4W68A

Cytoplasmically produced homodimeric single domain antibody (sdab) c22a/c99v variant against staphylococcal enterotoxin b (seb)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
130
structure length
130
Chain Sequence
MEVQLVESGGGLVQAGDSLRLSATASGRTFSRAVMGWFRQAPGKEREFVAAISAAPGTAYYAFYADSVRGRFSISADSAKNTVYLQMNSLKPEDTAVYYVAADLKMQVAAYMNQRSVDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Single domain antibody
publication title Structural and mutational analysis of a monomeric and dimeric form of a single domain antibody with implications for protein misfolding.
pubmed doi rcsb
source organism Lama glama
total genus 32
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4w68A00
1M05B 2W07A 3RVVD 2Z92A 2AJYL 4UB0L 4JREC 4TTDD 4UUJA 4XVJL 1QHPA 3SDCC 3IJSB 1QR1A 3HR5B 4LF3A 2JIXB 5EORL 5HHOE 1QKZL 4XC3H 3IYLW 4Y2DD 4E42B 4H20L 3O41A 3AGVA 1N5AB 1NC2B 2UY7A 2HFEB 4UQ3B 2HT4C 5D1XC 3B8YA 7FABL 3L3IB 5DS8B 1NBZA 4J3UA 4Z7VE 2HFGH 4E0RB 1JN6B 4JFQB 2MSPA 2DQUL 3KYAA 2L0DA 3KJ4B 3PG2A 4O2EA 2VABA 1JNHA 4WW2C 4U05A 1HQRA 3CSYB 1XF2A 2VDML 5HHVH 3RWHA 1CDBA 2HLAB 5DTFA 4NWUL 4LNVA 4WTZA 2C4FT 2EEBA 1YN6B 3BW9B 5ACZB 3PJSB 4FZ8H 3QCVH 4MA1B 1UWEH 3IU4L 5C0JA 4XCCL 1HCVA 4HXAL 2V6HA 5E1AB 3X3GL 2YD7A 1T5XB 1BOGA 1P9MA 5DJDB 1DFBH 1AFVL 3LPGA 4PJAF 3S35H 4U1MA 4M62L 1WQVT 4G5ZH 4R90H 3STLB 5IFJB 4K3GA 1S9XA 3QA3B 4RQQB 5HGBA 5DK3A 1W72L 3QDJE 1LK2A 1C5DB 3WXWH 3CUPA 4LHUD 4D0CA 1TPXB 3QDGD 3IVKA 3LKSB 2VXVL 4PJXB 5JXED 1L0YA 2FX8L 3VXQB 4UT9H 2Q7YA 1NC4A 2ITDA 3OKLB 3P11L 3PWVB 2V5SA 4MQXC 1CT8B 1BIIB 4NHUB 4F15C 3O6ML 1C12A 3P30L 3RGHA 2DS4A 5DI8A 2OYPA 1UKQA 5T3ZD 3QIBB 4L4VE 1U8NB 2FIRT 4K3EH 4O2FA 1J88A 2XXCB 2IPUG 4PG2C 3KWWB 4LEOB 5CSGA 5MEPB 4L4VD 5F1KC 3JWOH 1CDJA 3OXSA 1VFMA 3HUJF 1S7SB 1JGVH 5HHPB 4HUNB 4OGAC 1Z9OA 3ARUA 1HQ4A 4XPGL 5E6IA 