1FPTL

Three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCSSSQSLVHSNGKTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTYFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSEVQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/pv-1 fragment)
molecule keywords FAB FRAGMENT OF AN NEUTRALIZING ANTIBODY FOR TYPE 1 POLIOVIR
publication title Structure of the complex between the Fab fragment of a neutralizing antibody for type 1 poliovirus and its viral epitope.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1995-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fptL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fptL01
3OTTA 4PG2A 4IOFD 4N8VA 1FSKC 4FXGB 2ESVB 4XC3L 1NBVL 5E9DB 2EYRA 1RUQH 2VDNH 5K9QI 1LD9A 2EH8L 4R0LB 1YNKH 4PR5B 2NY4C 4L4TA 1NLDH 5H94B 3U0PB 1BFTA 1T6WA 4QXWA 5B21A 3KS0J 2JKXA 4WI6A 3G6DL 3NIDF 5JQHC 4M62H 1WTLA 3QDHA 3U46B 5F88A 4G80B 1P1ZA 5CZKA 5DJCA 3KJ4B 3K4AA 4HMEA 4XPAH 4LLUA 1L7TH 4HIIB 1WISA 1IILE 5DA0B 5DJDA 4XP5L 4PJAB 1N0XL 3ARYA 4U1GB 1IC5L 3WNOA 5HTSA 3IGAB 5DZLA 3BGMA 3DRTA 2W65B 3C2AH 5C8JB 1FJ1B 1AJ7L 4WGWB 3BH9A 1NLDL 4MAUH 4D3CH 1J5OH 4Q97A 4LCWE 5EC1A 2HJFA 1XIWC 3ES6B 3DO7B 3QRGH 2XN9E 1C16B 3WFCH 2JB5H 4M7KL 1YEIL 4YC2C 3U2SB 1QD0A 2XKUA 5DUBA 3QUZD 3PF2A 4XH2B 3UC0L 1ZT4A 1GPOL 4PUBH 1LP9F 2NY0C 3P0VL 5ISZD 1OTUD 3UAJC 4X7EC 4K71B 4HIXH 5C3LD 2VLKD 3E2HB 2E8YA 2EXWD 5TDOB 4PRDA 4ZO8A 3EYOB 3ZKXC 3N85L 4QHNB 1G9EA 2R2BB 2ZUTA 1WWCA 3CX5J 3LRHA 1DLFL 1YEKH 4HWNA 1W0VB 4RA0C 3W2DL 1UADC 4XBEH 1K8DA 3DVGA 1FCCA 4MAYD 5T1KB 4WI8A 2YR3A 5DZOA 5I75B 3BPLC 4GSDL 4WW2C 4LK4A 2YEZA 3VFPA 4Z7VA 3U4EA 1AR1D 1A6ZB 3VFRA 5I1CL 1P4IH 2AJSL 1H3UA 4TVPH 4K7FB 1OPGL 5JHDE 5FA4B 3BSZL 1IM3B 3CDGA 1ZHKB 3NCJH 2BY3A 1D9KC 1EEUA 1GC1L 3MYJB 1NCUA 3MLXL 3VCLB 3M07A 3IKKA 2Q8BH 1NFDF 3RWHA 4ZXBC 3AU1A 4C4KT 4Y2DB 4RBPH 4W68A 4RGMC 2W0LA 1IEHA 3OKLB 2FATH 4F2MA 5IVXF 3B5GA 2V17H 4PRIB 1AY1L 1NDMA 1O5DT 1P84J 4R96A 3LOWA 3CVHB 4PRPA 2CDGA 3V6OA 3VWKB 3AS1A 4JR9H 1QPPA 2OM5A 4U0RB 5BZDA 3QDGE 3HPLB 3ROOB 4Z95H 2HP4A 2CRZA 5D71H 4EJ1C 1WC7A 1I7RA 4FFZL 2RGSA 1OAUH 2DMCA 3L6FB 1AI1L 1K6QH 1T4KA 4RMWA 3QFDA 4MMXC 3P9MB 4BZ1H 4GW5B 3O4LB 3RWIA 3M8OL 5K9QG 3NPZB 4KRLB 1NSNH 3FB5A 3ILQD 3S8WA 5IJKA 4M7LH 3L5XL 3D18B 4Z78B 5EOCH 1KCUH 1A4KA 2OI9C 4UQ2A 4Y19B 5KG9A 3IAPA 1DDHA 1RUAH 5IHBA 2I60L 1KF9B 1OAKH 2J12B 4GKZA 4OZFG 4AMKH 4UBDC 3ARFD 3MLYL 4IDJL 5DMGC 4C55A 3TZVD 1D5ZA 1AHWA 1YNLH 2D7PA 4WUUB 1NAKL 3P73A 4WFHD 1R3KB 1YN6A 1F3JA 4BZ1L 5FKPA 3BE1L 3MBEC 1OP3H 2VWEC 5D5MA 4JFFE 4DGIH 1YYMH 5IESL 1J0KA 5SV4A 1G7PB 4U49A 2X89D 4XCYB 3PHOA 4FZ8H 1IGIL 4PJIF 3OG6B 5C1MB 4N0UB 3EOBA 4L3CB 1D3CA 2ARJQ 4U7MA 1LEIA 2ZNWA 4TQEL 5JXED 5E4EB 1WBZB 1HNFA 3UJTH 2Y06L 4L9LA 1RUAL 4N8VG 3WE6A 1IE5A 1MCRA 3QQ4A 5FB8A 3QULA 4XNMB 1TJGH 2P45B 4XNZB 1MCOH 3OKEB 4PJ9B 4TRPL 3CGTA 5I71C 1JPSH 3RUGF 4JO4H 4O2EB 3U7AA 4POUB 35C8L 4MNGB 3X14B 4C58B 2B1AH 1A1MA 4QWWC 1AQKH 4WW1B 1QYGH 4LSUH 2EC8A 1FYTE 4L4VD 4HPOH 1DSFL 5FHAL 4I3SL 5GS0L 4GAGL 4UT6H 4LCUB 3Q2CA 4UOW0 3TN0B 3NABL 4S1DD 5DK0A 3FJTA 2R1XA 2R4SL 1I1YA 4RFNC 3TIEB 3WIHH 1ZHLA 4H8WL 4MSWB 2X4SB 2YUVA 2WIMA 5F6HJ 3GI8L 5KBNC 1TJGL 3HRZB 5FYJE 2HLAB 3OBAA 5C09E 1KLGA 4M5YL 3BO8A 4LCWD 3QYCA 3RIAF 5KS9E 3VDBA 2YUZA 1T03H 4JQIL 3E6FA 4X8JB 5DMJB 4FQLH 4QF1B 4JFQB 2VLJB 4WDIA 3BHBB 2D4FA 5IBTL 4OGXL 2IWGA 2O5XL 2GFBB 4PJFE 4PV8B 4ZDHA 4JHZA 1QRKA 1DBMH 3KPQA 5BRZD 3BRFA 4EI5D 1DQMH 1IGCL 2ZSWB 3IF1A 3IS1X 5INCA 4CU7A 4GG6E 1MCWW 3B4NA 3HHRB 4P9ML 4RGNB 2OR9L 3MRCB 1V5JA 3F62A 5HYJE 1CLOL 1KJ2B 4AQ1B 4MJIB 4PG9B 5TGBA 4Z77A 2RB8A 1PD6A 1GXEA 3MRDB 5I76A 4ONFL 2DQFA 3QUMH 2OS7A 3P4NA 5D93B 5D8JH 5EIQA 1JWSA 1VGKA 2JK5A 2G75B 4G6FB 1WAAF 3QFJE 1MCLA 2ZP0T 1XR9B 2ESVD 1WBYA 4P2QA 4YNYA 5E9DD 2IBZY 1WZ1L 1JZ7A 1GSMA 2VAJA 1ES0B 3QXDA 4KJQD 5E5MA 2P46B 3QXWA 5JMOC 2A0LD 3BUYB 3VFSB 1YMMA 1DQLL 4LMQE 2X05A 3IU3B 2P8MB 5JHLL 4LF3A 1CF8L 2XPGA 3IDNB 1QA9A 5EU7E 1EX0A 2BXZA 1LO4L 4LSDA 3EGSA 4J3SA 4WY7L 3KLAA 4MA7L 1S7VA 4ELMB 4OCYL 5TQ0L 1BBJB 1INQB 3QDGD 4K8RC 3IT8D 1V7MH 4NJ9L 2VXVH 1EVUA 3UTSE 2UZYB 1X4XA 3B3IA 5DR5L 5BZWA 4C83A 5I1EH 1GAFL 3MRGA 5KZCB 4J6RL 4CU6A 5I8EB 4ONHA 3VXMA 1QRNA 4OD2A 1D5IL 2ZCLL 3WIFB 3MLSL 4HW6A 3PWLA 2EH7L 4G6JH 4P46C 1KCVH 3QJFA 4P4KD 1IAKB 4JN2A 4U1IB 1T80A 3QT2A 4X6FA 2RCSL 1ZLVK 1EFXA 2FWOB 1OD7A 4RFEA 4WI5A 3OR6A 3O3EA 1EXUA 1IC7L 4IHOA 1BQLL 2EE9A 5GS0C 1T22B 2DICA 1OVZA 3HCVA 2Q86B 1KIRA 1NCWL 2Q7YB 3V6FB 4DFIA 3W0WB 4Y8AA 2J8UB 5I74B 4OD3H 5T1KD 1EHNA 5F93C 4Q9RH 4IRZH 4GRMA 1LDPL 4ZO9A 4EDWL 5HHMB 4UUJA 4U1JA 5I1AB 5JW4Q 2DQEL 3WIHA 3LKNB 3QG6B 2C4FU 4KUZL 3U0WH 1MEXH 3H9SE 4PJDB 4YHIB 5FGSA 5FO7A 5IR1B 5HVWA 3QUYC 1T1XB 5E4IA 4L29B 3UROR 2NR6C 4Z0XA 3HZYB 1QLRA 2QQNH 4GFTB 3NOIA 4LRNL 4Y2DD 5LVEA 4P5MB 3MNWA 4OLWL 5JLZB 4KK5C 4D0CA 1I1CA 4PRID 1CFNA 3L3DB 1CD9B 2LTQC 1HCVA 1LO3H 1I1AC 4X0KB 4WEUD 2R69H 1AD0A 2CRMA 3FFDB 3AREB 3QCUL 3L95B 3TH2T 3F12A 4F7MB 3R8QA 5F7EH 3NZ8A 3KYNA 3VWKD 3WFEH 3QG7L 1CQYA 1K8IB 4LCWA 3RY6C 1DQTA 4WTZG 3BD3A 