4W68A

Cytoplasmically produced homodimeric single domain antibody (sdab) c22a/c99v variant against staphylococcal enterotoxin b (seb)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
MEVQLVESGGGLVQAGDSLRLSATASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYVAADLKMQVAAYMNQRSVDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single domain antibody
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 32
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w68A00
2V17H 1NLBH 4JFED 4WV1B 5EORH 3L9RB 2WINB 4NRYB 5C9JB 1JGDA 5ABDE 2JJTA 2ZG1A 1RUMH 2W0FB 5F88A 3TZVA 1M7DA 1G84A 4L1HA 1FL6A 3KPRA 5T33L 3BDBA 4XGZB 3CXDL 2X9XA 4KV5E 5MP6H 1ZVHA 1GVIA 3MMEA 4HS3A 1EK3A 4QRRE 2R0LH 4KK5C 1T0NB 5DYOA 4Q9CA 4TSCH 5T5NG 2FJHA 2GSGA 3QR2A 1L4IA 4OIBA 5C0CD 1ZLUK 1PY9A 5C07D 4LBEA 2R4RL 1FVEA 1ZEAL 4PRID 3FN9A 2APVA 3MRRB 1QVOB 2HT3C 4BQ6A 4CNIB 4YXLH 1MFEL 3WN5B 4Z7WF 3ULVE 4RRPA 3IDMA 4Y8AA 3SGKC 1H0DB 3VFOA 3KPRE 4G8EB 4XMLL 4FQIL 3VI3F 1G9EA 3VRLE 3MJ9H 4YK4B 3B5GA 1LQSR 2MQCA 4PJXE 3GGWA 1F6FB 4WFFD 1MCEA 4OBSA 4K9EC 2NY2D 2MQ0A 1HDMA 3U7YL 2UVFA 3QWQB 2NY1C 4NKIL 4NKQB 1MCWW 4MB5A 1MH5A 5D96B 1HKFA 1FNSH 1IC7L 1W0WB 4QHKJ 3VXNA 2BY3A 5ALCL 2OZ4L 1D5MA 4I2XA 4H88H 2HH0L 2J5LB 1GGIL 3OB8A 1MIMH 4LF3A 1K8DB 5C8JB 3DROB 3QXVA 3RVUC 5E56A 1MIEL 3B83A 2OTPA 4JREB 5CGMA 4U1KA 5FYJD 4M5ZH 2ZUTA 3S36H 1KT2A 4XCYA 3TWCL 3VXUA 5MHSD 5LJYH 3RVWC 2FATL 3TJEH 4AMKL 4AY0A 1ZXQA 4LSDA 3I9GH 4TQEL 5IVZA 4ZO9A 1NGQH 4RGOH 4L1DA 3CLFL 4PJEB 1F58L 2IAND 4OFKA 4XWGH 5DGQA 4XWOC 1R5WA 1CFTA 1RURH 5A3IC 2FWOB 2GT9A 4BH8B 1QSFD 4C56B 4DKDC 5IT2H 2VAAA 3EYQC 1RJLA 1QKZH 1NSNL 5E4EB 1HOCA 2AKRB 4EI5D 1JCKA 3DX9A 1F3DJ 1OLZA 2NY5H 4I0KA 2P43B 2WANA 1KXVC 4HXAH 2OQJA 3IRPX 2YOCA 3GMNB 4XZUB 4WI4A 3WIHA 4M6ML 1IGIL 2MNUA 3NTCH 3QA3A 3JWNC 5J3HC 1MLBA 4GMSL 2P24B 2DKSA 5I17A 5A40E 2YXMA 4JFPA 4JQIL 4RGNB 1ADQA 5ICZB 3TYFB 2HTKC 3SDDC 2BNQB 2DQCH 3T77B 5ANMB 5J7CC 3MOAH 1GGBL 2GIYA 3FHQA 3WS3A 5L2KD 5CUSH 4XRCB 4N0UA 2JIXB 1K4CB 5IV2B 2OL3H 3BP7B 2PO6D 9CGTA 4TOYH 1EIBA 3NCEB 2X9YA 5FV2A 1T5WB 3KAAA 3BP6B 5E1AB 2G5BB 4XCFL 4R2GB 3UZEA 3EDDA 3VI4E 2IMMA 5DC9B 4CJ1A 2A73A 1CDUA 4KKAD 1D9KC 1CXHA 3S37L 5CD5C 3ARGD 5EOQL 1F4WL 2NW3B 3C9NA 1DQMH 1JHKH 4TUKL 4YHMH 4O02L 2WIIA 4Y0GA 4V2CB 4FRWA 2VYRE 4UU9B 1NUFA 1BEYL 3CU1A 4HCRA 1CDYA 1LK3H 3IDIA 5DLML 4N0UE 4XC3H 3STLA 2G5RA 5EZIH 1J1XH 3A6CH 3V95A 2EXWC 3ZE0F 1RSFA 1GOHA 4PGBB 1UWXH 3QG6A 1I75A 3SOBH 2DQGL 3A67H 5L7XL 3VRIA 4YJZL 5DHVB 3O6FA 1T5XA 4XPGL 4HGWA 5T3ZD 1BX2A 3O3EA 4EIZC 3T1FB 4XTRC 5CIPB 2W07A 2NLJA 1J1OH 3JV5A 4LARH 4BZ2H 1MCSA 1CFVH 2HFFB 3ZHKA 5DUPL 5J13B 3UPRA 1I9JL 3EGSB 2O5YL 2WNGA 1F4XL 5H8DA 1DSFL 4JJ5B 4KTDL 4MDIB 4JJHA 2FR4A 4AG4L 3GZKA 3T4AB 2ICWA 5CEXA 1YMMD 2NTFA 1FO0A 5DMGD 3SQOH 1NEZA 1TCRB 1TIUA 4O2EB 4RFOH 2GK0B 1U8PB 2YK1L 3O9WA 1X5GA 4MJIA 1RU9L 3FQXB 3ARBA 4G9DA 2ZPKH 4RIRA 2RAMA 1NCTA 5JNYB 1T22A 4ETQA 3NZ8A 1TDQA 4MVBD 3QIBC 3EOTL 2IPKB 1MAMH 5TE6L 5DD5H 2Q76B 5B3JF 1JZ4A 4KI5E 3CUPB 4GAGH 2KZWA 1XCTA 4MD0B 2BSSB 1A4KB 1K5NA 4FZEH 4S0TD 5EBGA 4ZFOL 4OLYL 5ETUA 2A1WH 5CJ5A 2ESVD 4LLYA 1LNUB 3V8OA 3T3MF 5I1KL 5ACZA 4NQCE 1BD2E 1AXSA 3RY5A 4HKBB 1T89A 1XZ0A 1KNOB 5LXGH 2VKWA 5MEND 1N4XH 4I0CC 1A3RL 3PP3H 2DQFA 5E2JA 4BYHA 4CU6A 1N5AA 4WHTA 2J3SA 2JJWA 2Z31C 4H0IA 4WWKD 1QO3B 3UTZA 2ZKHH 4NQDD 4X6BA 5ESVA 5T3XE 4UTAH 5E6IA 3QFJA 1UQSB 1E28A 4I5BA 5IHUL 5J9PB 4LRNL 5GGVH 5FCUL 3RWGA 2FJFB 3CFJB 3VXMD 4Z7WA 1WC7A 2AXFB 4YEFA 1ZSDB 3C6LB 3DV4B 2BC4A 1QFUH 1U8IB 1X5IA 1UFUA 3ARFD 1UB6B 4PG9A 3CSYA 5IROA 4TVPD 1HEZB 5C0DA 4HWNA 3TYGH 3MRBB 3C2AH 2FH8A 2XRAL 4WGVB 1MCFA 4QOKB 3BUYA 4JLRA 4Z7WE 4KKBC 2V6HA 3B5TA 1NCNA 2BOCB 3DMMD 2R2CA 4PP1C 3V5KA 2F53A 4EBQL 4EDWL 2FIRT 4Z77B 5AAWA 5EC1A 3LRHA 2QQNH 1AXIB 5EZLB 1T1ZA 3P4OA 1F6AA 3H9SA 1U3HC 3VGGA 5C0CB 3RI5K 3L3JB 1OAZL 2NY5C 3GMLA 1RK0A 4XBEH 1LO5B 4NC2B 5E95B 4A6YA 3QISA 1UVQA 4PJCB 5FUOL 4HJGA 4NUGH 4P2QE 2J4WL 4RQQA 2EZ0D 1IEAB 4NQXA 4U1NA 4F3FA 1XAUA 3BKYH 1YUHB 4JHWH 5J6HA 3CSGA 1ZWIB 2GJ6D 2PW2B 1TQBB 3RVXC 1JZ8A 5EG6C 4NO0B 2NY2B 4MS8C 4YHNA 1CWVA 5DJYA 2BY1A 4KK9C 1CGSH 1MCPL 1EXUA 3DRQA 3ABZA 1I4FA 1WBYA 4N1EA 2AV1A 2R23A 2HVJA 3BMVA 1TTUA 1M6OB 3RWFA 3BKJL 4FNLH 3MLSH 1II4E 4EN3B 1HWGB 4LPWA 4JM2F 1TJIH 1UXWB 1AO7A 2JELL 5D1ZA 5F7LB 2QQQA 3PWVA 3MV7E 3H9YA 3KXFD 4TULH 4FFZH 1PAMA 2VIRB 2EDXA 3IFLH 3RA7H 2PXYB 3VXOA 4QRPD 4E41A 5KSBF 3RVTC 3LQAC 1FL5B 5SX5K 1J05A 3H0TA 5HHQA 3TBWB 2H32A 4ZFGL 1YN6A 4U6YB 1E4XI 2A74B 1UM4L 5B39A 3W81A 4ESKA 2AK4D 3G9VA 1KJ3L 1OAUH 4LPYA 2ID5A 4NT6A 4EI5B 1YZZA 3IF1A 5EU7C 1DUZA 3TIDA 4H8WL 5IKCA 2F5AL 4E41E 1DDHB 3T0BA 2BNRE 5D7JA 3ECBA 2XN9A 4MCZB 5EA0L 1J1PH 4C57C 1UKSA 4FFYH 4PGCA 1M4KA 4B0MM 4ZFFA 1IC4L 4H1LH 3W0WE 1P2CA 2I5YH 5TH2A 5L2KB 2J1KA 4LLVB 5E8EA 2BMKB 4PP2A 4XAWL 3O6ML 1ZT7A 3KPOA 2V7HA 3WFEL 2VQUA 1WBXB 3L5WA 1YEFH 1W2KT 4K2UL 3GI8L 4ZSOB 4QF1B 1U8NA 2VR9A 3C6SB 3LPFA 3DJ9A 3CFCL 5HYJD 2HN7B 3ARGB 1B0RB 3K8LA 4FOMA 4OD1L 4ZXBA 3UTTB 1KJVB 1X9QA 1DBJH 4JPIB 5I73B 