3VFGL

Crystal structure of monoclonal antibody 3f8 fab fragment that binds to gd2 ganglioside
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
SIVMTQTPKFLLVSAGDRVTITCKASQSVSNDVTWYQQKAGQSPKLLIYSASNRYSGVPDRFTGSGYGTAFTFTISTVQAEDLAVYFCQQDYSSFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3F8 Light Chain
publication title In silico Driven Redesign of a Clinically Relevant Antibody for the Treatment of GD2 Positive Tumors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfgL01
3RWJB 3DO3A 4NHCH 5CJ8A 1ZTXL 4FS0A 3FB6B 1KENH 4HGWB 4P49A 2E8YA 4R4BA 4Z6AT 3PIQB 3CGTA 4HWBH 2H1PH 1D7FA 1FZOB 3O6MH 4X0KB 5FFLA 1EAPA 5T3XE 1SMOA 4MA3B 2VISA 1UZ8A 4JLRB 4FABL 4LPWA 1OW0C 3TH3T 4MDIB 5INCA 2BSRB 1FNEA 1ZLWH 1JUFB 4J23A 4JGUA 4HIXL 2PW2A 5DUBB 3LIZL 3BPLB 2AKRA 3FO2A 3SJVB 1GZQA 1LO5B 4RGNC 3EYUL 1KCUH 1YZZA 5CJQL 4M93C 5JOFB 4PTUA 3BD4A 4OTXH 3HUJE 4ORGA 3HUJF 5D7JA 4ZAKD 2FJGA 1KTLB 3MLVL 2Q1EA 3BH8A 3HI1A 3NVQA 2HLAA 4IHOA 1BX2A 2OI9B 3OF6A 4YHOL 1QSEE 4LNVA 3HCVA 5CBAB 2OR9L 3OB0K 2C3GA 1C7TA 3UEZA 4HK0B 1TVHA 3K80A 3QULA 4X9IA 1P4LA 5HVGB 4MJ6A 2BNUB 1L6XA 1IEAB 3HG1A 3LIZH 4JDTH 2UWEB 4L8BB 3FRPG 2VLRE 4LLMB 2Y7QB 1CXHA 1H15B 5C08B 2YHGA 3L3OB 4XHJC 4IOFD 3EO0B 2YOCA 5BS0A 3T0AA 2LU3A 3MLVH 4F33A 2WP3T 2E27H 4Z9KB 3RHWK 2DMKA 1UB6A 2G2RB 3BIAX 3HE6B 4YJZL 1HEZA 2YD4A 4HBCH 4XNZB 1K5NA 3QDMB 4HUWA 3PABA 4X83A 5IB3A 3UYRL 5IVXE 5KAQF 1S9WB 2PYFB 5IVXF 4HC1A 4R96B 1HH9B 1D9KD 4HJJL 5TDPB 2BVPB 5C07E 1OCWL 1DDHA 1BOYA 4Z7UB 5F71A 3SJVD 3AB0B 3ECBA 5F88B 2AEQL 1PKOA 2F54B 1S9XA 3V52H 4JFEA 1OQXA 4N68A 1EO8L 3QHFL 4N0CD 5A2JH 1CFQA 3DYMA 3HE7A 1DL7L 5F3BA 5FGBC 1EV2E 2VDNL 1QSZA 1T7XA 3GB7B 1IM9B 1JMXA 4N8PA 2JIXD 1ES0A 1KXTB 1AGDB 4NO5A 3SDAC 5E4IA 2XTJC 3FRUB 5DFWH 1XIWD 3VA2C 3B9VA 1WFUA 3C08L 1N3NA 4CVUA 4KDWA 1FSKC 2FEEL 4X4ZA 3BQUC 4OGAD 2X4TB 3JSSA 3MRGA 1KCRL 1E4XL 1CS6A 1EEZA 1OCWH 3TGXA 2HH0L 3MRNA 5JW3H 1OP5K 4AENB 4FQ2H 1B4RA 3ARSA 3G08B 1BOGB 4ZS6C 2AEQH 1FN4A 3DRTA 1T4KB 4KVNL 2R1YB 1DL7H 4ELMA 2VDPL 5ICZA 2BC4A 4LMQI 3U7WH 1J8KA 2V9TA 3D48R 2P47B 3DYOA 4G6FD 3TBVB 3C2SA 2RFXA 3ARTA 4R7NA 1Q9WA 3V5DB 1XGPB 4CNIB 4M6OL 5INDB 3C08H 3JWNC 1CE6B 3NIFF 4ETQB 3TP4A 4P2QB 1ZLVK 1F3JA 1H5BA 2I9LB 5GZOD 3I6LE 3VCLB 1MFAL 3U1SL 4U6TA 1E4XH 1UM6L 4PYHA 2VXUL 2A74B 1AR1C 4WWKB 4FQXA 3PWJA 5AAWA 3B9KA 1VERA 2QADB 3N1FC 3REWA 4JFDD 1KULA 1IM9D 4NN7C 4ZXBB 2E9JA 3FO1A 1OTUC 4KVNH 2W92A 4PRPE 3DO7A 3C8KA 3UAJC 1B0WA 4OFDA 1FYTB 2V5RA 2N56A 2OSLA 4MYWB 5I8CA 5L8LB 1NANI 3FFDB 1G6RH 4JN2B 4N9GB 5EZJA 2ZOKA 4PB0H 3QEUA 1QLEL 4M6OH 3QFJE 3QIUD 1U91B 1SYSB 3D0LB 1UM4H 3O2WH 4NFBA 3HPJA 3WCYA 2APTA 2X40A 4PFEA 1RZ7L 4KV5E 5L88L 1MFAH 1JPFB 4KV5F 2VZ1A 4QRPE 1A1OB 3K8LA 3QEQB 5T1KD 5IB2A 3MBXL 4S10A 5D1QD 1D3CA 4NRYB 5CWSA 4G5ZL 4J12A 1P7QB 5CEXA 5FM8A 4IDLA 4NNYB 3P9LB 5B8CC 2OZ4L 3PE9A 5CGYC 5D2NE 2DJSA 5HHXL 3MUGB 3CPLB 2OXHA 1A7QL 1N8ZB 4ZQKB 2EICA 4R4FL 5I1EL 5DC0A 2GSIB 1T0PB 4P2QD 3RWIB 1AP2A 1QLEH 5D2LA 5D6DC 3OKOA 3PV6A 2EYSA 4OZHB 1EZVX 1ED3B 3N06B 1VFBB 5IVOA 3BRFA 3UTPE 3GHEL 2VTFA 5JLZA 1RZ7H 4JKWA 3SGKA 3DOSA 2I5YL 4BSVA 3TZVA 1IGFH 1TITA 2VZTA 5C8JB 2X4SA 3IYLW 1GGYA 4U1NA 2VXVL 4PP2A 3OAUH 5IBLC 4RGNB 5C9JB 1D5IL 1R24A 1OHQA 2XN9A 1FYTD 4I2XB 4M93B 4CJ0A 4I8DA 5EFIB 5E2JA 3VMPA 4OJFL 2X44D 1C12A 3TNNA 2BNRB 1MI5A 4R4FH 2R4RL 3ARBA 4Y4KC 1S7QB 4HKZA 1D5MB 5HY9B 5D6CB 3PWNA 3DROB 3IGAA 4ENEC 2R69H 5BRZB 4OCWL 4C83B 5C0IB 4OQTA 3SEPA 3MLUH 3ULVD 1MREH 1HHHA 1XGRB 4C58B 1P5UA 4IOIB 5K9QI 4S1SH 1P7QD 5DVNA 4GRMB 1R5IA 2P5WB 3CXDH 3BN9C 3SE9H 4LCCC 5C6TL 2VXVH 1J12A 1YYML 1ZT4A 1YDPA 1D5IH 2H32A 4GO6B 5EU6A 4F7TA 3QXAB 1QPPA 4UOW0 3LKRB 1F4YH 1ZGLA 3CH1B 3NIDE 1D6VH 4Y8AA 1IGTA 3NIDF 2OMNA 1C5CH 5IFAL 2WAHA 2I07B 1FL3A 2VZ3A 3L3HA 3QEGL 5IHZB 4OIAA 4PGCB 4C57C 5KZCD 2ZSWB 5E5MB 2Z9TA 2ZNXA 4XXDB 3SDCC 4OCWH 3U2SB 4MJIA 4ZOCA 3U48A 2HJLA 5CP7A 4JPKH 5I0ZA 3EOYG 4LSSL 4NJAH 4J3VA 4GLRI 3O0RL 4QRRD 1TQCB 1IGYA 4PRBA 4XNMA 3IFOB 1AD9A 3QRGH 4KKCC 1SEQL 5C6TH 1SM3L 4WW1A 4O4YL 4IRJC 2DQIH 5E2UH 3BP6B 5BXFB 3UROR 2V2XB 1YNLL 1YYMH 5A3ID 5IUSA 2HRPL 2PTUA 1P6FA 3STLB 2EKJA 4ESKA 1GC1H 3SDAB 4TULL 1KCSH 2XTJB 3WHXB 4MCYA 5DJ2B 1IQDA 1DN0A 3U9UB 1U42A 4IJ3C 5FM5M 2ICEB 3TV3L 3IU3B 1FSKB 4XBEL 3ZL4L 3UBXB 3BQUB 1K6QL 2GHWB 4KKAC 2GJ6A 3P77B 3OXSB 2Q7YA 2XKUA 5IFJA 2WNGA 1AO7B 4JHWL 1FZMA 5LWYL 5SV4A 1SM3H 2AJYL 3GJEB 3KYMA 4I48A 4O4YH 5FCUL 4JG0H 3QO1A 1YNLH 1MY5A 2DQHL 5DJZB 2HRPH 4Y2DD 1MRDL 3GO1L 4HV8A 1HCVA 4O9HL 3JTSA 4GMSL 1JWUA 5GSVB 4TULH 4M7KH 3SJVE 4M7JH 3WS6C 2NW2B 5CZKA 2K1MA 3GSRA 3TV3H 1NGPL 4XBEH 3PGFL 4HKBA 5F1NA 3S3JA 4RISL 4EUPH 4HFUL 1ZHKB 4HIHA 3LY6A 1N5AA 3C9NA 4N5UA 2Y6SC 5DD3H 3E6FA 1FGVL 4PG2A 4MD5A 2JE8A 5FCUH 5TQ2H 3H6JA 2DQEL 2BJML 2LFGA 2ZUTA 4YZFE 4JFFD 3GBNL 3VFSA 4YZFF 2DQHH 5J1AA 4ZFZB 1ZHBA 2P45B 2XTJD 3OG6B 4ZYKB 5C0CA 4YEEA 5HYSA 1MRDH 1MIMH 3GO1H 4CMMB 4EN3A 4EI5A 1D6EB 2UWEE 4DOHE 2UWEF 3BQUD 3RWDA 5C09D 3C2AH 2X4RB 3RBGA 3WIHA 3ULVH 4X9BA 1MHEB 1HH6B 4CN4A 1FPTH 1CYGA 4HDIB 1EVTC 2IPKB 2X2YA 