1C5BH 1A7OH 3TGXA 1RJYB 2J88H 2ZCLL 2DN7A 5IIEA 1HEZA 4OF0A 1M05A 2C26A 3L7EB 3O0RL 4KTYA 5ID0B 5JHDB 2HLFC 3B2UC 4P23C 3IJSA 4LSTL 2JIXA 1BX2B 4JQVA 3A6CH 4LLMA 1NC2A 1E4XL 2ERJB 4UQ3A 5HHQB 4P3CH 3ZE2E 3L3IA 4RAVB 5DS8A 4DKFH 1X4XA 4MZ3A 1DQMH 1JN6A 4JFQA 1HSBB 6CGTA 4PRDB 5C0NC 3V2AR 2QLVB 4WTWA 3HAEG 5I6XB 5F7HA 1LDSA 2HFTA 3CSYA 5T1MB 4LFHG 2NZ9D 2HLAA 3STBA 4X6EB 2ADFL 4ORGA 3SY0B 1IEHA 5DR5L 1IILE 3BW9A 4TSCL 3VWKC 5TFSH 5ACZA 3PJSA 2A77L 5HGDB 2VWEE 3GSUA 5E2TL 4YHLH 3WIFB 5E1AA 3OTTA 1UXWB 1U42A 1OGTB 3UAJC 4AIXA 1T0MB 5KSUB 2EDLA 5CSZB 5TQ0H 4JM2D 3STLA 5IFJA 3SDDC 3EZJB 1ZTXH 4UQ2B 1JCKA 3GBLA 3QA3A 1MCWW 3I2CH 1JHKL 3H42L 1IKNC 3EKCA 5KSAB 3QNZB 4HXBL 1F5WA 5LQBL 1A6UL 2KZ1B 1S9YB 3LKSA 1RAMA 4PJAB 5TF0A 5EZLB 4PJXA 3DTXB 2F54A 4LLWA 3VXQA 3D3VB 4N68A 4C4KT 3OKLA 4G6MH 3RFZC 1JWUB 3QWRD 3PWVA 4PJ9B 1A22B 1CT8A 4KPHL 2I26N 2GJ6D 1BIIA 4NHUA 3SE3C 1CF8H 2FJGB 3VD9A 3RL2B 5DDHA 5F9JB 4OAWB 4P2OC 3QIBA 3L3GB 1U8NA 4NZUH 3JTSB 3QHZH 3BD4A 4Y7MA 3GSNB 4CGTA 3U6RB 2CO7B 5CGYC 5MEPA 1FE8L 1I7ZB 1HZHL 4GQ9L 1CE1H 1JWSB 2AJSH 5LBSH 1S7SA 4EIZC 4R0LB 3MRIB 5HHPA 5D7JA 5JPNB 4BH8B 1HYRC 4D9LL 1IGFH 4K23H 4JKLA 3IF1A 4JPWL 2K7QA 2JTDA 2JELL 1RJYA 2UWEF 3PHOB 5GGUB 5DURD 2FL5B 1MFAH 2P46B 3BEWB 3P9LA 4ZD3L 5JHDA 2AW2A 4R8WL 2QQKH 4ZOCA 5KSVB 4JDZB 4CVXB 5IW1B 1LVEA 3HNSL 4BQ8A 3UJJH 5D2NA 1GIGL 4RAVA 5FA4B 4JHWH 3RIFK 1JNJA 5FXCH 4JFHE 4MVBD 4MCZB 4DW2H 3EGSB 3IFPB 5I19H 4KROC 4OLUL 2X2YA 1JNLH 4PRDA 4NFCA 4JFHD 4L1DA 3TBTB 3MJGX 1J86A 4Y4KB 3DUUB 1UKSA 3ULSB 3WE6B 3SGDH 5KVFH 2NR6C 4NBZB 2AI0H 1G0YR 2Q8BH 3SY0A 1FFQA 4NRZA 3N50A 4NZRL 1QR4A 3W9EB 5HGDA 4MJ5B 3CXHK 2R0WH 3KPRE 4PD4J 1J5OL 1WSST 3WIFA 1UXWA 5IEKB 1OGTA 5L0QC 4LSPL 1T0MA 5AYUH 5KSUA 5GS0C 1JF5A 3B4NA 5CSZA 4U1GC 5E2UH 1L4IA 1ZLWK 2APWA 4MAUL 1SM3H 4MXQC 3RTQC 4UQ2A 2N1KA 2J4WH 1EZVY 