1V3MA 4HEPG 4PB0H 3NCCB 1GZPA 4NFBA 2XN9A 4GRWF 5IIEA 5FYJD 4P59L 5AWNL 2P48B 2ZPKL 3FONA 3QUMA 5C09D 3V6ZB 5EBMA 2W38A 1KCSH 5AAMA 1LE5B 1Q8MA 5C0EB 2YC1B 5IM7B 2V7HA 4Y16A 5GJSH 2ADGA 2CLVA 1E0OB 2F54A 2FSEA 3H9YA 1DBJL 2E7BA 4WUKH 3O4LD 1YEDB 3GSUA 4MDIA 3WDIA 2AJXL 3CVHH 4XRCB 2UVFA 5LGKA 3CFJA 1LEKB 1K4DA 3QNZB 1X5XA 4NNPH 1KLUA 2WLZA 4UIMB 5AYUL 3INUL 4J3XA 4Y19D 3N9GH 3UTTB 4YR6B 1A7NH 4OZFB 4DOHB 4H25B 3GKWH 2XTJC 4R7DB 4H88L 3GMMA 5C0DB 4QRPE 5FYJH 3BDBA 4JHWL 1N4XH 4K55A 5F7KC 3OGCA 1BQSA 3ARDA 3LD8B 2DQGL 1UXWA 1MY7A 3T09A 1U8NA 1OAQH 1I8MA 5C0BE 5H8DA 4BK4A 2E5EA 3RL1B 4M93B 1MI5B 4WUKL 5A43C 1NMCC 3EYQD 3EYVB 2DLGA 4RCAA 2NY1D 5JHDA 1SY6H 2AP2A 3HE6D 1U3HA 2NY4B 1RUPH 1MPAL 2CJUH 1SYSB 2VL4A 4UU9B 1JFQL 4NNXA 3F58L 3HI6H 3QFJD 4K3DL 3QIWA 5ALBL 1VFAA 2ZUXA 4ZODA 2I26N 2W91A 3NTCL 1IKNA 4Z7OF 2OBGA 4PGDA 5EH1A 5CEYB 1DUYA 1LD9B 4DKEL 5T3ZD 4NO0D 2VR9A 4PJ9D 3S98A 1TMCB 4OF5A 4WEMB 1KOAA 2IH3B 2H2PD 3NN8B 2VR5A 5DDHA 4OCNC 3GHBL 1EZVY 4WI7A 2UUDH 4JO2L 3X11B 4ERSH 3HLAB 4JQXA 2A83A 1JGEB 3BVNA 1H3WM 3G5YB 4LLDB 5CWSA 2A6IA 3VH8A 1P7QB 3DMMA 1MJ7L 2Z91B 4NPYA 1HH6A 3TO2B 4PGCA 1XIWB 4X7FC 4IJ3B 5E94A 3TBWB 3TN0D 2HH0H 5IVZA 1KULA 3K46A 4LAQL 2CUMA 1EMTH 3WN5B 4YC2B 4C56E 4U6YA 3EJZD 4YDLC 3BJLA 4NRYB 2VC2L 4G5ZH 4H20H 1ZLSH 1EGJH 4Z18A 5JW4R 2NY0B 1TTFA 1FZKB 1AKJD 5EC1B 2HJFB 3MV9B 4W4OA 3RWJB 1KSRA 4PY7B 2VDLH 4ODBD 2VISA 5IOPB 1RZJL 2XXMB 2YPKA 4FA8A 3CJJA 1NANI 5KVGL 1A7PL 2YMXL 1P6FA 5JXAH 2DI8A 2A9ML 2I5YH 3EYSH 1G7IB 4HUXA 5HDBF 4XPGL 4KI1A 2GJ6E 1PG7X 2VXSH 1VEMA 3BPLB 3FFCE 4WW2B 3ULVE 4JFFA 3H9ZA 4X9BA 3HFMH 5D7KD 4RGND 3S96B 2JCCF 4CNIB 1XZ0A 4YGVA 4W6XB 4MJID 1G0YR 4PJEF 2WWKT 3FB6A 5L7XH 2WW8A 2EE3A 2X6MA 3ZT5A 2D2OA 3C8KA 2P5WE 5ID1B 5E08L 2DLFL 4KMTL 5J0BA 1J0IA 3VFPB 2D7TH 4G6FD 4P5TC 2YA2A 3VFRB 4F37K 2BSSB 3BZ4A 3LB6D 4JPWH 4FNLL 4MA8H 3V7AE 2C1PB 2VLRE 2IANB 2WUCH 4YFLI 1VACA 3QIUA 2NXZB 3L3JB 3RWHB 4GXUN 1LGVA 4AEIL 2Y9RT 2CIKA 3FT2B 3U7WL 2BDNH 2DM7A 3CXHJ 5CBEA 4JG1H 1FYTA 1L6ZA 4PJCE 5DJZA 3WLWD 1YUHA 5IEKA 3VXUE 5DYOB 3ARGD 3IFPA 1WBXB 5HGAA 1OB1B 4O51A 4PRPB 4DZ8A 5TF0A 3TJHC 4KAQL 5SX4H 4PP1C 5DT1L 3UDWC 4HUUA 4KK8D 4HV8A 1HILB 2AEPH 2VTFA 5FYKE 1JHLH 4E5XB 4MA8L 1BD2E 2OQJA 3KPSA 4R8WH 5GGUA 5CKAA 1VFOA 3SGJA 4YX2H 1U8PB 2VABA 1CBVL 3MLUH 4MVBC 1WC7B 5F9OL 1KBGL 1I7RB 4S1QH 1DBBL 4IOIA 5KZCD 4IEFB 4PJFA 2X9XA 3QI9C 3ALWA 1T4KB 4KHTH 3QFDB 1CFBA 3WLBA 3ARSA 3OKKB 1KEGL 1J8KA 1K4CA 4POZC 4HMCA 3EBAA 1DFBH 3K7UA 5H37G 3CZJA 4RWHA 4X7SL 3HE7D 5EN2B 4GG6A 2YKLL 3RQ3A 3O45A 5SWSE 4J2XA 4AZ8A 3L3KA 3MRLA 5HYJA 1RHFA 3MBEB 1DDHB 1JPTL 4CKVX 1KYOJ 4G3YL 4MYWB 4UV4H 2B2XH 4QRPD 5IW1B 4HKBA 4PJGF 1Q72H 3CVIH 5D1XD 2AJZA 5SWQA 3W0WD 1FIGL 5FIEA 1U8LA 1J18A 3JV4A 2PW1A 1AD9A 2VH5L 1UGNA 3F7QA 4PGBA 4CJ1A 2DRUA 4CMMB 3NPSB 2F5BL 4UQ3B 1MIMH 4H5SA 4HKXB 5ICZB 3ZE1E 1GHFL 1JZ4A 1UJ3A 3T2NH 4L9LB 2A38A 1V05A 2B2XL 4Z6AT 4NO3B 3QULB 3MUHL 1KELH 4YZFF 1FC2D 2HMID 4BKLB 2WSKA 3UPRA 2R39A 4MS8C 4IDLA 4DK3A 4YXHH 3H6JA 4RFNB 1V8HA 4M1GH 4MA1B 3S3JA 4AH2A 3UTSA 3ARED 1PKOA 3GEWB 3WV0A 1A1MB 2R0LH 1RFDL 4HJ0D 3SPVA 3O6KH 1VDGA 5C0RH 3PWJB 2V2TA 4OLVL 3NACL 5C0GB 5B4MD 1A6TA 4C56D 4TTDD 1F13A 4GKSA 1WWWX 2VUYA 3U6RB 5ID0A 4NQEE 4DKAA 2NY5H 4UTAL 4LEOB 3BO8B 4QOKB 3T8XB 5IWLA 3D85D 4PP2A 3FZUD 3V52H 1A9BB 3LS4H 3FO2B 4M6ML 5J3HC 5BCAA 2R0LL 4ONOA 4LMQI 1CICA 4OFVA 5GRYA 3RX5A 4YHNB 1D5XA 5GQBA 5CJQL 3UTTD 2DQTH 4OT1H 4FFYL 3DPBA 5DF0A 2VWEE 3N1QC 4OCXL 5ANME 3QHZH 4HFUL 5J89A 5DC9B 1DQQA 4YHOL 4OZIE 1I7UA 1O7VA 3WXVH 3UPCA 2FECL 3V0WH 1RJZB 1JJUA 5HI4C 4Z77B 3VRIA 5DC0A 3SBWC 1CLZH 1KPUA 5I76B 2ARJB 3V5DB 3H9SA 1ITBB 4Y4FC 3IKCB 2IFFH 3RDTA 1T2QL 2L4OA 3RPIB 3CMOH 1F6LL 2P5WD 2NY4D 5TF1L 1UB6A 4DN3H 1JWSB 4MD5B 2JK5B 4PV9B 2CXKA 5FO9A 1JRHH 3C5ZC 3PIQA 4JDTL 2CK2A 4GJTB 3PP4L 1U8IA 3ULVH 3TVMB 2R0ZL 3ARGA 5CP7B 3DVIA 1HOCA 4G8FB 1PQZA 5GRJH 1SBBA 3IFLL 3WXVL 2HG5A 4NUJA 4NZTH 4B53A 3TM6A 1J12A 5J6GA 3MV11 2Y07H 1E6JH 4ZUWB 2NY7L 5IMOA 5E2VH 4DK6A 2W60A 1PLGH 3VXUD 3N50A 4G7YH 4EQ3A 4OCSL 2OZ4L 5KANI 1IM9A 1FGVL 3IJSA 1X5AA 2A9NL 4YJZL 3FRUA 4P9HL 2AK4E 4I77H 3BKMH 1UC6A 1S7VB 1XIWD 2H6PB 3ABZA 2CMRL 4G8GE 4LKCA 5FYKD 3WS6A 3HB3D 3GIZL 3V4UL 4XPHL 3JV5A 4P46B 2OMNA 3U4AA 3QIBA 3F6LA 2XA8H 5C0CA 3O41A 4ONHB 3VXMB 1QRNB 2NY0D 5ADPL 3UAJD 5IB2B 1XGYH 4NKMA 1FO0H 3MV9D 1ZVSA 3D9AH 4YDVA 4IIQC 4P57B 3STLA 4ZUUA 5B3NA 4HPYL 4QRPA 3L7FB 4O2CB 4ZFOA 4M3KB 5FYKH 2G2RA 5SWSD 4JN2B 3WUWA 1SEBB 4MXVF 1B3JA 5FV2A 4V1DA 4PJXE 1EFXB 4RFEB 1HWGB 5E8DL 4JY5L 1MHPH 5DEZA 5C0BA 2ICEA 3SKUD 1SYVA 4FQHB 2YS4A 1Q0XL 2BVUA 4E41E 3KPRE 2PR4H 5B8CB 4P48A 4ORGB 4WFFE 3P77A 1UA6H 2APWA 4G8EA 3LHPL 2YD2A 3SKNA 3MV7B 3M17B 2DD8L 1UWXK 3NFNB 4XPBH 5D1ZA 4P2RB 3ZDZE 1OWRM 5IFAH 5IMMA 2WWKO 4KZEH 4ZYKA 1C7SA 1IGJB 5D6DA 1U8MB 3A67L 3VRLE 2ZZUT 1ZT1B 3ZSTA 4WHDA 4QRRE 1AGEA 5GHWH 5BW7C 2X4OA 2IAND 4NWUL 1F58L 1IL1A 2X4RB 4LKXA 3RVXD 3W9DB 4Z0XB 3Q1SL 5I8KH 1QLRB 1DBKH 2Q3ZA 4QLRA 1ZANH 3K8LA 3ZL4L 5JIPA 1CGYA 2BC4A 4ZTPL 3DYPA 3BDXA 4TNVF 3OG4B 3B9KB 1AD0B 