1FPTL

Three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
219
Chain Sequence
DVVMTQTPLSLPVSLGDQASISCSSSQSLVHSNGKTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTYFTLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSEVQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex between the Fab fragment of a neutralizing antibody for type 1 poliovirus and its viral epitope.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Complex (antibody/pv-1 fragment)
molecule keywords FAB FRAGMENT OF AN NEUTRALIZING ANTIBODY FOR TYPE 1 POLIOVIR
total genus 42
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1995-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fptL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fptL01
1JTPA 4NHUB 5FOJA 3PWPA 1IGIL 1Q1JH 2WBKA 3UBXI 5BRZD 5BS0B 4K71B 1U8MB 1RU9H 3O3AA 1CXKA 4MAUH 4PLJD 2OBGA 1RIUH 4GOSA 1MJJA 3BDYL 3F7VA 1TITA 1U8MA 1A7BA 4FXKA 2GQHA 1Q9WA 3QWOB 3P0GB 3O3BB 3V6ZA 1F4AA 1ZTXL 4HCRH 3KS0H 1VESA 1LNUA 5TDPB 2B5IB 3T1FA 4NO5B 4YHIA 4I0PD 1AGEA 4XTRD 5EZOH 4TSAH 4C54A 2PW2A 5B3JE 5HVHB 5MEPA 4Z0XA 5F96H 3KXFE 2AQ2A 3EYSH 5KANG 4Z7OF 2FEEL 4PFEA 3LV3B 4XNYL 1XR9B 2ZCKL 1KF9B 4R3SA 1NCDL 3ISWA 1GGBH 3E6FB 3OKKA 3OXSA 3TH4T 4FFVC 3WFDH 4JM2D 3H2WA 2ZUXA 2J12B 1I1AD 1NBQA 1AGFA 3S9DB 3O6FD 5T33L 4WEBL 1IC7H 1PQZA 1YNLH 5IM7A 4D9QE 3JVGC 4XP4H 3TCLB 5K9JH 1JZ5A 3ARBA 3QUXB 1B0RB 1R5VB 1R3JB 2DQFA 1QHOA 5I1JL 1BVLB 1FAIL 4U1NA 4JDTH 4OCRH 1KBGL 1XGPB 3STZB 4FQXC 2YK1L 4PJCB 4XAWH 1X3DA 4WFGE 2JCCA 5KSAD 4EDWL 4JJHA 1IGTA 3RVVD 1EZVY 4TUOA 5HHPB 4CVUA 5HY9B 1MFEH 1FZMB 2X1OA 1AXTL 2WWMC 2O5XH 4KDTA 4DGVH 1KPUB 1KN4L 4XPGH 3QNZB 5FF6B 2ITDB 4BQCA 1JP5A 1G6RH 3CX5K 1U0QA 5D7JA 4P4KC 4BSWB 4IMKA 5T1DL 3PWVB 4JHAL 4G8GA 1KPVA 3RJDA 4AYFA 5D7LB 2O61A 1WFOA 5F1IB 3RU8L 3WHXA 3D39A 4JRWA 4UBDC 1G7QA 3MCLH 5HYFA 5F1IA 2DLFL 3HZYA 4TVPE 1MHCB 2NLJB 3TV3H 4ERSL 1KSRA 1I7UB 3QNYB 3T8XB 1B4RA 2ZP0T 4UQ3A 2XPGB 1WAAE 5L2JB 2YRLA 4U1KA 2JJSC 4EJ1C 3T8XA 2F5BL 1KJMA 1SM3H 4OCSL 5HYSB 3RTQC 1R3IH 3WO4B 3O6KL 4U1SA 1W72H 3LKSA 4RMSA 1Q9KB 3LS5L 1AGCA 3WJJC 4ODHH 1QBBA 5HYSA 1PGRB 4KK8D 2R4RL 5E99L 1L7IL 5ICYA 2R0ZL 3B4NA 3B2VL 3S97C 2V17H 3VWKD 5EORL 4J7RA 1YPZA 4BZYA 5DVKA 3ZTJH 3NTCL 3NAAL 3KYMA 1OSPH 3GRWA 2R1XA 2BK8A 2DJSA 2A38A 4LF3A 5DZLA 3IGAA 2YEZA 4JO1L 5GGUB 2EH8H 3SGEH 3MUJA 4NT6B 2VC2L 2N7BA 2AJSH 3HRZA 5C0BE 1U3HA 1U41A 2Y36L 1MRDL 1J8HA 4UT9H 3ZL4H 2H45A 4W68A 4HC1L 1J1OH 4QOKE 4MXQC 3DGGA 4OF5A 5D6DC 3TWCL 4UNVA 1BBJB 3VXOA 5FUCE 3UMTA 2VDQL 4ZD3H 3QQ9C 2BVUA 2CKBA 3QWOA 5C6WH 2VDKL 1A4KA 2ZOKB 3IU4H 4P4KB 5F7EL 4OCWL 3OR7B 3W11C 2DD8H 4LKCB 3MYJB 5CFHA 1A6WL 4L9DA 3BP7A 4NCDA 4M6NH 4BQ8A 1QSEA 3BP4A 5L7XL 5KW9L 5HGHA 2D7QA 1QRNA 4W6WB 5GRZA 5DD5L 4P3WA 1JFQH 3RBSA 4OM1L 4Z0XB 1W8NA 2XFXA 4HPOL 1WWBX 1C5DA 1NAKL 8FABA 3STBA 5JW4N 4PJXF 4M7LT 5DMGD 2ZG3A 2BVOB 4N9OB 4XVSL 2V2TB 3MROB 3MRCB 3T2NL 4PJGB 1N5AB 1OP3H 2BX5A 4JR9L 3GFUA 3CH1B 4GRWB 3V0WH 3G5XB 2O5XL 4WEUD 4RWYL 5HDQH 5BS0A 1TZIA 4NN5B 4Y4KB 4WW2B 2PCPA 2BRQA 1D5IH 5TQ2H 5F7KC 3FZUC 4MD4B 1RIVH 3F5WB 3OB0K 4QXWA 1CGYA 1QSFA 1YEDB 4F7TB 3GMOA 1BVLA 1SJEA 2H32B 1UXWA 2BVQA 3B9KD 1J5OH 2H41A 4HBCH 4XCFH 4G6ML 2RBLA 5I9QC 3HI5L 1JMZA 5GRUH 3RWIA 1ZHKB 1PY4A 4LAQH 5C9JB 5I1CL 1YNLL 4TUJB 5H2BA 3UTTB 1U92B 4LCCC 5BVJB 3LS5H 3MRLA 4JM2F 1W0WB 4MXWH 4NRXB 4V1DE 1IKFH 3UTTD 1RIUL 4LHUA 2VXSL 5GRYA 3EJJX 3VWJB 1A14H 4YXHH 3MC0A 4GW5B 4N1HB 2DD8L 4CADA 5HD8C 5D8JH 3NFPA 2J8UB 5C0IB 1QA9A 1U8LA 4RMQA 1I85C 5HI4D 4QHMA 3HZYB 4CVXA 2IADA 3DTXA 3MJ8A 3E8UH 4N90E 1KCSL 2ZUWA 2YPLE 3LKQB 4DGIL 1FV1B 4LPWA 5FDWB 4WUUB 2A6IA 5DRWB 1PEWA 4W6XB 4WI4A 3PWPE 4LBEB 4GG8A 1ZHBA 4NJAH 3WNOA 1D6EB 5DZNA 3PQYE 4ZUTB 4YBQD 3MCKA 4OCYH 1FORH 2FR4A 1WICA 1WSST 4NO3B 2VUYA 3RWJA 4J1UB 4J4PD 4GAYA 4P99A 3AC0A 4B5EA 1SY6H 4EOWH 5J1AB 2F8XC 2D3VA 4E41B 1MWAB 2BNRD 4J23A 5HPOA 6FABL 3WLWC 1J0JA 2VOTA 3O8XB 3TZVC 2R2BA 4S1QH 1Q0XH 2Z8VC 5HHNA 1ETZB 3DVNA 5CJOH 3RTQA 1MIMH 1R3KB 4E41D 2DLTA 2DTML 3EHBC 1G0YR 4LIQL 2XRAH 3PWLB 3SO5A 3ARDB 2O61B 2ZSVB 3EYUH 3MRRB 1I1AA 2OR7A 1PLGL 1KB5B 2B0SH 2DQIL 3PIQA 4N5UA 1J8KA 1NLDH 4P2OB 3T0EA 1AHWA 5EU3A 3VWKC 1E0OB 4Z7NF 3GSXB 3OZ9H 5EWIL 1MAJA 4I18B 3T3ME 3GBMH 1BOGA 3QUKA 5JHDA 2AERT 3ZKMC 4WUUD 1F6AA 2CH8A 4EI5C 4FABL 4J2XA 1G9EA 4L4VB 2BNQA 1KT2B 2YA0A 1DCLA 1F11B 3MPCA 3QIBA 5JDSB 2A9NL 1UC6A 4F7EA 3LHPL 3GNML 2YK1H 5GGTH 5CBEA 3RZCB 1KCUL 3WKML 5D6DA 2BSRA 3X3FL 4OIAA 4DW2L 1YEFH 5DD0H 1MH5B 4PD4K 4TQEH 1HHJA 2HWZH 4KROD 3FFDB 4I3RL 4I3SL 1A0QL 5KSBF 1I8KA 2HYMA 1B0GB 2I5YL 4HKBA 5D5MA 4IRZL 3I3DA 5GGUA 1FE8H 1N64H 1T2QL 3HAEH 3QG6B 1HH9A 3MJ9H 3ZKNC 1PDKA 3QPXH 3HI6L 3TJEH 3CFKA 4GG6F 4QT5A 1HSBB 1M7XA 1P7KB 3EAKA 1A6TA 4CVZA 5D1ZA 3J8F7 3JWDL 5D1ZD 3S5LA 4MQXC 3L95B 1UWEH 2EH7L 4GXVL 4OZ4B 4GXVH 5DUML 1A7PH 3KPRB 3BT2H 2PUQT 4MD5A 2QSQA 1IT9L 4JFZH 2Q7YB 4PJ9D 3LEVL 4NQEB 3EJZC 3HC3L 2F8OA 4JZOA 4W4OC 4LVNC 4ORZC 5F72S 2R69H 5I1IH 2XFXB 4JFOA 4RGMC 4G80B 4JLRB 5DF0A 4K23L 2Z4QB 4K23H 1T2JA 1GZPB 1NCTA 4XCCH 3EO9L 2LTQC 4K3JL 1AE6H 