3VFGL

Crystal structure of monoclonal antibody 3f8 fab fragment that binds to gd2 ganglioside
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
211
structure length
211
Chain Sequence
SIVMTQTPKFLLVSAGDRVTITCKASQSVSNDVTWYQQKAGQSPKLLIYSASNRYSGVPDRFTGSGYGTAFTFTISTVQAEDLAVYFCQQDYSSFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3F8 Light Chain
publication title In silico Driven Redesign of a Clinically Relevant Antibody for the Treatment of GD2 Positive Tumors.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vfgL01
3HE7B 4LKXB 4U6YA 4EJ1C 5H94A 1MHHB 5F96H 2R39A 3K7UA 1D5ZA 1PEWA 2V9QA 3IDGB 2H32H 1NCWH 5F9WB 1EO8H 3WJLA 4POZC 3QDMD 2B1HH 5AZ2H 5HHOE 3VXUB 3F12B 2UV3A 3HNTL 1ZANH 3FRPA 3SGJC 3U48A 2VC2L 4HMDA 2R29H 4Y2DB 3WUZA 4X5WA 3H8NA 4X4ZA 4DCQA 1C1EL 4Z78A 4H26A 4MNQE 3OWEA 3MLTA 4H0GA 5DRZA 3WKMH 4XTRC 4CU6A 3BKJH 2EKSB 5DR5L 1WT5A 4K3JH 2V6HA 4PJDB 4NO5B 4Z7UB 1KPVB 5J11B 1FL3A 3JVGC 1WISA 5C6TL 4JAMB 4F7CA 2GJJA 1QPPA 3FONA 1T0MB 2AJZB 5D6CA 2OL3H 5IOPB 1AD0A 5D7LA 3KDMB 4M62L 2IMMA 3NBNA 1OT2A 1UYWL 4LAQL 4OD3H 4ZFZA 4G7VH 1G6VK 2I07B 3IU4H 3JTTA 4OD2B 5ICXA 4QEGA 1K85A 3T3MF 3BDYH 1YEDB 3QHZH 5K59F 3GMPB 3VFMA 1ZHLB 4OFPA 4P4RB 5C92A 4BSWA 1NMBL 4OZFH 4GRMA 1N7ML 3O4OB 1J7VR 2DQGL 2VE6A 3LKNB 1MEXL 2O5YL 4JGJA 1J0ZA 4KTEH 2DMBA 4RIRA 1N64L 3TLRA 4XP9L 4HCRL 5I1HL 5J6HA 1ZGLA 1JPST 1IJ9A 1CFNB 1T20A 2AJYL 2FSEA 2NY2B 3TJHC 1ZHKA 4PRAA 1FO0B 5C0FB 4KKBC 4K3EH 3V79C 3IU3B 4NGHL 1ORSB 1RZ7H 1GGUA 1LD9A 4QRTA 4P9ML 1OSPL 4WW1B 4G3YH 5CUSH 2CXKA 1EEZA 1FIGL 4DKEH 3HNVL 2YKLL 3SCMA 5EBGA 3N9GL 4U31A 1S7TB 4GUPA 5D7IF 5B3NA 5T1MA 4NPYA 5A43C 4UNVA 4EDWH 1HH9B 2B0SL 3VRIB 5DHVA 5E5RB 3OB0K 3GMLA 5D8JH 5FHBH 1BPVA 4LVOC 4Y5XB 5AYUL 5IWLA 2ARJQ 5H8DA 3HRPA 1SYSA 4KI5D 1SEQH 2ITDA 4LPVA 1A4JA 4FQIL 4KRPD 3RDTB 3WNLA 4I2XA 2BDNL 2YOCA 2C1OA 2CDEB 4JREC 4WEBH 5IM7A 5C07B 5IT2H 1KJ2H 2F53D 5DSCB 1F2QA 1PZ5B 2BJMH 2VLRE 2IMNA 2JIXD 4Z77A 5JHLL 5ITBL 4LASH 2EXYD 4LLUA 2BOCB 3QWRD 2BMKB 5JLZA 3RY5A 1AY1H 4X6EB 1T03L 2OJEA 5HVGB 1W72L 3SDAD 1TZIB 3SQBA 2XKNA 4NNYA 2D31B 2OTWB 3WE6A 1R3LA 4M48L 3OJDA 4R0LB 1JHLH 3NFNB 1A1OB 2Q76A 4FRWA 2AK4B 2W60B 5I8OL 1A7OL 3BN9D 4P23D 1FZKA 4HLZG 1C1EH 4KHXL 2F54A 1LILA 5JPNA 1INQA 4OSUL 1H8NA 5I17B 3OX8A 1K2DB 5CD5C 1HSAB 2EYSB 4Y4HB 2Z91A 5EZLB 2Z93A 3IFPB 1W0VB 5TE6L 3UP1A 2VOTA 5AUMA 3HRZA 2RBLA 3EYSL 3UDWC 4M62H 2P5WE 5CEYB 1DQLL 1WC7A 4KDVA 4IJ3C 3JUZA 1UYWH 3W11C 4LAQH 1S3KL 4RGNC 4MDIB 2E8YA 2Z35B 3SDCA 4LVEA 1FLRL 2DIJA 5E0QA 4IMKC 4MD4B 1HYSD 5DJAA 2J8UB 4Y2OA 1BBDH 1D5XB 2R1WA 2FJGB 1BIIB 3CC5B 4O2EA 4KJWC 3O45B 1ZGLM 5JW4M 1MRDL 5JHDB 3IJSB 3SDYL 3KPNA 2X09A 1TVBA 1IEAB 1YN7B 5DRNA 1DE4A 2O5YH 1MHPL 3HI1A 4ERSL 3TO2B 5I1HH 3VXNA 1UM4L 1TTFA 1CU4L 4OZ4B 4APQA 2XRAH 3I50L 4O02L 5DTFB 4RZCA 5GGUB 4Y4FB 2PN5A 4HS6A 3QWQB 3FQRA 4H25B 4MA7L 5EG6C 2ZSWB 3NCBB 4H0HB 3U7YL 5CIPA 2EDJA 3C5SB 2FWOB 4PTTA 4Y7MA 5BQ7B 1FIGH 3HNVH 5IW6B 5GGTA 3VXRA 3VA6A 4I0KA 4Z18A 4LDLB 2ESVE 4I8DA 3N9GH 5HDQH 3SY0A 3DX7B 4HWEL 5JUEL 2ID5A 3ZT6A 3B9KB 1BFVL 1U8QA 3MRJA 3VH8G 3NGBC 2OI9C 3BUTA 4UV4L 3V6OE 2Y07L 4XWOC 4UTAH 5AYUH 4FFYL 2PYFA 4WFGD 4UOJA 5B3JE 3V0VA 4LVHC 3ALPA 2M1KA 2PW2A 4Y4KC 2OX5A 3T1WA 2UWEB 3K46A 3NN8B 5CKAA 1A1NB 4IIQA 1MHCA 2APTA 4RFNC 2HKFL 3HG1B 4KDWA 4F8TA 4WENB 4BK4A 3NIDE 4EIZC 1KTKE 3S88L 3O81A 5IEKA 1A6ZA 1YN6A 2P24B 4Q6YA 3IFLL 2BP3A 4MCYB 4F57H 4NQXA 4PJIB 1WWWX 1WQVT 3UZVB 2V9RA 5DJZB 1BREA 2VLKA 4FG6C 4G9DB 1QP1A 4MS8D 3S4SB 3KYKL 3U6RB 1PFCA 1AHWC 4G7YL 4JFED 5I8OH 1CE6A 1WTGT 1A7OH 4TNWK 4YWGL 3TF7C 2I24N 4NZTL 1IKNC 3ARGD 2XTJB 3VFNA 1OCWH 5FO9A 1F4XL 5EIVA 2X4NB 4KHXH 5A3ID 1I1CA 1AXIB 2NXZB 3NFPA 4ORGA 3TBYB 4AEHH 1FDLL 4JM2B 3QJHA 4N90E 1JGDB 4OF5A 3RDTD 3TO4B 4MMXC 1DQLH 3PHOB 1OAXL 5INDB 2BVQA 5JXED 3BIKA 3LS5H 4U1KB 3U1SL 2R0KH 3VWKD 4FQQB 5FYLE 3RAJH 3DIFA 4DJMA 1J1OL 5EN2A 5TGBB 4J3XA 4NCDA 4QY8B 4ZDHA 2IAMD 3L3HA 4LLWA 3QUKA 1J1XH 2V2XB 4L5FL 5J9PA 5KSAC 2O5XL 4RDQG 3ULUD 1MHPH 3ILQD 3GIZH 4TOYL 3KJ4B 1T0NB 2X4QA 2WUCL 3FQWA 4R7NA 4HWBH 1CU4H 2LVCA 3L3OA 3EJZC 1AKJA 4JZOB 4AYFA 4V1DD 4W81A 4C58B 1XGTA 2J3SA 3EDDA 3KJ6L 5A16A 3D0VB 3SKMB 1J1PL 4XNQA 2R8SL 4ZOAA 3PQYB 5F93C 5ABDE 4M7KL 4DQOL 4GRWB 5KVGH 4PJ8D 3SE9H 4DGIL 1OTTD 2GFBA 3B8SA 4D0CB 4OD1L 4HWEH 5IHLB 2F58H 3BDXA 4ZG1A 1I1YB 5DQJB 4LPTA 2VDRH 4WW2B 2BNQA 3QHTC 3WFDL 4FZ8H 1BQHA 2XZAL 2Y07H 5HTSA 3BN3B 3E0GA 2Y1VA 1JZ7A 5B3JF 2IAND 4HG4J 3HMXA 1CTOA 1KTLB 3D2UB 4UIKH 4OCWL 4QYOB 4D9QD 1XF4A 5C0AB 2DWDB 1BLNA 3B5TA 3NACH 5ITFA 5LGKA 4IDLA 4AEEA 3MZTA 1IC4L 3SJVB 1RSFA 4PP2B 4AM0B 1S7WB 4YHYB 4JFDA 3OKOB 2KZWA 5DDHA 3S88H 2ZG1A 4UT6L 5CGTA 2XWTB 4K23L 3IB4A 4W68A 2CDGB 3DRQA 4FFWC 3H3KA 1OP3H 4C56A 3FO1B 1IC5L 5D2NA 3GMQA 1I8MA 1ZGLP 4LSVL 1NC2A 1XGUB 1X3DA 5CMAB 5LGJA 3HTLX 1I8KB 4RAHA 4YDJB 4G7YH 2H6PB 4R97B 2Z31D 3MBEB 3WMSA 4YWGH 3Q3GA 1KFAL 1S8DA 4ZNCD 1U95B 3EOAB 3V6OC 5H37H 3OHXA 3F7QA 4Z7WF 3FFCA 1T89A 2CLZB 4PJ7A 3MFFB 4IMLA 4H5SB 2Y06L 1F97A 4PRDA 3CDGB 1OAYH 1BWMA 2DQDH 3LEVL 1AXSA 3K4AA 4ELMB 