1FPTL

Three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
b'DVVMTQTPLSLPVSLGDQASISCSSSQSLVHSNGKTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTYFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSEVQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT OF AN NEUTRALIZING ANTIBODY FOR TYPE 1 POLIOVIR
publication title Structure of the complex between the Fab fragment of a neutralizing antibody for type 1 poliovirus and its viral epitope.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Complex (antibody/pv-1 fragment)
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1995-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fptL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fptL01
2ZKHH 2AV7B 5IMOB 3NPZB 4OQTL 4H1LH 4KVNL 4XC1H 4PRHD 2J5LB 4LHJB 2LV4A 1HE7A 2GQHA 2D0HA 4QXTB 2OK0H 4IJ3B 3RY6A 4HBCL 3C6LA 1ZA6A 2ZG3A 3VXTA 3VD9A 4ZPTB 1AXIB 1LEKB 3QUZB 2GTZB 4QRPE 3B8YA 2Q87A 3ARFC 1W8OA 4KDWA 3GM0A 1Q9KA 4M03A 5EPMB 3SOBH 3MXWL 2XQBH 1Q72H 4AIZA 2V17H 4O2CB 2EZ0D 2FX8H 3A67L 3OAUL 3O6MH 3HRZA 4Y4KD 4PY7A 3RWDB 3DXAA 4M1GL 1FSKC 4L8BB 2BY0A 2GCYA 4XNUH 3EFDL 3WSQH 4C56B 3RWCB 2MKLC 3HB3D 2Q6WB 2IADB 2B20A 3SBWC 2BDNH 3UZEA 2V5MA 4KZEL 3ULUL 5GIRA 1FZKB 4YDVB 3FQUB 1CD1A 5JIPA 2ZUVA 2P48B 3O41B 4OQTA 2ZUQB 1FP5A 3FT2A 4ZUSB 1KV3A 5T33L 2IWGA 2WWMD 2DLFL 2YSSA 1TPXC 1T83A 3CZFA 4M7ZB 3K3QA 3MNZB 2GAZA 5IHZB 3BIAX 3PHOB 3IF1B 1S3KH 3IS0X 4MNQE 3SJVE 1CYGA 5DMIL 2YD8A 3EBAA 1B0RB 5HHNB 1Q9OA 2R1WB 4L9LC 4IRJB 6FABH 3QNZA 4PBWD 3SQOL 5HVHC 3E0GA 3MRGB 1BPVA 3ROOA 5BV7B 3BDBA 5E8EA 1OM3H 3QDGE 4NKQB 5J6GA 1MRDL 2X4SB 4NQDA 3QXVA 3NIGE 4UQ3A 3OG6B 3N06B 5L88L 1H3PL 2FYYA 2IANE 1F6FB 2YD7A 1CE1H 2YKLL 3WLBA 2IG2H 3NIGF 4QHLB 3RZCB 1KBGH 4O00A 4LAQH 2W9EH 4KTDH 4XNMA 4TTDC 5TPWH 3HAEA 2AJUH 3D69B 4MGXA 1N7ML 4HEPG 2ATPA 4G8EB 4UTBL 2NY6B 1JTTA 2NXZD 3B2VL 1ORQB 4FMKA 4JZOB 4HJ0C 3ZKSD 3QAZC 5IF0A 3RI5K 4ERSH 1NFDE 4OCXH 5KSAB 3QRGH 2WV3A 4K71C 1WZKA 5CZVL 1UACL 3AB0C 5CZXC 4P3DB 4G3YH 4UUJA 3ARRA 4ODHL 3L5JA 3NIDF 1UZ6F 2AJYH 5K59F 3CLEH 3DRQB 4LBEB 4KY1H 5J56B 4HIJB 3QP3A 1A6WH 3AM8C 4MQSB 1PZ5B 1S8DB 4LCCA 3GJEB 4C54A 1DQJB 1FFPA 5FUCC 3NFNA 2AJ3B 3MLYH 3NA9H 3TP4A 2ERJC 4GW1A 3QQ9D 5DEZA 1HHKB 2BC4B 3HZMB 5I1KL 1MNUH 4ZAKA 3OR6A 2BK8A 1IGMH 4LSRL 5JNYB 1F42A 4ZFOB 1AGBB 4L29A 3BZEB 4LVEA 1L0YA 1ZHBA 4OD2B 3GKWH 5HYJE 5ITFB 4LSTH 1HYSC 3BRDA 4L3ED 3RWJB 5ID0A 2Y6SC 4JB9L 3QIUC 5H94A 3EJZD 1NCCL 5JUEL 2HG5A 1BZ7A 4G80A 2XWTB 3MFFB 5D6CB 4X8XA 3O2WL 4BUGA 5KJRL 1IM9A 3WS6A 1MLBA 3LN5A 3Q2CA 4JPIA 3LEVH 5EC1A 3F6IA 2XTJE 4M9PA 4WO4A 5F8QC 4H1LB 1VFMA 4TUJB 2VE6A 5IBUG 2HA1A 3ESUF 4UT7H 1YY9D 4WFFE 1QP1A 4V1DB 5GJSL 1LO3L 4ZNCD 4HUUB 1H5BC 1CTNA 4FXGB 1NGYB 1FRGH 4OCYL 5F3HA 3MA9L 3QR2A 3EOBB 2HKHL 4Y16D 3QXTA 2XYCA 4P4KC 2NMSA 3ZKXC 1OAKL 4YZFF 4WW1A 3MRIB 3PV6A 1F58H 1FGVH 4XC3L 1YEFL 5A2LH 5DJ0A 1DBKH 1I9JL 1XR8B 4N0UB 4GKZB 3GUTB 1L7TH 4JFQB 1I8IB 3UTTA 5I1EL 2ICCA 3SKJH 3B9KD 1DBJL 5ITBH 1DANT 4I3GA 5D7SH 5IIEB 2FJFB 3QUMH 5FV1L 4UDUB 4DEPC 4GQ9L 4NNXA 5DJCB 1P2CB 2MCPH 3IFNL 4LAJH 2XZCH 2G5BA 4JM4H 3MACL 4AY0A 2QTEA 2APBA 2VISB 3QXDA 2J5LC 3MROA 4XGZA 2F74A 2YXFA 1FPTL 4L1HA 4IJ3C 5ENWA 4JKWA 3GSNL 2VDML 3OKEA 4P5TA 3QUZC 2ILLA 4PGEB 4MXQC 4Q58C 2VXQH 4Y2OA 5DI8B 5E8OA 3L6FB 1QSFD 4MQ7A 4YBQC 1R3LB 1ZWIA 2FHFA 3NAAL 3RNKB 1FNAA 2KPNA 4APQD 2IQAA 3PIQA 3QWOA 4V2BA 3KDMB 1A14L 3KYKH 1D5ZA 3RIFK 1T89A 3MBED 1EUUA 3W2DH 1HH6A 4YHPB 4PRDA 2AXGA 1A47A 4OCLC 3MRDB 5FCUL 5DEFB 1AQKL 1D6EB 2EDWA 2HFGL 5E6ID 2HYMA 4PUBH 5C0CE 1A1OB 2V6HA 4DVRH 2JJSA 2NYYD 2ARJB 3QHZH 4YWGH 2XZAH 3OGCB 4H26B 5EZOL 5ESVB 1PJ9A 5DJ2B 2ZUQC 5IMKA 1OAUH 1UQSA 4M7ZC 4MB3A 3GSNA 4UTAH 4G9DB 5C2BL 4LEXL 4GMSL 2ADGB 4QOKE 2R39A 4OZ4A 4U6XA 5F6IB 5E2TL 5FYLH 4IRJC 1JGLL 1M7IA 4WJ5A 1HSAB 4JFPA 2RAMA 4DGVH 5BV7C 2CGRH 1KN2H 2VNCA 1IL1A 4M3JA 2LU3A 4DVBA 5D2LF 5EOTA 5CEYB 1OARH 1CICA 2CK0L 4GLRI 5GZND 4OIBA 5DFWH 1MHCB 4R6UA 1KEGL 1LO0H 3FO9A 1JPTL 3DV6A 1MIEL 1M05B 4KMLB 3RZCC 2DI9A 2FIKA 3VW3L 1KTDB 2VDOH 1BD2D 2BNQB 2H1PH 4U1SA 1BQHA 1KCLA 4OZGF 4D0BA 1YN7A 4EDWL 4HH9A 5DEGA 2NLJB 3T4AA 4MJ2A 1BX2B 2VYRE 1LE9A 4IRSD 3HI6H 1HKLL 1NMBL 3I02A 4RGNB 4P2OB 2Y5TA 4J3TA 1J0YA 4LQ1A 2B2XL 1WWAX 4YIQA 5TJWK 2G60L 3E1F1 5KSAC 1G0YR 4QRQB 1U42A 3TF7C 4OF0A 2XI9A 2QSVA 1D5IH 1RIHH 3B9DA 4DGYL 3NCYP 4OCWH 4XBEH 3RUGB 1RUPH 1FIGH 4HSQA 5KS9B 2AI0L 3MRCA 4O9HL 4OLWL 5C0ND 2KDGA 3B2UD 2XRAL 3G6JF 4Q97A 3QCTH 1YPZA 3WIHL 1HWHB 1IFHL 3T0DA 5IFHL 2X5PA 4XCNA 3MRQB 3QNYB 4WHDA 3CDGA 2H2PD 3MCG1 3SE3C 1G84A 4O2EB 4WY7H 1NC2B 4OT1H 5CIPA 4O02H 3EJYC 4PJXB 2WP3O 4WWKA 3ARBD 3L1OL 1TVHB 3UROR 4FQHB 4DWHA 4HPYH 2X9XA 4JPKH 1NGXB 1N59A 3UYRL 3FONB 4LLDA 4FXKA 3TBSA 2AABH 3SDYL 2HKFH 2Z4QA 4XH2A 5F9DC 4PB0L 3QUMB 4XCYA 4N8CL 4CN6A 4M5YH 3GBNH 2W91A 5BS0A 1KC5L 2VXVL 4P23D 4PJBB 4DOHE 4XPBL 3ARTA 4GAYA 3SPVA 4LVOB 3FQRA 4QTIH 3E6FB 1EDQA 3WFEH 3OKDB 1QNZH 5E9DB 4ZD3L 2G2RA 3WIHA 3VD7A 2VLJE 3H3PH 3U46A 1LK2B 1G7MB 4LSPL 4GOSA 4HS3A 1R6VA 3FFCA 3NFPB 3M8OH 5BO1L 1ZLSL 5MEOA 3AREA 1K6QH 