1H3XA 4RX4A 2NW3A 5KN5A 3VMNA 4M61B 4I0CC 4Z8FL 1P53A 5CD5C 2WP3O 3C6LB 5DQDL 5LQBL 3U48A 1YY9C 4WI9A 3NGBC 5BS0E 4XWOC 1RULH 1TJHL 4NN5C 4HC1H 2F8XC 1UCBH 2CGRL 4GW4A 1H3VA 2NMSA 2OTWB 3DRQA 1GZPB 2FB4L 1N64H 1UWEH 1N8ZA 3VJ6A 1UQSA 5EBMB 1UCTA 1ZANL 4FP8L 2V7HB 4WVRA 2N56A 1AQDA 4MNQE 2FSEB 4X5XB 5KSAC 3BRGC 1WT5A 3FHAA 1EEZB 2GJ6A 3RWEA 5DMGD 3CFJB 3FFCA 4JHAH 3WNNA 2FECI 1L0YA 1ZWIA 2YWYA 1G7HB 1NLBL 1MCFA 2HVJA 3HG1E 4L8SB 1NMCB 3MBED 5HHNB 1IAIL 3IDJA 1Z3GH 3ARUA 4YHYB 3F65A 5KANG 1A2YB 1BREA 3JWOC 3OGCB 1T3FA 4OZ4B 2P5WA 4EEEA 2JIXB 3OQ3B 3TCXA 2BNRE 4LLVB 3QCTH 2NZIA 3R06A 4NQCB 4Z7NE 5FECB 1I75A 4BQBA 2JJSC 5D7IF 1K9TA 1N5AB 4PRHB 2VLRA 1U8OA 2Y23A 3K0WA 4OZHF 4PYGA 1HE7A 4LSRL 1BBDL 1FORL 5D72L 3IDYB 1I3RA 2X9WA 4U1LB 4R7NB 5HY9B 3RTQC 1I3GH 2IAMA 1QQDB 4K2UL 4NM4H 2OTUA 1MFCH 4PS4L 3P4OA 4PGDB 5CUSL 3ZHDA 4QWWD 2AXHA 1P7KB 1FO0A 1EO8L 3V4VL 1HK6A 3MLWL 3H7BB 5FHBL 2VDOL 4X4YA 5BMFL 3K2MC 3P0YL 2HFEA 1BVLA 4DVRL 4ZFGH 1BD2A 4LDOB 3GFUA 4YDLB 4JZNA 2NXYB 3CZFA 1JN6B 4FHBD 5IHUL 3KYKH 5CWSB 5A40E 2A6IB 3FAWA 4QRUA 2GTWA 4IMKC 4PGCB 2F19H 2FRGP 2EKSB 2QSCH 2APVA 2HAZA 4PD4K 4BUHA 1MFCL 2YA0A 1OW0C 1HKLL 5J12C 3ZKMC 4U6YB 2IEPA 3X13B 5E99L 2BRQA 3GI9L 1CVSC 3F7PC 3PWNB 3DBXB 3HS0A 3RIAK 3DXAB 2MNUA 4HCRH 5SWSA 4QOKD 4C59B 4KK6D 4D0BA 2XTJE 3W9EB 32C2B 1F6AA 4F9PA 1NAMB 1BOYA 3MX0A 5HGHB 1AGDB 2YPKB 5HXMA 1QLFA 5I15L 1UVQB 1JNHA 1CVRA 5DUPL 2R2HB 4HUXB 3WUWG 5ADOH 5IKCA 3MRKB 1D9KA 5IHZB 3CPLA 2Y72A 4WFGE 4ZXBA 5D2LE 3KPRD 2H9GA 1AXTH 2GCYB 4WFFD 3EJYC 4OJFL 2NW2A 3OSKA 1YQ2A 2DJ4A 3T1FA 1QBLH 1T1YA 4HQQH 4N5ED 4D9RE 1E4WL 2VDPL 3GUTB 3WHE1 5E6IB 1XF1A 4HC1A 4NBYB 1NEZA 4NQUA 2VXUH 2HT4C 4O2FA 2DLTA 2JELL 3MRHB 3HC3H 1DE4A 2F58H 4KI5F 4OIAA 5K9OA 2HKHH 1IBGH 1VACB 1FZMA 4HIEA 2NLJA 5ESQB 3TVMD 1TENA 3QXTA 1L6XA 2R4RL 1FFPA 3RZCA 4P49A 2FJHA 4YDIH 3RWFA 5LGJB 1VPOH 3FTGA 4M03A 2CIKB 5J13B 4L5FL 4S1RL 4Q9QH 1HWHB 2E7LC 5EIIA 3WSQL 4K8RD 4QHMA 2JJVA 4XCNB 3IAGC 1TLKA 5BVPL 1T7VA 2FJGB 2ARWA 1J1PH 3JV6B 1B2WH 3AY4A 3D2UA 1NMBH 1KIPB 1MJ8L 5GISH 1U8JA 3WS3A 1FG2B 3C5JA 3PL6C 4HUUB 3OXSA 4NQEA 5GGUB 3GGWA 3SDCC 5FCUL 3ULSA 1LO0L 2F74B 5KOVC 3RBGA 4P46D 4IOIB 5DHYA 2O5ZH 4F33B 4K8RH 1NC4D 1YEJH 4ONGL 3BW9A 5EU5A 1PG7L 1IAII 4MNQD 1AGBA 1S7TA 1U91A 5GS0D 1J1PL 5DD5L 4EUPA 2N4IA 3FO1B 4OCMC 1R5VA 1WIOA 2UZIL 1KLFA 4OZIA 2Y7QA 4OZGF 2YRPA 4DAGH 3MRLB 4LASH 3X3FH 4ETQB 4X4XB 1H3PL 5T5FL 1IAIM 2PN5A 5IB1B 1N7MH 2X4PA 3VXRA 4LEXL 5DJYB 5IEHA 2V2XB 2W9LA 5DVKA 3G5ZA 1YEJL 2AJZB 2IGFL 4WHTB 4PJHE 2XWBB 4ZG1A 5F7FA 2XQBL 3D1MC 1XH3B 1Q9WB 1FFNA 2NR6D 4NOFA 3MV7D 1CD8A 3A6BL 3V7AG 1OLZA 4HEME 3VDAA 4H5SB 3DGGB 4NQXB 4KK5D 4Y4HC 2NPLX 1A7QL 3I50L 1J88A 1LO2L 3BPCA 2CPCA 4JFZL 4V2BA 1I3UA 1TZGH 3MUZ1 1JF1A 4O00A 3LRGA 3T4AA 1RJYB 3NIFE 2EDKA 4P3CL 4JDVB 2AK4A 3PDGA 4MD0B 1P6AB 4Y5YC 4G8GA 4KGLA 2CUIA 5EG6C 1XF3B 5KSVB 5CEZE 4KV5F 4HUWB 3VXNB 5CFHA 1FCGA 4XAWH 1GL4B 2FR4A 5EUOE 1A14H 3SPVB 1KN4H 2QHRL 1J10A 1F8TH 3KAAA 3S3SA 4LPXA 4NNYA 1MSPA 1U3ZA 5EPMA 3TA3B 4PY8J 4QTIH 4ODSL 4D0DA 3TFKC 5DD3H 4JO3L 4UILH 1Y18A 1NFDA 3D0VA 3HUJF 4F57L 7FABH 1H8OA 2HYMA 2QL1A 4KJWD 2NY3B 2ICWB 5TDPB 4PJXA 1ED3A 2XTJD 4HFWB 1KV3A 5ESAA 3VFNA 4LSSL 4CDGC 3GJFH 3DX6B 1Y6NR 1PKQB 1OF2A 3PQYE 5F6IB 3DROA 5DUMH 4E41A 4BFGA 2VXQL 5CP3H 3DX8A 2DDQL 2FX9H 3GMNA 4K9EC 4KHXH 4GMSL 4X83A 4Y4FB 1P4BL 4A6YH 1A3RL 1FDLH 1RIHL 4H26A 3H3PH 3HNVH 1NMAH 2YA1A 2XNAA 3MGOA 3GNML 1RAMA 1BQUA 5FOBB 2JIXD 3Q6GL 5FA3B 3WFBH 4NQCD 2X70B 4XPTH 3O9WA 1LK2A 3T3ME 3TLRA 2R1WA 4QRRA 4D9RD 4PRHD 1I4FA 1FLRL 1P5VA 5F89B 1VB9A 2J88H 4QT5B 4JKLA 1UB6B 5I1KL 3DHJA 4QKXB 1BHGA 4CMHB 1DLHA 4YO0A 2G5RA 5HBBA 3LKRB 1QLEH 4QY8A 2FX7H 1CU4L 1F2QA 4IS6A 3VFWA 4CADA 3RVUC 3S36X 5EA0H 1PQZB 1PW3A 4MJ6B 4AIZA 4NM8H 4M4RA 3C9NB 1ROWA 5EZIL 4UTBH 4AEHH 1J1XH 1MCHA 4DW2L 1V3KA 2ZSVA 4LBEA 2GITA 2CR6A 5BS0A 1T0NA 1H5BA 3G6JE 2W60B 2OTPA 1IFHH 4PJ8B 3TIDA 1MH5B 4XGZB 2DBLH 5F9AC 1X7QB 4M8QA 3V5KA 2XZZA 3ZHKA 3CLFH 2EYTB 5EO9A 5HHVL 4ENEC 5T3XL 1S9WA 3MQIA 4JRXA 2WMPA 5J8OA 4LCIL 5FGRA 4EI6B 3EW3B 3PWUA 3E6HB 1H8SA 2A6DB 4JRYA 1UM6L 5IG7B 2J4WL 3VRJA 4IIQB 5GS3A 4MNQA 2DQJH 3ZE2F 3ZYOA 2CXGA 2HFTA 3S4SG 5L8KB 4F7PB 1FNFA 3CLEH 4K7PL 1LHZA 4MDJB 1U3YA 1CFVH 3QIBB 2WWMC 4X80L 5C0CB 2L7JA 2B1HL 3OJVC 3W82A 3CC5B 3DXAD 2IPUK 4G7VL 3HG1A 1CK0L 2X4QB 6FABL 2EKJA 3LN9A 4LHUA 1ZS8A 5IFHL 4M7ZC 3GIVA 4ZUUB 1CFSB 2CSPA 3BGFC 2QQKL 1IKFH 2XZCH 4EUPG 1MJUL 1ND0A 3BIBX 4U1HB 4V1DB 5L6YL 1BOGA 3LSOA 3PG2A 3FQXA 2BNRA 4WU7B 1E28A 4RISH 2DKUA 1OQOA 1NCDH 2QHLA 5GSRA 4XCFL 4FTVE 5BV7L 3QUYA 1B4RA 1KIQA 1MUJB 2OJEB 4P5TD 3KNBB 1UZ6E 3QCVL 1EV2E 2G5BB 3P77B 5E24E 3L1OH 4M00A 1KXVC 4LLWB 1NAMH 1A6UL 4XNUH 4G8EB 3PWPE 3SKNB 1I1AA 3BD4A 5E6ID 2VQ1B 2YZ1A 5D1ZB 5H35B 4LSPH 2EC9U 3QQ3B 3ARBB 1Q1JL 3CXDH 1AO7E 1P9MC 3CCHA 1ERNA 1FVCB 1JWMA 3TCLA 4OTXL 2X4OB 4JM2C 5C0AB 4AEEA 1EA9C 2BNQB 3MNVA 4DGVL 3ET9F 2PF6A 2DTSA 3GSRA 3TJHD 1RZFH 4PP1D 4OKDA 5E2UH 4OI7A 4ZS7H 4WU5A 3MJ6A 4EVNA 4NN5B 1KT2A 2X40A 1Z0NA 4FQQA 5J6HB 5KVFL 1MJJB 5ITBL 4MVBD 1VEPA 