1FDLH 4PBXA 4KUCF 1E28B 3C5ZA 4FQHA 1IAKB 4HKBA 1NUDA 1T7WA 4CVXA 4IDJH 5IMKB 4NN6C 3DI3B 3DX6A 4G5ZL 2I9LB 1SVCP 2VABA 2DN7A 4ZUWB 1H0DB 4S0TD 1J1OH 2EC9U 5T3ZE 1EERB 4XBPA 4UB0L 4GAGH 1MF2H 5ESQB 3VFSA 3VFPA 4PLKD 4K9EL 1CXEA 1XCQB 5ILTH 2YS4A 3I9GL 3QCTL 3TNMB 3JTSB 1LK2A 2X7LB 5C0CA 4LQFL 1LO5A 4P5TC 4QHUB 3GFUA 1MRFL 2P49B 5L7XL 2VIRA 3STLA 3OZ9L 2BVEA 4PJCE 1QFWI 1S9VA 5SWQA 4MAYC 2R8SH 5B38A 4XCCH 4M7KH 2CD0A 4DQOH 2C7UA 4NQDD 3PWJB 2FIKB 3TO4D 1JMZA 4DGIH 3CMOH 2D3VA 1I8LC 1KXVC 1ZT7A 4UU9A 4JPVH 2BNRB 5D93C 1UJ3C 3BEVA 1DUZB 3OL2A 5HHPB 5L6YL 1S9WB 3OKMA 1F90H 1JNLL 3TYGL 4NN5C 1TXKA 3B6SA 3ZE2F 3TA3C 3MRLA 43C9A 3BGMB 1GOGA 4B5EA 1A7PL 3GMNA 3TT3H 1F00I 2E9IA 4JQXC 1GCFA 1YEHL 1D5IL 1FNLA 5IK3A 4Z0XA 4DTGL 3O6LL 1CGTA 2A6JA 5CZXD 5E4EB 1UH2A 2H3NA 2X10A 4HIHB 5K93A 4F15B 4J3TA 1H9VA 4ODBD 4XGZA 3L7EB 1KJ3H 3IDNA 3RTQD 5EC1A 4K94L 4HUWA 2AXGB 5CSZB 2J4WH 4NCC1 2VDQL 3QUYD 4Q9CA 3VDCA 5D5MB 3D39B 4U6HA 3U46B 4QF1A 1U8JA 3GJFA 1VKXB 4L8BA 1BWWA 1LO3L 1N8ZA 4A6YL 1C5BH 1HH6A 4OV5A 2EH8L 1NGZA 3MRKA 4YIQB 5DGQA 3RIFK 2B4CC 2Y06H 1PKOA 4OGYH 3WUWB 1XR9B 4YDKH 5E24E 1CDGA 4HPOH 4XC3L 5EU6D 4K8RL 4P2QD 2J88L 5HI4C 3OKEA 4FQXD 3BWUC 3TN0D 3MV7E 1CF8L 4J8RA 2D9QB 1D9KC 3O6ML 1YECL 3SDXE 1QYGH 1TIUA 3QXDB 3D0LA 5F9JB 3MV9E 1M71A 2WBJD 5BV7C 1NAMA 5MHSD 3SKNA 2W91A 5CD3A 5LQBL 3PWPE 4M93B 2YD3A 4WU5B 2V17L 1QNZL 1HCVA 4GXUM 1ZS8B 4C83B 5D7IA 3IJHB 3I9GH 3QCTH 3WXWL 3BQUB 3RUGB 3BESR 3QEUB 1IM3A 3K2UL 2IBZY 1FHGA 3MRFB 4LQFH 1I9JH 5KSBE 3S98A 5HBBA 3OZ9H 1T4KB 4XMLL 5GGQL 1FFRA 5T1LB 1X6NA 2K9UA 4UNTA 1MFEH 5J8OA 1AJ7L 4L4TA 1SYVA 1DQDL 3O4LA 1M7DA 1G7HB 4UQ3A 4AT6B 3H9SB 3UDWA 1LK3L 2LAAA 1CICB 3QNYB 3PDOA 1QEWA 1A6UL 4CMMA 3I6KA 1NEZA 1YY9D 5E8DH 3O3EB 3FQTB 5SV4A 5SWZA 4MXWL 1MJ7L 1Q72L 3U36B 4X8JB 2YRLA 3QBTB 3OF6D 2APFA 3TZVB 5IMOA 4NSKA 3BH9B 3ZL4L 1U8IA 3BHBA 4JY6B 4ZQKB 1M7XA 5EZJA 3S35H 3NCJH 5TDNA 3UJTH 3GMOB 2VXVL 5ICZB 4EVNB 3STZB 1MAJA 1T1XA 1NGWA 5L8JB 2D0GA 3M8OH 2R69L 3NCEB 5JW5B 5IW1A 4P2RE 5IKCA 3F8UB 2XZZA 1NCNA 3WKNA 4XMPH 1KB5B 4G9FB 4EI5C 2FNBA 4MNQA 3B9AA 1O0VA 2CO6B 3NPSC 5C0NC 4PJXB 4PG9A 1LEIB 2XKUA 3ARED 1FZOB 1G0DA 5ALCL 4HH9A 5JQHC 3UTQB 4DTGH 3O6LH 4PRHB 3T65B 1PGRB 4G6ML 4PRPA 1QR1B 4LNRA 1KLGA 1QFWM 5F1NA 1T6WA 5TDPB 1NFIB 4F3FB 3BGFB 3MLWL 4NQCA 5HI3D 3RWCB 1K4DB 5I1EL 3P77A 4K94H 2NY3C 4PJ5D 5FEBA 5FCSH 2VDQH 3LKPA 4HZAA 2X41A 1ZLVH 3G6AB 5JPMA 4LCCC 3I75B 3CFCL 3GHBH 3T4YB 3PABA 4DOHE 1G7JB 4XRCB 1PVHA 4FXGB 5B22A 4X9IA 4XAWH 1G7QA 4PGBA 4QTHA 1Z5LA 3J8F7 3OXSA 2IQAB 2VKWA 5D2LB 1QKZL 4JKMA 2C9AA 4Q97A 5CHNB 4UMGA 1KXQE 5DYOA 1Z0NA 3BPNB 4K8RH 3V5KA 2VWEE 3EO1A 1TETL 5HYJD 1E4WH 5JIHA 5T5NF 1CDCA 3GSNL 3L5WB 1T66D 3ULSA 3V5HB 2GSIA 3G08B 3SDXF 3O6MH 2DQTL 4XXCA 4DK3A 1MY7A 2OM5A 2QV2A 4DUWA 5GRVL 4YHLH 4WIQA 3HUJB 4PV9A 2CO7B 5EOCJ 3T0ED 4MB5A 4AH2A 1PQZB 2V17H 1QNZH 3VJ6B 5I75B 2AV1A 4WI6A 1H5BB 3X14A 4XVTH 1TCRB 3RWJB 3LKRB 3Q1SL 3M07A 4F7PB 3CSYA 1NLBL 2NX5D 1R6VA 5I71B 4I13B 1C12B 4NBZB 3MV8E 2WLZA 3CVHL 5C9KA 3H3BC 2VDLL 4XMLH 3OTTA 1PKQB 3HLAA 3WV0A 1ZSDA 1BECA 1DQDH 1LP9E 3D9AL 1X4YA 3SE4C 4RWHA 1YUHB 1LK3H 2RGSA 1R24B 2R2CA 3BISA 5DRXA 5E00A 1VGKA 1HHGA 1XGPB 4P4KC 3QIBD 3QUMB 4Q9QL 1Y0LB 2IPUK 1HHJB 2VLRA 4JVUA 4MXWH 3WXVH 5HY9B 2A6KA 2GHWB 4NQVB 4KV5E 3BP4A 3GI8L 1CTNA 4I0CC 3O6FB 1JGEA 4CDHA 3LH2L 2R2BA 4ODXA 4LLAA 1BFOA 2KZ1B 4XVJH 1XF2B 5DJCB 1CFVH 3IETA 3ALXA 1HKLL 3IXAA 1JTOA 5JDSA 4MDJB 5EU3B 2XXMB 3QG6A 3QPQC 4ZO8A 3RZCB 3VXPA 5CAYB 1A0QL 3QO1B 3MRDB 4KKLC 1S7RB 2FCBA 1AD9B 3MJ9H 1Q1JL 4YLQT 5ALCH 1ODAA 5D9SB 1DVFB 1FNSL 2EC9T 5DJ6A 2BNUB 3C8KB 1J0YA 2BVTA 3O9WA 1NBYA 4GS7C 1G9NL 2P1YA 2P5WA 4L8SB 1UH4A 2IFFL 3MJ8B 3TIEA 1MH5B 3VXMB 2QL1A 3MRCA 4KKNA 3D85D 3QDME 2WWMC 5HHMD 1BZ9A 4OKVA 5DJ0A 4WV1C 1I8IB 3TZVD 1T5WA 1QSEB 1GOHA 5CJ8A 1FVEB 3P4MB 1RZIB 5HYSB 2Y36L 4OZIA 1FYTA 1E4XH 2DAVA 5IR1B 3DJ9A 1I7RA 4PJHE 5L2KB 4ESKA 2ORBH 3GKWL 4JFFA 2JCCB 3GRWH 3FQNB 4LRIC 4MAUL 3GSNH 4O58L 2D7QA 5I8KL 4L29A 2XNAA 2GEEA 4DW2H 1DBKL 1RJZB 4QT5A 5IW3A 2DQTH 4WO4B 4Q74A 4OZHE 3IRPX 5GRUH 3NAAH 1GGTA 2EE3A 2DBLH 4O51B 2ESVA 4GAYB 3O6KL 4IRJC 4FFVD 2FZ3A 3P0YL 5TF0A 5FF6B 1ZWIA 2YRZA 4LSPL 5F97E 3RPIB 2P7TB 4GFTB 5HHQA 1QVOB 3JXAA 4JB9L 3OSKA 3V6OA 1PY9A 4TYUA 1JV5A 1OAKH 1TJIL 4JRYA 1K8DB 1V7MH 2PTTB 5C2UB 5ICYA 3L5IA 3FB6B 3CFDB 3EYOA 1GGYA 2DLTA 5E6ID 1A6TA 2VDLH 2APBA 4GMTL 1N0XL 4KXZH 3OQ3B 3F65A 2LU4A 3ZKND 4XVUD 1Q0XH 1LGVA 4OF6A 4M43L 2VWEC 4F2MB 4HKJA 1KLUA 1CE1H 5JR1L 5ALBL 2WZPD 4L1DA 2PETA 2GJ6D 4PY8J 3FHQA 4OFYA 2A77H 2VNCA 5LBSH 3LH2H 1J0IA 1F4YL 3DROB 1EH9A 4NHCL 3HAEA 1OM3H 2VLMD 3F6LA 3D6GA 1A6WH 5T1KA 3GSOB 1FFPB 1IGJA 4PBWD 3UCRA 4KI5E 4UT9L 1AGDA 1F3JB 2CLVB 4NRXB 3V6ZB 1HKLH 4P5TA 2WWKT 5I15L 1DL7L 3UTTD 1M6OB 3KPMB 3ZSSA 4GW1B 2C3GA 3GB7B 3U83A 1LDSA 3L6FB 4Z7WA 1A0QH 4O5LL 2ATPB 1FP5A 5DJXB 5KANG 4MAYA 5KS9B 3FOLA 2DRUA 1G9NH 5J06A 1OQXA 1W0WA 1Q0YL 4M3JA 1BD2D 4BQ6A 3EFFB 1GZQB 3QDJD 2NW2A 4PJBE 5GGVY 2VLJD 1KCSL 4N0FA 1MJUL 5J12C 4UAOC 2AXFA 1UJ3A 4LKCB 2R23B 3ZDYE 