3VFGL

Crystal structure of monoclonal antibody 3f8 fab fragment that binds to gd2 ganglioside
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
SIVMTQTPKFLLVSAGDRVTITCKASQSVSNDVTWYQQKAGQSPKLLIYSASNRYSGVPDRFTGSGYGTAFTFTISTVQAEDLAVYFCQQDYSSFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In silico Driven Redesign of a Clinically Relevant Antibody for the Treatment of GD2 Positive Tumors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 3F8 Light Chain
total genus 51
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfgL01
1QYGL 5JLZB 1HKFA 1EHAA 1S9XA 4Y16B 1UB5A 4CVXA 4QRPA 3UDWC 2XN9A 1NCDL 4JFED 4JFQA 4YHKL 2E7MA 4XCYB 2EKJA 1SVZA 4J1UA 2YN5A 3MGAA 4HIXL 2VR5A 2W07A 3VFVB 1AQKH 4CUCA 4M6ML 1I75A 3T09A 2FJFB 3VWKA 3OKMB 3AREC 4UINL 5CINH 1U58A 2PO6D 4JN1L 5IMKA 2BJML 4KROB 1RMFL 1J5OL 4LSDA 5D2NB 3MV7A 4LLDB 5FO7B 4OUOA 5CSZA 3QO1A 4HGMA 1MRFH 5IR1A 3RWFA 2EDEA 4MA7H 2BHYA 2XZCL 2PW2A 5DR5L 1FL3A 3F7PC 5A3ID 3LH2L 4HGKC 1EEYB 5JXED 3WXWH 5EZLA 3BN9D 4XGZA 2BXZA 1MFBH 2B5IC 5J06A 4K9EC 3S3SA 2V5TA 4I77H 3QR2A 3T0ED 3MRPA 2N1KA 2IGFL 2JJVA 5KS9B 1XMWA 1RZ8A 3NTCL 4IRSA 3T8XB 1YY9C 2VZ1A 4M3JA 4WEUD 3GIVA 1GXEA 3VFUA 2C1OB 1KTLA 1DSFH 4PRAB 1D6VH 5HVGB 2VQ1B 3L5IA 5GJTL 2OL3L 3KPOB 4D0DB 1HK6A 2D7TL 5E5RB 1BQHA 3WD5L 2OTWA 1XIWA 1BBDL 4BSJA 4UIKL 5F96H 5L8JB 1N8ZB 3KVQA 4F33B 5J9PB 5FKPA 2HTKC 5D1QC 1NMAL 1HKLL 3O0RH 1FVCB 2YMXL 2QADD 5EU5B 2AV7B 4Y4KA 3L5JA 1CICD 4PJGA 4WJ5B 3C6SA 4AIZB 4NQVB 4JKWA 3P30H 1S7XA 3EDFA 2VAJA 3LHPL 5I71B 1QO3A 3TZVC 5JMRA 3EJJX 2NCMA 3PNWB 2AQ2A 4XHJC 4HKXA 1JYWA 3KPMB 1FV1A 4BFGA 5L6YH 3QEQA 3NN8A 1YZZA 1OGTB 4NM4L 3V52H 3S35H 3KPTA 1UH4A 1KIUA 4K3JH 1YPZB 1RPQA 1LDPL 2MHAB 3MC0A 3GMRB 4KKLC 1ZTXH 3HS0B 3FB5A 1G9NC 4X83A 3OSKA 5JPMA 2DM3A 2OL3A 1HHGB 3SCMB 2VXQL 1CE6B 3GSWA 4FP8L 2BFVL 5KG9A 1FFQA 3LEYL 3FONA 4OZFG 4LSRH 1R5VA 4JPVH 2BVEA 4WUKL 3MV01 1MLBA 5JIKA 2P8LA 3DX6B 2PO6B 3QXVA 2C7UA 4Y19B 1CXKA 4K7PY 1EFQA 1SYVB 2GCYB 5IHBA 4OFYD 1CFNB 3S5LB 2G5RA 3L3KA 5FYJE 5FECB 3KR3L 4U7KA 3JUYA 2J8OA 4UTAH 2DQJH 1AGCA 5IHLB 3B9KC 4WI4A 1NC4A 4JFEB 4F57H 5DMKA 1P7HL 4M6NH 1VGEL 1YEEH 4JFPB 3NAAL 1KCSL 3MBEC 1K9TA 1IT9H 2W65A 3RWCB 1K3IA 2M8XA 5BS0A 3OKDA 4JQXC 4KRPD 3BP4B 4JM2A 1F6LL 4U6YB 1S7VA 4AEIL 1AGFB 2ZUUA 3P73B 4TSAH 4XNMB 35C8L 1ZS8B 3LKRB 32C2B 3VRJB 4E42B 5I19L 3HNSH 2DQDL 4U1MB 5E2WH 1YMME 2QSCH 5HGAA 3S37H 4NWTL 5E6IB 2PR4L 3Q48A 3S4SB 4FZ8H 4ZDHB 4PRPD 2AK4D 3LEXB 2BOCB 4MJIA 4PJIF 3SE4C 5A2IH 1INQA 1YN6B 3FQTB 2AV1A 4GG8A 3SDDD 4X4YB 3F6LA 1NCBH 4LCWB 3OJMB 3EOAB 4X7TB 1OQOA 3B9EA 4HWZA 3RVTC 3VXPB 1ZK9A 3VU2A 2NYYC 4OQ1A 1UVQA 1AO7D 2W0LA 5ELIA 1LK3L 5M95B 1UT9A 2PYEE 4KROC 4OLWL 2CLZB 1OQXA 3L3GA 4RMSA 5E00A 3TYGH 3HI6L 3QUZA 5HVWA 3MV9D 3RJQB 1JZ7A 2X4UB 1X4YA 5CD5C 2V5MA 5FF6B 1NPUA 2PYFA 1RZFH 3EDKA 4OLEA 3P4LA 2VUYA 5CJOH 5KVGH 2O5ZH 1BEYH 4HIJA 4PLJD 4HUVA 1GIGH 1DEDA 2CLZA 5MHSD 2ICES 3G6JA 4N0FA 4ODVH 2FO1A 4LDOB 4KJQD 1OP5K 1QSVA 2FIKA 5I8OH 2HH0H 4LRIC 3W11D 1UQSA 5DRXB 3BESR 3EDDA 3CFCL 1G6VK 4JLRA 4WFEE 2VITB 3SOBH 2L7JA 1R3IH 1JGDB 1AP2A 2MSPA 5AZEL 3ZKMC 4LQ1A 4RWYL 4U0RC 3KS0H 5HGAB 1OSZB 1TNNA 1A2YB 1GAFL 1I9EA 3AS1A 1JN6A 5C92A 4NN7B 4R0LC 4LSTH 2YXFA 5FHAH 1RHHB 5C1MB 32C2A 4OM1H 3KXFD 3DRTA 2BC4A 2VDOH 1CDHA 4GKOA 3MJ9L 4I4WA 1CQYA 4PPTA 3MOAL 4RAVA 4A2LA 2BSSA 1T2QH 5F8QC 1J05B 2HTLC 1F4WH 4XVUC 3GGWB 2VXUL 3CFKA 4TN9A 4BSVA 3GMNB 4RISH 4MD4A 1YECH 2FL5A 4JFZL 2MKLC 5IROC 5GRXG 3QUXB 3B5GA 1RUKL 3UTQA 1VKXA 3MV8E 1ETZB 3ILQD 5CJXA 1G6RB 1JPGB 3DSFH 4UV7L 4I18A 3W9DB 1BWMA 2GY5A 4IIQA 3O9WD 4V1DD 4C4KO 3LEYH 4NT6A 1CDGA 4Z8FL 3OJDA 4R7DA 3L3KB 3ALXA 4L1DA 3IDUA 2Z31B 4DUVA 4EZMA 4OZIB 4PLNC 1NC2A 2A0LD 4HUWB 2Y07L 3GBMH 2IG2L 2VXVL 4WI9A 5KSBF 5D7IE 4MNGE 4NSKA 3KNBB 5DJ0A 3C60C 2JJUA 4FTVA 1S9VA 2WP3O 4CMHB 1Y6MR 3F58L 3REWA 4YDIL 4O58L 3MGTB 3C09B 2EO9A 4ELMB 2YD4A 3I75A 4PLOB 5ILTL 3RA7L 2VKWA 3H9HA 5KSAD 3SGKC 4XWOD 5D2LB 4YFLF 2HN7B 3EYOA 3VWJD 3MLPA 1MEXL 1FV1B 4U1NA 5D1ZC 1KEGH 2DWDB 4QRPD 5DD1L 4HG4K 5J6GA 2HT3C 4S1RL 3VXMA 3TT3L 2FEDD 1R3IL 2Q7NA 3QIWA 3TESA 1ZGLB 2CXGA 5CZXC 4HPOH 1G7IB 3PL6C 4H8WH 4WJ5A 4OLZL 2DJUA 1GGUA 3GMOA 2CKBA 1UWEH 3C08H 1NJ9A 3DUUB 3T08A 1T04B 1G6RL 4GS7C 2QR0A 5DJ8A 2JCCB 12E8L 1TTFA 3L7EB 5FUOH 3NCYS 3TBYB 2VDKL 1SBBA 4ALAH 4JHAL 3V7AG 3ULUD 4ZAKD 1T0PB 4HLZG 1J8HE 2ADGA 2ADJB 2E6JA 2VIRA 3WN5C 4PGEB 1MCJA 5D5MF 1I9IL 1CQKA 2VDNL 1T1XB 2FBJH 1OGAA 3OGCB 1MRDH 3AAZA 3LKNA 4NNPL 3A67L 3HC0A 3HUJB 3WO4C 3FT3B 1JNNL 4G7YH 1BZ9A 4P57B 2A38A 4JFOB 1DQJA 5K9KA 1EA9C 3Q6GL 1XH3B 2HVJA 4Q6IB 3OXRA 1RUKH 3QUMA 4MWFB 1EEYA 1TQCB 1CVRA 3FT3A 2X4NA 4PJ5D 5HHMD 1WQVT 1G7HB 4KPHL 4LCIL 4APQB 5M94B 5I1EH 3EFFB 5LVEA 2XTLA 2OI9B 1ES0B 4YE4H 3T2QA 4FG6C 1U91B 4R26L 3S36L 2CMRL 3SE3A 3LKQB 3WFCL 4M4PA 1I9RH 5DD3H 5D7JC 4P5TB 3B43A 3VMOA 2XT1B 3BH9B 4P5TA 5ICZB 3LS4H 4WY7L 1JGVH 4OGXL 4YDLB 5JLZA 1S7TB 4R90H 4JPWH 3Q5TA 4PRIB 3VXSB 1EX0A 2GJ6B 4L9LB 4M7KH 3O2DH 4P4KC 3EJZC 3QDAA 1EJ6A 4K23L 2AK4E 1BIIA 4KK6D 2OBGA 5DRWA 3WMSA 4IRJB 