4TRPL 3V7AE 3L3OA 4WI7A 3Q1SL 4G80A 4Y4HB 5CHNA 1O5DT 1PYWB 4UB0L 1D7FA 4U7SA 4X6EA 2FJFA 4Q9CA 4OFVA 2J5LC 2ZSWB 3GI8H 4I13B 3W39B 3BW9A 1YMMB 3CXDH 4P46B 3QDGD 3U46A 2V7HA 3DMMA 3N1FC 2Y06H 3U7AA 1BOYA 1S7XA 3GSRA 5IVXE 3WLBB 4DW2H 3W0WE 3LOWA 1OVZA 4UDTB 4C56E 4XP5L 1G7LB 3RI5F 4EKXA 4QHLB 5IROA 1A6ZB 3D1MC 2A6IB 1JVKA 2XTJE 4G6JL 2RGSA 1OLZA 2QHLA 4JVWA 5GS3A 4QHLA 5JOFA 3DIFA 2IG2L 3L3KB 1Y18B 1UCTA 4R4ND 4FXGA 1F3JB 4XXCA 3C60A 4ZUTA 4ZUVB 1A6AB 5KSUB 3GI9L 2Q8AL 1T2XA 4J4PA 3QB7C 4L1DA 5FYJL 4F33A 4A6YL 3GUTB 4P2OC 5JMRA 4QNPE 4X4YB 3BGFC 3DI2B 3MRLB 1I75A 4DVRL 3JWOH 2YC1A 2XYCA 3U7YL 1QR1A 3BIBX 4U0QB 4PGBB 4ZUUA 4YH6A 2NXZC 1VACA 3S3JA 1BX2A 4WGWB 1MFAL 1D9KC 3P0VL 4D9LH 3SDCC 3Q3GA 3L5XL 3IFNH 1C1EL 4N8PA 1FGVH 1T89C 3GSNB 1V7MH 4HGMA 4NQXA 3RVTC 1EGJL 3BN9C 2D4DA 2DQHH 4HWZB 2DL2A 1NGQH 1P4BH 2FBJL 1ERNA 3ARPA 2IADB 5FGCB 2AABL 3SCMD 3LQAC 1EBPA 2ADJA 3QO1A 4L29B 1S7UB 4JFPA 3L1OH 4UUJA 4NKDB 1R24A 4X8JB 4Z77A 3VXUE 5C0ND 4XCNB 4RFNB 1DE4B 4JFQB 5MHSD 1NEZA 4JFDD 2X44D 5BS0E 1FDLH 1VA9A 2QJDA 3BD3A 1DQDH 5KAQF 4N8VG 5DQ9A 3EYUL 5IMMA 5DVLA 1U8KA 5D1XD 1U3HC 5GS0C 4WFEE 4BKLB 2XWJA 4PGJA 4M5YL 1MCRA 3KG5A 3F7YB 4WV1C 3GBML 4IHOA 4L3CB 3CX2A 1BEYH 3VWJC 3EUUA 3EDDA 3MV9B 5DEZA 2FSEB 3KPSE 3QUXD 2QQLH 5HHOD 1RZIB 3T09A 1CDCA 1UJTA 3PXHA 1TQCB 5J9PB 5F9JA 1MPAH 3TO2B 5LGJB 1IFHL 1RZIA 2ZPKH 2XRAL 4BM7A 1OTSD 1IRAY 3D3VE 2BSTA 5HBBA 1CE6B 3C8HA 3QUZA 4ALAH 1YEIH 1KCVL 5D70H 4ZUWA 1D6VL 1HSBA 4PJXA 2ZJSH 5D7IB 1CFTB 2MQ0A 3LKPB 2AK1L 1QLEH 4I8DA 3O6LL 1A6TB 5BV7C 5FM5O 1RZKC 4NUGH 4KKAD 1A7QL 4ZFFB 4KQ3L 3KWWA 1HEZB 3TM6A 2OJEA 4DKAA 3KVQA 5DDHA 2X4UB 5EU7E 1OW0C 2B4CH 5I8KH 4PJBF 2NZIA 3LQAL 5DSCA 4X99B 1EHAA 3ULVL 4KXZH 2C3VA 1RZJH 3SDCB 5EU6D 1INQA 2R29L 3ZHLA 3BESR 5GRWA 3ZDYF 2QQQA 5F21B 5SX5H 1WZMA 2ZG2A 1HHJB 4KTEL 1OQOA 2PXYC 3HMXL 4OBSA 5EU4B 5DUBA 4QRTA 1M6OB 3IDMB 3DO7A 2FWOA 1NLBH 3V6FB 2EDDA 2BHYA 5FIEA 1DBJH 2HVKA 1OWRM 1ZA3A 2EDKA 5E8OB 5CEZD 2WZPD 3RGVA 1CGVA 2Y72A 2B1HL 4E5XA 1L7TH 4JM2A 4XCFL 5JOEA 2ZUQC 3I84A 4UZGA 5C0AE 2IAMD 5FYKH 2EXYD 4DKFH 1NBVH 3T3PE 4MA3A 1UVQB 5KSAC 3RP1A 2FD6H 4R96A 2CGRL 4Z8FH 4XNUL 2CRYA 4JFXB 2NW2B 4H20H 5I30L 1YDPA 3QDME 1RFDL 1SJVA 3EFFA 3V2AR 3BIKB 4RBPK 5TQ2L 5GGRB 3L6FB 5EUKA 3E2HC 1QEWA 5EN2B 5T5NF 1A6AA 1S7QA 1H15B 3U7WH 1QEWB 4O5LL 3JV0A 5EPMB 1DQML 4M3JA 5J8OA 4PG2C 3NABL 4HXBH 5FUOL 1PJ9A 2EIZA 2FX8H 4D0CA 3ZLQC 1YEIL 3HAEA 3N1GC 1J05A 5E8DL 1EFQA 2AXFB 2MCPH 5HHVH 1JFQL 3ULVC 1SJXA 1T04A 3Q5OA 2BHUA 3TESA 1AFVL 3U36A 2X70B 5C0CE 1PYWA 4U6XB 4KK6C 5IB3B 1NCCH 2Q3ZA 3FQXA 2X70A 2Q6WB 4YHYB 3QQ3B 1UCBL 5B3NA 4U1GB 4OD3L 1T20A 4ODXA 4YHKL 4YFEA 3KYNA 1OTUC 1NKOA 3DURA 1TVBB 4ZMAT 4X4XA 5EO0B 3QXVA 4OAWA 4JJ5A 1DVFC 4ODHL 1Z5LA 2XQYK 4EUPG 4HPOH 2VLKB 3T2OA 3VXSD 3VFMA 4ONOA 3UO1L 3DIFB 3BH8B 4OD1H 4KVNH 3WIHH 5CJOL 4G9FD 2VLRD 3IFLH 5T5NG 3TBTA 5ETUA 2HTKC 3WEXA 2OMNA 5EBMB 1CD9B 2JB6B 3LKOB 4LFHD 4XBGB 3MOBH 2HFEA 4V2CB 3HCVB 5TH2B 3SDDD 3BIAX 1Q8MA 3SQOL 4JGJA 3SE8H 4MQ7A 5IBUB 5JW5A 5EIIA 4I2XB 4XWOD 4P2CG 1BAFL 2VQ1B 1I7RA 3D3VD 3FQTA 3BWUC 5TFSH 4Y5VC 4XMPL 3OAZK 4HIJA 1FIEA 4HWEH 2NY0D 4HV8B 5FB8A 5F9JB 3QQ4A 1ES0A 2HN7B 2OMBA 4JGUA 1NCAL 4NZUL 1OHQA 3CU1A 4WUKL 1RMFL 1GJIA 4HMEA 3QDGA 4R0LC 4S1RL 4PJ8A 3MRPB 2F74A 1MI5E 1ZT4A 5L2KB 1U8OB 2Y7QA 3C5JA 2WUBH 4ENEC 4HUVA 1QFHA 1BFOB 1RURH 5J13C 3MCLL 2X1QA 3EW3B 4ERSH 1U8OA 1V3LA 3B9AA 3C5JB 3OSKA 4YAQB 3T4YB 3WFCL 3DVIA 3N9GL 2OJEB 3CFBB 4JFYA 3QEHA 4JCMA 1EH9A 2P5WD 5TDOA 1A6UH 5JXED 4YAQA 4JE4B 3DSNA 5HDBE 4HZLB 3A67H 3SDCA 3OKEB 2CDFB 1BZQK 1ZVYA 3UTOA 3TFKD 1FLTX 4IS6A 3V4UL 5FK9A 3QDMB 1F4HA 1TNMA 3EO0A 5DS8B 5INCA 1XF5A 4Z7VA 4HFWA 1T7VA 5FUOH 2A73B 4ODWA 1ZVSB 5C0AD 4C55A 5D1ZC 4TOYH 4QCIB 12E8L 1S9YA 2QSTA 3GK8L 5ITBH 2AK4A 4YO0A 3QEQA 1X4YA 3WS3B 3UC0L 4XPAH 3QFJA 4TULL 3AFLA 5DJ2A 5C07A 1S9YB 1A9EA 1IAIM 1NCWH 2PYED 5DJAB 1JYXA 2HJFB 3IRPX 5DVMA 1WK0A 4WFED 3P3YA 1RZJL 3WUWA 2VJXA 4X7FC 3QUZB 1T1WA 3IJHA 1Z3GL 3O0RL 5C0GA 4KJYB 3T65A 5MHSE 3SO3B 3BKCH 4KPHH 1T1WB 2FX8L 1FL3B 4KJYA 2UVEA 5HHOE 4N0RA 1CU4L 5EUKB 1NC4A 5CILL 4AJ0A 4PBWD 3NACH 1G7HA 1WITA 1JPSH 3TNNB 2Q8AH 4JREC 2ZPKL 5F8RC 5FECB 3LKNA 4PGCB 2OQJA 4X6BB 1INQB 2DJ4A 4K71C 3WJLC 4EDXB 4XAWL 1DUZA 1AD0B 5IEHA 4FZEH 4G7VH 5AG9A 4YGVA 5IJVB 2IH1B 3E6HA 3BXNA 2QSCL 4OGAD 2V7NA 5IROC 2CK2A 3W2DL 3HUJE 4YGVB 1QZ1A 1V3KA 2DQTH 4ZTPL 2EDJA 1SMAA 3LMJL 4MAYA 4EI6B 3TO4C 5SWZB 1CXHA 5CZXD 3VMPA 4PV9A 1FYTD 2I5YH 3KPNB 5AD0A 1MHHB 5FO7A 2R8SH 1MLCB 1J10A 2Y07L 1YNTB 4JM2B 2SEBA 3K1KC 4N0YH 5I8CA 1MHHA 3TNMA 2YSSA 4V1DB 3EIFA 4PRHD 3SDXF 5D1QA 3WIFA 2NMSA 1F58L 2YD3A 4K7PY 4NCC1 1JRHL 2JJTC 5CIPA 5I1EL 1RJZB 3KYKL 2FECL 1BLNA 3W5NA 1LO2L 2LAGB 2DLIA 2BOBB 4QGYA 1IGML 3VRJA 4NUJB 3KPLB 4M3KB 1JPST 2JCCF 3U79A 4HEPG 4KU1A 4WI3A 2Q87A 3LRGA 2PO6C 2YPKB 1QR4A 2EIZB 4OZFB 3OKMA 1NCBH 1DVFD 3B5GA 4NZJA 5ESVB 4DZBB 4OZFA 3V4PL 2VABA 4JFFB 4Z0BL 3ALPA 4JFHD 2ZCHL 3PGCB 5DJDB 3QUMH 4Y2DC 2CUHA 3UJTL 4JY5H 5DJXB 3A6CH 1SYSA 1HKLH 3WFEL 3U0WL 4KXZI 5C3LD 1FGNL 4HIXL 3ZKMD 3I2CL 3X14B 