5CILL 3QWOA 4LF3A 3JV6B 4BUHA 5E4IA 4P2OB 1JK8A 1IM9D 3PP3K 5TPWL 1N3NB 1SEBA 3M1BB 4MB4A 1JMXA 1RHHA 4YGAB 3HFMH 2P5ED 2Y36H 4JLRA 4L4JA 3TA3A 5ESAB 4PJHF 2BSSB 5IHZB 1FJ1B 2JLLA 2Q3ZA 4I0PD 4EUPB 5F3HB 2AP2A 3ARBD 3LPFA 2Q86A 1EBPA 1YNTA 4GSDL 4XX1E 4I18B 2AJXL 5DQ9B 4C57C 4PREB 4MXQD 4TSAH 3N85L 2HLFC 4MQ7A 3RGHA 4YHOH 5T5FL 1YC7A 3CDCA 4OZHF 3FN0H 2DYPA 5F70A 3MRBA 5LVEA 4DGVL 2FBJH 2J6EA 4JO1H 4YDIL 5E1AB 5GS1B 1FN4A 5KVFH 5DHVH 2WANA 4K7FA 4LSPH 2XFXB 2I60L 1V3LA 1WAAE 3DO7A 3G6JE 3QDGD 4LEXL 3JV4B 1TJIH 3QPXH 5IHUL 2AABL 3LCYA 5DEFB 5K9QI 3IVKB 2DQFB 3W5MA 2QSQA 3H9YA 1UACL 4XP1L 4OJFL 4OAWA 4JG1H 2VZOA 3PDDA 2O61A 4LCWD 2ICEA 4PJDE 1BP3B 4JGMA 4Z7UE 1QO3A 2E7MA 5DD5L 1D9KA 3KHQA 1MQ8A 4OTXH 4D0DB 5JR1H 3B2VH 4IOIA 3REVA 3QEQA 4DAGL 1OB1A 1A1MA 1H3WM 2V7NB 1AGFA 5SWSD 3GK8L 4HF5L 1MVFA 1ZLSL 3TBSB 3MLUL 1EJOH 4XMKH 5BRZB 5GSRA 4QRQA 2V5YA 1F4YH 2FYYA 1MI5D 2QQQA 1BFTA 1YJDL 1YEGL 4KI5F 2F9BT 2X4PA 3ULVH 2B2XL 5C0EB 4WFGE 2XQYK 4ODWA 4UT9H 4NOBA 2QQLL 1G9MC 1N26A 5HVHB 1EBAA 4PGCB 5IQ9B 2H41A 1KYOK 3UPCA 1DL7H 2UYLA 1KBGL 3OB0H 1BVKB 3QI9B 2H32B 3MRMB 1KB9K 1MIEL 1KPRB 1XCTB 5EIIA 1WIUA 1F5WA 3AS0A 1KIQB 2ICWI 4UIMB 3DUSA 4ZUTB 1U3HB 5DXWA 2BSED 3SGKC 1P84K 3KPSA 4LSSL 2ITCB 3QEHB 1X5XA 1Q0YH 4PJBF 4YZFE 3FT2A 3ZDYF 3D25B 1AGBB 4DN3L 1QTYT 5CILH 1KOAA 1RZKL 1N6UA 1DSFL 4JFEE 1FLTX 3H42H 4QHUA 3V4PL 3HN3A 5ACZB 3PGDB 4PFEA 1VA9A 5FYKL 2VQUA 3BZDA 4K71C 5D6DC 2VR9A 3L3JA 2FX9L 4EKXA 1CK0L 1MNUL 4WWKD 4KI5C 5DVMA 3W9EB 1RQ5A 4ONHB 4EI5A 4L4VA 1GGBH 3MNVB 1A6PA 5FUOL 4KRPC 1CXIA 5ISZB 4OM0L 5MEOA 1WBXB 4Y5YC 5EZIH 5I76B 5LXGH 5IEHA 2AJXH 5C08B 2RAMA 1VFBB 4GH7B 5CZVH 3IS0X 4EI6A 3VWJA 1BGXH 5T5FH 3VFOB 5GGTH 3UPRB 2DQEL 1MCSA 4IM8A 1URLA 1KLFA 2EXYC 1JPTH 3CH1B 3RWGA 4LLQB 5DHYA 4DGVH 3HZKB 2A73A 4QGYA 1EV2E 3SDAC 5FKPB 2YD2A 3G6JF 3VMPA 3HMXL 3ULUE 2JELL 2ICWA 3EYUL 3R06A 2YC1A 3V4UL 1R3KA 4OLZL 2AK4E 3RP1A 2AJSL 1RUPL 4ZODA 4FQCH 1D5BA 3CSBA 1T22A 4M8VA 4BSVA 2YPLD 4HJJL 4OJFH 1U93A 4PJDF 1GC1L 3OXRB 4FQLH 1FG2B 4LAJH 2EDYA 1CGWA 4HK3N 3N50A 2YD7A 1AGCA 2XZCL 3CDFA 3MRNB 4QRRB 4KZEL 4WU7A 5F3BB 4DAGH 1TTGA 4R2GC 5TDOB 2QADD 3H9HA 2F5BL 4RFEA 5F1OB 1MCNA 2Y72A 4HS3A 5T3XL 5B8CB 5CBEB 1T1YA 2XA8L 3MLUH 3Q5YA 1KJ2B 4GBXB 1R3IH 1MCPL 1HYSC 2EDOA 2VISB 5FA3A 4P59H 1Q94B 4Z0BH 1M7IB 1TZHB 3DXAA 4XBEL 4YDVB 1YEEH 3QA3B 1JF6A 4GAFB 5JHDE 2QSCH 4D9QE 4KDTC 4IBLT 3TCLB 4GXUN 5F9WC 2FO4B 1N59B 1CFQA 1MIEH 4NYLB 3KXFA 5J1AA 4Y2DC 1Q9OA 4WHYH 2CLRB 4P4KA 5DK3A 5ERWB 5BMFH 5F6IC 3WIHA 4LIQE 4U1SB 3MV7A 4LSSH 1A22B 4YZFF 3NCYP 5J11C 3ARUA 5C2BL 1UWEL 3TP4A 4HJGB 3GI9L 3SDXA 1B0GB 1QFUH 4I3SL 4YDLC 4DN3H 3MV9A 3RBSA 1I3RB 1MELA 4HDIA 4IRZL 1NCAL 3KWWA 3BW9B 5ANMB 3MA9H 1FNEB 1HDMA 4MJ4A 1UA6L 3FFDB 1JWMB 4OIBA 4OM1L 1ITBB 3NFSH 4B0MM 2FX9H 4LRNL 4PIRF 1MNUH 1RIUH 1WBZB 1JF5A 4HXBL 4LOUD 2DL9A 4BZ2L 3EYQD 4Y19A 3IKKA 5FUOH 3TEUA 5E08L 1WCQA 3X17A 1NDGB 4EOWH 5E9DB 1HWHB 2V7HA 5F6HI 3VGAB 1JWUB 1FFOB 4GG6E 3UBXG 2OR8A 4PD4J 3L1OL 1RD6A 3SGDI 2VL5B 3U7AA 4P48A 1AGEA 1S7SB 1JYXA 4PJFF 1VPOH 2HMID 4JY6A 4NWUH 4WDIA 1UT9A 5I2IB 1A3RH 3MMEB 4KKAD 4PJIE 4NQUA 4ONOA 4WUUA 3KLSA 3ULUF 4OV6F 4RA0C 1AO7B 3B5GA 4AQ1B 2XY1A 2ED9A 3EUUA 1JZ6A 1JZ2A 2N7AA 1U36A 4OLZH 4TPRH 3UO1L 3GSVA 1RUPH 3ARGC 5HPMA 2FJFB 4JPIB 4PV8A 5KW9L 5A3IC 3CX5J 3U4AA 1U91A 4HJJH 4ZTOL 4JJ5B 4YHNB 4Z76B 4G43B 4KJQC 1UXWB 3VH8A 2ZG3A 1E27B 1S7QB 1QRND 1ZLWK 5SX4I 1DBML 3RDTC 2ZCLH 1KULA 2YSSB 3LN5B 3EGSA 5JOPE 1OLLA 4NQDE 4KRLB 3QHFL 1DTUA 5JXEC 5LG1A 3ARDD 5FUZH 4K7PL 1I9IL 4KJYB 1MQKL 1A64A 1R3HA 5FDYA 2ZPKH 2BVPA 5DZNA 4X9FA 4JDTL 4IRJA 5D1XA 3VGGA 1U8HB 2GTZA 1HQRB 2IAMC 1MFCL 3QQ4A 5GJTL 3TVMB 1C5CH 3ULUC 3ILQC 1YEFH 4G8FA 2CK0L 1W72B 4R0LC 5FHAL 5EFIA 3UTSD 3C6LD 4PGDA 4XWGL 2QR0B 3RX8A 5F9OL 4DZ8A 5DQDL 5E56A 1SMAA 4HS8H 2R0LH 1TJGL 3WDHA 1U8PA 5D4QA 5BVJB 4XNUH 5F7EH 1R3JB 3FO2B 1ZHNB 4KQ3L 4OBSA 1R5VA 4YE4L 5F7MC 5I73B 5C2BH 3DURB 3HZVB 1UWEH 4PJ8C 3HPJB 1X4XA 1OTTC 2DQCH 2XXCB 2G75B 3VXOA 5I1AA 5HGBB 4R4ND 1WVZA 2NYYD 1RULH 3MLRH 4BKLB 1A9EA 4WI3A 4OM1H 4OBRA 4ZUUB 1F45A 2Q7NA 4HUVA 1MPAL 1W2KT 2DMCA 4HXBH 4BZ2H 2XIDA 1F4AA 2NMSA 5E08H 1MWAH 5C0AE 4FZEL 1KCLA 4AL8L 4GG6F 5LCVH 5DMKB 4R4FL 1X5JA 1NSNH 4MWFB 1SBSL 4OT1H 3RU8H 3T2OA 3WFHA 4ODUA 5F9AC 3SJVE 4M7LH 1HKFA 4AG4H 3L1OH 3E3QE 3CCHA 1CD1A 1LO2L 3MJGX 2ZKHL 4Y4FC 3DNKA 2XPGB 4TUJA 1A3QA 3QUZD 1P7QD 3O3DA 4JRXB 4ENED 1E6JH 4NKOA 5MHSE 5MI0B 4LP4A 1NFDE 1T3FB 3MTRA 4J6RL 5C0BB 4RMSA 1T1WB 3CVIH 2JB5L 1A7NH 2Z31C 5JQ6H 3UO1H 4R7DB 2A1WH 4P0DA 1B0RB 4NFBA 4PRID 3Q6GH 4IRSD 4MX7A 3NIFF 3ZHDA 3CFKB 4ZTOH 4JDZB 3QT2A 4JN2B 3H7BA 3AAZA 4ONFL 1AIFA 4L3EA 5IGXL 4ZPTA 1ZVSB 1FFNA 3V5DB 5BS0A 3CFEB 1DBMH 3BZEB 1NBVH 1C16A 1VESA 1P1ZA 2H1PH 4LSRL 1U8MA 4G6FB 3QHFH 4DUXA 3EIFA 3MNZA 4NRZB 5EOQL 4WI4A 5HYQB 4PY7A 1MQKH 2XN9B 3DRTA 1QFWH 1CR9L 4EEEA 4CVZB 2BCKA 5ENWA 3S36L 4MJ5A 2FL5A 3D18A 1S9YB 4RMUA 1IGTB 4R4BB 3QDMA 3C60D 1MAKA 3X13B 3PJSB 4P5KA 3LN4B 4PLKC 4XPHH 2RCSL 3WIIH 5E8PA 5GJSH 1YMMD 2Y6SC 2EIBA 1LWRA 3GO1L 1JHTB 