4APQA 3MNVB 5D93B 4PYGA 3QHFH 1H15A 5LCVH 4Y88A 3X13A 3P3YA 1DLHB 5DUBB 2V2XA 3VI3E 1KPUA 1MI5E 3QUML 2IQ9L 5FCUL 1KTDA 4L9LC 2FB4L 4M5YL 1G6RH 3ZE0E 4IOFC 1UWXK 4QHUA 7CGTA 5INCB 4X6DA 4YDLC 4OCSL 1N2RB 5C0FA 3L3HB 1DFBL 3RUGF 4KK5D 2LAAA 5B38G 4MNHB 3MFFA 5IBTH 3QI9B 4CNIA 4FTVB 2BCKB 4OD2A 1Q9OB 5I8KL 4TVPL 2G5BB 4ZD3H 2J8UE 4W4NA 4XPGH 4NNPH 3VE0A 5C0EA 4TTDD 2ATPB 1J8HB 2HKFL 4M7LH 4LFHG 1NC4D 1WVZA 2DBLH 4CGTA 4G8FB 2UWEB 1DR9A 2YUZA 1UZ8A 3D6GA 3VXTB 4N8CL 3RA7H 4GKSA 5JW3L 1IGCH 4JKPH 3P9LB 2K3TA 3P0GB 1F90L 2E3VA 5FK9B 5HJ3B 1ZLVH 3BQUC 4E41B 1CFTA 4JGJA 1E4WH 3U9UA 4HXBL 5I1AA 4ZFZB 3ZL4H 5EOQH 1XGPA 4M48H 1VKXB 2NY2B 3KYAA 1DQTA 5EZIL 1JWUB 5KTEH 1E28B 4FFZL 1U3HD 1F42A 1U3YA 4JZJA 5I8CB 1BM3H 5CSGA 5E24E 4LPWA 1KIRA 3NIFE 4KHXL 3H9HB 3A6CL 5IEHB 4XCNA 4Y1AE 5D2NE 1AO7E 1YQ2A 4MA8H 1QSEE 3LS4L 1OAKH 4K7PL 4WY7H 5AAMA 5DTFB 3MZGB 5D5ME 3MGTA 3QP3A 3QRGL 1NDMB 4ZNEA 4R96B 5E1AA 1FNEA 2NY6B 2UY6A 3IKKA 5EBLB 5F6HI 2VWEE 3O8XC 4RFOL 1E4JA 5DMJB 3W9EB 1ORSB 3BMVA 4UILL 3E6FA 4LCWD 3VFOB 2F74A 4PRBA 4HIXH 3PL6B 3ARFD 2AJSH 3S96B 4XMKL 1T1YB 2CXKA 2OTPA 2X4OB 3HZYA 4R4FH 1IILE 3GB7B 1MFEL 2EE2A 2XYCA 2Z31A 2JJSA 1NCWH 1JI2A 2CSPA 1ZLUK 3VXRA 5JQ6H 1PKOA 2O5XL 5K9JH 4RRPG 2EDYA 4L29B 1PZ5A 3UO1H 5DHXB 5DSCB 5FHAL 2D7OA 2OS7A 2VXVH 1A4JA 4IIQB 1GGTA 4NHCL 1YUHB 4X6BB 4J6RH 4G9DA 2NY3B 4C83B 1WCBA 4HK0A 1RJCA 4BFIB 4OM0H 4NCDA 4R97C 5C0CD 3TGXA 1MIEL 3K8KA 2ITDA 5DD6B 1OARL 2HTKD 3GGWA 4ONOA 2LE9A 4P3DA 1I7TA 5C0AE 5DFWH 5KVMC 3ILPB 4HMEA 4GG6F 5GGVH 4POUB 3VFNB 4MZ2A 1RULH 4JCLA 4X6EB 3LMJH 1HDMB 4WW2F 5L88H 1R5WB 5E2VL 2BX5A 1QBML 5IQ9A 1H5BC 3EOAA 4X7TA 4AYFA 1ZLUH 3HRZB 4XC3H 1W72B 2DBLL 1G9MH 2APFA 4HCRH 3WEXA 3LEXA 4MJIB 2YA2A 1MCLA 3HCVB 3MMEA 4U1GC 2NY3D 5E8DH 1FYTD 3ZE0F 2YK1L 3T2OA 1W0WB 1GRWA 5F88B 2GT9A 4U1MA 5T3ZL 3U7WH 2UY7A 1HDMA 5FEBA 4F7CA 3PWLB 2VAAB 4LASL 2H9GB 3MBEA 2W9EL 1YC8A 3QXAB 4NQDB 3WBDA 1NANI 4G6KL 2IBZX 4ZPVB 3LRSB 4FQXA 1IZJA 2HJLA 3FFCB 4GH7B 2W65B 3THMH 4DCQA 3BKCL 1EFXD 3D3VB 1JK8A 2R0ZL 3SDAD 4GRLD 2IPUK 3WJJC 1Z9MA 3RKDD 5DZOA 5E2TL 1CLYH 3QDMA 2O5YL 1B3JA 5MP6H 2VYRE 3V5KA 1EV2E 3ZKQD 4OQTL 2N7BA 1XF4A 1BVLB 4L29A 4Q9QL 4NQSA 5DJXA 5KVDH 5C6WH 4C59B 2YMXH 3VH8B 1JRHH 4X8JA 1RIVL 1WZLA 1TENA 3QIUB 3WNNA 4P3CL 2AV1B 4HGWA 4MA3A 3AFLA 5LGKA 4LLYA 4J6RL 5DD1H 1ZT7A 2P8LB 1LP9F 3EFDL 3DX8B 3V4VL 2BNQA 1NQBA 3TBVB 2NZ9C 4HXAH 5TE4L 2H32H 4M43L 1A02N 2I26N 2WINA 3FN3A 4TSBH 1T7WA 5E1AB 5KZCD 3VRJA 2OL3B 4Z0XB 3DI3B 5BV7B 2FX8H 1QR1B 2DQGH 4NKQB 4LBEA 3CMGA 5DWUH 4OZIF 1AY1H 4LCUA 5DT1L 4HV8B 25C8L 3FFCE 5F7HA 4XP6H 4LLWA 1CTOA 3KYNA 4XH2B 5C86A 3ESVF 1HHJA 5ERWB 2AJZA 2NXYD 1NEZG 2PCPB 2BFVH 3MRJB 5KSBE 4UT7H 3VWKC 4P3CH 3BN3B 4GRWE 1L0YA 1MRDL 2DM2A 4C54A 4J4PD 4ZFOA 3DSNA 4RGNC 1CFTB 2H8PA 2ITCB 5B4MD 3C6SB 4DK3A 3BD5A 2AV7A 3L3JB 3V4UH 4BFBD 2Z8RA 4NO0D 3B8YA 3H3PH 4UMGA 1DANT 5L7XH 5FKPB 1T5XA 4NC1E 1ZHKA 1KN2L 1P84J 1JMZA 3VFGH 2RB8A 4PJDA 1BREA 3D69B 4M8QA 4WW2C 5AUMB 2R0ZH 1JP5A 3HAEG 3JV4B 3GSWB 3IXTA 2O5ZL 2EE3A 1A64A 2YZ8A 3T4AB 4FABL 3MUY1 3O4OC 4KJQC 5HGHA 2VISB 2MHAA 3KJ4B 4LF3A 4K94L 4NNXA 1SJXA 1P7QB 4NO5A 3TYFB 2FJGA 5GXBB 3QCTL 2FLBT 4OFPA 2OR7A 3K80A 5F6IB 1YMHB 2IAMB 1BX2A 1RFDH 2DLHA 3TIDA 3W0WA 4NJ9L 1RU9H 5DUBA 1T7ZA 5HTSA 4M1DH 1G9NL 1GOHA 1IQWL 4WV1A 4KK9D 1D9KB 4PTTB 1H8OA 3VFRA 3CVHH 4AZ8A 1X3DA 4JN2A 3U46A 1I3GH 1S7XB 2X7LA 5C9KA 4Y7MA 1A7BA 1OAZH 1VGKA 1IKNC 3VXUB 4QHKJ 3FFCD 2HFFB 5IKCA 3FQWA 3DETC 1FVCA 4LARL 3OKMA 2HTLD 2AJUH 1ACYH 3O8XB 3S98A 1CBVL 5BZWB 3HRPA 2IALA 4ISVA 2DM7A 2J3SA 2K9UA 2ICCA 4PGCA 1NGXA 3AMKA 2WIIB 4WI2A 2BNRD 4J3UA 3OX8B 2HJKB 3V6OE 2VQ1A 4ZO6A 3SGJA 3LPWA 5C2UB 1IT9L 3HZMB 3SEPA 5HXMA 3PABA 4X6FB 2R0LH 1ES0A 4QRRA 5GZOD 4KI5F 3I6KA 1EMTL 1KTLB 2DQFB 3EIFA 5D6DA 5GS2D 2VZUA 4CJ1A 2VLRD 3TT1L 2YSSA 3F8UB 1U2HA 2CK0H 5MP6L 2FWOB 5HYSA 2GITB 1WTGT 5BW7A 5D93C 5D7KE 5BZDB 1DQJB 2OQJA 1JTPA 5AAWA 1CLZH 3IDMB 3OGOE 3P11L 3IDJA 2R69H 2VZTA 2X1WL 3ES6A 4GW4A 2YWZA 3AAZB 3LKNB 3QIWD 1HEZA 4KMQA 3MV7B 3AY4C 3VCLB 4NQDE 1H0DB 5I0ZA 5CD3A 4DEPC 1PSKH 5IB1B 1SVCP 3NA9L 1U95A 3QI9C 3AB0B 1TZGH 3VFVA 4YX2H 1P4IL 5D2LE 4W6XB 3HAEH 3PIQA 4WHYG 2NXYB 3RWEB 5IG7A 5J1SC 4X6CA 2X40A 3PHQB 2YD2A 4M93B 4OD3H 2D9CA 2P8PB 1NFIA 4N9GA 5DFTA 4Y16A 4PJ7E 1FNSL 3OKNB 3VMPA 1GC1L 4OGYH 1OP3H 2MCPL 2SEBA 2X1OA 2WSKA 2R29L 4ERSH 3KLDA 4M6MH 4PD4J 4ELME 4EI5C 1TVDA 1T0NB 1TFHA 3CMOH 5EOQL 4U1JA 4FA8A 1O7SA 4MNGB 5BVPL 5KZCB 4DTGH 2AERT 1OAZL 4JB9H 5E03A 3ULVH 2XY1A 1N5YH 5DZLA 2IANB 4DN3H 1I1AA 4ZXBB 4Q9CA 1BQUA 3KXFA 1MF2H 3B3IB 4Y5YC 1IC7H 1QKZH 4JANA 3QDHA 3S34L 1WK0A 1CL7H 5IFHL 5K9OB 4NGHL 2HT4D 4QHMA 1S9WA 2LU3A 1QFWH 3WL9B 4Y8AA 4MD0A 3CFJB 2C5DC 4ONFL 3QDJE 3LQAH 4L4TA 3CCHA 2OM5A 5JMOC 1S7UA 4MVBC 3SDYH 2BDNH 4G80B 3DGGA 3I6LD 4OZ4A 3UC0L 2FHCA 4HUWA 2VLLB 1A0QL 5IB4B 5C07E 4KTEH 2VZVA 4Y19E 1V3MA 3C8HA 4IOSD 3KLAB 1DBAH 5EU6B 3VGAB 3MV9A 1KNOB 4S0TD 3VFWA 3CFEB 1HHKB 5T5FL 4JFFE 1CICA 2OMNA 2VE6B 3GSQA 1QLRB 3GI9L 4HUUB 5C2BL 3MLYH 1OP5H 3DI2B 4HHAB 4I18B 3QJFA 1GGIH 