1PZ5B 5CEZL 3ZKSD 3TBWA 1MVUB 4QXTB 3IETB 1AKJD 4JVUA 1JGVL 1NGPH 3GSOA 2AAVA 3QRGH 4KVCH 1Z9LA 4DCQA 1U6AH 5D7LE 1DDHB 5IBUG 4UOJA 5LXGL 4LCYA 3FB8B 3MLUH 3P9WB 3VFUA 4BFBD 5F8QC 1SEQH 3CPLB 5KOMC 4CN1A 4EXKA 4PB9H 4R0LA 3S6CA 4HZLA 4JFEE 4NP4L 2CDFA 2ZCLH 4MS8D 4JO3L 4NRZA 4V2BA 1UJ3A 5ESQA 2VXVL 2D7TL 1M71B 2X6MA 5JW5B 1MFEL 1UXSA 2NXYB 4OF8A 1A1MB 4FFYH 3I3EA 1S9VA 1JNHA 4XCCL 4PPTA 5IG7B 5JUEH 3O4OB 4ZPTB 4YNYA 5DR5L 3NZ8B 32C2B 3MGOB 4ZQKB 5BMFH 5I1IL 4AM0A 2C4FU 5DRZA 4YHYC 2X5PA 4OZIA 2BP3A 3Q0HA 4YHPA 2ZZUT 3PHSA 5MI0C 4G6JH 3S8WA 5HHMD 5D9SB 3TFKC 3WUWB 1VFAB 2WBJB 2C1PB 2VISB 3HR6A 3E2HB 1NFIA 1LNUB 5TDPA 1VFAA 1MRFL 3UTSA 2IPKB 4PJ9C 3KLSA 1G1YA 1P4LA 3UTSD 1K4DA 2DDQL 4EQ3A 3ARSA 3ILQC 3BVNB 2YPVH 2PYFA 1FO0L 5I1KH 2CDEA 2IPKA 1F02I 4QOKB 5GGVL 4KFZC 4ZS6C 1OGAB 3TP4A 1NBZB 4OZGA 3LIZH 1WEJL 5FECA 2A2QT 1TQBC 5ESAA 2A6KB 1VADA 5CSGA 4X9IA 4P59L 4LCWD 1FC2D 5T1LA 2BVPA 4Z6AT 1AKJB 1KB9J 5EZOL 1S7WB 1DN0A 5HYJD 3E8UL 3HE7A 4DGIH 4H5SB 4WU7A 3HE7D 4FZ8L 3DXAA 1K3ZA 1OAYL 4N0CD 3WD5L 5EWIH 4O00A 5SWZA 5D7KE 3VA6A 3WJLA 4PB9L 3K4ZA 2KZWA 5HYJE 2HTLD 1MLCA 4MMZC 2EE2A 4NQSA 5IHZB 5ICZA 3MV7D 5CJ8A 1YN7A 1XF4B 1K6QH 3VMNA 4Y1AE 1PVHA 4EI5A 4U1LA 2Z35A 4F80A 1XF4A 4RNRA 4P57B 5EO9A 1PFCA 4XH2B 4R2GC 4TUOB 5HHPA 4X9BA 3GEWB 3FOLB 1KPUA 3MRGB 5AZ2H 3VFSA 3BHBB 3QDGE 3FRPA 4KKBC 2CKBH 1QBLH 5KVEH 2HRPL 2JCCB 4X6FA 5DK2B 3QJFB 3WXWL 4JZNB 1BGXH 4X5XA 3BAEH 5E2VH 1FSKC 1CDYA 1PG7W 4R26L 3PV7A 4WHYH 3SKJH 1A2YA 4F9PA 4NFBA 2G9HB 4KUZH 1Z3GH 3O0RH 1GOFA 2BJMH 4ETQA 3U48A 1HHKB 4KDVA 2XZZA 2NR6C 1FZOA 1MFBH 1N5YL 3TYFB 3LN5A 2FEEI 3VXRD 3L3HA 1KJ3L 2MNUA 2RHEA 3SCMC 1E6JH 1AI1H 4YDIH 1KN2H 3SKNA 4Y8AA 3TBSA 2F5AL 5LJYH 4XPTH 3DGCR 4YHOH 3HG1E 1IGFL 2V2XA 3FQUB 4EI5D 1CT8B 3SDYL 5IFJA 1CE1L 1H5BB 1OB1B 5C0RL 5E7BA 2WINA 4LCCA 3IETA 1CT8A 4JFED 1JWUA 5DD0L 3KXFA 3C6SB 5D96B 1MELA 1Q9KA 3M1BA 4LP5A 4NKIH 3VXQB 5C07E 1QNZH 4OM1H 2J6EA 4BUGA 2XA8L 5F70A 3OGCB 1S9WA 3GMNB 2HA1A 3LQZA 3SDAB 2E6QA 4HG4J 3DX7A 1LO0L 3O41A 1T3FA 2PN5A 3QEGL 2A74A 3PWUA 1ZLSH 2OJZL 4KI1A 3VFRB 1C08A 1T3FB 3PXJA 3OMZA 1CLYH 1FL5B 3UP1A 1YPZB 2R0LH 1QRND 4PLJC 3K0WA 3B9DA 4JO4L 5IOPA 1IKFL 2BXZA 2VYRE 4P3DA 3QEQD 4IRJD 3RKDD 2BXYA 4YGAB 5IMOB 1SYSB 5F9OL 5CJXA 3V4VL 2CDGA 1R3LB 3ZKXC 1MREH 2XQBH 3EOYG 3HRZB 4KKAC 4PY7B 4W4NA 3GSNL 4G6MH 1QBML 2O5ZL 3G5ZB 1CFBA 2VISA 1KENL 4U31A 1INDH 3H3BC 3QRFM 5CAYB 5JPMA 4D8PA 5E9DD 4A2MA 5F7MC 2EIEA 3EJZD 4EN3B 2VE6A 4P5TD 2OP4H 3WIHA 1RFDH 4PB0L 2DM7A 3U9UA 3MV11 1D5IL 2VZVA 5HHVL 4XX1G 3P30H 1WWAX 4KVNL 2PW2B 1RUPL 3WYRA 4MHHG 3GIZH 4FS0A 1FVEA 1X5YA 1P4IL 1T80A 4MJIB 1A6WH 2V2TA 4JR9H 3WUWG 2ARJA 3P4LA 1GPOL 3D3VB 2JLLA 1XR9A 2BVPB 3ZT6A 2ICES 1SY6A 5BQ7A 1DQJB 5L9DH 3VG9C 5C71A 3NFSL 3WL9B 1TTFA 3CCHA 4MJ6B 4X6CF 2HLFC 3NZ8A 3OR6A 4U6VH 3UJJL 5DA4A 3I6LE 5D5MF 3MGAA 4P3CH 1ZGLA 1FZJA 2V6HA 4ZFOL 3OR6B 3OKOA 5J7CC 4PJGE 3QUYB 5CUSL 3ULVH 5EU6B 1VENA 2VXTH 3O45B 2VLKD 2GY7B 4GG6A 4NM4L 5CMAA 3LQAH 3KNBB 4EN3D 1ADQH 4K2UL 3THML 4PJHB 3MA9L 4YWGH 2WUBL 5TE4H 4BQBA 1T66C 1QLEL 5HI3D 1LE9A 4FZ8H 2J7LA 1H3PL 3B9KC 5GGVH 1CFSB 4XPGL 3B9KB 3RWCA 4Y5XA 3O6LH 3HMXH 2YPVL 1OCWH 1NBZA 4OZGB 1RJYB 5GS0H 1LQSR 3MV8D 3GJFB 2DRUA 5EOQH 1HSAA 4OQTA 3VWJA 1J8HE 4HH9B 4CMMA 2E5EA 4ZSOE 4XHQA 1KPRB 4NN6C 4YX2L 1UB6B 5SWQB 1EXUB 4LGRB 1U3ZA 4NFCA 3BEVA 4NQEE 1AH1A 5JPNA 5E08L 2DLFH 2AK1H 1RIHL 3I6KB 1SBSH 3B6SA 1J0HA 1KGCD 2ICWJ 2PO6D 5JPNB 4KRNA 1S5IL 3MRHB 4NQVB 4CW1B 1QSEE 4ZAKD 1KB5H 4YPGA 4Z7UE 4LSDA 4Q74A 3WFBH 4RNRB 4FRWA 1N6UA 4HPYL 2NX5E 1X7QA 1UZ8A 1JTOA 5EB9A 3SJVB 3KPPA 5IWLA 1KFAH 3WS6C 5MEOB 5LBSH 3RY6C 5J11C 3MACH 2OS7A 4GG8B 4EIZC 5IF0A 4KZEL 2W9EH 1L9MA 4XC1H 5IGXH 4LQFL 1I1YB 4GW1B 1OWWA 2IMNA 4QF1A 5FM4A 5T1MA 1MQKL 2PR4H 1TJIL 5T3ZH 4UMGA 5HHNB 4WO4A 4PLOB 1TVHB 4RFOL 3GZKA 4JAMB 4OTXH 2DQGL 4H1LB 4RZCA 3BRDA 3ARDA 5D70L 1LO5A 4MXQD 4JZJA 3MFFA 1J0IA 3RDTA 5DD6A 3AMLA 3UZEA 5E2WL 3DVNB 1LEGA 5LAXB 3WNPA 3S35H 3L3HB 3KAAA 5DQJB 4MJIE 5DT1L 2Z9TA 5IW3A 1E4KA 1QO3A 3C60C 4E0RB 2VSCA 1I1AB 4KQ4L 3D9AL 3W11D 3OAYH 5FXCH 4S0SD 4Y19A 4JY6A 4LASH 5C09B 5I1LB 5DHXB 2CIKB 4J3WA 2CXKA 4GXUM 3SGKC 5EIVA 3U0PA 5CBEB 2BJML 5E03A 3S34L 5CJXC 5EFIB 5EU6E 3P9LB 5HGHB 4I3GA 1FH5H 1DEEA 5L88L 3U1SL 1RZFL 4OQTH 1FVEB 5CD5D 5KVEL 1H0DA 2X1WL 4QHKI 1G9NH 3GI9H 5CINL 5T1LD 2P42B 2BVOA 3H0TB 5D7IF 1MI5B 2LV4A 4CGTA 1MY5A 1EDQA 4IDLA 1AY1L 3AM8A 1B0GA 3CFKB 3UBXG 5I1EH 4AEIH 4NC2B 4LQFH 4ZFGH 3U2SB 3MREA 4PJAB 1J8HB 3DYPA 4JFDB 4N0FB 3PWPB 2X09A 2RFXB 4QWWD 5B38A 1A7QH 1XGRB 2FB4H 3BT2L 1NUGA 2YD1A 3RGVD 1MJJB 1T0PB 1ZT7A 3QXWA 5EUOE 3HE7C 2IPUK 3ROOB 1K3IA 3GHEH 5GHWH 1LO4H 3BKJH 4FQHA 4YHLL 5GJTH 1VKXA 4M43H 1UYWL 3MYJA 1UYWH 2GUOA 4N0UB 4YDVB 1YEGH 1OAUL 5ECJE 2P5EB 4KKCC 3C9NB 4OGAC 1IQDB 2ED7A 3QNXB 5MERB 1KCRH 1CVRA 4TUJA 4J6RH 5E08H 1JGEA 4WWKA 1HHGB 4OZHF 4P5MA 1HQRB 2C1OB 4YHZL 4IRZH 1C5DB 3T0EE 2I26N 3DUHA 1T2QH 5D7SL 4UBDD 2BY2A 1PEZA 3GMPA 3UZQA 3WCYA 3MUGA 4D9QD 4UIKH 5JA9A 4JCLA 5JHDE 1GL4B 3VW3L 43C9B 3KPSD 1T0MB 3U0TA 1RUML 2I60L 5DI8B 4NKMB 3CXHJ 5GIRA 