4NDMA 4MNQA 4P46C 5HGAA 4L5FL 5DQJA 1UB5A 1B0GA 2W9DH 1FCGA 5EU6B 4LSRH 4ZQKA 2DQHL 3OKMA 5JDSB 1T21B 3E2HC 4LIQE 4L8DA 5EPMB 3PQYE 3IKKA 1UJ3A 5D1XA 4MXWH 4PS4L 1AGCA 5E2WL 4Y19D 5C7XL 4Y2OA 1YEDB 3O8XD 4K9EL 3UYOD 5L88H 4NN7C 2P45B 3NGBB 3SCMC 1JJUA 2B4CH 1OAXL 5T5FL 5JW5A 1RUQL 3SJVA 2DM3A 4HK0A 1OAYL 4J8RA 4K3JH 5EUOE 5B38A 3DUUB 1CD8A 1KEML 3KPSE 4PJEF 4JY4A 1YMMB 4X83A 5BS0D 2M2DA 4DUXA 5E8OA 3BQUC 1C16A 1A2YA 1CL7I 1DE4B 2CO7B 3BAEL 1CICD 1KGCE 1GGCL 4HJJL 2NQCA 2C1OA 3VFNA 2LTQB 1VGEL 4XH2B 2Q7YA 4KKAC 3NFSL 2IALA 2O5ZH 2P4AB 3SJVE 4OFDA 3MROB 2VR5A 4D9QD 4JFQA 1P4BH 1Y6MR 3CX5K 4GQ9L 2CDFA 3LPGA 3MLZL 3DSNA 4OV6F 5JLZA 1F8TL 3MJ8B 1NMBL 1PD6A 2XXMB 1JV5B 5ITBL 3TEUA 1D6EA 3RWCB 4K94H 4Y8DC 3F7QA 4R7NB 3V4UH 2FSEA 2ESVB 3V0AC 3GSVA 1Q0XL 5D7KE 1WT5C 3DBXA 4Q6IC 3QDMA 4FQ1L 5I30H 1ZT4A 3QDGD 4YXHH 3LRSA 3H3KA 3W5NA 1Q9OA 5GGRB 1O7SA 4HFWA 4AEIH 1KTDA 1S7UB 4KK8C 5I19L 4NSKB 1P7QA 4KU1A 5FECA 5DT1H 1FL3B 4NOFA 3F5WA 3MRJB 1U93B 4WWKB 2VDLH 4RZCB 3MRLA 1FJ1B 4ONGL 5LCVL 3L3HB 4J4PC 5CSGA 3QI9A 3T08A 5ADOL 4I77L 4JFXB 4HKJA 2VDOH 4PJ8D 2FL5A 3H8NA 4ZDHB 3ZDXE 4X5WB 2MSPA 2Y5TB 1YC7A 3WO3B 3IDNA 4JPVH 3VXMB 4JRXD 4G6JH 5IFAL 3HZMA 4LKCB 2CMRL 4OM0H 1FH5H 3WS6A 1RJYB 3QQ3A 2YD8A 3ARFB 3IAQA 3WIFB 3U0WH 1G9MC 3EFFB 2CQVA 5K9QG 5F1NB 2W65B 1CXEA 1TITA 3FN0H 4Y4KD 1NPUA 4JY5L 4NC0B 1X5LA 3LEVL 3RL1B 1NUDA 4YDVB 3RJDA 2C3GA 4HIEB 3DMMB 4U2YA 2EIBA 3G5ZB 1KB5L 3QCTL 4DZ8B 1CR9L 1JGLH 1JN6B 4XPHH 1FYHB 1XF4A 1P5VA 4G6MH 3VFUB 4KPHH 5I75C 4N8VA 3H7BA 4KXZH 3TNMB 1I8MB 4EDXA 1XF3B 5I1GH 2P8MB 2VUYA 3SDCB 1R3IH 4ACPA 2BXYA 1ORSA 2XZCH 1MREL 5DK0B 2C3HA 3ARDD 4PREB 3UJIH 3WUWG 4H26A 4JKPH 3OR7B 1OSZB 3MGTA 2YRPA 4DVRL 5EO9B 3O2DA 5KSBA 3ALPA 5IFJA 1UA6H 1U58A 4YLQT 3U0TB 3IJSB 1DVFA 3R1GL 4JM4L 5JW3H 1R3KA 2DI9A 5J57B 5DJ8B 3G08B 2X7LB 1FVDB 5H37G 2V17L 1NLBL 3DX6B 3PL6A 3TO2A 5ISZD 1E4WL 4LSSH 5HGBB 3ZKMD 4KQ4H 4WV1A 2JCCB 3THMH 3L9RA 2WINA 4LCWD 4DKFH 5I1EH 3B8SA 4NRYA 3UO1L 2WBJC 5C3TA 5C9JA 1FORH 2VDQH 3TIEB 4RAUB 3BPOC 1H9VA 1KCVH 1W8NA 3ULUE 2R0LL 1OW0C 2BCKB 4TSCL 4XGZA 4P4RB 1LO4H 3K80A 1MFAH 3QB7C 3E3QC 1T0NA 4C83B 3ZYJA 2DIBA 4ODUB 1UCBL 3KXFB 2J2ZA 3S35L 5F7UA 4OF8A 4IBLT 4R0LC 3MRRA 4F15C 1QVOA 1J12A 2JTDA 3OV6A 4CNIA 1CGUA 3EZJB 3WN5A 3CSBA 2FBJL 3MJ9L 2BY2A 4G8EA 3H7LA 4WUKL 5L0QB 3F8UB 4Z6AT 2GTZB 2VSCA 2AK4B 1IAIL 2E27L 2B4CC 4GO6B 3D2UD 4OCSH 3ZYOA 2A6IA 4IRJD 3QEHB 4IJ3C 2Q8BL 3WE6B 2J6EA 1FNSL 2EDJA 2XKSA 2AJYL 4LGSB 4YAQB 1JPTH 5CGYD 5T1KA 3WNKA 4XNZB 3ISWA 5SX4H 3D0VB 1AI1H 1W0WA 4PTTB 4WUUD 3EO0B 3VD7A 1VFUA 5BO1H 5C8JA 3AS2A 1K8DA 3DROA 1H3TA 4M5ZL 3S36L 4S11A 3GUTB 4YHLH 4HIIB 3E1F1 1NGXB 2CDGA 2SEBB 1RZIB 5F9AC 4OFYA 1SEBB 2HMID 4Z7QE 4TSBL 1NBQA 2KPNA 5DR5H 4RGOL 4PJCF 3U36B 4YHYB 2B5IC 5KVEH 1DN0A 2IJ0C 4PJEA 3UBXI 3BVNB 2J12B 3QUMB 5HYJB 2D7OA 4K94C 4UT7L 1QKZL 2FWOA 3X3FL 4LSUL 5LBSL 3HNSL 4HWUA 5FYLH 4BH8A 4C56A 2X4NB 5I74B 1H3WM 2NY5L 2AKRA 1IEBB 1P9MC 2BDNH 3B6SA 4MD5A 4BQ9A 4CMMB 3DGGB 4N5EC 1XR8B 3K2MC 4TRPH 4GXVH 1NDGB 4NNYB 3GMNA 4XZUA 3BIKB 1A22B 3T0EA 2P24A 2DQCL 4C56E 2Q20A 3MOAL 1DQQB 3ARRA 5AZEL 5ICZA 3MLRL 3TYFA 5F96H 3T77A 2BNQA 4LDLB 4X9BA 3RBSA 4PJ9D 5ANMA 3RZCA 2CSPA 3PWUB 4IM8A 3RAJL 1NKRA 4XRCA 2IPTH 2JIXA 1K4CA 4AIZA 3BP7A 2VXQH 1EFXB 1JGVL 4W4NA 1GGUA 1T5WA 3I6GB 4I48B 2E8YA 1GL4B 5E1AA 1KPUB 2G5BA 3WHE0 2GY7B 2XA8H 2HT2C 3ULVH 3MGAA 4YHML 3F12B 4M6AA 3TNNB 1J87A 2NW3A 3UTPD 2ZUUA 1CICB 1BZ7B 1YDPB 4LQ1A 4X8JB 5ANME 5EZIL 3A6CL 4UU9A 3OKNB 2AAVA 4JO1H 3SOBL 3UPAA 1H8SA 3A67L 5D2LE 4PGBA 3LQAL 4G42B 4XNUH 4EQ2A 3GJFH 2GCYB 4XVUD 3C60C 4D8PB 1J1OL 2IAMB 4LARL 4BZ2L 2EE9A 2YN5A 4XI5C 1KELL 5F9OL 3T1FA 5CIPA 5E6ZA 3U82B 3F7YA 2G60L 1VENA 2HFTA 1ZHLB 1DN2A 1KJ2B 2HFFA 3PV6B 1CS6A 4PRPB 4FFVD 3D25B 4K3EH 3EGSA 3WKNA 3QBTB 1BFVH 3WO4C 5C86A 4OUUB 1QNZH 4GW1B 3O8XC 4MDIA 4BSVB 4K8RH 1C5CH 4X7CC 3VWJC 3W11C 1DQLH 3HI6H 3LSOB 1KPVB 4FQLH 4RFOL 4WHYG 3T4AA 3B5HA 1QHPA 4O2EA 3GBMH 2GK0A 4Z0XA 1U41A 1ZVSB 1MHPH 1LDPL 1U8PA 2GHWB 2RIKA 4NQEB 1OOAA 1F45A 1EZVY 1UC6A 3FQXA 1QSVA 2AJ3A 4L4TB 4U0QB 1CL7H 3K3QA 3DIFB 5JNYA 4J3TA 5IBTH 4ZOCA 2F54B 3GB7A 2VDRH 3MLXH 4QWWC 1Z9OA 3IU4H 4FZEL 5F93C 2DBLH 3WSQH 4RNRA 3CUPA 1WZLA 4MD0A 1A4KA 2A1WL 1DQJB 5DS8A 1J11A 4G3YL 4JFDB 1SMAA 5GHWL 2XTJB 3BPCB 5CJXA 4CMHB 3TN0C 1LNUA 3QCVH 4Y4KB 2YD2A 2F58H 1EMTH 5EOCH 4HKBA 2P5WD 1KNOA 1T0MA 2FECL 4GW4B 3MBED 3SE3A 5C09E 4MXVF 1SJHB 5FYKH 2EDYA 4OLVL 5FYJU 3DRTB 1J8HD 2I60L 5GS0D 5IG7B 2G75B 3MJ7B 1A64A 1RUAL 3OAZK 4UTAL 4R6UA 5CJQH 5KVDL 1QO3A 1IARB 4IMLB 3V7MA 3MUJA 5GGVL 1UQSA 4KJQD 4WEMB 2X40A 5J9PA 3JXAA 3V52H 2FJFA 3PDDA 4OZ4B 4UOW1 3CFJA 1CXIA 1XCQB 1QFUL 1NCWL 4TNWF 5SWZA 3DHMA 2YBRA 4I9WE 1U8IA 1INQB 1UB6A 5IBUB 4M7JH 3DPBA 3C2AL 2A77L 1HEZA 5DJ6A 4JFEA 3MRBA 1ZGLP 2P1YA 3MV8D 1G9NH 3MR9B 3CDFA 4QOKA 5L9DL 1OQOA 1T3FA 4PJHB 2BOCA 2VLKD 5DZOA 2EDBA 1TFHA 4YDIH 4NQSB 3U7WL 4Z77A 4D9LL 5K9JH 3HG1D 3FRUB 3OF6D 3QPQC 5EZLA 5HI5C 1JGUH 5T3ZL 3TP4A 4XBEL 5C0CA 1FNGA 3L3JA 4X7SH 1L7IL 1V8HA 3QUYD 3WHXB 4XX1G 