1VA9A 2Z35B 3CXHJ 2GKIA 4MZ3A 5HHNB 4KI5D 1LP9E 3NCEB 3BAEH 1LQSR 3O4OB 4NDMA 3CX5J 4M61B 2YD8A 1YNLH 3C8KA 3O2WL 1NLBH 3N85H 2J12B 5LGHH 4DKFL 3WHE1 4QOKD 1T22B 4ORGB 4RBPK 5B3JE 1JZ8A 4R26H 4ALAL 4KK6C 3S36H 1KG0B 5ITBL 1XGYH 1S78C 1FZJB 1EBPA 5LGJA 15C8L 2KZWA 4ZO8A 3BKCH 3RAJH 3IJSB 1UXSA 1IC5H 5E9DA 3SKOA 4L3CA 3SPVB 1ZHBA 5EBMA 1L4IA 1YDPB 2ICWA 1TJGH 3HLAA 4BM7A 4LSRL 4KZDH 1JF1A 1JZ2A 5FA3A 4OB5H 1S7RA 3ZDXE 1WBZA 1SMOA 3A67H 4HC1A 4RIRB 1SJVA 4KQ4H 4HIIA 1J0ZA 4OKVB 1PKQE 3FL7A 1JRHL 3DRQA 1A6WH 2CDEB 4OQTA 3QZWB 2D7MA 2A73B 4NP4H 3VXME 5GS0C 4QCIA 3CFDA 4OCXL 5FV2A 1V8HA 2ZUYA 4I0PD 4UDTB 4DKDC 4JY4A 1YNKH 3T2NL 4EDXA 3BMWA 1WWAX 4ETQA 5J3HC 3VDCA 3U36B 1WFUA 12E8H 1GIGL 4HS3A 2WUCL 4O2EB 3G6DL 1F4XH 5FAAA 5LBSL 2X4TB 4X5XB 3MRGA 1U92A 4JE4B 3SE4A 1RZFL 1AI1H 4JKKA 3RX5A 2XKNB 4HWZB 3BO8B 4NZUH 4PJ5A 1P9MC 3K81A 3KPPA 2BSTB 3OMZA 4UNTA 3RY5A 4PJXB 4JM4L 4HC1H 3A6BL 1Q72L 1EUUA 3MJGX 4NIKB 4NRYA 1RMFH 4LEOB 5I8EA 3MJ8A 2I07B 3R1GH 3U9PH 1NGWB 2VLJE 3S4SA 1LO4L 4LU5L 1QQDB 4XPTH 2NXZC 3V7MA 3QZWG 1J7VR 1IEBA 2DQHH 4X6DF 3QCVH 4LSQL 1Q94B 1NBVL 3U0TA 1XZ0A 3IETB 5AYUL 3V5DB 3WV0A 2VOTA 5HHOB 4XNMA 4DW2L 1D6VL 4NKMB 3T0XA 3JV6B 4OUUB 3FQXB 2R2CA 4WCYH 3X17A 4MNQE 4HD9A 4MXWL 4ESKA 1L6ZA 5D7LB 2XTJD 1I8LA 3GHBL 5E5UB 1VSCA 1BFOB 5BJTA 1SBSL 3TA3B 3PWNA 3RL1A 4DKFH 1MCPH 2GAZB 3D1MC 3BHBA 1ERNA 1PJ9A 2F5BH 3UZEA 1F8TH 3ULUL 5IMOB 3JV6A 4QT5A 3CUPA 4RGOL 4RQQB 1H3PH 3VJ6B 3U30B 5DHYB 1KV3A 4KMLB 3NCYP 3HKFA 4JRXB 2LAGB 5FYKH 1TTUA 2HKHH 4KXZH 1NUFA 1B0RA 4JO4L 5FYJL 1L0XA 5DJYA 5E56A 1SEBA 2PTVA 2Z93B 3VFSB 5SX5H 3QCUL 3TH4T 3HMXA 4FXLA 1OTUC 2BY0A 5DC4B 4Z5RB 2NW3B 3RZWA 1JFQL 2EXWC 2E7LC 3H9ZA 3GMPB 3KDMB 3RVUD 3E1F1 1XGRA 3DGCR 1E4WL 2ZPKH 5ACZA 2I9TB 1BQSA 4QRSB 4X0KA 2IBZY 3PWPA 4N0UA 4EN3B 4FQCH 3SCMA 4KY1L 4Z76A 3BIAX 4Z0BH 1IMHC 5TQ0H 1RI8A 3RWIA 3QNYB 3D39B 1MLCA 1IGIL 1NAMB 4Y4HA 1J1PH 2Q8BL 1HHIA 3OG6B 4EJ1C 2EDOA 3U36A 1NSNH 4PGDB 1SY6A 3B4NA 3NN8B 1CCZA 4P9HL 5MENA 1LDSA 4CN1A 1OAKL 2Q6WB 1JNLL 3L5WB 4OZFA 4Z95H 1MWAB 1U8MB 3HPJA 1AJ7H 1I8IA 4JGMA 4P48A 2IH3B 5IB3A 4JAMA 4ODUB 4ELMF 4QKXB 5MEOA 3O3DA 1P1ZB 3C2AH 3R0NA 5C0BD 1QBMH 1CT8A 2HRPH 1MCIA 3HMXL 3S8WA 1F02I 3GHEL 4NQCB 3HZKB 2VLJA 4LKXB 4IDJL 1ZHBB 1MREL 3ULUF 5EO9B 1WTLA 4UI2A 4QRUB 1DVFB 1DBBH 1BP3B 1ZVYA 1CFQA 4OZGE 3AXLB 3L6FA 1IFHL 3QWRD 2EYRA 2WBJC 2NY4B 5DJZB 1B6UA 3UTSE 1N0XH 1A6VL 1EGJH 1U8IA 1DBJH 1DDHA 1T2XA 5FUZL 5DLMH 2J8HA 1CT8B 1HYRC 2Y4SA 4TNVF 1NLDL 5CCKH 3PDGA 4U31A 4JDTH 4YHIB 2F19L 4NYLA 2FH6A 2IH3A 5JHLL 2R2EB 2CDGB 3GBLA 3B2VH 4B41A 2VXTH 1IC4H 1JF6A 1BQHG 1GHFL 3BZ4A 1LEKB 4JQVA 3B9KA 4WGVB 3ARED 4S1QH 1AD9B 1T89C 3MV8B 4FZ8L 3MSPA 4LLDA 2ZPKL 5GGQH 1KLUB 5B8CA 5CBAB 3PHOA 1QRNA 5DK0B 1I1CA 4FQJH 2KL6A 3D39A 2A6DB 3QNYA 4OM1L 4WW2A 3G5XB 3U0PB 1BF8A 5A3IC 1FLRH 2V17L 1HYSD 1I1FB 2XIDA 2DMBA 5DUML 5BQ7A 1K8DB 3CC5B 1RK0A 3SKJH 1ZA3A 5EOTB 5EZJB 2QBWA 4XXDA 4P9HH 5C6TL 1UB5B 4CVXB 1YY9D 1KCLA 2APXA 1RURH 4Y4FC 4HULB 5ID0B 3R4DA 5B4MC 1F2QA 1L7IH 1FC1A 2FYYA 3L5XH 4PRHE 1EHLL 2G60H 2WMPA 1OL0A 1MAKA 3C9NA 5GGSA 4L1HA 3BGMA 1D5ZA 5E8EB 4N5UA 1FL5A 3QEUA 4G8EA 5LKNA 1R3HB 5D1QD 5FDWA 4JO1L 3MODL 4NBZB 4ZQKB 4FTVE 5K59F 4OBSA 2AXFA 5DJCB 5DD5H 2JB6B 1X5KA 3FQXA 5JNYB 1UC6A 4BZYA 4TVPH 4ZD3L 3BP6A 3SDXA 2BHZA 3QIBD 1HINH 2PF6A 1Z9SA 2UUDH 3OKNA 4Y4FB 4YBHA 1LNUB 3LKOA 3SGJC 2DM4A 4I9WD 4KU1A 1EAPB 4N90D 4WWKC 1FJ1B 5GRUL 2CRZA 2DQTH 3RTQB 2XWJB 1A6ZB 4DZ8A 2ZSWA 5F7EL 3VI3F 1BVKA 1CR9H 2XKSA 1RZ7L 3UTSA 1FJ1A 1B0GA 3BWUC 3OKLA 4L3AA 2BNRA 1R6VA 4MSWA 4OZGA 4XNXL 4NZTL 5F70A 4APQC 2FZ3A 3IB4A 3HNVH 2G75A 3V6OC 3BP6B 2J88H 5JNYA 4L5FL 1HQRB 3KWWB 4Q6IC 4LHUG 5SWSD 4XCEA 2B5IB 3UC0H 2IH1A 5E99H 1CGWA 1H3TA 2R56L 5EH1A 4NP4L 4H8WL 4Q7DA 5EA0L 4O2EA 1D5ZB 4HS3B 4D0BB 3MRDB 1ZHLB 3NIGE 1ZE3C 3WO3B 5HYSB 1WIOA 4X6DE 1KJVB 3VFMA 3UJTL 3WFDH 5FKAB 5F1IB 1A7NH 3TO2B 3DURA 5I2IA 4HWEH 2D7TH 5T1DH 2GK0B 2D4DA 3QZWA 4LCWE 1CS6A 3MJ7B 3ZKNC 3D18B 3IFOB 1ORQB 2HFGH 5ESAA 3T4YA 1DEEA 3GNML 1P7KB 2R1YA 3G5ZA 2WBJB 4O02L 3L9RB 2GSGA 4K7FB 1AHWA 2EXYD 2W0FA 5FFLA 5HGBB 2NX5E 1KYOK 3G5XA 1LO4H 2OTUB 2A6DA 4X9BA 4ORZC 5EN2A 4ZPTB 4GMTL 4JN2B 2KUTA 3CXHK 1KLUA 3VFRB 5DQDL 5B3JF 2FR4B 2YRPA 3BKYH 1MCBA 4R2GB 4K7PX 1MHEB 4W4OC 4WV1B 4XPAL 1KCSH 3BZ4B 2Q76B 3LIZL 4FQHA 3QI9D 3WSQH 4YDVA 1HE7A 2R0KL 2NY1C 4NWUH 1YY8B 4LHUB 2FJGB 4M48L 4O51A 1J1PL 1UGNA 5E0QA 3SDDC 4IS6A 3OZ9L 1K5NB 4LARH 1C5DA 1KJ2A 2AJUL 1G84A 3HE6C 3UAJC 5E2TH 2VISA 3KLHD 4YXKL 2JTDA 3U1SL 4E41E 1CLCA 5CKAA 3C08L 4WCYL 1DDHB 1FRGL 5L2KA 2FATL 5SX4I 4ZNEE 3MUZ1 5C8JA 3D2UB 5ADOH 3CH8A 2BNQD 4G9FA 3X14B 2XFXB 1U8OA 5DO2C 3O3EA 4PJDB 1MCKA 4JJHA 4P3WA 1NCCL 3ULSB 4GXUN 2NR6C 2JELL 1FE8H 2V5RA 2R0LL 3TBWA 5T3ZH 1S5IL 2NY5H 1J0YA 4G80A 5JZ7C 3HC3L 3C6LA 2I9LA 3QIUC 4OIIH 4JKLA 1J11A 3U6RB 3CXDL 1A3QA 1EEUA 4ZODA 4L4TB 3CSPA 1X5FA 5F7UA 3D18A 1INEH 5FB8B 5I16A 3GSNH 3U1SH 4P2OC 3MJ9A 1IQDA 5FKAA 1AD0A 1TXKA 1XF3A 1PG7X 4QOKE 5SWZA 5EZOH 3VFTB 2B2XL 5K9OA 4XH2A 5C0CA 4K3HA 3WHE0 4G7VL 3CSYA 2GHWB 