4LAQL 4HFUH 3D87B 2HLFC 3P9MA 1NFIA 5KSBE 1HQRA 3FQTA 5IMKA 5KSBF 1T21B 2PYEA 4XH2A 1FGVH 4UU9A 3ARFC 4X98B 4NGHH 3QAZC 7FABL 1FNGA 3UPAA 4MA7L 2DQEH 5B8CB 2BNQB 1NDMB 3MRRA 4NFCA 2YA2A 3W11C 4NO2A 1B0GB 3R8QA 2OJEA 4ZFFB 3EOTL 1A6ZA 1HHJA 4NSKB 1GVIA 3OQ3B 1X4XA 2IAMC 3B43A 5LBSH 3IRZA 4JFDE 2YRZA 1TXKA 5EO9A 2MQ0A 1DLFH 2VN7A 3GMOB 3HRZA 4JGJA 1A6TA 5M95B 1TNMA 5GS0D 3NCFB 4FHBD 4Y1AB 4LAQH 4Y19A 4YHKL 4U4BA 3DWTA 1KCVL 3EDFA 3NACH 2XY2A 1OTUD 1NBQA 3VWJD 2CIIA 1T80A 2EXYC 5DUML 2IH3A 1F13A 3GMLA 1Z5LA 4PR5B 2FBJL 3DUSA 4EDWH 3UAJD 2R0LH 4P46A 5HYSG 5FHAL 4OI8A 3GM0A 4GBXA 1NC4A 3A6OA 3WXVL 4MA7H 4GKNA 3MLWH 4DVRH 3TT1L 3UTTA 1OAKL 1CFNB 1DE4A 2P8PA 1QLFB 5DO2D 1ORQB 1HSBB 1ZA3B 4Y4KB 3X12A 4POUB 4PIRF 5E8EA 3RFZC 2HFFA 4F7PA 1IL1A 3HLAA 2DTSA 1JJUA 2JJVA 2F5BH 4R8WL 1SHMA 3LEVL 1OB1A 4Z5RA 5IR1B 4X5WB 3OGOE 1TFHA 1FDLH 1MVFA 3UPRA 3UJIH 2BNQD 1X6LA 5CGYD 5J6HB 4LLAA 3DSFL 3P30H 4LHUG 4PJAE 2FBJH 4L5FH 5E8PA 3BISA 1A6VH 4PJAF 2WBJD 3WXVH 5JHDB 4FXLA 3WN5C 1JGVH 4JJHA 4WDIB 1OAKH 4L3ED 2COQA 4Z0BL 5GGRY 2EDQA 1U3ZA 2GIYA 3BMWA 1PYWB 3AMLA 3CFCL 4NKOB 3VFRA 3NCBB 4GAJL 5HYQA 2DM7A 4PJXA 1MCWM 3VXMD 4LKXA 4QGTA 4R90H 5F9WC 1HHGA 1CN4A 3GSWA 3SDCB 1F4XL 1XH3B 4O2FB 2VLJA 1CDIA 3L95B 3EO0A 4OCSH 1F4AA 1FYTE 2FX8L 2AK4A 3ALPA 1RVFL 3INUH 1P9MA 3OJ2C 3E2HC 3FO0H 4BFBD 4GG6B 5IB1B 3JWDL 5A2FA 1BWWA 5HD8C 4FQIL 4IRJB 1BVLB 2ESVB 4ZPTA 1DLHB 3TNMA 5J9PB 1C08B 1JI2A 4KQ4L 3KXFD 3B2VL 5FO9A 1BZ7A 4Z0BH 3OB8A 5TFSL 4EXKA 5F96H 1WAAE 4DGYL 3ULVE 4PLKD 3GI9L 1WAAF 3TA3C 3ULVF 3FB5A 1W8NA 2X42A 4ENED 5D5MA 1FNHA 3CFCH 1I1CA 4MXQD 5FF6A 4JDVB 1OAYL 1EGJL 2D03L 5F44A 2NY1C 3ZYZA 4KUZL 4IJ3B 1CXEA 5GS0L 5L9DL 5KVDL 4BZ2L 3FN9A 1F4XH 4I13B 4XCFL 3MLSL 2VC2H 1RMFH 2E7LA 3EYVA 1RVFH 3BN9D 5TE6L 5CBEA 4DGVL 1QBLH 1R5WA 5DRXB 1KC5L 1PG7X 2YBRB 3JWDH 2HKFH 5BJTA 3TCLA 1W8OA 4MNHB 2DRUA 4FQIH 4CU8A 5ICXA 4X5LA 5IB5A 4KQ4H 4NQXA 3AS2A 5IESH 3FCTB 1DQMH 4XGZB 3VXSD 4L29A 1CR9H 4DGYH 3O6FA 4AENA 4QRRE 5EO0A 3SDCD 4ZOEA 3WFEL 1C1EH 1RU9H 4M00A 1T04B 5BMFL 4I2XE 4ZO6A 1R3IH 3MXVL 5GS0H 3DX6A 4BZ2H 1RULH 1LD9B 2CXGA 4WNQA 3WXWL 4XCCL 2VWEC 1VHPA 32C2B 4ZSOA 3VFOB 4E41B 3FB8B 5D7SH 1A64A 4C4KO 4DGVH 2ESVD 5DEGA 1G7JA 1S7WA 1T6WA 3EFFA 3I02A 2J8UB 4HH8A 3QDJB 4TOYL 4BK4A 3WJLC 1KSRA 4EXPX 1OARL 2NQCA 1RZFH 4ALAH 4OT1L 2YD9A 3PWVB 4FQJL 3STZB 4L3CA 1RHFA 2YUVA 5IROA 5FUOL 4RAHA 3IFPA 4NFDA 2AJSL 2QSVA 4G8EB 4KAQL 4LCYB 4POZC 5ESQA 4BFIA 2QKIA 4UI2A 4IIQA 3ZE1E 3HC0A 3ZE1F 5BMFH 2BCKB 4OB5L 3P4NB 1QLRB 4MCZA 4J2XA 4QHKJ 1X5LA 5GRUL 1II4E 3SDDC 3WXWH 5JMRA 1MJJB 5B22A 4YXKL 4RGMB 1PW3A 3RZCC 3PL6A 3TIEA 3MROA 1FYHB 1J0IA 5E00B 3IDIB 3PP3K 2ZUXA 4GMTL 3BZDA 5FOBA 5JUEL 1SYSA 3IB4A 2EH7L 3ARFB 1J05A 3D3VA 3BKMH 3QAZB 4MX7B 5IW3A 1VESA 2C1OB 1PEZA 3CZFB 5FHBL 4LNRB 3C5ZC 3T3ME 4XBPA 4Y4FA 3T3MF 4PJDA 3QYCA 3U6RB 2GITB 3I6KB 4E42B 5DHVB 5DVOA 3DARA 3SCMA 4AT6B 3BT2L 4J1UB 2IAMB 5KSAD 3T2QA 2CXKA 5DRWA 1CLYH 1T1YB 5GRUH 4ZQKA 4JFFE 3M17B 4YXKH 5KTEL 2JCCA 3MRDA 2XTJE 5JDJA 1MVUA 1X5KA 4BSWA 1M05A 2JJSA 1RK0B 1WV7T 4GW4B 1FNSL 2Z35B 3LS5L 2FSEA 1S78D 5JUEH 5C09E 4X9FA 3BXNA 3E8UH 5JDSB 1EERB 4YHZL 1I9JL 4L4VB 4A2LA 5IB4A 5ICYB 2BSED 4KTDH 1IQWH 2XACC 5C0FA 2VLLB 1EBAA 35C8L 1DUYA 1WTGT 3FQRB 4NZTL 3EFDL 3TJEH 5D1XB 1A7NL 1ACYL 3V95A 3BT2H 4OLWL 2NW3A 4L3AA 3V6OE 1UYWL 5A16B 4M7LH 5CP3A 1IJ9A 2ADGA 5KTEH 4GG8B 3CH8A 2IPTL 1HINL 1KN4H 1KEMH 3ZT7A 1UEYA 4UAOC 1FNSH 5L7XH 3U0PB 3LS5H 3G6AA 4CW1A 3ROOA 4UTAL 2OQJA 1U58A 5J7CC 1XF3A 4PV8A 1HQ4B 2F8VA 2VQ1B 3WN5B 3CDGA 3EO1B 1MCSA 2VIRA 4L8CB 5D9SB 3QCVH 1EEUA 1XF2A 2VAAB 5I1GL 3VMNA 1WLHA 3L3KB 1IKNA 1QEWA 35C8H 5F7EH 3N1PC 5DJCA 12E8L 2H26B 3EFDH 3S97C 5HGGS 2AV7B 3WDIA 43C9B 1I3RB 1F90H 5F9WB 1D5XA 3S4SA 5FYKU 4O02H 4WEBL 2WUCL 5CKAA 4JM2D 5I16B 3H3PL 2EXYD 5D1ZA 1AD0B 3MODH 3WKNA 5LJYH 3E2HB 3CLFH 3RL1A 2FJHA 3F7VB 5DVLA 1CK0H 3QRFM 1C7SA 4L8SC 3MZGB 4UTAH 4BM7A 1MLBB 4H20L 4Z7VE 1FFOA 4XPFL 2XZAH 4Z7VF 5FYJU 4AM0A 2W65B 3LD8C 3TA3B 1ZVSB 5I1GH 2APBA 2D2OA 3QISA 4CBPA 1TZHB 3WKMH 4CADB 4NUJA 1VEMA 2BNQE 1TCRA 1QFWM 2NY1B 5TGBB 4EOWL 2EE3A 3VI3E 4WEBH 2BY0A 1CICA 5DGRA 3VI3F 1ZLSL 5DI8B 4P48A 3H3PH 4L3EE 4XX1G 1V3MA 3H0TA 1Q0XL 2IH1A 5F3HA 3R0MA 4YH6A 1FG2B 4X6CA 3VXME 2CDEB 1UCTA 4XPHL 5DEFB 2YKLH 3W82A 4XPFH 1BD2B 2ATPB 3OAZK 3QPXH 3L5WB 3VG0H 5C0AB 4CAGA 4FXKA 1T89A 3JTTB 3W9DA 5DJDB 3S4SG 3VXNA 3GRWL 3WO3B 4YEFA 3SPVA 5MEOA 3QUYA 4G42A 4GH7B 1WIUA 4YHPB 4F15C 5CMAB 2FGWL 4EOWH 3O3UN 5E2WH 1T83C 4LSVL 3KXFE 5DRNA 1AKJD 4XNXL 1CDUA 5FGCB 5E94B 1CL7I 5GGTL 5HD8D 2BOBA 4JB9H 3BEVB 1V5JA 4OD1L 2DQGL 2X7LA 2VABB 1Q0XH 5I1DA 2ID5A 1S3KL 4Z95L 5JHLH 1A9EA 1DP0A 4EIGB 2NYYC 1ZGLM 1CTNA 3P0VL 3QIBC 1J1XL 2ITCB 5GISL 1DQJB 5TE4L 3WBDA 3QCTL 1W0VA 4I5BA 5FA3B 4X6EA 5DUPL 4OCXL 5HYJA 4JPVL 4NKMB 4WFHD 3GSUB 2MPAL 2NY1D 1XF5B 3GRWH 5DMGD 1AIFB 4WJ5A 2F53D 4BQ9A 4PJFB 5IBUG 4CVZB 4AZ8A 1WZLA 3S5LA 3DIFB 2FGWH 1U8KB 1ULVA 2BSSA 4S1RL 4R0LC 4ZUSA 4POYA 1YY8B 1MFDH 3GSOB 3SDDB 4GRWB 4FZ8H 3VXSE 3RZCB 4WI9A 5K9OA 4C56D 4OD1H 