2AXGB 4KRPD 3PABA 1EO8H 4WW2A 2EEBA 3GM0A 3S7GA 1BWMA 4NQVA 2J4WL 4YBQC 2ADIA 5GS1B 4FFZH 5SX4H 3MX0A 1JNNH 3WHE0 4PRIA 2IPTH 3QI9C 3HKFA 1N8ZA 2FIRT 4N8VA 5DRWA 3MR9B 4R4FH 1XGTB 3ARBB 1X5HA 4PRIB 2H9GA 5HY9A 1OAQH 3LEVH 3PWNA 2VAAA 1IGCL 1JGLL 4FQJL 4MXVF 4XC3H 1T6VN 5L0QB 1J18A 1UM6H 1E4XL 5AUMA 3JV5A 1YECH 2YC1B 5IF0B 2YD7A 2FHBA 4P3CL 4C83A 3D39D 2VLLB 4PP1D 4PJFA 1MUJA 4P2OD 2VUOA 3BYTA 4NC1E 3QUML 1ZLUH 3RI5K 4UV4H 5FYJU 2DM3A 5SWSE 3DLQR 4X4YA 3ARDD 4TN9A 2CXGA 2E8YA 3PDGA 5BRZB 1J7VR 2ITCA 4XP1L 2L0DA 3BPLC 3JWOL 3RDTB 3S37H 1G7PA 2ENYA 4CADB 4QHKJ 3PUCA 3HZMA 1U93B 3PHOB 3BDBA 3Q3GB 4UOW1 1KPVB 1LP9E 3QCTH 3PF2A 3B6SB 3CFEB 3OZ9L 1R5WB 3GMRB 4R90L 4R97C 2GITA 1I8MB 1FFRA 3WHXB 3Q5YA 1DQQA 3V0VA 3T77A 2XWTA 1YEJH 3HHRB 3UBXB 3QIWC 2GITB 2NY4D 5H37G 2Q3AA 2A77H 2E7LC 1ZLSL 4HLZH 4RFNC 4DUVA 3FAWA 5E9DA 4H1LG 3LKSB 1JJUA 1ZHBB 2DTMH 3SJVA 3LCYA 3TPKA 3IFLL 3V5KB 5KS9B 4KROC 4G6AD 1NAMA 1KCUH 3KJ4C 4PR5A 4WJ5B 3WKMH 2CMRH 4PJ8D 2VDLH 4DK6A 5IESL 1H3TA 3QIUA 3VE0A 5FKPB 3FONA 1Z0NA 2YD5A 1UWXH 2GJZB 4GAYB 2EDLA 2VO5A 4D94A 3H3PH 1IQWH 4WO4B 2R23B 4MA8H 1N2RB 4PJ7A 1I3GH 2KZ1B 4PG9B 3KLDA 5JHLH 1EHXA 1A14L 4JM4H 3LQMA 4HJJH 3VRLF 1LO5B 2VLME 4OD3H 3F12B 3K1DA 3IDUA 1AR1C 3DVFA 2G75B 4PREA 5JORA 4LQ1A 5JW4Q 2BSTB 1T22A 1GHFL 4YUEH 5EBLB 5C0EA 1HH9B 1OTTC 2RCSH 3QH3A 2P8PB 3HPLB 2VDML 5GZOD 4RFEA 5H37H 4QRSB 4G6FD 1QACA 3H6JA 4ZOEA 5A3IC 2V9TA 4JFEB 1Z9SA 2FLBT 2FGWH 4HGWB 3MNVA 1FYTA 3NABH 4OFYD 3CZJA 1HDMA 2WLZA 4NQCE 4FQXD 1WBZA 1MHPH 4MZ2A 1H3PH 3O6FA 1RUKH 1ZSDB 1D5MB 3FT4B 1IKNA 5EZJB 1A4KB 1EUUA 4M1CD 1JPFB 3RIAK 3TZVA 1CD1A 2BSRB 1WBYA 4XCEA 5DUBB 4K7PL 5HGBA 1QSEB 1OP5H 2EDTA 2NY6C 3HI1A 3HS0A 4MDJA 1BQUA 1AP2A 3D25A 2B2XL 1YJDC 1G7MB 2I07A 5DRNA 3ULUE 2HMID 3CH1A 4OJFL 5FYLL 5CGMA 3KLAA 1TJHH 4O9HL 3LEYL 3CFDA 2IC2A 3FTGA 4E42A 4Y5XC 5GGRY 1S7RA 3U2SA 1KG0A 1TMCB 5E6YA 1NLBL 2QSVA 3KPTA 4ELMB 1FG2A 4RGNB 4XBEL 3MA7A 4JFXA 1UM6L 5AZ2L 3N9GH 4PRPD 2ADIB 2J8OA 5I15L 4BZ1H 1I3RB 2GJJA 3RWHA 1N8ZB 4N8VB 4XHJC 2X9WA 3UPRB 5ILTL 2XZQL 3IU4L 1NUNB 5JOFB 1GGIL 2JELL 2Z31D 3HNTL 2UZXB 3BWAA 4YHIB 3X13A 1C7TA 5E8EB 5J6HB 5J12C 1IL1A 1XH3A 2NXZD 4D0CB 2WWMD 3LEYH 3O9WD 3P73A 4KRPC 1BZ9A 4NRXA 3BWAB 3O9WA 4UQ2B 3ES6B 2Q1EA 1KJ2H 5EC2B 1N6VA 1S7QB 1YQ2A 4B7LA 1QR1B 5AAMA 2EDHA 4JFOB 1S3KL 4JLRA 4GAGH 1RUAL 2V9QA 1Q0XL 3DX6A 1J05B 4IDJH 1HILB 1TJGH 1FHGA 1BVZA 2Y6SD 1LWRA 4F7MB 3G04A 1FNGB 2C3GA 3DX6B 1XGYL 3QXAB 1RUKL 1J0ZA 3K8MA 3L5JA 1QKZL 3U36B 3PHOA 4RX4D 4N90D 1WC7B 4JRYA 2AXGA 4PP1C 3O6MH 2WIMA 3B2VH 4L8SA 2R0ZH 2X1XR 1HNFA 1RV6X 4RGOH 1FO0H 5F9OH 5H94B 3IDIA 2A6DB 2AK4D 3I02A 1NC2B 5E1AA 1R5VA 3ZE1F 5DUPL 3OPZH 5T3ZD 3BPCA 3RTQD 1JF1A 3MRNB 3RL2B 4WI8A 3HCVA 2GFBB 2VR4A 4XVTH 5J1AA 5DYOA 2NY1B 2F54E 2I24N 5FKPA 5B39B 1S9XA 2HFGH 1U8KB 3VU2A 5JXAH 3ZYZA 2CQVA 5B21A 2MPAH 3UYRH 2BDNH 4Z18A 3VFTB 1O0VA 4WI5A 1N2RA 3AU1A 3VH8G 4G8EB 4JPWL 1BD2E 2FECI 5KANI 1O7VA 5IVNA 5ELIA 1L6XA 1AI1L 2J88H 3FKUS 5ACZB 3UTZB 2ZCLL 1TTGA 4G42A 4HD9A 3U0WH 4H26A 3MLVH 3VXPA 3U6RB 4NRYA 4NZTH 2NY0C 4PJ8B 1WIPA 1XCQA 3R1GH 4YBLB 3LAFA 2BVTA 4FQLH 2VB5A 2E6JA 3L5WA 1TCRB 4LEXH 4IRJA 2R15A 4P4RB 5F3BB 4YDIL 1DQQB 2NY4B 1KJ3H 5D7IA 4MAYD 5ADPL 5ISZB 1F45A 2XPGA 3MBED 5EU3B 3GJEB 4U0RB 5J6GA 2GCYB 2Z0BA 3P4NB 1HYSC 4YHML 5EU5A 1K4CB 1CD8A 2OXGA 4AG4H 4IS6B 4AIOA 5C86A 4RWYH 3P4NA 3ARRA 5D2LB 3CFBA 4JFYB 3T0WA 2ID5A 4DUXA 1MCCA 1LVEA 4DVRH 1IAKA 4YQXL 5MEND 4O51B 4Z7WB 5D2LA 4DGVL 1F4WH 3F7YA 1NC4D 3BMVA 4X4ZA 5DMGC 1NL0L 5L6YL 3O3UN 4Z95L 3WS3A 1CXFA 3FB7A 2EDYA 1WFUA 3RVXC 2FWOB 2DQGH 4ZXBB 4L3EB 1CR9L 1Y6MR 2IGFL 3D85D 4JDTL 5C09D 1DUYA 1A5FL 3GI8L 3QDJA 2E7LA 1T22B 4MVBC 4PJFE 1Q9OB 3QEUB 2HJKB 5ANME 4J3TA 4E5XB 1WISA 1KTKE 4DKEL 3DECA 5SWSA 3UTQA 4KI5E 5LCVH 3PGDA 1TLKA 2FYYA 3D2UB 4R9HA 5GGQL 4ELKA 4UINH 1BBJA 3VXOB 3CLFL 4U7MA 4HAGA 5IHBA 2IPTL 2B20A 4I9WE 3MLSH 5DEGB 4TVPD 4ZFFA 1VEMA 3K7UA 4JG0L 5T1KB 4XNQB 2CLZA 3UTPE 5HI5C 4N0YL 4QRPA 2C5DC 5E4EC 3S5LB 3ULVD 2I9LB 4QYOA 5DSCB 4NJ9H 1MQ8A 5EZJA 3MLPA 2BNUA 4HUUB 4JDVA 4PTTB 1AGBA 2UZYB 3BP4B 4EBQL 3ARED 4L8DA 2YKLH 3D0LB 4OZGF 4NO0A 5D7JC 3TNNA 2Z4QA 3ZHDA 1FYHB 4NYLB 3DETC 1LDPH 3R4DA 8FABB 4GSDL 2WUCH 4MCZA 4FQPA 2VDOL 2E9WA 2X89A 4FP8H 2NYYD 4YDLC 3TIDB 5DUMH 1FCCA 3OB8A 3B2UD 3DRQA 1PAMA 1NCNA 2HG5B 3QXAA 1J86A 1NDMB 4PJHE 4A2LA 4ZAKB 3O9WC 1CXEA 3F7QA 3FTGB 4P23C 5IR1A 4CN4A 4PV9B 1W72L 1JK8B 2HT4C 2XXMB 3CUPB 4YQXH 3R1GL 1YQVL 4JHBA 4F57H 2JJSA 3F5WA 1KXQE 4I4WB 4Z7QF 1ED3B 1QLFA 3VRJB 1XR8A 2VLKA 1BEYL 3BZFA 4OFYA 3LY6A 1QPXA 3N1QC 1I7ZA 4OTXL 4TSBH 1IL1B 2NY5L 1PX3A 2AK4E 2GFBA 1MCIA 2BOBA 1I1FB 1WCBB 4JO3H 3JWDC 3STLA 3LDBB 2W60B 4E9LA 5CSBA 4OD2A 2X4RB 3SE4A 3K4DA 1J1XL 1BM3H 5DJCB 4NKOB 1TPXC 2EZ0C 4NQCA 3WFEH 3WMSA 4JHWL 2R1YA 1CFVL 4HUXA 4HPYH 2VWEC 1VACB 1NCAH 4GW5A 4ODTH 3TEUA 4Y2DD 4M8QA 3QWRD 1KULA 3ZYJA 5FGBA 5C08A 5H8DA 3V4PH 3VXUB 5I2IB 1CN4A 3NA9H 5IHLB 1A22B 3L5WB 4P5TC 2VNCA 2Z93A 4S2SA 1NLDL 1BJ8A 1PZ5A 4DZ8A 3E3QC 3VRIA 5FDWA 4HWNA 4LVHB 5D2NC 1DQTA 3P0VH 1AR1D 5F1OB 4MQXD 4X0KA 4MJ4A 