL 3FCUB 1SEBB 5KYWA 5ETUB 5DJYA 2FIKA 2QEJA 2X4UB 4YSQA 2XZZA 3TZVA 2BNQA 3MU3A 1JVLA 3WTYA 4GKZB 1A2YB 1NH6A 1CR9L 4U33A 1TZGH 3I9GH 2GEQA 2OXGB 1F42A 4ODUB 3DVNA 3CZGA 5AEAA 4WFFD 1E7VA 4JE0A 4PHZA 5K9QG 1OGAB 4HCRL 2DPKA 4XNUH 3NAAL 5IFAH 2P49B 2IBGA 2J88L 1NOAA 2XN9E 1CFMA 1HH9A 4KDWA 4P2OD 5BRQA 1DFXA 1NC4A 3GXNA 5DZLA 5GJSH 3WEBA 5C6TL 4P2CG 4LCWD 3IJ8A 1OAZL 4XRCB 5FF6B 2R51A 3DSFH 2F54D 3TNMA 5CP7A 3VJ6B 4BQ9A 5IP4A 2BDNL 1U3HC 2ZKWA 3X13A 2C4FT 5DYOA 4BFKA 2WBWB 2CKBH 4M6NH 3FQTB 4HUCA 4LEOA 1F97A 3O3UN 3OHXB 3IF1B 4UUJA 1EGJL 3R7QA 2W8CA 3GSUA 2WQ8A 1P4IH 4UTAL 3PJNA 2JIXA 2VW4A 1F11A 3OSVA 4WUUA 5K9QI 1KB5A 1WZMA 1GGBH 4QRSB 1MAJA 1NOFA 2MFNA 3PXLA 4F7TB 2CMRH 5IMLA 5EEVA 1DBML 1XGQA 3FNKA 5C08E 4K7PX 3MJWA 3VXSA 5AYUL 5AOMA 5KVEE 2HPTA 3D0VB 1HHIA 2AC0A 3MYJB 3QCUH 3P2BA 5FM5M 1WP6A 2Z7UA 3HMXL 2D0GA 2BRRH 5CWSA 1JZ4A 3LB6D 3KYKH 3WFEL 4FERA 2VKXA 2WC7A 1X5AA 3SGEI 3OR7A 4DGIL 3PAYA 3X11B 3T3PF 4F8NA 3O4LE 1KIPB 2UZXB 1IIKA 1ZA3B 3RIFK 3IDJB 1JK9A 3O8XA 4BSVB 1ZIBA 3MZTA 3F8UB 2Q3XA 3AU1B 1E6OH 4LQFH 2C1PB 2YQGA 1MFEL 2OMXB 3FSVA 2OAAA 3MUY1 1ROCA 3FW6A 4WEMB 4ZD3L 1RJYB 3HB3C 3L3IA 3MRRA 5IWLA 1KLFB 3T0EB 2B9AA 3U2IA 4P8QA 3WN5A 2CPCA 2OPCA 1M7DA 4V2CB 3WN6A 3DC0A 2FHCA 2PPDA 5I8OH 3DVFA 2XPGB 3QUMH 4F7CB 3X12A 1NAML 4HFWA 1GXEA 3GXIA 4R8WH 2QR0A 1AQHA 2GJ6D 4MB4A 1TQWA 5D8JL 5IB4B 1AGDB 2R4SH 2RAMA 3MLXL 1EQWA 2XZAH 4GAYA 5EWIH 2KDYA 3QQ9D 2QKIA 4XMLH 5LB1A 3PP3K 2CH8A 1VESA 1XGPB 3QS2A 1HCZA 2N4IA 3FRPB 3PHOB 4YX2L 2IWFA 3BT0A 4W9FC 3D69B 5D96B 1NCWL 2DQIH 1JZ8A 1BEYH 1A22B 1QFWL 3MV8D 1RUMH 4WZ9A 1MAKA 5JA9A 3NZHL 5A2LH 1FL3B 1OGSA 2BMKB 1ZLSH 3OB8A 3QIBD 3QI9D 1KB3A 1JV2A 3K6DA 4NI6A 1BFOA 3BVXA 3K1KC 4FNLH 3DNKA 3OAYH 3GMRA 4X7DC 4UQAA 2DTSA 4CVUA 4HWBL 4KKBD 3FXIC 4ZOCA 5L2JB 4UILL 2UZPA 2JSFA 