2ADJA 5C0RL 5DUBB 4MJ2A 4OUUB 1WBYA 2VDPL 4WTXA 1I1AB 4JO3L 2PYEB 4PJHA 1BZ7B 1DLFH 2R2HA 5DJDA 5F9OH 1YPZB 2ZG2A 4MXVE 5EUOE 3MNWB 3QULB 3NCYS 3W39B 1TJGH 4X5XB 3HC0B 4Y0GA 1JUFA 4KQ3H 3PUCA 2E7HA 1NAMH 1T2QL 4J3OC 4RRPG 4PJ5E 2DD8L 3TO4C 2L4OA 1DQQA 4OZHA 4NO0D 4G6AD 1HHHB 4MA8L 2HJKA 3NCMA 3QH3A 4ZUVB 4EN3D 4U1HA 3JV5A 3D3VD 3PGFL 3L95B 2V5RA 4M5YH 3X12A 4YEEA 4KROB 5FOBA 4X6BB 1OAUL 1NC4B 3S3JA 4XP4L 2ZUYA 3A67L 2MKLC 3H0TB 4YNYB 1JZ8A 3SGKA 4TNVF 5IFHH 2RR3A 5CZXC 2NNAA 3KG5A 1IAII 1LO2H 4XPAH 3LB6D 4E42B 5IB4B 3IXTA 1P2CB 1FL5A 5IB5A 1NLDL 2CSPA 1A02N 2X1PA 2VLLA 1XGQA 3RTQC 1NFDF 3WHE0 4RQQA 5EUKA 3RWIB 2HTKD 1R5WA 3QUYC 4KMLB 3QIUD 5JOFB 2FX7L 3EW3B 5D6DA 5GRXG 5D5ME 3D39E 3FO9B 4N8CL 1P7HL 2Z8SA 2FR4A 4EQ2A 1K5NA 1TFHA 3L3GB 4LPWA 1AQDB 2B1AL 3M17A 3AU1B 3MV11 4L8DA 2DLGA 2B7DT 4KRMB 1RFDL 4Y5YA 2FB4L 5ACMA 3HZMB 4XHJD 2F53A 4F7EB 5F88A 1V3KA 4FQXC 2ZOLB 5GGRB 3TN0C 4DGYL 4ODSL 2GY7B 2EYRA 3AY4C 1FH5L 2JIXA 3OR7B 4XPTH 2G9HA 4NT6A 3QWRA 4YHYC 1MIML 4GQ9L 3KYOA 4G80A 4LBEA 2VJXA 3M1BA 3SDAA 3TWCL 5IVNA 4TUOB 4C54A 2WBJC 4RX4D 1WFOA 5TH2A 4Z7NF 1GL4B 3JSSA 5JIIA 2X9YA 2VDOH 1ZKAA 2W9DL 5MEPB 4J3WA 3ZDXF 4HIEB 3G5YB 3SDDD 3QNZA 2RCSH 1G6RL 4RCAA 1U8OB 4P23A 3BP6A 2Q6WA 5L2JA 3GSQB 1QA9B 1I9RH 5JXAL 3GO1H 2VR4A 2VDPH 2EC8A 3BPOC 4YXHH 1ND0B 3MBEC 4MXVF 4PYGA 4JO3H 5EUOF 4HX1B 1XF5A 4JPKH 3GUTB 1UENA 4P46D 2WAHA 5GS0H 4K7PX 3PV6A 3Q6FB 5EBLB 3HS0A 5C8JA 3KPOA 4KJPD 1AP2A 2X1OA 3OGCA 1T2QH 1MJ8L 5F1KC 1RZGB 2DD8H 4ZFOA 4KMTL 5LWYL 3U0WL 3GGWA 4NP4L 1AQKH 3CXHK 4X4XB 3LY6A 2A6IA 2HRPL 4DZBB 1J8HB 3RKDD 3T4AA 4PGEA 4GLRI 4Q9BA 1OPGH 3L3DB 4ISVA 3PGFH 2VDNL 4KDTA 4MNGA 4N68A 3G6JA 3WHXA 3QFDB 4HSQA 2EIZB 4Y1AD 4I4WB 3JWDL 4YAQB 3WD5L 2FEDC 2XKSA 5D7KE 1A7RL 3DVFA 3TJHD 3AM8A 5HHVH 2VSDA 2R0ZH 4MLSA 4KKBD 2OMBA 4G9FE 1C08B 1DQMH 3AREC 4GRLD 5I19H 3MREA 4PJXE 5M95B 1WEJL 3NIGE 1AI1H 1H3VA 4LARL 4X7EC 5D1ZB 1HI6B 3O8XB 4TVPE 3RL2B 3ROLA 1QBBA 2D4DA 3FMGH 1RURL 4GKOA 3C8DA 3G04A 3RNKB 1HK6A 1DCLA 3KR3H 2X89D 4U1LB 2K7PA 3K1KC 4Y5VC 5LGHH 2GAZA 4GAJL 3LRSA 1LO0L 3ES6B 3BOVA 3QFJD 1QLRB 4KRNA 4N8CH 4PJAA 3TBTA 1CVSC 1OL0A 2CRMA 3FB5A 4KK8D 2YUZA 1BOGB 4J23A 2B1AH 2GITA 2MTPA 3PL6D 1KG0A 5JNYA 4QRPD 4I5BB 1X5IA 1RFDH 1ZOXA 4P9HC 1MFNA 1MCFA 4G6KH 5D2LE 2DMKA 1GIGL 3KLAB 1JF1B 3DETD 5DMIH 3PWUB 5CJXC 1I1RA 1NC4D 5IV2B 2NY5C 5DA0B 5DJ2B 2GJ6E 4M6MH 1IC7L 1KN4L 1MCQA 5FYLL 1LEKB 3TWCH 4F58H 3UZQA 1XGRA 2VLME 1OWWA 5E70A 3MRHB 3VMNA 4CL7A 5KBNC 1J5OL 3HUJE 3MA7A 3QEGL 2XG4A 3IDUA 4JFEA 3ZE0E 4JFYA 3HC3L 5AG9A 4YHPB 1ZTXH 5DLML 3ARGA 3AROA 4LK4A 1E0OB 3UTTE 3F62A 5I76A 1YDPA 5CJQL 3WO3B 1RZFL 2D4FA 5EULV 2GCYA 3WNNA 1RJYA 4JFQA 2OR9L 5CP7A 4MYWB 1OVZA 4MJIB 5DURB 1KGCE 1MVUB 2ZZUT 3QIBC 2J6EL 5JXEA 4PJ9B 3QDJE 4KTDH 3FRUB 2CRIA 3VWKA 1KCRL 2VLJE 2GK0B 3A6BL 4NNPL 3O3BA 4KMTH 3QIWB 4DWHA 3U0WH 3GMRA 2C3WA 1NJ9B 3K74B 4O2FB 1VENA 3BKCH 4PJFA 2HRPH 1TLKA 5C09D 2IAMA 3T77B 1G84A 3QQ9C 1XIWA 5EO0A 2YZ8A 2B4CL 2P5EE 5HGAB 5FM5M 3VXQA 4FQ2L 1FNFA 5HHOD 2D03L 4MD0B 3E6HA 4MA1B 3E6FA 3KPRD 1DEDA 3SGEI 3JWDH 1BF2A 2V2TA 1UZ6F 5EBWA 5F7WC 2HT3D 2Y5TB 1A7RH 1FV1B 2X4OA 4HFWB 3SPVB 4CMHC 4V1DA 3VE0B 4PJXF 2OR7A 3MUGB 4YUEL 2MWCA 1CDJA 1ONQA 3SKOB 1WEJH 3DV4A 3BUYA 5EO9A 4LARH 4Y16D 2DTSA 5BV7L 3ARQA 4CW1A 5J89A 4PJ8A 1EMTH 2GIYA 5FGCB 1XZ0B 4YPGA 4OCYH 1G7MB 2PTVA 3VXME 3HR6A 1TENA 3QDGE 2F5AH 4YHIB 4GAJH 4PTUB 5C71A 4XWOD 5D1QB 3RI5F 2HKHL 3TZVC 2IANA 2IPTL 3R0MA 5MP6H 5F8RC 1BBJA 1QSEE 1JGUL 4WHYG 3INUL 4Y4KD 4U1GB 1QBLL 2FIRT 2IEPA 1Z3GL 5E2WH 3QNXA 4X7FC 2PO6B 3N1GC 5DJYA 3VG0L 2AI0H 2R1XB 3F6IA 5HJ3B 4E0RB 4P3CL 4NFDA 4X6DA 2DI8A 2CDFB 2JCCE 4NC2B 1IC1A 1QQDB 1KN4H 2KBGA 2VH5H 3R1GH 5SWSE 3MR9B 3WS6A 2HN7A 5DWUH 2GSGA 1V7NL 4KZDH 2IPKB 4DVBA 2HH0L 1TDQA 3D48R 1FE8L 3DUUA 3ZE0F 1P4LA 5IB2B 4FFVC 2EO1A 5I8CB 3IRZA 2LE9A 1LDPL 3NZ8A 2Z31A 1NMCB 2YWZA 2HYMA 3CZJA 5JDJA 3V6FA 1UZ8B 5B39A 4XZUA 4JFPA 3N1QC 3JWOC 5CJQH 1JWUA 2A83A 4MD5B 1ZA6B 4GRWH 2N1KA 5I18H 4JG0L 1MFDH 4F7TB 5E6IC 5D7JD 2VL5A 1NCDH 1PZUB 1U6AL 2EIDA 1FZMA 3ZKNC 2OR9H 4M6NL 4XVUC 1BQHG 4GG6A 2E9JA 3RA7L 2JB6B 2J6EH 5DEGB 4JO4L 1KCRH 5C0IB 4NNPH 3FQXB 5J3HD 3O0RL 2CIKA 4NRYB 5I16B 1XT5A 4I1NB 3GEWB 3WL9A 1U2CA 2H9GB 3QO0B 3GSNB 3RGVB 3U9UA 5T1DH 4F8QA 3PDGA 2HFGL 4XNXH 3ARFB 2ADGB 4FQ2H 5DUMH 1UCTA 2D03H 3UC0H 2VZ3A 1MHEB 1GHFH 3PP3H 3EJZD 5I75C 1H5BC 2DQJL 4AENB 1TVDA 3DMMB 5DC9B 5FO8A 2CIIA 3OBAA 3QRFM 5DD3L 5I71C 3MOAH 1N5YH 3LEXA 2YEZB 4U7KA 1S7UB 4X5LA 5CEXB 3CVHB 3LN9A 1PLGH 4NQDA 5C0GA 5DK2A 3DVNB 3VFGL 3ARRA 4UV7L 1A4KB 4YK4B 3NABH 4HT1L 5L9DH 4M7LT 1GJIA 4U6YB 5H94B 4A2MA 2P8LA 4QOKD 2HKHH 4GKSA 1D5ZB 5MERA 3B2UD 2PXYD 1CD9B 2IPTH 4OLXL 3VXSD 5IVZA 2YD1A 3GBML 5FYJH 2YPLE 2FATL 2CKBA 1OGTA 1Z3GH 4NUJA 4CRPA 2N4IA 3ARBC 3WIHL 4KHTH 4HK0A 4X5WB 2DM4A 4DCQB 1U58A 2JCCF 4Z78B 4YH6A 1EHLL 4H26B 1EGJL 3MLTB 4P3CH 2EH7H 3JBG7 3L3IA 4M8QA 5DRZB 4OZGE 4MXQC 4L8CA 1YEKL 1FL3B 4F7CB 5D6CB 3BPCA 3FONB 3ARZA 4LQ1A 1AD0B 5D7LB 2ERJB 2AXHA 1CQYA 3DOSA 4TVSa 4QRSA 3QUYA 2WBKA 4ZTPH 4LMQE 4ZFZB 