3NIFE 3HUJA 1QBMH 2O5ZH 4NKDA 3FMGL 4N8CL 1CFVH 4P2YA 4AT6A 2FO4B 2UZIH 4ZO6A 4M7LH 3RUGE 4UT6H 1ZLVH 5FCSH 5EBMA 3DX8B 1R0AH 1ZGLM 1U58A 4NJ9L 3QULB 5FK9B 1IBGL 4RGOL 4GFTB 3FCTB 4IHOB 1AXIB 2GSIA 3ZE0E 4KHTH 3ESVF 3EFDL 4ZPTA 2DQDL 1E4XI 5D4QA 4ZOAA 2YD4A 2ICEA 1M05B 5ADPH 4XBPB 5DC9B 5DRZB 2IAMC 1QTYT 3HNSL 4F7CB 4Y16B 3GMQB 4GRWF 4H26B 1JNHB 3GRWH 5ADOH 5DK3A 1A9EB 2OR8A 3ZKND 4KMLB 5IB4A 3MRRA 4JFZL 1GC1C 4EN3C 3L9RA 1UA6L 3EYOB 1KB5A 4AIZB 1C16B 4MXVE 3MRPA 1SEBB 2BSSB 3C08H 1PG7X 1S9KC 4IRJB 3BGAA 3DXAD 3D0VB 2CDEB 3KDMA 4KKCD 4M7ZC 3RVXD 1IE5A 2AJXH 2B39A 3MRBB 3TF7C 3U82B 2CIIA 1GGIH 4JPIB 3SKMA 4PJAF 1K4CA 3NIFF 2VDOH 1BFVL 2FIKA 2WBWB 4RIRB 2JB5H 2AW2A 3MA9H 4YWGL 3RIFK 4JKPL 4HK3N 2WSKA 1J1PH 3C87A 2KBGA 5ALCH 4H20L 3CMOH 5HGDA 3WBDA 3WSQH 3DXAB 5F1NB 3RVVC 5F7UA 4UI2A 4APQC 4HCRA 5GS0L 2FJHB 2OTWA 1ODAA 1T0NA 3QDHA 1OTUD 2AK4B 1VPOH 3TA3B 5I1HL 1ZWIB 4OZFG 1INDL 2GHWB 2H8PB 3JV4B 4X6CA 5TE7H 3MLYL 3DV6B 5IR1B 4HS8H 3VFPA 5C7XL 3TYGL 2Q8BH 4DOHE 3EYVB 3GNMH 1FNHA 1N59B 3F6LA 3HZKB 5F97E 3DBXA 1E6OH 4F37F 1X5ZA 2IFGA 3MLZL 2XICA 1JI2A 1P7KA 5HD8D 1N59A 3HZKA 1ROWA 3VXRA 1GC1L 1EAJA 1I9EA 1BP3B 3QUYD 3V5DA 3SPVB 1Z9MA 3SDDC 1ZHNA 2R0WH 1A0QH 1CR9H 1B6UA 1YDPB 4QHUA 4GQ9H 5FGRA 4NQDD 1HXMB 3FT2A 3HB3D 1I7ZB 5E2UL 1F4XL 2X4PB 2AJZA 3VFSB 4KK5D 3BHBA 1C5BL 3D0LA 3NFSH 4OZIE 1CZ8H 1Z2KA 4G6KH 5ENWB 2X4PA 5C6TL 2CLVA 1EEZB 1ZT1B 1XGUB 3ILPB 3I3BA 4N1CA 5AWNH 5T3XD 4CNIB 2RCSL 1OARL 2X4SA 4S1QL 2CLVB 3MNWA 5KVGH 2W1NA 3L3OB 2NR6D 3S98A 2BNQD 4HWEL 1RUPH 2BC4A 4MLIA 1FIGH 2DIJA 3T04D 2FX9H 2YPLB 3LEXA 2VR9A 4OLUL 3P4MA 3I6LD 3BW9B 5E5RB 5ACMA 4YC2B 1H5BA 1OB1A 2UWEF 4OIIH 1X5LA 2ADFL 2NXZB 1IARB 2ADFH 3ARGC 1JK8A 1FRGH 1Q38A 2DLEA 1CIUA 1YC8A 4NNXA 3WLBA 4G8GE 2ATKB 2V2XB 3FQUA 4PJ8C 4YK4B 1R0AL 4ISVB 3FN0L 1QLFB 1YZZA 1MIML 1YN6A 5AWNL 4ISVA 2XZAL 4IRSB 1GRWA 3DX7B 4JRXE 2CD0A 1FNFA 4C58B 2JB6A 1YN6B 2J88L 1UH2A 5KSVA 4UDUB 1CGTA 4M1DH 3HG1B 2AV7A 2GAZB 1WAAA 4OLUH 4PGEA 5I71B 4JQXC 1E28A 2KDGA 2VQ1A 1HHIB 5GSVB 1C7SA 5ESQB 4TNVF 4MAYC 1JYWA 4X6DF 3LKOA 5JUEL 1OAKH 1BIIB 1EFXB 3ECBB 2Y5TB 4NQDB 1BBDL 5J1TC 3OKDB 4OD1L 1A1MA 1TIUA 5IMKB 3V7AG 4QRPE 1C08B 4YDLB 5FKAA 2IMMA 3GSWB 5CZKA 4YNYB 5EIIB 4F7CA 4ODTL 1YMHA 5JIPA 1I7RB 2HFTA 1PKOA 2AP2A 3FQTB 1ONQA 1I1CA 1XCTB 3IDYC 1BQLL 5IMKA 3SGJA 2H2PD 1JNNL 5DEFB 2EDQA 2ICWB 2V5RA 4S1DC 2I9TB 1RHFA 5IOPB 4WV1B 3ZTJG 3PP3H 1I9JL 2Y7QB 5D2LF 4X5WA 3MUY1 1URLA 2KL6A 4XP6L 1EEYB 3P0YL 2DQCH 2DWDB 4PY7A 1U8JB 1IM9D 1QFOA 1G6RL 2BNRA 1BFTA 4DCQB 1AHWC 1P4LB 3OF6D 1KN4H 3LSOA 4R8WH 1QBAA 3RKPA 3TVMD 5BW7A 1ZA6A 2PO6A 2NZ9C 2EYTB 5EZLA 5D7SH 4RAVB 4YR6A 1NJ9A 4GH7B 4KV5F 4QOKA 2YUVA 2XN9A 1JGUH 3ARYA 4RGMB 4PJIB 1V7ML 1DFBL 5I0DA 5FYJD 2W0KA 1N6QL 3DMMD 3QEHB 2A73A 2WNGA 5TDOB 3QULA 3S37L 3TO4D 1RZGA 5CEYA 3INUH 5A2LH 1AXTH 3ARGB 1CDJA 4EUPA 4R7NA 4GAJH 4L3CA 3SE9H 2ICCA 5AEAA 2OM5A 4TTDD 4RWHA 4X7EC 4AEEA 2HJFA 5GPRA 5HXMA 5GJSL 1OM3H 3WUZA 4DVBA 2JJUA 2DKSA 1RIVL 2XTJC 5F3HA 3X17A 3M8OL 4L3ED 2YZ8A 1BZ7B 1RZKL 4XC3L 3JTTB 1UACL 3T65B 1GHFH 3MO1A 4JKPH 1U8HB 1L7TL 4HK3J 5E5MA 4ONFL 3IKCA 2YUZA 4XBEH 4XPFH 1MHEB 1T83C 2E7HA 1IC7L 4H0GA 4GKSA 1V5JA 1F3DH 1LO3H 4Y0GA 1CG9B 4NHCL 4JANA 3UZVB 5HI4C 4LHUD 3ALXA 4FHBD 5C08E 4MA8L 3AAZA 4FXLA 4PGCA 1TJHL 4X6BA 1KC5H 1HXMA 4OLEA 1CF8H 2YS4A 4JANB 4WGVB 4YXKH 1JHTA 4LLQA 3MXWH 4KK8C 3E0GA 5FO8B 2AGJL 3MSPA 2IH1A 4QRQA 1MRFH 2FDBP 1KCVH 5IB2A 1K85A 4P9ML 2OQJB 4EQ2A 1DUZB 5IEHB 3EO9H 4XWOC 3QA3A 1M6OA 4U3CA 5L8LB 1OP3K 3BXNB 5FM8A 5EORH 3W9DB 3CFCH 1EUTA 4OLXH 1KJ2B 3MLXH 1WWCA 5I8CB 3JV6A 4Y2DA 4WCYH 4PV8A 4O2EA 3QYCA 3VFPB 3KPRD 2NNAB 3EYVA 1KV3A 3H9YA 2IEPA 5IW6B 4WW2F 2GSGA 4FMFA 3VI3E 3MRKB 2JIXA 2VC2H 3MRQA 3MRHA 4DWHA 6CGTA 3SKOA 2JKXA 4P57A 3CMOL 3G9AB 2YRZA 1FNSH 3FFCE 4WTXA 4L8BB 1EHLH 4IRSA 4G5ZL 1CI5A 1CQYA 4V1DD 5J56B 1HZHL 3IF1B 4OLVH 3O2VL 1RQ5A 1JGVH 2FBJH 4U1MA 1CICA 2VXVH 5IK3B 4Z7NE 3VCLB 4K3EL 3AROA 5BJTB 1P69B 3RWEA 5GGVY 2O5YL 4FQQA 1UENA 1M7IA 1FL5A 3T0ED 3FQWA 3DROA 4I5BA 1IM9B 1OLLA 3TCXA 3O4LB 4B7IA 3X3GH 5CIPH 2R2HA 1UZ6F 1Q0YH 2VXUL 5HHXH 3AB0C 3IFNL 1F97A 4PJ5D 3IT8D 4U6XA 2EDOA 1ZANL 1KB5L 1J11A 3RBGA 2Q6WA 4LSVL 3A67L 4O2CA 3SDDA 5FCUH 4JY6B 1TENA 2PNDA 3OG4B 4IIQC 1NCBL 3MRJB 4G8IA 4PRNB 1FCGA 2IALB 4Q0XH 2HFGL 5JXAL 4M1CC 5I1LA 4ZNEE 2CR6A 4HKZA 5C0AB 3K74B 5C0BD 4GKZB 3TJHD 5F6HJ 5SX5K 4LKCA 1HI6B 3I85A 4LIQE 1DEEB 2EYTA 5EZLB 1BIHA 4CU6A 1S9WB 3GMNA 3QDMD 1K2DB 4MSWA 4I18C 2MKWA 2IJ0C 5ID0B 4QRRB 2A74B 3PWUB 2HLFD 3MOAH 1AR2A 1A3LL 4WUUE 5K9OB 1TFHA 4X98B 5CEZE 1BIIA 1EFXA 3ECBA 5L0QC 5HVHC 1H8SA 3JXAA 1KCKA 1J88A 4HKJA 4TPRH 3ARGA 3SCMA 5HHQB 1DLHA 4Z7UA 3ZYOA 3SN6N 3MREB 4PJAA 2DJUA 4LMQI 1H3VA 3CLFH 2NX5A 2DYPA 3HZVB 3K81A 4Z7UB 3DX9A 5K9KB 2RFXA 1Z6JT 2XWBA 3OJDB 1RK0B 2VXTL 2CLRA 3TIEA 2VQTA 4AM0B 4M4PA 4WHDA 1OPGH 2VZSA 3MMEA 4X5WB 1Q9WB 2BY1A 1GGCL 4GRLC 5D9SA 2ORBH 5EA0L 4LU5H 4CN6A 3IAPA 3BVNA 5FEBA 1MCOH 4MXWL 3BGMB 3KJ6L 1NSNL 1T1XB 4H88H 4KRMB 5EZIH 1IQDA 2RIKA 3WIIL 4Z78A 4ZS7L 5IQ7H 4MNHB 1B0WA 2WAHA 1NMAH 2P1YA 3KYOA 2R8SL 