3VFUB 4KKNA 1F8TH 5I17B 4HWUA 4PY8J 3LQMA 3VAEA 4IOIA 2G3XA 3EOTL 1GHFL 2C7UB 4FFVD 1KIRA 2Y7OA 5DXWA 4LOUC 5ESVA 4OCNC 4LHJB 4F58L 5F9DC 4J5VA 5IVXF 4YR6B 1UVQA 4JHZA 2H6UA 1YEDA 2R8SH 5HHPA 4JG0H 4U1JA 2WWKT 1W6LA 3P77B 3QB7C 3TCLA 1XD1A 1KYDA 3FFCB 2F53A 4ZFOL 1YVLA 4LDOB 1SOKA 1QABA 2N7AA 3STZA 4EBQL 5L8LB 3G5WA 3KCPB 3OKKA 1KXVC 3PP4L 3BEVA 4HBQA 1I8MB 1Q0XL 3BH4A 3B2PA 1BQLH 2G75A 1UB5A 2QJDA 3ARFA 1UXLA 3HBGA 5IHUL 3L81A 4HULB 4JL2A 4IKNA 1U6AH 1RZGB 3GJEB 1CZ8L 1MRCH 4YXLH 5IVXE 1Q1PA 4WK2B 3A24A 3FQYA 4Y4FC 1AOZA 5DURB 1TG8A 4ORZC 4HG4J 4WKZA 2XN1A 4WSKA 1AR1B 1HSAB 1P6WA 4R0LB 1G7IB 2WMPB 1MREL 4GB9A 3U46A 3P9WB 5DJXB 5LXVA 1A6WH 3FS9A 1IFHH 4XO5A 5FYJD 1CDCA 3KVPA 4GH7B 1PMYA 1YEKH 2CRMA 2BNQD 2OQJA 4KJWC 1RK7A 4Z7WA 3TZVD 5I6NA 4S0HA 1E65A 4WV1A 4ZOEA 4QIRA 3ET9F 2BVQB 3D3VA 4MB3A 4HW6A 5EBMA 2X2UA 3VFVA 2VDOB 5DWUH 2X4SA 3Q8CA 3QJQB 4J4PC 3IRPX 5B21A 2F5BL 3VXPA 4D0CB 2CJUH 2DLTA 3BVTA 5EZLA 4YQXL 4NKIH 4XP5H 4RGMB 3EDKA 1NC4D 4N0UE 3QDHA 3OGOE 3Q6FA 3TJEL 2FO4A 4XVJH 5H94A 3LZOA 5D1QC 2A9CA 3O6LL 3EDFA 2G2RB 3MLSL 3NTCH 3HCVA 3QWOA 1U0QA 2DWEB 4PB0H 1BYOA 3CCHA 1RY7B 2WQXA 3EBIA 3ARBB 3QPQC 4DFHA 2R29H 2CKBA 3CVHH 3B2VH 3B34A 2YAOA 3K72B 1I1RA 4I3RL 1KN2H 4BKLB 1JGEB 4XXWA 3ELQA 4GAFB 4F57L 1PYWA 5HDBF 2OCJA 4CDHA 2XG4B 1JVOA 3MRJA 1PD0A 3QZNA 4PGZA 5J11C 2JIXD 1REIA 1HDMA 3IJYA 4UOW0 5JORA 2L7UA 3AT9A 4A7SA 4ZFZB 1A4AA 1UOVA 3FOMA 1P1ZB 2FZ3B 4PIRF 5IBUB 3NJKA 3FRPG 3LKQA 3GUTA 1OSPH 2P8PB 2HUHA 3GK8L 1DQDH 5GSVA 4A7GA 1KPRA 4BWUA 2UWEB 1IM3D 1E5YA 1QBBA 3VFWB 5DRWB 3VE0B 4PJFF 3VXSD 2BOLA 2WXMA 4I3SL 4CADB 4AMWA 2IGFH 2AMGA 1DDTA 2VUYA 3BWSA 4HXAL 1A65A 4X5LA 3QNFA 3T4AB 3OKMA 4OLZH 4HUVA 5D6DC 5F7YC 5J6HA 4Y19B 3IMTA 1FG9C 3IXTA 3E1F1 1N7ML 1TJGH 4UOQA 2CBTA 3D50A 4UU9B 3DJTA 4AWJC 4BZ2L 3DUHA 