4YR6A 4KKNA 1LO5A 2E9BA 3C5ZC 3SBWA 3BD5A 4QOKE 4YPGA 4MA3B 2EDLA 4PJCA 2D7QA 3TH3T 3BZEB 3BKYL 1G7HB 2DS4A 3QHFH 4JHWL 3FMGH 1IEAA 3KLAB 1QR1B 2L7JA 3MV9E 5C0FA 3HNTH 1RZ8B 3TVMD 1UZ6F 3PGDB 1YUHA 3FB5B 2DM4A 2PW2A 3MODH 4NWUH 3D2UB 2UYLB 4IRJB 4HPOL 2BZDA 2X70B 5D1QC 2C7UB 1BWMA 3PWPB 3BJ91 3ZHDA 4JANB 3GIVB 2LE9A 4JRYD 1V7MH 4WUUB 1H3UA 3MLSL 5EBLB 4OZHB 5E5MA 2VTFA 3SHSA 3R0NA 1F4YH 1M6OA 2Q7NA 3C5SB 1VADA 1NCAH 1TJIL 4UT9H 5E2VH 2NY1B 3AVEA 4WI2A 4PJ5D 4EN3A 1OAKH 4FZ8L 1ITCA 3QDJB 4WW2C 1G9ML 3QJFA 4TULL 1BF2A 2DJUA 3O3UN 4JHAL 4LASH 5T3XH 2HWZH 4O51B 2VIRA 1KIQB 3DVGB 5JW4R 1KXQE 2DWDB 2PXYA 5KSAD 1FL5A 4LRIA 3TA3B 1WSST 3C08H 4FTVE 1JF5A 4GW5B 1Y0LA 3TBWA 2JJUA 2Y9RT 2UWEF 2WUBH 3FRPA 1WBZB 4U6YA 3NIGF 2A74A 3BOVA 1YYML 3PG2A 2L0DA 3DYMA 2OSLB 4EI5A 4ZPVB 3RRQA 5JXED 1T1YB 3FO0L 1RUKH 2JCCF 1A7BA 2IF7A 2ATPB 3LV3B 3WLWD 4K8RC 3NCJL 1NBVL 4MJ4A 3F7PC 4YDJB 1DDHA 4ZOBA 1RUPH 4AH2B 4MCZA 3G5XB 3BJLA 5EO1B 3LCYA 3Q0HA 2FLBT 4OZFG 4O4YH 2J7LA 1P1ZB 3HC3H 4F7PB 4PJ9B 1IGFH 1T83A 4W68A 2VN4A 5L2KA 4LLVA 2BMKA 4HC1A 5M95B 2PO6A 1WBXA 4TVPL 4ZSOA 4QF1A 1K3ZA 1A1MB 4OCRL 3SDDB 3C6SA 3V6OE 1IVLA 4ZO6A 1DBJL 1NGZB 2HN7A 3ARGA 3UBXG 1B0RA 3GEWB 3WNMA 3UTTA 1KJVA 1MAJA 4JPIA 1MRFH 5TPWH 4NN6B 3SY0B 4Z18A 2P44B 1MHHB 4EUPB 3G6DH 1AQDB 1G6RH 3OAYK 3V6BR 4JN2A 1QRNE 5EU6A 3ARQA 5K9OB 3BH8B 1F97A 5JDSA 1T21A 2ERJC 5F6IB 4MXWL 3FQWB 3UTTE 5EO0B 2EDKA 3T4YB 1F4HA 4MAYD 3CH1B 3OKDB 2VLJB 4R26L 2B4CL 3P73B 4ODSL 2G2RB 4OKVB 5HI3D 4N0RA 5SV3A 3HR6A 4OQ1A 2EH7L 3QHTC 1KB5B 5EU6E 3UDWC 4M00A 1DQDH 1I8LC 1T7ZA 3DUUA 1ACYL 2M26A 4KKLD 5MEQB 1YMMA 4I0PC 5CSBA 5GRYA 3EYOB 4P0DA 3QO0B 1DE4A 5K59E 1AGBB 5HHNB 1WVZA 3OZ9H 4XH2A 1CDJA 1XGYH 1G9NC 1HIMH 2X42A 2H45A 2WLYA 4X6EB 2UZIH 3MROA 4UI2A 4NO3B 1HE7A 3FB7B 3X11B 5E4IA 3MJ8A 3NPSC 4K94L 1I7RB 1JV5A 3MUHL 3RWCA 4R7NA 5JXAH 3X13B 4DWHA 3DX7B 2ESVA 3QIBB 1OARL 3J8F7 1S9YA 4F9PC 3RWEB 3VD5A 5DUMH 4JZOB 5ADPH 4M3JA 2P5WB 4LGRB 3MBEB 5IHZB 4XNQB 5GGRA 5IBLD 1L6XA 1S7UA 4M6OL 4G8GD 4NSKA 4P2RD 5I9QB 1JHTB 1QFPA 4FABH 2DJ4A 3MRJA 1U93A 4WCYH 2L4OA 3O6KL 4RZCA 2OJEB 1FJ1A 4FQXD 4WWKA 4ONHB 3RP1A 4IEFB 3GSQB 3L3HA 5DJAB 1QEWB 5INCB 5DI8B 3WEXB 2IBZY 1NMCB 4JFXA 5D7LD 4JPVL 4ZDHA 2VZUA 4X5WA 3Q1SH 2Y5TA 1JPGA 1YEKH 4OM0L 2APFA 5IMMB 3VXMA 1FH5L 5BW7A 5BXFB 4LKCA 3B3IB 4LIQH 3BDXA 1RJYA 1J7VR 3ARFA 3IDUA 5BRZD 2DLFL 3WIFA 3D39D 3FN0L 5T1MB 3CH8A 3EFFA 5F1NA 2W65A 3IKCB 5I1CL 5EOTA 4LMQE 4B5EA 5D8JH 5E6YA 3GSUB 1JZ3A 3RL1A 4H25B 4YDVA 4N5UA 3OKLB 4LLDA 4XPHL 4HIEA 3DMMA 4KK6D 4OQTA 5DD0H 2VLKB 3LZFH 1S3KH 3G5ZA 4DZ8A 1JN6A 4LCYB 1CTNA 4LCIH 4M7KL 3VFUA 2EDWA 4Z7VF 1R3IL 5CLWA 4MA7H 3TNMA 1XF3A 2P8MA 4KQ3H 3SDCA 2ED8A 5EWIH 4JKPL 5GS0C 1JPST 5DK0A 2FJGB 4PREA 1CCZA 2CKBH 3TFKD 4R4ND 1OSZA 2WUCL 5EO9A 2DLHA 4PB9L 4GG6E 3IDXH 4Y5YC 3FT3B 1X5ZA 2C26A 4NZDA 3U0TA 3TVMB 3BN9D 1PZUB 3BX7C 3WD5L 4LSSL 2UWEA 3TJHD 1AR1D 5DJ8A 3G08A 4GKNB 2GJ6A 2X7LA 4JVWA 5B4MD 1FVDA 3DX6A 4FMFA 4XNYH 2AJUH 2ZWLT 2VN7A 3VXRE 5HGBA 3CVHB 5H35B 5KSUB 2AEPL 5I1EL 3VXSE 5D70L 2AJVL 2JCCA 4FQHA 2VDQL 4DVBB 4M1DH 5F7MC 5FOJA 3VMOA 4FA8A 3OL2A 3MRIB 4LHUD 3TIEA 2QQKL 4RAUA 4OF6A 1IM9B 2OM5A 1I85A 1LO4L 2OL3B 2IH1B 4HDIB 2BCKA 4EJ1C 1KLFA 5I6XB 3CDYA 4P2YA 1X5FA 4C83A 4O58L 4U6HB 1V3MA 3L3OB 4ODUA 1TXKA 5HBBA 4QXGH 3KXFA 1I3VA 5KG9B 1JMZA 1WF5A 1BM3H 3EYSL 5KSAB 5IQ9B 1NQBA 3R06B 5DHYA 4G9FD 2Y36H 1JHLH 1JRHI 4JO4L 4F33B 4NNXB 1MCCA 4BK4A 3T04D 3DI2B 5F1SA 1F2QA 5CSZB 3UTSB 5F3HB 2R4SH 5GISL 1S7QB 3BGMB 4IRZH 4OCSL 3OJMB 3NH7L 5JTWA 4FP8L 1NAKH 2AK4A 3IRZA 1JPTL 1KFAL 3IJYA 1JNJA 4Y1AD 3WE6A 4JCMA 1QZ1A 4YAQA 3MOBH 4QNPF 3MA7B 5DQDH 3VXQB 4M5YL 3LN4B 1ZT1B 3D0VA 5BO1L 4PTTA 4KHXH 3EO1B 1PX3A 1YA5A 5IW1B 4YPJA 1XH3A 5EDXA 3LQMA 3D3VB 2OTWB 2DD8L 2NX5D 3CMGA 2FX8H 4HIIA 2G9HB 2X89D 2SEBA 1RZIA 4U05A 5TE4H 4JGJA 4CRPA 1SEBA 1HNFA 4QXUH 5C08E 1WIUA 5I18L 1EAJA 5IVXF 2AEQH 5KVEL 2BERA 3U6RB 2EEBA 4Z7UB 3KS0H 3GIZH 4G8IA 1T2XA 4UNVA 1T7VA 2VL4A 3BVNA 3QUMA 3AC0A 5HYJA 4NJ9L 1L7TH 2O93L 3OAUH 5CEZL 3AFLA 4GRMB 4NZJA 3GNMH 2X4NA 5C0AD 4GAJH 1E4XL 3L7EB 1VKXB 4LPCA 1IEBA 4TRPL 4GXVL 4XPFL 1NC2B 4Y5XC 5EU4B 3DGGA 1XR8A 1GH7A 1A6AB 4O2FB 4OLXH 3MRMA 1NDGA 4P59H 3BIKA 1MRCH 1JTPA 4OZHF 3LMJH 3BN3B 1FG9C 4YGVB 4Q7DA 2CUIA 3RHWK 4XP4H 3ULUH 4X6DB 3I6KB 25C8L 4MAYB 1DQQA 2VLME 1VDGA 1NGYB 1A6ZB 3UAJD 4YHKL 3PWUA 5BV7H 5FGCE 3E2HB 4LSVH 1EFXA 1B4JH 4WI5A 2XA8L 3I6GA 1I3RA 4I48A 4R4BB 4OZGB 3MRQB 1KPUA 2ZSWB 4RFNB 5BS0A 1Q72H 1UM5L 5FDWB 3ARED 4R90L 3F12A 2H2SC 4NN7B 1RZ7H 3TNNA 1R24B 1CGXA 1CICA 2YD6A 1BZ7A 1YDPA 4X8JA 4JO1L 1CQKA 1CLZH 1CXFA 4OTXH 3OKNA 3WJJC 2DLTA 4DQOL 3B9KD 3IS0X 1QYGH 3LD8C 1ZAGA 4XNUL 1DBBL 1JNHB 2XICA 4YDLB 5GS2H 1DLFH 3QCUH 5C0BE 1I3UA 2J88H 4G42A 2P5EE 1PZ5B 2GCYA 3MJ6A 4D8PA 3LIZH 4GG8B 2IAMA 1CT8B 2LABA 4L29B 1ZHLA 4LSTL 3WFCH 4K3EL 1KJ2A 1H5BC 1YPZE 2ICCA 5T1DL 1BFVL 3PV6A 4PRPA 2Z0BA 3BFOA 1QNZL 4X4ME 3D25A 3W2DH 1YQVH 3ZT5A 4K8RL 4OUUA 3HI6L 3GO1L 4GW1A 2QHRH 4FQLL 4BSVA 3RDTD 4L4JA 5FUZH 3LSOA 2O26U 1SEQL 4G8GB 1YJDC 2NY4D 