5EZIH 3PGDA 2J2ZA 2Z8RA 4L4VB 3S7GA 4NQCB 2JELH 4YE4H 3QPXL 5CWSA 2JJUA 1AGDA 4FMFA 1QA9B 1WCBA 3P9LA 4YDKH 3EOTH 3FRUB 4Y5VA 4NO3A 5HYFA 5HYJB 5C0JB 4X7FC 2YPKA 3MXVL 4TVPL 4WDIB 2UZXB 3Q5YA 1TJHH 5L2JB 4KK5D 4PP1D 1AJ7H 5I18H 3LKNB 1YEKH 4Z7WF 5HDQL 5LBSL 2PO6D 4LPYA 2HN7B 1KNOB 2JB6B 4NNPL 2AJVH 3H9SE 4LL9A 2J12B 4J6RH 5GGSB 5LGHH 1IC5H 3E2HB 4JY4B 4K8RH 1T3FB 4JQXA 5T5FL 4M6OL 4WFGE 2ICES 1KB5B 1NCDH 4K3EH 5CFHA 1EV2E 1OAZL 5IGXH 4XX1E 1C5CL 3KYMA 2DQJH 3ZKQD 4PG9A 1F3JB 2XV6B 3QUXA 2WWKO 2X4TB 3BEVB 3T4YB 4XB7A 5C09D 3F5WA 3PQYB 3HFML 1S9XB 1PBYA 1UWXK 4KI5C 1WIOA 2ESVE 4IDLA 1S9YB 1TITA 4KRPB 4X6BA 4QXUH 3GMQB 35C8L 4JJ5B 4CNIA 5I9QC 4UINH 4PTUB 3ZYOA 3HE7D 4E41B 5FO9A 4L3CB 4HK3N 4LSSH 1DQML 3DXAE 3IKKA 5GSRA 3CU7A 3BFOA 4PTTB 3GI9H 1F4XL 2CUIA 3QDME 5CBEA 5DD0H 5J1AA 1KYOJ 1HHJB 1GYAA 1DN2A 3VXRB 4HC1H 1CGVA 1E4XL 4U6TA 3QJHB 4B50A 1T1YB 1WT5A 4KUZH 4I3SH 1KN4L 1UC6A 1HDMA 4MD5A 5F6IC 2FZ3A 5HHXL 5I1CH 2DYPA 4NFBA 4ZTPL 4BH7A 1IGJB 1RMFH 4FQ2L 1U91B 3O4LB 4KKLD 4WW2B 4R3SB 3KXFD 5DK0A 3U9UA 4RA3A 5ICXB 4ELMB 1GSMA 3CH1A 4U1NA 5HGDB 3ZL4L 2N56A 2IFFL 2OI9B 3SE8H 1YEDB 3W9DB 3W5NA 3WL9B 1IKFH 1UM5L 3QQ3A 4UB0H 1WBZA 4YNYB 3U9PL 1FIEA 3K2UL 3C5JB 1QRNB 2YEZB 4ENED 3ILPA 4GSDH 2R2HB 3VDBA 4YHML 1HSBA 1ODAA 5C0IB 1WC7A 1I7UB 1Z0MA 2EE9A 2ICWJ 1EO8L 4JZJA 1AQDB 5EOQH 4D8PB 3MRMB 1ZS8A 3UP1A 3TCXA 3BDYH 4Q9RH 1BIIA 2BNRA 1SEQH 2ICWI 4AENB 1QFUL 3ZT6A 2VRAA 5KVEH 4XWGL 3ULUE 3TBWA 4YXHL 1G0DA 4RGNC 3WUWG 3RY4A 3WMSA 4P2OC 1FZJB 1S7UB 5MERB 2GFBB 3C08L 4QRPD 3H6JA 1N64H 1QPXA 1NCWL 3W11C 4F7MB 5E2VH 5I17A 4NN7B 1ES0B 1G9MH 1Q1JL 1LGVA 3KPSB 3W0WA 3G5VA 3P77B 1R3JB 2AEQL 1OTSD 3MX0A 4UIKH 3RIAK 3V0WH 1PY9A 1CFQB 1EHLL 1QBAA 5C8JA 4YXKL 4U1JB 2DMKA 4QCIA 3QXWA 3FO1B 1FVDA 2DTML 1ZT1B 5CSZB 4ZMAT 1LE5B 1NLBL 2HMID 3BD3A 2IMNA 5KN5A 2VAJA 1KTLB 3UBXB 3NZHH 1S7RB 4QF1B 3KPTA 2FLRT 1WV7T 2O5XH 3RVTC 1QUNA 2Y9RT 1IGCH 2AJXH 5IW6B 4R26L 2P5WB 4FQIL 2GK2A 2R0WL 1H15B 2GJJA 3SJVD 1BF8A 3DETC 4F9PC 3ARUA 2AS5M 2HFEA 1CFVH 1JPFA 2R56H 3M17A 5HYIA 4S11A 3BQUD 2BY3A 3QDGD 4OKDA 1MQ8A 4LMQE 4OLVL 4EBQL 3F58L 4DCQA 2YD4A 1MJ7L 4LVOC 4N0CC 2ITCA 3KPQA 2IAND 2ZOKB 3VRJA 3DX9A 3D39D 1F4YL 3JTTB 1S7WB 2NX5A 5EU4B 3TEUA 4HG4K 3I75A 2DBJA 2FHCA 5IVZB 5TE6H 4FP8L 4X6FB 5FA3A 1HZHH 2DIAA 4KVCL 3TO4A 1MHHB 4Y1AE 3C60A 1MCIA 4Z7QE 4NQVA 5I8EB 5D2NB 2Z9TA 1RK0B 4X99A 5DJZB 2E9JA 3IB4A 4OZIA 5LKNA 2FJGA 1ZEAL 4DZBB 4OLYL 1FZMA 3IJSA 4RAVB 3KHOA 2DQUH 1EPFA 4X6DA 5F7DA 3A67H 3VCLB 5JW3L 5L2KA 2Z92B 3P73A 4U6YA 3KS0H 4M1GH 2EXYC 3L5HA 4WFEE 2V5RA 3AS1A 2GTWA 1WBXA 1OAYL 3WFDH 3TBYA 4Y2DC 3GSXA 3B8SA 2NY1B 1YMHA 2BY2A 1G7JA 4GAGL 1HHHB 4PRBB 3EYFB 2CRMA 5KANG 3HAEH 3N1FC 3E2HC 3RWIB 2FBJH 4DQOL 3DUSB 1RUAH 3MRBA 4U31A 3IVKA 3DO3A 2DLFH 4XT1C 5JIIA 2CIKA 1U9KA 2G9HB 1CFTA 4PIRF 4Z95L 3TN0A 1P4BL 4WUKL 3L95A 4LLMB 5EUOB 2UWEE 1QHPA 3EDFA 4WHTB 3BPOC 1I1FA 1LDSA 3WFHA 1NUNB 4PRHB 4G8GB 2D3VA 3CZJA 3K4ZA 4JFFA 7CGTA 3WN5B 3MNWA 4R4BA 3MV8A 4HHAB 3VGDA 4HIIB 1UWGH 5L88H 4KRPC 5F72S 1IC4L 5DZNA 5DFTA 4PRPA 1KPRB 1YMMA 1CFNB 1X7QB 1R3KA 2E9WA 4PJAA 2DQTL 4KJPC 4OUUB 2E6QA 3FOMA 4ZOBA 4DZ8B 4U7MA 5KSBA 2XTJD 4L4TA 1N7MH 1DVFA 4U7SA 1P53A 1PY4A 2CKNA 1CXFA 2BSSA 1S9VB 2C3WA 4DW2H 5CJOL 4GKNA 1JGUH 3V6OA 4WFFD 2C1PB 4U4BA 1WK0A 5IEKA 5DD3H 1UACH 1JZ7A 3FJTA 5EBLA 1TJIL 2A0LC 2VDPH 4ODHH 4DN3H 4WW2C 1IEAB 2C9AA 1Y18B 1HQ4A 4FG6D 2D0FA 2OI9C 1MFNA 1VB9A 4RQQB 3GSRA 1A4JB 4JKKA 3BXNB 3DMMA 4NQSA 4NQXB 2J8UF 4F7TA 2X4NA 3C6LB 4ZFZA 1AO7B 5I1KH 2FCBA 3VDCA 3T0VA 4RNRB 4XAKE 4LSRH 1AR1D 1DJSA 2BRRL 5ICZB 5GGTL 1Q9KB 3VH8A 2VWEE 4AIZB 3WXVH 4XVJL 1EAJA 2A6DB 3CH8A 4NKDA 4MS8D 1DZBA 4NM4H 1AE6L 4JB9H 5AEAA 4PY7B 4BSWB 1NCCH 4CADA 3G6AB 1H3WM 3BKYH 2G75B 4XNXH 1MHEB 3F6LA 1JN6A 2H6PA 5CGTA 3HS0B 3T77B 1K3IA 3O2WH 1OT1A 1J0ZA 1DCLA 1FVCA 5GIRB 2B4CL 4HGMA 1CD1B 1WTLA 3RGVB 3T1FB 2HWZH 4IMKA 4C4KO 4MB4A 1U3HD 5I16A 1T7YA 3FT2B 3HMWL 3QHFH 4GG8A 4MA3A 4PB9L 2GAZB 1J10A 2VLKA 4OFDA 4LCUA 1LO3H 3QUYA 1H3UA 1MWAA 1URLA 1LP9A 2P44B 5E5MA 5DC4B 2BERA 2HVKA 5C0CD 5GGTA 1A7RL 1KIPB 2A2QT 3QNZB 3MRLA 4MCYA 3MLTA 4YDLB 3TGXA 1S7TB 3KR3H 4P46D 3MA9H 4QRSA 4ISVA 2HKHH 4XWOD 1NEZA 3S36X 1I1AD 2IBGA 1NSNH 3CSYA 4NQDB 1T66C 3DPBA 4ODXB 3MLRL 2IFGA 2FYYB 1YYLH 4W68A 1YEFH 3QO0B 4XC3H 3G6JA 3RHWK 3ZDZE 3MLXL 4QOKD 2AXFA 1AI1H 3WLBB 1WICA 2OXHA 4YDJA 5I1EH 4Y4HA 4P9HL 1DBJH 4XPFL 5J8OA 1AKJB 3CDYA 5GS0L 3LAFA 3HAEB 5DFVC 3BE1L 4K8RC 5HDBE 2FECL 3BEWA 4CMMA 3HUJF 4QNPE 1I3UA 3MACH 5L7XL 1MCNA 3OKLA 1JZ2A 2VZSA 1BFSA 4PJFF 3O3DB 2GKIA 4KK9C 1AGFA 4KKBD 1FPTH 5BS0E 3GSNH 1XH3A 2VDMH 3FT3B 3LD8B 1F13A 4M6NL 5T1KD 1HQRA 2X09A 5TQ0H 3K8KA 1TTUA 1RU9H 1X6NA 4PLKD 4KXZH 3Q3GA 2EYTA 2D0GA 4FZEL 4LCCB 4JR9H 1FN4B 3FFCE 1FFPB 1X5FA 2VQUA 3U7YL 3SE4A 2HH0L 5L0QB 5JO5B 3ROLB 3LCYA 1QSZA 4GW1B 3ILQD 3ZSSA 3PHQB 2DQEL 2DQFA 4W6YB 2BZDA 2OJEA 4YPGA 4LF3B 4EN3A 3OR6B 3QH3B 1AQKH 2HFGH 4MQXC 3T65A 1ZHBB 2IPUG 3BZFB 2X6MA 4EIZC 1KACB 5IW3A 2NR6D 4OLZL 4S2SA 1CLYH 5H94B 4LPVA 5I76A 2HG5B 3IFOA 2R29L 3KPRE 4JEGB 1MCOL 4G80B 4LEXH 1MH5B 