1VKXA 1MCDA 3RTQC 4NO3A 3HNVL 4HH9B 1MWAB 2Z8RA 5SWZB 1WICA 2LVCA 3C5SB 5C0AD 5DHVH 5BVPL 1Z9OA 3O3DA 4P4RB 5TF1L 3P0VH 1BJ1J 5GISH 4QT5A 1FJ1B 3DETC 2BXZA 3QCTH 1T03L 3GIVA 3OL2A 4WY7L 2PR4L 2WBKA 3PWUB 2VQUA 4OCXH 3NGBC 4JPVH 3MBED 3C5ZB 5IEKB 2FR4A 1YMHA 4X4XA 2W0KA 3QZWB 4X98A 2ESVE 5LCVL 4Q97A 5HGBA 4OLVL 2ZUYA 4F2MB 4JFYB 4X99B 3IJYA 5JIIA 4MD4B 2NY5L 4OF6A 4KK8C 1JK8A 2IF7A 3R06A 4G9FB 2YMXL 1K85A 3OWEA 3OKNA 1I85A 1J5OH 2V2TB 4Q6YA 1FO0L 2HYMA 3D18A 3LPFA 1TETH 1JPTL 1LEKA 5H37G 3SKOA 1RUMH 5EBWA 4WUUB 2EZ0C 5D7IE 1OT1A 1I9RH 25C8H 5D7IF 1Q9KA 4RFNC 4LBEB 3PHOB 1V7NL 4AQOA 4K8RL 4Z76B 3EHBC 4APQA 5HI5C 4P3CL 3Q6FB 1YEKL 4ISVA 2YRPA 4WY7H 4LQFH 3CSBA 3S5LG 1QBBA 3TN0D 1RZIB 4I3RL 2QL1A 6CGTA 1EJ6A 3FN3A 1MF2H 3MRHA 5F7HA 5TDOA 3KPQB 2BRRL 1IMHC 1BM3L 4LKCB 5J6GB 3I50L 3H2WA 3K81A 1QZ1A 4PRHD 1T0MB 4HG4K 4EDXA 3RI5K 3RZCD 3KS0J 1E6JH 4MXWL 2C5DC 2YMXH 1U92A 3BOVA 4Q7DA 3UTOA 5L2KB 4FP8L 4PGJA 1RZKC 5SWZD 4U1JA 3VFMB 2EYRA 1JPTH 1KLUA 1BQUA 5I71C 1HZHL 2HJFB 4YWGL 4UAOB 4HJGA 2BDNL 3UDWC 2BHYA 1V7NH 4HX1B 3C5ZD 4DZ8B 1KJ3H 4M3KB 3VXPA 5KVFH 4U1KA 1SVCP 4IBLT 1AH1A 2R1WA 2DLEA 3TBWA 1EFXA 1JNHB 3MA7A 5HDBE 5HDBF 4I3RH 1CFVL 1G7QB 4YPGA 5SWSB 1B88A 2OJZL 4LGRB 3CK0L 2H2SD 2BRRH 1Z3GH 1CFBA 3I50H 2A6JB 5J13C 4NN6C 3BKCL 2G5BA 5DK0B 4NDMB 3GSNA 4KKLC 3VD4A 3DV4B 4MXWH 3MJ7A 1RJYB 3TO4C 2IPUK 3BRDA 1LEIA 3O8XD 2P8LB 1IGJA 1ZA6A 2YD3A 4FP8H 3S36X 1XGTB 5I8KH 1P2CB 5BZWB 1QSVA 3HPLA 3BP4B 4YWGH 1BBJB 4JQXA 4XVUC 4P3WA 2CR6A 2W0FB 1P7HL 2Y72A 1FC2D 4L8SB 3GDBA 1PAMA 5EBGA 3DBXB 3P4OA 4BFEA 3C6LA 3K8KA 3LSOA 5J12C 2YPKA 1DUZB 1PY9A 5C0BD 3W0WB 3FOMB 3HUJA 5HTSA 1AGCB 3BFOA 5L2JB 5DXWA 1SJVA 2XQYK 5ABDE 1J1PL 2E6JA 4HW6A 3D69B 4UT9L 5EIQA 5HHPA 2IWGA 3QR2A 5F93C 4ZUUB 5BVJA 3VWKC 4ETYA 1WC7B 5L2KD 1T1WB 3S3PA 5DDHA 1QSEA 4I0CC 3DMMC 3DVIA 4AYFA 1PKQE 1CGUA 5KVMC 1R3LB 3MOAL 2CRYA 3ARWA 4N5ED 1JGEB 4HKJB 5E8DH 1DQDL 4XVSL 3U79A 4QKXB 5EOTA 5TPWL 3Q5TA 4KGLA 4OD2B 4YE4L 5CILL 1K2DB 5D71L 2VLRA 5C86A 4FQQA 3NABH 1H9VA 4QRQA 5MEND 4JM2F 5EOQL 2P49B 4U0QB 2F74B 2YXFA 2EIEA 3H7BB 3BP7B 4JZNA 1CL7L 4TSCL 2D7OA 5T1MB 2R23B 4F15B 1E4WL 1DQLL 4KTEH 5DMKA 1N26A 1WIPA 1S7VA 4UDTB 3BZEB 4Q0XL 5IVXA 1E28B 4FQCL 3B3IA 4K94L 5ACMA 3EGSB 2D3VA 3T2NL 3CFEA 3IF1B 5C07A 3O6KL 3S37L 2R0ZL 3TM6A 4XVSH 1J9CT 5E6IC 4QHLA 5JORB 5TPWH 4N90D 3D0VB 4YE4H 3W0WD 1BPVA 1U6AL 4LLVA 2ED7A 1N2RB 5CIPB 1W0YT 3CCHA 1FIGL 5IT2L 3RVXC 5CGTA 2E9IA 4Q6IC 5EBLB 2R1XA 3QT2A 2C26A 4DN4L 5EOQH 2AXGA 3KVQA 4R7DA 2GT9A 2Q20A 1F11B 2DBLL 1VENA 4NZDA 4QRTA 2A0LD 5FGRA 5GS3A 4RAUB 3STBA 2Q3ZA 2LTQC 3V0WL 1I8LC 3FMGH 4MS8C 4R0LB 1KIPA 1GIGH 2N7BA 2OK0L 1BJ8A 4JRYB 3TIDA 4YDJA 2HJKA 4J3UA 3T2NH 1CG9B 5C0JA 4MMXC 1JPGB 4XVJH 3S37H 3RTQB 3DUUB 5DS8B 4PJHE 1KT2B 4PJHF 3SQOH 3EYFA 4Y5XC 2WWKO 3SGJC 1U6AH 1LNUB 4XMKL 1TMCB 2O5ZL 1N4XH 1VPOH 4U1GC 5IT2H 4QGYA 1I7RB 1T0NA 4HWBA 3NGBB 2WINA 4DN4H 3ZO0A 3VXRA 3QFDA 3W9EA 1R6VA 3QUZB 4C59B 1IVLA 3MUHL 3MCG1 5F1KC 3LRSA 1S9VB 3A6CL 1AGEA 1ODAA 2QR0B 3BAEH 5E4EC 3QP3A 4Y4HA 5IMOA 4M1DH 2OK0H 4XI5C 5IK3B 9CGTA 1IZJA 1G7LA 1H8OA 1X5AA 1KF9B 5EC1A 5H94A 4FNLL 3NOIA 4JHZA 2CJUL 4WFHE 1ZSDA 2EIZB 3O2VL 3FONB 3QIBD 4HXAH 1D5ZB 3J7HA 4XMPL 5K9KB 2F53E 4RFNB 5IG7B 4XP1L 1WGOA 5FDWA 4HMCA 1VFAA 2GFBA 2DQJH 4XMKH 5IW1B 2A6DB 4LSQL 1R0AL 4RNRA 4JZJC 4QCIA 2CK2A 3QIWC 1F5WA 1NGZB 3KPPA 2GCYB 4JY6B 3T1FB 3BDYH 5E08H 1FAKT 3NTCH 4OCYL 1IAII 4C56E 2WW8A 3I6GA 5ENWB 3Q3GA 2ORBH 3WNOA 1ZANH 4JRYD 1U8JA 3QFJA 4G8IB 2JJUA 43CAB 5H2BB 4J4PD 3AMKA 2JJTA 1HKLH 2ADJA 4N8CH 3D5OF 2CJUH 4QRPA 1Q1JL 5D1XA 5I71B 3O2VH 2FATL 1F4WL 3GMMA 4TNVF 4NQDA 4XMPH 3DETD 1OGTA 3J8F7 4XP1H 3D39D 1N7ML 1UKTA 3LKOA 1I3GH 1WWBX 4LSQH 4LRIC 1IGIL 5LKNA 3JVGA 1OAXL 3BGFC 2BX5A 4MWFB 1KYOJ 3C5JB 4PJ5B 5LAXA 4U1LA 4ODSL 1WF5A 3AGVA 4OCYH 2DLHA 3P4LA 3WIIL 3PXJA 3MRQB 1BQSA 1YEDB 3GMRB 3UMTA 3H9HA 5BZDB 1G7IB 3ELAT 4LARL 5K33A 1YY9D 1HXMB 4NC0B 4NN6B 4AEIL 5J13B 1UWXH 1MQ8A 3VXTB 4GT7A 5IHLB 3TO4B 1B4JL 2YC1A 2X05A 2EZ0D 4YR6B 1YNTA 5E0QA 4GAYB 5HGAA 3JV6B 3MXWH 4JQIL 1KB5B 4HPOL 5HI5D 3W81A 2FZ3A 5CEYA 3QNZB 1ZK9A 1HE7A 2A77H 2JJWA 4PRHE 3GSVB 4PD4K 1RV6X 4WW2C 3VFNA 4J8RB 2NLJA 3VFGL 5J12B 5TQ0H 2GAZB 1I7ZB 3MOBL 2PXYA 3ZKNC 2Y25A 2YD5A 1S5HA 3KNBB 4OUUB 4UIKL 1CF8H 1S7UA 2CLVA 4ODSH 1FNAA 4V1DB 3WIIH 3UCRA 4D8PA 3VWKB 2AXFA 1URLA 2Y9RT 1CWVA 4QOKD 3MRLA 2IAND 3VFUA 3MX0A 3LKPA 3DMMB 5EO1A 4OZFB 2MOVA 5E7BA 2D7TL 1UA6L 2DLTA 3AY4A 2JB6B 4NQED 4X6FA 2OR8A 1EA9C 4IMKA 2FBOJ 3RU8L 5CD5D 4EVNB 4JQIH 4WHDA 2DKUA 1OGAB 4JVPA 4BFGA 1XGYL 4PG9B 3LQZA 3CC5B 4PGBB 3NFNA 3F7PC 4U3CA 1QRNA 3WL9B 5EORL 3IS0X 5HPMA 2F8XC 4ZFGH 3B83A 4RQQB 2C3XA 2I24N 3CDCA 4DFHA 3MOBH 4RDQF 4CVXB 3IDYC 4JREB 4G7VL 5DYOB 4EKXA 5AUMB 2VITB 5J8OA 1QFWL 4Z77A 4JANB 2KZWA 3O4LD 3SBWC 2IQ9L 2KDGA 4C4KT 3TO4D 5D7LB 3MRIA 1RQ5A 4C54A 3FT2B 3BKJH 3GKWL 5DA0B 3ZYIA 5CZVL 2HVKA 4JR9H 4OM1H 3OKEA 4OI7A 2D7TH 5C0BE 4ZNCD 5KS9E 1CXFA 3RNQA 3SDYL 5KS9F 1AE6L 5GGQL 2ADFH 3MO1B 3OGCB 4K3GA 4JHAL 3RGHA 2CO6B 1MHHA 1XGYH 2EDLA 2YK1L 