5LG1A 2VXUL 1J18A 1A6VH 1RQ5A 4I3RH 4Z7VA 2PNDA 5JPNB 4M9PA 1CL7L 4PRPE 1CGYA 4ERSH 5CZVH 5IBTL 1EVTC 3I3BA 4L4TA 3ZDYF 4LEOB 1EVUA 2VDRL 3S5LB 4N90E 3DSFH 4NO5B 2R9HD 3IU4L 4GBXC 1OD9A 4P3WA 1KB9J 1ZANH 2F54A 3F62A 2E7LC 3GSNH 1N6VA 4TUOB 5AYUH 2VNCA 3DX8A 1DQJA 3PWNA 1RJZB 5BRZB 4JFDA 4NQEE 1A5FH 3QCVL 3J7HA 1OP3K 3BPCA 1Z0NA 2F58L 3BSZL 1N0LA 3D9AL 2IFFH 5EOCL 1FG2B 3BW9B 1IZJA 1B9ZA 5ACMA 4Y4KA 1NFKA 1KTRL 4AEHH 1CZ8H 2O61A 1PY4A 4YFDB 1HZHH 1KENH 4JQXA 4GW4A 3ZDZF 3KPTA 2VQTA 1SJHA 1W72L 2Z4QB 3LDBB 2DB8A 6CGTA 3RPKA 4S1SH 5CJQL 5IG7A 2G75A 4G7YH 1ZGLM 3MJ7A 1PKQE 2PYEE 3MBXH 5CKGA 3OAZH 2XTJE 4M7ZC 1ETZB 4OSUL 3K0WA 2I07B 3H42H 4IMLA 1S8DB 1FYTB 3ARDA 3ET9F 4G43B 3QG7H 2YXFA 4FQXC 1JWSB 2QJDA 3NPZB 4JZJC 1YEJH 1UM6H 2DQTH 2XIDA 3MCLH 1MFDH 4GH7B 4YQXH 1S78D 4OZ4A 1NC4D 1XCQA 4JKMA 1SBSH 3P9WB 1K3IA 4M7JL 1WV7T 1MCHA 1INQA 2QADC 2R1WA 3L1OL 4PJ7B 5J56B 2I9TA 2EE6A 1E6JL 5ISZA 1GOFA 2ZUQB 1GZQB 1MPAH 1PG7H 1G9NL 1PSKH 4KMQA 2C4XA 2X4PB 1CDIA 2BOBB 2GUOB 1E4JA 3MR9A 4C55A 1H3VA 5CD3B 4H1LB 5TFSH 3OKOA 4JPKH 4LHUB 4PJHA 1JWUB 1U3ZA 4NQSA 1FV1B 1TZGH 4OCYH 3EHBC 1NGWB 3LH2H 4R4FH 3FRUA 4X7SL 4WGWB 1IRAY 4PJBE 2WBJB 1X4YA 4ZUWB 3WHXA 3BPOB 4WTZA 2DJSA 2XOTA 3KYMB 1CF8L 1MUJB 2IBBA 5IVXA 1YNKH 4DW2H 4PJHE 2OXHA 3HNTL 2MCG1 1G7HA 4PRHE 3KLAA 1QR1A 3I02B 1RZ8A 3HE6C 3PGDA 3FB5A 1DEEA 4TUJB 4PG2C 1RIUL 2A83B 5BV7C 2CIKB 3D2UA 2UYLA 1CU4H 3BISA 4IRJA 1FSKB 4Q9BA 1F00I 4HLJA 4BM7A 3MLYH 3K7UA 1I7ZA 1Y18A 1KG0B 2ICWI 2X70A 1FCCA 2YMXH 3ZE1F 3PWPA 2XZAH 4JGMA 3VE0B 4JANA 4PLKD 2C3VB 3GIVA 1VGKB 1FFOB 3DO7B 4MMXC 4QRRD 4WUUA 4LVOB 4OZHA 4UT9L 3C5SA 3T0AA 4IJ3B 4ZTPH 2FD6H 5GSVB 4LASL 2MFNA 3MCG1 2ZOLB 1IILE 1INEH 2HWZL 2X4RB 5GZOC 3WCYA 2P7TB 3ULVD 3TZVD 2YS4A 2ILLA 3GSWB 3PWPE 3KPRD 5HSFA 4O51A 3DVGA 1KIQA 3VFGL 1U9KA 1H3XA 3C08L 3CFBB 5DJ2B 5JHLL 3TA3A 5A2FA 3N1FC 2EH8H 4OFIA 2WUBL 5IMLB 5IB2B 4GW5A 4OGXH 1AC0A 1EHAA 2DQJL 2XTLA 3QDJE 5C0AB 4XNXH 4PGJA 1RUKL 4HUWB 5GS0L 3MLUL 3B9AA 1HCVA 3BH9B 4ZPVA 3O41B 3VFPB 1T1YA 2IQ9H 2ATPA 3LV3A 3KLHD 3GHBH 4Q9RH 2XQBL 4ONFH 5F1KC 3LS4L 3CZFB 5E99H 2VXSH 4AH2A 1F3DH 3G5XA 1PBYA 4DN3H 4O4YL 5EO1A 2X6MA 1RIVH 2BVOA 1TNMA 3I85A 3WFDL 1P1ZA 3IXTB 3HE7C 3VFVB 4F7PA 1JNLL 4PJ9A 3FB8B 5EC2B 4K07A 3U9PL 4UBDC 2N1KA 4X5LA 2X10A 4IOFD 5DRZB 2XWJA 5AZ2L 1X4ZA 1PYWB 3OJ2C 4M3KB 4RMTA 1A1MA 5HI4D 3SDDA 4HD9A 1UG9A 1BOGB 1MRFL 1NGZA 5CJOL 4GLRI 4O00A 3N50A 5GGTH 4F2MB 5I8KH 2BY0A 1S7WB 1CE1H 3MXWL 2QQLH 1S9VB 4WU5B 1Z5LB 1MHHA 2YSSB 1A6WL 4DZBB 3QSKB 2YUXA 4EUPA 1AQDA 4XHQA 2FEEI 5K9OA 3BH8A 1WWBX 4JZNB 2CIIB 3SGEI 3ZT7A 1MVUB 2XZQH 1S7SB 1FPTH 1GAFH 4M43H 3QQ9D 3FQWA 1BIIB 4YFLF 5EO0A 5IJVB 1HN1A 3DXAE 2ZCKL 3T4YA 3LKSB 1C08A 2EYTB 3CH1A 3PJSB 2VLJA 2MPAH 3ZL4H 1SM3H 2D31B 1QA9B 2ZCHH 3P73A 1MQ8A 2G2RA 1G1YA 3FAXA 3TO4D 4OKVA 5F9JA 3HI5L 1DQDL 1GC1H 3TCLB 4Z7UF 4JR9H 5JIPA 4YHZH 1JPSH 5MI0B 5MEQA 1ED3A 5KTEH 1OHQA 2AK1H 2NY4B 3EYOA 1UYWH 3WIIH 3QO0A 3MXVH 3CC5B 1AGBA 2VLJE 4NJAH 1XGYL 1U0QA 3AREC 3OR6B 3VWJB 1M71B 1A7RH 1MY7A 5DQ9B 1FIGH 1HHIA 1BQLH 4X6EA 3RIFK 4NO3A 4NHCL 3FB7A 1J10A 1LE5A 4U6VL 3SGDH 1I7RA 4URTB 4X6DF 3TV3L 5JXAL 4NCC1 5IWLC 2Q6WB 2XFXB 5HDQH 5B8CB 5D5MB 5F1IB 1OTUD 5D2NC 3X13A 3DX7A 5DUML 3QIBA 1RZFL 2FLRT 3RWEA 5ADPL 4H20H 3TM6A 1AFVH 3UYRH 4RRPG 1F2XK 4S1RH 3S96B 3JV0A 4JZOA 4OZGF 2P5WA 4WVRA 1C5DB 5ESQB 1CBVH 1WZKA 1Q1JH 2YA2A 1Z3GL 3MBEA 3MPCA 3QEGL 4J6RH 4XNQA 3QEQB 5IHZA 5JOPE 4FABL 4TYUA 2JJVA 3KPNB 2APWA 4JB9H 5HYIA 5KW9L 4U7KA 3KYOB 1RAMA 3TN0B 3RDTC 1JHTA 2DYPD 2Q87A 4A2LA 3JVGC 2OJEA 3QUZD 4G6FB 1O5DT 4ONHA 3RZWA 4XP6L 3GSQA 3PGFL 3SQBA 5DJAA 1QEWA 3IU3B 2VUOA 5INCA 5DI8A 3WEXA 5IVNA 4NCDA 4KI5D 4X80H 1BHGA 4PGEB 3S3PA 1QD0A 1P7KB 1T2QL 5GZNC 5IMMA 1NC4B 3UX9B 1HSAB 5BXFA 1TZIB 3B3IA 3PABB 1P7HL 4GJTB 1IGCH 4NQCD 4WO4C 1BD2D 1FBIL 2ED9A 3AM8C 3NIDE 4X4ZA 4X99B 4XVSH 1PEZA 1H3GA 4K55A 2YN3A 2CR3A 5T1MA 4WW1B 43C9B 3MV8A 5JZ7D 3IKCA 5IR1B 2YEZB 5DD0L 3GSUA 1BBDL 4KTEH 4H25A 1S3KL 2JJSA 3OKLA 1JTTA 3P0GB 3VD4A 1MCWM 1KN4H 2VLKA 1XIWB 4KDTA 4L4VB 4LCYA 4MA7L 5T3XD 1ULVA 3VWKC 4JVUA 5EWIL 4YDKH 2GY5A 4OLEA 3QIUD 2YWZA 2CKBL 3ILQC 4ISVB 1MLCB 2ZUXA 2FJGA 3BZ4B 4U1IB 1AH1A 3TH4T 1FNFA 1CFQB 1B6UA 4AENB 3FT3A 1YJDL 3KPMB 2AVGA 4KRPD 4LOUD 1HQRB 2NY0C 3QWOB 5E6ID 2Q8AH 3TVMA 1D3CA 5DF0A 5FUCC 3WNNA 3C5ZB 4OZIE 1KBGH 3VFTB 2EDEA 1MQKH 3CVHA 5H35A 3ZKSD 1S9KC 3VA6A 1QFWH 1U6AL 3LVEA 4JFZH 3HNVH 4DVBA 1UWGL 4G6KH 4I4WB 5BVPH 3MRIA 4PBWD 4QRRB 1HXYB 4HUUB 2CLRB 3ROOB 1NCCL 3CVIH 3MRCB 4FQQB 5FGSA 5FXCH 1KCSL 1IM9A 5I15H 3I3EA 2OL3A 1Q9WA 2WP3O 5FO7B 4HDIA 3BRFA 4HW6A 4C54A 2LVEA 1JNNL 5D1QB 5IQ7L 1HILA 5F7YC 5F71A 4U6HA 2I27N 3GJEB 3L3OA 4PD4J 2HLFD 1I9IL 1K9TA 4HCRH 4ORGB 2VDKL 4Y16C 4TTGA 4P2QD 1MELA 2NXYD 5DRXB 5KG9A 3KNBB 1FZOB 4K7PY 5D93B 5I1HL 1JHLL 5KSAA 5IQ9A 4POZD 3R06A 4LVEA 5T33H 4PJXB 1A9BB 4F33A 2Z8VC 5F72S 4WW2B 4NNXA 1BBJB 1U8HA 1DEDA 4ZD3L 4PJ7F 5CSZA 3UTSA 5F3HA 1S7QA 3BGMA 3R4DA 2W9EL 4JFHE 2R4RH 3HI1B 3GJFB 5E9DB 3M1BB 2E7HA 2LU7A 4ENEC 1F11B 1J0IA 1GC1C 5JXEA 