3GSVA 4NRYB 1OAQL 5F1SA 1IT9L 4HV8A 1L9NA 2Z35A 4GUPA 2YWYA 1IM9B 5FUZL 4KK6D 1JGLH 1MCHA 3LQAL 3LN5B 4YX2H 3FO0H 4LDEB 1A7OH 4JPIB 4HWUA 2UUDH 4ZS6C 1WTGT 1CGSH 2WBJB 2NY0B 1RFDL 2VE6B 1P7KB 5A3IC 1FVEB 1KJ2L 4Y5XA 1I3VA 5DVKA 1AH1A 3GMPB 1U8KB 1KEGH 3C2SA 4HK0A 4FFWC 4Q2ZA 4W81A 3MLZL 1HHGA 1YEGL 2XQYG 4MSWA 1CD9B 4EUPG 4RGOH 2X4PA 5B38G 1U36A 2CKBL 3LPGA 5F3HB 5CIPH 3TBVA 1HINH 4JRYE 3T0EB 1IGYB 5AZ2L 4MAYA 1VFOA 4TVPE 4RRPG 3WFCL 1XAUA 1FFQA 4EDWH 2Z31D 1NCBL 5FHAL 3P2TA 4D0CA 3MCLL 4YAQA 4PJ8A 3SY0A 4MNHA 4OCRL 5DJ0B 3S4SA 4L8SA 4ZDHA 5DHYA 1CDHA 2W38A 2HTLD 3UTTB 2YA2A 2G60H 3GHEH 2I07B 1U58B 2AEIT 3UAJD 3LKSA 1N5AA 1G9MC 4LRIA 3ZKMD 4G5ZL 1I3GH 3TNMA 1RQ5A 4YDIH 2G5BB 3EYSH 5CD5D 3LZFH 2Q86A 4JHBA 2APVA 3QXDB 1AC0A 2EKSA 5E8PA 3BISA 1RZKH 3MGOA 4Z7UB 2F74B 3TVMD 4X4YB 1ZVSA 1FV1A 5ENWB 3WIHH 3SGDH 4FFVD 3C6LC 3VXUA 2QQNL 5D7JB 3OKEB 5CUSL 4PD4J 4P5TB 2CKBA 1R24A 4JRWA 3H9SD 4JANB 3TNNB 4D3CL 4J3XA 1ZAGA 4PJCA 5DJ6B 1F4AA 3V5DA 3RVWD 4WFGD 1I8KA 4NZDA 5D96B 5BVPH 1T04A 3V79C 4R4NC 2R0KL 1JF1A 5HPMB 4JHAH 3UYRH 5FM8A 1NL0L 3LN4A 2W92A 1FAIH 3SDYH 4X5XA 3QFDA 3EGSB 3LEXA 1M7DA 3WNPA 1I85C 4PRDB 4S1RH 4PB0H 4N8CH 4JVUA 4OKVA 5F93C 3S35L 4JM2A 4MDIA 1WIPA 2BNRE 2L0DA 2C26A 4OCSL 3RGVC 3X17A 1EFXA 1CXHA 1JPST 2ESVD 4M5ZL 4HKZB 1JWUB 5H8DA 1T83C 2PYFA 4Z5RB 4ZD3H 4HEME 3GSNB 5KZCD 4LSPH 5LGJA 3IAPA 1RZFH 4HQQH 5ILTL 1ZLSH 4Z0BH 1FYTB 3TJEL 1II4E 1UVQB 2HLFD 4U6XB 4RMUA 1U8PA 1M7IB 4CGTA 4WJ5B 4G6KL 4G9FB 4JFPB 4HWBL 4JKPL 5JIKA 4PRIE 2KUTA 4R90L 2VLME 4NIKB 4AM0A 4X7DC 4XPTL 1CVRA 3QDMD 4KGLA 4PJ9A 3EHBC 4PLOB 4BQ6A 3DROA 4S0SD 3NIFE 1QQDA 4IMLA 4FNLL 4U3CA 3DO7A 3MXVH 4ONHB 4UBDC 3LMJL 2XKSA 3AC0A 3FO9B 3DV6B 2DQDL 3G6DH 4P3CL 3VFWA 2ZG2A 2B7DT 2FIKB 1FAKT 5LBSH 3TA3B 2CXKA 1JWSA 5INDA 3MLWL 3QIBB 1YN7B 4MNGA 4TPRL 4OJFH 4HH9B 5DEGB 2AP2A 5T5FH 3G04A 1LE9B 1IAOB 5D9SA 5JORB 2ZOLA 3NACL 2BSRB 2DAVA 3L5XH 1C5CH 1HHIA 4MA8L 1JBJA 3LD8C 4YIQB 3WFBL 1B6UA 4HWBA 5FA4B 3ZHDA 3CXHJ 4EEEA 4KJYA 3KLAA 2E9IA 4XXDA 5GGRY 2Y36L 1ZKAA 3SDDD 1PD6A 1E6OH 3TT1L 2NX5E 5DUPL 3MRCB 2YRLA 4LCCC 3ULUD 4TSCL 1ZV5A 3BI9X 5IBUB 1LO2H 5L0QC 3F7RA 3KWWB 1YPZB 4M8QA 5GJTL 5GGUA 3TPKA 2R2BA 2R1YA 5EO9A 5I8KH 4OZIE 1WAAE 1AGCA 2IPTH 1AHWB 1E4KC 4EUPA 5CIPB 2F19L 1Q94A 2Y7QA 4X6DE 5L2KE 2IH1A 4I18A 2BX5A 2C3HA 4DK3A 4A6YL 3TJHD 3WXWL 3IDGA 1QSEE 3MYJB 1QFWI 3FB5A 4KROB 4FXLA 4LLDB 5BZDA 1E4XH 4HF5H 1QBMH 3KYAA 3HCVA 4TNWF 4JY6B 2Z4QB 1AXTL 1KN4H 1QEWA 5FYKH 5HHXH 3WS6C 1ED3A 4LHUG 1ETZA 5BZWA 4FQ2H 2P5EA 2GK0A 3O0RL 4YHOL 1S78C 5A2JH 2N1KA 5GZOC 2WBJC 2NY0C 1YECL 4N1HB 3BN9D 2H2SC 2A6KA 4ZAKD 3H9ZA 4M1DL 1DQLH 4KRLB 5FK9A 3CX5K 4HS3B 3U9PH 1VFAA 3U0PA 2XICA 1BEYH 2C3GA 4HKBA 5DS8A 3AREB 5C9JA 3PGDB 5INCA 3L3IA 2APWA 5GXBB 4YHMH 4XVUC 5TDOB 4PJDA 3BP4A 4A6YA 2RFXA 5EIIA 3T0EC 4PRPE 1FL5A 3GMRA 4IIQA 3SQBA 3SGKA 4Y5VB 4UILL 3WJJA 2HJFA 4XWGH 4PJAE 3HE7B 1YC8A 1MCRA 1V5JA 2YPKB 4RX4D 4PJIA 3EYOA 5I1LA 1RZJL 2LU7A 3U0TA 5KSBE 2EYSB 4Y1AD 4L4TE 4GRWF 1WQVT 4WO4D 1RZ8A 1NCWH 5EBGA 4OM0L 3PF2A 1B3JA 1JWMA 5EOCJ 3RBSA 4BKLA 3QEQE 1KGCE 2A6IA 1MAML 1Q1JH 2PCPA 4KWUA 4PREA 4WI5A 4FQXA 3VXSB 3V0VA 4UIMB 4WFED 2IMMA 1NDGB 5JHDA 2WMPA 3REWA 4F33A 4YXKH 4Y4FA 5D7JC 4P5TC 4DKFL 1MRCH 2IAMA 1NLBH 2QHRL 3LRSA 4RFNC 2VZTA 1RI8A 4BQCA 2NTFB 5GS2D 5D96C 5JOEA 3HZYA 1RURH 4ETQB 3STBA 1FLTX 4FQIH 4X6BB 2KQNA 3NCEB 1T89C 4PV9B 2GSIB 2H32A 2GHWB 3WLWD 1LEIA 1U8LA 2PN5A 1XEDA 1VADA 1QVOA 1B6DA 4CNIB 1XZ0B 2Y07L 3AS2A 1DBAH 2OR9L 3BP7A 5FO9B 1MFBH 4OLVH 4P4RA 1UM6H 3K81A 3TFKD 2QEJA 4YEEA 3PP3K 4ODTL 3S3PA 3U7AA 4NKIL 3GFUA 5K9JL 5JPMA 5J1AB 4QEGA 2F8OA 3FT4A 5C1MB 3CLFL 3RVVC 5JW5B 5EN2A 5L8JB 3O6FA 2FBOJ 2FZ3B 2BCKB 4KVCH 4KJWC 2DYPB 1RHHA 4BH7B 5HY9B 4RMRA 4CL7A 1I3RA 2MNUA 1KEML 2AKRA 3EO0A 2D7PA 2X10A 1OGTA 3EYVA 3U9UB 1ZEAH 3CH1B 2MCG1 5ALBH 2HJKB 3T0XA 2NXYB 5HYQA 1M6OA 3U4EA 1LP9E 2VWEC 1Y6NR 4HIXL 1UXSA 2YN3A 3QQ3B 4M8VA 5HYSG 1HEZA 4X98A 1CLZH 2DM4A 5E08L 3ALPA 4ODUA 1OAYH 4O4YL 4F15C 2DOCA 3RL2A 4Y19E 1HSBB 3Q5OA 2EE6A 3TA3C 1WC7B 4GAGH 1ZXQA 1ZS8B 3OF6A 5BMFL 3QIBC 4Q9QL 1RZ7L 3O2VH 3DBXA 2MHAB 3IXAA 3TBWB 2B0SH 4Z77A 3ZSTA 3BQUB 2BFVL 3KJ4B 3WHXA 1T80A 4H5SB 4XAKD 4NZJA 1IEBA 3MOBL 1CICD 3QUKB 3D39B 1JE6A 3VFPA 5MEQA 1P9MC 3W0WB 4GBXB 3G5VB 1V3LA 1A1NB 3U48A 2EH7L 1EFQA 1VKXA 2VXUL 2YD6A 4NO5A 2J8OA 4L3AA 3SKNB 1F5WA 5DUBA 2XN9A 4CN4A 3QHTC 2EDQA 1ORSA 2EDLA 2DQTH 2HTKC 2Z93B 1P84J 2QR0A 3HNVH 3I9GH 5EUKB 3X12B 2AVGA 4PLNC 2AJZA 1XGTB 2H45A 2GJ6E 3IU4H 5EIQA 5CJOH 2HT2D 5C08B 3N9GH 4KROC 5I66A 2D4FA 2E9BA 3K80A 4R2GB 1T22A 3HE6D 3OPZH 2FGZA 1VDGA 3BIKB 5T3XH 1J1PL 1UWXH 3M17B 4M7JL 4EDXB 1TJIH 5EWIL 3N0PB 5MI0B 3IKCB 1KJMA 3NCBB 4LU5L 4PJ7A 3RVUC 3EYUH 2BOBA 4DCQB 5H35B 4LEOA 1IQDA 4BK4A 3SKMA 2UVEA 2ITCB 4JFOA 1RZKC 1NGZA 4LHUD 4JLRA 3DX9B 1H3TA 4M7KH 5DJXA 4I0PD 3U1SH 4WWKD 4JFED 2P46B 1MFEH 3CK0L 3AREC 5FA3B 5CEZL 1BJ1H 1O0VA 3DUUB 1FDLL 1MWAH 3C60B 1MCLA 2J4WL 3U0WL 5DD1H 2BRRH 3RNQA 1L6XA 4HMEA 5F44A 3LKQA 2FJGB 3VI4F 5DJDA 3WUZA 1T7XA 4Y5VC 5F7DB 3P73B 4HGWA 4U6YB 4P9MH 5GGVY 4WUUD 