4KNQA

Crystal structure of 1nt-5'-overhanging double-helical ccg-repetitive rna 20mer complexed with rss p19
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
122
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into CNG-repetitive RNAs associated with human Trinucleotide Repeat Expansion Diseases (TREDs)
rcsb
source organism Tomato bushy stunt virus
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP*CP*CP*GP
total genus 35
structure length 122
sequence length 125
ec nomenclature
pdb deposition date 2013-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4knqA01
4KTGA 4J5VA 4JK0D 1RPUA 4JGNA 4KQ0A 4J39A 1R9FA 4KNQA 4JNXA
chains in the Genus database with same CATH superfamily
3GI8H 4J3OD 4L37B 4NKDB 3T0ED 3T3MF 1IBGL 5I1CH 4XPGL 5E08H 3QHFL 4FQLH 4M93B 3U1SH 1HAWA 4G8IB 1IBDA 4JM2D 3FNKA 1VESA 2ADIA 5DRXB 1P5VB 4UQBA 1UA6L 4HZ1A 4LBEA 4MX7B 2R9HD 5ACMA 2X9WA 4V11A 1MHHA 1Z0NA 4WUKL 2M83A 1UENA 4PW3A 1NTDA 2X6AA 4YLBA 1L5GA 2HH0H 2LQRA 2RCSL 4U1KB 4NPKA 2WTPA 4LLYB 5AW5B 2YMTA 3EKCA 1IKFL 1AI1H 1M7IA 5JW4N 3O4LA 4WI3A 4GSUA 4U6YB 3QJSB 5EUKB 5I26A 3D4GA 4MJID 1T66C 3DJSA 4JFDB 2BIQA 3OR6B 3NJGA 4WNSA 3L95B 5FC9A 2MOVA 3QJHA 4H0HB 5MERA 4LSRH 5F0PB 1F13A 4PY7B 5BMFL 3T0DA 1BZ8A 4M00A 4XGZA 3ZKMD 4JDZB 5IGXL 2Y36H 3ARSA 2DQTL 2H9GB 2RJMA 1UZ6F 3BD5A 4GSXA 5IWLA 3X3FH 4O51B 1R5IB 4GAFB 3BEVB 3WSQH 2ETWA 4X7EC 5E94A 1U8OB 3E2HC 3F58L 1GGCH 1LHZA 1T20B 4IM8A 1BVKB 3VO0A 3DTXA 3FB5A 2XG4B 1J11A 1U8KB 4UTAH 1JK8B 1TKWA 3L3HB 4P9HL 1DJXA 3MSPA 1IC1A 4NPYA 1IM9A 1JXJA 3CFJA 4KJQC 1EEYA 1PCSA 5BVJA 3ZE2F 3VE0A 2YK1L 3VXSE 3IJHB 1KCWA 3FL7A 2VDRB 3GMOA 3GXMA 3UEQA 4KI1A 3ME0A 3U82B 2VC2B 2WLNA 2ICWI 2ZAGA 1A6WH 3UP6A 4P4KA 1T4KB 4XN1A 1T5XB 2HRPL 1RK7A 4WWKA 3SB3A 2YEVB 2DBJA 4HJGB 2ARJQ 1XSOA 4AEHH 4PJFF 4J3OC 5KSAC 2WWKO 1NBYB 1OPOA 3QDJD 1MH5B 2BVPA 4PW9A 1KLGA 1ZLSH 4LPTA 4HWUA 1DDTA 1Z9MA 3QQ9C 4XTRD 1ZSDA 1OGTB 4AE0A 2FEJA 1IM3D 1T22B 2B7DT 5E5LA 4NZDA 4HIXH 1PG7X 3EW3B 5IOKA 2A5UA 1HKLH 4QRPE 4K9EL 2DQHL 2XWRA 1GYWA 2Y1ZA 1QO3A 3L5WA 5LXGH 3UTPD 5C0JB 1OIOA 4M62H 4XI5C 4PJHF 5C3LD 4FFZL 2EP6A 3BQUA 5DEJA 4Y4FA 3UADA 2AEPL 3CVIH 2V9TA 4DK6A 4AG4H 2AXHA 4Q6KA 4E41D 3RWEB 3I84A 1JDAA 1NH6A 3EOBB 5HHOD 3LNGA 4PWIA 4YIQA 1V3KA 5EOTA 5IW6B 1GY2A 3SGKC 4DKEL 5B38A 3S8GB 1UEMA 2WXJA 4KJWC 4HXAL 1FO0A 2E6JA 3UBXB 3VD0A 3V6ZA 5DXWA 3ISWA 2MQ3A 3GEFA 5I0ZA 3CN3A 3ZDZB 4ZTPL 1ZA3A 4JDEA 4EXPX 1HSBA 5D1ZC 3NSCA 1JNJA 4AQEA 1N6UA 4TN9A 4G9FE 1KELL 5E8PB 3H42L 3L45A 1G7IA 4PJ5E 2XN1A 4PBVC 3APDA 1ZHLA 4CVZA 1L3NA 2FEDC 1EAJA 1Z3GH 3D4CA 3ZKMC 4N2GA 3MDJA 4PTTB 2D3LA 5GGVL 3ZTJH 1WF5A 3MACL 3MRHB 3QC6X 1F3RB 3S3CB 2XJKA 4UIMA 4X4ME 5AKSA 5EC1A 4GT7A 4ABWA 4X6FA 1BZEA 3VFWA 4MCZB 5J6GA 5EA0L 3KLAB 4HV8A 3A21A 3LMJL 4XBMA 5DS2A 1E4KC 4FEIA 4WO0A 1AXIB 1I1CA 1I85A 5EA0H 4QHUB 1DE4A 4JCLA 1OAXH 2GSGB 2PWHA 4HJTA 4XE0A 1R3HA 1NC2A 4J3OH 3WS6A 1J1XH 1QD0A 3FRPG 1T2XA 3C9NA 1HHGA 3FHEA 2NY4D 1B0GB 2MH4A 4HMDA 1BX2B 4XMUA 3QEUA 4GKOA 4PSRA 3ZHLA 1KSRA 1KC5L 1K6QL 3KPSB 1Z3GL 3F7VB 1FZMB 1OT2A 2QADB 1ECZA 3WIHH 4F1SA 1JUFA 3BUDA 5HGBA 3O4OC 2A9NH 4JFPB 4D7BA 3Q44A 5TDPA 2ED7A 2J8UA 2JCCE 2ADGA 4NQSA 4XMLH 4L8CA 3GDBA 4BFEA 2ZUUA 5IQLA 1SHMA 5EZJB 3C8KB 3ESOA 3V52L 1PMYA 3D06A 4Q0XL 5BS0E 3BAEH 5HGDB 5DJ8A 1XIWA 2FUQA 4HXAH 5FCUL 5EU3B 2ODHA 4O2EA 2VLMD 4MBRA 2BSEA 4CN1A 1N64H 2E8YA 4OKVB 2G4EA 1UB5A 1ZIAA 3WEMA 3ZK0A 4H8WH 4Y16C 4R0LC 1OXYA 5DZLA 1MHEB 1SJEB 2W8CA 1FIGH 4JHAH 2DQFB 1GGUA 2WO2B 4KX9A 1RK1A 1UJ3B 2JV6A 4CBZA 1JFHA 5ACZB 4PN6A 3WNNA 2BNQE 3PU7A 4FQXB 5I15L 3IDJB 3RDTC 4BK4A 4JQXC 4ENEC 5HYSG 3QJVB 5ICXA 2PW1B 3UBFA 2Z91A 1XSKA 4I77L 2IAMA 3OKYA 1P0SE 4YSRA 3SDYL 4TNWK 3S37H 1WBYB 4W6WB 3U0TA 5L6YL 5LNGA 3NTCL 4BRVA 3AGVA 1UH4A 2H26A 3APCA 3WO3B 4MAUL 1MAKA 5T3XH 3LRLA 4U0QB 3ZO0A 3HI6H 1A3LH 4XO9A 2J73A 4MTMA 1PZBA 1JWUB 4L8SB 1YEIH 3B8YA 4FQQA 3Q0HA 4ONHB 3RI5K 1FBIH 2J8UB 3MXWH 1NMCC 2WNWA 3TC9A 1IBHA 1ULVA 3OQRA 2J20A 3HTLX 4OFIA 4HCIA 4ANVA 3GMQA 4PJCB 1BX2A 1NQBA 2YD9A 3RFZC 4MQTB 2AGJH 2NLJA 4UT6H 4BHUA 1G0XA 2BPBA 3CFEB 1I1RA 3WIFB 4BBWA 2V7NA 3HBZA 3IDNA 4MMZA 4JX0A 2FECI 4LAJH 4ICWA 3BUYA 4P9HH 4R0LA 3EF4A 1NBVH 2AJ3A 2FVNA 3TBSB 5IB3A 3HE7C 5C0CA 1XBDA 1MFBL 5GRUH 5EC1B 3FQXB 4IHBA 2RACA 4PJ8D 4NLAA 5DC2A 4RX4A 2AEWA 3VD7A 5IK3B 3LN9A 5J9PB 2BWQA 3GSRB 3GMRA 3GZOA 5F72S 1YZZA 3X3FL 3DJTA 3L3OB 5DD3H 2YEZA 3VFNA 5CD5C 2MOGA 2PP7A 3VU1A 4B9IA 3IVKA 3LY6A 3W82A 4HIEA 4JMXA 1HSBB 1ZLEA 1JWMA 2XQYG 2WKLA 4BIKA 3KG5A 5TDOB 1YMMD 1QQDA 2NY2C 4KAQL 4JPIA 4NUGL 1P7QD 1TMQA 1X7QB 4YVUA 3SE3A 3A6CH 4EUPH 2HH0L 4R7NB 5C07A 1M7DA 3EOBA 3S48A 1BCIA 3RIAK 3LIZL 1JHLH 4LKCA 2BNQD 3M17A 4DWHA 3VGAB 3KD4A 4ZW8A 1THCA 1PAZA 1WE5A 3LN4B 4L4VB 4PRPE 2WLJA 4GW1B 4AYEC 1SVBA 5KS9E 1QRKA 3QR0A 2OYLA 2F61A 1G0YR 4UQ9A 5B1JC 5DURB 4F9PC 1I9RL 2B0SH 3QG6A 3PP4H 2P8MA 3T2OA 3B34A 3REWB 2AQ1A 4NIYE 4ZFOB 4QO1B 1W0WB 4LLVB 4Y9CA 3SKJL 4ZMWA 1RKRA 1XF2B 1IAKB 2C3VA 3V4PB 4OZGF 2NPLX 4JG1L 5KYXA 1LLAA 4APQD 4E5XG 4GQRA 4F37K 2XKUA 2P5ED 4NNXB 1F6AB 3C5ZD 5CEZL 3LH8A 