5A2JH 1J0YA 5J06A 4LVHC 2ICES 3MA7A 4IHOB 4P5KA 3VXQA 2VERN 5HPMB 3LN4A 3TBSA 1ZT1A 1NEZG 4Z0BH 4BFBD 4XMLH 4KGLA 1K6QL 5J12B 3FQNB 3SKOB 5EU5B 5K33A 4HWBA 4XP5L 3EO1A 4NZTL 5IW1A 2FX8L 1FO0H 1QLRB 3MV7D 5EB9A 3UTSE 2OTWA 3W82A 5AG8A 4B50A 1GHFL 1KIPB 5TE4L 4DGIL 4PFEA 4I18C 3U7YH 2G9HA 4NKIH 1AKJD 4DK3A 3SE8L 5D72L 1W0VB 1IC7H 2AEQL 4PRIE 1U8QB 5ALCH 3GIZL 3GBLA 2JJTC 2HH0H 3ZT6A 4XCEB 1GGIH 4Z7UA 3ETBF 1L7TL 5D1ZD 5F97E 4OLUH 3D3VE 3GNML 5L8LB 5EU7E 3U7AA 4GAJL 3TWCH 4E41D 1EBPA 4KJPD 3ROLB 4AMKH 3L7EA 1VKXA 2BNRD 2X05A 2CJUL 3IETB 4GRWH 2XWBA 4OLXL 4ODHH 4TQEH 3P2TA 5EU4A 1ROWA 1A6AA 1F58H 4O2FA 5T1LB 5CCKL 3HCVA 3LMJL 3GMMB 3ME0A 4ZAKD 2F74B 3BKML 5B22A 3W0WD 1FFQA 1Y6KR 4RBPH 5FA4B 1YECL 4X4YB 4YGVA 1NSNH 1VFMA 2AJZB 1R3HB 3B9DA 4X6DA 2R2EB 1F4AA 5DJXB 4MAYA 4DK6A 4JKLA 4S1DC 5BV7L 3O4LB 1RI8A 1NGYA 4LSVL 1A6ZA 1X4XA 5DJCB 2VXVL 1B4JL 2NYYD 5BOPA 4FFWD 4E5XB 2ERJB 4M6MH 3H6JA 1RMFL 3ARTA 1S7VB 4GMSH 1Q72L 3P4LA 4R4BA 4OZGA 3WNOA 3MRQA 2CK2A 4PJIF 2ZSWA 1RZ7L 4JQIH 4ETYA 2IANE 5F9WC 3VFSB 5FDWA 2W9LA 1V05A 1GGBH 1R24A 3VGEA 5KS9B 1QSFE 4OTXL 4UV4L 2FDBP 3LKNB 2OMNA 4FG6D 1DLFL 3QCUL 2J88L 4XCFH 4APQB 5ILTH 5FAAA 3PQYD 1MCOL 1JNHA 4L9LC 4AK1A 5BJTA 1BZQK 4OZGE 2FHCA 3HTLX 5EOQH 1CG9A 5FOBB 1I9RH 1P5UA 4O02H 3JBG7 4GG8A 2ZOKB 3B2UC 5KAQF 3WFCL 1CT8A 1QRKA 1UWXK 4RCAA 4L29A 2Y7QB 1YQVL 3ARVA 3O0RH 2IADA 2QEJA 3KPSD 4NBYB 2DQGH 4G5ZL 8CGTA 4OM1H 1AR2A 4NKOA 5D1XD 4F9LA 4XPBH 5DO2C 1KGCD 3KJ6L 3HHRB 4ZPTB 3GMPB 4G8GA 8FABB 2W0KA 1LVEA 4AIOA 1BZ9B 5CILH 1FLTX 2DYPB 3SJVD 2LVCA 1I9JH 4ERSL 5CZVL 1DBMH 5GJTL 5JPNA 3QUZB 5I8EB 1MCKA 1F4XH 2NZ9C 1DSFH 2WWMC 3RFZC 1U95B 1OCWL 1FZJB 5D7LA 4AG4H 4LEOA 4B7LA 5HYEA 5JMRA 3S5LA 5AYUL 3MLPA 5GGSB 4YNYB 2IPUK 2HFGL 2HT4D 3G6JE 4CAGA 1UKTA 4ODWB 5T3ZE 2JF1A 2ZCLL 5D7KD 4J3UA 2BNUB 3C87A 2D7MA 4LK4A 3MREB 2FEDC 4NQCB 1RJZA 5BRZA 2HTLC 1FFNB 3D39A 3AS1A 1CZ8L 2HVKB 1FG2A 3EOTH 3BW9A 4XMKL 1KENL 4GKZB 1U8LB 1OTUC 3ZZ1A 2A6DB 1C8PA 1KPRB 4PY8I 4PLJD 5E8PB 5TGBB 3EFDH 3G9AB 4RSVA 5I16B 4DEPB 3O6FC 2GEEA 4JDZB 4S1SL 5IEKB 5B39G 2MKWA 2Z4QA 1MFCH 2DMKA 1T0PB 3P4MB 2FRGP 2C3WA 1V7NL 3MRKA 1ETZA 3QZWB 3QIUB 2Q3AA 2I07A 4WFHE 4YHIB 3PP3K 1JE6A 1A7PH 3ZYIA 1S8DA 2YPVL 4G43A 1YEJL 2DQTL 1A3RH 1VERA 1WQVT 1Z9SA 4J12A 1VSCA 2XKNB 4F7MB 1JWSA 1TPXC 4W6YB 1M7XA 1OTSD 2MJWA 1SBSL 4P2OD 3MRNB 3V4PL 4NFDA 4G6AC 4KRPB 4WI3A 1OVZA 1HSBB 3QO1B 1QBLL 1MHCB 1NFDB 5D5MF 1MPAL 3LPWA 4PJ7A 1PG7L 1PSKL 3O9WC 3MFGB 3DYOA 2NR6D 1P69B 5IHUH 4DCQA 2Z9TA 3QUKB 3ARBC 4LRNH 2UZXB 1FYTE 4HG4K 5FCUH 1RHHB 3BZFB 2BOBA 5TFSL 2GUOA 3KJ4C 5CD3A 4H1LA 1BAFL 1AJ7L 1IQWL 3PV7A 4LHUA 2AEIT 4JG1L 4OCYL 3DETD 5JZ7C 5CP7B 1JWUA 1YY9C 4J3OC 4R4FL 1QSEE 1FV1A 1IGTB 1NGWA 2IWGA 5IM7B 2Y6SC 4LLQB 1LEGA 1SY6A 2WBJA 3U4BH 4ZUWA 2BHYA 4P2QB 2NXYB 1GCFA 5HDBF 4YIQB 3OKEB 4P5MA 3KYMA 4DW2L 1MUJA 4HBCL 3VCLB 4EBQH 2ZP0T 4S1QH 1ZLSH 4EDWH 4K7PH 4G9FA 4XPAH 4ZS6C 3WLBB 4HS6B 1MCNA 3I02A 1G6RB 4XVJL 5DUBB 1XEDA 1OAZH 1CU4L 4TUJA 3RU8L 4TVPE 2CIKA 2YMXL 5ACLA 3DVFA 5B38G 4Y1AA 5KOVC 4P9MH 5FUOH 1DVFD 1KG0A 3ULUD 4IIQB 2J4WH 1MFBL 3VE0A 4V1DB 1H3PL 3E0GA 2C3VA 1VGKA 1FFOA 3DO7A 3E3QE 1EHLH 2LFGA 1WJ3A 4UQ2A 4U3CA 2CO6B 4OLZH 3FFCB 5C0ND 4CKVX 3MV7B 4WEBL 2K3TA 2NX5A 5DRNB 5GSVA 3BYTA 4U1HB 2RHEA 5HVFB 1AKJB 1RPQA 2ZOLA 2X4RA 2VWEC 3Q6FA 5HPOA 3PE9A 2P7TA 4W6WB 3GSWA 5LGHL 5JQ6L 2AEWA 2EH8L 3CFBA 5DJ2A 1R0AL 4PYGA 5DK2B 4OGXL 3BKJH 4ELKB 1AE6H 3GK8L 1MCQA 4PJIA 5IB2A 4ZO8A 1JZ5A 3S4SB 4XNXL 4LHJB 4DUVA 5GS2D 3D1MC 5C0AA 2IC2A 3HPLB 5IB4B 2IQ9L 4L3EE 2WLZA 2BNRB 3DV6B 4LVNC 2YUVA 3BH9A 3O41A 5FIEA 3VFPA 4KUZL 1B6DA 2VXSL 3FZUD 2W1NA 4KV5F 4DN3L 4ZAKB 3CZFA 5LGJA 1RIVL 4ZFGH 1KCKA 2BVEA 3W0WB 2FB4L 1UM4H 2XNAB 2EYRA 2R2HB 2JB6B 2E9IA 1KJ3H 4QHLB 3U48A 2ED7A 3IXTA 1HINL 3VFVA 4YXKH 2CDEB 3FB8A 5EC2A 4Q97A 3ULVF 3IVKB 2ZNWA 1ZLWK 3L3GB 5H2BB 5KZCD 3VRLF 1MSPA 1PVHA 1RZKH 4RMRA 1PYWA 4U7MA 4PJXF 2UZYB 3JSSA 4WW2F 3EO9H 4F7TB 4ZUUB 1BOGA 5IEHB 2MCPH 5I8KL 1CE1L 3HS0B 5ID0A 4XAWH 3O6MH 4F2MA 4KROD 1S7WA 5JOEA 5D1ZC 4WU5A 1S9VA 3K2UL 1Z5LA 4KI1A 2YSSA 4DZBA 4YC2B 4U0RB 1I1FB 3GI8H 2V2TB 3B9KA 4DTGH 4HFUL 3D85D 5DFWH 2VSDA 4BFIB 4PJAE 5M94B 4C56D 1FPTL 4YZFE 5DURD 1GAFL 1JTOA 4JZNA 3RY6C 2CIIA 2VDNL 4N8VG 5C1MB 1MVUA 1N64H 3GRWL 3FO2B 4L5FH 2MPAL 1BIIA 3B4NA 3ZL4L 5IJVA 2ZCHL 2ICEB 2OR9H 3GFUA 3LKSA 3MLVH 2EYTA 5EUOB 2OS7A 3SO3C 2D31A 1QA9A 3KPSB 1CLYL 4JR9L 3X12B 4HX1B 1PQZB 3HC0B 4XCNB 3NA9L 5BZWB 1MJ7L 3TCLA 4RGND 5D7JC 1KIRB 1DUYB 3CXHJ 1EAPA 1JMXA 32C2B 3O2DH 3IXAB 3T65B 5SWSE 4BZYA 5DTFB 1UYWL 4PS4H 3WIIL 1H5BB 5C7XH 1TQCB 5CZXC 4NJAL 4K9EH 3VD9A 4P23C 4O5LL 3CC5A 3MOQA 3NCCB 1OAXH 3CK0H 5T5FH 1RUQH 1FIGL 5BMFL 3RIAK 3E6FA 1IKNC 3OR6A 2BHZA 1M71A 2B1HL 4R2GD 4PRDB 5DQ9A 1NKOA 1KEMH 2EDDA 5EIIB 1IL1B 4J7RA 4G7VL 2L7UA 1R3JA 2V2XB 2R39A 3MYJB 1QQDB 5F8RC 2DLGA 2IGFL 3BAEH 3QEUA 2FX9L 1GGCH 4HJJH 3IDYC 4AZ8A 1WZMA 4ZXBC 5HDQL 1WFUA 1VGEH 3MA9H 1KB9K 3NFSH 4NKDB 3GSOB 2Q6WA 2XFXA 3HC4H 1IGYB 5D5MA 1AGEB 5F1IA 5B8CA 3B43A 4X6FB 4H20L 4U1LB 4NGHH 4OGYL 