3ROOA 1FG2B 2QKIA 3PP4H 5E8NB 1A9EB 4TYUA 4I8DA 3ARFB 4ZFGL 2CDFB 1CK0H 1PY9A 5C09E 4QRTA 1MLCB 3VDAA 4X7SH 4Q97A 1EK3A 4POZD 4MNGA 2WINB 1AKJB 1JGVL 4OGXH 1O5DT 4YR6A 1NEZB 1QNZL 3O6FC 5HD8C 4PJDE 1FPTL 3CDYA 5I6XB 1IC7L 1QKZL 2NTSP 1CI5A 4HGWB 4MA3B 3NIGF 5GS3A 1G7PB 5IG7B 4F15C 5D7SL 1KCUH 4OCSH 4DN4L 4OD1H 1SEBB 2Z93A 3HPLB 5T3XL 4PYHA 1TNMA 5IW1B 2JK5B 4HWUA 3I3BA 3P11H 2VSDA 1WITA 2I24N 5DHYA 3O9WC 3VJ6A 3C5SA 3HMXH 1GPOH 4DFIA 1JFQH 4QNPF 5F9JA 3VD4A 5AD0B 1IEAB 4HFUL 4ODXA 3X3GH 3WSQL 3TA3A 3E6HA 4HH9B 1RURL 1IAIH 1XAUA 1JK8B 5D7LA 1FO0L 3IDJB 4G8EB 4Y4KC 1QFWL 3FB7A 4GRLA 1XGUB 3FFCA 4FQXB 3BPNC 5F8RC 4ZPVA 2DICA 1J5OH 1LILA 4X98B 3G9VA 4OLXL 1ZA6A 1TETL 2MQ0A 2V9QA 1CU4L 1JWMB 2BMKB 5T1LA 3GI9H 3EO1A 3NIDE 4HKBA 5K9JL 5IROA 1LO3H 3EGSA 1NCNA 4FQJL 1XGQA 5C09A 5KSAC 3SJVA 4NQCD 5J11C 5EIIB 3IDNB 3I9GH 4W68A 5BW7C 3O4LA 3TM6A 4HDIB 5E08L 4NFDA 3RGVA 4WWKB 2J8UA 1FN4B 3LB6C 2P5EA 1R5WA 4LGRB 3S36X 1CZ8L 1FSKC 2X4QB 3L1OL 3S7GA 2X4TA 3AY4A 1DE4B 1NLDH 1SEQH 4WFHD 4RX4D 3QG6A 3VGHA 1OAUH 3ULVF 2H3NA 3UTTA 2RJMA 1ZKAA 1L9MA 4MA8L 1OM3L 1IBGH 4OGAD 2EZ0D 3MQIA 1CGSL 2X4SB 5FGCB 1TDQA 2ITDB 4KGJA 5DD6A 3GMLB 4ODHH 3B9KB 3MLVH 3PWJA 4NBYB 5H2BA 3RVWC 5EUOA 3S97C 3E8UH 4YDKH 2IAMA 4OKDA 2NXZD 3OPZH 4OZGF 1F4XL 3NPZB 2P5WA 1A4JB 4NNXB 5IVZB 3GJFA 2AXJA 5GPRA 1FORH 4XPBL 2F54E 4PB0L 2PETA 4PFEA 3T1FA 1EFXB 1Q9LB 4ODTH 4NHUB 1MHHA 4G6JL 2UZIH 5F3HB 5FA3B 1MNUH 4MS8C 4LVNB 4K94C 3WXWL 2ICEB 2Z91B 4N0CD 4GBXA 3MGOB 3CX2A 1CDJA 2BNRE 2I5YL 3D69A 4M8QB 4QRPE 2HT2D 2CO6B 2A6IA 2WV3A 5F97E 1OM3H 1QEWB 3O6LH 3ECBA 1ORSA 4AMKH 3W9EA 2UUDK 2UZYB 3ZSTA 5E9DD 5IEKA 3TN0B 4HIEA 5TJWK 2AEQH 3RI5K 4FG6D 4ORGA 1TCMA 1YEKH 1DQLH 1AE6L 1IGTB 1W8NA 3C5ZA 1P1ZA 4XCNB 4XRCA 5D7LE 4P2QD 3G08B 2F53D 4NCC1 4PV9B 3TZVB 4P5MB 2HMID 1II4E 3BP5A 4DZBB 1OTUD 4OZFB 5FGSA 5EORH 1ZLSL 3T2PA 3LRGA 1L7IL 3ZTNH 2YD5A 2GI7A 5HSFA 1EHLH 1Z2KA 1E6OH 4QXTB 4A6YL 3MOBL 3F12A 4ZSOE 5FV1L 5DEGA 2CK0L 2UWEE 1MCDA 5FGRA 4G43B 1NUDA 5DA0B 1JGEA 2AKRB 4FNLH 4G5ZL 3W2DL 4JO4H 4U1HB 1KIQB 5FYJH 4WUUA 2BVQB 3H9SE 4P4KB 4QNPE 2ZUSA 2V9RA 2YK1H 1FZMB 3KLAA 3GSUA 5JO5B 1TZGL 2CR3A 1Q1JL 3PWPB 4F7TA 5HI5C 5HVHB 3F5WA 4NUJA 4WO4B 4YHPA 1RUML 4NHCH 4JHWL 1BD2A 1FDLH 1TZIA 3WLWC 1TZHB 4OV5A 5B39B 1MI5D 3Q5OA 1JHTB 3JBG7 2C4FU 2O5YH 3OAZK 2ENYA 4YPGB 4LLYB 2H2PC 5JOPE 1DBAL 4AL8L 2LTQC 1XGTB 5GS0H 4ODVL 4CNIB 3ZKSD 4MXQD 3KPQA 2E27L 4ACPA 2FH8A 5L2JB 1XR8A 1H3UA 2C3GA 5J12B 5IMOA 1CGYA 3KJ6H 4OAWA 4G6ML 1A3RL 2GAZA 4WU5A 3BPLB 4D3CH 5I17A 4LSUL 1I1AB 3EFDH 3V4VH 4X7EC 1SJHB 2IANA 4WO4D 4IHOA 5IMMB 4YAQA 1FNHA 5DD0L 3ZE1F 3MLSL 2FHBA 2X10A 4PJ8B 2GTZB 2OSLB 3N9GL 5IBTL 3RDTD 3WO4B 4XI5C 1N3NA 3WNLA 3V0WL 3UYRH 2YWYA 2Y06H 2GJ6A 1S9YA 3MYZA 5TDOA 5IB2A 5CZVL 2B0SH 1WIPA 4MB3A 3WJJA 1JZ4A 5FM5O 4HCRA 3JWNC 5E7FA 1RUAH 2E9JA 3D0LA 5CHNA 3WIFB 2FX8L 5I1JH 3BXNB 4TSBL 1WWBX 1JHLL 3DX7A 5TDNA 4QOKB 1DN0A 4NRYB 3EAKA 3GSNA 4GLRI 4NO0A 3O6KH 1U8QA 3MLVL 5SWQA 2EYSA 2PYED 1OAXH 4HS8L 1DQDL 4PGBB 2WIMA 5GGUB 5GGTA 4H0GA 1N4XH 4GW4B 1G7HA 1X7QB 4U7SA 2IFGA 3RY6A 5E8OA 4UNVA 5AWNL 2J6EL 3TA3C 2JELH 2HVJB 5D71H 3RBSA 4H5SA 1WGOA 2APBA 1RZGA 1Q0XL 2MPAH 4XCFL 2RFXA 1K4CB 1NCBL 3RL2B 2YSSB 1LP9A 4DN3L 2Z4QA 1WBXB 2EO1A 3WE6B 1OGAB 2YPVH 4O58H 2DTMH 5TH2B 2H1PL 5FYLD 3P4OB 4Z77B 3KYOB 2C3XA 3GSRB 1M71A 1E6JH 5ICXB 3OZ9H 1F11B 1KJ2H 4JFYA 1C7TA 4P46A 5C0DA 1T7XA 5I1DA 1YPZF 1N26A 5HI3C 1RFDL 3QAZC 3SPVA 3V79C 5BZWA 5B38B 1AXSA 4HJ0D 2E7BA 3B9AA 3VRIA 2AJYH 3H0TA 3OR6B 1A1NA 2F74B 4PRBB 4K55A 1QRKA 3T65A 3U79A 1TVBA 1DZBA 2R23B 4D9QD 5CINL 1EEQA 3K8LA 3QBTB 2V2TA 2P49B 1NDMA 3H7LA 1ACYL 1CBVH 2BY1A 5JIIA 4G6AC 4F7MA 2DWDA 1QSFA 4WRLA 3FT4A 1PLGL 5I9QB 1UA6H 3BN9C 4YGVA 3FAWA 5IEHA 2QQLH 4OJFL 1G7MB 1TPXB 5DDHA 3SDCA 4HJJL 4DWHA 1T83A 2OP4H 1T03H 5GGTL 3F65A 4BELD 2XG5A 1OTSD 3DVGA 3G6JF 1G7LA 4ZFZA 2M26A 3UZVB 4XNQA 3NCFB 2XXMB 2V5SA 1OAQL 3RUGA 3OHXB 5FK9A 3VFWB 4UT9L 1FIGH 5CIPB 1N4XL 3UCRA 4C56B 1FNGA 3MNZA 4K94H 2A6JA 3RIFK 3LRHA 4FFYL 5EA0H 5BCAA 2GUOB 1EZVX 1T5XB 1H3XA 4PJCB 3DO3A 4WFGD 3RKDC 2VLLA 2A6JB 4GKNA 2BVPB 5E08H 5C0EB 2H32B 4N5EC 4FQLH 1RIUL 3P4NB 3LDBC 2QADC 1CE1L 1H3GA 4R4FL 3DARA 4NT6B 3SO5A 1CLZL 1JUFA 1QPPA 2MOVA 2BCKA 3RWJA 4JFFD 2MMXA 4PTUB 5L0QB 4ZS7H 5E95B 5L8KB 4TNWF 4XXCA 3BKJL 4QXUL 5ERWA 4XX1G 1WT5C 5BS0E 4PJDF 4Y19D 2IG2H 4BSVB 1CD1A 3EYVA 3EJYD 5C09D 4LASH 4ZUVB 4WFHE 5DJ6A 1YEJH 4UT9H 2NY2C 4H1LH 5DURB 1KIPA 1T21A 4F7MB 3AS0A 3QUYB 2NY4D 4EUPB 1M7IB 2AXHA 2ADIA 2YPLA 3R0MA 4G9FD 3CVIL 1A47A 1C08A 1TVHA 2H26B 4NUGL 5D1QA 3BPLC 4L9LA 2ICWI 4HUNB 3MOBH 1CLYL 4P9HC 1JGDA 5EB9A 5HPMB 3WXVH 4YXLH 3H0TB 4IMLA 1J88A 3QQ3A 3K2UL 3MR9B 1KTRL 1UA6L 1BD2E 4Z9KB 1XT5A 4G8GE 1RJZB 3T3PF 1BGXH 1F11A 3DO7B 1JNHA 43C9A 3H2WA 3ZMRA 4R2GD 5ICXA 4WU7B 4BZ2H 4OCRH 3K7UA 4XVTL 3P4OA 2NMSA 1LO5A 3U7WL 4JRXE 4HIJB 1LK2B 4BFEA 3H9YA 1HEZB 5SWZD 1MHCA 4M1CD 4U1SA 1R3JA 1K4CA 4Y5YB 1KCVH 2PYFB 1P6FA 2X4NB 2FX9L 4NM8H 4FS0A 4PB9H 1YPZE 3GDBA 1U8PA 5GGSY 3AROA 4O4YL 3D39D 1EXUA 5JZ7D 4YHOL 4ZO9A 4A6YH 