1HT6A 1ZVSB 1RZIA 1KEMH 5IJDC 3O3AA 1CFMA 3D3VB 5TJWK 3TO4B 3NT0A 4PB0H 2FB4H 4E9QA 3RWHB 3HKFA 2BW4A 3B7TA 2H3NB 3IVKB 4OJFH 4P4KB 1JZ7A 2I27N 1A3ZA 4ODHH 4DGVH 3NJXA 2CHZA 3PWPB 4XT1C 5DO8A 2HFEB 2X3AA 3FONA 3HG1B 4FTVA 4XVSL 7FABH 4TPRL 4KX7A 3ZUNC 4WFHE 2G4GA 2XQ0A 3HBGA 1P7QB 2UX7A 4FXKB 4KMLB 3BFQG 3ULVH 4LLWA 3ESUF 4ZQKA 4TLSA 1UGNA 1HINL 4N2DA 3VFUB 2RIKA 1XTLA 1N0LA 3PJNA 3A4EA 4E9LA 1KN4L 2V7NB 3MRNA 4FMVA 1KTBA 3BPLB 2XACC 4JVPA 5ALCH 3DDGA 4F3FB 1E9QA 3CPLB 1X5MA 4LK4A 1DLFL 4N9GA 1QLEL 1QSFA 3CVCA 2O4EA 2VR8A 1AD0B 3D1MC 3OR6A 1BWMA 1VGEH 2NY1D 4P46A 4BXVA 2CDEA 4EI6B 3L9RB 3FU9A 2DAVA 3KLKA 1J1OL 4HZAA 4JZOA 1FL6B 2QSCL 5F6IB 1AGCA 1YC7A 3WLBB 4O2FA 2CO3A 4XP5H 1G7MA 3C5ZB 2AXWA 5CJOH 4K71C 1CU4H 3CZKA 3G5XA 4EO5A 5C1MB 2H1PH 5DZOA 2V4LA 2OMUB 3B2UD 8PAZA 2PW1A 4FC3E 5KVMC 2JKLA 4JFOA 1CZ8H 2CGRL 2VL5A 1ZVYA 4LMQI 4RFEA 5IP4A 3K6SA 1XGPA 3NFNA 2KQNA 2BVUA 1QR4A 2A1WH 3PWPD 3QEQE 4NX0A 4YHKH 3MFFA 1ZA6B 2WLIB 5F89A 2VDOB 4NZTL 2YOCA 4KI5C 1NAMH 1NDMA 2CAKA 3MLWL 5EF2A 5C0IB 4X2UA 5EH1A 1U3ZA 1Z1WA 4TV3A 1N6QL 1SMOA 5IROC 1TJIL 3WJLA 3CBRA 4K8RC 4NQXB 4CC4C 4OLXL 1GS7A 1QWHA 4ONGL 1PGRB 4PJDB 4QOKD 3U83A 5IQ7L 5F7WC 4H8VA 4L48A 5CKAA 2JF1A 4I13B 1Q0EA 4D8OA 2VZSA 4N86A 4F2MA 3FF7A 1W15A 4ZUVB 3W9DA 1PLGL 1I3UA 5JHDE 1KLFA 2V7HB 3MYZA 3DOSB 4FZEL 2ED9A 5BZWA 2DYPB 2Z92B 4L8DB 3VX1A 5HPMA 3OMNB 3QNZA 2AANA 3W0WD 1DJSA 3MRMA 4XOCA 1RZPA 3ZL1A 5EBMB 5I1JH 4PJ5B 5DJ6B 4IIQB 4WEEA 5DRNA 3HG1E 1GOFA 3HFML 3B1TA 2HAZA 2I25N 3A3YB 3CSBA 3GSQA 3HRZB 4M5ZL 4S1RL 1RHFA 5ICYB 2CSPA 1E6JL 4NEHB 5C71A 3FO0H 2I9TA 1IBFA 5AB1A 1KB3A 4OJEH 1ZLVH 3AMLA 3BT2L 1ML0A 1QLEB 1TETH 3JYBA 2V5MA 1KIPB 4OQ1A 1A1NB 3KM2A 1EPFA 1U8PB 2VN4A 3CHPA 4CDHA 5B3SB 1H5BB 5TE6H 1G7MB 3VXTB 4ZUUB 1LXMA 1J8RA 4ZBJA 1PLGH 5DVNA 3CZSA 1M7XA 3DIFB 4L1HA 1HL5A 3K6OA 4L3EA 5AW6B 5JLZB 4C57C 4UM8B 4YQXL 4M1DL 2CDGA 4ZK8A 4LL1A 2Y06H 4PJBE 3CZEA 3EDEA 3B7SA 1VSCA 4NQCB 5T5FL 3DDFA 5D7JA 2VW4A 3NIFE 5DQDH 1FG2A 1VA9A 3WY1A 4KQ0A 5IWLC 2NY2B 2AQ3A 3AU1B 3LOWA 5HI5C 1MCQA 4GS7C 1D2OA 4CAGA 4MJ2A 2Z4QA 1UADC 5PAZA 5BOJA 2PTUA 4TVPL 4MA8H 1XB3A 4I18A 4RMTA 4PJAA 2DH3A 4NAQA 2PPFA 4Q4EA 1KGWA 4HCRH 2RB8A 4UUJA 3F3HA 4WW1A 4RGMC 3T3MB 5C0JA 2XVBA 2WQXA 5T1DL 1TJGL 2K9FB 1RZ8A 1DVXA 1IKNA 4E0RA 3QEQB 5K9QG 4K5NA 3QDMA 4LDOB 1R5VB 2ZPKH 2H3NA 4EUPB 1I9IL 4QXTB 4RCAA 1JD9A 4NCDA 3RWDA 3HAEG 5B1KA 4KRNA 4BSVB 1ONQA 1H15B 2J1XA 4UQ3B 1ZT7A 3FFCD 5EZIL 4MLSA 4W9ZA 3S8FB 4NKQB 3SE9H 1U91B 1LE5B 4QWWD 2Y7MA 2HP4A 4CNIB 4PJ9D 1T89A 1KJ2B 2R1WB 2CUIA 5K33A 4Y16B 3ZHDA 3X1NA 4C8XA 5I8CB 3I50H 3MODL 3N1QC 4AYBA 3STZB 1HKFA 5ACLA 4GKSB 4WU5B 3CIAA 1BDYA 3FQWB 4CC4A 4MD4B 3LS5L 1S7XB 5F21B 1T4KA 1UWEL 5JW3L 3V0WL 3RUGE 3GS7A 2WW8A 1S9YA 4OCRH 1HWWA 2G75A 3QAQA 2LTQB 4S1SL 2EVGA 3M1CA 3WXWH 2KH2B 1KENH 1IU1A 1USQA 2YA2A 4KKLD 4LKXA 1JYXA 4E36A 3ZPDA 3FQRB 4YPGA 3VW3H 3AM8A 3UTQA 4G43A 2ED8A 4KNTA 1FFNB 4N2CA 4Y7MA 2KKQA 3ES6B 4QXGH 5EIIB 1Y7VA 4Q9RH 2KBGA 4Q9CA 5I6XC 3LRGA 3BKML 1U2CA 2FRGP 4Z6AT 5JOPD 4Y9GA 4GKNB 3CLFH 1CDJA 1QI4A 2WB1A 5DQDL 2BNUB 2Z7WA 1IZKA 1UJ3C 3ESNA 4K2UH 4JY6B 1U33A 4JFDE 4HUXB 1ZHBA 3O2DA 4A2LA 3KLDA 2LLGA 3JWDH 3KCPA 4M6AA 2ZOTA 3MFGB 3ETTA 1A9VA 1WIUA 2E3VA 2VH5H 1OM9A 2AK1L 5F0MB 1BOYA 2IAAC 4HH8A 4A7SA 5EEZA 5H2BA 3T0VA 4OIFA 1U8JB 3L9EA 3LKSB 5A3IC 4P0DA 4WEBH 4F8PA 1OSPH 5EB9A 1I9IH 4PJGF 4ZT1A 3GKWL 1U8IB 3F6IA 3MRFA 4FP8L 1IGTA 4EN3A 2QJDA 1AP2B 2ITCB 2ZSWB 3WHXA 3GB7A 3K6IA 4XN7A 3VDCA 2WYTA 2R0WL 2XKSA 4U3CA 3FO0L 1YNKH 3K72B 5FXCH 4D9LH 4LPUA 4N90D 5DD6B 4FXGA 1HQRB 5CS7A 1SXAA 3EOTH 1EAOA 5F93C 3FB6A 3GJEB 1FWXA 3TZVD 3ZMRA 2YAOA 5ABZA 5BQ7A 5I5JA 3NZHL 2ESVB 1U95A 2FHCA 4MDJA 2YGPA 4UM9B 2AJZB 2W91A 3IJ8A 2JKIS 2JVUA 1CDGA 1RERA 4LHUB 2LTQC 3TT3H 4BYHA 4ISVA 4OCYL 2JELL 1D9KC 2P47B 3BN9D 3PIQB 1PDKB 1U41A 4K7FA 3VXRD 3PJSB 4W9LC 4IRJD 1XGYH 2G5RA 1O6SB 1WBYA 4EQ2A 1VGKB 4DPCX 2J44A 3ARTA 3PNWB 4CBPA 2AERT 2HXAA 2RA1A 3BWSA 1I7UA 3P3SA 3H9SB 3QUYC 3HLAA 4KY1L 3DRTB 2EE6A 5DZPA 3VFGH 4NM8L 4HC1H 1JAEA 5CZVH 1XCTA 3TIEA 3NZHH 3NQIA 3HAEH 5BW7A 8FABB 3QXAA 5EBLB 1ROCA 1YEHH 3L5HA 3BZFA 3WDHA 1TTFA 2PCFA 4AEIH 5FYLL 3BO8B 2AJVH 2BRRH 3D51A 4FEMA 3OX8A 1B4LA 4P06A 4ZRGA 3SZ6A 1N26A 4R26H 2XC8A 1JNLH 3Q2VA 4EQ3A 3SBPA 3BGFB 2YWYA 5CEYA 5T1LB 5EF0A 4ODVL 4PJ7B 5D5MA 4X6EA 5F88B 3JZYA 5J12C 4KTEL 4KK8D 3IU4H 1I4FB 2UVEA 4IMKA 1DO6A 2Y24A 1G7PB 4M3JA 3CFCL 5HHMD 3OTTA 2QHLA 1ZA3B 3I9GH 5IB2B 4C56E 2JKSA 5CP7A 2YXWA 2VDPL 2PW2A 4IGBD 4YDKH 1PTZA 1ZDQA 1ADQL 2WVVB 4QRFA 4ZD3H 3S5LB 1NAKL 3SQBB 1TJIH 1I9EA 5C08E 2ZUQB 5E8EA 4Z77A 1J05B 4MKMA 3MLWH 1Z9OA 2ZWLT 4FQJH 3KPRB 4GRMB 3T8XA 3MROA 1IIIA 4JO3L 2LU7A 1KWKA 5JPMA 4UINL 3FB8B 4E9SA 4KROC 3V9CA 3WIAA 3WKPA 5I1DB 4RMSA 1I8IA 4NO0D 3VGBA 2VE6B 2NYYD 2ZG3A 4B5ZA 3LQMA 2F0CA 2I07A 4W68A 4GUPB 1U92A 1E65A 4TLUA 2GIMA 4M5TA 2IGLA 3U30B 4FHBD 3KEDA 1J8HE 1LYQA 3O3BB 5J11C 4JRXB 3UYRL 3HLAB 2FLBT 4AQEB 5ICZA 2GY7B 1DUZB 4Y1AA 5IBLC 1SUJA 1KXQE 2D8KA 3O45B 2J1ZA 1A7RL 3PQYB 5CGBA 4HSCX 3MRCA 3RBGA 1XGQB 5AD0B 2YSTA 1EJFA 1WLHA 