1AFVL 3NCYP 4FXLA 4QXTB 4Q9QH 4FMKA 4GBXB 4ZYKB 3VI4F 2NXZC 3WJLA 3MLZH 1Q1JL 4RAVB 1F8TH 4YBQD 1NMBH 3EYUL 1C5DA 5ITBH 2IQAB 1IGJB 1UJ3C 4M9OA 3PNWB 2QSCL 5D1XC 3KPNA 3KYOA 2QR0B 3Q3GB 4Y4HD 5D5ME 5CP3H 1QSZA 4FQ1H 4PRAB 1T7WA 1TMCB 5C0JB 3AB0C 4JAMB 3VG9B 4F8QA 1B2WL 3IU3A 1C1EL 1EUUA 4NN5C 1C5BL 2CUHA 4D9QE 3LHPL 4PGEA 3S37X 1P7KA 5C6TL 3QEQE 4P2OB 3O4OC 1HH9B 1NC4A 5TQ2H 2R0WL 1HSAA 2KH2B 3GKWL 3EJZD 1K2DA 5LCVH 1FP5A 3PABA 3ZO0A 4XVSL 1N8ZB 3OBAA 5ADOH 4I77H 4X99A 1INDH 3M17B 3IGAA 3KWWB 5C09D 4WW1A 1D6VL 3KPLB 1OP5H 1GRWA 4KTEL 4EIGB 43C9A 3QDGE 5IR1A 2YEZA 4X4XA 1NANI 2J8UE 5C3LD 1KN4L 3O45B 2CMRH 1ZHBB 2FCBA 3TGXA 4LDEB 4J3XA 3RI5F 1B0WA 1FC2D 1R5VB 1XIWA 1RJCA 3WNPA 4XHJC 2YUWA 1MWAB 4L4VA 4PLJC 1SJEB 1OPGH 4YBLB 5HHXH 3Q2CA 5JA9A 4CDGC 3U2SA 3HAEH 5C0GB 4JY5H 4MLSA 3O81A 2FO1A 2CPCA 4ISVA 5DMIH 1MLCA 4KI5F 5E8NB 3R8BB 3BZ4A 2BSRA 3WIHL 1Q8MA 1CR9H 3K1KC 4U1IA 4W81A 4I9WD 4MJ6B 1CFQA 1VFBB 3RGHA 2I9LB 5C0IB 2HA1A 3KPMA 3T2PA 2C1PA 4AM0B 1A6PA 1ADQL 1PFCA 1GZPB 4JPWH 1KBGL 5B21A 1MREH 4PV9B 4QTHB 4RMSA 3BKCL 3C5ZA 3QI9C 3QXAB 1LMKA 3EDKA 3MCKB 5DMYA 4G6KL 5C2BL 3AY4A 2NZIA 1RZKC 2ENSA 3C6LD 3QP3A 5FYLE 3AAZB 4I4WA 5DMJB 3R1GH 3RPIB 1HXMB 4W70A 4JM4H 4QRRA 1A7OL 5CEZE 3A0OA 1HXYA 4HUUA 2CLRA 3BPLC 3ROOA 5FDYA 3MRCA 4FQQA 5BV7B 5GGUB 4CJ0A 4BK5A 3RUGB 1E4WH 1BVKB 2X5PA 1X5HA 5FO7A 2QL1A 3T3PE 3WS6C 3V5HB 5GPRA 5D1QA 2IG2H 3Q5OA 1AD9B 3QHZL 4HCRL 1I1AB 4QOKD 4HK3N 4BSWB 3GJEA 3UO1H 4Y2DB 4MSWA 4ORGA 3MC0A 5FF6B 1J0ZA 1FDLL 3WDIA 5DRXA 4B41A 3KNBA 1I3GL 1FZOA 3SKMB 3SGJA 3MV9D 1FNAA 1JF1B 3HN3A 4PJXA 1A9BA 4UZGA 4WW2A 2P49B 1BBJA 2XZZA 4X9GA 4HS8L 3RGVD 5L2JB 4RX4D 3WXWL 1CK0H 3HUJE 1IJ9A 1GPOH 1UCBH 3S35H 5E8DL 3HI1A 4JM2C 5IB5A 1CFNA 3M1BA 1A6UH 1F11A 4GS7C 2FBJH 4ODVH 5HHOE 4Z0BL 4KVCH 5HPMA 4Y7MA 2OYPA 3FQNA 1OWWA 1FO0L 4UOW0 4WUKH 5EU5A 3SKOA 4NO0D 1EPFA 1IAIH 4Y5VB 1QLRA 2E27H 5D6CA 1KIPA 3PL6C 2Q8BH 3C5JB 3DURB 1TZHB 3N9GL 2AJYH 3PXJA 4XVTL 5AG9A 1IZKA 4KMTL 5HHPB 5E9DE 2QTEA 4NRZB 1W0VA 1Z2KA 4UV7L 4WV1C 4FTVD 3CJJA 1U8QA 5KZCB 1FAKT 1WITA 3L5HA 5F21B 3INUL 4XCEA 2GAZB 4OLUL 4EN3D 2MWCA 5I1LB 5GGQL 3HE7B 3L95A 3GMRB 3K8MA 4ZNEA 2BP3A 4QGYA 2ZUWA 1N2RB 2A9NH 2QKIB 2ZJSL 4KC3B 1E4KA 4KROB 2PXYD 4ODHL 3ROLA 3GSNB 1A8JH 4TSBH 3MSPA 3WHE1 1TETH 3VW3H 4P2CG 1KOAA 1EA9C 3D85B 4YH6A 2FHFA 5DVLA 5TDPB 4LAQL 5GGRY 5T1LA 5DA4A 3WN5C 5DURB 3GMMA 2F74A 4NUJB 4UT7H 1DANU 2BHUA 3X3FH 4LSUH 5LBSH 3HNSH 4ZNEE 2VH5L 4X4YA 4OIIH 3JWOC 2AJZA 1R3HA 2R1YB 4JDTL 4YK4C 2FNBA 4XB7A 3FOLB 5DJXA 3REVB 5I71B 1XT5A 3O4LA 3EJYD 5MEPB 3HZYB 2VXTL 4JQVA 2PW1B 5SWQB 5DJCA 3TO4A 2CXKA 1NGPL 4E5XA 1JYNA 2DLIA 1L6ZA 2RGSA 3VU2A 4MZ3A 3AROA 1S7VA 2BVPB 1TVHB 5AZEH 1QBAA 3MLRH 3QXDB 3VFSA 3MUY1 2CRMA 1G7PB 2CLVA 3RNKB 5KS9A 4M4RA 4JREC 3RAJH 2X41A 5D2LB 1NBYA 3O4LE 1QRND 5FYKE 1FZMB 4YE4H 1I8LA 1IKFH 1JGVH 5ILTL 3LKNA 1CN4A 5CBAB 5TE7L 3NAAL 3ZE2E 2RCSH 4APQA 4PRBB 4NZRH 2A0LD 4G8FB 4Q0XL 3UTTD 1I9RL 3EOYG 4HQQL 2FEEL 3PHOB 5FOBA 4HMDA 3AMLA 2ZOKA 4I3SL 5KS9E 3UJJH 4QTIL 5CZKA 3O0RL 5AWNH 4FXGB 5EU6D 5E4EC 1BVZA 2R69L 3GJFK 1ZTXH 4OM1L 2BVYA 4OFVA 3LQAH 3UP1A 1QLFA 2ZNXA 4XPBL 4A6YL 4D9RE 3QRFM 2HG5B 2MQ3A 1KELH 5F9OH 5CILL 3T0EC 4ZPTA 3GMPA 2DAVA 2G60H 8FABA 3M8OL 3JWDH 1BZ9A 1DBML 4RGNC 3EDJA 2DYPA 4Y4HB 4WFEE 4OF0A 3RZCC 3JUYA 3QUZA 3NFNA 5I8EA 2BVQB 4NC1C 3QDHA 1U95A 1FZJA 1VFOA 2OI9C 5EN2B 5JMOC 2EDHA 1NFIB 4HXBH 5GGSA 4R2GC 1CGVA 4YNYA 3B9VA 3MACL 5DJ0B 1LDPH 3GMQB 2KKQA 1MNUL 2BNUA 4NPYB 3MREA 4NQCA 1ZGLB 1BD2A 5EUOF 4F7EB 1FFNA 5FYJH 5C09B 3NIFE 4KKCC 3M45A 3AXLB 2HVKA 5F8QC 3EFDL 1U8LA 2A6DA 1KPRA 1YEEL 4WHDA 5E8PA 5TGBA 1V3JA 3FRPG 5I16A 1MFCL 4G3YH 4JDZA 5IEKA 2AJSL 4DN4L 3S88L 5GHWH 1OGAE 4HLZG 3P4MA 4F57L 1A7PL 3MLWL 1IM3B 3QZWA 3QIUA 3OG6B 2RJMA 3QAZB 4YHIA 4PBXA 5J13C 3H9ZA 1YEIL 1WWCA 5ELIA 1DJSA 1KF9B 1KCRH 4F7MA 2XKNA 4OLVH 4OD2B 3HZVB 3WBDA 7FABL 3CX2A 2I60H 3P4NB 1ZV5A 5C0RL 3JTTB 1X5KA 4QKXB 1RUAH 4LCCB 5KVDH 4OFPA 5EFIB 3QO1A 4PYHA 5C6PB 1MY5A 4WJ5B 3QUKA 1M1SA 3RTQD 1RHHA 4EKXA 4BFGA 2BSTB 2GJZB 4BKLB 1NCWH 2NY0B 3EW3B 4L8CB 1A6TA 2LAGB 4TTDC 1KN2L 3BYYA 3ALXA 3PWJB 1J8HE 4KZDL 5CP7A 2EXYC 4U49A 1IGTA 1NFDE 2A77H 3U4BL 5HHME 3ZDXF 2V5YA 5IM7A 5CJXC 4D3CL 4LLQA 2H6PB 4P4KC 4NYLB 4OIAA 4P2QA 4NCC2 5L9DH 4MA8H 4U1GB 3BHBB 4S1QL 1ZLSL 4YIQA 3OKEA 3MV9B 4K7PL 3SDXB 4XPAL 3VCLA 3U7WH 1HHJB 3SE3C 1S5IL 1A9EB 4D9LH 5IW6B 1EGJA 5C92A 1BFSA 3SDCD 1HHKA 1P6FA 3WLBA 4HS6A 3VXRD 4KJWD 1ZS8A 1G6RA 5T3ZH 3RGVB 5J8OA 5DUBA 3VXSD 4XP1L 2H3NB 1L7IH 4MQXD 4P9ML 1NAMB 4OF3A 4X98B 2ARJB 4WWID 5TF1L 1MI5E 2J8OA 2AS5M 3ZTNL 4IIQA 3UYPA 1EHLL 5JR1L 4V1DA 2R29L 1LO0L 5DRWB 1D5XB 4OLZL 4P5TC 5HHVL 3QNXB 2PYFB 4E42B 3Q5TA 2YA1A 2R0ZH 4UILL 1QACA 2MHAB 4HUMB 3MV7A 1Q94B 5DRNA 5DSCB 3HG1E 4U1HA 4HPOH 2V7NB 5IJKA 3N1MC 1ZK9A 2ADIB 4GXUN 1AKJA 4KHTH 3QIWD 3RWDB 4FTVB 1I1RA 3KLSA 2WSKA 4V1DE 4OJFL 1AE6L 2VAJA 2W60B 5DK2A 2E6QA 4HPYH 4HJ0D 4I18B 4AEFA 3VH8B 3FFCE 3O11B 4FZ8H 1U2HA 2YPLE 4IRSD 1A4JB 3H3PL 5F89B 3S4SA 5AYQA 1G9MH 2DKUA 1MCRA 2WQRA 2OK0H 