4FQHB 3Q48A 4PG2A 5IVZB 5SWZD 1VKXB 4FQXB 3MOQA 2KKQA 5E2TH 4MJID 1X5XA 2W92A 4MJIA 2CO7B 4MYWB 4DKEH 1VGEH 1QSZA 5ESAB 1DSFH 5IUSA 3GSVA 5HGAB 2K7PA 4Y5YB 3MTRA 4BK4A 1JTTA 3BEWA 3RVWD 4HBQA 5C8JA 4ZAKC 4Y1AB 5E2JA 2NY3C 3OKKB 3OXSB 4XPAL 4Y5YA 1T4KA 3SE9L 1IEBB 3AXLB 5IB5B 4Y8DC 1RULL 5C07B 1DQMH 4Y7MA 5DJ0A 4OLXL 2VKXA 1T4KB 1GPOH 5CLWA 3HI5H 3HRPA 1R3JA 2DQFB 2VZTA 5SX4I 3RAJH 5EU6A 4CVXB 4XNMB 1DVFA 1S7SA 1RZKH 5EO1A 4WIQA 3QBTB 3QI9D 1JNJA 1FL3A 4LPYA 4OT1H 1D6EA 3BN9D 4YHNA 5DGRA 3IB4A 5GSRB 3RL1A 1JBJA 3S4SA 3QNZA 4GJTB 1JZ8A 5IVOA 3UC0H 1KEGL 4U6HA 1DQLH 3ULSA 4LSVH 3FN3A 1GAFH 3FOLA 1R5IA 1H8OA 1DBBL 1IGTB 4BSWA 1LO0H 4QLRA 2FCBA 4AZ8A 1AD0A 1AJ7L 5CWSB 5C0CB 5F7DA 4B41A 4JN1L 2HRLA 2AKRB 5SWQA 4LPCA 3BKYH 3EO1A 1SYVA 2YD6A 3KXFD 3RDTC 5KG9B 1J1OL 5LCVL 3NBNA 3W9DA 4K94H 3O2DH 4LSSL 2NCMA 1LEGB 5LAXA 4MD0A 1T5XA 2X89D 3BSZL 5I0ZA 4QTIH 3T77B 1IEAB 3QG7H 3PL6A 3KPMA 4CL7A 4M02A 4OCWH 4LNVA 3L3GB 4S1SH 1R5WA 3SQOH 5L9DL 2G2RA 4QRRE 2Z8SA 1J87A 5KS9A 4G8IB 4PRNA 4HUWB 3L3GA 3NPZB 2ZUQB 4XB7A 3GSQB 4CDHA 1N26A 2LAAA 1CXIA 1HI6A 3NGBB 3SGJC 5A2JH 3L3JA 4XMPH 1YEHH 1QP1A 4PLNC 4KH2A 4P9HH 3BAEL 2QTEA 4HHAA 4I0PC 2M2DA 4HF5L 4HH8A 3T4AB 2FL5A 1FORL 4UILL 4UTBH 2Z31B 2APBA 4TVPL 3H0TA 2GK0A 4K2UH 3THMH 4NZDA 4DZBA 3VWKB 3IU3A 3IVKB 5FAAA 3IDGB 2G5BB 3TJHC 5BO1H 2VABB 1BVKA 1HKFA 3QH3B 3VFRA 2UYLB 2V17L 1S5HB 3MV01 4KC3B 4NIKB 4LF3B 1TTUA 5FHBL 2GK0B 1LDSA 1C5CH 1JZ3A 5GISH 2G5BA 4LCWE 3EOBB 3HC0A 5AZEH 4JM2C 4JFDA 3BUYA 2OK0H 2ZOLA 1KIUA 2B1HH 1L0QA 2VWEE 1PSKL 4XGZB 1VEPA 4U6YA 4JN1H 5A3ID 1F4XH 1MFCL 5EG6C 1AD9B 3BFOA 3L95A 3IFOA 4OZ4A 1CGSH 4L5FL 5TF1L 2VLRE 1GGYA 2X4OB 1KEGH 2Q7YA 4AEHH 4F9LC 3O2WH 4ZXBC 1IC5H 4NZRL 3S37X 5J06A 1HHGA 4GAGL 3T2QA 1U8IA 3LIZL 5I17B 2DMCA 3GHBH 4LCIL 3VFVA 4WW1A 3MODL 3KLAB 3FQRA 3G6AA 4MA7H 5HHOB 2P47B 4QRPD 4OKDA 3REWA 4HBCL 1BD2D 5E8DH 4P2RE 4LARL 3VD7A 2XKNA 2ARJB 4H8WL 5GGTA 1GYAA 2NX5B 4XPTL 3D18A 2C9AA 1LO3L 5IV2A 3T0DA 2HFFA 2IH3A 4P46A 1QBLL 3SJVE 4P2RD 3SDAD 4FG6C 4JFHE 1X6NA 3D18B 3QUYC 2C26A 2D7MA 2OL3B 2HFFB 2IH3B 3AY4A 3KPQA 4U3HA 2C3HA 4C56D 2W0FB 2IBGA 3QXUA 2V5MA 3F7VB 2JJVA 1RK1A 3QCUH 2GJ6B 2Q8BL 2D31A 5CZXC 2OR9H 4RRPG 1KCLA 2DI9A 5C0NC 5JW4R 5L7XH 3O4LE 4G6KL 1XGPA 3STZA 1NMBH 3L3KA 4JG1L 4J3VA 3WDIA 5JDJA 1G84A 2N7AA 5J12B 5K9JL 4TSAL 2AJXL 3KJ4B 4ZSOB 4G8FA 1P1ZA 5CCKL 1FP5A 4F33B 3BH9A 4ZS7H 5F9AC 5AZEL 4BA8A 1LE9B 2P7TA 3F7RA 1QFWL 1BQLH 4HH9A 1OF2A 2Y25A 1BZ9B 4UQ2A 1HQRA 2C1OA 4D9RE 4MJ5B 1FNAA 2CMRL 3G04B 1BJ1H 5D7JB 5EA0H 5KSBA 5M7QA 3HPJB 1AKJA 2HJLA 3ZE2F 4YBHA 4MA1C 3D2UD 4LEOA 2R69L 3HZMB 5DI8A 4W4OA 3TZVD 1FNLA 2VXQL 4LLYB 1PQZB 1CTOA 2EE9A 4WI6A 5DJ0B 5ICXA 3DYOA 1JV5A 2F19H 3IDYB 4I0PB 2X9YA 4WUUA 1P6FA 1YN7B 3TCLA 2H6PB 4TTGA 3BPCB 2AJVH 1B0RA 4MA7L 2FZ3A 5B22A 1CDUA 3BJ91 5F9DC 2RAMA 2OXHA 3DO3A 5GRJL 5FYLE 1UT9A 5BOPA 5E8NB 1HCVA 4YEEA 5FM5M 2FR4B 3S34H 4JO4H 3CSYB 4UTBL 3MJGX 4AY0A 1QUNA 1I4FA 1RU9L 1IJ9A 5B8CC 1JZ4A 3KPPB 3BRGC 3VFTA 3NCEB 3L3JB 1GZQB 1W0VA 4D3CH 4U2YA 4JZNA 1UJ3C 1T7ZA 1PZUB 3WNLA 3VGGA 1CK0H 4TSCH 5J4MA 1FGNH 4ZPVA 4JKMA 4M7LL 4RMUA 5DD6B 1R3IL 2G9HA 1VB9A 4UU9B 1RUQL 1SJHA 3S35L 2K1MA 3O8XA 1K8IA 5IESH 1S5HA 5E2WH 4P2OA 5CKGA 3X3FH 4YDJB 4I2XE 4NPYB 4HT1L 2HH0L 5GZNC 3FN0H 2P8PA 2XACC 3HPLA 3VD3A 2NY1D 4I18A 2D9CA 5T5FH 1BOGB 3HNSH 3G08A 2CK0L 2APFA 2EICA 3TVMC 3VXMD 1MHCA 4OUOA 1EMTH 3T0EB 2D03H 1V3JA 1IM3B 3L7FB 2VERN 5JIHA 3ZMRA 1NGPL 1F11A 1XAUA 4LCCB 1FYTB 3MBEC 3C5ZB 4U1KB 1JGLH 4F7EB 5ID1B 2DI7A 3QPQD 4MDIA 2MFNA 3B83A 3QIUB 3VE0B 4LSTH 4WWID 1GGTA 3OXRB 4L3AA 1ZGLP 4J6RL 3RWDB 5CZVL 1NAML 3P9LA 2BCKA 3EDFA 3VGAC 1I8IA 2DLHA 3IRZA 1IGYA 4KGJA 4PG9A 4LPUA 4S1SL 4GXUN 4NN7B 1YUHB 2F15A 4RRPA 4JHZA 3IU3B 5JIKA 1YECL 3EJYC 1DBKL 2BERA 2QKIB 2UYLA 1FFQA 4XWGL 3MRFA 1IGCH 3L7EA 2DQTL 3J7HA 4ZXBA 3BKCL 4ZFOB 4EOWL 2N4IA 3IXAB 4ZXBD 2UUDK 4KDTC 1U3HB 5AYUH 1B90A 4QKXB 3IXAA 3W82A 2UY6A 5HYSG 5EOQL 1UVQA 2EE3A 2W0FA 2VTFA 1FE8L 2NY7H 2ZUUA 1ZT7B 2P5EE 2GJ6A 3OAUL 4YHLH 1A7RH 4X6DB 1UM4H 2X4NB 3GKWH 3RVWC 4OSUL 3BIKA 1XGRA 5HI3C 1KLGB 4HUUA 2BNUB 1NH6A 2ZOKA 3GHEL 3CFJB 4CVZB 4UV7H 4LKXB 1GGCH 3RPIA 2UV3A 5E8EA 5J6HA 4PBVC 3QZWG 2ZKHL 3UPAA 1LDPL 1ZHKA 3FRUB 5ANMB 2Y6SC 3N06B 3O9WB 1CD1B 2VSDA 1UKQA 5KS9E 4Y88A 4R3SB 4F9PC 3VFVB 3TPUB 3NCMA 3GIVB 4U1HB 3UPCA 3G6AB 5HHOA 1ACYL 1G7MA 2AI0L 2ZWLT 4NYLA 15C8L 5DJ6B 1A02N 4KVCL 1HHHB 2XKUA 3K3QA 5D7IE 2XKNB 3FAXA 4NKMA 2V7HB 3DMMB 1NEZG 5JTWA 3L3DB 3FQXB 3MXVH 3GMPB 3TIDA 3IFPA 3BP5A 4KQ4H 3OGOE 5FFLA 2JCCE 5IQ9A 1XF1A 1N0LA 4OV5A 2UY7A 3KYNB 2QQNH 4OAWB 1U8QA 3GMLB 3JWDH 3DTXB 3ARZA 3MR9A 4NWUL 1RK1B 3I02B 4F9LA 3R8BB 1Y18A 5I8OH 3C2AH 1M1SA 3TJEL 4F7TA 2C4XA 2J6EL 2YMXH 4MCYB 3ARTA 5DVNA 1BAFH 3OHXA 5TGBB 1SVZA 5JW4M 3MCKB 5SWSD 5EOCL 1GZQA 1W0VB 2QV2A 4FTVA 3T0BA 1MWAL 3W9EA 5F1SA 4XC1L 3O11B 3TVMB 4LPTA 5E4IA 4KGLA 1ZHLA 4WUKH 1B9ZA 1E4JA 1OAXL 5MI0B 5T5FL 1HILA 3ARFB 3EDEA 4Q2ZB 3TA3D 4CU7A 4WHTA 1P84K 4WHYG 2EIBA 4L4TE 2F53D 3ARFA 3QUZD 25C8H 3OWEA 3QQ4B 2E8ZA 5BRZA 4XTRC 1FPTL 5KJRL 2VLMD 3QRGL 1QA9B 1G7PB 