3Q48A 3E2HB 1D7FA 5IJKC 4LPYA 4X9FA 5JIQA 1TNMA 1KB5A 1M6OA 2OQJB 1USZA 3FUKA 4UCFA 1HK6A 4OT1L 2IBGA 3KVQA 3CSYB 4WFED 4LCIL 5DHVB 5B7MA 3ME0B 5ISZE 5HHMB 2R0ZL 1AH1A 1JP5A 2YD7A 1CGWA 3WKNA 3QXDA 3GSXB 3KYMB 5INCB 4IKKA 1D5MB 1ZE3C 3D09A 4YL4A 1YPZE 4YGVA 1UCTA 2Q8AL 1H3UA 5D2NA 3TPKA 1HINH 4Z7AA 2NY1C 1WH0A 2ZG2A 5DR5L 2B0SL 4TVUA 1U8KA 1DN0B 4AIOA 4M9PA 3ES6A 3MJGX 4RMQA 2MCPL 4YPGB 1VFBB 3I02A 1RFDH 1BBJB 2AAVA 4PG2C 5JIDA 4GMTH 3VA6A 5IMLB 1R5IA 3MRQA 3R18A 5GPRA 5MENA 3JWOH 4JE4B 2F58H 4ANUA 3VH8B 4BA0A 3T4AA 1ZS8B 3OMZA 3QUKB 1QKZL 1FV1A 3LN5A 1DJYA 1ET7A 3ARQA 2JIXB 4KI5D 3SHSA 1C8QA 2BWDA 3S88L 3T4AC 3HS0C 2PPEA 3CVDA 1K8DA 1QA9B 3FT0A 4H8HA 4FL4B 4R4FL 5C0DB 4HKZB 5FK9A 3VH8A 3MRJA 3VYNA 1L0XA 1VPOL 5FECB 1OB0A 3KR3L 2OTWB 3ARRA 5DRZB 5HJ3A 4AYID 2WSPA 5EZOH 1RK0B 4BSJA 4DKEH 1YY8B 1DQML 3KL0A 2A9AA 3H2QA 1GGIH 4D9QE 2OYKA 1HIML 4X6CE 5L2KE 3VSTA 3R0NA 5HI4C 5JR1H 3GS4A 3TPUA 3B2UC 4B5EA 1A0QH 2FQEA 1A21A 2DDQL 2QQLH 2IG2H 1HHKA 4AZ8A 3VI3F 5LXGL 4A7VA 3MLRL 3EYUH 1TPXC 3SJVD 1NBVL 4Z5RA 2OKMA 4AGPA 2F53E 3NIDF 1MUJB 4I2XB 1E6JH 4NC1C 2PCPB 3QXDB 2CGZA 4LRIC 3GSOA 3SOBL 4YHIA 3PGDB 2X7LB 3N41B 4NKDA 2EZ0D 2GSIB 1S9YB 5DHVA 2Y72A 4QYOA 3B7UX 1JDCA 3VX0A 4LHUG 5CMAA 1UD2A 1T6BX 1GJWA 4WU5A 3G5YA 2PLTA 2QSTA 2HJLA 4KC3B 2W9DH 4XB7A 1XCQA 4AGLA 4N6QA 5GS1A 5DLML 3V9EA 1SDDB 5HVGB 4WJ5A 2JKNA 5DD1L 1QBBA 2ILLA 5FFGA 2DQJH 1BOGA 3U7AA 4ZOAA 4NZUH 3MRPB 5MEOB 3IRCA 4P3WA 5I30L 4AK2A 4UQ3A 4HWZA 1S7UA 3VXUA 1CO1A 3V0IA 5HI3D 5CWSB 2BSBA 1ID2A 1FNGB 1KTLA 1NCTA 2XY1A 1YEKH 1OAUL 5IG7A 3EO1A 1DVYA 1NIEA 3CPUA 3D39A 5EWIL 5GGQH 1O7DC 3CHQA 3X12B 3U2IA 4XC3L 4Z3FA 4XP6L 3K71B 2ZIDA 3UZQB 4NHCL 4DP5X 1AGFB 5EN3A 5EG6C 1ILUA 3VSVA 3G9VA 3H8NA 4G70B 3THMH 4FFYL 2I26N 3B9KD 3O6FC 2BIOA 3WDIA 5CU9A 2ZOKA 2WLLB 4MNHB 3HC3L 2WO3B 1BVNT 3CVHB 4P3CH 2WTOA 4JG5A 1OALA 5FYKD 2WXRA 4PGEA 3LB6C 4QRQA 3GMLA 1K4CA 5ITFA 5JYMA 1IL1B 3MBXH 4UT9H 1NCWL 2G2PA 4IRZL 4EZMA 5H4ZA 2BCKB 1WS8A 3G9AB 5D2LB 1FLRL 1Q9WA 5FCSH 2WTRA 3FFCA 4QHPA 4KFMA 2E75C 5DA4A 3JWNC 5AL0A 1H3VA 1WV7T 2DB8A 1AQ8A 2UZIL 3IMUA 3QI9C 5BVPH 4AV4A 1AR2A 4UM8A 4KDTA 4M1CD 2B1HH 3O3EB 2CM5A 5ERWB 1NCOA 1AOHA 1FZJA 3DXAD 1HNYA 6TAAA 3OXSA 2SODB 2GABA 4U7MA 3B2MA 1OTTC 1Z3RA 2NXZD 3L5XL 4S0HA 4HS3A 3GEWB 3RU8H 3GTVA 4BWTA 1CDYA 4LSTH 2WY3B 2C3HA 4LPXA 1J1XL 2AXJA 1S5IH 4EIZC 2OXHA 3FTUA 1CFTA 5FYJL 3CX5J 3WL9A 3L4CA 1OAYH 5KG9A 1HJBC 1BF8A 2V9QA 2VLKA 3CXDL 5F7HA 3CFKA 5HGAB 2ZUYA 4JPVH 4G1EB 1KNOB 1R3KA 1RSFA 3FAXA 5F6HJ 3G3LA 4NFCA 1PQZB 4TMPA 4NC2B 1ZLWK 4XVSH 1B2WL 2DKUA 3RWCA 4KO9A 2F54B 3PNWA 5GZOC 3CSFA 3ZSSA 4IBYA 3ZN6A 3H1ZA 2Y2WA 2OMZB 4JN1L 3HKZA 4Q6IB 1XH3B 1N3NA 5BVPL 3MA9L 4L3ED 1BM3H 4MJJA 4AZUA 2GVYA 4PB0L 3T0XA 5KSUB 3L9RA 1ZLWH 2B77A 4MCMA 2C9AA 1AANA 3I2CH 5IM7B 3ZTNH 3KDMB 4JQIL 3CG8A 3ATEA 1BQHB 3MRRB 3FPYA 1QP1A 1F11A 5AQ0A 4LCWE 4M7ZC 4P3CL 5KVDE 2CIIB 3VFMA 5GS1C 1WEJL 2ICCA 5DK2B 4LOUD 3L2NA 3WBDA 3NCYP 4KXDA 2CK0H 5C86A 1F41A 2Z93A 3BUBA 3GHBH 4AK1A 1EFXD 5C2BL 3O4OB 4FQ2H 3VFUA 5DS8A 4XX1G 2XZAH 3D0AA 3MCKA 2AMUA 5K1VA 5DYFA 5CUSH 3FF8A 1CGTA 3TNNB 4FQXC 1E5UI 1E28B 2G3NA 2N3JA 2KYIA 1JXGA 1M9WA 1QSZA 4AT6B 1P5UA 1T04A 4XBEH 1VZGA 3LRSB 2IGFL 1AQDB 5T5NF 1I8LC 1FZKB 4DFHA 5CZXC 3TN0D 5C0EB 2D3VA 2DQDH 5TPWH 2ZXWB 4K94C 1SY6L 1PD6A 1UZ8A 2HLAA 1J8SA 2JJWA 2P44B 1LQSR 2K78A 4R97C 2AVGA 2NZ9C 1NA8A 4WHCA 5DD1H 1S7WB 1WZ1H 3VJ6A 3ULVE 2HTKC 3G04B 2IJ0C 3CN2A 4LCCA 3CQQA 4OLYH 5FYJU 2Y9RT 1AQKH 3LRMA 2JLLA 5JIMA 1JS4A 1UASA 1XB8A 2WBKA 4KV5F 5CBEB 5F71A 1J0HA 4UMSA 1D9KD 4GT0A 2EEAA 4FQIH 2ZUTA 3AS2A 2UYLB 1XR9A 3WNMA 4NKMA 1HNGA 2I32A 3BE1H 1C7SA 1NC4D 5TPWL 3D25A 4NT6A 4AIZB 1L9MA 3GBNL 4DT2A 5HHXH 2H0EA 2VXQL 2W0FB 1ZLUK 3TFKD 2CRMA 4LDLB 2X2YA 1T6VN 4H1LB 3OXRB 3DV6A 4MJ5A 4QO1A 5F3FA 4FFZH 2A6JB 1G6VK 3ILQC 3FCTB 3LZNA 4C56D 1A5FL 1TJMA 3FFDB 5ETUA 1UM4H 5DJ0A 2ZOOA 5I16B 1GIGH 1S7RB 3L3JA 3QA3A 1UXSA 1TMCB 2A9MH 4M29A 3VXSB 3FQWA 3LCYA 4TQEL 3BIAX 4DH2A 1ZHKA 1FI8C 5FHBL 5JXAH 1MCOL 1TQBC 3QWOA 4DTGL 3G08B 4PJEF 3I9PA 3EXLA 4P46D 5T33H 3EUDA 4WJG3 1ZLSL 2GI0A 2KI6A 4GP4B 4YWGH 2DWDA 5CJ5A 2WB7A 3HE6B 4GEJA 4KMTH 3VFPA 1OCWH 2BSRA 2P28B 1QTSA 4L1DA 4ZTEA 1NGZA 2X6UA 1QZ1A 1YJDH 3VB8A 5KSBE 2OA9A 2YMOA 2X4SB 2WVTA 3V0GA 3LKNB 4M48L 5IFHH 1KB9J 4QXTA 3RWDB 4AL8L 1X5AA 2E0PA 3HE6A 4XMVA 3JWOL 5D1ZB 5KUKA 2C9SA 4ADIA 1O7SA 3O3BA 2GCYA 1B90A 1FGVH 2IQAB 1SHXA 4NHUB 4L0ZA 3V0EA 5E2VH 3CZJA 2GJ6A 2WXNA 1KYOK 4RZKA 4ACTA 4K94H 5IBUB 2QT6A 4I0KA 1TZAA 1OGAA 4I5BA 1UA6H 2UXGA 2OL3L 1CICB 5E2WL 3AZUA 3VXRE 4Z0BH 5I1DA 5LNDA 3WKYA 1I8KA 4Z7WF 2H8PA 3HC2A 4JW3A 1YC8A 4MJ5B 3HN8A 3N40F 3D2UB 5JR1L 3WSQL 4JFHD 3WIFA 4CC1A 3MN8A 3MRGA 4V1DB 5B3NA 3NIFF 4RSVA 2O6CA 1RLWA 2KZ1B 2NNFA 4NT6B 5E5UB 1KJ2H 1UWXK 3VQ1C 4N8UA 4OZIB 1KFGA 1XT5A 4N8PA 4YX2L 5AB9A 4PR5A 3KLHD 4WI0A 2UX6A 3WTTA 3VWKA 3OC5A 2P46B 3GPSA 3RVUD 1OK8A 1I8UA 1IGIH 3F01A 1M2VB 5CKGA 2KMWA 4IRJA 4XP9H 4D7PA 2UZIH 3DPBB 4YSQA 1JSYA 3VJ6B 5JA9A 2FX7H 4MKTA 3I6KB 4B50A 2ICWJ 1S9VB 4PHXA 2W65B 2F53B 1I4FA 3FQNB 1SFHA 3FCSA 