5DVKA 5C3LD 3OAYH 2Z31C 3OTTA 2RHEA 5EORH 5EH1A 4XWGH 4OLYL 5GHWL 5L2KE 1P4BL 1F8TL 1KPVB 4KQ3L 4WHTA 1UH4A 1JZ2A 4P5MB 4Q6IB 4Z7OE 2UYLB 4NOBA 4Z7OF 3VWKD 5ID1B 2VKXA 3HRPA 1SYVA 4P2OC 4XB7A 1A1MB 3BYYA 3KLHC 4TUOA 2IQ9H 3DMMD 2YN5A 4U1HB 2LTQB 3RWHB 2MMXA 4JY4B 1YPZE 4WTXA 1YPZF 3RUGB 4N0YH 5HHNB 4DZBB 4CDHA 5F7LB 4BJLA 3O3AB 3OKDA 4PJ8C 5FB8A 2PTTA 3RIAK 1MEXL 4FFZL 1BZQK 5DQJA 5GGQH 5MENE 3G04B 4FFWD 2PTVA 5DD0L 4WENB 4DUXA 4ZTPL 2XNAB 3BZ4B 3MV8D 3SOBL 4Y5XB 1BIIA 5DK2A 5BW7A 3IXTB 1B2WL 3L3GB 3TPKA 4JFOB 1EO7A 4OLYH 5GHWH 1F8TH 4FG6C 4U1GB 1TZIA 2F19L 1C8PA 3WHE0 2H45A 5B39B 1D9KA 4XXCC 2VNCA 4TNWK 4K2UH 4NRZB 4UUJA 4YHYC 3IDJA 3QNYA 3LH2L 1RJLA 4W4OA 1U8IA 4A6YB 1UVQA 5TDNB 4EBQL 1T2JA 5DJ0B 3T77A 1E27B 4N90E 3AREA 3W0WE 4U33A 2YD6A 5E4EB 4XAWH 2AQ3A 3VGHA 4DCQB 4RFOL 4G8GD 4HS3A 3GMNB 5DMJB 4LRNL 3ARQA 4G6AD 5E6ID 1UXWB 5GGSA 3W2DH 1MEXH 1F6FB 4S1DC 2R56L 4WU5B 3RGVC 2JIXA 1BGXL 2OZ4A 3VXOB 4ZTPH 1U3HD 3RJDA 5EG6C 3ARPA 5I17A 1Q0YL 1J0ZA 2DMCA 3RVXD 1IEBB 4G80A 5GZND 1DBKL 1XIWA 4PPTA 5E1AA 3HN3A 5I66A 1B2WH 2AABL 2AEIT 4UOW1 4JZJB 4ODVL 4QO1A 3QUML 1U8HB 3QIWB 5JPNB 1MCIA 5HYEA 3M8OL 2R2EB 2ZCHL 3TYFB 1RZKH 5IM7A 2PO6C 4K8RC 2HKHH 3HKFA 1HSAA 1WJ3A 2OR7A 4KXZI 3GHBH 4LIQL 2CLZA 4PGDB 4NZJA 3L3JA 4LMQE 4ZUWB 1MHCA 4UINL 5I30L 4PP1C 2A73B 1U0QA 2V5SA 3LRHA 3DX7A 1CGWA 1GCFA 2CGRH 1BGXH 3O9WC 5KSBA 4K7FA 1NFKA 5HDQH 1GPOH 4HHAA 4X6BB 1RK1B 3C60C 4UOJA 4OKDA 2B1AH 1DBKH 4O51A 3CFKB 3LKQB 1C5DA 4XNYH 4M61A 1CFSA 2AABH 2NY6C 4HWUA 4K3JL 4ODVH 1S7TA 3QUMH 4HJ0C 4JAMA 3AM8A 3BESR 1LDPH 3ZE2E 3ZE2F 3LKSA 15C8L 3V5HB 5JMOC 4R26L 2P7TB 1JV5A 2W59A 5CHNA 5C0EA 4TQEH 3S8WA 4PRID 5IEHB 2R0KL 1CD1B 2ATKB 4JFDA 4PYGA 3RIFK 2V5YA 1YNKL 5E2VH 4U7SA 1MCPH 2CK0H 2CDFB 4LLYB 3MMEB 5I1CL 1NEZA 1LO2L 3CUPB 4M5YL 4KI5D 3IDMB 3UYOD 1B3JA 3QIWD 4JRYE 4KJQC 4M43L 1YEEL 3QIUA 4G6ML 5C6PB 1VGEH 2C7UA 4QXWA 4WW2B 3OB0H 4D0BA 5ALCL 4B41A 2B4CC 4H1LH 2ARJQ 15C8H 1C16B 4OZFH 3D1MC 2FD6H 4YUEH 1U8LA 1FVCA 1NBYA 2V7NB 5T1KA 3ZLQC 2P24A 5D1QA 1A1NB 4RFEB 1SJHA 3D39E 5HI3C 2R0KH 4YGVA 1K8IB 8FABA 5ADPH 1G9MC 4AG4H 1YNKH 3CX5J 1ZHLB 3V7AE 1F00I 3MV9D 2RGSA 1GZPB 4NKQB 4NYLB 2J7LA 2DWDB 1UM5L 4JFXA 4Y16A 4B7IA 3OHXA 1NLBL 1UQSA 1I4FA 3TC9A 5EUOB 2H3NB 1Y0LA 1S8DA 1U8OA 3D25B 4PJAA 4W6YB 2CQVA 1EAJA 1K8DA 1I8KB 2HVJA 1H3PL 2CRIA 2CKBB 1A6UL 3IDYB 4QXTB 1ZT1A 4HAFA 2IMMA 4GUPA 4PJIB 2APXA 1LE5B 3JUZA 4GS7B 3SGDI 3SY0A 4EUPA 4JGMA 1NEZG 2DM2A 1NAML 3KPMB 5F1IB 2D0FA 4AQ1B 4PJGB 3DUHA 3VFVB 5JIKA 2XTLA 3FOLA 5IVZB 1FLTX 1UM5H 5EUKB 5F7YC 5ISZB 1NLBH 4QNPF 1KCLA 4DUVA 1Z0NA 1L9NA 3KJ6L 2UUDK 1X5HA 4ODXB 2Z31B 3LEXB 4CU6A 4CN1A 3CX2A 4YDIL 4OLEA 1DQQA 3EGSA 4QOKE 1MCEA 2IANE 5I2IA 3G5ZB 3H9SE 5I1JH 1MCHA 4R3SB 2EDHA 4Y89A 2ITDA 1A6UH 2BY2A 5D7JC 3RWEB 1WAAA 3KPSA 3MRFB 4NQEE 3BE1L 3T04D 1OP5H 4P2OB 4JDZA 2VZUA 3I9GL 4WHCA 5GRZA 1CTOA 1JGDA 5HHMB 5HI4D 4ODTH 2PNDA 3VFPB 1IC5L 3MFFA 1B9ZA 2HT4C 5BV7C 3PGCA 3IDNA 1TDQA 5BQ7A 4PJ8B 3GIZL 4O58H 4RCAA 1UJTA 4PJBB 2VOTA 4Z18A 2MHAB 1EZVY 5IF0B 4G6JH 3O4LE 1U9KA 2ENYA 5DFVD 4A6YH 5C0RH 2EEBA 4XRCA 4YDIH 3O45A 5I1IL 1LO4H 3GSQA 5FKAA 5A2KH 2DD8L 2FIKA 3HS0A 1OW0A 3CNKA 4EUPG 4I0PD 1G9NC 1PX3A 5EU3B 4KK5C 1I8IB 4D0DA 4QRRA 3SKMB 1MRCH 3RDTD 4YHYB 4PGEA 1AHWA 2VDML 3EDDA 1BFSA 3I9GH 3Q1SH 1IFHL 1I9EA 2AQ1A 3BGMB 2X4QA 2APVA 5E70A 4M6ML 3VI4E 4JVWA 3S96B 3VI4F 1JHKL 1CE1L 3MGOB 5D93C 3RWCA 4LK4A 1S9YA 1ZS8B 4UQ2B 3GIZH 4F7EA 4DN3H 3FQWA 5MEPB 1AXTL 3RGVB 1KPRA 2Z31D 1KIRB 5DTFB 1ONQA 2JF1A 1S9VA 1EXUA 1YUHB 4U1SA 5E9DA 1ZWIB 2E7HA 3FTGB 4XPAL 3U83A 2FO4A 3HE7C 2WP3O 3EKCA 3L3IB 4Q74A 1P6AB 3DXAB 4G8FA 3BWAA 2VDLL 4X7TA 5I8OL 3KPRD 3KLHD 5HHMD 4MJ5B 4XP5L 3FONA 4JQVA 1HXYA 4LP4A 2PO6B 2X4UA 1IFHH 3MV8E 4X7FC 1KJMA 5B38B 2AJUH 1MAML 3RHWF 3KYNA 5AD0A 4S11A 2AJ3B 1AGFA 3G5YB 4M7ZC 1JHKH 4JY6A 1MNUH 2H2PC 2RQ8A 2VJXA 1LP9E 1RZJC 4Y2DA 1AXTH 1LP9F 2EXWC 4F7MA 3O9WB 5SV3A 2X9WA 4QF1B 3WEXB 4FG6D 1X5GA 2AEWA 3THML 3C60B 1JP5A 1J18A 4F3FA 2H9GA 4XPAH 5ESAA 1KBGL 2Q8BL 1UKQA 2NY6B 1H3VA 3VD5A 4MSWA 5KVEL 5FO7B 4RAVA 4HQQH 3TH2T 3DX9B 2VDLH 4MQ7B 4EZMA 4G8GE 3ALWA 5I8OH 4IDJL 2OP4H 4MGXA 4DKFL 2Z4QB 2DTMH 1AQDB 3FKUS 3VFWB 2W0PA 5KVGL 1NBZA 1NCCL 3IFLH 2NMSA 4ZPVB 3NAAH 1YMMD 3MCKB 3ZKSD 1FBIL 5EC2B 5HGHB 3W5MA 4YAQA 1MAMH 4HCRH 5GIRB 4X5XB 5ITFB 4S1DD 3C5JA 1UXSB 1H5BC 3IRPX 3WFHB 3CMOL 4JFFA 4AEHL 2DDQL 1M7DB 5HJ3B 4ZFOB 4FQXC 4F9LA 2VDQL 2Z8WC 3B9KC 5CKGA 4ONGH 1KOAA 1QHPA 3DGGB 4F7CB 4M7LT 3VXQB 5JNYA 5C09A 4RA0C 1JFQL 1L0QA 2FGZA 4H25A 4FXGA 4NCC1 5ESVB 3WLBB 2PO6D 1T2XA 4DKFH 1QR1B 1EUTA 5DRZA 2ILLA 3H9ZA 4ELKB 1A02N 1E4KA 5CD3B 5M7QA 5HHQA 4GW5A 4IRSA 4LL9A 1X5XA 4KRNA 3NZ8A 4I3SL 1IC7L 1S7XB 2Q76B 1KNOA 5GJTL 3V6OA 2A1WL 3O9WD 3QA3B 5T1DL 4ODUA 3FFCD 4AEHH 4WV1A 2Z93A 1XF4B 4XZUA 1G0XA 1F58H 3KYOB 1IILE 3RY5A 5IKCB 1QD0A 2I27N 1BLNB 3DV6B 1I1FB 4G3YH 5FGSA 4L4TB 1T5XA 5HYIA 3I75B 2BVOA 4PRIE 1JFQH 3MV01 2EC9T 4ODBD 3ZDZE 5I19H 3ZDZF 5IJVB 4LEOA 1ZGLP 3SE8H 2OL3B 1JN6A 4XNUL 3T65B 4M4RA 1AQKH 3HR5A 4PGBA 2XOTA 5BO1L 