4U1MA 2NW3B 5DRXB 5CP3A 5CEZD 3UTZA 4X7CC 4YUEH 4LLYB 4A6YA 3GSQB 4F7EB 1IGTA 3BP7A 3QI9D 3B83A 2AK1L 3I9GH 5DJAB 3AM8C 3CSBA 2ADJA 1WAAA 3HC4L 4NKOB 4KPHL 3BX7C 3QDMA 1AE6L 4WWID 1G6VK 1EDQA 3R1GL 3DRQB 4FOMA 3LEYH 5EU3B 5D7SH 3EOTL 3B6SA 2R0WH 5I16B 3MRFB 3UEZA 4FQ1H 2MWCA 2KDGA 1JGDB 4OSUH 5I73C 1AQDB 1ONQA 3BP5B 2DM4A 5CEZH 1OAYL 3LMJL 1I9RL 2WAHA 5DTFA 1RUMH 5E1AB 3PQYD 4WRLA 1ZWIB 4NO5A 1HDMB 4H0HB 2HVJB 5D2LA 4Z7VF 1KFAH 2Z31A 3LVEA 5DJXA 3GHEL 3QUXB 2PXYA 2XZAL 1A47A 1LEGA 4U7KA 3SDDA 2EDEA 4CVXA 5CHNB 2XT1B 4L3EB 1GGBH 4YHZL 2CKBB 4D2NA 4Y5VB 4JZJC 3UYRH 4I18C 1G7MB 4NGHL 1S7WB 4JDZB 4NQTA 3GRWL 2FX8H 2WINB 1ZLUK 3MZGB 1I3RB 4N9OB 4RGOL 2YZ8A 4W81A 1KB5H 2NZ9C 4MS8D 2YPVH 3BKCL 4K94C 4O58H 3ZE0E 4AEFA 1NH6A 5DEGA 2YPLE 2PW2A 2VNCA 4JKPL 3ZTNH 1V7NL 3CFKA 4X5LA 5MI0B 3KPMB 3RNQA 5EO0A 1VGEH 4DQOL 3QJHA 1XMWA 3SOBH 5CJOH 3ALPA 1RZKL 4X4YB 4HGWA 3LIZH 5BV7C 2YUWA 5KSBE 3WL9B 1MVUA 1BVLB 3HZVB 3P9LA 4X5WA 1MCKA 5J12B 3O6LL 4H0GA 5FUZL 1IEAA 4P2CG 4PJ7E 1I9IH 3JTSA 1B0RB 3DX9A 3DUHA 3OZ9H 2C3XA 3DV6A 1CD0A 1MY5A 2GT9B 4Z7QE 4WI2A 1T83A 4N0FA 4GRLC 3SE9H 2HKFL 3TA3D 4OF3A 1G6RB 4I0PA 4D8PB 1MOEA 1DEEB 1DJSA 5E2TH 1NKRA 3BI9X 1X5FA 5KVEL 5J3HD 1UH3A 1OSZA 4QTHA 1ACZA 3NCYS 3PGDB 3LV3A 1RZ7H 2FO4A 4UV7H 4S2SA 4APQA 3OXRB 2ICES 1IGYA 3VG9C 3CX2A 4JZOB 2RFXA 1C08A 5ABDE 1CE6A 1XF2A 1F6AB 3MCKB 4OLYL 3WKNA 5AD0A 4YIQA 5D5MF 1CI5A 3LQZA 4AL8H 3UTQB 1RURH 4LHUG 1T7YA 4M7LT 3U1SL 4A2LA 2FJFA 5MEQA 5HI4D 2V6HA 2K7PA 5DFWH 5JOEA 3RI5F 1DZBA 1P4LA 1JGUH 3A6CH 4Y1AB 4GUPB 5IKCB 4Y4FD 3Q5OA 1VFMA 5I2IB 4EZMA 2XRAH 3M45A 4HWEL 3P11L 4UV7L 1MWAL 4P2OB 4M7JH 1AGFA 4N9GA 3MBXL 4CDHA 5E2WH 3MPCA 4HLZG 3KXFE 1H0DA 2A74A 3UP1A 3RWDA 1JUFA 3KPPB 4OCRL 2AVGA 4N0YL 1XCQB 5FGCB 3AGVA 4RNRA 3MLZH 1DANT 4DGYH 3QZWA 1AO7D 4BZ2H 4HT1L 1N6QH 2D31A 1WLHA 4JAMA 2PTTA 5F3BA 4GAJL 2ID5A 2E3VA 1JBJA 2DAVA 5C7XL 5FO8B 2AXFA 1I9EA 2YSSA 4R90L 4P2YA 4ZMAT 5EOTA 3GMPB 2AAVA 1DL7H 4Y2OA 5HHPA 5EUOA 4F15C 5EIIB 1CG9B 4LGPB 4XNXH 1S5HB 5DD0L 2H3NA 4XMKH 1H9VA 2I07A 1OGAB 1ZHNA 3HZMB 4KTEH 2PO6C 3WS3B 1MRDH 5EOQL 2KL6A 3WIIH 1N6QL 3S4SB 2G9HA 5JA9A 3MJ8A 3CFCL 4O9HL 5DHVB 5T1DL 3DYOA 3WFDH 5CSBA 2B0SL 1BQHA 3AAZB 1FNGB 3EFFB 1CE1H 2YD7A 2J5LB 5IW6A 4LQFL 2VZOA 1BZ7A 1M1SA 5F1IA 3MUGB 4Y5XB 5ETUA 5HYSB 5HDQH 1MCEA 3GMRB 3DVFA 3DETC 1KB5A 5FGBC 3OX8A 5EBWB 4EUPB 2IALA 2AEQH 4U1SA 3GO1L 3NIGE 4M1DL 5B38A 1R5VB 3SGEI 2R23A 1BEYL 4OGYL 3VXSE 4Z7WE 5ICXA 3GB7A 3PGFH 4F3FA 3LQAL 3LEVH 4QEGA 2PYEB 2Y5TA 5E5RB 1J7VR 4FQCL 5DVNA 1G7JB 1WWBX 4Z0BH 3O3AA 5HYFA 2X4PB 3VXRB 3V0VA 3KR3H 4EDXB 5IEHB 5LKNA 4EN3A 5F3HA 4EOWL 1I7TA 3SY0B 3I75B 5DK2A 4QXUL 5IBUG 1OCWL 1AC6A 1W0YT 2FZ3A 1Q9OA 1NCTA 1BX2B 2HFFA 3FQWB 5F1OB 4JFPB 4LVOB 1MLBB 2EZ0D 1CZ8H 3OAUH 2RQ8A 1UXSB 3MOBH 5ACZA 1OSPH 1CFQA 3H2WA 1NCAL 2JJTC 3ARBD 3BP6B 1NGQL 5FCSH 1CT8B 1PFCA 4Y5YB 1FVDA 1R5WA 5C0AD 1LP9B 2BNQD 2CK0L 2YPLD 4Z9KB 2RHEA 3G6JA 4I9WD 5C9JB 4J3WA 5C0FA 4JFEB 3NA4A 4Z0BL 3Q3GA 1YY9D 2Q20A 5C08E 2BHYA 4L8BA 3C09C 2VLMD 4TNVK 3O81A 3FQTA 5M95B 1OAXL 12E8H 1UM5L 1FLTX 2AJUH 3MOAH 4M6OH 4UDUB 2FD6L 2B20A 4TSBL 5GGRY 2APBA 5BVJA 4N1HB 3MMEA 5C70A 2A6JA 1J05A 1UACL 3IFNL 4NSKA 4CW1A 1VKXA 3HNTH 4U6XA 1YPZE 1FE8H 3S34H 1WTGT 2NYYC 5ESVA 1QTYT 4YHPA 5KSAD 3D48R 4ZD3L 3OL2A 1YC8A 3I3BA 2C7UB 4BFBD 2BCKB 3U36B 5F7NC 5DMKA 1TVBA 4YXKL 4JVWA 5T1MA 1EHLL 1NFDB 4UT7L 1EFQA 5EZLA 3WKMH 3QXAA 4QGTA 1R24A 3LEXA 3MOAL 4NN6C 5IVXB 3KYMA 1IQDA 5I8CB 4X9FA 3QEGL 4FTVA 5I1HH 4RAUB 2HT2D 1C1EH 5TQ2L 5E6ZA 1S9XB 4HUVA 1EVTC 2R8SH 3C5ZA 3QUXD 2FIKA 3MRQA 4NC1C 1F6FB 3DIFB 1KPVB 4JJHA 3PWPA 1A1OB 4ZOEA 1I1FA 2XNAB 1KPRB 3DURA 1PYWA 3MGOB 4L3ED 4LLMB 4CN1A 4NHCH 3RTQD 4Y88A 4F8QA 1A8JH 4QHLB 1K2DA 5EWIH 3JWOH 3WO4C 2J1KA 1U95A 4HLJA 3IDGA 4UNVA 2DWEA 2P7TA 4ESKA 5AZEL 3VI4E 5CBAA 4ZQKA 2AEWA 3H9HA 3VFTA 5FYJU 1P84K 5C2BH 1BM3L 4YO0B 3BRDA 2BY1A 2NY6B 4YPJA 1ZKAA 1FAIL 4GG8B 4ODWA 1JYWA 1INEH 3TYFA 5C07E 4CADB 2IG2L 1MLCA 4HUKB 4R26L 5I18L 1G9ML 4MAYC 4PJGA 3QEQE 2ZSVB 3KG5A 3KJ6H 1D6EA 1EO7A 2GITB 2K3TA 3JTTB 4WO4A 3WCYA 4N8CH 5JPNB 3TIDB 4I5BB 4P4RA 1BGXH 3C8DA 4LLAA 3QO0B 5EO9B 2H41A 2Z93A 3GK8H 1T20A 4MX7B 1CTOA 3FQNA 4PJIB 2AV7A 4JRXB 1W0WB 1LILA 3SJVE 5JOPD 2BSRB 4XAKE 1TETH 1KNOB 4GXUM 3GJEA 1FZJA 4A2MA 1BZQK 4YHKL 4JRYB 1KTDA 3QWRA 4JPVH 5TFSH 1G9NC 4LLQA 3BGFB 4Q9CA 3VD9A 1KC5L 1QNZH 4MA3B 2UVEA 1QR1A 2XG5A 3MXVL 3PV6A 4LHUB 3QEHA 2ERJC 1FVEA 2V5SA 3RUGB 1N26A 3FT4B 4U33A 1S7UB 1Q9LA 3JVGC 1GZQA 5DSCA 4XCEB 3REVA 5IB5B 3EJYD 3VFGH 2FBJL 1G6RH 2IQ9H 1BOGB 3GBMH 5MENE 4OIBA 1FL5B 2Q3AA 4Y1AD 5KW9L 1TZHA 3U4BH 1KEML 3I6LE 1SM3L 3C8HA 3I2CL 4DVBB 3KS0H 1KIQB 4HAFA 2P5EE 5IQ9B 3MNZA 2F5AL 4NWTH 5DRWB 3U9UA 1BECA 4R4FH 2EDOA 2ZJSL 4P2OD 2IPTH 2FYYA 3RKDC 2V9QA 2Q8AL 5A3IC 1B6UA 1RIUH 2HRLA 3S36L 5IBLC 2DQCH 1XGUA 2JB6A 2B4CL 4G6KH 5D7LE 1QUNA 3VXTB 3BZEA 3TBTB 3UJIH 2W0FA 1PZ5B 2IPUG 3BQUB 4YXLL 4PJBE 3HR5A 5D2NC 3BD5A 3EYUH 1F4XH 1HINH 5L9DH 3U7YH 1GGUA 5KSBA 5FYLL 4ZFFA 4BH8B 4HULB 5I1JH 2GAZB 2X09A 3D25B 3BJ91 4PJ7A 3Q48A 4I3RH 4Y4KC 3TPKA 