3LDBB 4ZD3L 1P4BL 1VADA 3ZKXB 5FGSA 5I1CL 2YZ1A 2JJTA 3JTTB 2DI7A 2CR6A 5ICXB 1T5XA 2FGWH 4WTWA 3PHQA 5ID1A 3K1DA 3VFMB 3BE1H 1JZ3A 4WWID 5FM4A 4BSWB 5B38G 4GRMB 3ELAT 2VE6B 1CYGA 3MXVL 1IGYA 2JE8A 1NCBL 4JG0H 4RIRB 4QKXB 4CU8A 3FB8A 1KNOA 3HE6D 3FT4A 5EU6A 5E8EA 4P2QA 4FQXA 5J6HB 1ZGLB 1KIUA 3TN0A 2NR6D 1FGVL 4M6NH 4M7JL 5GISH 4WUKL 1AC0A 1T20B 2FSEB 3LZFL 1ZHKB 4PRAB 4C55A 4XCYA 3OAUL 4ZYKA 1I3GL 3O0RH 3S6CA 4JCLA 2WBJA 1LD9B 5I6XB 4QRTB 4GW5A 2AS5M 2VUYA 1EEZB 1F4HA 4N8VG 4WO4C 5BRZE 1WWCA 1NFDA 4JZJC 3SCMB 2HG5A 2AGJH 4XHQA 4GUPB 5T1MB 4NPYB 1HILA 2FX8L 3DX8A 4FTVA 5DHVB 3GMLB 5MEND 1OAZL 5E2VH 1BVLA 3GNMH 1KN2H 2OMNA 1SYSB 5I1GL 3MJ7A 1X6LA 4LHUD 2ITDB 1A4JB 4HUXA 3QQNA 4I2XB 2APWA 3BVNA 4PD4K 4N90D 2C1OB 3D1MC 4GW4A 4KPHH 4KUCD 3DHJA 5IM7B 3UAJD 1BX2A 3P40A 1ZVYA 3OF6A 4XNYH 5KAQF 3F7PC 4UV7H 4Z77B 1T1ZA 4EZMA 1MCHA 3BJLA 1L6ZA 4LLUB 4QXGL 4GG8A 5FGBA 1NCTA 5JLZB 5IMMA 1EXUA 2EDHA 2J8OA 1KENH 2OJEB 1X5GA 2XKNB 1DBBH 4NNYB 5EDXA 3WE6B 1R3LB 3OJDB 1KIRA 4OLXH 1UB6A 2Q76B 3HC4L 5B4MD 2FATH 1FNGA 3UJIL 3WIHH 1FZKB 1EEYA 1VFOA 3AREA 2E27H 2X4SA 4OZGF 4HLZH 5ISZE 3RWHA 2F54B 5HHXL 5JPNB 1INQB 5EUOA 1CVRA 5F7NC 3OX8B 5CEZH 3EOBA 2DBJA 4LSTL 5C08E 2Z91B 3GKZA 2Z93B 4EBQL 4NZRL 1BJMA 2BXYA 2JK5A 5AUMB 3HRZB 4PJ5A 1WC7B 4Q6IA 4Y5VA 4UDUA 1LE9A 5I1CH 3SDCB 5E2TL 1CFSA 3ZYOA 5FDWA 5BOPA 5DJAB 1H3UA 2R1WB 1NEZG 4O2EB 2VMFA 1K8IA 1RUKH 3EJJX 3KPNB 4P2OC 1TVBB 5DRNB 1DE4B 3H0TA 4HK3J 3BKYL 3BH8A 4LSDA 3HI1B 3RJDA 1IZJA 5A2LH 2DWEA 3VXNB 4ZAKD 5HYJA 1G7LA 4APQB 5CJXA 4OQTL 4M7JH 4M7ZC 5BCAA 4N0UE 4WUKH 4NJ9L 4TSBL 4PRBA 4RZCB 4ZO7A 5KVEH 2OK0H 1TQBC 1XR8A 1NGPL 4HS6B 1IGFL 3FQRB 1SMOA 2QADC 4QRRE 4LL9A 5CIPB 5FYJU 4PTTB 5DFTA 1EA9C 3REWA 1HZHL 3T0EA 2DTML 3VXRB 5E95B 2HJLA 5EBMA 3SY0B 1UM6L 3N0PB 5DD1L 5GS1C 2DJ4A 4BFIA 5DMGD 2NX5A 1U8QB 3MRJB 1BM3L 2FX8H 3BIBX 1OAZH 1G9EA 2PYFB 4M00A 5I1GH 3V0VB 3WFEL 2PW2B 5I1KL 4NWTH 3SQOL 4IIQB 3S9DB 3KYNA 3QIBA 4OGXH 3MYZA 1CIDA 1MHCB 5EWIH 2NY0B 2OJZL 3MLZH 1CD0A 5IEKB 1J86A 1A6ZB 5I74C 1YN6B 5E94A 4QXGH 5T3ZD 4NQXB 3BYTA 4MZ3A 4NHUA 2DS4A 3SGDH 3CLFL 1OT1A 2VLKB 4AEIH 3LQAH 5HYIA 5EO1A 5ANME 2XWBA 4PRIE 4Y89A 5E5UB 12E8L 1DFBL 2JJSC 1OGAA 1OAQL 1CE6B 4LOUC 3RRQA 5J13C 4M6OH 1WCBA 4KQ4H 3EYQC 1QSFD 5DUPH 3H6JA 1TPXB 3VFNB 5FO9B 1JRHI 3UBXI 5HVHC 1I75A 3TH3T 2IH1A 3QI9C 1EHNA 3NFPB 4ORGB 5E9DE 1LO4L 2A38A 5BZDA 4JJHA 4EBQH 4J2XA 5TF1H 1ZLWH 2OYPA 3QJHB 1PSKH 3MCG1 1KEGL 2ADFL 4NQED 2BVQB 4KKAC 4XH2A 3D85A 3BIKB 5SX4H 3T0VA 5ADPL 2F8VA 1TMCB 3EDJA 1G9ML 3P2TA 1OD7A 5E2TH 3IDMA 3DIFB 4YBQD 3BAEH 3BT2L 5EN2B 2DJUA 3WNOA 1AO7E 4ZDHB 3CD4A 1CXFA 3L3HB 5E8OA 3QUMH 4LLWB 3QUKB 3HZYA 1HN1A 4WJ5A 1KACB 3OAYK 5J9PB 4XNZC 4WGVB 2NY1B 2ZCKL 2X4QB 3FQWB 4HAGA 1U3JA 4QHLA 3HNSL 2VKXA 3QR2A 4R7NB 3GIVA 4KMQA 4TSCL 3AS2A 3L3OB 1AKJB 1BZQK 4NJ9H 4TSBH 4U1JA 4GJTB 4RAUA 3ULVD 3EOTH 1NGPH 1XGTB 1IGFH 5A16B 3X11A 3K2MC 2B39A 3TC9A 4XNQB 1HZHH 4NJAH 5EOTA 2NQCA 4I3RL 4F37F 1T7ZA 3UBXA 3HB3C 1JTTA 2GFBB 2QHRL 2HWZL 4O2CA 1CG9A 1GOFA 2VITA 1EPFA 4V2CB 4JY5L 3SDCD 2BNQB 1V3MA 1BQHB 1IFHL 1FL6A 1E4JA 3C6LC 5E6IA 1RVFL 5C3LD 4RGOL 1I1FA 3TM6A 3BD3A 3WFEH 4E5XA 1ACYL 4LFHG 1XF4B 2CKNA 1BLNB 5ITFB 2IPUG 4TULL 3OKDA 4LGRB 1WIPA 4Q2ZA 2VDKH 1RMFL 3CUPA 1BMGA 5CKGA 4JFDB 5DDHB 3U79A 3O2WL 4N1EA 2VAJA 4S1QL 1ULVA 25C8L 1CXKA 3DYPA 3PWPD 2X70A 1FAIL 3DRQB 5K9OA 1IAIL 3PWNA 1RUAL 2NYYC 5B8CC 4C56B 5D2NB 3GMQB 1I8MB 1QG3A 1NC2B 5LGJB 3UZEA 3UTTA 2AQ2A 2P46B 4A6YA 2OSLA 7FABH 1P9MC 5EU5A 4L9LA 3Q3GB 1S8DB 1JWSA 3OHXB 4RAVA 3FFCB 4LLVA 4AEFA 4PJ7B 1VFAA 4IMLB 3SOBL 4PR5A 4PRDB 1MY5A 1HHKA 3GJEA 1AXSB 2A9NH 2VAAA 4PJGF 5JW3H 4ZFOL 5KSVA 3BIAX 3VFWA 3C5ZB 1BD2A 4FQHB 2AK1L 3QDJA 2RJMA 3QUZC 4HKBB 2VLJA 3QG7H 1KEGH 2ADFH 43CAA 4M61A 4CVXB 1EZVY 1UM5H 1FGNL 2DL2A 3VD5A 5ADPH 3DX6B 3MRGA 2VABB 2X4UA 3QP3A 2WP3T 1IM9A 3KPPA 3MUZ1 4XBPB 2P5EA 4ONGH 1YNLL 5C0BE 4W6XB 2LV4A 3VFSB 3VFPB 3ZYJA 2WQ8A 4I0PA 1EX0A 4P2RD 3K8MA 3ARBA 2WIMA 1ZA3A 1LK2B 5C0CB 1HNGA 3VD3A 1LO5B 3HAEG 4XPBL 4R3SA 2VIRB 3STLB 3UJJL 2W65A 3QUXD 4Z7VE 4HUUA 4ZXBD 2Z0BA 1S9VB 5L88H 5SWQB 2DQUL 5EORL 1KIPA 5A1AA 1PG7W 1OTSD 2O5ZL 5B38B 2C7UB 2QQKL 4X6CF 3TGXA 2BVOA 1U8KA 1ZT7B 4UU9B 1GSMA 1TZGL 4HZLA 3MXWH 4QTIL 4Y1AE 3OB8A 2M26A 1IFHH 3BEVB 4G42A 4HJ0D 2FLRT 2AEPL 3OKMB 4RGOH 1Q8MA 1SVZA 3QJFA 1LQSR 1ACYH 3B6SB 4ZS7L 3VG9C 3MRLB 4UBDD 43C9B 4LCWA 3GMNB 2PYEE 1F13A 4TULH 5GRVK 1YPZE 1IVLA 1RMFH 1CFBA 3BWAA 3K8KA 5DVLA 5IK3B 4Z0XB 1ETZA 5SWSA 4BH7A 2A6JB 3EJYD 3OKNA 3PP4H 4CAGA 1FNAA 2ZOKA 2H3NB 3BRFA 1O7SA 3TNNA 5DFVD 3MLYL 4XGZB 1MI5A 1TQCB 25C8H 2DB8A 4G6AC 3IDNB 4JZJA 5EC1B 5IFJA 1FAIH 3QFJE 1AFVL 3IFOA 4HUWB 4PLJD 2D7TL 4EN3C 2DICA 1PEZA 3WSQH 5IHBA 5LKNA 4U6HB 4RBPK 4QF1B 1U8JB 4QRPE 3T3PF 3NTCH 3GJFB 4L8BB 1T21A 3PE9A 1N8ZB 3MV8D 1PD6A 1HH6B 4HHAA 4OV5B 3MRPA 1CLZH 1NH6A 5HSFA 1NGZB 3MRKB 2V2WA 1KTRL 1I7UA 3PF2A 1QZ1A 1QOKA 2DKUA 2AJ3A 1ADQA 2W0LA 2MQ0A 1B4JH 1XGYL 1JGVH 3OKEB 2YPKA 2YHGA 2R4SH 1SHMA 4J8RB 5C7XH 5JO5A 4JHAH 1PX3A 3MBXL 4PGJA 3ULUL 1AR2A 1TJHH 1HQ4A 