4R4BB 2Q8AH 3VWJA 4KI5E 2ADIA 4KI5F 4KU1A 3B6SA 1WFOA 1JYNA 2KBGA 1EAPB 4PY7A 5GJTH 2VISB 3SGKC 4JPWH 1UZ8B 4WGWB 5T1DH 3TZVC 4KRPC 1MCJA 3PNWA 4KJQD 2CD0A 5INCB 3VW3L 2DQUH 5IQ9A 4CU7A 1FNEB 1NFDE 2PW2B 1NFDF 5FA4A 3QCUL 2BVQA 3FO2B 2XICA 1SJXA 4GRLD 1GZQB 2Y5TA 1F6AA 2OLDA 5F89A 4GQ9H 4Z7VA 4HIIA 4PTUB 1MPAH 4UDUA 3RNKA 3MYJA 4ORGB 3MV9E 5D7JB 3MLTA 3FAXA 4RIRA 2XG4A 4YFLF 2FJGB 1FCGA 1OTTD 3BH8B 1GGUA 3HI1B 3ARBC 4DKEH 1Y6NR 5F9JA 1YN7A 5BO1H 2HLAB 4IHOB 1BX2B 2FECL 4OZIE 2NXZC 3VDCA 4OZIF 1OM3L 5BV7B 1R3HA 2WBJA 1MSPA 3HCVB 4NM8H 4YO0A 5JQ6H 2HMID 1AY1L 2Q3AA 1P7KA 4L3EA 1QKZL 3BZFA 5DD6A 1TVHB 3QULB 1P4LB 2B5IC 5ETUA 3VW3H 1T6VN 4MJ6B 1NDGA 3IAPA 3HG1B 1LILA 3X3FH 1TTGA 5HHOD 1IGML 1ACZA 3IU4L 4U05A 4QLRA 2EECA 2RBLA 3O6LH 1BF2A 2OTPA 1NJ9A 5BS0B 2XKNA 1HKFA 2VDOL 5I74C 4F33B 4PBVC 1UB6B 1FORL 1FFQA 1HEZB 1K5NB 1L0YA 3DHMA 3B9DA 3L3GA 4HUWB 5FUCC 1ITCA 4JFQA 3PABB 4M1GL 3EIFA 4TSAL 5IB3B 4TSBL 2VZVA 4WGVB 4NJ9H 3BIKA 5D93B 1QFPA 4N0RA 3KHQA 3KXFA 4NQVA 4P5TD 4X8XA 1DDHB 5K9JL 4HGKC 5KSVA 2ZJSH 4JHBA 2ZG3A 3WFBL 1A4JA 2ICWJ 5FEBA 3V0VA 4GXUN 3ECBB 2Y36L 2VXTH 1S9XB 3EYQC 4JFEB 4RZCA 1RURH 1MAKA 4OLZL 1INQA 1CFQB 3HE7B 3MRKA 4H88L 5F3BB 1KTKE 3IDXL 5FKPA 1YN6A 5HDOA 3CFJB 3TYGH 3WFDL 3U7YH 3ULSA 5AWNH 3VFTA 2IFFL 1I1AD 1ES0B 4FTVD 4Q9CA 3TWCH 5C3TA 2VDOH 2Z91A 4LCCA 3RX8A 4NO5B 2QSQA 4MNQD 2EKSA 5HYFA 2CR3A 3LN5A 3P0YL 5JIHA 1N3NB 4P3DA 5IGXL 4TSAH 2F8OA 2MNUA 4TSBH 5FM4A 4M7ZB 3S9DB 4PJIE 3MRGB 4PJIF 3MACL 2AW2A 4LHJB 1EEZB 5DHYA 3VXSA 5JXAL 3S7GA 3MRNB 4HULB 3M1BA 1MFBL 2UZIH 1CBVH 2Y36H 1FN4B 3DURA 3DRTB 4K23H 1MJUL 2WWMC 3BD3A 4H88H 5BS0D 2B0SH 4XCNA 4ZS7L 4TRPH 4ELMB 3IDXH 2N1KA 3B2UD 3BHBA 5ICZB 2BC4B 3NCJL 2IFFH 4U49A 4AEFA 2CUHA 2OTWA 4R7NB 1Q9WB 4X6DE 2K9UA 3BUTA 4X6DF 1FVEA 3TVMC 2IJ0C 4CN6A 1ZVYA 3T0DA 1G9EA 3CU7A 2PW1A 2Z8SA 5JW4Q 1F3JB 1KJ2L 1H5BB 2DQCL 3LQAC 1OWRM 1N59A 4XP9L 4PJ7E 3KPRE 4GJTB 5GJSL 5HHME 4PJ7F 4JFED 3C6SB 5E5RB 2B4CH 4IRZL 5JXAH 4KK6C 4FQXB 3PWJB 1MFBH 1HHKB 1YECL 2BFVL 3B9KB 5D7IA 4ZD3L 2EDYA 2HG5A 5IWLA 3REWB 2EC9U 4PG2C 2IFGA 1P69B 3T0BA 3FO1B 3QWOA 4NCC2 1MJUH 2XFXA 2QHRH 1CIDA 4XC1H 4PJBE 4PJBF 3DO7B 3C8KB 4ONFL 3WLWC 1XGQA 5F7DA 3SKNA 3QG7H 1G9MH 3NCJH 4EN3C 1TNNA 1I9IH 2P5ED 4EI5C 5I8CB 2OSLB 5EZJB 2ZOKB 3WSQL 3QEUB 1LE9A 5ALBL 3BJLA 3E3QC 3HPJB 5SWQA 5D72L 5FECA 3MJ8A 1KJ2H 2DQCH 3V4VL 1LK3L 3GMQA 3MRPA 4JFHD 1TLKA 1VFUA 5IMMA 5IB2B 2OL3H 4D0CA 1R3KA 4YBQC 4ZD3H 5CWSB 1YMME 4LOUC 2IADA 5CEXB 2BY3A 5KSAA 3U0TA 1IM3A 1NCBH 3L7EA 1LEGA 4XMLL 2HT2C 1V7MH 2HFGL 3HZMA 5GXBB 5AEAA 4JVUA 4KTYA 1N5YH 4BK5A 2MWCA 5AYQA 4KZDL 1AP2B 2A83A 1OPGL 5D2LB 3OKOB 3PV6B 5KN5A 2EYSB 2IALA 5ACZA 3F5WA 5ALBH 4OAWA 5D72H 3EOBA 5JXEA 4FQXD 5JLZB 1TENA 3B9KD 3LN4A 4BSVB 1LE5A 3TZVB 5CAYB 4XP4L 4F37K 1RPQA 3SKUD 1QFUL 5EU4B 3CVHL 5E99L 2X4SB 2G60L 4OFPA 2ZUUA 4U1NB 2JB5H 5ID0A 2VL5A 4PP2B 4P46C 2B1HL 5HHVH 4GBXC 5I8EB 3T8XA 3GRWA 1PFCA 1R24B 3MR9A 2XN9B 1RIHL 5K93A 3T0VA 2VB5A 1NH6A 1Q9LA 2X4OA 1GRWA 4XPGL 3UJTL 5GGVL 1NC2A 3U4EA 3FFCE 1C12B 2DYPA 3TNNB 1XEDA 3N85L 2HFGH 1MI5B 1MOEA 2VMFA 1CT8A 5GRWA 4HKZB 3PWNB 4KZDH 2FYYA 4E0RA 3IGAB 3LHPH 5JW4R 1OPGH 1G0DA 2NXZB 3PHSA 5GPRA 3K4DA 4HAGA 3RKDC 1WCBA 4TTDD 1E6OL 1PKQA 2E5EA 1J8HA 1HHHB 1SBSL 3GUTA 3JWOL 4WU7A 4YXLL 3SO5A 4XP4H 4M62H 4N0UE 2B5IB 1BBDL 2JTDA 5JIPA 3CVHH 1R5IB 4LFHD 2XA8L 2G60H 3CLEL 3KWWA 2IMNA 1EMTH 5FM5O 3C87A 2B1HH 4LGSB 1ZT4B 2XT1B 1YDPB 2H32B 3KAAA 5EU6B 4F7TB 4PS4L 2PCPA 3MGAA 2C3VA 4XPGH 4NQCD 4GXVH 3UJTH 4K9EL 3KYAA 1CXLA 3X11B 1ZGLB 4OV5A 3MRBA 1IGTB 1ETZA 4JM2A 1F42A 5T3XL 5I74B 1EX0A 3TPUA 2O26U 1FL3B 4DJMA 3L3HB 3ZHKA 5HXMA 1RZ8A 1LQSR 1F3DJ 2KPNA 3P73A 3AS3A 4KRPD 2W91A 5EWIH 4MJIB 2HJLB 5CP7B 1E6OH 2M26A 1SBSH 4YXLH 4XNZC 3U4AA 2AGJL 2YPLD 1P9MC 1IGYB 1YEGH 2GTZA 4PRBB 4XNMB 6FABL 2DLIA 2ZCKL 1BBDH 1L9MA 3CJJA 2XA8H 3NFSH 3QWRD 4KJWC 4WW1B 1JZ5A 4ODHH 2IC2A 4OFYA 3ETBF 1JWSA 4UQ2A 4PJ9D 1MI5D 1MHPH 3HZYA 1JE6A 3ARBD 3A6BL 3ULUD 1WEJH 4K9EH 3QJHA 3QEHA 2X1WL 3PP3H 4BZ1L 3O81A 1JIBA 1HIML 3K7UA 3UZEA 5D8JL 2VERN 1OAUL 4MCYB 1IQDB 1DN0B 1FO0A 5HHOE 2EH8L 2GJ6B 2E7LC 4M02A 4OSUL 4OZGE 5MERA 2Q7YB 4OZGF 4DGIH 5IFJB 3LEYL 1TIUA 2AGJH 3UJJL 3P0GB 1N6VA 4PTTA 1SBBA 2ZCKH 3ARZA 2FX7L 4MNGA 5EU6D 4YDKL 1FZMB 4PJHA 3MTRA 3KYMB 1JRHL 1JNLL 3VU2A 3QO1B 2WUBL 2QQNH 2MKLC 4K7PL 3A6BH 4HUKB 1CU4H 5DC4B 3SQBA 3O6FC 1AKJA 1LVEA 4HV8B 2FEEI 3JTSB 4RMUA 4BZ1H 1HIMH 1JWUB 1WWCA 4TPRL 4DFIA 5ADOL 5EIIA 3AAZA 1B0RA 1E4XI 1IT9L 3LPGA 1FFPA 4R97C 3GSRB 5IW6A 3BYTA 4HKBB 5F1NB 2EH8H 4P23D 1PDKA 2VZSA 4HIHB 3EYQD 3ARGD 5BCAA 1N5AB 3C9NB 4FTVE 3L7FA 2H6PA 1VSCA 3NZHL 1T20A 3E6FB 1NKRA 4MNQE 4X5XA 3OJDA 3HNTL 2ZWLT 2AQ2A 1RJZA 4MD5B 3DI3B 3BX7C 1JRHH 2NY0C 1A9BA 5GGUA 5E1HB 3BGAA 3KR3L 2NY3D 4Q2ZA 4LCUA 4N0FA 3VFSB 4UT6L 5IROC 4Y88A 5J1AB 1ZHBB 3GBML 3HHRB 5C0CB 5HYSB 1NLDL 4EN3B 3T0ED 4YHNA 4XC3L 3UO1H 4EI5B 4P2RA 3UTSE 3Q6GH 4IIQC 4C56A 5ADOH 5CJOL 3HMXL 4L9LA 4KROC 1P4IL 5EPMA 2WMPA 1CLOL 1MLCA 3I2CL 2SEBA 5BS0E 1CDCA 2QQKH 3EYSL 3ESVF 4NHCL 1KFAH 3PL6C 