3VXRE 1RMFL 1NGWB 4G8IB 4K3EH 3AWGA 1LJMA 4IS6B 4M3KB 4DT2A 1WCBA 3IE9A 2F8XC 3QUXC 1VPOH 3KS0H 3WMSA 1U95B 5IVZA 5B4MC 3POCA 3AAZA 4WWNA 4KK5D 3VDBA 2FQFA 3B8SA 2OMWB 1AQDB 1H3GA 2LV4A 4JAMB 5DR5L 1SYSA 1TVBA 1USQA 4PRPB 1AP2B 1JTTA 1WAAF 2GFBA 5SWZB 3RUGA 2XTJC 3R8QA 3QUMA 2HMIC 3OLDA 1EDHA 4JRXB 4E41A 2EO7A 2BHZA 5HGAB 3VFMB 4M1DH 4JZJA 2VZVA 3SKOA 3IDYB 4JL1A 1T5XA 5KN5A 1U93B 1CFQA 2PXYB 2XBTA 1PLGL 3HMWL 3QFJA 4GW4A 5IROA 2NYYC 3WNNA 4PU2A 2YXMA 3QPKA 4LCVA 1SBSH 3T3MB 2NUPA 3OZKA 2EIBA 1CFBA 4Z7NF 1A1OB 1S78C 1HINH 1FV1B 1QPPA 4CBZA 3WDIA 1PY4A 4M1CD 1NBVH 4KRPB 1L4IA 2IANE 1FL5B 1HWWA 2BVEA 3FO1A 5L7XH 2KUTA 3NSJA 3UROR 5D7LB 3OPUA 3QIWA 5AW1B 4BWWA 3F2LA 1NCTA 3GT6A 5KS9A 5TFSL 2V5YA 5DHEA 1ZS2A 5EBGA 2GIMA 4MA8L 4L8CB 2LLLA 4M8UA 4R7DA 2YGPA 1FO0B 3SPCA 4GS7B 4MZIA 3NOIA 2GJJA 1HT6A 4AV5A 1DVZA 2E6QA 2HT3D 1R3JB 1XGYL 3GGWB 4Z7NE 5F9OL 3BP4A 3MUJA 2ZG1A 4P2OB 3QHZL 3JWNG 2NNCA 3JV4A 2C9PA 4LCWB 3SO3C 1MVUB 1TYJA 2Y07H 5I19H 3MMEA 4IEFA 2F54B 4OBSA 2E9GA 2YN5A 1XR8B 2OMTB 1P4LA 1AHMA 3HRZA 1DANU 2ENSA 2Q7NA 4NKOB 1LEGB 4NQEA 1GZPA 2AJ3A 2BP8A 4ODBD 3ORJA 4N87A 3MRKB 2F53D 3ZDZB 2YEZB 4NHCL 4XP9H 1F3DH 3K2UH 2Q10A 2PP7A 1QPKA 4UF7C 3P73B 1ZHNA 4KY1H 4B27A 3HE7C 4BRVA 4LCYA 2VKWA 3F7KA 4GINA 2ZE0A 3ARFD 4JDVA 4P2QE 5AD0B 3Q8AA 2NNAB 4QT5A 2J4WH 3MRNB 5IBUG 1XF5A 4NQCE 3B9AA 5B3NA 3DETD 2CA4A 2ADIA 3V5KA 3TTYA 1M42A 4POUB 4TQEL 4GG8B 2DL2A 2JLLA 2YMTA 4BZYA 2WUCH 3NN8B 1PG7H 4K3GA 4FMKA 4FYTA 5GSRB 1VFUA 4MWFB 4O9HL 1MCDA 4PJAB 3W81A 2R2HB 2UY7B 4LDLB 1YMMA 3V5DA 3ZOAA 4JJHA 3QYMA 2F58H 1RUKH 3D3VD 4RMRA 5D5MF 1PNDA 2N3JA 1ITCA 2R1WB 4ODXA 5DJZB 1MCOL 2JCCF 3GDBA 3O45A 1LL1A 2CO7B 4QDGA 1HZHL 1LWHA 4HFUH 4U2YA 3Q5YA 3IEAA 1F00I 1UWXK 5E1GA 2IH1B 2DWTA 2ZF9A 4I3GA 1OSZB 3OKEB 1BF8A 4NNYB 3US1A 4QRFA 4ABWA 