4JFEE 2BRRL 2W0KA 1HXYB 5ICYB 1T6VN 4R0LA 5GGQL 2NX5B 3OKOA 5J1AB 5GGUA 3FQRB 1CE1H 4OLYH 4G8GB 2DYPB 2GT9B 4ERSL 1M7DA 5TF1H 1A0QH 3ULVE 4NO0B 1U8KB 5HHOE 3MMEB 3FQTA 4GG8B 4M93C 4JG0H 3S35X 3SY0B 3ZDZE 2ADJA 3P4MB 4FFYH 1JZ3A 2WWMC 4PGCB 1G1YA 3DX7B 1UH2A 4JRXD 3NCJH 4GAJL 2F5AH 4LMQI 5IQ7L 1M6OB 2QEJA 4ISVB 3SQOH 3X12A 4NNYA 3NFPA 1QUNA 4U6HA 1ONQA 5DLML 3U0WH 4JZJC 3L3OA 3LN9A 4QO1A 3TF7C 2I5YH 2DD8H 2IFFH 3G6JE 3VXUA 5HYIA 2ED8A 4WHCA 5C0IB 2C26A 4U6YA 1BM3L 4KQ3H 1NCTA 2PXYC 4F9LC 1ZGLA 4RSVA 3CVHA 4KY1H 3DX9B 4L3EE 4GKZA 3RRQA 4PTTA 3DUHA 4PS4H 4YNYB 4OJFH 4P2RE 5I73B 5D70H 5J6GB 3UJIL 2V5YA 4FXGB 3MRMB 4P59L 2A9ML 3NVQA 2GFBA 1F4WL 4F7EB 3MRLB 3W5NA 3F7YB 3QEGH 3GKWL 2BERA 3NA4A 1YUHA 1UCBL 4JO2H 5DEFB 4M7JH 4PLJC 5FECA 4WTZG 4D94A 4K23H 1OP3K 3TCLB 2Y07H 2QV2A 1AJ7L 4Z7NF 2F15A 3T4AA 3OKKB 3EZJB 1RUMH 4Q0XL 2X5PA 5DR5H 3O3AA 5I73C 1KOAA 1JCKA 5DJ0B 1DL7H 2YC1B 4Q9BA 5IUSA 1FL6B 3BFOA 2EDHA 3S9DB 1I1AD 2C3VA 3E6FB 2VLKA 5H35A 4I5BA 5KOMC 4Z7WE 3ZKMD 2OZ4A 3VW3H 1FNEB 5EBLA 4HUMB 1CD9B 4N8VA 3DXAB 4KK8D 4XMPL 3L3JA 2XZQL 1DVFC 4XNYH 5L88L 2C1PB 3GIZL 3UBXI 5CILH 1QHOA 4OLUH 2PR4H 2VO5A 4JPIA 4WHYH 5I76A 1DQMH 4CAGA 4RFOH 4XVUD 3BIKB 4Z7VE 3SBWA 5JHDD 3UTQB 3HAEB 2AJZB 4TUKH 1AHWC 3KYKH 4ZOEA 3PNWA 2YEZB 4MD4B 2KQNA 5LAXB 2NZIA 4YHZH 2DIAA 3G08A 4HS8H 5FDYA 1CXLA 3G9AB 4KFZC 4PUBL 2NW2B 3IFNL 3SE8H 2ZG1A 3EUUA 4N1CA 1Q9KA 2P5WE 5EZIH 1ADQH 2EZ0C 1B0WA 4KMTL 4UQ2A 5EUOF 5D1XC 1YEDB 4I5BB 1JHLH 2C3VB 4Z7UF 4XP9H 1JPFB 3QQNA 4XNXH 4MCYB 4PJHB 4JFDD 5GSRB 4NOBA 1BEYL 3MGOA 3CU7A 4MA1C 4HS6B 2HT4C 3QI9A 4G6KH 2GW5A 3D25A 3VH8A 1M05B 1OVZA 5GRUH 4LLUB 4QTIL 5F3HA 1AIFA 1OLLA 4NHUA 4PB9L 1N7ML 3FQUB 5F9OH 5FYLH 2R1XA 1DQQA 5FHBL 3GJFB 5T5NG 1CGSH 2AJ3B 5CJXC 5D71L 3OB0K 5DEFA 5LWYH 2Q87A 1GZPA 4XWOC 4Y89A 3QDMB 2HT2C 2ZG3A 4MAYB 1OTTC 3A6BH 2OZ4L 1VACB 1DLHA 4XGZB 3MRMA 1MEXH 4TTGA 3KPSA 1MHCB 4U1SB 2HT3D 3WFCH 3BPNB 3DX9A 1BIIB 1IAMA 4QYOA 1E27A 4Y4HC 5JORA 1OT2A 3QXAA 1ODAA 4NQDA 5CZXD 3QG6B 2EDBA 3NZHL 2AJVL 1C7SA 4S1DC 5GZND 3LEVL 1PLGH 4F7CB 1MCOH 4U1IA 4XCFH 2DQIL 3DTXA 4FHBD 1UWEL 1SYSB 3V9FA 4UB0H 4J3TA 2MTPA 3TH3T 3HUJE 4BH8B 3TVMC 5ID1A 3GK8L 3MR9A 3SKMB 3UTSD 1P7QD 4JFQB 2YBRB 1ZOXA 1VESA 2C3WA 4XB7A 4O2FB 3I6GB 1LE5A 2CQVA 3LPFA 3QNZA 1CDYA 1XF2A 5F44A 1QSEB 4MQXC 4Z8FH 3IDIB 4YHZL 1JYVA 4WI5A 5JW5B 3EFFA 2Q3ZA 4KJWC 3EO1B 5L2KE 2ADIB 2YPLB 2DRUA 5HI5D 4DVBB 2P5ED 3H8NA 1AGFA 3ILPA 4KJPC 1NFKA 1AO7A 4TQEH 3QEGL 3R8QA 4XAKE 5BS0B 1YEHH 4JFOA 3RWCA 1BHGA 5DS8A 1U8PB 4J23A 3TV3H 3MCKB 3MX0A 5C7XH 1NBZA 4XP1H 4YHKH 5IVOA 4AG4H 2Y36H 3QUMH 4NO3B 4QXWA 2L7UA 5C0AB 2N4IA 5CJOL 5AG8A 4KPHH 2AEWA 4PREA 4PG2C 5F1OB 1IEAA 5T3XD 4PJEA 1WC7B 3GRWA 4M7LL 4GW1A 4LSTL 4PGEA 5DSCA 1A7NL 3BPCB 3FB6B 3WNPA 4P2OB 5DJAA 4I0PC 4U1GB 5DUPH 3S5LA 3VG9C 3ARGD 2GCYA 4WV1C 4GKNB 5KAQG 4JPKL 1CVSC 3ZHDA 1YJDC 3DUSA 2VXSH 4FQQA 4PJCA 3LN4A 3FN0L 1T80A 3CLFL 5M7QA 4GG6A 4M7ZB 1PX4A 4NPYA 3DX6A 1GZQA 2G2RA 2CKBB 1H5BB 2YD9A 4XZUA 5FGBA 1CIDA 3VFPB 1G7IA 5DI8B 1YMMD 1XF5A 3AM8A 4XNQB 1GPOL 4ZSOB 3MRNB 4GLRH 1F90H 5DTFA 1N5AB 4S10A 2YPLD 2X70B 2CDFA 3HI1B 3BT2H 5D8JH 1J18A 1P4LA 1CXIA 3PQYE 2HN7A 4IEFB 4R97B 4OBRA 1JGLL 5JR1L 2DQTL 5DQJA 1A6WL 4GRMB 4IOFD 2B8OT 3KPMA 2DQUL 1JV5B 2EEAA 4ELMA 1V3JA 5D9SB 2Y6SC 3O6LL 5A16B 5GGRB 4RMVA 5E1HB 4KK5C 1PAMA 4ZSOA 4UOW1 4OIBA 3QPXH 1XCTA 3BD3A 1TVBB 5GS2H 1LMKA 2BRQA 5FYJD 4FABH 3K0WA 3P4NA 3TA3D 5F93C 5EU5A 1S7QB 3MPCA 3OR6A 3OXSB 4GKSB 2Y9RT 5ILTH 1AXSB 1KCKA 2DI8A 1YECL 5D7LD 15C8H 3KGRA 4XTRD 3UTTD 4YHNB 1QFPA 2J5LB 3IDGA 2OR8A 2MPAL 3WCYA 3OBAA 3H7BA 3Q6FA 2G5BA 3V0AC 4G9FB 3IS1X 1Q9OA 2FGZA 3D2UA 4X9HA 1PVHA 4KTYA 5C8JB 4TVPD 1CFBA 4PRAA 1ETZA 1OARH 3O45B 4MNHA 5J57B 1FYTB 2DI7A 5C0AA 4L3ED 4OCMC 4IRSB 1ZVSA 1DUZA 3MLSH 4X9FA 1DUYB 5DUPL 3JWOC 1RZGB 4BZ2L 5D96B 3D0VA 1Z0NA 4NZJA 2IC2A 3IU3B 3MROB 5INDB 4L8SB 3X3GL 1CGXA 4HJGB 3WFEL 1RHHA 3BWAA 2EYSB 5DRWB 1FFNB 3M17A 1TJHL 4JREC 3WKML 3QUZD 3VXMD 3T65B 4Z7VF 2P1YA 3GSNB 4UILH 4PJIE 2AABH 1FBIL 4LSQH 1CD8A 2FLRT 4ZTOL 4HXAL 2AQ3A 2HVKB 5CMAA 4HAGA 3UJTH 1Q38A 1RIHL 4P2QA 4L9DA 1D7FA 5E6IC 5FO9B 3DV6B 5CGTA 1ORQA 5E8DL 4K8RH 4N0FB 2UV3A 1LE9A 2RR3A 4MJ2A 1MJJB 5CP7B 3PWUB 1I9IH 5DQ9A 2VDNH 2NY0B 1U36A 3GSOB 1F4YL 5TQ2L 5IFJA 2FO4A 2RFXB 5IMMA 2CLVA 5BO1L 3ZDZF 4OT1L 1KYOJ 1P6AB 1X4ZA 2VDKH 1VACA 5CLWA 4ENED 2H6PA 1NGPL 4AT6B 2EECA 5C0NC 5BS0D 2WBJD 3HZVA 4P57A 1HZHH 4M7LT 2VDRL 4CU8A 1CDUA 3CZFA 2BVYA 4I2XB 4JY5L 3SDXF 1KLGA 4HBCL 3BE1H 1FNSH 1FH5H 1KBGH 3FO2B 3FQUA 4YZFF 4M7KL 4JO3H 1KPVB 2RIKA 1E4XL 3EO9L 4B5EA 1OP9A 3SKNB 4HS6A 1FZKA 2B4CL 4QXGL 5C0CE 1IKFL 4OCYL 3UTSB 4HQQH 4KTDL 4DZ8B 1N0XL 3WIFA 1PY4A 2OP4L 3ISWA 4GAGL 4F57L 5C9JB 5GGTH 5IJKA 2NY4C 5F7NC 2NNAB 4ZFGH 3FRUA 1Q9KB 2FATH 1MFDH 1U6AL 4JVUA 2R1WB 1TQBB 5TDOB 4ZFOL 4HFWB 2PKDA 3D3VD 3VMNA 2D7NA 1C5CL 4XVSH 5IK3B 3CDGA 4EI6A 5DHVH 1TQCC 2GTZA 3VA2C 5FDWB 1A7RH 3QHFL 3DJ9A 3LSOB 3G6AB 1F3JA 1RUQL 4U1NB 3EYFB 1GL4B 3P30L 1Z3GH 2AXGB 3BIKA 4C56E 4YDJA 3WN5A 1BOYA 2YPKB 4JPWL 4LMQE 4Y4FD 