2ILLA 5C08D 3RWCA 3PL6D 5TJWK 3TT3H 1KT2B 5L2KE 1S9YB 4JANA 4ZUSB 4NUGH 3V8OA 5FUCC 5LGHL 3HMWH 3FN0L 5CCKH 5JXEC 1OGAD 2IBZX 4B0MM 2W9EH 4R4NC 1D6VH 4KK9D 2O61A 1TQCC 5GRXG 3SCMB 4JG0L 5IF0B 2FEDD 1NJ9B 3BP7B 2X4UA 1YEFH 1G7QA 3MR9A 5I73B 1W2KT 3RVWC 2V2WA 2RAMA 4AM0A 1S7XB 1UEYA 3WFHA 1TVHA 4J4PA 1AIFA 2VDKL 3HI5L 1TTUA 3T0DA 1FBIL 4BELD 5DD6A 1QKZH 4GAYB 2EDDA 2BJML 3EDDA 2EDYA 1U0QA 2QV2A 3EZJB 1A7BA 1MCPH 2JJSA 2VDRL 2CLRB 5I1LA 3DSFH 3BDYL 4HIHB 4FQIH 5JORB 2DQHH 2Y5EA 1MFDL 1M6OA 3VFUB 5MEPA 5DD1L 4NO5B 3RU8H 2OXGA 4JZJB 2Z31B 4YPGB 4MCYB 4KDTC 3IAQA 3HAEH 3RTQA 3MA9H 4QRSB 3MLPA 5I17B 3FCTA 4RMRA 4RMTA 4ZUVA 2PYED 3MGAA 4JO1H 3T04D 4CVXB 3KXFA 4JPIB 1XT5A 2B5IB 1JI1A 3SO3C 2Z35A 5IBUB 4Y4HD 1S7RB 4R4BB 5HHOE 4RQQA 5SWZA 5D70H 4L8CB 3SQOL 1MAJA 3I6KA 2MCPL 3S35H 2MHAA 2HVKB 2MQCA 3VXOA 1U93B 5LXGH 4FQXA 3C08H 43C9A 3EOYG 2Y36L 4R2GB 5DZNA 2VQUA 5ITFA 2XV6B 3EDKA 3MV8A 3ARWA 3LKPA 5BV7B 2XFXA 2ZG1A 4AT6A 4XMLL 4ODUA 3UTPD 1KG0B 1FNAA 1KN2L 3AXLB 3EFDH 4OV5A 5KS9F 4LCYA 2DS4A 1OW0A 5JIIA 2O5YL 4PGEA 4I2XA 4LCCC 3EHBC 4NYLA 4LNRA 1PEZA 1Z0MA 3H3KA 2QTEA 2XZQL 5ILTL 4LOUC 3QEQD 1W72L 3TH3T 4PJFF 3ELAT 4HGMA 1FL6A 5C71A 1WEJH 4BFIA 1DQJB 2PKDA 5GIRB 3TFKD 3JTSB 3MA7A 4Q6IB 2EDHA 4WEBL 5DURB 1KENH 1EAJA 3VFVB 3LN5B 4GG6F 1FN4B 3VG9B 3DV4A 4PB9L 4R0LC 2ZOLB 4JVUA 5CJXC 3S3PA 3BPNC 1L9MA 3RWGA 1A7RH 3BPOC 2HN7B 3T1WA 4QTHB 1X5JA 5GGVH 2BFVL 2H26B 1MHEB 3BIKA 1N5YH 2XWJB 1RVFH 1DN0A 3NCBB 2VDQL 5IT2H 1YMHB 4ZSOB 2G60L 4WTXA 5JUEL 3VXSA 1RHHB 4Z7WA 5DWUL 4P23A 4GOSA 4JY4B 1CE6B 4HXBL 2QQLL 3TWCL 3LQZB 3T2QA 4TOYH 3FMGH 4K3JH 2JLLA 4UIKL 5KAQG 3WJLC 1CGXA 4HS3A 3VXPA 1F4AA 1Z9SA 3K1KC 4XVJL 4HF5H 4MNHA 2Q7NA 2V5MA 1Q0YL 4TPRH 5B39B 4KQ3L 4XVTH 3L9RB 4GRWB 4K9EH 4NP4H 5E03A 5CZVH 3EJJX 3KLDA 5F9DC 3STZB 3RWDB 4I8DA 4LAJH 3BYYA 5GRVK 4HWZB 1QFWL 3AUVA 2YK1H 2NTFB 4YDKH 5L0QB 3MJ7A 5GGSB 2NY6D 1OT2A 3WNMA 3SDCA 4XMPH 4ENED 4KTYA 2KQMA 1NGPL 2LAGB 3JWDC 4X99A 1I8LC 4PRNB 5MERA 3REWA 3MLTB 5HHPB 3EUUA 1GGYA 2BSTB 3TT1H 1TZIA 5CZVL 1YPZA 1T0MA 4Q2ZB 2Z8VC 5JA8B 3TO4A 3HAEA 2ITDA 3L5WA 4JEGB 3LDBB 1OGTB 1Z5LA 4Q6YA 5CLWA 1MQKL 2F8VA 4EBQL 1HZHL 1IC4L 1MREL 1YECH 3GMOB 1BIIA 5CSZA 4Y2DC 4TUJA 4H1LG 3O6FC 4Z7UE 1BFVH 1EZVX 2EDJA 3NZHL 5C0JB 5DI8A 1HHGB 1TTGA 1GGIL 2COQA 4PTUB 3BH8A 4JM4H 5ETUB 2ZG3A 5HI3C 2FO1A 4M6NL 1J9CT 1HSBB 5EU6B 3QWOA 4OLZH 3HNSL 2IALB 1XGQA 3LS5H 4U0RC 4JFOA 3RVVC 4HZAA 5CMAB 2NX5E 3RZWA 5GRZA 1GIGH 3U9PH 1I85C 3W81A 1T21B 1ACYL 1NCBH 4YH6A 3J8F7 4P3DA 2NTSP 2ADFL 1BFSA 3BKYH 1EAPA 4ZUTB 1JHKL 1ETZA 4PTTA 5HHOD 1O7SA 3K2UL 4LPWA 1NGXB 1JWUB 4JM2D 4L8DA 4X6CE 2J6EL 2AJYH 4J3VA 1NFIB 2HFFB 1U41A 2VDMH 4ODXA 5FYKU 1M7DB 2QBWA 3NH7L 4M5ZL 5GJTL 3W5MA 5CILH 3I6GA 5C07A 5ACZB 2EXYC 3GMQB 3BQUD 1J8HE 5IB3A 3OAYK 4KY1L 2R15A 4ODVH 3U9PL 3QEQA 1HHHA 5J9PA 4X6DE 1MWAB 1A3LH 2F15A 4KJPC 2VMFA 1HQRA 1D5MB 4U3XA 3U0TA 1ZEAL 3OJMB 5LBSH 1IQWH 4QHKJ 1RSFA 2VYRE 3RAJL 1R0AL 3FQTB 2JCCB 3SJVA 1LVEA 4HD9A 4XNYH 4JVPA 3B9EA 4MCZA 4OKVA 5DEFB 4O02H 3PDOB 5C0IB 1JNNL 4MXQD 3E8UL 4PJEB 2PETA 4I4WB 5E4EC 3T77B 4ODHH 2ICWJ 3SCMD 5F96L 5MP6L 2MCG1 3EOAA 2GYSA 4UT9H 3ME0A 1F3DH 3RKPA 3MRJA 1J0JA 4PJ9C 1NKOA 1RK0A 1EHXA 5F7DB 1PDKA 4D9QE 1QHPA 2VERN 5GGQH 1EPFA 4O5LH 5LBSL 4UINH 3V95A 3OF6D 4NQDE 4OCLC 5EZLB 5TPWL 2ZKHH 4OGZA 3HA0A 1S8DA 3QDJE 5E8OA 3LEXB 5MENA 5T3XD 3KYMB 1IQDB 3SKJL 1M71B 4FQJL 3DTXA 4KI5C 1GGCH 3BAEH 3TN0C 3OKDB 5EU4B 2GUOB 2BMKA 1HQ4A 1R3JA 2V5YA 2P5EA 1AFVL 2X1OA 1AP2A 3GSWA 1ZSDA 3QO1B 4QRTA 3PV7A 1GOGA 3CK0L 3WO4B 1LK3H 3MRQB 4JFDB 1F3RB 1CDGA 2CLZA 1VFUA 3O3DB 4TULH 3VFOB 4BFEA 1B4JL 4KKCC 2MFNA 3T3PE 5D7LA 3S88H 1QFWI 2H1PL 2P8LA 2VSCA 2R1YA 3KWWA 2NZ9D 3PGCB 3IXAB 3LKOB 3IXTB 3MOQA 1T2JA 4M48L 4PJBA 1J86A 3NA9L 3MRBA 1OM3H 4GLRH 4HJJH 5J11B 1QBMH 4KROB 4AENB 4R3SA 2Z92B 4QXTA 4UOJA 1CXLA 4G6AD 1LWRA 1SJEA 3D69A 1UFUA 4LARL 1NGWA 3NAAH 2X7LB 4YQXH 2MKWA 2I9LB 1TITA 4ZQKB 2XXCB 2BVEA 4OF6A 4OFYD 5L2KA 4XPFH 2AI0L 2P43B 5DMIH 1Q94A 3DX7B 3D0LA 4WWKC 3WJJC 4TVSa 4F37F 3IU4L 1IGMH 3KYOB 1UG9A 5E00A 4KDWA 1T1ZA 4K94H 5GRVL 4KVNL 1TIUA 1IZKA 4PJGB 4LSVH 5TDNA 2J8OA 5F6HI 1J1OL 4TUOA 1UB5B 1YNTA 3MRNA 4KQ4H 4NDMA 1MFBL 5F9JA 2J7LA 3VE0A 4ZOCA 4NKDA 3QA3B 4NJAL 4XP9H 5DURD 2YBRA 1A21A 3ULVF 4YHML 4YWGL 1FZJB 3QEUB 2IADA 5DMIL 2IH1A 2ZCKL 4S1SH 4LLQB 2XQYK 1M05A 1IGML 4F58H 4WHYH 1S5IH 4JB9H 2DTML 2A73A 2CDFA 1F97A 4JFXA 4UB0H 1CL7H 3O3BB 5EZOL 4NC1E 1NC2B 1MF2H 1HNGA 1F00I 1KTLB 1B9ZA 1FVEB 4NCDA 1Q9LB 3MRPA 4EXPX 2GSGA 1FPTH 1T5WB 3RI5K 4ZOBA 5JR1L 3O8XB 4U6VH 5K9JL 2VXTH 1JHTB 3O6ML 5HHQB 2WM0A 3FB7A 2E27L 4HS8H 1HHIA 1BP3B 3TNNB 4JM2A 1CDIA 1TZHB 4PJCF 3UYOD 4DN4L 4JGUA 1R6VA 4WJ5A 3UO1H 5ISZE 1H15A 2CRYA 1HIMH 2VLKE 3HI1A 3MNZB 3D3VA 2GK0B 1MFAH 3SDXE 3IDXL 1A1NA 4IM8A 3U9UB 4EXKA 3SO5A 2IMNA 5GGVY 1G7LB 4GQ9H 3HMXH 3D5OF 3MTRA 3MLVL 1J11A 2EDRA 4L9DA 4RAVA 25C8H 3CDYA 4QXGL 4CVZA 3T4YA 2W0FB 2H32A 2ED8A 3HR5B 2R2EA 1KJVB 1TJIH 1OARL 4HS8L 2LU4A 2XOTA 1QO3A 4KGJA 4ZFFB 4KUCF 1XGTA 4G6ML 3MZTA 3GSNH 3NFSH 3QPXH 3BFOA 4OCWH 3IDMA 5I74C 