4LPWA 5D96C 3KBPA 3K6SA 3RVXD 1JBJA 3FTWA 1AE6H 4YHPB 5C07E 3DUUB 5HVFB 3RVTC 2IFFL 3LQAC 4JO5A 5GS0H 3HC4H 3T6QC 1BREA 1EHAA 2R29A 1GGIH 3CVHA 3RGVB 1WSST 2GJ6B 3WUZA 4TLKA 4OQ1A 2XCMC 4IRSA 2PCFB 1DVSA 3M1OA 1XGUA 3GKWH 1UENA 4NP4H 3SDXF 3FT4B 2Z35B 5GRUL 4JS7A 3U0PB 3ZBMA 1A14H 2C1OB 2JCCE 1NCAH 2X2HA 4O4YH 2XX0A 4PJ5A 4GIPD 5F1IA 5C0ND 4HHGA 1DHKA 5EU5B 3VSQA 4EIBA 1Z3GH 1OALA 4N5EC 2ERJB 1GW6A 1HEZA 5CIPB 1OW0A 4AI7A 3RHWF 2EEAA 3L3KA 2F5AL 4XHQA 4CGUB 1IEAA 4GQ9H 3UXFA 2ZXEB 3ALWA 4OJCA 1JGUH 2JB5L 3VI4A 5E94B 1YNKH 2XPZA 2UX7A 3QI9B 3QIBB 3MLWH 4ZMQA 3KBHE 2YPVL 3GFUA 3VA2C 2Q86A 5KSBB 3O3BA 1KTDB 1YYCA 1PQZB 1IGTA 2JVUA 1TZAA 2OMZB 4JX0A 2UV3A 1T04B 4B53A 1GMEA 3T8VA 2JQAA 3V4VH 3MV9E 4JRLA 2QGCA 4PV9B 2VDNH 1OK8A 5FOBA 1JNLH 2CWRA 3ZX1A 4L8BB 5K1VA 3P3YA 3VFTA 3QJTB 1KJVA 4PFEA 1AHWA 1F58L 5IV2B 1A1MA 1IX2A 2BSCA 3FCTB 1GS8A 1UQSA 1GZHC 1Z2KA 4QAMB 4J3BA 2R69H 2YAMA 2CNZA 1GRWA 2Q7AA 1VFMA 4UQ2A 2H3NA 3Q6GH 3PG2A 4MD5B 3N6YA 1BIIB 1DSWA 1G43A 4IOFC 1AR1C 5EU4B 2JKXA 5TH2B 3PHQA 1FN4B 3ZQ9A 4E41D 4R0LC 3VFSA 4P5TA 3MQIA 1B88A 2E9BA 4H20L 4YSRA 2NY0D 2YUXA 1Z32X 4ZOAA 1JGDA 5HI4D 2A6KB 3QFJD 1K5NA 2CZNA 3DBXB 3IJEB 3IFPB 4GAJH 4TUJA 5IROD 2X40A 4NN7C 4GG6F 1BF2A 1YC8A 2CO4A 3QXAA 3TF7C 1A7RL 4ADJA 5IF0A 4ZOBA 4FMFA 5LAXB 2R56L 2W91A 1UKQA 2W1NA 5JW3H 3C09C 1Q9OA 4HF5H 1JDDA 4RGMC 2AI0L 4Q9QL 1MWAB 3LKOA 5DJYB 1TQSA 2FIKB 2FUTA 3QIWD 2O6CA 3TZVB 2BNQB 4M4RB 3VD4A 1YCSA 4N2KA 3CDZA 3ZKMC 3ARBC 4GQZA 1INDH 3T65B 4AUJA 1CTNA 4TSCL 3MYZA 3QAZB 3RTLA 4PVBA 1CQYA 1ZCRA 5A2JH 4HS6A 1SUJA 4UOJA 3S5ZA 4Q8BA 1UD5A 3U83A 3VTTA 4AV0A 5CP7B 5JXAL 4O2CA 2A77H 4OZGF 4TKWA 3T4YA 4NQED 4CRPA 5DYOB 1IBYA 1ZWIA 3FUIA 4BKSC 4BH7B 1DBBH 4LEOB 1NCUA 1WH0A 2YPLA 5L8JB 3C87A 2YD3A 4UUJB 3TTSA 2ZCKL 5I0WA 4G9FA 4OKDA 3OPZH 3T4AC 