3IE4A 3VI3E 1SVCP 2ENYA 1A6TA 3L3OA 5EF3A 3P0VL 5G5DB 3NCYS 1AD9A 1DBJL 4Z76A 1AXSB 2BXZA 3JT0A 4U3SA 5IVXE 3O11B 2J71A 1GZQA 2C9VA 1PYWB 4Y88A 4KH9A 2OX5B 3QDJB 4ODUA 2CD0A 5FDWB 3SKOA 4OGAD 2IWKA 4GMSL 4X0NA 5I73B 2D31B 3ZE1E 3SEPA 4DJMA 4X0KA 3QXAB 4S0SD 4TOYL 1F00I 2H3XC 4JFZL 1ZEAL 1TU2B 3QCVL 4UNVA 2E46A 3L48A 4IK7A 1NC2D 1EEZA 2JQAA 1T83C 2GUYA 5BZWB 3DOSA 4YHPB 1D7DA 4GP5B 5E6YA 4Q7DA 2BJML 4DO6A 2CO2A 4GG8B 4TTDC 4J6RL 4PS7A 3U1QA 1TXKA 3CXHK 3ISRA 4K7PH 4QI3A 3ZQ9A 2I9LB 5GJSH 5IMOB 2VLJE 3S5YA 2TRHA 2OR9L 4MJIE 2C3GA 4WI9A 5EZJA 1J5CA 3BEWB 3BT0A 12E8H 4BE5A 3B6SB 1KPUA 3UMTA 3VWKC 4Y2DB 4JUSA 5KSUA 4BH8A 1MW2A 1IGJA 3LXCA 1HNFA 1LTXA 4RZCB 1J9RA 4Y5YA 5GGRA 4L9LC 2WBXA 3AB0B 4FFWC 4NC1E 2XTLA 2TSAA 3P30L 4NRXB 4Q6IA 4S0TD 1NDMB 5KYUB 5CHNB 3DX4A 2F1AA 2WZ5A 1NCWH 2P3YA 3BGAA 1XL4A 2HLFD 4ELMB 2JXMA 5IHUH 4H13C 5B8CC 4MD0A 5TGBA 2H3KA 5EIVA 4UNTA 3U7WH 4F58H 2ZOUA 1QLFB 1NCAL 3V7AG 3V8CA 3QCUL 1UVQA 2FJSA 3GJFA 4KK6C 5KAQF 1AHKA 3DX3A 3SJVA 4AEIL 5LBSA 5ACZA 3J07A 4XB3A 1JERA 4HDIA 4IU3B 5DZ9A 1AIFB 3DBXB 4GRWB 5LGHH 5ANHA 2O1AA 2VLLA 1FQ9C 3O2DL 2QVKA 2VNCA 4NJAH 4XXWC 3M7FB 1ZLUH 4DGYH 3VFGL 1XH0A 4Y5VA 1DBAL 3GUTB 3WXVH 1L9SA 3I75A 4NZRL 2JI1A 1G9EA 3V6OE 2AITA 5L9DL 2GW5A 4CVZB 5DJAA 1JI1A 1AGEA 2HVKA 5EZOL 2X9YA 5KBPA 3S3JA 4WU7B 2X4OB 4QCIB 1ACZA 1NAMB 3QUZC 5TH2A 1CE6B 4ZMZA 2HPOA 2XJLA 3KCPB 4IRJB 4MNGB 3SE3C 1IFRA 2EAEA 4KQ4L 1HCZA 3MJ9A 4OQTA 1NSNL 3KGUA 4JM2C 4LESA 1G7QA 3J7HA 4RGMB 1WWBX 1HCVA 1IT9H 3GMLB 3GXUB 5ITFB 4GG6F 3INOA 3SDXA 2EE2A 1N0LB 3QQXA 3STLB 5EOTB 1KMGA 3TU6A 5HYJD 1X5LA 2F7RA 4X4XB 5JHLL 4P2QA 1JGEB 3MJWA 4UTCA 1U3HD 3RL2A 4PJIE 3ZKND 5I66A 1XXFC 4PUBL 3NFPB 3EJZC 5EEUA 5F3BB 5G55A 3OPZL 5D96C 2H47C 3MRKA 1UM5L 1DANU 1ND0B 4KKCD 2XBTA 3KM1A 4PS3A 2NR6C 4X5PA 1VAHA 4FP8H 2GSMB 2R39A 4K7PX 1KTLB 4NENB 2CCLA 3UTTD 1KJ3H 1OLLA 4WCYH 3STZA 2L3BA 5IMKA 1CLVA 3UZEC 4L4TD 2ZXGA 3QS2A 4A55A 5ECJE 1SXNA 4JFFE 5FS5A 1EH9A 4F7EA 4J3WA 1VPOH 2R1WA 4N5ED 4YFLI 5E1AA 4HWNA 3NBNA 3GSWA 2VO5A 4KVNH 3GMPA 4ZYKB 4F7PA 1F6AA 2E76C 3LKNA 3MV7D 3AC0A 4X5XB 2NY6D 3OB8A 3IJEB 1OP3K 2R59A 1EEQA 2J7LA 1MCEA 1E50A 3BMWA 4L2LA 3NGBC 4FA6A 1QR1A 5LGKA 4NNPL 2JB5L 3H3KA 1Z9PA 3WJJC 4LDCA 1PSKL 3ULUC 4KOCA 4AW4A 5DVPA 4YZWA 1FL5B 5IR1A 5GS3A 4ODWB 1WA0X 4MB1A 2Y5TA 3KPRD 4N8CH 2AJUL 5L4IA 1FCCA 4D8PB 1NFDA 3FO1A 3LNEA 1XV8A 4WO4B 3L3JB 3TJEL 4EZKA 5ITBH 5CEXA 5JHBA 2VXVH 3RL2B 2O30A 3SBWA 3BCFA 3NIFB 4OCLC 3DTXB 4PMFA 4CA4A 5H37H 4XVJH 1W8OA 2OMWA 3BH9A 1YAIA 3VSUA 5EU6D 4EF3A 4KO5A 3IKKA 4N2NA 3W0WA 4AY0A 2COVD 3PAYA 2YS4A 1KGCE 3VI4B 2OBGA 2W60A 3X1GA 1ETZA 1PG7W 1OAJA 1UKTA 3ZYIA 5GS0H 3CDYA 1GYUA 5EU5A 4HJJH 5JQ6H 3ARPA 5IMMB 1G7HA 2VR5A 3L95A 2IMMA 5K9JL 4OLVL 1UOKA 4E9WA 2O6PA 2JJTA 4LCCB 3F7LA 3R1GL 4DPAX 3K2UH 3DXAB 5JUEL 1EHAA 1XGTB 4HVBA 2QHRH 4OFVA 3X3GL 3WTYA 4EIGB 4U1LA 3S5LG 1Y07A 1WT5C 5FYKE 4LLMB 2IAMD 1F2XK 3DJZA 3FT1A 1E40A 4TUOA 1A1NA 5IB3B 1OOAA 3HI5L 1QUPA 3CSTA 4X9GA 4XPBH 1E8YA 1KTDB 3O6KH 4P2YA 4U1MA 2EDWA 3ABGA 4AQ1C 2D3JA 4CKQA 5ADPL 3VW3L 3RA7L 1FYTA 1UD8A 2JWYA 2AJVL 3T6XA 1YEWA 4G71B 1OM3H 1SDAB 3RGHA 3LZFH 5I1KL 3OKNB 3DMMC 1XF1A 5HYFA 1F86A 4J3TA 1PFOA 3S97C 1GTNA 4KHTH 5LO7A 5EBMA 2QMKA 5C08D 4PRAA 3HN5A 1QPXA 5C0NC 5DK2A 3FOLA 3MODH 4P2OC 4HWBH 3DLQR 2EVJA 3A4DA 2H5UA 3C75A 3NDYE 2G2RB 5E00A 2AAAA 1QMUA 2FIKB 1E42A 2QKIC 2Y06L 3GPEA 2YSSA 3QAZC 4HWBA 4ZO9A 3OL2A 3OLDA 1XL6A 1EBAA 1TJXA 1WCBB 1HXKA 4TL5A 4I0PC 4PM1A 2HVKB 2VABA 4M43L 4OZ4A 4UNUA 2E6PA 3QH3A 1HL9A 3WN6A 4U6YA 1B4RA 3ZIMA 1KJ3L 3TNMB 1KYOJ 4XX1E 5D4QA 1F4HA 1F6LL 1K8IB 4FMKA 3WV0A 3NAAH 2Y6SD 3AREA 1BGXL 3OM3B 3A67L 2DQUL 3EYFB 5ICUA 2J72A 3X13A 4XXCA 1GKEA 1MHHB 1BMGA 4J5VA 3J8F7 1YMHB 2QDWA 3LQZB 3NEOA 4DZ8B 2X0VA 4TVPH 4Y4KD 4XMPL 2DQ6A 5FIEA 1QBML 3ECWA 3OMIB 4GW5B 4JQIA 1DVFA 4XNUL 5EO9B 1IO4C 4Z76B 1NFKA 1HH9B 2OXHB 5F1IA 1MXGA 4WV1B 4OGXH 1P4IH 3FQTA 2YAPA 3E8VA 1Q1PA 3ECQA 2FX9H 4HUMB 4RFNB 5GHWL 1FFQA 3ZR5A 4ADGA 4MWFA 5H35A 3RZCD 2LHAA 3F7YB 4M7LH 3O9WB 1DJGA 5DMJB 5TDPB 3IDYC 4LOEA 5J1AB 2P8LB 1TITA 1Z5HA 4UQCA 5AZ2H 3FQ4A 4UDUA 4A63A 1INDH 3KWUA 4PY8J 5D2LA 3ZE0B 2SEBB 1NC4B 4QF1A 4YSOA 2NY7L 4YC2C 3IDMA 1D3CA 1Z32X 4JO2H 4OZGE 5K39B 5CEYB 1TETL 5T1LA 3CVHL 4QEGA 3QARA 5IFJB 3UXFA 4ENED 4JO5A 4KXZI 5F9JA 3RDTD 1D9KA 2OYMA 1CICA 2J88H 3EO0B 2FLRT 2X89D 4YSPA 1MLBA 4P4KC 4JFQB 2HRLA 5HVHB 1A4BA 4PJIA 1OD9A 4BRJA 3L13A 4HFUL 3QRGH 3WMPA 3O11A 3WXWL 1HXMB 5IHUL 1CFNA 3BN3B 4U6VH 1CURA 4QHLA 3QR1A 5GRVL 4YBHA 3NAAL 4A2GA 4OCXH 2W5PA 3K91A 3FCSB 3QXTA 4HOWA 1ODAA 3H9SA 4JAMA 5IV2A 5HJDA 1NBZA 1VCBC 3V8OA 2V9RA 1GHFH 1XEUA 2MIZA 2P80D 2AV1B 2BIHA 2OTPA 3TYGL 2PUQT 4JFSA 3KPNA 3L1GA 2FD6L 4XHJD 4A37A 3GMMA 4PAZA 3VD3A 2BSRB 4ONGH 4H26B 1PDKA 3HCVB 1DLFH 2NY0B 1YUHA 2QFRA 4X6CA 3R06B 5L2KA 1N6QH 2J5LB 5AEAA 3EYSL 2P4AB 3IN0A 4HWBL 4NB7A 2OXGB 4WWKD 2NT0A 1CDCA 1IEAA 4ZUTA 4CMMA 1NUGA 4NO0A 1SLUA 4HXBH 3ARWA 1J1PH 3EH5B 3N43B 4E42A 5JHDA 3S36H 2YGVA 2ICWA 3B9AA 3PREA 3SQOL 3IDUA 3D05A 5ENWB 3DMMB 3S4SA 2Q9OA 3WJMA 1DBBL 3UBGA 1C7TA 