3CSPA 2Y06H 4JHAH 1VA9A 1E27B 3HPLA 5IB4A 1T6WA 2BNRA 3RX7A 3DV6A 4GFTB 3OSKA 4IDJH 1X5XA 3ULUF 1M7DB 2WBWB 3SBWC 4ZAKA 3ARWA 3UEZA 3W0WA 3JWDC 2HRPL 4N0YH 2XNAA 3RUGF 1AGDB 2R2HA 2JB6A 3D5OF 1YYMH 4QHLA 4YXKL 5JW4N 2ICWJ 5C08D 4DKAA 1YQ2A 3FO0H 1TQBC 3UZVB 2CDEA 1IGMH 2NY2C 3NCJH 1JK8B 3IVKA 1NBVH 1RZKL 3L3GA 3HB3D 1SJXA 1ZLWH 5H2BA 4HKZB 3EO9L 4HH9B 1KJMB 4YO0B 4UINL 3C8KB 2MCPL 4RDQF 4F7TA 4ZUUA 4F8TA 5IEHA 2DWEB 2W0LA 2EDOA 3HMWH 3HS0A 3QUXD 5HYFA 3S35X 1QRNB 4MLIA 4DTGL 2EE2A 4LCUB 3VXNB 1K8IB 3C2SA 4TVPH 1I1FA 1S7XB 2V2TA 4OCRH 3PQYA 4BFIA 3SE4C 4F58L 4LRIC 2JK5B 1N64L 2VLMD 4N0CD 1JYWA 4OQTH 2X9WA 5DFVD 2OR9L 4M48L 3FO2A 3MLVL 4Z7QF 43CAB 5CEYB 4RWYL 5I0DA 3MLTB 1UH3A 5EUOA 4L9LB 1AHWB 3SKUD 4EI5C 3HMXA 3KPSA 2CLZB 2P42B 3X12A 2AQ3A 4HX1A 4U4BA 3JTSB 1PQZA 1P4IL 3HC0A 4XCNA 3O2DL 5BZWA 3QQ4B 1YC8A 3U79A 5F7WC 1KIRA 5KVGL 3LOWA 1DUYA 32C2A 3S36X 3T65A 5DTFA 1A21A 3N85L 2ZG2A 1WAAE 1HOCB 2ARWA 3O3BB 4R26H 3CK0L 1LDSA 4ODSH 1EFXD 1VFAA 3FQUB 1T83C 2JLLA 2EH7H 4PJDE 4PJFE 3DUHA 3ESVF 3TT1L 5C0BD 2P5ED 2YD5A 4HUKB 5GRJH 1XGPB 4PRDA 2PO6C 1ACYH 1N7ML 1IL1A 2QSTA 4OKDA 5A43C 2V2XA 3MYJA 3UROR 5FEBA 5J6GB 4AT6B 4XNMB 3MA9L 5JOFB 3ARGC 4OB5L 4C4KT 1CE6B 4LQFH 5E0QA 3HC4L 1XGUB 1V5JA 1EJOH 5I73C 3NMEA 4QRUB 4NKDA 4NGHL 3RY4A 3OPZL 3GSOA 4Q9QL 4KRLB 1AGEA 5DZLA 1XGTB 4X6FA 5DD6B 4U1LA 4QXTA 2D0GA 3HR5B 4GBXA 1QLEH 4ZYKA 1LP9E 3RVVD 1A1OA 1FN4B 4RAVA 2IAMD 4GRLD 5IESL 2YZ8A 4R7DB 2EC9U 7CGTA 1IGJA 2F15A 2M8XA 1CLCA 4JCLA 4PRPD 3JWOL 5E5RB 2QR0A 2O5XL 3Q3GA 1OARH 5D2LF 3GMOB 3V0VB 1MEXL 5C0JA 1XMWA 4N90D 3NGBC 4JAMA 4M6NH 2J6EL 2ZG3A 4Y4FD 3MRHB 12E8L 5D71H 1IMHC 1I8KB 5C2UB 1N0XL 4HIXL 4M6OH 1RZGB 3BMWA 5TQ2L 4PIRF 2ZUSA 4NQED 4NM8H 4P2OA 1HH9A 1A02N 5DDHB 1A3LH 5IVOA 5DMGC 3O6KH 1N5YL 3H2WA 1TJGL 4L4TD 2PCPA 1INDL 4MB4A 2GK2A 1IT9H 1L0XA 1N8ZA 3MUGB 2HKFH 3RX5A 4JFFE 2LTQC 1CD0A 5JHDB 3M17A 2F54D 1XGQB 3RTQB 3KWWA 5CEXB 1F02I 3JV6B 1MAKA 3KPLA 4P3CL 4LFHD 4WY7H 1UH2A 4MVBC 3O45A 1WISA 3K8KA 1ZHBA 4JFDD 2PYED 3O9WB 2XTJD 1OPGL 5HHXL 2W59A 1R5VA 1BMGA 2DLFH 1MWAA 3CX5J 1D5IL 1NL0L 3HPJB 1ZHNB 3KJ4B 4ZS7H 5DMIL 4BELD 1BQHB 4NQVB 5I1CH 2LV4A 5C0GA 4GG6B 1BF8A 2MMXA 5E8NA 4TNVK 5LAXB 5FGBC 4R97B 3DUSB 3S34L 4RISL 3SKNA 3LB6D 3QNZB 4KAQL 4M8VA 1BECA 3AS0A 4AIXA 4HKXB 1EO5A 1L0QA 3B8YA 4MJ6A 5FO9B 4M7KH 3RKDD 1VFBA 1TVDA 2I9LA 5C0IA 2GKIA 4GRWB 4JPWL 3VXRB 4AM0A 4JO3L 4L8SB 5CS7A 3VXSB 4WWKC 2D03H 4PV9A 4QTHA 5DVNA 4K23H 5JO5B 3ES6B 3QXAA 3MCKA 2WUCH 3K4DA 5F7EL 1ZLVK 2YRZA 1KTLB 1G7LA 3UJTL 4PB9H 4OV5B 1J5OL 3T2OA 3V7AG 1QP1A 5BZDB 1N26A 1NCDL 1FAIH 3AAZA 4WHTB 3RPIA 2H2PD 1HXMA 3C09C 3WD5H 4PG2A 3UTZB 5HYQA 5GGUA 2VB5A 5GIRB 2IG2L 3RUGA 1BVKA 1TJHH 1EV2E 3ARFC 4MJ5B 1DTUA 5H37H 2AEPH 3V5HA 3FO9B 4LPXA 3BWAB 5GS1B 1AD9A 5D70H 2AJVH 1I1AA 3QIWB 4BSWA 4N9OB 1QHOA 1T80A 4Y2DA 2W0FA 4PRHD 2QQKH 3SKMA 4CVUA 1JF1A 4FQCH 2ZZUT 3DMMC 4YWGH 5TJWK 1JPFB 2YHGA 1CK0L 4IRSB 3RUGE 1S7TB 1GPOL 4O58H 5L2JA 3RWHB 2XKUA 3DVIA 1PG7W 3FB6B 1A6UL 3BGFC 1GIGL 4L3CB 4ODVL 1KJ2H 4KK5D 4BUHA 3EYSH 1H0DA 4KVCL 2FIKB 4JO4H 4MQXC 5EC1B 1WICA 4Q58C 2DMCA 2YRLA 2EZ0C 2GJJA 2HT3D 5GISH 2NY6B 3NH7H 4WNQB 4FP8H 4Y5VA 3V5DB 5C08B 4PV8B 1KFAH 1DBAH 3RBGA 3PWPD 5A2KH 5M7QA 5ALBL 3C5JA 3DURA 1TZHA 3NFPB 5HHPA 2W91A 4HT1H 4HJGB 3MJGX 1BFOB 4NRZA 4M5YH 1BJ1J 3NOIA 5D7SL 4U3HA 3BPNB 3SDXF 3RL2B 2CRIA 4DGYL 4X6CE 4ZODA 5EZOH 3NVQA 4LFHG 3TBYB 2GAZA 1HH6B 2NY1D 1FNLA 2A9NL 5I1LA 1BVLB 4MD4B 3HE7A 2DD8H 3QDJD 3GMRA 1I85C 4YHNB 5ITFB 1N2RA 1P84K 4J2XA 2QKIA 4NQTA 3F58H 3WFHB 4MJ2A 4ZTOL 3QUXB 1TETL 1I4FB 3RVUD 4P3DB 5I18H 3VW3L 3GSNA 2AV1B 3TA3D 4ELME 3D85A 5TF0A 3GDBA 2DQEL 3HZKB 4AEEA 3RVWD 2NY3B 4NJ9H 4NUJA 4MYWB 4OIIL 5E1HB 5CEZH 3VFMB 5FGCB 5J89A 2DQUH 5L0QC 1E4XH 1QFOA 2R1YA 4WI8A 3UTOA 3REVA 3FOLA 4XWOD 4XPFH 3ELAT 1VPOL 5A3ID 5MEPA 3H0TB 2E9JA 3EYQD 4ZFOB 2DM7A 3MTRA 5CJ8A 1D5ZB 4TSAH 3C8DA 4XNZC 5DXWA 1YN6B 3QNYB 4NBXB 4JVPA 4WTWA 2BVPA 1TVHA 1RULL 4BQCA 25C8H 1G7IB 5HYSB 3QXDA 5IBUG 3SO3B 5IV2A 4ODBD 1OM3L 1HYSD 1G7PA 3CXHK 4JY6B 3RNKA 5J3HD 4YHKH 3ZLQC 4YE4L 1IKFL 3DVNB 5D2LA 1A7NL 3FO1B 5C0BB 3BP6A 1FZMA 2P5EB 2RCSL 3PUCA 2HTKD 3SDDD 4LSPL 5CBAA 4NZRL 1V3KA 1IAOB 3GI9L 4PRBA 1UM5H 4G8FA 4R90H 4YHYC 4P23B 1U36A 3WDJA 1MRDH 3L3IB 1P2CB 2DL9A 3UJJL 2A2QT 1YPZB 3LKRB 4NP4L 5AWNL 1AY1L 1ZT7B 1QBML 1ZTXL 4FXGA 1D9KD 4DQOH 3U9UB 5CD5D 4WTZG 4U31A 1DBBH 2VOTA 3IT8D 2XWTB 4RGMB 5DHVA 1PGRB 2AXJA 4MMZC 3VDCA 1Z9LA 4GRLB 2IEPA 2RB8A 2EXWD 4WHCA 2HG5A 3U30C 2VLJD 3JWDL 4LAJH 4YUEL 4LSTH 1UADC 3L7FB 4Y4HA 5T1DH 4JJ5A 4WFGE 5HY9B 4XTRD 3GO1H 2HLAB 4Y4FB 3KYKH 5C71A 5F3BB 4HXBL 3G5VB 1TCRA 5FO8B 1SEQH 2AGJH 1NFIA 1UCTA 1ZHKB 2VXUH 5MERB 4WHYH 1BFTA 2YD3A 4YFLI 5D2NE 2R1XB 5DJ0A 3GMQA 3AB0B 1MFNA 1CICC 4NPYA 4MWFB 4K71B 4EEEA 1ZGLA 2BXZA 5FYJL 4F7EA 1CD1B 1OF2B 4D2NA 1KCLA 4JHBA 1KC5L 2IPKA 5DA0B 5JOPD 2Q76A 3LKOB 3O4OB 5C09A 5KANI 2IFGA 3AXLA 3HLAB 1WTLA 5LWYL 1AQKH 2BSSA 5DJZB 5K59F 1BJ8A 4TVSa 4E0RB 1PKQB 1LEIB 2C1OB 2PYEB 3RVVC 3S98A 3MFFB 2Q7YB 3QIBD 4UT6H 5D7IE 4HMCA 4RWHA 