4BA0A 2VN3A 2MCG1 1K85A 3I6KA 3GSUB 1T5WA 3Q5TA 4IRZL 4XPTH 3UZVA 4EN3D 5C0AE 2GG1A 3C8DA 3NABL 1S7TB 2BNRE 1KB5B 2UZYA 3G6JF 4ODVH 3O11B 4IBWA 4D0BA 1ECYA 3KLLA 4KK6C 3ZRFC 1XGQB 1IM3B 4GRMA 4J3OG 3VXSB 3ECWA 2VDQB 2AK1L 4N0CD 5AYTA 3HN5A 1HHIB 5G4MA 1YRKA 3ROOB 1ONQA 2EXYC 3PNWA 4UT7L 1NPJA 1QYGH 4O51A 2X4QA 5HDRA 2L4OA 3ELAT 5DHVA 5CWSB 2W38A 4HEPG 1H6FA 4YO0A 1YMMD 1CXIA 2JH2A 2KHAA 3TBYA 3OR7B 5CCJA 3N50A 3MXWL 1JVKA 1S5HB 1ZXKA 2DB8A 1JK9B 3MRPA 4WI2A 2AEPH 5FA3A 1SEQH 1VZGA 3IDYC 1WBXB 2DAVA 3CBKB 5FA4A 2PXYC 2VDML 3HI6L 3K2KA 2GUOB 5DMYA 3AY4C 3DIVA 1PU0A 3DYPA 5ID0B 4B6ZA 4LSQL 3L3IB 1CR9H 2JKWA 1A25A 2OMYB 2OYMA 1E4XH 3L13A 1JNNH 3KPRE 3ILQD 3VU2A 1IKFL 1SGKA 3LNGA 4HCRH 2FJFB 1CU4L 1TR7A 1IT9L 4KRPC 1B2YA 3FUFA 3O3DA 2J88H 4JHUA 3X12B 4HFWB 3QT2A 1E9OA 4MYWB 2QR0B 3CFQA 1VENA 1IM9A 2X42A 4IRSD 5C6TH 1PVHA 4R90L 2BJML 1OAZH 3I6LE 3L4WA 4L1BA 1H19A 2DY2A 2BDNH 2QKIB 4GFTB 1U2YA 5K1JA 4PJ5D 3TIDB 3OB0K 4PWIA 5MI0C 2IQAB 4GS7C 5BOZG 1VB9A 5HJ3A 4QRTA 1EGJH 2J73A 4JVWA 1LK3L 1DQJA 1FC1A 2V9UA 5KYXA 5EC2A 3G5ZA 3LY6A 1EV2E 3DOHA 4P48A 4TUUA 5FOJA 1JV2B 1YY9D 1BFOB 2OXHA 4XX5A 4AQAA 3D4YA 1AD0A 3GMRB 3WI9A 4XZ4A 1A1NA 1EHLL 3DLQR 4WRLA 1EANA 1W9XA 2FJUB 4U49A 3V4VA 2XRAL 1AXIB 5AYUH 3N1FC 1FFQA 4IOIB 2AFNA 5DD3L 1BQKA 2HTLD 4LOEA 1QLEL 2DWXA 4HKJA 2GI0A 3HMXH 5TPWL 3EO9L 1BAGA 3NSYA 3PRZA 1KIRB 3WFEH 1RPKA 5ESVB 4C83A 4P9HC 4UQDA 4DGIH 1AKPA 5K5YA 1UVQB 4WW2C 2P48B 2FECL 2R69A 2PR4L 5HHPB 3DYOA 5CSZA 4U1JB 1L9QA 3ENEA 5CJBA 4X83A 2V3DA 2EIEA 1MFEH 2DQFA 3ZZLA 3VD7A 1DVFD 4NZRL 3H9YA 4HX1A 4P5TD 3SPHA 3RGBA 3STZB 4GKNB 2WN2A 3K91A 4ZD3H 1FAKT 2ZWSA 3KBEA 5E24E 5B7MA 4UV7H 1XCWA 3LB6C 3LZQA 2NCMA 4K7PY 2WYTA 3LKSB 1II4E 1T20A 1UB5B 2J5LC 3LN4A 4GEIA 4MCMA 4KWUA 2A6JA 4QR7A 2DQHL 4DKAA 2J8UA 5AZ2L 3U9PH 3BSZH 