5HHXH 1FC2D 4HK3N 1KJMB 1UB6A 3C5ZB 4PJFA 4NFBA 4JRYA 4GSDH 4G8IA 5FM5M 2FYYB 2C1PA 1RJYB 1QSED 2D03L 3FTGB 4Y5VA 3QFJA 4HUXB 3OF6D 3MLYL 4ODBD 5FYKU 5IT2H 1PQZB 3ARTA 1U8HA 1ZSDA 4YPGA 3KNBA 4ZTOH 5GJTH 3BDYL 4GBXD 3E2HB 2A6IB 3A0OA 1PG7L 5IVXF 3CD4A 4KZEH 3RX7A 5D7IF 5EOTA 1AXTH 1TZIB 1W0YT 1WUNT 4NRXA 4XPFH 5KG9B 3CK0L 3QDJD 4EN3C 3IFLL 4XB8A 2ICEA 2BSRA 4OCWL 4X6CE 4LFHD 2FD6L 2VDPL 3V5HB 5JPMB 3OR7B 4UT6L 2QHLA 4PJ9A 5EC2A 2GJ6D 3CVIH 4WUKH 1QRNB 5F9AC 3UTPD 3LQAL 4UTBL 3MCG1 1PZUB 1NH6A 3O0RL 1RZKC 4WI6A 3VGGA 3WUWB 1JPGA 4Z7UB 3BGAA 3DYPA 3PDOB 3V2AR 2WWMD 5ALBH 3MRLA 1NANH 4J3OC 2GQHA 2DF3A 1M4KA 4E9LA 3TVMA 1HNFA 1MFCH 4KJYB 3K46A 1I8KA 5LXGH 3MO1B 2O61A 3JTTA 4PV9A 4HKZA 1AH1A 1CXHA 1U42A 3UTZB 3TJHD 3BT2L 1MOEA 3DNKA 1UENA 4Y4KB 4ZUTA 4X4ME 3AUVA 3ZL4L 2WUBL 3PP3H 5C0JA 4JHAH 3L3OB 5JDSB 1U8IB 5D4QA 3O6ML 4KHTH 1KJ3L 5J9PA 1BVZA 4P23D 1A2YA 2YKLH 3QRFM 2X9YA 5F3BA 1D5BA 4H1LG 4PV8B 2QQKH 4Y2DA 1BQHB 2Y06L 2EDRA 5CZVH 5EO9A 3L5HA 4K9EL 2VLJB 2F8OA 3GUTA 5KVEL 3VXQB 5C09B 4PJBF 3EGSB 3NH7L 2VZSA 2B1HH 2VXQH 3MA7B 2NX5A 3OKOB 3T8XA 3WD5H 1GGBH 4Y0GA 5IVZA 5MEOB 3QUXC 4JZNB 5BXFB 3UTTE 5KSVA 5GRJL 1I8IB 4PY7A 3S34H 3IXAA 1KBGL 3VWJA 3TVMB 2IANE 4RX4A 5TF1L 4LSSL 2ZKHL 4LPTA 3GMLA 1KJ3H 2X4UA 4OLYL 1C16A 4ONHB 2E9BA 4QF1A 3E6HB 3U2SA 4KZEL 3I9GL 3QJHA 2HYMA 4CW1B 1HSBA 3RDTA 4GMSL 1HH9B 4U6TA 3L3GB 4JRYE 4EI5A 2EIZB 5GSVB 3RWIB 3C5SB 3GBML 3MRBA 2EC8A 2X4QA 4GXUM 1F13A 43C9B 1J8KA 4OCXH 2FJFA 3WFDL 4K71B 2JK5A 1PKQB 5FM8A 4HWBH 4Y5XB 3DPBA 1R0AL 4WWKA 1X5LA 1J0KA 3ULUH 1YN6A 2M1KA 1FVEB 4RGOH 1MJ8H 3ZLQC 4L8BA 4UU9A 4UIMA 4Z7QF 2QSVA 3RIAK 1QZ1A 1KJ2L 4BQ8A 4Y5VB 4U3CA 5DJYB 5F21B 1C08B 1TVHB 3IDYB 5I15L 1HOCB 4ZNCD 1UB6B 1IE5A 4RQQA 1CFSB 1A5FH 5IHUL 4MA1B 5JOEA 2AXGA 1RZJL 1QBBA 1WIUA 2X09A 4LOUC 4PBVC 3RL1B 2NR6D 3GEWB 3ORJA 3OJ2C 4G6FD 1UZ6E 5CBEA 3MNWB 4POYA 2B1AL 2VDOL 1AD0B 3FO0L 5ENWB 3QIUD 3D85A 3HE6B 4JFXA 5DMKB 1KT2A 3ARDC 4JFEA 1JL8A 5FB8A 5KVEH 4UIKH 3QXWA 1JUFB 4JVWA 2NNAA 3CAFA 5DMGD 3IFPB 2A83B 3RI5F 1IFHH 2BOBB 1UM5H 2WWKT 5HY9A 1JWSA 4JY5H 2VABB 2X9WA 2A6KB 3FOLA 1FH5L 3GHBH 3GMMA 2C7UB 3Q1SL 4N1HB 3AC0A 3MJ8B 5T1KB 4PRHD 3WS6A 2KBGA 3V95A 4D0CA 5FOBA 3SKNA 1R5VB 3U7YL 1L7TH 4M9PA 1FO0A 3Q0HA 5AZ2H 3VGAC 3RVTD 3RUGB 5E2WL 3BO8A 4PJ5B 5F7FA 5HHMB 2MCPH 3BDXA 4OGYL 4POZC 3MUJA 1RJLA 1AKJA 3WLBB 1C5BL 4ZTPH 2VLRA 2VLKD 1HHGA 3FRPG 3UYRL 3IU4L 5LXGL 1CF8L 2H2SD 4QRTB 3DMMA 5GIRB 4MDIB 4MCZB 3BKYL 1OCWH 1BBJB 5BRZE 1OGTA 2Y7QB 1F97A 4GAFB 3QEQB 2EC9U 1AC6A 4RNRB 3G04A 1DBJL 3VGDA 4MHHG 5IFJB 3V7AE 1MJUH 1R3LA 4JY4B 3FB8B 3MLTB 1BBDH 1MVUA 3GSVB 3EYUH 1HILB 1RK1B 3NMEA 3OG4B 4WUUE 1OW0A 2IWGA 3PWUA 3S6CA 1T1ZA 3BE1L 1DSFL 2HG5A 4KJWD 2KH2B 1AGEB 4P5TD 1ZHNA 5DWUL 5TGBB 4EUPG 4ZXBC 2X4RA 4ZPTA 4NQVA 1MWAL 1V5JA 5DZNA 5GS0L 1S7RB 5SV3A 3ZTJH 1IM3B 5FGBC 1NGPH 1ZLWH 2Q86A 1XGYL 3GSXB 3QPQD 5HGBA 5F7KC 3QSKB 2F58H 5I30H 1YDPA 2ICWB 2XACC 1CGVA 2ZNWA 1IRAY 4H20H 3QCVL 3GSXA 1Y18B 1XIWB 2R1YB 4HZLA 1RY7B 4MXVF 4NRZA 4UUJA 5T3ZD 4MA7L 1D9KD 5H94B 4LSPL 2HG5B 3ZDYF 1LO2L 1KG0A 2CGRH 4QHKI 3TPKA 4N0UE 5TH2A 1UKTA 1IAIL 1ZTXL 2OXGA 2H45A 3DURB 3VFUB 3LKSA 3IU3A 3ARGC 5ETUB 1RZKH 3L3DA 4KI5C 3Q3GA 2VUOA 4IS6B 3TEUA 1T20B 2X89A 1ZHLA 4NDMB 2JJWA 8FABA 1F2XK 1HH6B 4FQHB 5EZLB 3T3ME 4L4JA 4DAGL 3BVNB 3ILQC 5A2LH 1FL3B 1S5HB 5EIQA 1YA5A 2Z35A 2G9HB 2D31B 2VDMH 4L4TD 1D5XB 4Z78B 2V9TA 2ERJC 4GQ9H 2VE6A 1RUPH 3KWWA 1J0JA 4UUJB 3ARSA 4Q2ZA 5E5MA 5ESQA 5FOBB 2FZ3B 1HKLH 1NBYA 1I8LC 3QDGD 3OAZH 4K7FA 2CD0A 4FOMA 5HY9B 1S7QA 1BZ7B 1SMAA 1G9ML 4HCRL 4LGPB 3C60D 2Y6SD 1SY6H 4KDWA 4JG0L 4MMXC 2EEBA 5CEZH 3D2UD 4P46D 2BK8A 5FYKD 3SDXE 5D6DC 1KT2B 3AB0C 5D7JB 5EU6E 2EDLA 3BKML 4MS8D 3TBTB 5F6HJ 4NN5B 3QNXA 1R3LB 3LOWA 3VXUE 3VFMB 5D5MA 5FUOL 4NZTH 5DQJB 5CBEB 3ME0A 5BV7L 2W91A 4IDLA 1MCWW 3OPZL 1SJHA 4JANB 1A4KA 3K1KC 3IF1A 4UDUA 3MRDA 3KXFB 4MCZA 2JCCE 5F7EH 3PUCA 4PBXA 3SJVE 1QLFB 3ZYZA 4DUXA 1CN4A 4JM2F 2NY6D 1FGNL 2FEEL 2AS5M 2RAMA 4AEFA 1KPRB 2JIXB 1G7QA 5CKGA 5IW3A 2OR9L 2CRYA 4ZOBA 4XHQA 1YEFH 1Z3GL 4KGLA 5SX4H 2OCFD 1KEGL 2L4OA 2XNAA 4JM4H 1PSKL 5CJBA 2X1QA 3QO0B 1JGUH 1TLKA 1E0OB 4Z0BL 1DFBH 3QEHB 3ZT5A 3PIQB 2EDKA 3ULUC 2ATKB 1T83C 4Y16C 2A83A 4YXKH 1EAPA 1UJTA 1LWRA 1WISA 5DJAB 4AM0B 4P2YA 3BPCA 4WW2B 2QSTA 4KKCD 5ITBH 3BDYH 3FO1A 3SDXB 5EC1A 3PHOB 1X4XA 5JHLH 5B8CB 4UBDD 4JFXB 4M1GL 4Z7NE 2VR9A 4KKAC 2AEPL 2AP2A 1RZKL 2NY0D 4ZUWA 5IBUG 5IJVB 4PRPE 3WDHA 1MCQA 5EWIH 1N6VA 3MRCB 3I84A 4UQ3A 3IXAB 3TP4A 3VGFA 5CAYB 2CDGA 3C5JB 4GRWF 2EH8H 3RIFF 3TZVA 2XXCB 2FWOA 1WFOA 3WFHB 1CFSA 4Z7WF 4X6CF 5MENE 4MXVE 4XAWH 3WJLA 4OQTH 4H20L 5MI0B 4WVRA 1LO0H 4RGNE 5E4EB 1IZKA 1XF2B 1UJ3C 5K9QG 3ECBB 3T0EB 3L95B 4F9PC 1PYWA 2XWBB 3T0VA 1CFQB 4U1LA 3W39A 2EXWD 5I1CH 2FRGP 2LFGA 5ADPH 2KZ1B 1K2DB 3OV6A 1OHQA 5BV7C 3ETBF 2IQAA 1I3RA 4WHTB 3ABZA 2ZJSH 3N85L 4RMQA 2GJJA 5FYKE 1MHHB 3QIBB 3QCTH 3EJZD 1FAIH 5SX5K 1QNZH 1IGFL 1E27B 5CIPH 4CW1A 5CEXB 4ZS6C 1Q72H 3VD3A 1U9KA 5MEPA 1KF9B 4PY8J 2N7AA 3NCCB 1REIA 5E8PA 1LEKA 1BWWA 4MNQB 1FNAA 3P0VH 5T1MB 