4XBGA 1CGSH 2YXFA 4JJ5B 2XKNA 3L5JA 2V7NB 4JANB 5I1IL 4GQ9L 5C6WH 1QSFB 4O4YH 2XWTB 3H7LA 5EBGA 1U6AH 5CGMA 3IJYB 1NBZA 3FQRA 5TE6H 5GZOC 3GSXB 3LZFL 1UWGL 5ENWA 2QSQA 2YRZA 1QSEE 4WW2F 4P5KA 4FFVD 1BJ1J 4H1LB 3C60C 3RA7H 4LNVA 3S6CA 4RBPK 1F4YL 3F7YB 1N6UA 1YJDL 2HMIC 3DETD 1TVHB 1CTNA 4XC1H 4XP1L 4LU5L 3FT3A 1BAFL 1TCRB 4FZEH 5DD6B 4NQDD 2DL2A 4QCIA 2HJLB 2F53B 4G43B 3AREC 1FL3B 3QDJD 3ZE1F 4IMLB 3UCRA 4HJ0C 3MFFB 1BLNB 5EU6D 1CR9H 5MEPB 1F2XK 2DLEA 2WQRA 1PSKH 4U1KB 3BXNA 4XCCH 1UKTA 1VFBA 3ULUC 3F7VA 2EDWA 1N2RB 3LPGA 1ZLWH 4ZUVB 4XVSL 3RGVA 4X7DC 4HZLA 5D2NE 2D03H 3MFGB 5DQJB 5SWZB 4WV1B 4NT6A 2Z9TA 1XR8A 5ICYA 4JFHD 5EUKA 4WI4A 2GTZA 1OP5H 4CJ0A 5FF6B 1CD1A 3S5LA 4GXVH 4OIIH 4K3EH 1HXYB 3PABB 1ZXQA 5K9KA 2ZCHL 3I02B 4N5UA 5ITFB 3MV8B 3VWJB 3LH2H 3LKPB 5JPMB 3GM0A 3D39B 4ZAKA 4GRLA 1RJLB 4G9DA 4N0CC 1E27B 2EO9A 5MEOA 1LE9A 2WBJA 2P49B 2V9TA 1QEWB 3RL2A 3CNKA 1Q38A 5GSVA 1RIVH 1OP3K 2AABH 4M93C 3L3OA 3FB8A 2SEBA 1T1WA 2NYYD 2OL3L 4UDTA 3BPNB 1JTTA 4NRXB 1A7OH 3BPOB 1MRFH 5HGGS 2Z4QA 3FOLA 4Q9BA 4PG2C 4Z7UA 3WXWH 3TBSA 3S37H 4U1NB 5IMKB 3FL7A 4XP6H 4GMTL 5FUOH 4OZIF 3MXWH 3V4PH 3RVTC 1WCBB 2E6JA 1PY4A 4L4VE 4QYOA 1EJOH 5D6CB 5TE7H 1CCZA 3ZTJH 3MO1A 3HMXA 3OJDB 4HJGA 4XTRC 3CFDA 4PREB 3FO0H 2W9DH 1RUQL 3HC0A 1DN0B 3G5VA 1HHJA 1KB9J 2VDNL 1REIA 2NX5A 1YNKL 2QR0A 4M02A 1BZ9B 4KJYA 3C5SB 2OR8A 1OL0A 5BJTB 4PJ5B 5EC2B 3EYFB 1YN7B 2P8PA 1RZGA 3GSOA 4PRBA 4IJ3C 3HB3C 4M62L 1XF5B 4TNWK 2KPNA 5A2LH 4FG6D 4RSVA 3WN5C 3HZKA 4GO6B 2DYPA 2K9UA 3GSNA 4XPAL 4JN1H 3IETB 2X1QA 1U2HA 4JFDD 4MNHB 3K4DA 5TH2B 4FXKB 1HXMB 5D7JB 1L7TL 4XXDA 5BRZE 1BWWA 3EO1A 4OV6F 4XNQA 1XF4B 1Q9KA 3C2AL 4XX1E 3MCLH 1CS6A 1YEHH 3K8KA 3H0TB 1J8HA 1F90H 4J1UA 5AUMA 3VFMA 4MAUL 4XBPA 3SGDI 2UWEE 4D3CL 1J5OL 4X6DA 1F11B 2HWZH 1U8QB 3QRGL 4X8XA 2VRAA 3WFCL 2PO6A 2JB5L 1KJ3H 5IQ7H 3MJ7B 4TSAH 1AR2A 1ZGLB 5DQ9B 4PUBL 4UNTA 1XCTB 1XGPA 3SE8H 2ESVE 4WNQA 5E9DE 3SDAA 4HIXL 4DKFH 5FDWA 2X4TA 2Q1EA 3CFIC 5DHXB 1N59B 1T7ZA 4HS6B 3KHOA 2A6KA 1MAMH 3O6FB 3UBXB 1YEKL 4PJXF 5D7IB 5CEXB 3DJ9A 5HHXH 1NL0H 4XBEL 4OZHB 5E8PA 1KIUA 3MGTB 4G9FB 1QSED 3ECBA 1VEOA 3T0EB 1UYWH 3RVXC 2NXZC 5DJ6A 3MRIB 4MQTB 1P4IL 1W72B 4KKLD 2OL3A 4TVPL 1XFPA 1SVZA 2HRPH 3NCJL 4PJAE 3QHFH 1M7IA 2Q8BL 3ZDZF 3HKFA 1FYHB 1G9NH 1NCCH 4D94A 4GW1A 1I1RA 3VRLF 1N3NA 2FATL 3VGFA 4DCQB 1DVFB 2V17L 4PBWD 3V6OC 4OQTH 1U9KA 5DJ8B 1OT1A 4JFOB 2MJWA 4OM1H 3AC0A 3GZKA 4OD1H 1JNLH 8CGTA 3V0AC 3RKDD 3ZKQD 5KVDH 2JJTA 2EYSB 5A3ID 5E8EB 1RV6X 4S10A 3M1BB 5DLMH 5IBLD 4KH2A 1QVOA 4ZS6C 4UNUA 3L3IA 3CH1B 4JR9L 5DGRA 2D7QA 4X6EA 4Z95L 4PTTB 1MIEH 3KPLB 5D71L 1KXQE 5F44A 4IRSA 4L8DB 4ZPTA 5BO1H 1OAUL 3ILPB 3O11B 4RMUA 3HRPA 1K6QL 4ODXB 2OJZH 1UM4H 4NQVA 4GKNA 4Y4KD 3AMKA 1KCRH 4P0DA 3O4OB 1NSNL 3FO9B 1FNSH 5IB3B 5C2UB 4XZUA 4M7LL 3IRZA 5EOCL 1KCUL 4YBQD 3CFEB 5I6XC 5LWYH 5ELIA 3QH3A 4R4ND 2AXGA 3U0TB 5FK9A 2AQ2A 2AERT 1OAKL 1MIEL 3O0RH 2GY5A 5IJVA 4NCC2 4AMKL 3RVWD 4NRZA 3OKOA 3NPSC 4QHUA 4X7TA 1YNLL 1QSFD 2DJSA 5CIPH 4HK0B 1YC7A 5F1KC 4PRIE 2FEEL 1SEQH 4WENB 2A1WH 4YBHA 3SEPA 4RA3A 1I8IA 4L9LC 4TN9A 4DGIL 1YYML 5JW3H 1WSST 1ZT7A 2C4XA 4G9FE 3VD4A 1R3LA 3G6AA 4FZ8L 1Y0LB 4NO2B 4MD4B 4DZBA 3K3QA 1XGRA 1FZOA 4PGZA 4Z7NF 4BH7B 1L7IH 2J8HA 5T1LD 1AC0A 5LCVH 3UJTL 3DUSA 2C1OA 3VI3E 4YDJB 1NGZA 4ELKB 1PGRB 5I8OH 1BMGA 4MA1C 2F53D 3IDIA 5L8LB 1MCOL 2Q6WB 2BHUA 4NZJA 5BQ7A 2ORBH 3QUZA 1GC1C 3GBNH 4OLEA 5EZJB 1JPSL 2APFA 1V3LA 4JO4L 3O4LE 5ISZA 5BXFA 1ORQA 4ISVA 5KSUA 3FQUA 1MHCA 2VLKA 3FN3A 4K23H 1QHOA 2B1AL 3MREB 3OKNA 1AQKL 1LNUA 1HEZA 1QYGL 4LSUL 1GYAA 4HPOL 1C5BH 2P44B 2ZUWA 5MHSD 4UT6L 4Y19E 2BVTA 4BSWA 3J7HA 3KPNB 5JDSA 4KK6C 1DCLA 2UYLA 2FH6A 2QKIA 2VZ3A 3WIHL 4MAYA 1MHHA 5HVFB 3ARTA 2HJKB 4WWKB 4WUUE 3V9FA 1U8HA 4GBXB 4LIQE 1T03L 3DUUA 4N90D 5TE4H 3EHBD 1U92A 5F7WC 3VWJD 4OFKA 4LOUD 5IHLB 4FQLL 1ADQH 1ZHBA 4N0UE 3RRQA 4OZGB 1U8KB 3VXQA 1DBML 2AJVH 2C3VB 4DWHA 5CD3A 5JIHA 3ZKNC 4NQSA 1F02I 1GOHA 4M3JA 3U30B 4N5EC 1HH9A 1DQML 1NDGB 3UJJH 2Z8WC 4OQTA 1J0ZA 1QSEA 3BN9C 5EFIB 5TDNB 1B0GA 3IVKB 2VLLB 5T3ZE 1CDBA 5M7QA 1T0PB 5HYQA 1CXFA 4JPKH 3VE0B 3HPJB 3BZFA 5FYLD 4UI2A 4ZFZA 3JVGA 3ZSSA 2BOCA 2K1MA 3QUML 1S7QA 2YBRB 1URLA 2BNUB 3TVMC 2X4NB 4MNGE 5E8NA 5D8JL 5D2LF 5J1SC 1E6OH 3SE3C 2DMKA 5IB4A 1S7SB 1NEUA 2AJVL 5JW4N 1JZ5A 1IEBA 1YEEH 1M05B 3BP4A 2X44D 5CGYC 2GJZA 2ATKA 2UUDK 5HGDA 1J0HA 2H2SC 3O2VH 1OD9A 1G84A 2A73B 2CDFB 4JFXB 1JYNA 2XY1A 1IAOB 4PJ5D 1HHKA 1T66D 5I1DB 2ZUQB 4HHAB 2GSGB 4YK4C 2BOBA 3K80A 4AQOA 3L3HB 3F5WA 4E9LA 2VZVA 2VLJE 1JK8B 5D2NA 3DI3B 3QUKB 4OM0H 5C6PB 3ARFA 3TZVA 5IK3A 5IV2B 3PP3K 5D7JD 2WUBH 3OPZH 2AV1A 4RFOH 3QP3A 1V7ML 2VXVL 4GH7B 1SJXA 5CIPA 3D3VB 3HTLX 3QB7C 1F3DJ 1A6AA 5I1EL 1A1NB 1ZTXH 5DK3A 2X89A 5D7KE 5ERWB 3HUJB 4RGNE 3KYAA 4BSVA 4J8RB 2XQYG 4H8WC 4RAVB 4L1DA 4MJIE 5JXEA 2FL5B 4KZDH 2APTA 5JOFB 1KCKA 4F7TA 5DGQA 1F4WH 1TPXC 5DRZA 1ZA6A 2H32B 1JGVH 4NFCA 5DJ0B 3VDCA 2ATPB 1BFOB 4G6JL 1KCVL 5B8CC 1L0QA 2FEEI 3S7GA 1C5DA 1ORSB 1JIBA 2VAAB 3IFOA 2QJDA 4IRJB 4HKZB 4NKIH 3C60B 2ED9A 4XBGB 3WEXA 2I9TB 4PYHA 1NGYA 