3BYYA 4MJHA 3UO1H 3CC1A 1I53A 3ABKB 5B39G 3OKOA 4N2BA 1SEQH 4Z3EA 1MJ7H 1BVLB 3P3RA 2BVOA 4QLWA 4U3HA 4TSAH 4PY8I 4HKBB 4DGVL 3WE1A 2GCYB 2NNCA 1FYTD 3P73A 2WLKA 3UH8A 4ZI8A 4G2AA 2EO1A 1MG3C 5EOQH 1X7QA 4CRPA 3EGXA 2EKJA 1FRGH 2JKWA 4XMXA 1FVCB 4YHLH 4J6IA 1MPAL 4QRSA 5TDOA 1HTYA 4F9LA 2RGSA 2CRYA 3FPXA 4KUZL 3L7FA 5C09E 1CK0H 3L08A 4JKPH 3DSFL 4GYBA 3MRJB 1OQOA 2OZ4L 4HIEB 2R1XA 5E9DD 3TA3D 3C5JB 3U46A 5CEZH 3VWJD 3Q13A 3QFJD 3ABLB 5GGTH 5CLZA 3KAAA 2YEZB 4OGQC 4XOBA 3SO3C 4NN7C 1UUNA 1EWHA 4OFYD 3IJHA 1PKQB 3C2AL 2PPAA 3FRUB 2V2TA 5FUZL 1YSOA 1MJ8L 3N04A 3KWXA 4PWEA 1IM9B 3UG3A 3NZ8A 5BQDA 4PGBB 2O5NA 2BFVL 2XVLA 3FTGA 3WNKA 2AJXL 5I0WA 5I9QB 1EFXB 3L4ZA 1H19A 4UTBL 5DJZB 2OZNA 2I85A 4HSAC 7FABL 3L3DB 4S1RH 1I7ZA 2Y23A 4FERA 1D7CA 2EO9A 5DEFB 2A73A 2EYRA 1JN6A 3WFDL 5ENWA 4L8SC 4UOZA 3BP7B 3O81A 4M4RB 3U7YL 2ICWB 2CDFB 4MMZC 4NI3A 3ZY7A 3VU2A 4ODTH 1E9PB 3RY6C 5HI4D 1ZGLA 2JSFA 3FXIC 3B43A 3V0DA 2F68X 4XNYL 3BOVA 2AS5M 5EIIG 4NRZA 3HMWH 3KGTA 1A6UH 4EN3C 1EDHA 5A1AA 4NQVB 3OD3A 5KTEL 2XXCB 1EO8H 3L7FB 4QR7A 4DHLA 4LSUL 1I1YB 4RDQF 5LGYA 1I1AC 2CMRL 3LZQA 4YDVB 5AYUL 5F1NB 1DJWA 3WIIL 4Z7QB 4ZZKA 1DUZA 4DVRL 4JL1A 1TZIA 4GB9A 4A2FA 1T03L 1IE5A 3K3QA 4PJ5D 4FQCH 4L9DA 4LSQH 5GRUL 3NSFA 4Q58C 4JY5H 3MCKB 3Q2NA 4F92B 5SWQB 3BPOB 5JOFB 1QBMH 3PAVA 3US0A 1FF5A 3DK0A 4GI6A 5LG1A 1CGSH 1UFGA 3Q5YA 1U93A 3PCYA 5CP3A 1WICA 3VI3B 1NGXB 1JHLL 2OTUA 2UY6B 3BE1L 3WTUA 5C2UB 4D0BB 3MROB 2XFXA 4R2GB 5JHDD 1KXHA 1O5PA 3INUH 4ANXA 3UYOD 1A3QA 4PJAF 3ML8A 2ITDA 5DHXB 4C4UA 2ZZUT 3WIHA 1U8QB 2I5YL 2QSQA 3BDXA 4JREC 4OLYL 3SYOA 4K07A 1VKXB 2XIDA 3QI9A 3SCMD 4X80H 5GSRB 2XA3A 3IGUA 4LCUA 1EBPA 3KYOA 5J1AA 5T3XL 4R4NC 3FSVA 2NNRA 3GMMB 1ADQA 1D5ZB 2YQ3A 3DUSA 5IQ9A 3L3GA 3NTCH 5BZXA 5IB2A 1QRNB 2P24B 4K7PL 5LG6A 3T77B 3L3IB 3FTSA 4YBQC 4F7KA 5D1ZD 2R69A 3KGSA 3W2DH 3WXVL 3F00A 4EZLA 1DZBA 1D2PA 4JPQA 5DD0H 3C9NB 4W4NA 2QGCA 1ZTXL 2NX5D 4JRFA 4OZHA 1R3HB 5TQ0L 3KHOA 2VSCA 2CA4A 3BP6A 1CE1L 3HUJE 2VLKB 2VLRA 2X9XA 3OGCB 3A6OA 4JHWH 2WPGA 3DARA 5DDHB 4YHYC 3R4DA 2BRQA 3CZNA 4DP4X 1G6RA 3GBLA 2QEJA 3CZGA 2VDRH 5D1QD 4L1TA 2K7QA 4XE5B 3IPEA 1AR1D 4HWZB 1BQLL 2PYFA 2X28A 1RZFL 4TNVF 5D7IA 1T1XA 5AYTA 1G7IB 3V7AE 3U0WH 4L9LB 4JQVC 4JK0D 3QZBA 2QSCH 2OW7A 1A1MB 3UBHA 3HI6L 2WCPA 3HUJF 3F7QA 1K3IA 4XBPB 4OV5A 2OSLA 3AWFA 1CXIA 3V4PL 2A74A 5EMYA 5EZPA 2NNAB 1NMBH 4TSBL 1A65A 4J4PC 5SWSB 3U36B 1A7PH 4QRRB 1NFDE 1EHLL 3NFSH 2QQKH 3ZHKA 2A6IA 1FNEB 5C7XH 2WNKA 1G1YA 3Q5TA 2J8HA 2HUEA 2X7LA 4A7GA 4D2NA 2GK0B 1DQTA 1OGAD 2KT6A 1AYOA 4IHOB 4JFZH 3QNFA 1U36A 4UU9B 3SYAA 1U8HB 3PWNB 1AGFA 4IRSA 4Y5XC 4MAYC 5T3ZD 1M1SA 1YA5A 1KCBA 1PNCA 1YMHA 4ZPTB 2J5WA 2EO7A 5AVRB 3AT8A 1FNGA 4AVKA 4K94L 5EO1A 5CWSA 1RJLA 5JPNA 3S3BB 1BIIB 1ZSDB 5K1NA 3BAEL 1ACCA 2VLKD 4TUOB 3WKML 1J18A 1AGDA 4HG4K 3V52H 1YNTA 4WJKB 4FXTA 3PPSA 4J39A 2J43A 1AGCB 4AL8H 4HPOL 4WZ9A 2FX7L 3CH8A 3GNMH 5FYKL 5C0GB 4M48H 3HPJB 3BVNB 3LKOB 3GRWH 5C8JA 4P04A 2ZTBA 3N1FC 4HJGA 5T1LD 1CL7I 3I74A 4IRZH 4O2CA 5HDBB 3X1FA 5E03A 2WYIA 1CFBA 3Q6FA 4X6DB 4P2OA 4S1DC 1WAAE 3K5RA 4ZOCA 4M5YL 2Z6FA 2H6PB 3ZTCC 1JN6B 1O75A 3WJJA 5KANG 4H4NA 1DQIA 4DAGH 1JZ8A 2WXGA 2DQCL 1QTPA 4JFED 4AQZA 1MCFA 5FPIA 3MX0B 1MHPH 1Z2KA 2G30A 4HJ0C 3TCTA 1BBJA 5HHOE 2ZCZA 1HH6A 3AG1B 4M93C 3FQYA 1GJIA 4NHCH 2EUXA 5E95B 1SXBA 3WJLC 2XG4A 1EA9C 2WXOA 3A47A 1UD3A 1SHSA 5GGQL 1HYSC 2NMSA 2R69H 2IALA 4HWEH 3G6DH 1CLOL 4M8RA 4R4BB 4ODWA 1NFIB 1O7DE 1R6VA 2X0WA 3MUGB 5C9KA 5CM1A 3MNZA 2ZF8A 5EEWA 1XGUA 3WN5A 1KY7A 4HKZA 4PY7A 4F15C 4F2FA 4EXKA 3RWFB 4YSAA 5C3TA 4BFIB 1N59B 2B4CL 2DEWX 2F7QA 3QIUD 3QUKA 4HPHA 1VFOA 3N3EA 4OY9A 4PRBA 1T7ZA 2BM3A 2FL5B 1M7IB 5AWNH 5HYIA 1OCZB 3MZTA 2CK2A 1JTPA 3GT6A 1MY7A 2VXTH 1BD2B 3H3PH 4JRXD 4U1SA 4MVBC 3ZMNA 2ICEA 3MUHL 4RGNE 4YE4L 3PQYD 2WWMD 4DGIL 3KXFB 4G42A 2H2SC 2WQ8A 2EDRA 5K1JA 5L88H 2I07B 1A6ZA 2NCEA 2D3NA 2J56A 3B4NA 1VFBA 1MAJA 4HAFA 4R5VA 4Y19A 3SYPA 4JANA 3ZYJA 3DGGA 3QZWG 2G60L 4WUUD 4G11A 2WZPD 4JFEA 1LEIB 3WJMB 2CJSA 2G60H 3MRKB 1C5BL 4LCYA 2EUZA 4TQ8A 2OL3B 4V1DE 1Y0LA 3W3BA 1JMXA 1D6EB 5I19H 1JHTB 3D48R 1NKOA 1IEAB 4DAGL 1T0OA 5C0RH 2RQ8A 2IV9A 3CBJB 4KZDL 4G7RB 2P5WB 4M5YH 4N1HB 4XNZC 2AC0A 2VLJA 3V4VL 3H3PL 3L81A 2DBLL 3S5LA 2F9BT 5E8NB 1M6OB 2YQGA 2BHUA 4LSRL 2IO5A 1YNLL 4M5SA 3VRLE 2DLTA 4L4TB 3ZTNL 3IJEA 2K3HA 3P30H 3NABL 5I1EH 1MWOA 5GIRA 5D7IF 3OAYH 1R17A 4WI2A 1SJVA 2DEXX 2CDGB 5CINH 3RUGF 2VDNH 3MA9H 1WGVA 4G5AA 4WU7A 5FYLD 1F58L 3BUIA 2QBWA 2OR9H 1NICA 4MQ7A 4FFTA 1OTUC 4X6EB 5F88A 3UTZB 3SDCD 1MF2H 4RVBA 1Z9SA 4YK4C 3V6OC 4ZMVA 4EN3D 2NR6A 4JUTA 5B21A 3GUTA 5JHAA 3LIUA 4ZG1A 4N4YB 2NW2B 2WBJC 2YXVA 5DVKA 5IVZA 3K6DA 4JG9A 4OZHF 4Q2ZA 1N70A 5EO0B 4P8QA 1UUSA 2PO6C 3BH8B 5DLLA 1Q90A 4TOYH 4DO4A 4YXLL 3NP3A 3EADA 1X6LA 2X4TA 2CBTA 5IJCC 4NYLB 1KFAH 1LWRA 3N40P 5LJYH 3B7RL 3IXTB 2MFNA 2DQCH 2NTFA 4QF1B 5DZNA 2HYMA 3L4VA 4BDVB 1MW3A 2DQTH 3NA4A 2JXMB 5FCUH 4AOFA 3ARBD 2R9HC 3DUUA 3B2XA 4PJ8B 5C08A 5ID1B 4BSWA 4I9XA 4FAAB 3QUML 2V3EA 4NBXB 5FAAA 4G8AC 1ZGLP 4L8SA 1QOKA 2PN5A 3B56A 4NP4H 4ISVB 4BKLA 