1DL7L 1A9EB 5BS0D 1MCSA 4AEIH 1IILE 3ABZA 1E4WL 3SCMA 4ODSL 4X8JA 3TBYB 3J7HA 4YGAB 5DSCA 2WUCL 5FGCE 4H25A 3M1BB 3WHE1 3P3YA 1G7JB 1OP3K 3O4OB 4RISL 1IZKA 4NKMB 3HR6A 3IU3A 2AJSL 1T03L 1KLUA 2VLRA 3FFCD 4R0LB 2C4XA 4JQXC 3S97C 1NBVH 3MRBB 1MVFA 3VGEA 5F7KC 2CIKB 4GW4B 4E0RA 3TN0B 1J88A 5KW9L 3MOAL 3LV3B 1D5MB 2AK4A 3C5ZB 5GGRA 3L95B 4WVRA 4G6FD 1IMHC 5IG7A 3S36H 4BZ2H 3VXOA 3ZDXF 3HI1A 3MUGA 5I8OH 3WFHB 4MJ5A 5C92A 1WLHA 3T0AA 4JFFB 1A7PH 2P24B 1J87A 3K0WA 3FQNA 1UKTA 4R7DA 4R4BB 3MV8B 3X13A 3B43A 3KPRD 3VXUE 1QR1A 3WFZA 1KCSL 4GKSA 4PRPB 3MLXH 1YMMB 4K7PX 5E1AA 3SGDI 3THMH 1R3KB 4F3FB 1S7QA 4P9HH 4KKCC 1Q8MA 4PJCE 4UV7L 2DI8A 1I75A 4JN1L 4LPWA 1KB9J 5GS0H 3BUYA 3UZQA 4Z8FL 2CXGA 1DVFB 3CFIC 1VCAA 3PWUA 1FG9C 2ZSWA 4HJGA 3CFKB 8FABA 3SDXE 4Y0GA 5FECB 3QUXD 5HI4D 4GKNB 5EA0L 1KLFA 3DSFL 2FWOA 3WUWB 2QKIB 4N5ED 1WFOA 1U8MA 1WT5C 1PSKH 4U05A 3QDAA 4M6NH 3RWGA 3JVGA 1JHKH 5EBLB 1MCPH 1LILA 3MV9A 4JRYD 4ZS7L 4TVPD 2C4FU 2YPVL 2X4UA 1J1OH 2WP3T 4OZFG 3OZ9L 2VC2L 1HQ4B 3QCVH 2OP4L 2NXYC 3CFJA 2OS7A 1SJHB 3BRGC 5BRZA 4KPHH 1CS6A 4OFIA 4KZDH 1HXMA 3DMMB 5ESQA 2AEWA 2DQEH 1CXLA 3Q6FA 2LAGB 4L9LA 1Q9WA 3HC4L 4CJ0A 25C8L 4A2LA 5DK2B 1AXSA 4ZYKB 5J12C 4JZJC 5D1QD 3T3ME 5H37G 3BSZH 3Q48A 1VGEL 4NWUL 4NC1E 4YHZL 3HR5A 4NNYA 4NKDB 5D2LB 5KVDL 4MJ4A 1B4RA 4WI3A 5FKPA 1JZ4A 1GGIL 1RJYB 1ZANL 1TVDA 5D1XD 3JUYA 1MCOH 2DBLH 2H6PB 4HULB 1ADQL 3KJ4C 1OAQH 2H8PA 1IT9H 4X6CF 2YS4A 3DGCR 3ZDYE 5D6DA 4KJQD 1FVCB 1T21A 2LE9A 4MNGE 2CO7B 3LQAH 4XVTH 3PWPE 2HT4D 3GEWB 1E27A 4JPVH 5MEPA 4JY5L 4GBXC 4OZGB 5I16B 5IHBA 4WHYH 1CGXA 3MO1A 1BVLA 1RFDH 2YRZA 5T1KB 4GG8B 3IDNA 3LDBB 4HXBL 1MHPL 1UJ3A 4Z7VE 3OXRA 2VLKB 4ZOAA 1KCVL 4U33A 4R8WL 1SBSL 3QUYB 4JGUA 3MLZH 1MWAB 3SDAD 3VMOA 1OT2A 1GGBH 4S10A 5FOBA 5E5MB 5IB5A 1YEGH 4AK1A 3JV6A 2HVKB 1VFBA 5ISZA 1BM3L 3BPCA 3MLTB 2QQLH 4ODWA 3CFDB 4QWWC 3AM8A 4QRSB 5ESAB 1D9KB 5AZ2H 4WV1A 3WFCH 3QISA 4HLJA 1NCBH 5K9QI 4F7PA 4MXWL 3IDUA 3MCLH 2V5SA 1RV6X 4I5BA 3G6JB 43C9A 5DRWA 2P8PA 1J8HA 5DQDL 2KL6A 1UCBL 4R2GC 4PJ5E 3TWCL 1V7ML 4YDJB 1P7HL 5DJ8A 1IAIH 4BH8A 3WIFB 3DX8B 1DLHA 5MI0C 4PRID 4AEEA 2VLMD 1EXUB 4OSUL 4CMMB 5H2BA 3EO9H 5KVFL 4NQED 3BT2L 2YXMA 5HI3C 4CN1A 4U1KB 3O8XD 5JHLL 4GRLA 1AGFB 1AGEA 1EX0A 2PR4L 5MP6H 4U1GB 1KTKE 4KQ4L 2P5EE 5HYEA 1HQRB 3ULVF 3C60C 5I1GH 5D7LD 5E94B 43CAB 4R7NA 1VGKA 3Q3GB 3T8XA 3SEPA 2EYTB 1FCGA 5E8NA 4OGXL 3VRIA 3JSSA 3CMOH 1OPGL 4X4XA 4LVHB 3KPLB 5C07E 5AUMB 2X1PA 1XGYL 1K8IA 4PJDE 4M61B 4YHIB 4YPGB 2AW2A 4QHNA 1WZ1L 4FTVA 4EN3B 5CSGA 1BQLL 3T3PF 4DKEH 1J0IA 4WEMB 2EYRA 4OCSH 3O4OC 3X3GL 1MEXL 3TCLA 2NX5D 3OKMA 4NFDA 4P4KA 1Q38A 4R0LC 2XNAB 1P4IL 4LCWA 3X14A 4W6XB 4LASL 4PJIE 2EXWC 1Q9LA 4XCFH 3TO4D 3PWVB 5GRVK 4AG4L 3TN0C 3UYOD 1L7IL 4O2FA 2NZ9D 1IARB 3C5ZC 5ILTH 5BW7A 4HV8B 4OCMC 4PS4L 4LSQH 4RIRA 1GZPA 2Z35B 5J13B 4GUPB 5I30L 1C7TA 5L2KD 4PR5A 4Z7WB 1TETL 3MV7D 1D6VL 2WQ8A 4JKPH 4R90H 5IMOA 3KPPA 2VO5A 5JHDE 2YWZA 1QSED 1QKZL 2W60B 3TZVD 5BJTB 3RKPA 4Y5XB 4QXTA 1DN0A 1RVFL 4G6ML 4FNLH 5C6WH 5KOMC 4LGRB 1OW0A 3O45A 1MCFA 4NJ9H 3LMJH 3P0YL 4HK0B 1LEKA 3QUZA 2GTZA 3U4BH 1QLRB 1Z6JT 4HS8L 2F54B 2DQDH 5GS1B 1GC1L 3HKFA 2UY6A 2X4PB 3UTPE 5EPMA 3ZZ1A 4EUPH 1DVFC 4YHKL 3TBVB 4O2CA 4NQUA 4MAYB 5ACMA 5GGVL 1YEEL 1QTYT 1VERA 3V6OC 4LOUD 4D0CB 1HOCA 3SY0B 4LGPB 4MNHB 4PFEA 5JDJA 3NACH 3RWCA 1FL6B 4NT6A 2Q6WA 2IADA 2OMNA 2R2EB 3WFBH 1FZKA 4YDVA 3FQUA 3LKSB 1N5AB 1CIUA 2YBRB 4K3DH 4XHQA 5FF6B 3ARDB 1NCTA 3NPSB 3O41A 3P0VL 4ZUSA 1IAIM 1LQSR 4KKAD 5DUPH 4D9QE 3B3IB 4YPJA 1JVKA 2Q86B 1JHTA 5IHZA 3PHOA 1W0VB 3OKOB 1RULL 2EDBA 3DMMC 2R0ZL 5GJTH 1FV1B 4F37F 2YD9A 3EZJB 4YGVB 4WU7B 1FNLA 2R1WA 3OR7B 5F88B 3ZE0F 1J0JA 4IRJA 3UO1H 3DGGB 3QXUA 4JDZB 3B6SA 1R24B 1S5IL 3QEQD 2X42A 1N0XL 4HK3J 1KGCD 5LVEA 2F19H 3BJLA 2X4SA 4D0DA 3FZUC 2M1KA 5IFAL 3V5DB 4OTXL 5IB2B 4I3RL 2E27H 3IDMB 1J5OL 3G5ZA 1T04B 4L8CB 4HKXB 1T7WA 1JF1B 2KKQA 2MPAL 2X4QA 3NCJL 5F1IB 1CDCA 4QHLA 5EFIA 4ZSOE 5GS3A 5GRXG 3RZCA 1AXTH 3D85B 4U0QB 3CFBA 1ZVYA 5F7EH 3O6LL 4G43B 3TIEA 3HG1B 4ZFOL 4G8EA 3FN9A 3LH2H 1EFXB 4IMKC 4TN9A 1SY6L 1CD8A 4F7CA 3VG0L 2FEEI 3RKDD 4U1HB 1YECH 4KQ3L 5JZ7C 3LDBC 3S88L 1NQBA 4EI5D 5LGJB 1CI5A 2BOCB 3QUYC 4NHUA 5ADPL 2J8HA 4P3DA 3SDDB 4F57H 5JOPE 5D7IF 4GJTB 1U8PB 4IEFB 5C0BB 5C2UB 4I2XB 4OGZA 3T2OA 2ZKHL 1CDBA 4Q74A 1D9KC 1S8DA 3MLVH 4AM0B 1PKQA 3GJEA 2P47B 4NOBA 2AJ3A 2XN9E 5C0RH 4XC1L 5AZEL 4OGAC 3VWJD 3DIFB 5JTWA 3DROB 2OK0L 3MNVA 1ZOXA 1FNSH 2R69L 3DO7B 32C2B 5FFLA 1ND0B 4PY8I 5DHVH 3WJLA 1RZJH 3SE3A 2H32H 1F90L 5JNYA 4ZFOA 1X3DA 2VL4A 1TVBA 3QEGH 5ERWA 3BZEA 5F1KC 4OM0H 4LNRB 4OD2A 2CRIA 1SY6A 3SOBL 5A40E 1JWSB 2XQBL 1Q72L 2V17L 2D7QA 5IHLB 1A3QA 3RWJA 1MAMH 2FL5B 4NRXB 5JMRA 3O6ML 4HUVA 3G04B 3EJJX 5E2UH 5DO2D 4LCYA 3WSQL 2XWTA 5D6CA 3UTSE 1RPQA 1A4KB 2ADIA 1HHIB 4JAMB 4U1GC 2OZ4A 4Y19D 4PJ7E 4BQ9A 4DKFH 5KTEH 3BHBB 3FRPG 2IBZY 2A83B 1AY1L 5CSBA 4EVNA 3ARWA 1YY8B 4KJYB 3MOQA 3KLAB 3E3QE 1OTTC 4F7EB 4XXDB 4H1LA 4Y4HD 1HI6A 3VJ6B 2QSTA 5I8CA 5F9OL 4HWNA 4TNVF 4HUUA 4P9HC 2DIBA 3O9WD 4MZ2A 5EO9B 5GS0C 4HZLA 4EN3C 6FABL 3QFJE 1AGCB 