1LNUA 4R90L 3GSXA 1UFUA 1YNKH 3QIUC 1DBJH 2EDTA 3D0LB 3RY6C 4MA3A 1M71B 2XY2A 1NAMB 2AJVH 3SKNB 3U0TA 5CD3B 3RHWF 4ODTH 1L7TL 3OKYA 1HE7A 4WWKA 5TFSH 3VD4A 4FQ1L 2UZXB 1I3UA 4ZUSA 5D7IB 5DVNA 5AZEL 5DT1L 3C5JA 2VXSL 1IM3B 1NGYA 1HHIA 1FPTL 4LMQI 4D0BA 1MCDA 5CFHA 2IQ9L 4BQBA 1EK3A 4NO3A 4Z7VF 1JPGA 3AS3A 3UJJH 4LPYA 4JO2L 4L4TB 1SYVB 3O4LB 1M7DB 2MJWA 4UQ3B 4DN4L 3KNBA 3PDOB 1QEWB 3Q5OA 3ZKQD 4IJ3B 3BEWA 3I6KB 4CMMB 1NEZB 5HYEA 4Y88A 1B2WL 4RGNB 5C09E 3VXTA 4KC3B 4O9HH 5SWZB 4ZFGL 4XPGH 2AW2A 3W0WA 3EO0A 3PWLA 3ME0A 5DD6A 2LTQC 5IMOB 4NSKB 4QTIH 3SDDC 1U8IB 2ZUXA 3KPRE 4PP1C 3BHBB 1A3LL 3SBWC 5EZJB 2I9TA 1RZJL 5TDNB 3AC0A 1VB9A 2AEPH 5IBTH 2YPLA 3LD8C 5K9QG 1T1XB 2CRZA 4RMTA 4GLRH 1NGWB 3HA0A 4BSJA 4D9LL 1J88A 5IW1B 5IKCB 1CGYA 1YPZF 3NVQA 4LIQL 4KFZC 5IG7A 3ZKSD 5TQ2L 4K2UH 4MNQB 4P46C 4PG9B 1UCBH 4OZGA 4CNIA 1CDBA 1J05A 5C70A 4KJPC 4OLEA 1JGLL 4HH9B 4BYHA 4WY7H 1CDYA 1HOCA 1EJ6A 1KJMA 1X5ZA 5JW4Q 2WW8A 3L5XL 4G6JH 4PRPB 1F6LL 4LNRB 1KLGB 5F1NB 2Z4QA 4P3DA 1JFQL 4DK6A 4NQCB 3P77B 4OI8A 1AFVH 2XQYG 3RKDC 1U0QA 4R96A 2D7TH 3GMMA 3LKPB 4X7TA 5F7LB 1IQDA 4ACPA 5JPMB 1LEGA 1OWRM 3VI3F 1UKQA 1C5DA 3KPQA 4CN1A 3PABB 1TNMA 3S96A 4X9HA 4U6XA 1A6VL 1PY4A 1GGIL 4GMSH 1RI8A 5IP4A 1JN6B 1G7QB 4PGBB 4QTHB 1Z5LB 2W0FA 3MGTA 4YC2B 3OXSB 3VFVA 1S5HA 2A74A 4M1GL 4GRLC 3ORJA 4RFNB 2J5LB 2X05A 3ILPA 5DYOB 4I3GA 1I1AC 3QYCA 2C4XA 3V5KB 3EO1B 1U9KA 2CUIA 2VTFA 4BZYA 4F9LA 3LHPL 4LLMA 1B3JA 4TTDD 3FN9A 4H1LA 1GGCL 3BKML 5GPRA 5BVPL 3ULSB 2GSIB 4D3CH 5F7HA 1CFTA 1ES0A 4HC1L 4JFXA 3FT3A 4JVWA 2OZ4H 4HH8A 4PV9B 4PLOB 5HD8C 1J10A 2BERA 3VA2C 1L7TH 1VFMA 2JJSA 4AH2B 3IDIA 5GRJL 4KK8C 2ZUQC 2NY7H 2AV1B 2X1QA 4S1RH 5GS2D 5GQBA 1RU9L 3OKKA 3PL6C 4OIIL 3X14B 3EO9L 2VXSH 4ZS6D 1IQWH 4AIZA 3CSYB 2DJSA 4N5EC 2BFVL 2EZ0D 2IQ9H 3OAZK 3KYAA 3TJEL 3DETC 4DFIA 2X1WL 1Q9WA 4HW6A 3HLAB 1ZSDB 4NUGH 2NY4B 1KJVA 5EU7E 5FGRA 5DRXB 5E00B 2FH8A 1VGKB 1D6EA 3SE8L 1HHGB 1Q9KA 3IDXL 4Y8AA 5A2KH 1B2WH 2HJFA 4FXKA 2VLRB 2AERT 1UVQA 2A6KB 3SHSA 3BP4B 4HKXA 4URTB 1GAFL 3C2SA 1JGEB 3GBNL 2R2BB 3HNTH 4YFLF 4O4YL 4F33A 2OL3A 2CKBL 2VC2H 4ODXB 2HT4C 1BFOB 3LSOA 2B5IC 2UZIL 5KSAB 1WITA 3RX5A 1RZJH 5T5NG 4HBCL 2YA1A 5DR5H 1FVCA 3IETB 1OP9A 1G7IA 3IXAB 5JDSB 3EHBC 3QG6B 1QRNA 5C6TH 3MCLL 4B50A 4FABL 3UPAA 4NNXA 4OZFA 3VXPB 2BOBA 3I6LE 3SGEH 3F7RA 4IS6A 4R2GD 3ZHLA 4MJIE 3ARDA 3ISWA 5DJ6B 5F7KC 1FSKC 1NBYB 3O9WB 3NMEA 4JY4A 4U1IA 1L7IL 2P5WB 3HE7D 4QOKE 1NMBH 2CH8A 4LLDA 3O2DA 3TIEB 1N7MH 2DQGH 1IT9L 1MEXH 3MRCB 3WO4C 2HA1A 3KGRA 1N64H 3ARYA 3VXSE 4XP9H 3MOBL 4M3KB 4HCRH 4KVNL 4HXAL 1BZ9B 3B3IA 4OKVB 2YN5A 5DJ0B 3UTSA 3C6LA 4BM7A 3VXUD 1T5WB 2ZUUA 1A6VH 1RUQL 2HT3C 4UI2A 2AJYH 2E8ZA 4OZIB 1FYTB 1HINL 4Y2DD 5I8EA 1I7RB 4L3CA 4NGHH 4UTBL 2W0PA 4P9MH 4N0UA 4JFFB 1OSPH 1T0PB 4Y16C 3P3YA 3G5VA 1EAPA 1N6QL 1WLHA 3V52L 2YKLH 1GGCH 2KDGA 2XNAB 4L29B 5GHWL 5BVPH 4QT5B 1GPOL 5L0QB 3A6OA 3BRGC 3LKQA 4Q9RL 1IGML 5JTWA 1E4KC 2B0SH 2SEBA 1CN4A 5CBAA 2ESVB 3DLQR 2FZ3B 2G2RA 1ZWIB 1KYOJ 4YJZL 1RIHL 5HHQB 4N0RA 4FQIH 1P9MA 2EDLA 1RU9H 1KB9J 4J3UA 2BDNH 3EO9H 1JV5B 3VFUA 5ESVA 3X3GL 2DLHA 4JRYB 4MMZC 5ICYB 1CL7I 3EYOB 2OP4L 3TJEH 3VI4E 1IARB 4XVSL 5F71A 1A6TB 1UGNA 4LLYA 3OJ2C 5JHLH 2NY2D 1P84J 5ITBH 2ICWJ 3QUZA 1P7QA 4BH8A 2BSRA 2J8HA 2OTUA 3FHAA 4WHDA 1I85A 5I1DA 1T03H 3PNWA 5E03A 1W72H 4HKJB 4QCIA 1KLUB 2LU3A 5D1ZC 3BRDA 5KOMC 4M48H 5KG9A 3BGAA 1CXLA 4QXTA 4NKMA 3IDYC 2CKBH 2YK1L 3R0NA 5GS0D 3HAEB 3KHOA 2NY6B 5L8KB 1F02I 4JKPL 5MENE 2UZIH 4PRIA 1CQKA 5T1KB 2Z8WC 2O26U 4IRSA 1IGJB 5EZOL 1UKSA 4OSUH 3FOMA 3BXNA 5ID0A 4G8EA 3U4EA 1AGDB 3CXDL 4KJQD 3DX9A 5KZCB 4P5TB 1KCUL 5D7JC 5TE6H 2PW1A 4LDEB 3MCLH 3EYSH 1PYWA 1ZEAL 4Z7WB 1Y6KR 5I9QB 1S3KH 5C07D 2XI9A 1VHPA 3VW3L 4MAYB 4PJGA 1FLRH 3FOLB 5FIEA 5EU7C 5J3HC 3RVXD 3CU1A 1L7IH 1W0WB 4DFHA 4ZNEE 3FQUA 4HPYL 5IMLA 1MRCL 1MCWW 3UX9B 4CBPA 1MRDH 3C60A 2NW2B 3SDYH 2WNGA 2OS7A 4N0FB 1IT9H 1R0AL 2H2PD 3I02A 2AXFB 1UJ3B 3S3SA 3QWOB 4ERSH 4LF3B 1YMMA 4U4BA 5INCA 1MCLA 4KVNH 4P9HL 4CGTA 1NKRA 1UM4H 1JK8B 4KGJA 2AK4D 2F8XC 1SEBB 3I50H 4O02H 4JZNA 1RHHB 4PJEA 4RNRA 2NY5L 3ZDZE 1INDL 4JLRB 3TA3B 5IVXA 4K94C 4XAKE 2YBRA 3P0VL 1S7VA 4KK9D 3PG2A 3ZT5A 4UQ2A 4MA7H 3ROOA 1WTLA 3CFJA 3U7YH 4Y4HD 2R0WL 2Q86B 2RFXA 1YNTB 5CINL 1HXYA 1RJCA 3M45A 1TTUA 3VFTA 4JQVC 3LQZA 2UZYB 4MQ7B 4NO0A 5JUEH 3D69A 5CJ5A 1GPOH 1DUYA 1Y18A 2DYPB 3MRBB 4P3WA 1SBBA 1BFVH 4UV4H 4EN3A 3D3VA 1FN4B 1IBGL 4X6CA 4FFYH 3B2UC 4E41A 5JHDD 2PXYC 4NQSA 4K7FB 3TH4T 1NBQA 1RIHH 3DO7B 1MCEA 2GQHA 3NIDF 1CZ8L 2HKFH 2ATKA 3DBXA 3LVEA 3X3GH 3VI4F 3FAXA 1JPSL 1UXSA 2OP4H 4XVSH 1Q9LA 5BOZG 3CSPA 1FYTD 4Y4FD 3IFLH 5DGRA 3U0PA 4OAWB 1MJJA 4U1NA 3WS3A 3S34L 2O61B 2MPAL 2ICEB 1DN0A 2NXYB 1QO3B 1D9KB 5DO2D 2D0HA 3UMTA 2L7UA 5C3TA 4IOIB 3REVB 3KYKH 2E7LA 3QEQB 5EC2A 1OB1B 5BZWA 1A1MB 3QIUA 1AGFB 3RY6A 2IJ0C 4OCRL 4R8WL 4KVCL 5GSRB 3G9VA 1P7KA 4QRQB 5KOVC 4NZTH 2FYYB 3B9KD 2YK1H 4YHML 1A14L 4P5MA 1F4XH 2XT1B 4JKPH 1MREL 2X4PB 4MHHG 4YO0A 5EZOH 4Z8FL 1CGSL 4NKDA 4ODWB 2UY7A 4HLJA 4XC1L 1RJLA 3HE6C 5D7SL 1DANU 2UYLB 1EUUA 