2UZXB 4OI8A 4E0RB 1X44A 2ZOKA 3O6FD 5DRNA 3JWDH 2BVOA 4L4VA 5DJ2B 4EQ2A 2UY6A 3G04A 4C4KO 5ENWB 4FABH 2W59A 4OD3L 5T1LA 4G9FD 2DN7A 2HTLC 4Q9RL 1CDYA 4IRZL 1NQBA 1RZ8A 3W5NA 5HI3D 2KKQA 5I1GH 8FABA 4ELME 4Z5RB 4OB5H 4PJHF 3U0WL 3P4MB 1MEXL 1EUTA 1DUZB 5ACMA 3RVVD 5GZNC 3GMLA 2P24A 1Y6MR 3C2SA 1VSCA 2ITCB 1C7TA 1R5IA 3B9KC 2ADIA 2PCPB 2GW5A 2QQNL 1KJMB 3Q6FA 5F70A 3C6LC 5GRUH 1A64A 1DVFD 3KPOA 2Q76B 3RNKA 1LO3L 2QADB 2EDXA 4OUUA 5BRZA 2R69L 5AZ2H 4EI5A 5I9QB 2CQVA 3NIFF 2KZWA 5F7EL 5D1QB 3IRPX 4NZUH 5A16A 5JNYB 3WFEL 2DF3A 2UWEA 4V2CB 4Y16C 2R0KH 4KJWC 2EXYD 4D9LH 4LCCA 1CFTB 4PB0L 1NPUA 5INDA 1UZ8A 2C4FT 2OR7A 4Q0XH 5IFJA 2A77H 5EUOF 5JW5A 4KJPD 4WUUD 5HYIA 1KCSL 4HDIB 3W0WE 3O2WH 5GJSL 2J8UE 1MFEH 4L8SC 4ALAH 4FXGA 1T04B 2YWZA 3LKSA 3CVHL 2ESVA 5E9DA 1SQ2N 3MODH 4YHYC 5HHME 3BWAB 5E56A 2MPAH 4R0LA 5I30H 4PR5A 1WQVT 5CJXA 5MEOB 4NNPL 5H94A 4XVUC 4N8VB 1I9JH 2ZUUA 3N9GL 3U0PA 1A6WH 1A7NL 4HIJA 4PJDE 3GKWL 5EO1A 2EYRB 1WVZA 1WFOA 5FYJL 2SEBB 4XP4H 1N4XL 3U46A 1U3HC 4G80A 4L4TB 4LIQH 3IDYC 3FOLB 1R3IH 1OAQL 5JMRA 1F45A 1GVIA 1A5FH 2E9JA 4OLXH 3QIWC 1JCKA 2AQ1A 4HIIA 3QDGA 1IKNC 1SY6L 4BQ6A 3UZVB 5F88B 1NBQA 1P1ZB 5DJCB 1RUPL 3IGAA 1JGLH 2W65A 2CJUL 2ICCA 4LLUB 3WJLA 3BT2H 1FJ1A 2C26A 3HI6L 4QYOB 4KI5D 4ZNEE 4C57C 1DQDH 4KVCH 5DJDB 3T3MF 3CFDB 5K59E 3ES6A 4HWBH 4BSJA 3DO7A 3HC0B 3BGMB 2XG4A 3DRTB 5T3ZH 2NXYC 1VA9A 3ULUE 1C16A 3U2SA 2Y6SD 4MJ5A 3BH9B 4F8TA 1MRCH 4OFDA 3KLSA 4NBXB 4XH2A 3DMMC 4P4KA 2VOTA 4KKCD 3PP3H 3MACH 3CD4A 3VGDA 4NZRH 4ERSL 1YQVH 3HN3A 1WWAX 2VLJD 5DUBB 3NCFB 5TDOA 1ZT4B 1FH5H 2HT3C 3SE4C 3TYGH 2O93L 3EO9H 4QHNA 1CLYH 2R2BA 3UTTE 3G6JF 3WYRA 2HH0L 1W0VA 4YE4H 4DOHE 3O2DH 4W4OC 3KLHC 1EMTL 2FGWH 9CGTA 1S3KH 5T1KA 4NZDA 1DN2A 2AW2A 4PRDB 4HH9A 4G5ZL 4H20L 1ZLSL 3MJ9H 1FRGH 1EGJL 4OGAD 4WWKD 4GBXD 4X4ME 3CU1A 4ZO7A 1K8DB 4ETYA 1MI5E 3DVGB 2VDLL 5FA4A 1YQVL 1IM3A 1DBAH 1ZHKA 3B2VH 3A6OA 3MYJA 3SDYH 3VCLA 2YEZB 4Z7VB 3U4EB 3OWEA 4Y2DA 4LL9A 1XGPB 3OKLA 5JXAL 4JQVA 1WCQA 1OTSC 2I5YL 3EYSL 1WK0A 4PRIA 4BK5A 3CDGB 2VXSL 1K3IA 5EORH 3ZDYE 1IGFH 3AU1B 5E6IC 3HFML 4LHJB 4YBLC 1KJ2H 1ITCA 3CVHA 4F2MB 4WCYH 1NDMB 3VWKA 3TJEH 1UT9A 3HPLA 5L7XL 4R96B 2DM2A 3MROA 3L5IA 3RGHA 1UZ6F 4PLJD 2D7TL 2CDGB 1I85A 5ACLA 5J13C 4ZTOH 5C09A 4JPWL 4OLUH 2OL3B 5BZDB 5KS9A 2WUCL 2OK0H 3P9MA 4LRIA 5IP4A 3VGHA 5T33H 4GW5A 5J1TC 3O4LA 3OAZK 4KMQA 3ZYJA 2BDNL 1KJ2L 2F8OA 1SY6A 4UZGA 4JG1L 3D18A 3DECA 4Z78A 5HPMA 1HKFA 2LVEA 4G8IA 3N1MC 4Y19A 3MV9E 3RWIB 1MNUH 5E95B 3FB5B 2BZDA 4KRPB 2OX5A 1P5UA 1A4KB 3L3IB 4UQ2B 2AEPL 4WUUA 1JHLL 5KG9B 4R8WL 3BKJH 3H42H 4YX2L 1R3KA 5J57B 3MLUL 3TH4T 4GKZB 4KRNA 1G7PA 4IRSB 3HE6A 4XCYA 4S1QL 4ZPTB 1D5ZB 1AHWB 5I6XB 4HXAH 4L3CA 2IC2A 3P73B 4KHTL 1ZOXA 3QFJA 1YN6B 1F3JB 5FKPB 5J06A 1BPVA 1WBZA 5D5MB 2X1WL 3DOSA 5C6TH 3VGBA 1MCSA 1DFBL 5E6YA 3PHOB 2YD8A 4XZUB 5HHMD 3EOBB 4HWBA 4MJ4A 4XNMA 1LEIB 1RUKH 3FN9A 4NO0A 3OKEA 3LY6A 2BRRH 4MQ7A 4PJ9A 5GZOD 1RZJC 2AXGB 3VMPA 2IANE 4IRJD 1EGJA 1MELA 3WE6B 4UV4L 1SVCP 3C60D 3NVQA 3QQ4B 5FB8B 4O2EA 3WD5H 3L3GA 3OKOB 4MNGA 3X14A 4X7TB 1PZUB 1Q72L 2MKLC 3CVIL 5KJRH 4WW1A 2HFGH 2HLFC 5GGTH 1UJ3C 4LCUA 1I8IB 3TN0A 1R3LB 5KAQF 3TIEA 4PRPE 1MIML 2X4SA 3O2DA 4MSWA 5L88H 3HRZA 2HLAA 2DQIH 3V6OE 2BRRL 2R29H 3PWVA 3VH8G 2KBGA 5DK0B 3T2NL 1AKJA 3MJ9A 2R1XB 3DUSB 1I1YB 4ZFOL 1NGZB 2BP3A 1ZHLB 2EEDA 4X8JA 5IGXH 3ULUD 1KELL 3IDIB 4QF1A 1FGNH 4JFQA 1SBSH 3BHBA 1KLGB 2GFBA 4PV8A 1MCNA 4LSQH 3ZE0F 1RMFH 4YXHL 4AG4H 3TA3C 3E6FB 4M1GL 3FQUB 1MVFA 3IJHA 4WDIB 2ZSWA 1YYLH 1WUNT 4ZDHB 5D1QD 3O6KL 5C0RL 3KPQB 5KSBF 3MRCA 1QR4A 4CUCA 1RQ5A 4BA8A 1KJ2A 5IWLC 2NY3C 4MJIA 4PJ7F 3WHE0 3ULUH 3IF1B 1JE6A 3MRDA 3ARRA 4KTDH 5INCB 5DFVD 3B43A 4N0CD 4Z7QF 5F6IC 2GJJA 2NY5L 2G75A 1EBPA 1JMXA 5TGBB 1YEGH 3RX8A 3V52L 1MI5D 2DQFB 1XR9A 3LS4L 1TDQA 4MXWH 3I84A 3P4NB 1ES0A 1JZ8A 1VGKB 3BUYA 3VFSA 4JCMA 1L0XA 5CZXD 4OZFH 2OP4H 2DQTL 4OT1L 2VKXA 4ODTH 4YLQT 1WBYB 4P2QB 4YNYB 4WIQA 1WIUA 2M1KA 3U83A 3QHZL 1CN4A 3IU3A 4DUXA 1DTUA 3QXDB 2P8MA 3RDTC 5E5MB 2GKIA 1B0GB 1U58A 3RVTD 1A0QH 3IDNA 4L4TD 1YMMB 3SN6N 3R0MA 3V0WL 4CMHC 2CH8A 1CLZL 4XTRD 4ELMA 1WGOA 1INQA 1A6VH 4LF3B 2IFFL 3CMOL 2XPGB 1QA9B 4BYHA 3ARPA 4DN3L 3OAZH 1P7QD 3EGSB 3KLAB 1JRHL 1OAZH 4YK4B 5HPOA 1QSVA 3BGAA 1IT9H 3TV3H 3ULVL 1FP5A 2X1PA 4PJ8C 3B3IB 5BZWB 4C83B 2LFGA 4WFEE 3MRGB 3W39A 5GRJL 5SX4I 2FLBT 4LFHG 1OTTC 4NZTL 2C3WA 5C9KA 3HE7A 4BM7A 2WBKA 1HHKB 2Y07L 1E6JL 4LSTH 4OD2B 4QOKE 4TSCH 4U1IA 3VG0H 3WS6C 1NUDA 5E2VL 4KKNA 1PLGL 4CN6A 2FWOA 3WDHA 4G7YL 1SHMA 3PWLB 3F5WB 1G1YA 1T22A 1AXSA 3QJFB 2Q86A 3QIBC 4I77L 3BKML 3TZVB 4X6FB 5IK3B 5F8QC 2LV4A 2DQDH 2Q7YA 5SV3A 3V6FA 5D1XA 3W0WA 1TPXB 3OR6B 1X6LA 3O3EB 2J8UA 3CMGA 1EXUB 2D7NA 1QFUH 4IHOB 1N0LA 5JO5A 5GGTA 4YHLH 3HCVB 4DUVA 3OMZA 4BSVB 3MV01 2XA8L 1KIRB 5I1AA 3LKNA 3MRMA 1XGYL 2O26U 1FO0L 3R4DA 3UMTA 3D9AL 1ZA6B 4PJDA 4YHIA 3EIFA 5IR1A 3THMH 4GRMB 1T1XA 4L29A 4UUJB 4U1JB 3HZYA 5FYKL 3P30H 3X3GH 1I7ZA 2DQDL 2YXMA 5JLZA 4TUKH 1MHPL 5FO7B 3L3DA 2OLDA 1MAKA 3QPQC 2NXZD 4X0KA 5T5NF 2EZ0C 3NIGF 3FFDA 3AREA 2PR4L 5D1ZC 3MNWB 