4FABH 2VH5H 4MB5A 3VXNB 5ICXB 3PHQB 4UQ3B 5LWYL 4QHMB 2ADJB 4LVEA 4X8XA 4PJEA 1WBXB 3G08B 3IAQA 2OTPA 2H6PA 4JO2H 1EHLL 2Y23A 1G9NL 1ZS8B 5BXFA 4DEPC 1O7SA 4PJEB 1NEZB 5M94B 1KJVA 2B0SL 4YX2H 3V0VB 2JIXD 1ZEAL 5IB1B 2DQIH 5MEOA 4M9PA 5MP6H 2VDRL 2ZG1A 3OL2A 3O6FC 1L0XA 4RGNE 5CJ5A 4FQ2L 4HKXB 4OFKA 3RZWA 1YY8A 1CXLA 4NSKA 1S5IH 3TT1L 2A1WL 3IDJB 4E41A 3P11L 1I8IB 1F4YL 4JO1H 1IGFH 1YY8B 3F12A 2OZ4L 3FCTA 1LMKA 4A6YB 5J1SC 5IJKC 4RGND 1FBIL 4Z76B 4P49A 3DNKA 1KOAA 4TSBL 1CICD 1FRGL 1WLHA 4RBPH 4AQ1B 2OL3H 1A1OA 3VXPB 4F2MB 3KYKH 3NCBB 2CGRH 2VLKE 2FD6L 3GDBA 2FSEA 1SEBA 4NPYA 4GUPA 1Q0YL 1C12A 3LKPA 1NCWL 4E0RA 2NY0B 2VZ1A 3T0AA 2CSPA 3VG0H 1OARH 5C0EB 3GSXA 1AIFA 3H9SD 5D6CB 1CE6A 4P4KD 2L7JA 3GJEA 3U7WL 4P4KA 1Z9OA 5F89B 4IMKC 1OD9A 5ERWB 5L2KD 3RY5A 1WV7T 4NOFA 1BJ1J 3TBYA 3MRBA 4XB8A 1K8DA 5FO9A 1U91A 4LVNB 4XCEB 4P46C 4EXPX 2P43B 4GMSH 5LBSL 5SV3A 5DDHB 1I9IH 1ZLVK 5H35B 3P30L 4XRCA 1MFNA 2ERJB 3HFMH 4K94L 4PJBE 5DUPH 4PRID 5DJYA 5FGCE 2B4CL 1CF8L 2AEPL 3EYFB 4PP2B 5F7EH 4KKBD 4P5TB 3C5SA 4DTGL 2BZDA 5SV4A 3EYFA 1YEEH 4XNXL 2YUXA 4F3FB 2QADB 1JPGB 3C5SB 5C0CD 5AD0B 1VFOA 4ZO7A 1G6VK 4PJCE 1HOCA 1NBYB 1FNEB 2DS4A 3MLTA 5HDLA 5I1DB 5B4MD 4F3FA 4I0CC 2A6JA 3SE3A 2IBBA 5IFHH 4E42B 4QT5B 1I3RA 4WO4D 3CX5J 3SHSA 5GGRA 5GRVL 3KR3H 4I4WA 3HFML 5EBGA 4WDIA 1PW3A 1A6ZA 1FAIH 4BYHA 4Z7WF 4C57C 3WS6A 5SWZE 5E24E 1CD0A 1XH3B 3BZFB 5T1KA 1XF3A 2D7OA 1B3JA 3V0WL 3CLEH 4OCLC 3LVEA 5HDQL 2GUOB 4N0UA 3TH3T 3UTTA 4JDVB 4XCYA 2E3VA 5BOZG 3AUVA 3VXME 4F15C 4FQ2H 4N5EC 3GGWB 4K7PH 4XVSH 1F13A 4EEEA 3O3EA 4AENA 5DLMH 1DQDL 1FFOA 2OK0L 1BJMA 3A0OA 1ZT1A 3W0WD 5IFAL 1CTNA 2YPLA 3FO2B 1G9MH 1PG7H 3LN4A 4WHTB 4KKLD 5C0IA 3MV8E 4J3XA 4NO0D 5B8CA 4F7MA 4L8SB 1YMMA 2CPCA 3DURB 1EEQA 1JWSA 1RURL 1HXYB 4XP6H 3OKNA 1DZBA 2FH6A 1S7XB 3GSRB 4ZD3L 1YEKH 1A7OL 4HWZA 5E6ZA 4POZD 4WFFD 4PS4L 1MREL 2XQBL 4AQOA 4XI5C 4LBEA 3QFDB 1JHKL 1OTSC 4P9HL 5T1KD 3IDIB 4Z7WE 3RA7H 3UDWA 4JJ5B 4XCNA 2Z8RA 4IOSD 5DYOB 2XTLA 3O8XC 4XX1E 5B39A 4DJMA 3ZSSA 3O6KH 3HG1A 3MV9E 3JUYA 1F6FB 2NY1C 5DHYB 1HINL 35C8L 3B9EA 5DWUH 2Y5TA 5DQDL 4X6CE 3O11A 3TVMA 1S9XB 4YFLI 2F5AH 3IDJA 5JXEC 1P7QA 2GAZA 3NAAH 4KHXL 3BO8B 1I9RH 4XP9H 3RNKB 3MBEA 1A6VL 2IAMA 1JZ6A 2QL1A 2ICWA 2J6EH 2YMXL 1ES0B 4G8EA 4YE4L 5CGTA 1FVCA 3MOAL 2EDEA 5EBWB 3VD4A 5TE6L 1QNZL 1OTTD 5ACZA 4GUPB 3BKYL 4HV8A 4NQCD 2CKBL 3SDXA 2DB8A 5LG1A 2QQLL 5T1DH 5I66A 3BQUD 4LK4A 3WN5B 1MCQA 4OKVB 1QSFD 1F6AB 3QDGB 1ZOXA 2APWA 3ZDZE 3QO1B 4Y2OA 2GJ6D 1CICC 1DBBH 3IJSA 4KUCD 4JO2L 1G9ML 2Z8WC 1F8TH 2AJYH 3RU8H 4XP1H 4PBXA 3MLZH 4NFDA 4PR5B 4Z9KB 3DETD 4LCUA 3LH2L 1BF8A 5MENE 1TZGL 1N5YH 3DUUB 3CZFB 3NCCB 5IMMB 2GTZA 2FIKB 4HK0B 3VXSE 4TUKL 3S96B 3Q6GH 3F65A 3S88L 2XY2A 5D93B 4XT1C 4PJGF 2MQ3A 3FO0H 3Q6FB 4XRCB 3T3MF 4IIQB 1OT2A 1YQVH 1VPOL 1GH7A 2Q86B 3WXWH 5EU4A 1JF6A 4M8VA 1Q9LB 4LVHC 5D2NB 1HWHB 1Q9OA 2DQHL 2JELH 4UB0H 4Z7UF 5J9PA 3S5LG 4FTVE 3O2VH 1U95B 4YO0B 4PJIE 2JB5L 5ITFA 3MLTB 5CJQL 4JRXA 2C7UA 1MHEA 1U95A 5IKCA 1CLZH 4UAOB 2IFFH 4GSDH 4JRXB 1N3NB 2J8UF 1HCFX 3MO1B 2FEDD 5IKCB 4L4TA 4Y4FC 3AAZB 2OX5A 4PJ5A 2FYYB 3ZKXB 4X7TB 5ERWA 4GAFB 3HC4L 1TCMA 2A83B 3AREB 3H9ZA 3C8KA 1S7VA 3O6FB 5DEGA 2LU4A 4L8DB 3NIDE 4GW4A 4WEBH 1XZ0A 3QJFA 3U9PH 2DQJH 4GG6E 4LRNH 5JOPE 1Y0LA 1DBMH 4TRPH 4L8CB 3P4OB 2XT1B 1V05A 1JHLH 3W0WA 2HP4A 3EYSL 2I07B 2HG5A 4WY7H 3NA4A 4HMCA 1I3GL 3TA3A 5JQ6L 3EOTH 3CC5B 2XN9D 1D5XA 1PBYA 4HS3A 5E8OA 5DMKB 4GRWH 4MCZB 1KYOJ 2Y9RT 5B8CB 1VGKA 2F58H 1RUMH 3BPNB 4ZOBA 3X12B 5DMKA 4UT6L 3LRSB 1T1YB 5JIIA 4OGYH 4ELMA 3VD9A 4ZODA 2XN9E 2HWZL 5A1AA 5CIPB 2P5WA 1SEQL 2RQ8A 1XFPA 5EULV 5TF0A 3ZKQD 2W07A 5CZVH 2KUTA 4EUPH 5DRXA 4WTZG 5EOCJ 4H0HB 1ACZA 3A6BL 3EOAA 1WGOA 2A9ML 5GGSB 2PW1B 4K3GA 4LP4A 3OGCA 2D4FA 1T03H 1UACH 3MJ9L 4UDUA 5BCAA 3OKMB 4FFYL 2BVYA 3ES6A 3RGHA 2HKHL 1YYMH 2XZCH 5CBAA 4NKOA 5I9QB 2G5RA 4OF7A 1B2WL 1HHIA 1XGUA 3ILPA 4RQQB 5GSVA 4F7PB 3VDBA 1X5IA 1G0XA 3K2MC 1OAZL 4M61B 1FSKB 2Y4SA 2W60A 3UDWC 1CICB 1RZ7L 3RVUD 2AV1A 4U1JA 5C3TA 3FO2A 4LIQH 1XF2A 4I5BB 4HIJB 2W0PA 1OW0A 3HI6H 4YE4H 4JFFA 5EBWA 3ARXA 1XF2B 4NN5C 4PJBA 1AY1H 4FMKA 1X9QA 3WO4C 1T20B 1OSZB 2NZ9D 4ODXB 3BKML 3M17B 1KTLA 4PD4J 4PJBB 4Z77B 1YYML 4PTUB 1MJ7L 4KWUA 4ZTPH 1P2CB 5IJKA 4JKKA 5KS9F 4OZHE 3VFGL 3PGFL 5DXWA 4D3CL 5BW7C 4PTUA 3U1SH 3WV0A 4CRPA 4G3YL 3PDOA 4LFHG 2WWKO 3HLAA 2FNBA 4Q97A 4OCNC 3FMGH 4N8CH 1U58B 3DUUA 3OV6A 3HLAB 4Y19E 4RAUB 4YIQA 4W70A 4AT6B 2N1KA 4LHJB 2DIAA 3SO3C 3D3VA 5CILH 3UTPD 3GSUA 1MCEA 4LRIA 4O4YH 2C4FT 5IGXL 4QRUA 4RDQF 4Y16A 4D0DA 1UJ3B 5JO5B 2IAMB 4TSCL 2DLGA 5CS7A 3I6GA 3TO2A 2ICEB 5I8OL 2YN3A 2DQEH 1F6LL 5JQ6H 2QSCH 4ONHA 4M00A 4WV1A 4EBQH 2HMIC 4XP5H 2UWEB 4MX7B 2HT2D 2BMKB 5E5MB 1K4DB 4XPBH 3IKCB 5IIEA 4LPVA 1JPSL 4EVNB 1I3UA 3NN8A 4OLZL 1C16A 5TDNA 5DMIH 4R4BB 3AMKA 2FHCA 3M07A 4FP8L 4Y4HC 1ZA6B 3QHTC 1TJIH 5T3ZL 2XKSA 1YMME 2YR3A 3SDCD 5J6GB 2MKLC 2A83A 4OI8A 3HC4H 1TXKA 4X7CC 1RJLB 3IXTA 1XZ0B 3UYOD 3NH7L 4HFUL 4JRYD 2JTDA 3VFNB 4DN3L 1DJSA 1OGAA 4YEFA 1MY7A 5E8PB 2ZKHH 2Z31C 1QQDA 3HE7B 4Z7WA 2FJHA 4F57L 4CMMB 2E27H 