1P2CB 4N8VG 3U48A 3J7HA 4QTHA 4PY7B 4TOYH 2R2EA 5DC9B 4UAOC 5BXFA 5KSVB 3QHZH 4JRWA 1I7RA 4NKDB 4G9FE 2AJ3A 1FVDB 3JWDL 5HI4D 2H3NB 3UTTB 2OLDA 3RWGB 3QQ4A 1HNGA 2P46B 3QXTA 1NAMH 4N0UB 2FNBA 4WHTA 4RZCB 5JW4M 2RBLA 3TN0D 4OIAA 3B8SA 5TFSH 1KCVL 3CJJA 4NQEB 5TDPA 3L6FB 4F3FB 5D6CB 5GISH 3WFZA 4NRXB 2YS4A 1QA9B 1YMMA 4JDVA 5GRYA 1IGFH 3MLXL 4QY8A 4HDIA 4S2SB 1D5BB 1J0IA 4FFVC 4XVTH 4FQ2L 4K3DH 3NABL 4U0RB 5D1XA 5DEZA 2YHGA 1U93A 5I18L 5KSAA 4KZDL 2XPGA 4XC3L 2ZSVB 1N59A 4E0RA 4KRMB 4ZTPL 4PJ5E 5HHME 43CAA 1JWMA 2BMKA 3GJEA 2YPKA 2P5EE 2DLFL 4JAMB 4ODUA 2R2BA 2WLYA 1I8KB 4NBXB 2G60L 2C4FT 4K2UL 5I15H 5ECJE 2ZG2A 5GS1C 3OAYK 1G9NH 3ARZA 4PGDA 1ND0B 3CDGB 4LCUB 2H41A 2CR6A 2VDQH 2DAVA 3KPLA 2ARWA 1GOFA 4Y4HB 3JVGA 2RCSH 5HHOA 5A2JH 3VG0H 1OOAA 1J8HD 4AM0A 3V4PL 3VGBA 5CJ5A 4I9WE 2X05A 1AI1L 1MQKH 1HHHA 3HE7A 3F7QA 4LVOC 5IOPA 1T5WA 2QLVB 5EFIB 1EAJA 4LEOA 1AFVL 5CWSA 1AQDA 1OGAD 3IKCB 4DTGL 3RZCA 4OCNC 2XZAH 4X4XA 3UJIH 4TOYL 5FXCH 2AI0L 2O26U 1MWAH 4NQSB 1G7QB 5C0RH 2QQQA 5MERB 4PJFB 2VB5A 3W0WD 3WFBL 5AYUH 4LCIH 3CZFB 2BP3A 4M03A 1QFWI 5IT2L 4YDJB 3BHBB 2LABA 3BX7C 4V1DE 4F7EA 2H6PB 2L0DA 1D5MB 1UACH 4GSDL 3MLRL 5CEYB 1N64L 3T1WA 3GSOA 4GKZB 1DBKL 2Y5TA 4EBQL 2J7LA 3CVHB 3LRSA 5HBBA 3FFDB 1KXQE 1MCPL 5IFHH 5C0IA 2HRLA 5GHWL 2DI9A 2B4CC 3PWLA 1J1OL 2HFTA 2QQLL 4FFWC 3U0TB 3QUXD 3QXDB 3KAAA 3NFPB 4U6HB 1W0WA 4WWKD 1V3KA 3HR6A 4IIQC 3TFKD 4YBLC 4I18C 5BVPH 3BEVB 2J1KA 3CH1B 3MLWH 5FOJA 3RZCC 1I7ZB 3O3EB 2P44B 1UXSB 4APQD 3UPRA 1NMCB 1TETH 4HPYL 4YO0B 1NDGA 5C08E 4LVHC 3O2DL 3LKPA 3MRGB 3A6OA 5KVFH 5ALBL 3QB7C 5HHXL 1N64H 2FBOJ 3JV5A 3VFNA 4LAQL 5ICYA 4GMTH 4L8SA 1S7WA 3MFGB 2A9NL 2E7HA 4FZEH 4TRPH 2E8YA 4EOWH 3MRQA 4X5LA 1RHFA 4J2XA 1BFSA 2XTJB 2GTWB 4GRLC 2D0GA 4H26B 2OXHA 3IDXH 2MQ3A 4TUOA 5ADOL 5CJQH 4C83A 2KPNA 4G9DB 2DL9A 3CPLB 3O45A 3H6JA 2EDDA 1I8MA 4KTEL 4Q58C 4MMZC 1F3DJ 4HHAA 4IMKA 4JFFB 1MI5B 4LSVL 3WS6C 5IF0A 4AIOA 3DVNA 2VL5B 1D6EA 3DO7A 1A9BB 4WI3A 4M1CC 1Y18A 1GGCL 2CIKB 2XN9E 5DHVB 4YHNA 5DXWA 3NABH 5C0BA 1AGDB 2CJUH 3HG1A 2IMNA 1A22B 3BPOB 3QQ3B 4IRJC 3BQUB 3E0GA 5L9DH 1T1YA 2AW2A 4R90L 4X4ZA 1FGNH 1S7UB 1NGZB 2NZ9D 5CLTA 2VLJD 2HWZH 3O2DA 3CCHB 2X4RB 4CRPA 4UOJA 4HLJA 5CS7A 3GZKA 4TPRL 3ARDD 4I3RL 1FZJA 3DIFA 2IPKB 3OB8A 3CFJA 2DDQL 4OTXH 4WFFD 1YEIL 2GK0A 4MD0B 4LP4A 1M7IA 3OKYA 4G7VH 1T22A 5DMGC 1OD9A 4XVSL 4D9RE 2QQNL 3ALWA 5ALCL 3D0VB 1UFUA 3GSNL 3DHMA 4DEPB 1E4XI 5TF0A 1OSPL 1IAKB 4ZXBA 4MDIA 5ITFA 3TNNB 4IMKC 3UAJD 3MJ9H 1LEGB 4WEBH 1XGPB 1IQWH 5CUSH 5I1AB 4MNQD 5FO8B 2IMMA 4I1NB 3QRGH 4LGSB 5DI8A 4WFED 3MRKB 5DJDA 4HT1L 5L8LB 2Z31D 4TULL 4PJFE 4XCCH 5D2NC 3WHXB 5GS1B 4U4BA 1MVFA 1W2KT 5HYQA 1BVKB 1A1OA 1DLFH 2ZSWB 3H3KA 1QVOB 2XRAH 4OZ4B 5EDXA 5C2BH 4C56A 1U0QA 3CGTA 5CIPA 3RNKB 3V52L 4TUJB 3ZHKA 2XV6B 3EBAA 4LNRB 2Z92B 3TV3L 4PGJA 3FZUC 4M5ZH 1H0DA 3G5YB 4P5TC 3O11B 5A16A 1KN2H 4M00A 1LEGA 4PS4L 4TSCH 4GS7B 3U4EB 3TNNA 5ENWA 35C8H 3SDCB 4AQOA 4DFHA 4JY6A 4F15B 5INCA 4OLXH 3QPQC 1B2WH 3UROR 1EMTH 3MCKA 4LHUD 4J3SA 5DS8B 1NFDF 4URTB 1MIEH 3ROLB 2AJYL 5FA4A 1G0DA 4PJEE 3WIIH 1D9KC 3STLA 1A6AA 3MRNA 1DVFD 3MODH 2V2TB 3P9MB 3LQMA 1MF2L 4I0KA 4UTAL 3DETD 4PRIA 1MUJB 5DRZB 3ARBA 4KKBC 3ZE2F 3I6GA 1I7UA 5HD8D 4NKOA 2MJWA 4PJGE 1MFEH 1AXTL 4GG6B 3QDGA 3PHQA 3LN4B 5ID1B 2RGSA 2DQGL 2YPVL 5HHQA 3VW3L 1WJ3A 2CIKA 4JQVC 3UEZA 4FXKB 5L0QC 2AEQL 1CLOL 2VH5H 5EUKB 2VL5A 1HSAB 4FQXD 1CDBA 4O00A 5GSVA 1VPOL 1DL7L 1CG9A 4H25A 4HIHB 5DK0A 3MXVL 4PJEB 3B2UC 1RQ5A 1RZJC 2QADB 1JPTH 5FM4A 3VXRE 1IL1B 1T3FA 3CFBA 4QF1B 2D3VA 4A2MA 3U2SB 4Z7VB 3GRWL 2W38A 4YC2B 2R0WH 1EH9A 3OXRB 3GKZA 4WEMB 5K9KB 1B4RA 2OQJB 4ODTL 5JXAH 1GZPB 3HHRB 4NO5B 3TYFA 2HLFD 1P7QA 4KVNH 3QIWC 5ACLA 4WFGE 3HUJA 2A9MH 1F45A 4N9OB 3RVVC 1H8NA 2R1XB 5HYJD 3IDIA 4RMRA 4CL7A 3B5HA 1B4JL 1BFVH 5HHVH 4RFNC 3QFJD 1SJEA 3I50H 3UJJL 1WZKA 2VIRB 4V2CB 2BVUA 4O2FA 1DN0B 1LE5B 1IC1A 2YBRA 4IRZL 5DVNA 3CIQA 4JQIL 4PJ9C 3TJEH 3C60B 2JCCA 3L7EA 4FMKA 4JFHD 4XPGL 3O8XA 3LB6D 4XBGA 4KVCH 1EVTC 4P5KA 5JDSA 5C0JB 3PWPD 5GISL 4EI5D 4LLQA 5DMIL 5LQBL 2NW2A 2Z8VC 1RUPL 2X7LB 2QQKL 1N3NB 4CN4A 3EHBD 3UTZA 1I85C 1OLZA 1IM9A 1E4KC 1YN7B 5I8OL 1CXFA 1D9KA 1VFMA 3T0DA 4CJ0A 2DOCA 3V6BR 4IHOB 4XC1L 2GJZA 3FCTB 4M5YH 3GHEH 3HI5L 3WJLC 4DJMA 1NAKH 4DKEH 4EVNB 5HYEA 2P48B 4NWUL 3ARBC 4KUCD 4I0CC 1BIHA 1JZ5A 5DGRA 2X4PB 2MNUA 4JDZA 1S7SB 2B0SL 5IIEA 3LVEA 4KKCC 4H0HB 3MREA 3CXDH 4P2CG 4X4MA 5FUCE 1VFBB 3BUYA 4LLUA 2ZUQB 4X7CC 1VHPA 1JZ6A 2NTFB 3FO9A 4MVBD 2BNQB 4PRDA 3HMWL 3GMPA 2JB5H 4QXUH 4NQED 1N7MH 1A21A 1A7RL 1QTYT 4CADA 3F5WB 1MCOL 3QIUA 5DT1H 4OZIA 3QFJB 2EE9A 2YOCA 4LRNH 4IBLT 1FRGH 2WLZA 4Y8DC 4U1HA 1NUGA 4JRYB 4JDZB 2ESVD 5A1AA 4TQEL 3CUPB 3C6LD 1KCRH 2WBWB 1J1XL 4YHLH 5BOZG 3QH3A 4YHOH 3AMLA 1F3JB 3HC4L 1HI6A 4TRPL 4XMLL 2VDLL 2GSIA 3RTQC 4M6OH 5D7IB 4OM0L 5AYQA 4LLWB 5IB5A 1IM9B 3PV6A 3PQYB 3SOBL 3EO9H 4DOHE 5KVFL 1GGIL 1OAYH 4HFWA 2F54A 5IV2A 1JPSH 2ERJB 1AC0A 1VFAB 4AEHH 1QR1A 3STBA 4FFZH 4Z0XA 2VAAA 3GO1H 4YUEH 4MLIA 3TN0A 1NGYA 1Z9OA 4D9RD 2R2HB 1DANU 1M6OA 1G0XA 4P49A 