3P9MB 4RA3A 1NFIB 3MBEA 1HQRB 3FQTB 5IMKB 1N6QH 2YD7A 2PYEB 4XH2B 5I1KH 4UU9B 2OYPA 3IDGA 4K3HA 1FNGB 3ULUL 1JTTA 3ZKMD 4G6KH 4DTGL 3CFDA 4L1DA 2XI9A 3KR3H 3TBTA 3MRRB 4MAYA 3T4YA 2R2CA 3QDGE 3HI6H 3LRGA 3HZKA 4NO2B 4Y4FC 1NLDH 2OJEB 3TVMD 4JFEE 4XC3H 1A6ZB 5HBBA 1HHJB 3SCMC 3UTQA 2X1XR 3N50A 3UC0H 4OTXL 3I2CH 5EO9B 1KIQA 4KK6D 1UWEH 1F2XK 3HRZB 1A6TB 4Y19B 4BKLA 1PVHA 1TVDA 5E8OA 2BY1A 3IJSA 3HMWL 2MCPH 1TVBA 5F6IC 3TN0A 2JJSC 4K7PX 2P5EE 2CIIB 2IH3B 3GMLB 1Z5LB 3BH9A 3DUSB 1DVFD 4LSTL 2XXCB 4P46B 4DK6A 4GBXB 5C0CD 1NC4B 3ULUH 1QHOA 4GKNB 3PQYD 4PRHA 4DTGH 3TBYA 2BOCA 3UTTB 2YWYA 3EYOA 5T1LA 4OQTH 2ARJA 5D96C 1DE4B 2P8PB 4JFHE 4JDTL 3X12B 4MVBC 5E8EB 1A5FL 3EJZC 1J87A 2HFFB 4F7PB 4UBDC 1IL1B 1HILA 3HLAB 3OAZH 1FL6A 1RHHB 5I1AA 2O61A 1CGSL 3SDXE 3H9YA 2E27L 2PYED 3SDXF 2H32H 1OB1B 3TBSA 4HBCL 4Z5RB 4LOUD 1PZ5A 2C4FU 2FEDD 4QHUA 3HMWH 3E0GA 3UPRB 5F9DC 2NY2C 1KLGA 1JPSH 4HK3J 4OZ4A 3B8SA 4LLDA 4H8WC 5E8PB 4LSTH 4LHUD 3F6LA 2HT2D 2X1QA 2DI8A 4CUCA 3LB6D 4RBPK 4LVOC 3KLAA 5KOVC 3O8XA 3OKMA 1IKNC 3V52L 4KGJA 4AIZA 3VFRB 2YPVL 4YHLH 5HYQB 4PJXB 1Y18A 4LKXB 5IBTL 1A5FH 2ZUWA 1T3FA 2DM4A 1HHGB 4P9MH 1OSZA 3GSWB 2VLJB 1T7YA 4J3OC 1CGSH 2AK4B 5D1ZC 2X89A 3HZVA 5C0BA 5KS9A 2DM3A 2FNBA 4QY8A 5LGKA 2HWZH 4GBXD 4M03A 4O5LH 3FQUA 4G43A 5EOCH 2X41A 1IAIH 4GAGH 4Y5YA 4YBHA 4ZPTB 3TNMB 3MA9H 4OFIA 3BRGC 5FO9B 1BZ7B 1TQCC 1YYLH 5JW3L 1JYWA 4FQ2L 3IVKA 3FB5B 3LZFH 1S9KC 5D5MB 3TEUA 2AJXH 1BMGA 2AK1H 1MUJA 3RKDD 2NY4C 5FF6B 2YPVH 5DEZA 1EIBA 1MCLA 4KPHH 5IBTH 3X13A 3CFJA 1YPZA 3E6HA 1CICC 3U7WL 1CD8A 4MB4A 3EYVB 4Z7WA 4NQCE 2P8MA 5CBEB 2BMKA 1R5WB 1H3GA 5MENA 4NQSA 5D2LE 5D2LF 4PGZA 1VGKA 4WO4A 1S7SA 5BJTB 4RDQG 3TCLB 3QI9B 1XZ0A 1GGIH 5ICXB 5IB5B 4HMDA 4ZO8A 4NQXB 1W72L 3MLYL 4L29B 3D85A 3FQXA 3O6FB 1T89C 4W70A 2J5LC 3G6DH 3QUYC 1H0DA 1ND0A 2YPLE 5EO0B 5C08D 4KH2A 2VLJD 4P9HC 1PLGH 2EEAA 3V7MA 3F12A 1HDMA 2D9QB 4P5KA 1VB9A 1KG0A 1ORSA 4EQ2A 4R97B 1T22A 3S35L 1M4KA 3DX6B 3HE6D 1U93A 3QDMD 5GS1A 4WNQB 4UTBL 3OPZL 1MI5E 4XVTL 5FV2A 4ZSOB 5IIEA 3ULUE 1G6RL 3ULUF 3VXUE 4PB0L 4X7EC 5DEGB 1G7JB 1S7WB 3HAEH 2AJVH 1A2YA 3DX8A 2DLFH 3EFFB 3I02B 1UM4L 3O2WL 3FJTA 2WQRA 2Q6WA 3IAGC 2NY0B 2FCBA 5I15H 3WIHH 4L3CB 5C2BL 2F54D 1JF5A 1W72H 3C6SA 3MLYH 3BO8A 2XIDA 2DQFA 3IFPB 2QSTA 1HHKA 3LAFA 5J11B 3V8CA 4QXUH 2W1NA 5ESQB 4BFIB 2QKIB 4IIQB 3BKYL 2P43B 1INEL 2VZOA 4W68A 5DJXA 4HGMA 1O7SA 3HC0B 4KROB 5EZOH 3S35H 4N8VA 2GJZA 4MCZB 4PJEA 4F57L 4DAGH 1T66D 3IXAA 2H8PA 4UTBH 3OPZH 4XVTH 3MJ6A 3PL6B 3TIEB 3MROB 4JFPA 2R2HA 5FUCE 5ILTL 3PHQA 2J88H 3BPOC 4X80L 4UT7H 1MCRA 5FOBB 4HBQA 4MMZC 1J05B 3D3VB 2FHCA 2EE9A 4PRAA 3O6FD 3FZUC 1VFMA 2X10A 3QQ9C 3ZSSA 5C2BH 1IGFL 1TTUA 4P4KB 4U6XA 4HT1H 4XBPB 4Y4FB 4PJDB 1A6PA 1H3XA 4Q9RH 3BW9A 5EZLA 1LK2A 3AU1A 3BKYH 1INEH 3OAUL 1DBBH 4M6NL 3SCMB 4CVWA 1NMBH 1VFOA 3RX7A 4AL8L 3PUCA 4S1QL 3IJHA 1EFQA 2DKMA 4F57H 4NZUL 5DRWB 1IAOA 1I85C 1X6NA 3EDKA 1MCFA 2JCCB 3MRDB 1MVUB 3RVUC 4B53A 4BSWB 2VUYA 2Y4SA 5F6IB 3T0EE 1M05B 5ILTH 4X80H 3LKNA 5FYLD 2FSEB 2R69L 3PP4H 3HFML 3QXDA 4DVBA 4WWKD 3MLUL 4KKNA 4APQC 1AJ7H 1MREL 3BXNB 2QADD 3LOWA 4HIJA 4S1SL 1NUGA 5IB4B 5E24E 3L6FA 4J4PA 5JOPD 4ZXBD 5D96B 5EU4A 2GSGA 1JZ7A 3CXDL 5C0FB 3SE9L 4N8VG 4X9GA 1DUYB 3MLXH 3TESA 1XCTA 4OCLC 4HWZA 5I8EA 3NA4A 5CINH 3U46A 4M6NH 3ZKQD 1T1XA 4AL8H 5B21A 2NW3B 4S1QH 1DEEA 1F4YL 3D39A 1D6VL 4NZUH 1YQ2A 1C5CL 4F58H 1FVDA 2ADGB 1BEYH 3EDJA 4FA8A 3VMOA 2Q86A 3LQMA 2NY2B 1CFTA 2BXYA 3G6AB 4CW1B 4HG4J 3ROOB 5E5UB 2OQJB 1U58B 3HFMH 3QEQD 1XF3B 4PV8B 5CS7A 5IMLA 4JPKL 4LCWA 4M5ZH 4NJAL 1LGVA 3CDGB 3KG5A 4PRNA 2VDKL 1YJDL 2VIRB 1XF2B 1AXIB 4LVOB 3JBG7 3ZKXC 3T09A 3QRGL 1XGUA 1QEWB 4QHKI 2E3VA 3B9AA 2DQIL 5DJCB 5E2UL 4KI1A 4GQPH 5J0BA 1QSFA 3ES6A 1D5XB 2VRAA 3S4SB 5C0CE 3PQYE 3X11A 1CCZA 3TO2A 4X7CC 1O7VA 4ZO9A 1GC1L 5D1ZB 4NUGL 3G6JE 3RI5F 3O3BA 1UCBH 3G6JF 1KCSL 3QQ3A 5DJYA 4YHIA 2X4NA 4YIQA 1BVZA 1UB5A 1PQZA 3MNZA 2VUOA 3RL1B 2FJHB 4JQXC 3LS4H 4U0RC 3E3QE 3BPNC 2HFEB 3WE6A 4OF3A 3QXUA 5EZIL 1FFOB 3GI8L 3C6LC 3UPCA 1VEPA 4QOKA 2K3TA 2VDKH 1YJDH 3OX8B 2IANA 2VE6A 3H9SA 4AM0B 3U30C 1JNJA 5JW5B 2PYEE 2Z92A 4RGND 3Q5OA 4NQEA 4UBDD 4KKBC 2I60H 2NY4B 1QACA 4NUJB 5H35A 2W38A 4JG0L 3V7AG 1TCRB 2BNRD 1DJSA 1OTSC 4JN1L 5EULV 1CICB 2NNAB 5IBUB 1P84K 3ARYA 3DRQA 2Q7NA 1BQHB 4NUGH 4OIBA 5BRZD 4M7KL 1OWWA 4M7JL 3H0TB 3B5TA 3CDFA 2IH1B 5F3HB 3QUMA 3O4LA 5FYKD 4X6CB 5F1SA 2EC8A 2VXQH 1IAKA 3CSYA 4Q9QH 5EZIH 2P5WD 3GI8H 1FZJA 4PLJC 1A8JH 3FO9A 1XFPA 3CFBA 4FXKB 4PJCA 1MFCH 3W9DB 2E7CA 5DD3L 2J5LB 3VXNB 5MEOB 3SPVB 3QUYB 1QQDA 3OMZA 4PBWD 4G42B 5TQ2L 4XHJD 4R6UA 4JFZH 2D31A 5FYJD 4JN1H 1BQLL 5KBNC 2YUWA 4NKDA 4U2ZA 1MIML 3IAQA 5DRNB 2KL6A 2MQCA 5FYLH 3DVFA 1VADA 4XBGA 1FAIH 2BOBB 1J11A 3C2AL 4JJ5A 3G5VA 4HIEA 2X7LB 4F80A 3OXRB 5I1DB 1BJMA 3ULVL 1NCDL 3V9FA 5F6HJ 1A9EB 1FPTL 4H1LA 4KY1H 1T1ZA 1CVRA 5B4MC 2OXGA 1G7MA 2FH8A 4ONHA 1EJOH 3DGCR 1FL5A 1W0VB 4I5BB 5DD5H 4FQ1L 3K8MA 4X6EB 3RPKA 5HYJB 1RZJL 4NPYA 3WUWA 2ZG1A 1HNFA 3PF2A 2R9HC 4NGHL 4WJ5B 5F72S 3S5LB 3MV8A 4BH8A 3BEWA 1G84A 