2KPNA 3MCKA 4YGVA 2NR6C 4U1GC 5EIIB 1ZEAH 4PYHA 1DLHA 1OAXH 3HG1D 5F6HJ 1KT2A 4RGMC 3B9VA 1NQBA 4UUJA 3VW3H 3U1SH 4XNMA 3GHEL 5AEAA 3DUSB 2HFEA 4HWBA 2UUDK 3KPSB 1HXMA 4RX4A 5H35A 3DGCR 4HPYH 3V0AC 1MRCH 2XWJA 4HWZA 1QHOA 3FT2B 4L5FH 4J1UA 2KL6A 2O5XH 1CDIA 2AJUL 3SDDA 3SGJA 4TOYH 5MEQA 4G8GA 2Y6SD 1MLBA 3IAQA 2WUCH 3SBWA 3Q2CA 4OFYD 3T2QA 4CU7A 1QSFE 2HFTA 3ZDZF 4DEPB 3V7AG 3L3JB 1KB5L 2XTJD 2R56L 2NY6D 3OGOE 3JVGA 3KJ6H 3P0VH 1X5KA 4EI5B 4L4VB 2NXZD 4P46A 3NPSB 1J1PH 5MEOB 1S7XA 1N5AA 2R1YA 3GJFK 1CS6A 4LU5L 4JM2D 4YR6A 5JOPD 4Z7VA 5IEHB 3BSZL 2G60L 4K3GA 4NQEE 3UAJC 4EI6B 3VWJB 1JRHL 4OKDA 4OD1H 4HIJA 4LPXA 2B20A 4BZ1L 3RWGB 5DHYB 2NY3B 3WFDH 3AS1A 2XZAH 2A73B 3JWOL 1IBGH 4EXPX 4OCWH 2K3TA 3RGVC 3FB7A 3S37L 4Y1AA 1RK1A 1T7YA 5DVOA 4GT7A 2ICWB 3R06B 2YC1B 1R3KB 5B4MC 5GIRA 4N8VA 1IC4H 1NDMA 1OARL 1IMHC 1JPSH 2J7LA 1D5BB 3HI5L 3RWFA 5DZOA 1T22B 4GRLA 4F9PC 3A6CL 2H8PA 4UT6H 3ULVE 4BSVB 3OR6A 1U93B 2F54E 1B6DA 4K23H 5EPMA 2VXTL 5E5MA 3HMWL 5FM8A 1AGCB 2Y7QA 1IC5H 3PQYD 2X89A 3TCXA 1FVDA 4ODHL 1FCGA 5LJYH 4LSVH 4OQ1A 4WU7B 1EO5A 5FCUL 3H9HB 4RFEB 3TT1L 3NPZB 4HS3B 1T1YB 4QHMA 2C3VA 4XX1G 1KFAH 5GS3A 5FA3B 1RZ8A 2WWKO 1A14H 4YHMH 4MGXA 3QB7C 1K4CA 3DXAB 1MREH 3PL6A 4QRPA 4JHWL 2IBZX 2ZJSL 3LEVH 5JIKA 3D2UD 1A7BA 3WJLC 4V2BA 5C0AD 4R26L 1S9XA 4JEGB 4ZAKC 5FO7A 1CFQB 4KUZL 4XCEA 4CN4A 3SJVD 3KXFB 4ALAL 4UZGA 5J1AB 4G5ZH 1I3VA 1QBML 3WIFA 1Q9OB 3F7YA 4P4KB 4YXKL 1WZ1L 3MV7B 5KSUA 1WT5C 4UB0H 4R9HA 1BEYL 2OCFD 4U6VL 3GBLA 4X98A 5C0JA 4QXUL 2IFGA 2EDKA 2V5TA 2BC4A 2NXYD 4K9EH 3SDXB 5GGVL 1BF8A 4ZSOE 2AJUH 1ZLUK 3CU7A 1CI5A 3MV9B 4HDIB 1A2YA 3KWWB 4U6TA 5LAXA 2BXZA 4JANA 5CCKL 1G9NC 1HDMB 3MODL 2E7CA 1MRFH 5DMGC 3MBED 4PJCF 2Z92A 5L7XH 4FQPA 1VCAA 1G7PA 4D9RE 3G5XA 4X4MA 4PB9L 5IB1A 2R56H 2XQBL 1S78C 4BFEA 3IDJA 3LV3A 2B8OT 4WI5A 5CWSA 4Y19B 3MLVL 5D72L 2QQNL 4PB0L 2FD6L 5DA4A 2X4RB 1DEEA 4JN1L 2V7HB 2VXQL 3CLEL 1BJ1H 2G60H 4IMKA 1DN2A 1JRHH 1IGIL 5EU4A 3HPLA 1YMHA 2F74A 5FECA 4NM4L 1AGEB 5C09A 4WDIB 5I0ZA 3MFGB 3NZHL 5K9KA 5L6YH 4WUUB 5HHOA 1F6AA 4AK1A 1JNLH 4FFZL 2VLKE 1T2XA 3TYGH 3CNKA 4Z7QE 2FEDD 3FO0L 3KPRA 5I1JL 1A7PH 3SCMC 1GH7A 4HMEA 1G1CA 4P2YA 3ECBA 5IFAL 3BI9X 6FABL 1OARH 3GSVB 4P2CG 2AEQL 5HPMB 1YEHH 1D5IH 3ZSTA 2BHYA 1JNHA 3HI5H 3OAYH 4PV8B 3ULVF 1Z9LA 3RBGA 1U91B 3MRQA 4Y16A 5K33A 3QZWA 2XOTA 3VH8B 5EA0L 3C2AL 4HKZA 5GZOD 3EYVA 2E6JA 3EGSB 3BO8A 4MQTB 4ODHH 4Q58C 2P8PA 2LABA 1T04A 1R3HB 3VWJD 2BVPB 4W70A 4OLWL 4IRJB 1LO3H 4DKFL 2BNRD 5D1XB 4YBQC 4X0KA 1X9QA 4A6YH 3MYJA 1JN6A 5IESL 2GTZB 2EH8H 4Y4KA 5F1IA 3QQ4B 4ZOBA 3AXLA 4UDTA 4YBHA 1FCCA 1VEMA 2BZDA 2ZJSH 3BMWA 4DOHB 3F58L 4XC3H 4G8FB 1ADQL 1UWGL 4XB7A 2J88H 4U33A 5EFIB 2LAGB 4HIIA 1CF8H 4MQSB 4KUZH 2P4AB 4PGDB 2COQA 3IFNL 3I6GA 3GSWA 4DZ8B 3EYFA 3ULVC 1QBMH 1YZZA 1YECH 4P57A 1GZPA 1KELL 2BY2A 2IH3A 1U8PB 4YHZL 1SM3L 8CGTA 4W4NA 1R5VB 1BEYH 2EDQA 4U6VH 5LQBH 4IHOA 4QXUH 5T33L 2YA2A 1AHWA 2OQJA 1IKNA 3WXWH 3VXOB 5CJOL 1KPUA 5I1AB 4WRLA 5KSBF 3D39D 1IILE 3P4OA 4Q0XL 1N0LA 2BHZA 3K2UH 3MX0A 3JUYA 4RWYL 2VN4A 3MODH 3SDCC 4C4KO 1A9EB 3MACL 2AXJA 5GGQH 4HUVB 5D7JA 1AJ7H 2XQBH 1D5MA 4NIKB 1EIBA 2VR5A 5F89A 5DMJB 1A6UH 3MLVH 3RWEA 4CUCA 4M1DL 4PB0H 2FD6H 4AQOA 1NBZA 1MFBL 1NCUA 1H3PL 3DVIA 1MJ7H 1NAKL 2VXQH 3CLEH 1Q72H 3G6DL 4XCFL 3WFHB 4ODUB 4HGWA 1IGIH 2VZTA 3CCHB 1CD1B 3ZL4H 1BAFL 4TUJB 3QQ9D 4MCZA 3O3DB 3CH8A 4NC0B 3ARXA 4NKOB 5KSAA 3QRGL 1ROWA 5J12B 4NN7B 3V9FA 5JORA 3VFRA 3NZHH 2PR4L 5JW4N 2VXVH 5E1HB 1SJEA 1DANT 3IKCA 3L9RA 5TE7L 4U05A 4FFZH 5CEZD 2R69H 4C56E 4N1HB 3T08A 5SX5K 3C6SA 2ICCA 3X3FL 3BQUD 5KN5A 7CGTA 1X7QA 1OF2A 3THML 6FABH 3PIQA 1I4FA 2WMPA 3EFDL 4MX7B 2C1PA 3MOQA 35C8L 5EOCL 3UYRL 1YC8A 3FFCE 5T1LD 4POUB 2GTWA 3H7BB 3AAZB 1XMWA 1AIFB 5BO1L 4G6MH 32C2A 4L3EB 3VGBA 5IBLD 4ZPTB 5EA0H 1FFNB 3C2AH 3H9SD 5BS0B 3IT8D 3MLWH 1CICD 5I1EH 4MSWA 4Y19D 5B39G 5F44A 2DM2A 1C16B 1S5IL 1EFXA 2YPVL 1P1ZB 1WK0A 3CXHJ 1U8MB 4U0RC 1ED3A 1ZT4A 3MNZB 2G5RA 3CFCH 4ZOEA 3VMOA 1WZKA 4PY7B 4QOKA 3DRTB 4HUKB 2HVKA 2BCKB 4OLWH 5ENWB 3S37X 2CXGA 3V7MA 3WN5C 4MJ5B 4F7MA 2FL5B 2PXYA 3D18B 1V8HA 4NBYB 1I7ZA 1WFTA 3QDMB 3VXSA 3TIDA 2MMXA 5I66A 2E6QA 1G6RA 1QKZH 4P5KB 4X9BA 3IAGC 5E8PB 5D96C 5D7KD 1T2JA 3MJ6A 2BRRL 3F58H 1FBIL 1ADQH 1UWGH 4K3DL 4NZJA 4EIGB 1TETH 3MUJA 4N1CA 1FZJA 2ADJB 1WBYB 5C0CE 2Q8AL 4G9FD 3O11A 3ZTNL 2WINA 2H26A 4PJHB 2R2HB 1TPXC 1OSZA 5DJDB 4QO1A 3EDEA 3QUXC 4ZXBC 4TNWF 4TVPD 1BJ8A 4PRHD 4YHZH 1ORQA 1JUFB 1SM3H 3RFZC 4G8IA 3DO3A 1OTSC 1HIML 2G5BA 5FKAA 4HEME 1NCCL 1DQQB 4OZHB 3T1FA 5CJOH 3I84A 3Q1SH 4Q0XH 1NLBH 5F96L 4RWYH 2HJKB 3KPTA 1E4XI 3QH3B 3GM8A 3FTGA 4U1HB 3MACH 3I85A 3CVHH 1LP9F 1FC1A 4HJ0C 1NCWL 1EO8L 2CK2A 3HE6A 3BP7A 4RBPH 3MGAA 1UC6A 3X12B 3D9AH 2B1HL 5FOBB 3AUVA 1F11A 4UBDC 3QAZC 3WDIA 4Q9QH 4KV5F 1MFBH 2V5SA 1H3PH 3ZTJG 4XCFH 3G6DH 2R15A 3WLBA 5CSBA 3GI8H 4BK5A 3BKJL 3U2SA 2FO1A 2NNAB 3EJYC 2FJHA 4U0QB 1MCJA 4HBQA 3IXTB 5DFVC 2E3VA 1FL5B 5IB5B 2OL3L 2VLLB 1XGQB 1C7SA 5E6YA 3C9NA 4RQQB 3MZGB 5EUKB 4PLJC 1Z2KA 4G7VL 1R5WB 1TVHA 4X83A 4M4PA 3LKSA 4ZFFA 2HVJA 