2XOTA 2PTVA 1EVUA 1ZVSA 2EZ0D 4DOHB 5JNYA 1DP0A 1KCSH 4LVOC 4OIBA 2P8LA 2VN4A 1W2KT 4KTDL 4QRRD 3QEQB 4LDEB 1MLBA 1TDQA 4RDQG 4ZNEA 1QFWI 3LZFL 2QEJA 1P6AB 4Q9BA 1BZ7A 1CDIA 1PLGH 2WW8A 5DHVA 1U3HD 5EO1B 2SEBB 2I27N 1F2QA 2YXFA 1KEML 2H26A 4ORGA 4KRLB 2YSSB 2Y36H 4XMLH 3D2UA 1GOGA 2YWYA 5I16B 1UB5A 3MRIA 1A6UL 4ZFGL 1SBBA 1MEXH 1CBVL 2X42A 1OM3L 2Q76B 1N64L 3ARBD 5D1XB 2PF6A 2AJYL 4S1RH 4GW4B 5D1XA 4C4KT 4HUKB 3TYGH 5CINH 4TOYL 1HINH 3IF1A 4WTZA 5E99H 4PRIE 3FT2B 3RWGB 3MRMB 5FUZL 5CBAB 1D6VH 4TQEL 4QTHA 3VI4E 5F7FA 4G6AC 3P0YH 3QUZC 3QQ9D 4QHNA 2YD9A 4UT7H 5ESVA 1OGTB 2AV1B 3VJ6A 1HQ4B 1LEIB 1MJUH 4MMXC 2W65B 5CGYD 1LEIA 2OJZH 5EO0A 3MACL 4HUWA 4I9WD 4G9DB 1OAKL 5CP7A 5IT2L 2NPLX 2MHAB 3MRJA 1JUFB 1LP9B 2NY5C 3TN0A 4XVUD 3M45A 2IALA 3WIHL 2YN5A 1P2CA 4W6YB 4L4TD 3BD5A 3G5VA 1LP9A 3SDAA 4OM0H 4HXAH 4WTWA 5GGSA 3C6SA 2F5BH 3O41B 3P9MB 3G6DH 4BFEA 1I1FA 5J11B 3FOMA 4RCAA 4RA3A 4YHKH 2C3XA 1S8DB 2X4RA 1SY6L 3FOMB 5LWYH 5KTEL 4NWTH 4PRPA 4Y16D 4LEXL 1IM9A 4HSQA 1S8DA 4APQD 3P11H 3KYMB 4BFIB 4QTIL 5I1JH 4OF0A 5IHUH 32C2A 3MGOA 3DUSA 4NCC2 3U83A 4BFIA 2BOCA 1EZVX 2MCG1 3OJDA 4YXKL 4O2CB 5ISZE 5JQHC 4PJ7E 2Q7NA 1G7IA 1AXSA 3IAGC 4D8PB 5KZCD 4GRMA 2P49B 3BUYB 5I19H 1E6JL 2BDNL 2EO1A 3NN8B 5TDNB 5EOCH 4U4BA 3ROLA 2AJUH 4H25A 4NGHH 5FYKU 3G6JA 5I15H 4JVPA 4BK5A 2FATL 4YXHL 3BN3B 4ESKA 1UFUA 2YBRB 1Z0MA 2X4TB 1PG7L 4N1EA 4MSWB 3QEQE 4RX4A 1WZ1L 5D71H 1CFNB 3QFJE 5INCB 4WWKB 3LN9A 3R06B 1PX4A 1MCPH 4XMLL 5FYKL 3NH7H 3HMWH 2XN9B 1HE7A 4EUPB 1JWMB 3CSGA 2GSIB 5K9OA 5HPMA 4POUB 5FUZH 5BZDB 5GS2D 4QRUB 1RZGB 1DLHB 4WNQB 5HHMB 1CVSC 3OJMB 4H88L 4ODSL 4PRHB 5D7JD 4YHOL 2GYSA 1N6QH 3QCUL 2VDNH 3T1WA 5IB5A 2XWBB 5LQBL 4ONHB 5K9QG 2OSLA 3OJ2C 15C8H 3P77A 5F9WC 4R97B 4P2RB 4EZMA 2HTKD 2ESVE 5F7NC 4HMDA 4XNUH 3RJQB 5GS1A 4GO6B 2BMKA 3NOIA 3P77B 4R2GB 5DC0A 5BS0D 3K8LA 3D0VA 4U1LB 2QR0A 1UB5B 3BGMA 4U1NB 1S7TB 1XIWC 1YYLL 4FN0A 4X80L 5HTSA 4Z78B 3BH9B 2PYFB 2QQNL 3D87B 4IOIB 4XVJH 4U6HB 2N56A 3D85A 4ZFZA 2EIDA 3B9KA 5KSBB 1DANU 3SE4C 1EAPA 3CMGA 4LLVA 2A6KA 1UM5L 4G7YL 4ZFZB 1GOHA 5T1LB 3CSPA 4Z8FL 4LEOB 2J3SA 5GRVK 2R39A 2VLJD 3QIBC 3BZEB 2OTUB 5C8JB 4G8GD 3TYFA 1UB6A 1JPTL 2DKMA 1MLBB 4P0DA 2NNAA 2VDKH 3BZEA 3LZFH 4JKLA 4POZC 2H8PA 3JV4A 1T5XB 4JFFD 4KJWC 4X6CB 5E6IA 4V1DA 5GZOC 5IEKB 5F6IC 4LGPB 4JQIH 2QQKH 5F6HI 3MRQB 4ORGB 3I6KA 1DVFB 3O8XD 1UZ8B 4IRJC 2FGZA 1RJZA 4AH2B 2E27L 4MA1B 3CSYA 3O3DB 4XXDA 5L2JA 4J3OC 3ARVA 1MFAH 1MCNA 5A2KH 5L88H 1IZKA 1EK3A 1RZ7H 3OKYA 4JRYE 5E70A 2A9NH 3MRGA 1KYOK 1CCZA 5I8KL 1FZMA 2PETA 5CGYC 1B4JH 1MNUL 1CLYL 3CK0L 2DTSA 1EERB 2XIDA 4A6YH 3VCLA 4ZPVB 3LPGA 3QI9A 2KH2B 3O4OC 4QTHB 3B9VA 4P48A 4PJIF 4F37K 2VZ3A 2R2HB 3NA9L 3AS2A 3FT3B 1LK3L 3PQYA 2XG4A 5FA3B 1LEKA 4PLKD 4XPHH 2W91A 3UJTH 3VWKA 1MCKA 3CGTA 1PKQE 4MJ2A 5KBNC 2G75A 4PREB 5JORB 1MCLA 4D9LL 4MAUL 1N7MH 4OM0L 2DMBA 4UV4L 5D7LA 3SDDB 3O4LA 5JW3H 1BPVA 1KIQB 4O2FA 4ZYKA 3X14A 4G3YH 3PWLA 2WLYA 3SKNB 3TBSB 3DVGA 4G9FB 1P9MC 3CXDL 1OQXA 2ZOLB 4OZFH 1G7IB 3QXDB 3V0AC 5J89A 4YHMH 1YMMD 5FYJH 4JFEA 3IDNA 4PJEF 5D2NE 4KDWA 3H3PL 3KXFB 3RIFF 1IGMH 1AD9A 1DL7L 2ZCKH 3BQUA 4HWBL 2ZCHH 4M9OA 3VA2C 1K2DA 3B8YA 3EZJB 2NX5D 3R0NA 3WNNA 1G7JA 5C6PB 1ZANH 1KT2A 3QIBB 5BV7H 5BV7L 4PJFF 3WN5C 2GW5A 3HC3H 3V8CA 3C2AL 4HIEB 4PRAB 5B39G 1N4XL 5ICYB 4P2QB 5EFIA 3RZCA 3T4AA 2EO9A 1Y6NR 3VW3H 2V5SA 3NFNA 2M26A 4HX1A 4UV7L 1T6WA 4MQTB 3FFDA 2Z92B 1H0DB 5CJBA 3EYQC 3V79C 1IGYB 2ENSA 4U49A 4WCYL 3UTSE 3CCHB 3PL6C 3S36X 4WY7L 3ARWA 4L9LC 3MNZA 3AGVA 4HKBB 4LLWB 5D5MB 2CRMA 3A6BH 1CLCA 3MRFB 5I73C 1ZGLB 4Y4FD 2OSLB 4XVTL 1OT1A 1ACYH 2AI0H 3V6OC 3GMMB 1DN2A 4FZEL 1L0YA 4XGZA 2EECA 2Z91A 2DDQH 2X7LA 2DWDA 5CMAB 2R9HD 4HEME 2CKBB 3UPRA 2X7LB 2JF1A 3LSOB 1RSFA 2E6PA 1ZV5A 3FRUA 5ANMA 2EC9U 1M7DA 3FB5B 3PWJB 3BP7B 4X80H 4ACPA 3OQ3B 1JZ2A 3DXAE 1P1ZB 4LKXA 3KPRA 1JF5A 3GKWL 3F62A 4P59H 5FV2A 5ADOL 1L6ZA 4WI2A 2BVEA 5E2TL 1QKZH 4CUCA 3QDJD 3HR5A 1EAPB 3T0XA 5HYJA 2CO6B 2EYSB 4WW1B 1ZXQA 1RI8A 5CSZA 5IVXF 4PUBL 2XXCB 8CGTA 2NY2C 4Y1AD 3HB3C 4H5SA 4WU7B 4WWKC 5HPMB 1F58H 5GXBB 1NGZA 4Y1AA 2VLJA 1T0MA 3MROA 3U0TB 4P9MH 1RUAH 3H9SB 5I1KL 4MHHI 3HMXA 3MLSL 4IBLT 3ZTNH 1FAKT 3JVGA 5BVPL 4DAGL 3CDGB 4TVSa 4DAGH 1ZTXH 3AS3A 3MUGB 4HCRL 5ICZB 2WM0A 4KK9D 2BY0A 5D1XC 5GS0D 3L3DA 2DOCA 2OL3A 4PRPE 5GGTL 3FN9A 4J8RA 4NNPH 1XGTA 4XH2A 4AEIL 1TZHB 1OL0A 3GMOB 4CDGC 1A9BA 4MLSA 2R1WA 4OCXH 3GIZL 5KN5A 3KPOA 4D9RD 5DR5H 5BMFL 4U0RC 4XP9L 1WF5A 1BQHG 3QIWD 1MUJB 4G8FB 3KPOB 1NL0H 1CL7L 1EIBA 1JHTB 3JBG7 1RJYA 4OFIA 1T7WA 1U92A 3GJFK 3EDKA 4M7JH 1UADC 1B4JL 1MNUH 3CK0H 4P5KA 3V4UH 1A3RL 4G8GB 1DANT 1RMFH 1MF2L 4PIRF 4JPKL 3PQYD 3G6JE 3AVEA 3CU7A 3FT3A 5GRJH 4UU9A 2HJLB 4LSRH 3R8QA 1CLZL 1IAII 5FHBH 1FFPB 3AY4C 1MFDL 1QRKA 3PHQA 1I9RL 3BDXA 3QDAA 1YEKL 5DQJA 43CAA 4DQOL 1QO3B 5DA0B 3CVHH 1BREA 1AHWB 4HUNB 5CEZH 1WQVT 2EDFA 2GSGB 1MHPL 3VXNA 1JWUB 1B6DA 2PXYD 1R3HB 1WTGT 4AH2A 2GI7A 3SOBL 5HHME 3FONB 1ZS8A 4Q58C 2P44B 3JUZA 4ODVH 4QWWC 3G5YA 3UO1H 1N7ML 3AS1A 3SGDH 3PJSA 4LDLB 5IB1A 2VDPL 3BE1H 2AEQL 2HTLC 3EJYD 5DQ9B 2WANA 1TVHA 4CMHC