5KSAA 3QNZA 2NXZC 1IC7L 5KG9B 1S9YA 4I9WE 4PJAA 5EZLA 2KBGA 1FYTE 3DTXA 2R69L 2BP3A 3D3VA 4XP6L 5GZOC 4I9WD 1RI8A 3DOSA 4Q9QH 1H3WM 4LLAA 3W0WB 1JWUA 4RWYH 5CZVH 4PJ9A 2DM2A 1ZA3B 2DAVA 4M9OA 3LRGA 3RL2A 5F9JA 3ZT6A 4OAWA 2R0ZH 3UJIH 5SWZE 3L3GA 5IBTL 3JTSA 3GSNA 4KMTH 4XMPH 4Y1AD 4KKNA 3U6RA 5E2VH 4KFZC 4NP4L 1I7ZA 3QHTC 5DQDH 1BGXL 2LTQC 4CJ1A 3AU1B 4R0LA 2RJMA 3MRIA 4HKZB 4P4KB 4BH8A 4JFPB 3QNYB 2ZUYA 3VFPB 4LASH 1EHAA 3C60B 4QHLB 3LEVH 5GGUA 1GC1L 3H8NA 2FL5A 3HI5H 4MDJB 3RWJB 4HIJA 1S7TB 1A7QH 2ZCKH 4JFEE 1PZ5B 1A8JH 5KSVA 5FM5O 3HNVH 2UWEB 3CFCL 4CVXA 5IW1A 1EPFA 4JFOB 3VD7A 3G6DL 2NY0D 4Y4HB 2W9EL 4ZFGH 1RULL 5FA4A 4XPFH 1ZS8B 1QG3A 2EC9U 3QH3B 1GGUA 3HC4L 4MCZA 1FRGH 1FNLA 4M7LT 4OZGE 4KGLA 3EGSA 3IFPA 4NC2B 4I5BB 4UZGA 3TBTA 4HJJH 4Y4KA 2ZG3A 1W0WB 3DUUA 3OV6A 2VISB 5EC1B 3WE6A 4LVNC 4PB9H 3RX8A 4M5YL 1UACL 4RSVA 5HDQH 4HIXH 1TTGA 3HLAB 2V5RA 3LH2H 5IP4A 3H9SE 3QUYC 3JV0A 5JW4N 1YEKH 4L3CB 3W9EA 4KAQL 4XMLL 5C9JB 3MNWB 4HV8B 3H9SD 5TE7H 3PGDB 1YMHB 3LQAC 1P84K 5E99L 4AEIH 4LVOB 2DI9A 3EBAA 4NO5A 3CNKA 4LCUB 2CPCA 1KUMA 5T5NG 4TNVF 3T3ME 1N5YH 1BECA 1FO0H 1FH5L 4OLXH 5L8LB 1DUZB 4K94H 4MD5B 4NQUA 3C6LB 4I3GA 3QWOB 3OZ9L 5D7LB 4YXHL 3OKEB 4U2YA 5KG9A 2ICCA 5AYQA 2BK8A 1BZ7B 4ZXBD 1NCWL 4FS0A 4OI9A 3U4BL 3TF7C 3CVHB 3UBXB 5F7MC 1HYSC 3W0WA 1G6RB 4KU1A 3QP3A 4U6HA 5TPWL 2ZJSH 1WZMA 1ZA3A 1J87A 3VA6A 4M02A 2YD3A 1Q72L 3G6JE 3BOVA 2ENSA 1FG2B 3GI9L 5T1KB 2CK0H 5CS7A 3GDBA 2W1NA 3DPBA 4TNWF 5E5MB 3EHBC 4G6FD 3AU1A 3IU3B 4OCSH 4HKZA 2IPKB 4GMSH 2ADGB 4JFPA 1AR1D 1BBDH 3QNYA 3VFPA 2D9CA 1JGUH 3C60A 4QHLA 3U1SH 5IR1B 1F90H 5I66B 1VEOA 4MDJA 1CFTB 3RWJA 1S7TA 3MXWH 4YHYB 3GMQB 1T03L 4N9GB 4NQEE 2F19H 1YC7A 1PZ5A 3QNXB 5ACLA 3QDHA 2L7UA 3FQWB 3TIEA 4JFOA 1F3JB 1B2WH 3ZHKA 5F71A 4EZMA 1D6VL 1DN0A 4OZIF 3PQYD 1R5WB 1ZS8A 3Q6GL 3QH3A 4KK8C 4K9EH 