1UADC 2BSSB 2I9TA 4ZUSB 3SDAD 3A0OA 3TFKC 1M6OA 1BQLH 2DBJA 3PWPA 4QRSA 2XQBL 4WTZA 4WI4A 4BQBA 3RVVC 3Q2CA 3O3EA 2GKIA 3F7YA 2IGFH 5K9OB 4M8VA 5E8NA 1LP9A 1VKXB 3ZTNL 3BPOB 2J8HA 3MNWA 1CZ8H 4NO3B 4HZLA 5C08E 1NCDH 5LBSL 1NCUA 2VLJE 4JY5L 3SGEI 4PY8J 1DLFL 1QP1A 3O3DB 1VCAA 1AO7D 4HUVA 4RGMC 4QT5B 4ZS6D 3QUYD 3GIVB 3QDME 3PV7A 4FQ1H 4IMLA 4ERSH 3NACL 4G8GA 4GKZA 1RZJH 2FR4B 3LMJH 1YMHB 3LPWA 4I18A 5E6IA 5J3HC 4X4XB 1NGWA 4MDJA 4EDWL 2R0LL 5HGBB 3WIFA 3RVTC 3IJYB 2OX5A 1U3HA 1WT5A 3MLWL 4Z7UE 5FK9A 4DVRL 4Z7UF 1JK8B 4Y4HC 3R06B 3OJMB 3T4AA 4ZNEA 3OKNB 1UG9A 2XQBH 2DJ4A 3UXFA 3EZ8A 4MXVE 2F54E 4H1LG 3D18B 4MXVF 3RWGA 5E7FA 4AY0A 4H0HB 3OR7A 2EE2A 5GRJL 1LEKB 1MCQA 3SKOB 4OV6F 3ZTNH 5EBWB 1MFEH 1Q9KB 1QFOA 3IFNL 1WFTA 4LLUA 4JY5H 4F8QA 1AR1D 3LCYA 3WUWG 3CSGA 4APQB 2F5BL 5C7XH 1YEIH 4ISVB 3QO0A 2CLRA 4WI8A 5AG8A 1FDLL 3UJIL 1BFVL 2J8OA 2YA1A 5CP3H 1OSPH 1NAMA 4OCRL 3P30L 4ZUVA 3JXAA 4L5FL 5CEZD 1A6VL 3MRHB 3OR6A 4UZGA 4WTZG 5TDOB 3SGJA 4GW1A 1JGVL 2D7PA 5T5FH 4EDXB 3BPCA 3RL2A 4H8WH 2MCG1 1U92B 2W0LA 4U1JB 5F1OB 5FYKH 2EYRB 1KLUB 2ICCA 5D1XC 5GRJH 2V9RA 4R90L 2CPCA 3FZUD 3GNMH 3BSZH 2V7HA 3ZTJH 3IFNH 3QQ9D 4HJGB 3ROLA 4Z8FH 2E7BA 1RHHA 4FFYH 3ISWA 4OCSL 4ZSOE 4PRIA 1PGRB 1QA9A 5MP6L 5CJBA 3VXPB 4U1KB 3MZTA 3INUL 3JVGC 2R1WB 4NHUA 3TBWB 3FO0L 1EFXB 1CLZL 3MA7B 4UIMA 3ZKXB 2VDRH 1BFVH 3WNMA 4YPGB 1LO0H 2QHLA 4P2QE 3GGWA 4OCRH 5FYJH 4WIQA 5FYLE 1A14L 3T2OA 5KG9A 3UX9B 2FHBA 2G5BB 2DF3A 4U7MA 3GSNB 2ZP0T 5F96L 3RVUD 3MJ7B 1NPUA 1LEIB 2ED8A 1IGJB 1ZA6B 5F8QC 4QHNA 1EO5A 1KN2H 4HS6A 1KEGH 5JOPE 4ZOBA 3HPLB 1C5BL 4U0RB 4Y1AD 1NFDA 3AXLA 3BPNB 1ZMYA 4X4YB 1ZHNA 3P4OB 2VC2L 1RMFL 4H26A 4ZDHA 1B90A 4KZEH 2RR3A 1R3JA 3C6LB 5MP6H 3D9AH 3LSOB 2W9EH 2YPKB 1QBLL 3U30B 2PXYC 1CLZH 4YLQT 3HUJB 4LVHB 5IBLD 1AC6A 3MV9A 2HKFL 4PB9H 5HHPB 5BVJB 3IS1X 4PD4J 5ANMA 1A14H 1U95A 3O11A 4M1CC 4OZIA 5DDHB 1OY3B 5IESL 1G7PA 1QSEB 2CKNA 4Y4KD 1DQML 3QEQE 3VGAC 4RRPA 1CR9L 1FCCA 1AXSA 1JHTA 3AY4C 1T7ZA 1C1EL 4HUUA 4Y5VA 1RU9L 1J10A 4IMKC 4HUXA 1PY4A 1FZKA 5EOTB 1C5BH 1R3IL 5F9AC 3DI2B 5BOZG 1RULL 4TUJA 3SE4A 4S2SA 2VYRE 4P9HH 2VLRB 3CMGA 4WCYH 1NQBA 4FQQB 1XR8A 3BDXA 1MCKA 5D7SL 3IDUA 2IBZX 4NC2B 1IAMA 1WISA 5DC9B 4QRQB 4TVSa 4OZHE 5JHDD 2YEZA 4OZHF 1O5DT 3QI9A 1FP5A 4JZNB 5JA8B 4LCIH 1DSFH 1RZFL 4ALAL 1MH5A 3GJFA 5DMKB 1S7VB 2C1PA 4LQ1A 5IVXB 3B3IB 5C0GA 1Z6JT 2EDRA 2YN3A 3QXVA 3CFEB 5C07B 4NO0A 1CI5A 5KW9H 4RGNE 4TN9A 1FC1A 4PLNC 3C6LD 4QHLB 3E1F1 1TPXC 2W9DL 2FDBP 4LLVB 2BNRE 4U6HA 2LE9A 4XCEA 3CCHB 3KPLA 2ZOLA 4KKCD 5DJAA 2NZ9C 4KKBD 1CGXA 5CEZH 4IRJD 2R1XB 3L5HA 4YFEA 1YEHH 2AXGB 5ITBH 4R7DB 2D7QA 5BRZE 2GT9B 1XAUA 4MLIA 2DQTH 1OTSD 3BKML 4U7KA 1GL4B 1RI8A 4IS6A 5DQDL 2NX5A 4QRTB 1NAKH 3RA7H 5FYKE 1SEBA 1KACB 1KIPB 1NGYA 4AH2A 4GOSA 2P5WE 4D9LH 3TIDB 4YDJB 2ICWA 2HJKB 5IHUL 1QO3A 3G9AB 4A2MA 4X4ME 5C0JB 4I0PA 5K59E 4KKAD 2DOCA 5K59F 4PLJD 3RDTA 5IJKA 3EYFB 3QUXA 2W9DH 3QHTC 5BW7C 1CLYL 3FB7A 4BH7A 5IQ7L 1RUKH 1PSKL 3L9RA 5L6YL 5FYJE 5FDYA 3VG9C 1F6LL 1XF1A 1T0NB 4LLWA 1D9KC 2WINB 4ZODA 3VXRB 3QFDB 3W9EB 3VJ6A 5C0DA 2VQTA 3NN8A 4W4OC 5DQDH 3MFGB 3LRSB 3LVEA 4X6DA 3E8UL 2CIKA 1M71A 3EJJX 4U1MA 3AREC 3NCEB 1AGEB 5IV2A 3B8YA 4P4KA 5IMOB 4N0CC 4HMEA 4Y4HB 4ZTOH 4KTDL 2GUOA 1G7LB 4ZG1A 1IQWL 2EDEA 3LDBC 5TE7H 2P48B 5IHUH 5EC1B 5H94B 2NTFA 3TJEL 4PJ7A 3KPRA 5CGMA 1ZSDB 2X9XA 4PRDA 2Y06L 4JE4B 2VLKA 1M7IA 4CMHC 1KTDB 3V4PL 4E41D 2BVYA 3RIAF 3MYZA 5FDWB 1XIWC 1VFAB 2Y6SD 2GFBB 4M7LL 5IQ7H 1PSKH 1F45A 4HEME 5L6YH 4LF3A 1HWHB 4UB0H 4RNRB 1GOFA 5J56B 1A4KA 3D2UA 3QDJD 4QCIB 2OCFD 1J1OL 4LSRL 1KN4L 1KEML 3KPPB 5L7XL 4BQ6A 4X6CE 1PG7W 4Y2OA 3P4MA 4X6CF 5A1AA 3I6GB 3TFKD 3Q3GB 5IOPA 4WI7A 5LGHL 1U8JB 2NY7H 4TNWF 3QFJB 3QCVL 2Y1VA 5DWUH 3X17A 1AO7E 3QBTB 3FHAA 1W0WA 5F7EL 2ADJB 4FMFA 4QRPB 1FH5H 4DUWA 3PJSA 2Y06H 4NNXA 3GMMB 2RAMA 1F90L 1BFOA 4NQDB 3V4PH 4O02L 1OGTB 2HLFD 4CRPA 3WDHA 4OD3L 1YMMA 3ET9F 3LKOB 3MODL 5DLMH 5J3HD 3VXRD 3ARFD 5D2NB 1FFNA 3VRIA 4OGXH 1J1OH 4LSRH 3AM8C 5LAXB 3CLFL 4U1LB 2CUMA 1CK0L 4HFWA 2FL5A 3GSXA 2QQLH 2X1PA 2UUDH 3W11D 5LGHH 3H9HB 5C6WH 2XZAL 4U3HA 2DKSA 4M4PA 2HTLC 1QTYT 1JBJA 5J89A 5DK3A 1CVSC 2QEJA 4J6RL 3MLZH 2YC1B 2YZ1A 1YNTB 3WKML 2IAMD 2AVGA 5HGAB 1WZ1H 3NPSC 2HN7A 1J0YA 2FZ3B 3P9WB 5CEYB 3RWFA 3TF7C 1JF1A 5EN2B 5SX4H 3VE0A 1T7VA 2E8ZA 2O5YH 4OD3H 3MLRL 3QIUC 5DQ9A 4NQUA 3VFNB 3VA6A 2NLJB 1MJ7H 3OKLA 2OMBA 4BUHA 1BVKA 1SY6H 1A47A 1I7TA 2PXYB 3K2UH 1V3LA 3MRCA 2J3SA 1S5HB 3QG6A 3KPTA 1N64H 1KXQE 1S7UB 2CLVB 2DQDH 3FFCA 4L4VD 1X3DA 3QJFA 4OBSA 5DVMA 2HFEA 4JRXA 4QHMA 4D8PB 2GI7A 2IQAA 4U6YA 2YKLL 1CDYA 2OM5A 4H5SA 5D1QC 3U36A 5FO8A 2AXFB 3PGDA 3OX8A 1BAFL 3ARDA 3QPXL 3VG0L 3MRLB 4YDVA 3VFUB 3VGAB 4J6RH 3LKPB 5D1XD 2ED9A 5EO1B 5JW5A 1ZV5A 5AZ2L 4NQDD 1HOCA 2AERT 4X6FB 1ZLUH 4Y16C 3RIFF 3PDDA 1RJCA 3MJ9L 5GS2D 1AGBA 3LQZB 3NFNB 5A2IH 5E2WL 1QRNB 3H8NA 2NNAA 1H3TA 5HPMB 3MLRH 5JO5A 1BQHA 5I1HL 3H7LA 2A6IA 4JB9L 1JGUL 3IKCA 4WFED 3SN6N 3MV7A 5JHLL 2QJDA 4Z77B 3SE3A 1EHAA 1EHNA 3UTZA 3C09C 3MRIB 3UTPD 4LHQB 3BIBX 2FX9H 4Y1AE 5CSGA 