5A2FA 3L95A 4Z7WF 2BVOB 4F7MA 3ARBC 4D0CB 5CINH 1CFNB 1UA6L 4FQ2H 1UEMA 3FAXA 1K8IA 1C5CH 4C56A 4XPBL 4PRPD 3F12B 1Z9LA 5IFAL 4KZEL 3NZ8B 5J56B 1PX3A 1QSZA 3KYNB 5GHWL 1P7HL 4LCWB 4NC0B 5C0EA 5IM7A 4JREC 3D85A 3AS0A 15C8H 1TCMA 3P9WB 2XN9B 4MHHI 5I8KL 2ENYA 5ALCH 5IIEB 3MLRH 4XRCA 1MQ8A 1DBKL 3FONB 3QUMB 4ZS6D 3VXME 4F9LC 1QRNE 4Y16B 5GS1A 3QNZA 2ADGB 2CLVB 2EIZA 2F54B 3KPOB 4UIMA 3UTTA 4YR6A 3GSUB 4MDIB 4OZFA 1NBVH 4XC3H 4H25A 4KRPD 2EO1A 3N0PB 4R7DA 3QISA 5C0DA 1K4DB 2WLYA 4W4NA 2EH8H 2LVCA 1KLUB 3G08A 1RULL 5CJ5A 4HC1L 1UCBL 3G6DH 4P9HC 1FQ9C 3GMMB 3RL1A 2YD1A 15C8L 3EYVA 1WT5C 1N64L 1UWEL 3ARDB 1EIBA 5GPRA 1UXWB 2HT2C 5JW5B 1U8NB 1YPZF 4UU9A 1I8MB 3QUXC 1EK3A 5JHDB 3LKSB 4JRWA 4XP5H 1HN1A 1N0XH 1B6DA 3MV7E 3S97C 1IC5H 1U3HB 5EBLA 4JHAL 5CEYA 4P2RE 1AJ7H 4NNXB 3QIWB 4Y5VC 1VFAB 2IH3A 4HIJB 3NN8A 4JGMA 4PJCA 2MQ3A 3P3YA 1Z3GL 4P99A 5EO1B 1ZE3C 3VXUA 1DUYB 3X11A 3HLAA 1YEIH 4M7KH 1JGEA 4K3HA 3G5YA 4LLDA 1JRHI 1MCDA 3QCTL 3UC0H 4JE4B 1P7QA 1GPOH 2Z91A 5DDHB 3TO2A 1XIWA 2C5DC 1X5IA 2IAMC 3P0VH 3RY5A 5GS2D 3TBWA 3QDGB 4B7IA 2A83B 5MI0C 4ZO6A 3WN5A 3BVNB 3TP4A 4CAGA 3VH8B 2OMBA 3KHQA 3U79A 4NRYA 3DMMB 4NPYB 1HH6B 3N85H 1I3GL 5E94B 1DLFH 1FZKA 5IVZB 3W2DH 1U42A 4NM4L 3MV9A 1E4KC 3RWJA 4PY7A 4JKWA 4WFED 5IOPA 4MJ5B 4OQ1A 3VI4F 4GSDH 3KDMA 4P4KB 5I1CH 5GS2H 2F54E 4ZFGL 2AJSH 5F71A 1OOAA 1OPGH 1G7IA 2VISB 3BSZH 2VN7A 4OF8A 1GC1H 3KYKL 4TVPD 3MLXH 4WW2A 5I66A 1RI8A 4FFWC 2CKNA 3S96A 2F19L 4CNIA 2CDEA 4XT1C 2QSCL 1AY1H 4RMSA 3BIAX 4F9PC 4JFFB 4KKAC 3GJFK 2YHGA 2JJWA 3G9AB 2CUHA 4HH9B 3B5TA 3FKUS 5ID1A 1XZ0B 4YGVB 1SJVA 1A02N 2HTKC 4HCRL 2X9YA 3ZKND 4NQCE 3CAFA 2BSSA 4LPCA 4N68A 3BEWA 1JYVA 2FHBA 2C1PA 3FB6B 4PRHE 4MHHG 1Z9MA 2IANA 3BN9D 3C8KB 2B8OT 4YBLB 1WITA 3L3JA 3O3UN 4FFZH 3BZ4B 3FT2A 4X9IA 4P2OC 1AI1H 5ADOL 4P2QD 3QIUB 1FAKT 5DYOA 3M8OH 5FEBA 1WBXA 1OB1A 4TYUA 3NCYP 1AXTL 1YMMD 2R56H 3L5XH 5CBEB 1FYTB 5DJZB 1QBLL 5CGYD 1YUHB 5IEKB 2E7CA 4HQQL 1HILA 4E5XA 3IFPB 2H2SD 5HGAB 5DC4B 2I60H 3MROB 4XHQA 1U8PA 4O51B 3RZCC 3QRFM 4DZ8B 4FMFA 2VXUL 1HSAA 1QG3A 3MLYH 4IDJH 5C09B 4HV8B 3HC3L 3T2OA 2F58L 2OQJB 3KPSB 1NAKH 4RMVA 5KS9B 2HKHL 1CDJA 1IBGL 4M1CC 5FOJA 2VABB 3OKKA 3BE1H 5BOPA 1X9QA 4YDIL 5IESH 1VPOL 3AY4C 3UZQA 3T0AA 4KK9C 1IGIH 3QQ9C 4PJFB 4PJBF 2FEDC 2R56L 5EN2A 3VXMD 4Q9QL 1WICA 1GGTA 1QRND 3DXAE 4UAOC 5HPMB 1CGUA 2L7UA 4TQEH 1CWVA 2KUTA 4G8IB 3WLBB 4HKJA 1K4CB 3MBEA 3QNXA 2Y06H 1NUNB 5ANMA 1B2WL 3CU7A 5FM8A 4GG6B 1NMBL 5GISL 5IW1A 3O45B 4UMGA 4ZOAA 3L3KB 4TRPH 1EFXD 2J5LC 3DARA 5HYJB 2DQUH 3ZT7A 1IRAY 4Y5XC 2YD3A 1M4KA 5F7LB 1Z6JT 1FFQA 2NY1B 35C8H 4HKBB 3HE6B 4CMMA 2O5ZL 1UKSA 4UQ3A 4HG4J 4K8RL 4HKXA 5ICZA 1K3ZA 5SWQB 1U2CA 1DSFH 5FHAH 4I3SH 3QFJB 5GS0H 4GAGH 1U8LB 3UXFA 3JV4B 5FDYA 2PW1B 3NABH 1AD9B 4U3HA 2R4SH 4PGBB 5K33A 4H8WH 2PYFA 4NO3A 4P2RD 3GI8H 4NO0B 1UJ3B 4MQ7B 4DAGL 1SMAA 4LASL 4M5YH 1TQBC 4BKLA 2RJMA 3X3FL 2DQUL 2DMBA 4JQIH 2HTLD 4HCRA 1UENA 4X4ZA 4LVOC 3L3GB 1N7ML 2PTUA 5IBTH 4OGXH 2O5XH 2EDNA 4OBRA 3UPRB 5GZND 4WTZA 5EDXA 3PWJA 1V3JA 3B9KD 4AH2B 3UTSB 3DVNA 5C0GA 1IGCH 3C6LD 3ZKSD 1I8KA 3R0NA 1NFKA 4P9MH 3BMWA 5F9WC 3U6RA 2GK2A 3PWVB 2V2TB 2OR9H 4JM2F 1CLOH 4LEOA 3KPSE 1AKJB 4QOKA 3T8XA 1AXIB 1A6TB 1A9BA 1TZGL 4GKSB 4ONFH 4XXCC 3FO2A 3VMOA 2XN9D 1X6NA 3VGAB 1K5NA 3UX9B 5ID0B 4CU8A 3IYLW 3NCEB 4Y16D 4YHNA 4PP2B 2F54D 3IJHB 1WZ1H 1ZA3A 2DLIA 3MRRA 4U31A 4XAWL 1CICB 3CSYA 1A14L 1D5XB 3G9VA 3KPRA 1KN4L 1F8TL 1DQLH 1A3QA 4PGJA 1RJZA 4QTIL 2ARJA 3V5DA 1ULVA 5JHLH 1DQQB 3IKCA 5DD3L 2Z0BA 1CF8H 1I7UB 3ARDD 2X2YA 4UILL 3RPIA 4U7SA 4XVUD 3D87B 4MD5A 4PV9A 7FABL 5H37H 1LO4H 1NCNA 4WY7H 3VRIB 4MA7H 1KPUB 2J2ZA 4OCYH 5TQ0H 3H9SB 2FDBP 3RDTB 5JHDD 4NJ9H 1U3HD 3TVMA 5DR5H 4WI3A 5CP7A 1GAFH 4G8FA 5DUML 3SE3A 1NEZG 5FO9B 4J6RH 3PIQB 3QIWD 4OFIA 1IVLA 2FX9L 3O9WC 4KHXL 1XEDA 1U8IB 4ZUWA 4A6YL 1D5IH 2ZCLH 1FDLL 3MLSH 3ARGB 3X17A 3H3PL 3HNVL 1VENA 1HOCB 1NMAL 1U58B 2HG5B 4NUJB 5J6GB 2EH7H 2FNBA 3WFBL 3V2AR 5IMOB 4XPTL 3B5HA 2RCSH 2H6PA 2NY6C 1T7WA 2E9WA 2NXYD 1IC7H 2J88L 1BQLH 1IM9B 3IJSB 3GDBA 5HD8C 4JCLA 2EDQA 3FRUB 4P46A 3DMMD 4LKCB 2WBWB 1NCWH 3ZZ1A 4N1CA 1NC4A 1NANH 5I19H 2XKSA 3UYPA 1QLEL 1H5BC 5IB2A 5KTEH 2FX7L 1BF2A 5AYQA 5EA0L 3W39B 1R3HA 4P57A 4NM8L 4MGXA 2HT3D 1LDPH 1T6VN 4AEHL 4UTBL 3L7FA 1J1XL 4O2CA 4EDWH 3HE7B 3O41B 2XYCA 2DQEH 3DHMA 4AIXA 1SEBA 4NKMB 3KLHD 1IFHL 1ZVSB 4KUZH 2DBLL 3NCMA 4YDVB 1JF5A 2YD9A 5DS8A 3STLB 3CLFL 5DVMA 4QRPB 1PKQE 4ZFOB 1AXSB 2CD0A 2G2RB 4FQHA 4LRNH 3WUWB 5B3JE 4CGTA 2DLHA 5B8CA 1YA5A 5FM5O 4ORGA 4OLWH 5D1XB 2I27N 5I19L 5C0BB 1Y6KR 3DO3A 2ICEB 5CJBA 4M43H 5KTEL 1T5XA 2DQJL 1RU9H 5JO5B 4MWFA 4JFFD 1SYVB 5EIVA 3CLEL 3MV7A 3M17A 3VGGA 1CFVL 3NFNA 1GRWA 3QCUH 1T89C 4P2RA 1QACA 1OTSD 1IGJA 1U8MA 2H45A 2ZNXA 3MRMB 5J4MA 1ZT1A 3QG7H 4NC2B 4Z7UF 2VR4A 1HCFX 2DIAA 1JYXA 4L4JA 4BZYA 3FRPA 2X4RA 4YEFA 3W9DA 3MJGX 5IMMB 4ZYKB 1IKFL 2XZCL 4P59H 5AWNH 3V6BR 3DNKA 2ZPKH 1I7ZB 4OAWA 5E7BA 1AGEB 4PLOB 4RISL 3RY6A 1NCDL 4M43L 4AJ0A 3ETBF 1IL1B 3QIUD 2D4DA 43CAA 1DBJH 1RU9L 4LKXB 3B9KA 5E7FA 2AJXH 3B9DA 2D0HA 4M61A 4HAGA 3C6LA