2H8PB 3BSZH 3D9AH 1EFQA 2VLRE 1IM3A 3D87B 4XP9L 3L5JA 1MHEB 3T2NH 4AL8H 1KCRL 2E7CA 1BREA 4XB8A 2AV7B 3CMOH 4OUOA 4OD2A 1W72H 3HZVA 4LP4A 5E08H 3P4NA 3EUUA 3JTTA 1KIUA 5FM8A 1KV3A 3GSVB 3RX8A 4HZLB 4LCCA 3DBXB 3WFZA 4OSUH 5HGHB 5DVOA 1G6VK 5EFIA 2V9QA 4Q6YA 1URLA 1ZT4B 1LGVA 4R8WL 3LRSB 5HDOA 4HC1L 1I7TB 4WJ5A 3PHQB 5GJSL 4D0BB 2DL2A 4PJ8C 1KACB 1W8OA 2BSTA 2AXFA 2GJZA 4BKLA 4DKEL 1ZSDA 3C6LA 4CU7A 5EBMB 5FECB 3DV4A 2ADFL 3RQ3A 1FRGH 1UZ8B 2BVUA 4L8CA 1M7IB 5D6DC 3L1OH 4PJBB 1CLOL 3PWJA 3QI9B 1E6JH 3SDAB 4EUPG 2VITB 2VL5B 4PY8J 1ONQB 4U1JB 1IQDB 3NBNA 4GOSA 4CMHC 4MA8L 2H6PA 4NYLA 2DQIH 4Y4KC 4LLUB 4PRHB 4QEGA 3BHBA 4IOSD 3MV9A 4X9IA 5GGTA 3SDXA 2LU3A 5JDJA 5I8OL 1HHJA 1A9EA 5IW6A 3QYCA 5FUCE 5DD3L 2D9QB 1WFNA 4KKBD 3RGVA 3UMTA 4RX4A 2H3NA 4PP1D 4HK3J 1CDGA 2F8OA 3OKYA 1NAMA 4X98A 1CFBA 2ARJA 1CF8H 3ARDC 1T1XB 3SDXE 2R8SL 2H26B 2Y4SA 4D94A 4HMEA 5DRWA 3H7BB 1OL0A 1ZWIA 4JN1L 4LEXH 1D5XA 2R0ZL 1IC5H 3S6CA 3QNXA 1B4RA 3SE9H 4U1MB 4NO0A 4JM2B 4XBPB 2X1XR 1RIUH 1NUGA 2OXGA 3FAWA 2MHAA 1S5HB 2AQ2A 1Q94A 4RFEB 2X4TB 5DSCA 4KHTL 1YN7B 4GS7B 2V7NA 2NY7L 5F1OB 5HVHC 5CLTA 4GG6F 3ZKMC 2DTMH 4K3DL 3RWDA 4PGDB 4FTVA 3RVXD 1IM9D 5HJ3B 4MS8D 4HPYL 4KK9D 3BO8B 4P49A 2W60A 2EIEA 4WDIB 3NN8B 4JFHD 1J0KA 1UXWA 4EVNB 2OK0L 1CIDA 3VH8A 2Y06L 3O11A 3D6GA 5F89A 1A4JA 1U92B 4IDJL 4EOWL 3IJHB 4OD3L 3G5YB 1E27A 3VFGH 1MF2L 4PJGE 5DZNA 3RHWF 5JHLH 4PB0L 2FYYB 1DFBL 3UTSD 4DGVH 4N0YL 4UQ3B 2YWYA 5I1JL 2DQJH 2Z8WC 2FH6A 3RVTD 4YHPB 4HUVB 1AGDA 5F7DB 2XY1A 5GS0H 1IGML 3MLUH 5FKAB 1BGXL 2CXGA 2B20A 2VE6B 1XF2B 4IRJC 1JK8A 1CDCA 2XQBH 3LS4H 4LU5H 3V6OA 4RMUA 5CGYC 3MRGB 3AS3A 3D3VD 4CVZB 4HKZA 3LQZB 4HH9A 1KJMA 4YO0A 3C8KA 3ARYA 3WFDH 3HMWL 1QPPA 4OZFH 2A6IB 5FCSH 1JNLH 3WUZA 2DWEA 4Z7OE 3U9PH 5IMOB 5T1KB 4LKXB 5FHAH 1QRNA 3AMKA 1BWWA 4ZG1A 4LCUA 2HMIC 4O2CB 4YX2H 1K8IA 5AZ2H 2OTUB 3BRDA 1S7XA 1X5JA 3I6LE 3L5XL 3UPCA 2OR7A 2PKDA 4LLWB 3DXAB 2JK5A 5CJOH 4OQTL 3TA3C 2YZ1A 2CDGB 1A0QL 1EHXA 3L6FB 3MXWH 4C58B 1OT2A 43CAA 1NC2D 2EIDA 5CEYA 1A6WH 1D9KB 3MLTA 4L9LA 1AHWA 3O2WL 1DN0B 4P46D 4I2XE 5GRWA 2CLZA 1CDHA 1U91B 3ZKXB 5EPMA 3U1SH 3JTSA 3W5MA 3QQ4A 3HAEB 3BESR 4HGKC 4GUPB 2ZCKH 1YEDA 1MJJB 3VXUE 4EI6B 3O3BA 3V2AR 3B6SB 4MD5B 3SEPA 4LPTA 1JBJA 4PJ9C 3FQUA 2KL6A 5GRJL 4Z76B 3DO3A 3HI5H 3ARZA 1HYSC 1XGPA 3CVHH 3T0EB 2XYCA 3SCMD 2DIAA 3LN9A 3SKJH 1E6OH 3PP4L 4LQFL 5J6GA 4AT6A 4XNMA 3RZCB 1EJOL 3L3KB 4LL9A 1UWEH 2R15A 5JOFA 4NM4L 2WIMA 1CE6A 4NNPH 1XGUA 4AIZB 2FHBA 4IOIB 4NN6C 4QRUA 4IS6B 3MUZ1 2OI9B 1QLEL 2WK2A 4MB3A 3BQUD 1XGTA 5DD6A 3F65A 3HR5A 5CJBA 4NHCH 2NTSP 5L6YL 3N0PB 1FN4A 1MCBA 3GBNL 3K1DA 5JUEH 4U6VH 4TPRL 3ALWA 3F6LA 3TV3H 4XVUC 4HWEL 4R7DA 5F6IC 1H8NA 4X7FC 5TDNB 1EERB 2MOVA 1IFHL 1RZFH 3V0VA 2ORBH 3GMOA 4M6NL 2X09A 4HSQA 5D71L 3A6OA 4FFVC 2DM2A 3BEVB 2EKSB 1B3JA 1Z3GH 3MRHA 3QEGH 2YKLH 4KRMB 1I8KA 4NM8L 1FL3A 1RZGA 3HFML 3F7YB 1A3LL 2WWKT 5KW9H 1I1CA 2QSQA 4MNHB 1YPZF 1T7YA 1TENA 5DDHA 1IT9L 1F13A 2HKFL 4HWBH 3MV01 4P9HH 4XP6H 5BCAA 3PGFH 4KK8D 3MUGA 3PXHA 2B1AL 1OT1A 5ERWB 5JHDA 1JZ6A 2Z31B 1XGQA 4WY7L 3RTQA 5KN5B 2HJFB 5J11C 2BFVL 3JV6A 3ORJA 1T2QH 2IPUG 5KANG 5I66B 2VRAA 4J4PD 3P0YH 4DOHE 2WW8A 4Z0XB 5IOPB 1NCBL 1N59B 1U8KB 3WXVL 3QUML 4ZUVB 4WFHD 1FBIH 2D4FA 1FGNL 3HRZB 2JKXA 4A2MA 4ZS7L 2AJ3B 3HPJA 2C4FU 2OZ4A 1ZHNA 4POYA 3OXSB 4HHAB 4JKWA 4JO2L 5JHDE 1BQHA 4GKOA 4NQVA 2D7TH 3GB7B 2J8HA 3G6AB 4GG6A 1BBDH 4UTBL 5LAXA 4RNRB 3DUSA 5F70A 3QNZA 5CINL 3NCMA 5DS8B 4HKXA 3QPXL 4QRQB 3MBEC 5BQ7B 3S8WA 4JGUA 5FO9A 3MO1B 2X1OA 1I8MA 4OZIB 4MJIE 2CKNA 3VXPB 4HH8A 3VXRA 5I9QC 5K9QI 1SVZA 3QWRA 4P4KB 4XAKE 2D03L 4NOBA 5FB8B 1FYTD 3VXSA 4L8SA 4K23L 3VDAA 3OR7A 4F37K 15C8H 2N7AA 1ZMYA 5EZJB 1T0MB 1LO3L 2OJZL 5JO5A 4KXZI 3ES6A 2K7QA 3T2QA 4XC1L 4KJQC 1FAIL 1NMCC 3IJSA 1KTLA 1U3HB 1DL7H 1ZLVH 4OV5A 5BZDA 1YNTB 1QSED 1YJDH 2IMNA 3C8HA 5GRVL 4GRWE 1TJHL 1T2JA 4Z7NF 5A1AA 1A14L 5GIRA 2Z35B 4MJ5A 5GS1A 3FO9A 3BWAA 1U6AH 1ZA3B 2H9GB 3QIWA 1UWGH 4U1SB 4P5TB 1KCUH 2R56H 3MNZB 5SWZB 4FQCL 1NCCH 4YWGL 3Q48A 2JJSC 2YBRB 1KCSH 3O6LH 1ODAA 4P4RA 5I15L 1JPFA 1HQ4B 1JNNH 5KOMC 2WBJD 4FN0A 4KDTC 4OCWL 5HGDB 5IQ7H 1NLDH 4IRSA 1S7TA 2K1MA 3QFJE 5DJ6B 4JFEB 2YC1B 2AERT 3RWHA 2YD1A 5JPMB 1I9IH 3FB6A 2VDKH 1KJ2L 4O9HL 2D7NA 4L3CA 5I1HH 2AXGB 2B2XL 3QUYC 1T3FB 3NCYS 1GYAA 2DRUA 3BIAX 5DGRA 2FIKA 2XG4A 3BUTA 3VI3E 5IFHL 1LILA 2GTZA 1O7VA 3EIFA 4XCCL 1X7QB 4PJBF 4ZD3H 5FGRA 4WNQA 2VWEE 2W9EH 1DBAL 1FNGB 3QEHA 5C07B 3TVMC 4CU8A 3V5DA 4YR6B 5C6WH 4PRIB 5C08A 4PV8A 4HT1L 3X14B 4W6XB 3NFPA 4YPGB 4I1NB 2BJMH 3VGFA 4PJHF 4LLMB 3S5LG 5GRUH 1BFOA 3EO0A 3P11H 5EZOL 2F53E 3P0VH 3RL2A 1K6QH 5C0FB 3IDGB 4P48A 2M1KA 3LEYH 4XP5H 2GQHA 4NZTH 3TBYA 1HH6A 1OB1B 3GUTA 1UEYA 5SX4I 1BVLA 3H9SE 4MD4A 1GHFH 3F58L 1NGXA 2Z93B 2X4SB 1RVFH 4L3ED 4DGIH 2WWKO 5IGXH 5ITFA 1TVBB 5CFHA 2UUDK 5I6XC 3WFHA 4XPTH 1OWRM 3SE8H 5D72H 5DVKA 3QUXA 1J9CT 2EDRA 4P3DA 3U36A 2P46B 1VEPA 5E5MB 4BQ8A 1CI5A 2EYSB 5JQHC 1VADB 3HZKA 5KSAC 1NDMB 2DQUL 3ARUA 3QJFB 3VFMA 4JHZA 1Q0YH 3ZMRA 4CMMA 2GFBB 5I1AB 2CJUH 2MTPA 4OAWB