1G7PA 1YYCA 3ASOB 4GIPD 4OH2A 5SX4H 43C9A 5ESVB 3C6EA 1AC6A 3ZQXA 3F12B 1FFPB 5CR1A 3D6GA 4N6RB 1NANH 2I9LA 1BD2E 5D5MB 4X5QA 2XLLA 5I6KA 2EIZB 2X4QA 4Y8AA 4WUKH 3O41A 3V7MA 3C5XA 3Q01A 3KXFE 4Y5VB 3BWUF 4CADB 4XPTL 2FATH 2DJ4A 3BAKA 2WLIA 5F89B 4AG4L 3MFFB 1JD7A 3K72A 2XWCA 3RWIA 3AS1A 1MRDL 3VXOA 5E08L 4WI4A 1NGQH 2OR8A 3D69A 3AS3A 4AITA 4NQDA 1V27A 2CKBA 5IFAL 2Y25A 3JBG7 4XCYB 4QY8B 2FJHA 1UVQB 3GJFB 2G0KA 1DN2A 1RL1A 4N26A 4MD0B 3C8HA 4DVBB 1SY6A 5D1XA 1GL4B 1NEZG 3WS6C 3OKDB 3ULUE 3S35X 4NRYA 4AMKH 1HVXA 4RISL 3VD5A 1YMME 4PCTA 4KXAA 2DI9A 1QLRA 2YSSB 2WBJB 5FO7B 5E9DB 1HSAA 5AW4B 2YPLB 5CIPH 4GRLC 3RVVC 2VM4A 5KVDH 4BKSC 1WK0A 2G3MA 5DEGB 3ZTDC 1RSYA 4G6MH 2AVFA 5KSBA 1NIDA 2L0DA 4AXWA 1MI5A 3D3VD 4JQVA 4PJFB 4BDVA 3KYNA 4OZIA 4YHPA 3JXAA 1UD6A 1SFDA 5T1KA 2J25A 5LGJA 2IANB 1NMCB 5T5NG 5FB8B 1X4YA 3H9YA 2BP0B 4EI5C 3ZE0F 3PS6A 3BFOA 1GTFA 5CZVL 2P26A 3DVIA 2XWBB 4GP8B 3ILEA 4HEME 2E9BA 5I6MA 1Y6KR 1W16A 4EKXA 1WIOA 2QVMA 3FC8A 4XXCC 3SE8L 3EHBB 1RUMH 1ZHNA 1A3RH 2XZCL 5I8CA 3UTTA 4DKAA 2CXKA 4FQIL 2WKGA 4Y16A 5JMRA 5I1LB 1K85A 5AWNL 4R7DB 4UOW0 3C5ZC 4HLZG 2ROYA 4PVNA 3IMBA 5KJ7E 2Q76A 5GIRB 1IAII 4JO4L 1Q4NX 1RUKL 4TS6A 3T2NH 4KY2A 3P9MA 4O02L 1RH8A 2UWEF 4Z7NF 1R5VA 5C0AE 4PCYA 4W9KC 1B3JA 1Q0XL 2OMWB 1T1WA 2YD8A 1OW0C 2NY3B 3PAZA 2HT4D 2IWFA 1NCDL 3H4HA 1NFDB 3HZMA 1JL8A 2PPCA 2OL3A 4PTUA 3BQUB 2FJUB 4X5WB 4LCYB 5IHBA 3TCXA 1I8KB 2DI7A 4RFNC 5D93C 3T0EA 2HLEB 2Q8AH 3OAUL 3L4WA 4GLRI 4W9FC 3OAZH 3TH2T 4XRCB 1XMEB 2R2HA 4LGPB 1JRHH 1J0JA 2R23B 3QQDB 3QIBC 2JK5A 1GZHA 2JB6A 4RSYA 1I8LA 3ZBMA 4LCIH 4JGUA 2H6OA 4OIAA 2HJKB 3LKQA 5LAXA 4JQIH 5M95B 1TVBB 3IT8D 1JNNH 1L0PA 1FVDA 4QDGA 3TURA 3OF6A 1CK0L 1VADB 1JK9A 4Q4IA 2AQRA 2Y3AA 3CQFA 1A7RH 3MV9E 3DYPA 3FQ2A 2A4ZA 4X7TA 4G6FD 4DQAA 1XGUB 2LW3A 3B9EA 2NXZB 4X7SH 1NEUA 1OB1A 3WFCL 4N20A 2HCZX 4XCNA 4K8RH 2YN5A 3TWCH 5EBWB 2XQYA 1MJ7L 1Y1UA 1FYTE 2ZOLB 3V6BR 3IJSA 1JZEA 3NFPA 5GZNA 5JIKA 5MEND 2X2UA 4P9ML 2AJXH 5E5MA 3GSQB 3VXPA 2OMYB 3V0VB 3HRZA 3KCWA 3QAZB 1TSHA 3WG7B 3FB5B 5HDWA 1MWAB 3JV4B 2WO4A 3F65A 2BNRA 1KWGA 4TRPL 3PL6C 3SDXB 3QW9A 1AS8A 2X4NB 3FHQA 2Q0ZX 3QEHA 1R24A 3U9PH 1GPOL 3IXAA 5I1CL 1W6LA 4LSTL 5D7JB 3IMTA 2DL2A 4WWNA 5ILTL 1LDPH 4P2RA 2BP8A 2E27L 4DOHB 3N5AA 4DP8X 1D6VH 1TG8A 4MMXC 5SV4A 2H32B 4HGKC 1GZHC 1S8DA 2IPKB 2WXKA 4LNVA 4M56A 1C1EL 2Z64C 3KYKL 4OFYA 4DKFL 4TULL 5BW7C 5D1QA 5JLZA 2Z8RA 4OD1H 2W0PA 3TIDB 1Q8MA 2NUPA 5J1TC 1OY3B 1JGIA 2ZG1A 2MEJB 1MN4A 4PD4J 4OF8A 5H35B 3O4LB 3CFCH 2EH8H 1SYVB 1OCCB 4QRRD 1AE6L 1P1ZB 2H26B 3UBXG 1AGDB 4IBWA 2D7NA 3CK0L 1KY6A 4HLJA 1F5WA 1P4BH 1CFVL 1QFUL 1AIFA 5EO9A 3OPUA 1L9QA 4MASA 3QP3A 5DU7A 4DZBB 3B2DC 1F6FB 1OSZA 5ESAB 3I6LE 5BV7L 2W1NA 2VL5B 3LPWA 5FYLE 1I7RA 2ADIB 4MCYB 4PGDA 5D71H 5DRXA 5BV7C 2O6FA 4AM0Q 1H6FA 3VQMA 2FECL 2PXYB 4OF7A 4DZBA 5JYLA 4OGYL 5J06A 1P7BA 1GR7A 3MRDB 2EECA 2A74C 3LSOA 4JO2L 5FW8A 2D4DA 4N8VG 1IRAY 3W1ZA 3GS0A 4QJ5B 5DD0L 3H0TB 3VFMB 5T5FH 5IVOA 3PDOA 3SE4A 5I8KL 4EBQH 3LNDA 2APVA 3KPOA 3OXSB 4TM9A 3C60D 4Y9EA 1IGJB 4JZOB 1PZUB 1JPST 4RDBA 1IJNA 3LH2L 1KCLA 4PIBA 4LSUH 4I9WE 2KZBA 2WANA 1JGUL 5EPMB 5FYKU 5KTEH 2R1YA 5JO5A 3CDZB 4PJDA 1IVLA 3AQZA 1QSFB 4KJWD 2B59B 3IGAA 3A4AA 3PXHA 2ADGB 4NQSB 1DVFD 5C0BB 3VYOA 4YXHL 3GJFH 3RQ3A 3RUGA 1JUFB 3HNTH 3QGVA 2X6BA 3IETB 4QRQB 5BUGA 2VLME 3MLTB 2YD6A 3TBBA 4DN3H 1HZKA 1AHWA 1L6XA 1HOEA 3QRGL 4GSRA 5DCCA 1KTRL 3JV0A 3SYQA 2NTFB 2WINB 1QPPA 3ARED 5L0QC 4GXUM 1OP9A 5ESAA 1OSZB 3OJ2C 4QAMB 5CIPB 1C08B 3VA2C 4S2SA 2FQFA 4YAQB 3A67H 4PP2B 3MLRH 5E6IC 3WNJA 3HNVL 1JTOA 2EIBA 5C70A 1S9WB 3QFDB 4Y5XB 3CU7A 5E8DL 1FPTL 4P5RA 4H0LC 2F5BH 3I6KA 5AZ2L 1T7XA 1OAZH 4JPWH 2H7WA 3BP5A 1AMXA 2BK8A 1SBBA 4P57A 1F90H 2C8NA 4ZAKB 4YMPA 1KB5H 5L8JB 1U8NB 3FUMA 5IKCA 1BOGB 1TVBA 4BQ6A 4WDIA 4WJ5B 4X42A 2H32A 1J7VR 4P5MA 4Q9QL 1P4IL 1CD1B 1WZLA 3MA7B 1FSKB 1QKZH 2G0LA 4OJCA 5T3ZL 5KYXB 1I82A 1TOXA 3MRGB 4K23L 4AYDC 1MCWW 1V7NL 3LHAA 3SGEH 3JUYA 2CUAA 2UY6A 3R7QA 4HH9A 4X5WA 3BVXA 3E6FB 3FO1B 1HL8A 2HN7A 3P4NB 4G9FD 3VWJC 3M1BB 3WNLA 3C6SB 4KTDH 5GRZA 4YXKH 3O3DA 1G9ML 5CF3A 1M7DB 4HIQA 2GHZA 5D4HA 5I6PA 2BHFA 2YA1A 5CR8A 1UD4A 3DO7B 5I76B 1A6ZB 8CGTA 1OVZA 4GFXA 4Y2OA 4AQ8C 2YPLE 2BSSA 2GK2A 3BPOC 4PRID 4UV7H 5TK2A 3PABB 3R1GH 1CF8L 4G3YL 4MA7H 3VXNB 3QULB 3GIVA 4B53A 4HUWA 4JN2A 4X9HA 1KLGB 2WGNB 5F9WC 2O93L 3GSWB 1FVDB 3K1KC 4AGQA 4JFFA 5C6PB 4R7VA 1MCJA 4PVMA 4O4YL 4K5PA 5ISZA 5SWZE 1PIGA 1ZHNB 3N2JA 3VXRB 4OJYA 2P8PB 3OJVC 4XCCL 4OAWB 3WY4A 1PFCA 1SMAA 4HIPA 4X9IA 1JCVA 2ATPB 2FBJL 2P1YA 5BUAA 3EJYD 3FT3B 1T21B 1U3NA 3ARFC 3FFDA 5ESQB 3WO4C 4TSAL 2FWOA 3ZDWA 4ZX6A 2QGDA 3UDWC 3LZFL 2YKKA 2GFBA 3N0PB 3N43F 3FCTA 2BP0A 3GSOB 3FO9A 4GXUN 4KTDL 1A6AA 4WI8A 4J3UA 4R8WL 2WZPA 2EIMB 3O6LL 4HQQL 2OLDA 1XCWA 3BAXA 1LWHA 5SWZB 4I89A 2FX8H 3LZLA 5HGHA 3OKLB 5DYOB 4ADJA 4FHJA 1A9BB 2V2XA 5DHDA 4M61B 1RD6A 2JB5H 5KSBB 2IPUG 4UILL 3UG5A 3P9LB 3BEVA 5JQHC 3NYKA 3B9KA 4X8XA 5IQMA 1JZGA 4ES9A 3K2UL 2DJSA 4JHVA 3WUWA 4OLVH 2H9GA 4ZSOB 1RK0A 1A4AA 3QQ3B 4QRUB 2A4CA 1NGWB 4KKZA 3EDFA 5HDBE 1LD9B 