4FXGA 4HDIB 1NGYA 2Y07H 1T0NA 4B5EA 3KYOB 4EUPB 3GMOA 3EOBA 5B38B 1Q94B 1BF2A 2Y7QB 1OM3L 4RAUB 4ORGB 4BSJA 2X1WL 3MRIA 4JREB 4ODTH 5IVXF 3IDGB 4NKIH 1ULVA 1K4CB 1XR8A 4I4WB 3DWTA 3GUTA 2XZQL 4PJHF 3BAEL 1I8IA 2BSTA 5EU6E 5LAXB 1FFRA 4N1EA 1KBGL 4LAQL 2W9EL 1QEWB 3EOYG 3JUZA 2FJFA 4XRCA 2Z0BA 5TPWL 5IIEA 5J13C 4UDUA 3VFMB 2VLRE 1PKOA 1P2CA 1ED3B 1ETZB 1SJVA 4JGMA 4F37K 5DDHA 2GK0B 2GJ6D 1CGTA 4XPAL 1JGEA 4RMTA 5FYJD 3GNML 3RX8A 2YZ8A 2B39A 5FM5M 1PEZA 3MREB 3ZE2E 2AK4E 5CEZE 2A6KB 3I6GA 1K4DA 4Y5XC 1ZT4B 5SWZA 4U1LA 5FK9B 4NSKA 4ERSL 1VFAB 3U0PB 5E08H 3QRGL 3RTQD 1G1CA 2YPLD 1JRHI 2OTPA 4G3YL 2PTVA 3V52H 5I1DA 4HH8A 5GS1C 5INCB 3CLEL 1RD6A 2BJMH 1Z0NA 5DI8A 1RUQL 3BP4B 4MA7H 2ICWA 2W9LA 5BMFH 4LKXA 4MAYC 4Q9QH 2X89A 1XIWB 4HIEA 3UTZA 2EDTA 3GMRB 3MLYL 4IIQB 2HJFB 4D9LH 3FFDA 1Z5LA 1I7RA 4YHPA 5IW1B 1MNUL 3EYOB 3KJ6L 3K4AA 4QRRD 3MRDA 5DEFA 2YC1B 3LQAC 3QDHA 3QI9D 2C4FT 2ARJA 3ARDC 4BKLB 5F6HI 4LSTL 1W72H 4H26A 3VXMB 3NPSC 5DJ2A 2PCPB 2YZ1A 5IK3B 2BSED 4FQXB 2AXHA 2VXUH 1CDJA 5ETUA 5HHOA 3FQWA 3WHE0 3V2AR 2ADGA 1XF2A 4UNUA 1QBLL 3REWB 4AEFA 2W0FB 3MV9E 1P7QD 4AEHL 2BVEA 1BZ9A 5KVMC 2VN4A 4DUVA 2IAMB 5J1TC 1HSAA 1PQZA 4OZHF 5E95B 5ACZA 4CRPA 5F7NC 4PJ8D 3PNWB 5MENE 3DI2B 4WI4A 5BRZE 1WWCA 3FN0H 2FEDD 5CEYA 4NO2A 3U79A 5JQ6H 1ZTXH 3V5KA 3S35X 1GPOH 1NC4A 4FS0A 3BD5A 4FQ1H 1MHCA 5DHVB 3G08B 3HNTL 1LEIB 2J8UB 5DD5L 1VADB 1KTDA 1FRGL 1J1PH 4M7JH 5ANME 4G6AC 5EWIH 3CVIL 1TZGL 3BP7B 1KJ3L 4LU5H 4X5LA 2NLJA 4P4RB 1BX2A 4BK5A 1F58L 3VXUD 4QKXB 5E70A 2R9HD 5JPMB 1CDUA 4P2OA 1LHZA 3V7AE 1KXVC 1L7TL 3FT4B 3SKJL 4HMDA 5ITBL 1YEIH 4JRXD 3CK0H 3O6FB 3QUML 2EDHA 5JXED 1REIA 3FRPA 2J4WH 2DM3A 2MCPL 1I3RB 1SM3L 2VDNL 5D1ZA 1CT8A 2AKRB 2VXTL 3PWNB 4UT6H 5E99H 1OCWH 3G9VA 4JM4L 3F8UB 3S6CA 1KCKA 4PJ9C 5HYQB 3U4EB 2CMRH 4JM2D 5DJAA 4HAGA 2O5YL 5ISZE 5EBWB 3QNYA 3C5SA 4ODUB 5F71A 3T0BA 2VQ1B 4CVXB 2HRLA 4XNZB 2ED9A 2WUCH 2XY1A 5FUCE 1YA5A 1MJJA 1T0PB 4NQTA 4RISH 2VITB 3MUZ1 3W9EB 1P1ZB 4JO2L 5FKAA 3NCFB 3HE6B 3QQNA 1J8HE 1NGXA 3DBXB 2O93L 3KYKL 3V4VH 3VI3E 3IXAB 3S37H 3GSUA 4I13B 3QUMA 3WHXB 4OF7A 1NGPH 2KZWA 4YXLH 5IKCA 3DRTB 4YWGL 2VN7A 5IESH 5MEQB 4I0PB 4MLSA 3HUJB 2Y5EA 5E9DA 2NW2B 5JPNB 2Y1VA 1FBIL 3QJFA 1KB5L 4UTAL 2F58H 1T1WB 1LK2A 4NO5B 5DMYA 5IQ7H 4PJFB 4G8FB 1BP3B 3BZ4B 5DUBB 4IHOA 5FYLL 1EJOH 3PWLA 4NQCA 1ORSB 3T1WA 1C16A 4JN1H 3PWPD 5C3TA 2CGRL 4Z8FH 1KN2L 1QA9A 5FDWB 2YD1A 4WUUB 1MRFL 1B4JH 2AJZB 4I18C 1U6AH 5I73C 4MVBC 4ONOA 3FRUA 2VDKH 3ARGD 3MZGB 5IB3A 2ID5A 3RWEB 4QYOA 5EA0H 1N4XH 3L7EA 4M1CC 1E6JL 1RAMA 1T22B 1TQBB 1VEMA 3OB8A 3LKNA 1YEHH 4JFZH 2HN7A 4AIXA 1W72B 1KNOA 2JB6A 3P0GB 5L9DH 4IDJH 3FB7A 5GGSA 3KGRA 1KJMB 1MLCB 1XCTB 4JY4A 4ZFGH 2YPVH 1PGRB 2BOBB 4K07A 3OZ9H 2JCCE 2VC2H 4LEOB 3SKMB 1KB5A 5K33A 4G6FB 4JFOB 3B5HA 4POZC 1A6AA 1QFOA 2V7NA 4PJ5D 5DJXB 3D3VD 1F3JA 2XKNA 2X4TA 3LB6C 3BEVA 3T4YA 1MUJA 3SO3C 3TESA 1ZHLB 4QRTB 1D5IL 1RIHL 3PQYA 4OCWL 4XBEL 2WM0A 1RUPL 3VD4A 2VDRH 1FIGL 1X5XA 1WEJL 3PP3H 4P5KA 3RNQB 1EAPB 3LKQB 1XIWC 4NWUH 4YHZH 1ITBB 1S9YA 4IIQC 1CQYA 3R06A 3SGKC 1TQCB 5SX4H 3QCTL 4P2RA 1ZANH 4K23L 2P5ED 3GMQA 1OP5H 3SCMB 4X8JB 3O3UN 4PTUA 3QPQD 4LMQI 4WY7L 3TT3H 4JQVC 5HHPA 4OT1L 4H25B 1K85A 4E41A 2XZZA 1VA9A 3QT2A 4JY5H 1U41A 1KLUB 4C56E 5JXAL 4HPYL 2WSKA 5CP3H 4XVSL 4S1DD 4FQXC 1BMGA 3BPNB 3IFPB 5C07D 3VXRA 1BAFH 2AABL 3ZLQC 3MYZA 4E0RB 4X7EC 3QJHA 5JIHA 1WF5A 3VU2A 5IT2L 3BKML 3O2DL 3P9MB 3RJDA 2AV1B 3S96B 5GGRB 2F5AH 1NAKH 4M5YL 5FGRA 5E03A 4R4FL 2IAMC 1IGJA 4OI8A 3HI1B 1U91A 1BM3H 3CSGA 4R3SA 5LJYH 4MJ5B 1K9TA 2RBLA 1DUZB 3HZKB 5EULV 5ICXA 2E7LA 4PGBB 4FQPA 3FQNB 4R7DB 4X7SL 1YEDA 3W9DA 4WI2A 3X13B 1PG7X 1QR1B 4MXWH 3RDTD 3NCCB 5HDLA 4YNYA 2R2CA 3BH8B 2C1OB 2MQCA 3M8OL 4GKSB 1RZJC 1ZLWH 5HYSB 3C5JA 5AAMA 2ENYA 1K6QL 5E1AB 2YEZA 3BW9B 1A1MB 2RCSL 1S7QB 2R2HA 1ACYL 2JELL 4YE4L 2B1AL 5ID1B 1I7UA 3TH2T 3MRMA 3BUYB 5DA4A 3CFCH 4YDKL 3PWUB 3EOTL 2C7UB 5JHDD 4OSUH 3ES6B 4M02A 5EO0A 3ISWA 3SDCB 3DX6A 4HFWB 4HJGB 4AENA 3D2UD 4Y4FD 2FATL 2DJ4A 3GHBL 3O2DA 1S7UA 5B3NA 1DLFH 2GFBA 1TJHL 3OJDA 4JDVB 1MF2H 4W6WB 1AJ7L 4XHJD 3O6FC 4F7MA 3RWGB 1G7LA 3UTPD 1G7IB 4YUEL 3QDJD 5J3HD 2AJVL 4GRWH 1ES0A 1U3YA 4J6RL 5LGHL 2PYEB 1KIQB 2MFNA 4J2XA 1KXQE 2X4UB 1R3JA 2DWEB 3V6FB 3PJSA 5DURD 3H0TA 1CFQA 2J6EA 4HUWA 4JO1H 4OGXH 2J88H 4OZFH 1U8JA 1X5YA 4KAQH 3DLQR 5EZJA 5IGXL 3RPIA 2DQJL 3BRFA 1JYVA 5ESQB 3HPLA 3AMLA 1A3LL 4OAWB 1LE5A 1ZT1A 5CSZA 4OBRA 3UPRA 4XNZC 4YHNA 1BQLH 4QF1A 1KULA 4YHYC 4D9QD 5H37H 4JG0H 4EIGB 4NNYB 5IW6A 4X5WA 3DTXB 2QSQA 1SJEB 5FKPB 4POUB 4KV5F 3VFVA 5KBNC 1F45A 4EI6B 2H8PB 4UINL 2I24N 1J9CT 4HXAH 1CTOA 5D71H 3TV3L 2F53A 4LLUB 3RWFA 4NJAL 4NQEB 5D5MF 3TYFB 4IOFC 1RZIB 2EIDA 1E27B 1QR4A 4LLVA 3PE9A 4FA8A 3MO1B 1E0OB 2ZOKA 1QKZH 4MXVF 7FABL 1S7WA 3IDNB 5EU4A 4HC1L 4JHZA 1RVFH 4G6MH 4KFZC 5IVZA 4RBPH 4TSAH 4X6FA 4KUZL 1L9MA 4P59H 2JIXD 3P0YH 3QCUH 1MHHA 4D9RD 5I1CL 4HS8H 5FOBB 5I8EA 5D2NA 2MJWA 1RK0A 5DJZA 1GC1H 2DKSA 4OF8A 3GMNA 3BPCB 3IYLW 4I9WE 4DZBA 1IGFH 2GT9A 1MY7A 4V1DE 5GGVH 5HGAA 5HD8C 2HLAB 3SE8L 4PJGF 2YUWA 4F7PB 1YEEH 1CBVL 4ELKA 