3VGAB 1R3LA 1NAMH 3V6ZB 5EIQA 1VFAB 3E8UL 5D8JH 5JHAA 3BUQA 2WNXA 1HXKA 3L1EA 4ONFL 2H4EA 3UJTL 3U46B 2BWDA 2FWLB 3GXTA 1EWHA 2G9KA 3ZE1F 3GSOA 4YX2H 1Y1DA 2OQJB 4Z7WB 4YL4A 1S7VB 1NCWH 4WV1B 1ZLVK 1RLWA 2YQ3A 3M1CA 1A3RL 1EMTL 1QFWH 3AG2B 4JG1L 4ORGA 4XVSL 3VFVB 3NZHH 4UAOB 2X4SB 2NY4D 4YZFF 2FDBP 1NEZB 2ZYHA 3VXPB 2XKNA 3QQ9C 2PF6A 3QRFM 1FG2A 1E43A 1G7MB 5GGUB 2YOAA 3Q6FB 3UACA 4HWBH 2ZP9A 5E6SB 4UILH 2Z7ZA 3CPUA 3U48A 1NUDA 1K4CA 2XXFA 4FXLA 2ERJC 4AY0A 3HZKB 3HCVB 3S35X 2CKNA 1QUPA 3QWOB 4YOKA 4LO9A 1AGBB 3BVNA 3CCHB 1RHHB 2KERA 3EOTH 1GHFH 2GC4C 3LXUX 5FECA 5HYJB 2Q3ZA 3PQYA 2YPLD 3QI9C 1EHXA 3EJJX 3D2TA 4G9FD 5EO9B 1PYWB 1VCAA 1WD9A 5I1HL 2OP4L 4F58H 4PP2A 4DTGL 3MRJB 1VEMA 5F3FA 3NQIA 2EKSA 5GGQL 2I27N 4ANXA 1BVKA 1V7ML 3BJLA 1HDMB 5JORB 2W94A 2WINA 2ROXA 4G82A 3B7SA 3LKQB 1KPRB 1JN6A 4FFVC 4FZ8L 2QLYA 4EBQH 5E8OA 4CSPA 3PP4H 4KKZA 1Q0XH 1TEYA 3QYNA 2CO3A 1NGZA 1FIGL 4F15B 1J8SA 2M83A 1XF2A 3W9DA 4HUVB 5F0MB 1MW0A 3IB4A 1Q1JL 3BYYA 5IHUH 5DRNA 5J6HB 5E1IA 3MLTB 3P4NB 2IDFA 1CZ8H 1ADQA 1CTMA 3FU8A 1KFGA 3MAWA 3NIGE 2VL5A 5F0LB 4FFWD 3F6IA 1J8HB 4FLOA 4TL5A 5A6LA 4N90D 2BSTB 2Y7NA 5T8IA 1RU9L 1EHNA 1WCBB 1TU2B 1MREH 3MNZB 1AZNA 1IC1A 1YEFH 4WTZG 4IHBA 3WJJA 1LM8V 1BD2A 2G5UA 5IVZB 4QRRD 3AAZB 5SX4H 4EKXA 2QV4A 4ZMPA 2WLHA 3N5AA 5L2KA 1A7PL 4C8XA 3KYMA 5IOPA 1TVBB 2AXWA 3PP3H 4PAZA 3MFFB 4G8FB 5AVVB 3RUGB 5FO8A 1CDUA 4HCRA 4HHAB 3DX7A 3VD5A 5GS0D 3QUMB 4YQXH 2AQQA 3CVIL 3ATEA 4E41B 1IM9D 3TJEH 4JZJB 2AQRA 5G2NA 4L4JA 3SKOB 1JI1A 2NY0B 3GMMA 3QG6A 4R3SA 3TZVC 5KN5B 3O6LH 1MZZA 1QPXA 1P1VA 3QFJB 1Q94B 3GHEH 2YAEA 2A6IA 3MLSH 3GPSA 4L23A 4XC1L 5JW5B 4PYGA 3BX7C 1IGFH 4LRNH 3NMEA 2HVKA 3QAZC 1F13A 4A7QA 2ZSVB 1EGJA 4F57H 2AQSA 1MJ8L 2O6PA 4A7UA 1JZGA 5CEXB 1JXJA 3QEUB 3OLGA 1K5WA 5I1CL 2XETA 3FO1B 4HS3A 4UTAA