3PWUB 4PJEB 4ALAC 2EADA 2R8SH 5JPMC 2Z0UA 4ZZFA 3UTTB 4HD5A 4NN7B 4F8TA 4EAEA 1KN2H 1Q38A 5C0GA 2F5BL 1A6PA 3SGJC 4AV5A 4FN0A 4UBDC 1JRHL 3LEXA 3NCJH 3SBQA 1JZ3A 4GUQA 1TDQA 5E8DH 1IMHC 1MFEH 2MPVA 3O8XB 3HUJA 1MVYA 2QTEA 1AKJD 2G5BA 5DTFB 3QUMA 4YL9A 1R34A 2YLKA 1SEBA 4EKJA 4XMPH 3L17A 1DYZA 3ARDB 3QUGA 4HCRL 4D3CH 4KJYB 3DIDA 1I1AD 4Y2NA 3JTSB 4FJ6A 4H20L 4XPHL 2LE9A 1CTMA 4K0OA 3O41B 3HPLB 2MRYA 2HWZL 3KPRA 2C3WA 4PSPA 3TF4A 3PL6D 4K23H 4B7IA 5HYJE 2D2OA 4NO0B 5F0JB 3S4SG 3BI9X 1XIWC 2APFA 3MOBL 2XFGB 4YNYA 1FNEA 1RZJL 2VUKA 1INDL 4X99B 3QDGE 1PJWA 4G9DB 7CGTA 1L7TL 1EGJA 5D6CA 1XF3B 2X05A 2PWDA 3K8MA 4NQEA 4PEEA 3VFRB 3C6LA 1KGJA 4GG8A 1RZ7L 4BFKA 1AG6A 3N1PC 2V17H 3JV5A 4WFGE 5I8KH 4MXVE 3BAIA 2LOEA 1PAMA 2PYFB 3L4UA 1G87A 4XX5A 3PLYA 4I1RA 2XETA 4BWUA 1UJ3A 1F1AA 2NSQA 3NMEA 2QR0A 3US9A 1FNSL 1M05B 1TLKA 4OFKA 2A6DA 1MLBB 2IMNA 4LSSH 2YAQA 4WHTB 4Y8DC 3EH2A 1EZVY 3FB8A 4WV1C 3ZGHA 5F9JB 3RA7H 2Z31C 3U7WL 1EO5A 3G6AA 3EFFA 2WLHA 5ADPH 3FUHA 5CCHE 4YHOL 3Q06A 5DJ8B 4HEPG 2NXYD 4L29B 1H6TA 2ZP9A 1U21A 3MLSH 3CK0H 5I71B 2UZYB 4UT9A 2WWOA 2N4IA 1U8CB 5E8PA 3SKNB 1CBVL 2CXGA 3MRIB 4XZ4A 3I6SA 2ATKB 3V5DA 2FBRA 4M6NH 3CVBA 2WVVA 1Y6NR 3V2AR 4MYWB 4AX3A 3QJUB 4MAUH 2UXFA 1O6SA 4Z7UB 1Y1DA 1BBDH 2WXFA 4UQ2B 5I6LA 2L7UA 4PYHA 2AJSL 4FYSA 3HHRB 4Q14A 2VH5L 4NQDD 3VMOA 2EVIA 3T4YB 2ATKA 3C5SA 5GS0L 4G8EA 1AO7D 1CXFA 2Q10A 3RWJB 4Y1TA 2OS7A 1HHGB 3LJ3A 1JGDA 4Z7WA 4HIHA 4M6MH 4TUJB 4H8WC 4TKWA 4KGLA 5AVTB 3ZOAA 4L3CB 3QPQD 2H8PB 3AQYA 3RNKB 1QWNA 4NO5A 5IJVB 2X89A 2LGNA 2QKIB 4R97B 1T7YA 4JANB 5T3XD 2GC7C 4HQQH 4RRPA 4FLHA 1M05A 4F58L 4AC4A 2WIIA 3PF2A 4MA3B 4RGNC 3F83A 1ECYA 5MEPB 4KRPC 3JZ7A 2OMTB 3VDBA 2XT1B 1QYGH 3QUYA 2ICEB 4N68A 1BAFH 1HZHL 3DX7A 3QEGH 4HUUB 1OE2A 2ZICA 1PG7L 4XP5L 5CJOL 5KW9H 4J8RB 2ZKYA 4UF7C 3POCA 2AP2A 2MKLC 3CDCA 3PDGA 4K5MA 1GGTA 2Q7YB 3L5JA 3LKSA 5D7LD 2A6KB 2X4SA 2KZKA 1AIZA 1EJ8A 3BP4A 1YLBB 3NEEA 4PRNA 2ZCLL 4M1CC 5CJBA 5EU6A 2A9NL 4X6DE 5JIHA 3G5YB 4WWKB 1X9UA 2DMCA 2ZKMX 5D93B 3PP3H 1N5YL 2J57A 4FKEA 5H37G 1X44A 2JFCA 3GI9H 4WK0B 1ERNA 1R3JB 1DQJA 3N0AA 4M7ZB 4DEPC 3IRPX 2GSIA 5KYNA 3E8UH 1LDPL 4HX1A 4DK3A 1BG9A 1SN5A 3FFOA 3UO8B 1JRHI 5CFAA 1U95B 2Z8VC 3QYCA 1DQQA 3O2VL 5I5MA 4K3JH 4A6YL 1MFUA 3FB6B 4MCNA 3VVWA 3QQNA 4NO2A 2IPTL 4UTBA 2A9CA 4PGZA 4PJCE 1KOAA 1A7NH 2KUTA 5E94B 1QVOA 1XSIA 3AAZB 3WFHA 2VDMB 4P23C 4U3XA 5ELIA 5EIQA 3C6LD 3WHXB 1Q0XH 5F2FA 4J2XA 2AW2A 5GS2D 5BS0A 3RPIA 1E7UA 1U2HA 2IF7A 1K8DB 1QA9A 3UAJD 3VGFA 1M56B 5C3IA 2Z31B 1UXWB 3D0VA 5FOBA 2AV7A 4JO4H 2WIMA 3ZQWA 3AFLA 2MWCA 3PGCA 1MCBA 3FTWA 3I3DA 2EICA 4XXDA 4NERA 4ELME 4ENZA 4FLRA 3UTTE 1KYDA 1YNTB 5AAMA 3OKEB 1HQ4A 4FFVD 4Z78B 4FI8A 2PP8A 2DWYA 2NUTB 4HUXA 5JPNC 1DVQA 4FYRA 4MS8C 1PVHA 3ILPA 1A4CA 4AT6A 4HHAB 1DBAH 4FNLL 3T0AA 1GMEA 3VI4E 1PD1A 4URTB 2D0FA 4DGYL 2EZ0C 3SPGA 2CHXA 5CJXA 2IQ9H 2HKFL 5DMYA 5HGGS 2BVOB 3AQXA 1KUMA 3U4EA 5DUML 5AW7B 5AZUA 4JRYB 4IQHA 4WW2C 2X1XR 3E6FA 5CEZD 3GHPA 3KPTA 2GAZB 3RY5A 1KIUB 1FL5A 4MFHA 4JZJC 5IR1B 4JGNA 2H6PA 3JUZA 3FT3A 4MJIB 3O6FD 4ZO8A 2X0UA 4A2MA 1ASOA 4MHHG 5GSVB 4HJ0D 2N7BA 3RX7A 3UFIA 3SN6N 4HIIB 2AXGA 2R83A 1PLBA 3HLKA 3IU3B 1LO0L 2ZCHL 2R7EB 2EC9U 1CQYA 4AEHL 1FC2D 3BVNA 1HHHA 3LKOA 5C8JB 3FK3A 1YEIL 2Q7YA 1FO0H 3WTXA 4JKLA 2XVGA 1V10A 1BSIA 3ULVD 5BRZA 4L3EB 4G83A 2E7MA 4JDVB 1PX3A 1RULL 5IV2B 4GQZA 1KBBA 3T71A 5KVGL 1MIEL 5I76A 1IGFL 2EKSA 1KYAA 3BSZH 3GZQA 1YEEL 5A16B 1MCHA 4XO3A 1CYGA 3E1F1 5JPMB 2WLZA 3MU3A 4J3VA 1URZA 2VLRB 2YN3A 5SX5K 2WMPA 3QO0B 4HD9A 4JPSA 3M1BA 5DA0B 3BKYH 2WXIA 2CK0L 4XBGB 2NW3A 4I18B 4JFVA 5F9WB 2C7FA 5DFVC 4YE0A 5D2NC 1DQDL 1P4BL 2K3TA 2Q8BH 4NKIH 4XI5D 1ITBB 1CU4L 3I2CL 2ID5A 4Z7UF 3WOVA 2O5XL 1SLWA 1TPXB 4NP4L 2YRLA 2HMID 3NJIA 4NQED 4KKAD 3CC5A 1GSKA 1Q9WB 2X40A 4ZFZA 1U8NA 5IKCB 1SHWA 2WOYA 5DVOA 2GTZA 2VIRB 2W81C 4PWJA 1LO5B 4L3EE 3MJ9H 5JMOC 3EJZD 3HS8A 5SX5H 4TLTA 4XBEL 3WNPA 3UACA 1RZKH 1BZ7A 3AQDA 1RP8A 2FDBP 3MGTA 1R0AL 4WRLA 5DDHA 1RV6X 5EU7C 3OGCA 3LYRA 2ZYSA 3HMXH 4HA1A 4P2RD 3BP6B 5ANMA 1WVZA 1DDHB 2WQUA 2WXHA 2W38A 4J28A 5E2WH 4P2QD 3ZDXB 3O6MH 3QC5X 4AEFA 3D9AL 3WMSA 1KPRA 1QLFA 1BPLB 1YYMH 1A7OL 2J8OA 1YDPA 4N0RA 1YECL 3X13B 4N5EC 4EJ1C 2OMUA 3DUHA 1I3RA 4JDVA 2YGQA 5DMIL 2YD1A 5HPMB 1KGCD 1FGVL 2I7OA 4DK5A 1JZFA 3C5ZA 3MQIA 1WZMA 3S35L 1Z5YD 3IFNL 2PP9A 4TTDD 1IEBB 5HHQB 3IFNH 4Z0XA 3VWJB 3HC4H 2EQDA 3VG0H 1S9XB 2GYSA 3K7UA 4AVHA 3U0WL 4BCZA 3OKMA 3IKCB 5DHMC 4CMHB 1XD0A 3UAJA 3WGVB 1E8WA 2H32H 1S6NA 4G59C 3VQLA 4LEEA 3WGUB 2NY5H 5TFSH 4M7KH 3KWVA 1IGYA 1BHGA 3FU7A 2A83B 1IE4A 2MPAL 3QIWB 3RKPA 4R2GC 5E4EC 3BWZA 1EEZB 4AM0B 1ZA6A 3F7RA 3L3DA 3EBHA 3OAUH 4LVNC 2Z8WC 3OAYK 5T3XE 5IHLB 3H54A 3HMXL 1A64A 3VD4A 2YXFA 4NUMA 1G4MA 4UZSA 3N42F 2ZSWA 4FNUA 5T1JA 3CMGA 2IADB 2FQDA 2M26A 3VTAA 1X5YA 1Z66A 2MKWA 2CLZB 1WC7B 5LBVA 4BKTC 3ARGA 1FUNA 3TPUB 4JM4L 3LEXB 1WFIA 5JOPE 4WI6A 4ZMOA 2HFEA 5J7CC 4NJ9L 2NYYC 1ZTXE 3ARGC 4N3TA 2NUTA 3L1FA 4KX8A 3P4OA 1NFDF 3EFOA 3QK0A 1R3LB 2QPSA 5GXBB 2VDNL 1CICC 4UV4H 1U3HA 2K7PA 4OQTH 5F3HB 3A6BH 4NZJA 4Y0GA 2ESVE 1TYJA 