4K71B 5MENA 3T0WA 4ZO6A 1KV3A 1H8OA 3T3ME 2FR4B 3E2HB 2P47B 3ZZ1A 1K5NB 3THMH 4KXZI 4LHUA 3CSGA 1Q1JH 3M17B 3V8CA 4CJ0A 1HWGB 1FNSH 4KRPB 4L8DB 3BYYA 1RPQA 1KSRA 4Y5YB 1T7VA 1KGCD 1N2RA 2F53B 5F88B 1I8LA 2IFFH 1IAOA 2EYRB 2JIXB 3O2DL 2G9HB 5BXFA 4NT6B 1LE5A 4K3EL 2A0LC 4Z5RA 1ZMYA 4LPCA 1RZ7L 2Q7YA 2GT9A 3BP5A 3KYOB 4G80B 3VGEA 4LBEB 2WM0A 3O6FD 3SDAB 3MROA 3GRWA 2JJVA 4U3HA 5TH2B 2C5DC 2ZUVA 2M8XA 4YBLC 2FEEL 4DKEL 1JPFA 5DI8A 4NO2A 4WGWB 3QNZB 4JFOA 4P23B 3CFBA 3BP6B 2PKDA 2Q6WB 4JQXA 3GKWH 4EDWL 5L2JB 1TITA 2WBWB 5D8JL 5FHBL 2P8MA 2A6DA 4MAUH 4BFGA 4O58H 5I8KH 2V9TA 3RZCD 3BZ4A 1DBKH 1SEQL 4H1LH 1JVKA 3FAWA 1XF5B 1DVFD 1CT8A 1Z9OA 1KEML 4L4TE 1BFSA 3PV6B 3RL1A 2C26A 3WEXA 3HS0B 5C8JB 3KPOB 4WFED 5IT2L 3O6KH 1KJ2L 1AP2B 3OGCB 1BQUA 3P0YH 3QXAA 1IL1A 4ZFOB 1NCCH 3VXMD 2BJML 2I26N 4JB9H 5SWZE 3GGWB 3LRGA 1K3ZA 2A6IB 3VXUE 4OFKA 1IE5A 1AY1L 3T4AB 1L0QA 4PGEB 1QSED 4HD9A 5HHNA 4ISVB 1RIVL 4MNGB 4GMTH 3G6JB 1N0XH 5CS7A 1I7TA 1JHLL 1JNNL 3WHXB 4ZAKA 2NTFA 3DV6A 3KPLA 2P44B 3G5ZA 4M43H 5DK0A 2EO9A 5L2KD 2YD8A 5FK9A 3LPGA 5ALBH 1A5FL 1P53A 1EEUA 4LCUA 5F6IB 5IB3A 1MUJA 4KY1L 2X40A 3MREB 4PG2C 5CGYD 3JZ7A 1LVEA 4OFVA 3LMJL 1Z9SA 4WO4D 2IBBA 4NDMA 3ROLB 4NHCH 2D0FA 3F7VA 4PRPE 4YDLB 3G04B 1OY3B 4NQCE 4ETQA 5F21B 2EKJA 2J2ZA 2GAZB 5I15H 4BQ9A 1X4ZA 3LRSB 3NCFB 4PJAB 1IKFL 1BBDL 1XFPA 3TBTB 3MLPA 4X6FA 3FB5B 4LHJB 4O5LH 1DQJA 3HI6L 3HCVA 2GITB 1KG0B 1P4IL 1RHFA 5JNYB 3BDBA 4RMQA 3AB0C 1MCIA 5J1SC 3VGDA 3W82A 3OAZH 3KLDA 2X9XA 4WHTA 2XRAL 1XEDA 1XF3A 1FIEA 1UEMA 4JKWA 1KCSH 3VGFA 4TTDC 1MJUH 3O2DH 1CL7L 4DVRL 1NANI 4OFIA 3WFBL 3GDBA 5TPWH 2MHAA 4LCYA 2XA3A 2Y4SA 1XGRB 1WIOA 5EIQA 2D7MA 1TQCC 2VQ1A 4Y8DC 3MA7B 2R9HD 5FB8A 4D94A 1QRKA 4JFEB 3L7FA 5HDQL 4C4KT 4JFYB 5DZLA 1QSFA 3ARGB 5IF0A 3L3KA 2W59A 4ZS6C 4L3AA 4GSDH 5CIPH 4PJCA 3VCLA 1YDPB 2NLJA 2EZ0C 4BFBD 4UTAL 3N85H 4CDGC 1YA5A 5C07E 2YA0A 3BZFA 4RMRA 4CADA 2GCYB 3F5WA 1RJYB 4JFQB 4XT1C 5CP7B 1KEMH 3FN3A 4YDIH 4NQEA 3RIFF 3ETBF 4LCCA 1WAAF 3SKJL 3VWKB 3SO3C 6CGTA 2FBOJ 2I60H 3O3BB 4WCYL 2ARJA 3GMRB 5HYFA 4LEXH 2MCPL 4PJFB 4F57L 3WUWG 1M05A 2X42A 2E9BA 1Z6JT 2IAMB 5IHUH 5DF0A 4P2OD 3AMLA 1XIWB 1ZHBA 2AABH 5EO0B 3TBWA 2W1NA 2V5MA 3VXQB 1RIVH 4ZPVA 1UACH 3LKOA 4XP1H 1EVUA 5IJVA 3E6HB 1JNNH 3T0DA 3W9DA 2FGZA 3E6FB 4Z7UF 1SJHA 1OTUD 1LHZA 3HKFA 5E8NA 2V2TB 5EBWB 3PWVA 5HVFB 2X4OB 1HEZA 1VACA 1YY8A 5DD5H 4H88L 1OCWL 4V1DB 3IF1A 1A5FH 5GGSA 1U41A 1UJTA 3ARPA 1NGXA 4KY1H 1ONQB 3GK8H 4HF5H 1ZLSH 3DV4B 3DVGA 3BUYB 4XCNA 5EO9B 2QKIA 3Q48A 4QXWA 4AEHL 3LMJH 2CUHA 1U8LA 4GKZA 1CGXA 4CW1B 1A6AA 3HE7C 1YJDH 4PJ8B 1YEGH 2J8UE 2P45B 1B90A 2B2XH 5GRWA 1UG9A 4YPGB 2QQLH 2JJWA 3LS5L 1U42A 2R0KL 1MOEA 3MGOA 3RAJL 1DDHA 1KBGH 5BJTA 5CLWA 2R2EA 1IKFH 3MRRA 2IANB 2YR3A 3RWDA 3O3AA 4LEOA 5IIEA 1BBJB 3SE4A 3HI6H 1J1XL 1P4IH 5FV1L 4OZIE 1FYTE 3GIZL 3GSUA 3QNXB 1M1SA 1EGJA 2X6MA 4AMKL 1Z0MA 4HWBL 5DJYB 1KF9B 2GJZA 1QR4A 2XACC 4X6DB 4JFFE 2EICA 1CL7H 1F3DJ 4S11A 5DJ8A 4DVRH 1RZKH 5C9JA 1DSFH 5DS8A 3RVUD 2HN7B 3PWPA 3IGAA 3WFBH 2GSGB 3ZO0A 3V4PH 4MJ6A 5BRZD 5FYKH 2QTEA 4DVBB 4N8PA 4PPTA 3DUUB 4ZSOA 3U9PL 5KVGL 1P4LB 1V05A 5DRWA 1CK0H 3SE9L 3CPLA 3NZ8B 2Z31B 3O4OC 5KSBA 2F58L 3V6FB 4OM0H 4X4YA 4X99A 2VDRL 2X4RA 5B39B 2UWEE 4XZUB 4FZ8L 4JFPB 3QI9D 1WWAX 3MRIA 2A83B 3HG1E 4JRYE 4YEFA 3K81A 4UIKL 2DQEH 1D3CA 2NY2C 3NOIA 4YC2C 4OI7A 1FZMB 3NACL 1GYAA 2BHUA 3KS0H 1U3HD 4GG6B 1UKTA 2J5LC 3SKJH 4N9GA 4WV1A 3CZFA 3HMXH 4WCYH 2JELH 3RNQA 2CIKB 3WN5A 3WFCL 3EYUH 3V4UH 1YEJL 2MCPH 3BMVA 3WL9B 3VRJA 4XXCC 3U9UB 2AJSH 1T7XA 5GS0C 3P9LA 2XTJE 3MO1A 4P2RA 3RVTD 3Q5TA 4Y5XC 1WSST 4W4OC 4LRIA 1GC1H 2BVUA 4FN0A 2DKSA 3P73A 4GKNA 5ISZD 1CCZA 4OCLC 2XZCH 4H88H 3QUXA 4ZXBA 4KZEH 5FO8B 5C08D 2CIIB 2F5BH 4Z7WE 1OAYL 2DQDL 4QHKI 5T3XH 2XA8H 3LEXB 3T8XA 2ILLA 2LFGA 1MCPH 3RVXC 2J8UF 3QCUL 3HB3D 2NY4C 4YXLL 4NQDB 5C0GB 5DK2B 4XBEH 1UWXK 4IDJL 4D8PA 2HFFA 1KC5L 2H2PC 5H2BA 3D5OF 3QCVL 3KAAA 2P8LB 1II4E 1AE6L 4GKSB 2VQTA 5MERB 4GAGL 1MF2L 3B5HA 4OZIF 1XIWD 5IVZB 4B7LA 1Z9MA 4MNHA 2IALA 1ZT1A 2CKBB 5ILTL 4KK9C 1OGTB 4NUJB 4LNVA 4Y4HC 4AMKH 4HK0B 3ALWA 4R6UA 1U58B 2YUWA 2IADA 4O00A 1JYNA 3PQYE 2GUOA 3L3IB 4M8QB 3GI9H 3PGCA 3RX7A 4L8CB 4GRWE 4I3SH 3ZYZA 5F7DA 2ED7A 4QRRD 2WIIA 4IRZH 1NCAH 4U1MA 3BPCB 2QSTA 3RTQB 5M7QA 3CJJA 1UA6H 1U92A 3O9WC 4GBXD 4QRSB 3QUYB 4XCCL 1F8TL 3U9PH 3DGGA 3GZKA 4LRNH 4JFZL 1VADB 1MLCA 3CMOL 1X5LA 1T5XB 2ADIA 4JPVL 5ID1B 3PHQB 2UWEF 3T0BA 3MV8A 2ZSVA 1JZ4A 4I48A 3RVVC 1LP9A 1IGYB 4ELKA 1XF1A 1F90L 1QFOA 3UXFA 3FB8B 1KNOB 3FT4B 5EU6B 5E8EB 4P2QB 5HDBE 2PCPA 4FQXB 4OQTA 3TN0B 2XTLA 4PJIF 3ZE2E 2OXGA 3MLSL 3TT3L 2AV7A 5DO2C 5HYSG 2X4TA 3S5LA 4E9LA 2YRPA 5FA4A 4PS4L 4XCYB 4ZYKB 4YFEA 3SN6N 3WFCH 2EDNA 2WBJB 3QEQE 2UUDH 4GW5B 5ETUA 1YEJH 3RQ3A 1KJ3L 5L0QC 4MHHI 2BSTA 1KCKA 3B9KC 4OCSL 1NFDB 5KW9H 1VDGA 2HG5B 2J4WL 4J7RA 3TBVA 3V95A 5E99L 3P9MA 4RISL 1HILB 3DI2B 1CBVL 1JIBA 1BJ1J 1CGVA 3BPOB 3DX8B 4FTVB 4JM2F 4ELME 1BVLB 1C5BL 5E9DD 3MJ7B 2N56A 2FDBP 5FYKU 1CLCA 4HUXB 2NZIA 4X80L 4K7PH 1I9IH 5FYJE 4OGYL 3BVNB 4JDTH 4PRNA