5CUSL 1BAFH 2HVKB 3CX5K 4GRLA 3OKEB 4KC3B 4HPYH 4IM8A 3N9GL 5AZ2H 3RNQB 3S34L 3H42H 2DB8A 3MJ9H 3LV3A 1MHHB 5I1LA 1EEYA 1EDQA 1TPXB 1P53A 1MFDL 5F7NC 3DVNA 1ZEAH 2WIMA 4CGTA 3CVIL 3NCCB 4FZ8L 4WHTB 3VRLE 3SKJL 5E56A 5I1HH 3VRLF 1ADQL 1TJHL 1JGUH 3OXRA 3ULVC 1SYVB 1KELH 2BP3A 3WS3A 5JPMA 1T2QH 1O0VA 1BZ9A 3T08A 1KJ2A 1OF2A 4TUOB 5D7KD 3V5KA 3TA3D 1UJ3A 2FJFA 5AYUL 3FQNA 5CUSH 5HHOA 4I1NB 3OKDB 5FB8B 3NCMA 2PTTB 2R4SH 3N9GH 4QXGH 4OZGA 1SJEA 2ZNWA 1QRND 5DQJB 5E2TH 3S34H 4DWHA 5JHDE 1BQHG 4N9OB 2V2WA 1BIIB 5DK2B 1IKFL 3QNXA 1J5OL 2J1KA 1K3IA 1YQVL 3CVIH 1I1YA 1TETL 1TZIB 3SKJH 3VG9B 3K2MC 1ADQH 1OAZH 1TJHH 1D9KB 4M8QA 1RUML 1I9RL 25C8L 4Z0XA 1MCCA 1BD2D 4P5TA 1JTPA 4FQLL 4KHTH 4UUJB 2XWBA 3IDJB 1AHWC 3QNYB 4H0GA 1RJLB 1U8IB 3JUYA 1UVQB 1WBXA 3KPNA 2EDOA 3T77B 3AREB 2FLRT 3L3DA 5AYUH 3VH8A 4P57A 4GG6E 4LQFL 4GG6F 5I75B 4HS3B 5A3IC 3LDBB 4OKVA 1KGCD 1RFDL 1MF2L 5GGSB 3QUZC 1IC4L 1ZTXH 2JIXB 1I1AA 4FTVA 2KH2B 4CMHB 3DJ9A 1V3JA 5I17B 2NZ9D 4D9RD 4MNQA 5TH2A 3QQ4A 1E6JL 4G80B 5E1AB 1XIWB 1IKFH 1BHGA 2KZ1B 5I66B 1E4JA 1YQVH 3NFPA 4Z7NE 5HGDA 1WVZA 4Z7NF 4FABH 4PREA 3DECA 3NPZB 1WZKA 3PDGA 4JG1L 4JQVC 4HIXH 4FQLH 1S5IL 5IM7B 2EDFA 4DOHB 3UTSA 1HSAB 1KJ3L 2CRMA 3EYUH 5KVFL 4KDTA 2MKWA 5CJQH 2CLZB 4POZD 3L3JB 3HR6A 1R5VA 3CVHA 1MHCB 1IRAY 3BD5A 5GS2H 3DLQR 3N1QC 1RFDH 2UVEA 1IC4H 3QB7C 1DBML 3DX7B 4Y2DC 1Z3GL 3ARUA 5B3JE 2GK0A 3SDDD 5B3JF 5KSBB 4MJ4A 4K7FB 4ZUTA 4G6FB 4YHOH 4HHAB 4JCLA 4O51B 1C5DB 4M61B 5I76A 2OR9H 1CFSB 3REVA 4ONOA 1HWGB 3F62A 1B6UA 1S7TB 5ACLA 5I8KL 4JAMB 2YR3A 3P2TA 2YSSB 3QDGA 1X7QA 3LKSB 1Z9MA 4XNQA 4JG1H 3VH8G 3ARED 4O2CA 1L4IA 3TJHC 1JV5B 1S5IH 3ZT6A 4CJ1A 3JZ7A 3CU1A 2CRZA 5CHNB 5C0EB 4E41E 1OQOA 1ZE3C 4OF5A 3W39A 4JFDB 2J8UE 3QDJE 3O2DL 1HYSC 2J8UF 1WUNT 1NEZB 1DBMH 4G9FD 5DGQA 5IHBA 4ZO7A 2MFNA 3NPSB 4F9LC 2EDNA 2P5EA 3UYRH 1GH7A 1NCAL 4HJJH 4WUUD 3QIUB 2C7UB 3V6FA 1BP3B 4D0BB 3FT4A 1JPST 5E8DL 5ERWA 4GSDL 1D5BA 5FAAA 1U8LB 1FVCB 1NBYB 3HNSL 1EO8H 3QHFH 1E4KC 5T1KB 4X4YA 5JW4M 2Q87A 2P24B 5D1QB 3NABL 1SJHB 2VDNH 5FCSH 4IRSC 5DMIL 3KDMA 3CD4A 1WBZA 2P42B 4YGVB 4DW2L 8FABB 3JWDC 3V6OC 3VXRE 2ZSVA 3O2DH 4Q9BA 3SDXA 3B4NA 3PDOA 1A3LL 4JFXB 4WV1C 4Y16B 3OHXB 5CJXA 3ZHLA 1UQSB 5IVNA 1UZ6E 1I4FB 1UZ6F 3JV4A 4HUMB 4KTEL 3NIFE 1Y0LB 1S8DB 4WUKL 1U8OB 5J4MA 1RZGA 4Z78A 4PJAB 2A6KA 1K8DB 4NIKB 1NCAH 1KCRH 1DFBL 1BFTA 3VGFA 1H3UA 2HVJB 1ZT1B 2HH0H 2FLBT 2D7NA 5DHXB 3KPOA 4GSDH 4GUPB 5GS0C 5KSUA 1DBJL 2HTLD 3HNSH 2BSTA 1OD9A 2J12B 3SY0B 3C09B 4WEMB 4IEFB 1MCOL 4EUPB 3VWJC 2BVTA 1U8PA 5SWSD 2VDPH 3K1DA 5MEQA 1NGXA 4NRXA 5DMIH 2OTUA 1LMKA 2V5MA 4JREC 4X8JA 4DW2H 3WNLA 1A7BA 3FOLB 3X14A 1A3LH 4XCYA 4KMLB 4E5XA 2UZXB 4L4VE 4RX4A 5DO2C 1TQBC 3FMGL 1MWAL 3U82B 2HTKC 1Q9OA 4WI3A 5J1SC 1GIGL 4WUKH 3IT8D 2CDGA 1QFWI 4UQ3A 3U1SH 1A6AA 1RAMA 2DJUA 1DQQB 1DFBH 1UM6H 5I2IB 4FFVC 1FE8L 2RJMA 2GJJA 4TYUA 2VXUH 2ITDB 4D3CL 2HA1A 1JZ4A 4XVJL 4NQDE 3KPSB 3PWLA 4P2CG 1OP3K 3SQOL 5MI0B 1DBJH 3EUUA 4JDZB 1JGDB 2IBGA 1MCOH 4KJYA 1N4XL 2DMBA 1G0YR 1VPOL 1WBYA 3MFFB 2IG2L 3MNVA 4Y16D 3PGCB 1CQYA 2WBJC 3IDNB 2ZCLL 5BQ7B 1J0HA 3CXHK 1JWMA 4GRWH 2EDDA 4LLQA 4NQCA 1G1YA 5EU5A 2D4FA 1AC0A 4WFEE 1XR9A 2DIJA 3QH3A 3MRJA 1A3RL 1EVUA 3HTLX 1MWAH 3BAEL 3VDBA 4M1DL 4KHXL 3T0WA 5KZCB 4XRCB 5L88H 3O45B 4OF0A 5DSCA 3GSQB 5FKAB 3MQIA 2FIKB 3HS0B 1FE8H 2FWOA 3BUYA 4I9WD 4LDEB 3HMXA 4D3CH 1V8HA 4QRUA 3MBXH 4HXAL 4D0DB 4QRRB 4PGEB 4G5ZH 1AHWB 2YPLA 5GGRA 2DQJL 5GRVK 2X4QB 4RMWA 2OZ4H 4L8DA 3QWRA 2IG2H 5CJ5A 2V17L 4FQHA 5HHXH 1A7QH 3VRJA 5E08L 3BDYL 1I8MA 3RWCB 3BVNA 1S9YB 2W60A 2ZCLH 3GJFK 4PJ9A 3NTCL 2J4WL 5I1EH 4F7EB 5KAQG 1CQKA 3FQWB 2ORBL 1ZANL 1KPRB 4PLKC 3VXUA 1ONQB 2Y5EA 4Z7QE 4Z7QF 1EXUB 1A3RH 4MXQC 4U1SB 2G9HA 4HKXA 5E9DB 1QVOA 5D7KE 1IE5A 1U8QA 4KHXH 3GHEH 2FO4B 3KPSD 1HKLL 1U8NA 2I5YH 1S7RA 3KYKL 1VACA 2X70A 4G8FB 4N8CL 3BWAB 4X7TB 2NYYD 1K4CA 4EI6A 4LFHG 3T1WA 3MGTA 3DTXA 4I3GA 1KTDA 1QRNE 1HXYB 4AIOA 2X4UB 1DR9A 1U8MA 2YXMA 4MQXC 4L1HA 5FOJA 5AG9A 1I3GL 1KJMB 5C9KA 3KYNB 1DEDA 5AD0B 1NUFA 3U4BL 2V17H 3GMPA 2G75A 4OJFH 4PRPA 1AGFB 4HSQA 1AFVL 1KTRL 3F7QA 3WMSA 2J4WH 4EIZC 2R4RH 1LHZA 5M94B 5GQBA 5L0QC 4Y2DB 3K74B 1BD2E 2X9YA 4F7MB 4PV9A 2P44B 1Q94A 3OZ9L 5C0AE 3S37X 1J0JA 4F3FB 2A38A 2H9GB 4O2EA 2EYTA 2N7AA 3G5XA 3RTQD 4NT6A 5ESAB 1KLFA 3T0XA 4MSWB 4RAVB 3KYKH 5KOMC 4I4WA 1YEFL 4WVRA 3MXWL 1WITA 2WM0A 1KGCE 1KJVA 4P23A 3IETA 4GAFB 3ARGA 1T5WA 1NBZB 2A77L 1NGQL 2VWEE 3NCYS 5FGCE 1ITBB 4D9RE 2EIDA 4YAQB 5TQ0L 3QUZD 5D2NA 5DR5L 3U4BH 3MRMA 1AFVH 2KUTA 5IFAH 1CF8L 4JFFB 4KK8D 2L4OA 5E9DD 3QEGH 3Q5YA 1M7XA 3T0EA 3V6ZA 4J7RA 3OZ9H 5IWLC 5JNYB 4GKSA 2AP2A 5C09B 2GTWA 1JTOA 4HUNB 4JKPL 4LSSH 4G9DA 4H25B 4FXGB 4PJFE 3O0RH 4J3WA 4PJFF 1PX4A 1YEFH 4F8TA 2DICA 5GGVY 3EHBD 1EHXA 3RPIA 1SEQH 1G7HA 5DRZB 5EN2A 4ODWA 1NGQH 1MCWW 2BVEA 4GRWE 1WQVT 4ZFGL 2JK5A 4GRWF 5HHQB 2L7JA 5F70A 4GW5B 4IRSB 1ZT7B 2AXJA 1CD0A 5DR5H 3QDHA 5LGJA 3NZ8B 3WJJA 4AJ0A 1KNOB 5SWZE 3F6IA 1KPUA 2F9BT 1LWRA 4ODUB 1HCFX 2Z93B 4MA1C 4WV1B 2AXHA 4XZUB 3TVMA 2R2BA 3BKJL 4YBLC 1T5XB 3ZL4H 3B5HA