4M03A 3DXAA 5C0DA 3T2NL 3KJ4B 3L6FA 2OJ1A 4ZSOA 1SF5A 3BD3A 5CN2A 2AV7B 1WZ1L 2O5YH 1MNUL 5TTRA 2NY5C 4KITB 3NP4A 1AR1B 3EGXB 5EU7E 3VWKB 3P73B 3CPLA 1QSEB 4FLOA 3SKUD 1RIUH 1XB6A 3BLKA 3I6GA 2X4UB 4NQQA 4B9ZA 1J5DA 2ZXCA 2JK5B 2X87A 3MR9B 4IGBC 5JXAL 4LQ1A 1SYSA 1CLOH 1NANI 3UTQB 4TQEH 4LCWB 4HWEL 3VYPA 4M62L 5KYYA 1RUPL 3IBOA 1DVTA 3SBWC 1AHWC 2V6HA 2QQLL 4KNUA 4FQCL 4LF3A 4KXCA 4YGVB 3TGXA 4LGRB 1PS3A 3WELA 4D0DB 3OZ9L 2ZOLA 1QTYT 1UEYA 2HT3D 4XNXH 1NCHA 1TR7A 3MUUA 1UT9A 1W72B 4M9OA 1FAKT 3SGEI 1GGIL 1K72A 4WSKA 1NLDH 4ZODA 5I30H 1EQWA 1YQVH 1BM7A 1FH5L 1X4ZA 3BJLA 2WYZA 3EJPA 1EO8L 1IV8A 3K2IA 3OJDB 2VDLB 4FG6C 3VXQB 5KSAB 4IMLA 4FCAA 5DQJA 4U0RC 2HX9A 3SCMB 4NDMB 4CKVX 1EXGA 3DKHA 3LZOA 3S88H 5KZCB 2K1MA 1JHKH 1H15A 3SDXF 2K6YA 1WS7A 1Z6JT 4WKZB 2W9DL 4HPOH 5FYKH 3Q8AA 3ZRFC 1NEZA 2EEXA 3OR7A 5B38G 4LVOC 3QUYB 3EFDL 4WIQA 4Y2DD 3DGDA 4KHXL 2OYPA 5MEPA 1KJVB 2R2BA 4F91B 1U58B 1B2WH 2JE8A 1R47A 5DK3A 4IOFD 1MJUH 1W72L 2W95A 1N0XL 4JFQA 2XICA 1XH2A 2QKIA 3MLVL 1D9KB 5LCVA 4E41B 1F2QA 2XWZA 1Q9LA 3QJFB 2DKMA 3HZYB 5EEYA 5HY9A 1BP3B 4NAJA 3KLSA 5AOLA 4GRMA 1TQUA 5E70A 3T04D 2YUWA 2FR4A 1TFPA 3FQUB 5KS9A 3JV6B 4LKCB 3D7PA 2JCCA 2R0ZH 3HMXA 5L7XL 1WA1X 1A14L 3L5XH 1MI5B 2ENSA 4A67A 1LMKA 3KEHA 4GAAA 5DZAA 1ET8A 2CH8A 1K5NA 4JPIB 2J5LC 5IW1A 1BA9A 4P5TB 2VAAB 3CJJA 1ZJBA 4OM0L 3U9WA 1WWAX 2APBA 4YR6B 3BZ4B 2Q76B 4ZOBA 3UP1A 3ZMEA 4ERSL 5ALBL 2ZXDA 5CZXD 2Y7OA 1FRGL 4NUJA 4W9DC 2JCWA 2OSYA 2OCFD 1U8CA 4ONFL 1W80A 1RZFH 4MXQD 2F7PA 2RCSH 4JE0A 5A43C 3MBXL 4UT9L 1LQBC 1T1ZB 4MNQD 4RMVA 2JJTC 4PI0A 2E7CA 3KW8A 3W5NA 3D07A 2PTVA 4ODXB 1AZZC 5H94B 1P5UB 2EACA 3BKCH 5ICYA 1P6FA 3F5WB 4QY8A 4OUUA 5D4JA 1E28A 4NUPA 3H53A 4OFQA 4LOUC 1HOCA 1INQA 3ZDXF 3SODB 4IIQA 3BZEA 4JCWA 3CMOL 2QR0B 2X6MA 4O9HH 1CE1H 1JZ5A 3MRMB 2VKXA 5FYJH 5E1IA 1RMFL 2QADD 3RB7A 5EC2B 3HEIB 1IBGH 2IH3B 1FC1A 2APWA 1K8IA 3RU8L 1KLFB 1NPJA 4U49A 4LP8A 1NCJA 4KPHL 5TQ2H 3RHWF 2K6ZA 4O58L 4UDUB 1MWAH 1S7VB 1VDGA 3EYQD 2FJGA 3FH5A 1RUAL 4RGOH 5C09B 3LRHA 3II1A 5E0QA 2P8LA 2YMXH 5EPMA 4HOMA 4PJFE 1LO2H 2EDEA 1GRWA 1WZAA 2CCVA 3VWJA 1ROWA 3I9GL 5A2KH 2DLFL 5E9DA 5C0BE 43CAB 4DCQA 3FHAA 3ET9F 2P52A 1JPEA 1A8JH 2VC2L 3AWGA 4C83A 3B6SA 3AM8C 4YNYB 2Q3XA 1IX2A 3CDGA 5TDNB 2NY3C 4MDJB 3M1OA 4EI5D 3IMVA 4ODVH 4QTIH 2N0MA 1DQDH 5CO1A 1NOAA 2DMBA 1MOEA 3CBKB 4AI7A 5CLWA 1A8ZA 4FXGB 4LSSL 2XU9A 4PI2A 1X9LA 1G7LA 3MRLA 4GLRH 1CGYA 2VITA 1RUQL 5KBMA 3VACA 5I75C 4UNIA 2XWTA 1D5BB 1SQMA 1SPDA 4OLZL 2RTTA 1MCRA 2XWEA 3ESMA 3Q8FA 1JWSA 1VACA 1YPZA 1INQB 2CO6B 4OGZA 3QDJA 4ODUB 5GGTA 5C0FA 2ZSVA 4EN3B 3WAJA 1XBRA 1HKLL 5AAPA 1FP5A 1U8IA 3PFUA 2C7UA 2Q2EB 4OTXL 5INDB 4ANWA 4FABL 2EE0A 4QRPA 2EXWD 3IDXL 4EDWL 4A6YA 4BK8A 2FE0A 3QJZA 1ZV9A 1LD9A 1QX1A 1H0DA 3F12A 2VO8A 3OBAA 3IMSA 5AB2A 3BQUC 4ZFZB 4YPJA 3AG2B 3QFJE 2Z7YA 3LB6D 4XAWH 2NY4B 5GHWH 3IFOA 2JQZA 1KYUA 4FZ8L 4RESB 2Y1AA 1AXTL 2X5PA 1UCBH 2XQBH 4WWOA 4MRBA 5E0FA 5I1AB 1DZ0A 1GOGA 1HDMA 1JF1A 4TUUA 5E8NA 4GKNA 2PCYA 4Q9BA 3BAJA 4I18C 4HGMA 4DN4H 5E24E 5EUOB 2P5WA 1JGVH 3MV11 3FZUC 15C8H 2XBDA 1CTOA 2CUHA 1MCPL 3IGKA 2ARJB 4G43B 5E99H 4WW2B 2X3BA 3GSUB 1E5YA 2GSGA 4P5SA 4YO0A 1MELA 1XF5B 4LKXB 2DN7A 1OLZA 5F1SA 2DWEA 2X2IA 2EDXA 2Y22A 1KTDA 2BFVH 5FX3A 4UI2A 4JY5L 4K73A 4OBSA 3DVFA 2GJ6E 4EPSA 4HF5L 1NCUA 2ICES 1T6WA 5C9JA 3P4MA 2IC2A 4ES8A 3GKWH 4XXWA 1MY5A 4LXFA 4OAWA 2B1AH 1H3PL 3ZT5A 3GC3A 1Z9SB 1H8SA 5DQ9B 4B41A 3EYOB 1CTNA 1BVZA 2IQAA 3MV9A 2PO6A 1SN2A 5IGXH 1JVKA 2WVUA 5IOPA 2GEEA 4JFHE 3LKRB 4WTXA 2FL5A 2ZWSA 4LSVL 2JELH 4GRWH 4N24A 1I7TB 1ZT7B 1MPAH 2MQCA 4ZMAT 4JNXA 3T09A 2EYTB 4IIZA 1E3XA 3EBAA 3QHZH 3RGVA 3QDGB 3QJRB 2O6DA 2L4OA 4ANKA 4AUYA 4EZJA 2A0LC 3CLFL 3VNZA 4I88A 2IDTA 1PG7H 4Y2OB 5KW9L 4G8GD 3UYRH 4JZJB 3HR6A 1DFXA 3BKMH 4MYPA 5DJYB 4Z3GA 3BUTA 1OCOB 5I18H 5KSVB 3DTUB 3WFDH 2DWXA 1IFHH 3RWEA 4B0MB 3OHXC 2HFGL 1NDGB 4Y4FB 4YEFA 2VLRD 3O6LH 4D8PA 1YNKL 2Y7SA 3CU1A 3C87A 2ARJA 1NGYB 2NY0C 2RMNA 3NSDA 5MHSE 1PKOA 3CXHJ 2DIBA 4XHQA 2VN7A 1E2VA 1HH6B 1JZ4A 3OXRA 3EDJA 4KO7A 1AGBB 3ILPB 2QHRL 3MV01 3M7OA 4MQXC 2H0FA 1I8MA 4CU8A 4PJBA 5AENA 2QQKL 5E1QA 2PETA 1Q1JH 3LXBA 1DVZA 2IBZX 4KRPD 1HHJB 3IWUA 1BWWA 3GI9L 4JDZA 1OEZW 3BESR 5IB1B 1EAQA 1H0DB 5FR3A 3SE9L 4M8VA 2HPTA 2PO6B 2FD6H 2V5RA 4ZMXA 3GSNH 4F7TA 2MJWA 2BNRD 3B9KC 3G6JA 2EVFA 1GHFL 4LHQB 4YSUA 1J8KA 4GUOA 5F3HA 1X6NA 3GM0A 2VLKE 2VL4A 4JFYA 4PG9B 1IGCL 1N2RB 1L6PA 5MENB 4U1KA 1LP9F 1NIBA 4LLAA 2FX8L 4WK2B 2XX0A 3KJ6H 4B7LA 1M57B 3FKUS 2IGTA 4R0LB 5IF0B 1QBLH 2VITB 3HB3B 4PCKA 5TK4A 2Q86B 2VR6A 1BW8A 4PP1D 5F1OB 3FAWA 2J88L 1FZOB 3T6ZA 4MAZA 5B1AB 1AC0A 5EHFA 3NQKA 3BW9A 3AROA 1V7NH 1X5XA 3OB0K 5INCA 3LS5H 4OW6A 3EJTA 3QWNA 1G94A 4RAVB 2WWMC 1MREL 5TDNA 3ESVF 4WHYH 3G5VA 2TSBA 3HZVB 1PEWA 3V4VB 1TVHA 2XVKA 5AW0B 3U36A 1HFUA 43CAA 3Q6FB 3IMRA 3GLAA 4F7CA 3MVSA 2X4OA 2VXUH 1A7QH 1DSFH 3AITA 5F9AC 1WIPA 3DJ9A 4A66A 2ZWNA 4N0UA 4PV9A 5I74C 1KCUL 5HHQA 5CBAA 3GIZH 2DD8L 3RNQB 4OD2B 3V10A 2K45A 3E3QE 4ZMTA 2WV3A 3DX8B 4CN4A 3O4LE 1UWGH 3IU4L 1NM4A 4GQPH 3DHUA 3GSNB 4KKBC 5HYQB 1DR9A