4I5BB 4TUOA 3BOVA 5DRWB 2D03H 2A1WL 1TQBC 4GSDL 1H8SA 2YD2A 4WI7A 12E8H 1HHHA 3IT8D 1DLHB 5EOQL 4ZXBD 1OGAA 3BDXA 1KPVB 2DQHH 4P2CG 4Q9RL 4U0RB 3RWIA 1BFTA 1SEQL 2XN9D 5H2BB 4N0UE 1GZQB 3PL6A 5CS7A 4HC1A 2G9HA 1NFKA 4UU9B 2FH8A 3MV7B 4LLMA 4M43L 1N64L 3O3AA 4N1CA 4PJEF 4GG6F 4XPHH 4P2YA 5E2VL 5J11C 1S5IH 5CGYC 1N0XH 4PRHA 4G8GA 1JCKA 1G9ML 2DLHA 3I2CL 4R7NB 4J3SA 1GOFA 3WN5A 2O5ZL 3HPJB 1VGKB 1LMKA 2PW1B 2ZCKH 2ICEB 4UIKL 3V0WL 4ALAL 5E8NB 3VRIB 4Q6IA 1JI2A 1TQCC 1AP2B 3UTSD 5B3JE 3KPNB 4TQEH 1X7QA 3NCJH 1E4JA 3SCMC 2NY3D 1K8IB 5KSVA 3S5LG 2CLRB 4FTVB 4Y4KA 3NZHL 4NZTH 3TO2A 2O5XL 2VL5A 2DM2A 3OKMB 4I77H 3L9RB 1IGCL 4LCWB 3X14B 4KI5F 4XNQB 1OTUD 5JLZB 1HYRC 2XWBB 3VRLF 1CFSA 2C1PA 3W39B 5ICYA 3S88H 3T2NL 4O2FB 5KVGL 4ZODA 5SWQB 1CFVL 3F12B 3QFJD 4RIRB 1GZPB 3CDCA 4GRWB 1XFPA 1OL0A 2NY2D 3UTQB 2OZ4H 4PR5B 5E6YA 5GPRA 1WITA 3VGGA 1IEAA 1YUHB 1Y18A 4YH6A 3KPPB 2MWCA 2VSCA 4OZFB 2LABA 4RQQA 2DB8A 5DMGC 5AZEH 1A4JA 3FQTA 3FKUS 3BXNA 1DN0B 2YN5A 3GK8H 1HILB 2WAHA 4NQXA 5EU6D 5TE6L 4ZFFA 1P5UA 2R69H 1AO7A 3O45B 1HZHL 3VWKD 2E7CA 4RNRA 2VLRD 2LAAA 1F90H 5ICZA 3P4OA 2A6DA 2DQUL 3BH9B 3SDCC 3DVNB 4E42A 1V8HA 5CEZD 1UA6H 2UUDK 4BSWA 1R5WB 1B88A 3JTSB 3G6AA 4OBSA 1HOCB 3FOLA 2G75A 1MHEA 4ZNEE 4RSVA 4XMPL 3HS0A 4JJHA 2BNQE 4NT6B 3T77A 3WFDL 1OWWA 1I85A 1HCFX 3ARYA 3MBXH 2CH8A 1KG0B 3JVGC 4JN2A 4Z7NE 3RGVA 3T1FA 3B9VA 1AY1H 3WS3B 5FM4A 3PGFH 4LFHD 2FBJL 4RGNE 1RUAL 1QO3A 3MRFA 1YYMH 3LIZH 4WGVB 1CDGA 3MRHA 5DQJA 3RX7A 3VGBA 1JHTB 4OF3A 5F9OH 3ARFD 4G7VL 5FV2A 3RAJL 3GO1L 1CFBA 3RUGE 5DR5H 4MA1B 5KS9E 1PAMA 1KIPA 3LKRA 1S7TA 3B6SB 1MCJA 3RPKA 1Z2KA 5DJYB 4D0DB 1CF8H 2VKWA 4ODXA 1UWGL 1YC7A 1MELA 3G5ZB 3QO0A 1G9NL 4Z7OE 1C12B 3CSBA 2X4QB 3DVGA 2XZQH 3BAEH 3MV9D 4G7YH 3V5HB 4PJXE 3MMEA 5EFIB 2ZPKL 2EKJA 1AKJA 5D6DC 3CFBB 3B9AA 4KUCD 1NMAL 3TIEB 5MEND 1DTUA 1CDYA 2Z8WC 3V9FA 4ZO8A 4XPAH 4F7CB 3MTRA 4GXUM 3GNMH 2NTSP 3HMXA 4DW2L 1JGUL 3O3DA 5F7YC 1S7VB 1UJ3C 5JA8B 2VERN 4CDHA 3X3FL 1V05A 3FT3A 4PJBE 2QBWA 2RB8A 1U8QA 4NHUB 5DD3L 1A7QL 4RWHA 2EDEA 2VDPL 4DN3L 2VDLL 3OWEA 4PYHA 2IGFH 5E9DE 3U30C 1HKFA 3N1MC 5HI5C 1RUQH 1NFDF 2OQJA 1NPUA 1F8TH 1KIRB 2B5IC 4WV1C 1FN4A 1PKQB 4KDTA 3MR9A 2P42B 1WFUA 5JO5A 3ROLA 1YDPA 4L4VE 4TTDD 3MNVB 4NQCE 2QHLA 1J05B 1YNTB 3PHQA 2R0LL 4HX1B 4Y16A 3GZKA 1JI1A 4LF3A 5F96L 1X44A 3KJ6H 1K3ZA 5TGBA 5LQBL 3QH3A 1E4KA 4GXUN 4PGCA 1TVBB 2IBBA 3RL1B 4HJ0D 1DP0A 5ERWB 3BZFA 3I6LE 4U0RC 3VD3A 1FL3B 3WXVL 1T4KB 4NM4L 3B9KA 4HUVB 5F21B 1V7NL 5CZXD 4JFHD 2EIEA 4NPYB 3BKYL 4NUJA 4LCYB 3TBTB 1BGXL 4O5LH 4XNXL 2BVOB 1MVUB 5ISZD 4WHCA 3P11L 1MH5A 4NRYA 2P49B 4WENB 4GRLC 4RGMB 2ADIB 1LWRA 1RSFA 1QBLH 1A2YB 5C0AB 4AEHH 3K74B 3TC9A 3NABH 3RGHA 4EVNB 1LEGB 2HWZL 4QY8A 2F8VA 1X5IA 1FHGA 3B4NA 3LHPL 5GGQH 2WBJA 4HGKC 5LCVL 3QHFL 1R0AH 1P7KA 5FYLE 1FVEA 4H0GA 2YPLB 2CUMA 3VXPA 1HI6B 5I8CB 1BFVH 3GMPA 3IFLL 1U8KA 3PQYE 1QSFA 1G6VK 4ZUWB 5IHUL 1HYSD 3HNTH 5DD5H 2Y6SD 2YK1H 4HZLB 3QIUD 3MFGB 4APQA 4E5XA 1T0NB 3KR3L 3GMOB 2N7BA 3CVIH 1UH2A 1TZGH 4FHBD 1IGYA 2Q8AL 3T0EA 4NBXB 1KJ3H 3F7YB 3W82A 1NSNL 2XT1B 2QJDA 2FB4H 3C9NB 4QRRB 1YYLL 5SX4I 2DICA 2ZZUT 1AI1L 1UEYA 4OFKA 4F9LA 5IWLA 4E41E 2BSTB 4CU8A 5BW7C 2I07A 1U58A 3LEYH 3R1GH 4XRCB 4XTRC 5IBTH 1QLEH 1O5DT 1UH3A 2NY4C 1SM3H 2VDNH 5DDHB 2VXTH 3EYQC 3VXRE 3WKML 1JGEB 2JKXA 2FR4A 3U6RB 3I6GB 1K4DB 1JUFA 4Z7UA 1JGDA 3P4MB 4X4YA 5SWZB 4U1LB 2I9LB 4JFDD 2O5YH 4NSKB 2F8XC 1OW0C 3O4LE 5D7JA 4ELME 4LHQB 4MB5A 3AAZB 4P4KD 5TQ0L 5I1DB 1RU9L 2ATKA 1J18A 4HIHA 4JANA 3TNNA 5SX5H 1F00I 4NCC1 2HT3C 5DJ6A 2ICWB 3ULVH 1R3HB 5E5RB 5F7WC 1LDPH 3R4DA 4ELMF 4LKXB 4JR9L 4JO2H 1G6RL 4HIEB 4LPTA 4JZNB 3UTZB 3CVHL 5HPMA 1QRNE 1T2QL 4K94L 4ZO7A 1BD2A 3FFDB 1Z5LB 3P30H 1I7RB 3EGSA 1V3MA 1IEHA 2V9RA 1TZIB 4ZQKA 4POYA 2XKUA 3BJ91 4M93B 4QGTA 3OSKA 2EEBA 5IQ9B 4IRSA 5DUML 4RWYL 4HKZA 1NAMH 1JWUA 4FZ8H 1CLYL 5EB9A 4JRXB 4Z5RA 1A9BA 1FBIH 1EVUA 3QUZD 4WGWB 2W59A 1KB5H 4MXQD 4NHCH 5ETUB 2AK1L 5HHOB 3FQWB 1G9EA 9CGTA 2VJXA 1XF2B 1FYTA 4J1UA 1UVQA 3EIFA 2PETA 4YBQD 3KPSE 1GC1C 3QQ4A 4MA1C 1ZA3B 1BZ9B 4ODVH 5IJVA 3C6SB 4YX2L 2QSCL 3FO0L 1F3RB 1A7OL 1PQZB 4G9FA 5D70H 5ACZB 2PTTB 1G6RA 1MRFH 1CGSL 4C56D 3CVHA 2LQRA 4NO2B 1K2DB 4OIAA 5CGMA 2BNUB 3H42L 4NKOB 3V5KB 1NC4B 3UJTH 2M26A 4U7KA 5HHMB 4ONHA 4PV8A 1TDQA 1E6JH 3WV0A 3ARBA 4JFXA 4NWTH 4RGOL 4PRAA 5JR1H 3TA3A 3GMMB 4URTB 4G6JL 2ADJB 1H0DA 2VXSH 4N8PA 3TYGL 1HINL 5TH2A 2P5WE 4H8WL 3QIBA 4LPUA 1ZGLP 3EO1B 2NY6C 4HCRA 3LVEA 3VMPA 1V3KA 1JNHB 1Q0YH 1EJ6A 2WBWB 2VH5L 1Y6KR 1IAOA 5JORA 4IRJD 1Z3GH 4X9BA 5I2IB 2BSRA 2DQCL 2VQTA 4P23A 4XP1H 1EH9A 5IBLC 4M3KB 2OJZL 3G5XA 3OKKA 5CJXA 2OL3L 5AYUH 3GHEL 3DVFA 5FAAA 4X6CB 1MCWW 5M95B 4KU1A 5FEBA 5FA4A 1XR9A 1XF5B 1INEL 5K9QG 3H7BB 5D5MA 1I3GL 1P9MA 1WEJH 5D1ZB 1CT8B 4M7LL 4YDIL 2CD0A 3EYSL 1OHQA 3OAZK 3WNNA 3LZFL 3NH7H 3RZCD 1UXWA 3KWWA 1RZKL 3V8OA 1SEBA 4Q9BA 5DJAB 4K23H 5D2NE 1K5NA 3S9DB 3RX5A 1CLOH 5T1LB 2QADB 3C5SB 3WJLC 4NN6B 5IP4A 1AHWA 3CXDH 5ADOH 5L6YH 1MJJB 3A6BL 4Y8DC 1J86A 1I9RH 2W0KA 5FKAB 5BVPL 4PPTA 5KSAD 5JXAH 4XVSH 3MYJA 4PJGA 4JHAL 3L3HB 2PO6A 