2IPTH 4WI8A 3MLWL 3NZHH 4P59H 1NGWA 2I07A 1V7NL 4WFFE 1J10A 1MFDL 1U6AH 5TDPB 5BO1H 4QWWD 3CZJA 5IBUB 1SJEB 4KQ3L 3HR5A 5IQ9B 3P0YL 2DYPA 3MREB 4X6EA 4MXQC 2VXSL 4D8PB 1KLGB 4MD5B 1XF4B 1MRCL 4B50A 3FT2B 3MRRA 2WP3T 2P5WB 2XN9D 5DD5L 1UH3A 3P77A 2CLRB 3KYMA 3SQOL 1QR4A 1U8JA 1CGUA 3OB0H 3U4BL 4WO4C 4YNYA 1U8LA 3QULA 3CFDB 4X9IA 3HG1D 3T0BA 1B4JH 1BFVL 5HHVL 3SGKA 5A2FA 4XNYL 4G6FB 2F8XC 1QBLH 3O41B 3IAPA 3QIBA 5K33A 4BK4A 5IHZA 3HNVL 3DV6A 4C4KT 2E9IA 2J2ZA 4FXKA 4NWTH 1RJZA 4MHHI 5JUEH 3ARDA 1FN4A 4WTZA 4AH2A 3C60A 2XY2A 1NFDE 3SGEI 1W0VB 3QDGB 3WEXB 1AR1C 1PYWB 2XWBA 4TSAL 1MCSA 3O3BA 3RKPA 4YXHL 4OCLC 2WNGA 3ARBB 4PRPA 4JPKH 1MUJA 5DRZA 4W6WB 1XR9A 4PJAA 3PJSA 1W72L 5D1QB 3I3DA 2PO6C 4G8GA 3BWAB 4Q9QH 5SWSA 3VD7A 4LHQB 2CJUL 5J1AA 5T1LB 1BOGB 3BKJH 3QUZC 4AENA 2Y5EA 4TSCL 1FCGA 2CMRH 4H1LA 3BP4A 4JM2B 1IJ9A 4P3DB 5FA4B 1EBAA 3FB7B 2R69L 1A1MA 2VZ3A 1WT5A 1EGJA 1DUYA 4EXKA 2CK2A 5GRZA 4DAGH 4RISL 3FHAA 2AK4B 1NBQA 1T2QL 4AL8H 5T33H 1T3FB 3VG9B 3WFEH 1JWUA 1LK2A 1G9EA 1HN1A 3O11A 4PR5A 5EOCL 3G5YA 2DQEH 1JYXA 3FO1B 4P2RB 2W0PA 4OI7A 3GSQB 4LNRA 2ZWLT 3Q6FB 4LDLB 1HHKA 2R8SL 5HDBE 1UM6L 3V8CA 5F9WB 1W72H 4ZOCA 4XXCC 3AVEA 5IESH 5CUSL 4JN1H 2P47B 3NGBC 3RJDA 4IMLB 3KPRD 1I7UB 3MACH 1RD6A 5HPMA 4LKCA 4PJHE 4LDEB 1XEDA 4BH7A 4NC0B 1DBMH 3CNKA 4IDJH 5L6YL 1O7VA 4JB9L 4PGZA 2H26A 1FORL 4XPBH 1CE6A 5FO8A 3I85A 2IQ9H 4LLVA 1G7LB 2HRPL 3STLB 3MFFB 3BRDA 3WL9A 3QUYA 1T21B 3GMRA 4QHMB 5I1EL 4JFDE 3TZVD 2CUIA 5DGQA 4QLRA 3GJFH 4X6DB 4AEHL 3DVFA 1MFNA 4L4VE 3S4SG 5D5MB 4JHBA 1KPUB 2X70A 2V2XB 3HI1A 4HKXB 4U1KB 3U4EA 2LQRA 1LD9A 3GM8A 4HK3J 2CUHA 2AEIT 2Y72A 2ZZUT 3MXVH 3MNVA 5IBLC 5D7JA 1DQDH 3U30C 4U1JB 4AEEA 4F7PA 2A1WL 5KN5B 4E41A 4QTIH 1MAJA 1FFRA 5HJ3A 3VFPA 1DQML 1S7TA 1H5BA 1V3LA 5T5NF 5JDJA 3D85D 5KTEL 4U05A 2AI0H 2DWEA 3MRHA 5H37H 3ARQA 4S1SL 5HYQB 3DUSB 3RWEA 3VFGL 4F8QA 1J8HA 2YA1A 5E5MB 3AREB 1SM3H 5ESQB 3HFMH 3MRKA 3X14A 4P2OA 1D6EB 4D0DA 3FB6A 1U2CA 4CN6A 1WWWX 5TQ2H 4P2RA 1MI5A 1U91A 3N06B 1QSFE 3MTRA 1WC7A 5L2KB 1NUNB 1I8MB 3V0WH 5KBNC 3UZQA 3REVA 2CPCA 3CPLA 4PJ7A 4FP8H 4EBQH 1TCRB 1Y0LA 5JIHA 2RCSL 4K8RL 2AK4A 3MLRH 1C5DB 1NBZB 2R8SH 1T66C 1UKQA 5KS9A 2ID5A 4XNUH 3IDMA 5E94A 4MJIE 1JTTA 3RGVD 3DYOA 3FT4B 4YDVB 4BZ1L 3PHSA 3BGFB 4BA8A 5JUEL 5E8OB 3TBSB 1NCWL 4KKNA 4DGVH 1BOGA 3M45A 5IR1B 1FGVL 2CKBH 5FO7A 3ARWA 1EVUA 3NGBB 1F00I 4ELKB 5H94A 1MSPA 4XMKH 3PJSB 1ZT4A 4GO6B 5JHDE 4FQ1H 1XCQA 5HYJE 1ITBB 3ARYA 3MYJA 1Q0XH 4PRHB 1I7ZA 2ADGB 3LCYA 2APTA 3BEVA 4BH8A 3BH9A 2JB5L 4YEFA 1SYSA 3D0LB 4KVCL 2D03H 3JWDC 1DEEB 1VB9A 2WWKO 9CGTA 1A9BA 4FQ2H 2P5WD 2XN9B 3L3IA 3LKQA 5B3NA 1ZHNB 3S3PA 3DROB 1EJOL 4XP4L 5EG6C 1K85A 3DVIA 3O6KL 2F5BL 3ZKXC 4KUZL 2XOTA 1Y6NR 3RY6C 1V05A 2ZCKH 3KPSB 2FECL 2Z31C 3QWOA 4TUOB 1MHPL 4UB0L 5DVKA 4Y1AD 3QUMB 4MWFA 4J8RA 1U8JB 4Q6IA 2VN7A 4LSVH 3MXWH 3EOTL 1BX2B 5HHOD 4S1SH 4OAWB 2PW1B 5GRWA 5GIRA 1RIUH 1BZ9B 5LCVL 3DMMB 4EQ3A 4PJHF 4LF3B 3I75B 3E8UL 4R4ND 4YDKL 3BPOC 1T1WB 3PWVA 3BSZH 3TO4C 4M9OA 3MOQA 4XCEB 1U8QB 3U4BH 1GYAA 1MFCL 3D25B 4HT1H 3RHWK 3KPSE 4ODSH 3IKCA 3LV3B 4TULH 3HI6H 3QA3A 4OFYA 4DOHB 5A40E 4NSKB 3ARRA 5I8KH 3QHTC 4LAQH 4P9ML 1QG3A 3LZFH 2ESVA 4OV5B 5IMLB 3BP7B 1JWSB 2XWJA 4HKJB 3RTQA 1MH5A 3ET9F 4O9HL 2XICA 5JR1H 4P23B 4N0YL 1NJ9B 1ROWA 3GMOB 3V6FB 1XIWD 5ADPL 3CK0H 1X5YA 2QQNH 5ALCH 3UBXB 2AXFB 4G43A 3BYTA 2FX7H 1KC5H 1WZ1H 2CKBL 5J8OA 2IPTL 2Y5TB 1SHMA 2PXYD 4PJ8A 5DK3A 5C6PB 5ISZA 1A3LH 2N56A 3VXMB 1NGQH 4QXTA 3X3FH 1YEKL 3OAUH 2OJEB 4PJXF 2DQDH 2DLEA 1FL5B 1CU4H 1D5MA 3QXUA 5MEQB 4P0DA 2IAMD 2Q1EA 4Z95L 1X5HA 4KRLB 2VLME 1H3PL 5F7DA 1CTNA 2KDGA 1IGTA 1CWVA 4JJ5B 2E8ZA 4I4WB 5DQDH 5I74C 3D39E 3PE9A 4K8RD 2EC9T 4YHMH 4XMLH 5DMYA 2O93L 1F4AA 4CADB 5IEKB 1JN6B 2WM0A 1AQKL 4M1GH 3TBVA 5CWSB 1TITA 1ZV5A 1ZWIB 4M3KB 4AY0A 4YK4C 1ZA3B 2EXYC 2UYLA 1ZT7B 4JFZH 3FJTA 2C3HA 5DVMA 1HIMH 3RAJL 5I75B 1NC2B 2D9QB 1WAAA 1KB5H 3E3QE 3SHSA 4KVNL 2EIZA 4GW5A 1F4HA 4EI5B 4ODHL 2YN3A 4E5XB 4XAWL 4LPXA 4BZ1H 2VERN 2ARJB 3V5KB 4DK6A 1I7RB 4NKDA 3RP1A 3W9DA 1C16B 3B6SA 4ONHA 2R9HC 4OZIE 3GRWH 3NH7H 2FSEB 1ZEAH 3DHJA 2GFBB 5D1ZD 3VWJB 2FL5B 1X5XA 3PWJB 1CDCA 3ZT7A 4K3JL 4P5MA 4U6XA 5HGDB 2R2BB 2FEDC 2D7PA 5EU6D 3KLHC 2BSSB 3OKEB 1JTOA 4PY8I 3LPGA 4LVOB 3RUGE 4LLQB 2H9GA 3MBEB 2BC4B 2DS4A 3EO0B 1QFHA 1DE4A 2DQCL 1F3RB 2IADB 4P5KB 3T0EE 3VXQA 4XBGB 2EICA 1BQLH 1ONQB 5T3XE 3X12B 1RV6X 2ZOLA 3BW9B 4KMTH 4X4YA 2XZZA 4HLZH 2ZUQC 2AGJH 4Y2DB 3MOAH 4IJ3B 3ULUE 1A8JH 3M1BB 3NFSL 2P43B 5GHWH 5I74B 4ZAKC 3T0EA 2FX9H 4NM8L 1FPTH 1YYLH 3IDNA 1VEMA 3ARBD 1JE6A 1K8IA 4NQCA 4S1RH 4KWUA 1A7PH 4Q9RH 3GI8H 3LD8C 2J6EH 2FIKB 1UWGH 1B9ZA 2OMBA 4ZUTB 4HKBB 2XWTA 5F96L 4KH2A 5L2KD 1ZS8A 3LKRA 1AGBA 4WIQA 4EXPX 3R06A 4ZXBD 4YFEA 2E7LA 3NFNB 4X98A 3RIAF 3MO1A 1E6OL 4QTHB 2AABL 3OKDB 5HGGS 4L4VA 3SGDI 5T1MA 4UQ3B 4OF8A 4GUPA 2DIBA 4ZUUA 3ZYOA 4FQIL 4LPCA 5I1CL 4OI8A 3SCMC 5IHUH 2X2YA 4WUUD 4XPFL 1WCBB 4HK0B 2E5EA 1IL1A 4PJBB 1DN2A 4F8TA 1EDQA 1LO5B 1IGYA 2CRMA 1NC4B 4BKLB 1Q9WB 3K4AA 1N6QL 2PN5A 4PJ9B 5EC2B 5KVGL 2PNDA 3DYMA 3HNSL