1FAIL 2OL3A 4RGMC 4JY6A 3GSUB 1I4FA 5E5UB 5IT2H 3BKMH 3O2DH 4S1RL 1BJ1J 4PBVC 4CVUA 1TIUA 1PDKA 1U95A 4R4FH 2UYLB 5IKCB 5SWSD 5TE7H 3P9WB 3QEUB 4Z18A 1PX4A 3O6KL 3FN3A 1ZE3C 1FNGB 3D3VB 4XZUB 4X7SH 5EUOE 5LGKA 3QJFB 2V2WA 2J6EH 3EJYD 1RZFL 4HQQL 1LNUB 4Z0BL 2Y06H 4IHOB 4PRHE 4G8GE 2RCSH 3PWLB 1ACYH 1MQKH 2B1AH 5TDOA 3IGAA 1C16B 5EU3B 4L9DA 3BVNB 3KLHC 4WIQA 2AERT 2DN7A 2DLIA 5IB3B 3BWUC 3HE7A 2J7LA 3JV5A 5FUOL 2FATH 1NGQH 4QYOB 3GHBH 3MJ8A 5IR1B 3L7EB 3TPUB 2EYSA 4OF6A 3G6DL 3ETBF 4AL8H 4I9WD 4NO0B 1B2WH 4YUEH 1ZVHA 4RFEA 1WUNT 1ZHNB 3FB7B 3BO8A 1NAMB 4OJFL 4J4PC 4V1DD 4XB8A 3VXSA 1A5FL 4MJIB 4UIMA 1U3JA 5AD0B 1NDGA 2X7LB 5DA0B 3V6ZA 4YO0B 1A6AB 3L5XL 3LKPB 5F9JA 2VB5A 2V7NB 5B39G 1UJTA 3KXFA 4UT9L 2XKNB 4NP4H 1MSPA 1A3LH 3WIIH 1EHNA 1S9KC 3DV4A 1CZ8H 1MUJB 1A6ZB 4H0IA 2H3NA 2WINA 4P5KB 1EHXA 1E6OL 2NTFA 4YBHA 4GAJL 5A2FA 3QG6B 2P4AB 3MGAA 4LLQB 5BOZG 2FECI 5B8CB 2I27N 4X0KB 4ETQA 1AO7E 1LO2L 1U0QA 3R06B 1YQVL 5JMOC 1DQDL 4P2RB 4PV9A 2GSIA 3REVA 4RFOH 5I8KL 1XZ0A 2IPTL 5DQ9A 3MJ7A 3TV3H 1IBGL 5HHPB 4M93C 4NJAH 3L7FA 1J1XH 4OV5A 4U3HA 4R96A 2HRPL 5T3ZH 1BZQK 4PLJC 2H9GB 1CVSC 3QXAA 3VFNB 5KSUB 1WJ3A 7FABH 1E28A 3QDJB 4HF5L 1XF4B 1QBML 5JW5A 1WZLA 2DQGL 3ZKNC 2EH8L 5FYKL 1P69B 2OBGA 2BCKA 4KI5D 3O3EB 1X5ZA 2X89D 4JE4B 5HY9A 2XG5A 1RZGB 2HAZA 2KH2B 4N90E 4P2QB 3PP4H 2PXYB 3PABA 2NCMA 1U2CA 5E7FA 2HJKA 4HG4J 4MHHI 5TQ2H 4YLQT 4UNVA 3QA3A 1DQLL 1CBVH 2BHZA 1BEYL 2Y25A 2A1WH 2VR5A 2A6JB 4JCMA 4NQDE 2YOCA 2AXJA 3SJVA 3BMWA 5DTFA 1F2QA 5EO0B 4B53A 2E7HA 1D3CA 3DX6B 2MHAA 3EDDA 1QFPA 5E00A 3D0LA 3BQUA 1KELH 3QDGA 1G7PB 4H5SA 1MJ8L 4M43H 2EDJA 3ZE1E 1NBZB 2GSGB 2ZUTA 3OJDB 3ULUF 1FZOA 4JDTH 5ALCL 1OLLA 2FX7L 1G7LB 2IANA 2IC2A 4X9GA 1DBML 3QUKA 2VZ1A 3D39A 5EBMB 5D1ZC 3I2CH 4GBXA 2O5ZH 5I1IH 4OLXL 1A1NA 2ZSVA 3PJSB 2FX9L 4ALAH 3H0TB 4HUWB 3VD5A 5D4QA 1U8JB 1MFAL 5EZJB 3RPIB 2BNQD 3SKNA 3D0VA 2MQ3A 3HPLB 2QADC 3NGBB 2Z93A 1AFVH 1MRCL 1EEZB 3UPRB 5EUKA 1BJ8A 3X12A 5D7IB 2IH3B 4YHNB 4BZYA 1U8IB 4RGND 4G8IA 1XF3A 1XGTA 4P2OD 5CLWA 2LVCA 1C5DB 1D5XA 4KC3B 1F6AA 2YMXH 1EEQA 1RURL 3H7LA 4X5WB 5C08A 3W11D 1A6PA 4MNQD 2BP3A 3VFVB 3T2NH 1EIBA 4P0DA 5KVGH 2PF6A 4OD1H 3BIKA 2HVJA 4FQCL 4EDXA 2F53B 2XACC 3RWFB 5BVJB 1DBAL 3F7VB 3IKCA 4ZG1A 1EZVX 1MFBL 4TYUA 3UBXG 4N9GA 1PVHA 1UM6L 4S1SL 5H35A 1OVZA 4LLVB 3Q1SH 1DQQB 1NC2D 1QG3A 3AGVA 5AWNH 3ARZA 1TXKA 5B39A 1O7SA 2LFGA 3RVTD 3DUUA 1QLFA 3KPOA 2Q7YA 1MI5B 2VZ3A 3QIWB 1H8OA 3IXTB 1PLGL 1B9ZA 1WWBX 4NBYB 3ULVC 3GMNB 1N6VA 3H9HB 3BX7C 4U6VL 4ZUTB 3ZYIA 5ALBL 3UC0H 5EU7E 4XI5C 2GT9B 3DETD 4Z7QF 5HGAB 5C0DB 1QFWH 2ZCLL 1A9EA 1CLZL 4ELKB 2X40A 2W07A 5DMKA 4TUOB 4XMPH 2SEBA 5DZOA 4J3OC 2H26A 4Q0XL 3T0EE 2UZIL 4L4JA 3M1BA 4N0CD 5E9DD 3UYPA 2X1XR 4MWFA 4HWZB 4NKMA 5DMJB 1OGAB 5T1MA 3L3JA 4R0LA 2YUZA 3O2VL 3PL6B 3UTTE 4L4VD 5EZLB 5IVXB 4GW4A 2ZUSA 3HMXH 1CE6A 4F58L 1I1CA 2B0SL 4G7VH 1GHFH 2F5BL 1D5MA 2AQ3A 3LV3A 3RAJH 3C5ZA 4PJHB 3GO1H 4XAWL 4Y5YA 5GRJH 3O3AB 4YQXL 4TOYH 1UZ8B 1LO4L 2V7HB 5HYJD 1C5BL 3I6LD 5TDNA 1A6VL 3MSPA 2EXYD 2P24A 2UWEF 3V8CA 4MD0A 4Z7UE 2X4OB 4Y2DD 3FQXA 3DYPA 4FFYL 4Q6IB 5HHQB 1G9NH 3UPCA 4EKXA 3JWDH 3KYNA 3ECBB 4NYLB 3SKUD 2OM5A 3GI8L 4F3FA 4W4NA 3GBML 2ZPKH 5KSVB 3HNVL 3I9GL 1S9WB 4Y4KB 1BBDH 3HLAB 5CJQH 4KHXH 3VE0B 4CJ1A 1NMAH 4DN4H 1AIFB 3TO2B 2VL5B 5I1AA 4U6HB 4YBLB 5EOCH 3CFKA 5FYLD 3IU4L 5FECA 1YNLH 3N9GL 1CFSB 4PYGA 3WUWA 5ICYB 2ZJSH 3PQYD 2QKIA 1GGYA 3X3FH 3OPZL 1C7SA 3E8UL 5T3XL 4XP4H 1U3HA 5AAWA 1A7QH 4O51B 2HFFB 3VFTA 2D7NA 2VDLH 4KRPD 3EYUL 2V9TA 2PXYC 4KKNA 4UV4H 2E7LC 1A6UL 3GB7A 1JIBA 2VABA 5HPOA 1N3NB 2FDBP 1SJHA 1FYTE 4KJPD 4M7KL 2IPUK 3FQTB 4E41D 4ZFFB 1X5HA 1XCQA 3IJYA 3U1SL 1XGQA 1UB6B 2DQIL 1FORH 2A73B 1MFEL 2R0LH 4G9FE 1I1AA 5F96H 2VLLB 5LQBH 1MWAL 3VXNB 3VA2C 5DK2A 2GJZB 4ZYKA 5DD1L 4XX1G 2CQVA 1MCEA 4A2MA 3OJ2C 3P4OB 4OZHB 3VXRD 3NTCL 4QOKA 5FCSH 5HGBA 5CJ5A 2ARWA 1YNKL 5D2LA 3MJ9H 3PHSA 4BQ8A 4E42B 3MC0A 1U8HB 1RJYA 1V7NH 4P9ML 3VMNA 2A0LD 1S5HA 5IROC 3FOLB 4AEIL 1BGXH 5JDSA 1I7TA 3O4LD 3P11H 1F4WH 5I15H 3INUH 3IDIA 1QFWM 2NXZB 3I6KA 2QQKH 4JN2B 2R1XB 4NN7C 1JNNL 5DF0A 1KENL 1TTGA 4OZGA 4LLYB 1UH4A 3LHPH 2XQYK 1NBVL 3VA6A 1QRND 5LCVH 5T1KA 1QO3B 3MRFB 4J3UA 1YJDH 3MRHB 3JZ7A 5DQJB 1ZK9A 3IFLH 1JRHL 3NGBC 1D7FA 2I5YH 4HUNB 5IHUH 3S36L 3S3JA 2DMBA 4BZ2L 5I8OL 4AJ0A 2I60H 3ARSA 3LKRB 5T5NF 3CFDA 2ED8A 5F7FA 2Q8AH 5ESAA 1D9KA 1A7PL 5B4MC 1YPZE 1RIUH 4LQFH 1BBJB 3UMTA 2Y23A 4LLWB 3DVGB 3THML 3MRRB 3KPSD 3RA7H 3L3GB 3MMEB 2E5EA 4L3EB 4KK8C 1N5YL 4JFYA 3WIFA 3DX8A 5I1JH 5C0FA 5TF0A 2A38A 3ZDZF 4K71B 3KNBB 3U2SA 4FQQB 4BFGA 1EXUA 1BFOA 3AFLA 3N1QC 5BQ7A 5TE4H 1CK0H 5GRZA 3WKMH 4GH7B 3RVXC 5HDBF 4U1KA 2C3XA 4QNPF 3A6CH 1WFTA 3GSWB 3CAFA 1ZT7A 5HVFB 2NZIA 1PSKL 2W1NA 5FO8A 3UDWA 1U8QB 3QWRA 1BECA 1JHKL 1T66D 1MCPL 3QIWC 5D2NC 3OMZA 43CAA 5E94A 1C08A 2P5WD 1WWWX 3HAEG 1J1OL 2OQJB 4M00A 3AU1B 4JVWA 4CBPA 4RZCA 3QCVL 1G6RH 3IS1X 2JTDA 3MR9B 4MMZC 1TMCB 2XFXB 4KPHL 3CVHH 1LD9B 1YDPB 1T2QH 3KPLA 4K94H 5AUMA 4KZDL 5DFVD 2HFTA 2RHEA 4AT6A 4K8RD 4M61A 4Y16B 4YHIA 2NY1C 3FB6B 3C09B 5TGBB 3S5LB 2K7PA 4PGCB 4BUHA 2CSPA 4WTWA 5DUMH 3BSZL 2EDDA 4KK9D 4RWYH 1JGVH 2XNAA 3RI5F 3B9KB 4HCRH 3PL6C 3LQMA 3PWVA 1YN6B 4NUJB 3I84A 3LSOB 2DBLL 5IB1B 2AK1H 4ZPVA 1CL7I 2QQQA 4OLUH 1W0YT 3VFUB 1N6QL 4Z7WA 2QSCH 4XVTL 1T20B 2D9CA 3VXSE 4QY8B 4JPVL 1IGIL 4JQIL 3TVMA 5F3BB 3WN5C 4JFDB 1IAKA 2XXCB 4LKCB 2R8SH 1L6ZA 2W60A 3W81A 4Q6IC 5BJTA 3VXPB 2BVUA 3H42H 4YHLL 5FB8A 1SQ2N 4MQXD 1JHLH 3LQZB 1QSFB 5HJ3A 1IC1A 1QLRA 1AD0B 1GGBL 2F54A 1Z9LA 4KTEL 3L3DB 1I9IH 5GS1A 1F11B 2EZ0C 4Y4KC 3MV01 4APQB 3CSPA 4E5XB 2QQLL 4G6JH 3TYGH 2X05A 3MBEB 3OHXA 4DEPB 4H8WH 4YBLC 5C0EB 3HB3C 5I74B 1CDIA 2VH5H 4CU7A 2VLJD 3MA7A 3D87B 4U49A 4X7TB 5HHVL 5E6IB 1N8ZB 3L3KA 5CZKA 1FL6A 1JTOA 2DQCH 4TSBH 3STZA 4G8GD 2D7TH 2R2EA 2OJZH 1IAIL 4ZS6D 2ESVA 2OL3H 5D8JH 2R4RL 2WWMC 2YBRA 5C6PB 5FF6A 4BFEA 5A3ID 3ARDA 1INEH 1ZSDB 5JW4M 3FAWA 1FE8H 15C8L 5K9OA 1EVTC 4M7LH 3EO9L 4XCEB 3PDGA 4FFWD 4NZRL 1FGNH 3B3IA 5IEHA 2RJMA 1NFIB 2FR4B 1W0VA 3OKOA 4RAHA 1JUFB 2E8YA 1JGDB 2N4IA 4XP6H 5MP6L 4JCLA 4YGVA 1BVKA 2ARJQ 4LSDA 3OR7A 4WU7A 5F88A 4D94A 1MY5A 4LIQH 2O61A 3UX9B 3DGGA 3QDMA 4JDZA 5I1GL 2ATKB 4HIHB 3A6OA 2OTWB 3A6BH 5CLTA 1IGTA 4NRZB 5IB2A 3IDMA 3CMOL 4L8CA 4HKXA 3BP5A 2XA8L 4J8RB 4YC2B 5E4EB 1BD2B 5I6XB 5F1IA 2P1YA 2CDFB 5IM7B 4BELD 3U36A 5DT1H 5EORH 5JW4N 3IDJB 2RR3A 3D85A 4ZQKB 2NXZC 3GIZH 4LSUH 3H9YA 4IS6A 4DKEL 2A9ML 4G43A 3HG1A 2CR6A 1SMAA 4IRSB 3O6KH 4IBLT 4X4ZA 4IM8A 3HC3H 3SO5A 2EIBA 4BA8A 3C6LD 1AO7D 4U1HA 1CXIA 5FYKE 4XCFL 4U2YA 1A9BB 2EECA 4WNQB 1MOEA 2BOCA 3MODH 2FRGP 4J1UB 3SDDA 4LSQL 3D39E 5CJBA 3QQ4B 3W0WE 4RCAA 3K8LA 5C0BA 5EC2A 5F9WB 3SE9H 4UZGA 2PUQT 4I2XA 5IJVB 4ODBD 1WBYA 4YDLC 4R4ND 3MCKB 5C3LD 3DXAD 4HLZG 1SYVA 1BJMA 3G5YA 1G6RB 3QQ9C 3Q6GH 3RIFF 2IEPA 3CX5J 3CVHB 3DIFA 4Q9CA 2YA1A 3L5IA 3NBNA 4CAGA 3N50A 5FUOH 3RGVD 32C2A 1ND0A 4NJ9L 5DLMH 3NIDE 1UZ6E 4PV8B 5K59E 3U4BL 5J7CC 5D72H 1A6TA 3ARBB 4JFXB 3CC5A 3NIFF 3EFFB 4LPXA 4PRAB 1MFCL 4LNRA 4N90D 3EJZC 3HNSL 5E6ZA 1H0DB 2XOTA 4KDVA 2CJUL 5TH2B 3TM6A 2DJUA 5C08E 2FL5A 4NRXA 5F7LB 1UYWL 1WIUA 2FNBA 1CLCA 1A5FH 3C2AH 4P57A 3UCRA 4QTHA 5SWSB 3FMGH 1KCUH 2ZWLT 1A4KA 4P23B 3HC0B 4JAMA 3OKKB 2B1HH 3G5XB 1MJUH 3QYCA 4UT9H 5DYOB 5HGGS 4NQDD 4QO1A 1VEOA 3BHBA 2A83A 4K3DL 3GM8A 5C6TH 1BQUA 1XR9B 1YY8A 2D31B 2PW2B 3EHBD 2YHGA 3SHSA 4F7EA 5D5MB 1YY9C 4M48H 1BQHG 5CHNA 3CUPB 4GAJH 4UBDD 2CDEB 1HXYA 4H88H 4KDTC 3VJ6A 1G9NC 3X11A 1UXWB 5D7KE 1AKJD 3JWDC 1YQVH 1NUDA 1DQDH 4Z9KB 1SEBB 1GH7A 1GOHA 3BUTA 1K5NB 4Y16C 5HXMA 3QG7L 4C57C 3UO1L 3C09C 4HDIA 3OTTA 4MAUL 5TDPB 1IBGH 3KYOA 5B38A 3V4UH 5T5NG 1JPSH 1A7BA 4RAUA 1N26A 2FD6L 2XWJA 2HRPH 2DF3A 4ORGA 4RX4A 4RRPA 4OZIF 1WAAF 2E27L 2DDQL 3TH4T 4Y1AA 3B9KC 3SKOA 1K4CA 3AVEA 4X6DF 4PJGB 1IM3B 4I4WA 4FRWA 2PO6B 1OQOA 4DTGL 5LAXA 2OL3B 3H8NA 2I9TA 2DQGH 1I4FB 2DRUA 2EH8H 4LDLB 5DRZB 3VFMA 5F7EL 1U95B 5L8LB 4WEBL 4EOWH 3LH2L 4YZFE 1T5XB 1NLDH 1TCMA 4ONFH 4O58L 5F97E 5SV4A 3SGEH 3MREA 4K9EH 3RP1A 3UTOA 1ZT4A 4HJJH 5C09B 1ZMYA 2V2WB 4K7PY 5EU7C 4GMTL 2EDOA 5DWUH 5C0GA 1XGUA 4F57L 1EMTH 1G7QB 2P8MB 4JFFE 2EDXA 4PJEB 4GG6B 1LO5A 4APQC 5I1HL 3IGAB 3MV8E 2P7TA 1JYXA 1ZHKB 3MBEC 5E24E 3MLVL 2W9DL 5DVLA 1SVCP 1XIWA 4HWEL 2UWEA 1YMME 4LRNH 5I74C 3UEZA 5C0RL 5EIVA 2KQMA 3PXHA 1M7XA 1EA9C 1GGTA 3RY5A 3WD5H 5LWYL 1IM9D 4GQPH 4RDQF 1FNSL 5E6IC 2GYSA 3WNKA 4F9LC 5IW1A 2NYYC 2WIIA 3MJ8B 5DVNA 5IWLC 2RGSA 1I1YA 1INDH 1MJ8H 1S78D 4JQVA 5GZOD 1TZHA 2WBJD 2YC1A 4PJAF 2NY0D 3QEGL 4N9OB 5ALCH 3FCTA 2H2SD 3ZTJG 2FX7H 5CJ8A 1H8NA 3MGTB 3VXMA 1DBMH 1AR2A 3D25B 4RFEB 3V6OE 3NMEA 5KSBF 3BO8B 5IK3A 5F7HA 4OLXH 1YJDC 1NANH 5E2UL 2FX9H 4OFYA 1NGWB 1B90A 1I8LA 2ZCHL 3IRZA 5E2WH 1MFAH 4LP5A 4XVUD 1DUYB 5A2IH 5IFJA 3V6ZB 3T08A 3O11A 5F9JB 2OMBA 2W0FA 3T0ED 3KXFB 1KLGB 1Y0LA 4CUCA 2A77L 5KTEL 3DV4B 1GGCH 2NW3B 5I9QB 3PNWA 2H3NB 2WINB 5GZNC 4FQLL 1R5IB 4L5FH 3UTTD 3E6HB 4P48A 4OGYH 4C55A 1SYSB 3GGWB 4S1QL 4YC2C 5DHVA 5E4EC 5I6XC 3G08A 2R23B 3REVB 4EQ2A 3S3SA 1KSRA 2J8UA 4GXVH 4CMHB 4CDGC 1T1ZA 5DQ9B 3L5WB 3MJ7B 4FQCH 4Z76A 4P5MA 4N8VG 1F2XK 5D2LE 4IRSC 2PTUA 3L7FB 3OAZH 4XBPA 4OV5B 5MHSE 4R96B 3GRWH 3VFGL 5E4IA 4S1SH 2ZUXA 4QRPB 5T3XE 3ME0A 3QXAB 5D7JD 2B8OT 4P5TD 4AQ1B 5CBAB 5F89A 3R8QA 4ZTOH 4DUXA 1E28B 5SV3A 5IV2A 4R9HA 1N2RA 1INQA 1OP5K 4OZGE 5F9WC 4N68A 5C0NC 1PLGH 4B41A 3VFRB 1BHGA 3B2UC 3PWNA 1OAXH 3RU8L 4JG1L 3PABB 3FTGB 1AD9B 5EU5B 1KOAA 4U6VH 2VLKE 1OSZA 3LS5L 2VIRB 2DWDB 4XP9L 1CGYA 2H2PC 3BKJL 4K94C 2ZCLH 3GSQB 3QA3B 4BFIA 1DQTA 1U8OB 5EBWA 4Y7MA 4QHMA 2VQ1A 3EZ8A 1HNFA 3V52L 4CVXA 3ARBC 1C1EH 4Q0XH 4JKMA 2UZIH 1LP9F 4YFLI 5BXFA 4NC2B 2BJML 4JO4L 5ECJE 1GL4B 1FG2A 4MA7L 4NUGH 3W9EA 2VITA 3D9AL 4TNWK 1GXEA 4MNQB 2RIKA 1OF2A 1P1ZA 3MUY1 3SJVB 5K9KB 3G6JE 5DTFB 5CD3B 3RVVD 3HE6A 1FYTD 1TJGL 3ALXA 1FJ1A 1FO0H 5F70A 4D9LL 1RK1B 4KJWD 1XGPB 5E00B 4F58H 3D0LB 4U1IB 4P23C 5EG6C 2F5BH 3QDGB 1LK3H 4G9FD 4KMTH 3LN9A 4XAWH 2WQRA 1F3DJ 5CJXC 1ZLWK 1CU4L 1S7XB 4YQXH 3DRTA 1FH5L 1FZOB 4OIIL 2IANB 1LO4H 1W72L 1C5BH 4LHUA 4CVWA 2K3TA 1A6VH 4I0PA 3HUJA 4ZUUA 1B0GB 4JFEA 2NW2A 3S98A 5JPNA 4PGJA 2ZSVB 4FFYH 1T1WA 1MCDA 3OKNA 4PJFA 4G8FA 3TA3D