1ACYL 3SO3C 4X4YA 4JM4L 2NYYC 4B7LA 4FTVA 4HCRA 4I5BA 1W0WA 4BFGA 2VISA 1U6AL 2NY3B 3EO1A 4HFWB 5D1QC 3EFDL 1GHFL 5A2KH 1FORH 2BMKB 2QADC 4S0TD 3GHEL 1A5FH 1D5XB 2MKLC 4L3CA 3RZCD 1D5IL 4H8WL 3WNNA 1BP3B 3RX7A 5C9JA 3MNWA 4LSRH 4HV8A 4WFFD 3PGDA 1RUKH 1QSED 4ZAKC 4ZUWB 3I02B 3MACH 1J0IA 3RJQB 4EKXA 5HVHC 3RHWK 4NFBA 25C8L 1DUZA 2YSSB 3PDOA 4A2LA 4MD5A 15C8H 2DQFB 3C6LA 3QWOA 5EBMB 5D7LA 2W65B 2W0PA 3OKEA 3IDGB 4TOYH 1D5MB 3E6FB 3LN9A 1T7YA 1FFRA 3DI3B 4PJ5B 5HSFA 1BZ7A 4N8VG 3CLFH 2BSSB 2CRIA 3MJ9A 3C5ZD 1ZK9A 4LRIC 4MXVE 5CLTA 3WKML 2VITB 4LSDA 4UAOC 5I1KL 5GS3A 5CEZL 1FG2A 3OJMB 5T1KA 1OLLA 4Y16C 4ZFOL 3RA7H 3TEUA 1ZGLB 4LLUB 1OSPH 1TTUA 4XHJD 5FOBB 4KKBD 2ADGA 3GMNA 1FAIL 1YEJL 4BM7A 1I9EA 3C6SB 3BRGC 3QFJD 5I30L 5F89B 4FFZL 5FAAA 5IR1A 5I66A 3QIUB 1CFTA 3BESR 4POYA 3GMQA 4ZDHA 4N9GA 3PABB 5FYKE 1CLYL 4X9GA 3QNXA 1PX3A 4FP8H 2UZXB 4P9HL 3BX7C 3WIHH 4M48L 1F3JA 3F6IA 4AIZB 2ARWA 1AO7D 1QFPA 2PO6D 4B0MM 1YEEH 2QR0B 5ID1A 1N6QL 1DUYA 2X1PA 2VLMD 5FUOH 4PJCE 3SQOL 1JF6A 1TVHB 1ZANH 2OR8A 2VXTL 2X44D 3VGDA 4X5WA 4OZIB 4JGJA 4UTAL 2AABL 3RVXD 1WBYA 3TCLB 5ESQB 5GQBA 4QNPE 1DVFD 2PXYA 2BMKA 3BD5A 1D5XA 4P0DA 3TNNB 2PKDA 4FQPA 2V5MA 4BK5A 3OKMB 1KIPB 1C16B 1LDPH 3T08A 4RISL 5I1HL 3HCVB 4ZUWA 3ZYIA 3I02A 3K8MA 3P73B 1FVCB 4Q58C 1XIWD 1KJ2L 4G8IB 2YSSA 2ATPB 2WK2A 3K8LA 3QI9C 1T20B 1UJ3A 2DQFA 4POZD 4CMHC 3MRPA 3EYQC 2WBJB 4IOFC 5KANG 2B1AH 5BV7L 2W65A 2HN7B 1EO8H 3BPNC 5J12B 3IDGA 5JOFB 3E6FA 5IQ7L 2IPUK 4MQTB 5TH2A 4PJ5A 4KUZH 2YRPA 3S98A 4FQCH 4XMKL 4M43L 2BSSA 2P4AB 5DVOA 2OBGA 3P3YA 5BZDB 3QHFL 4NZJA 4NCC2 3A6OA 3DX7B 1MFBL 1PG7L 3BRDA 1A3RH 3AY4C 3MRHA 4LCCC 2VITA 3RUGB 3K46A 4QXUL 3X11B 4GAFB 1H3TA 4OCRH 2C3XA 2NX5E 2R2HB 3WS6A 4XBEH 3O4OB 1W72A 4GRWE 4LLYB 1ZGLA 5JW3L 3BKYL 1J9CT 4RGOH 1MCBA 3UTOA 2NX5D 2XICA 1F45A 3I6LE 5FOBA 4JKKA 3MGAA 1WIUA 1XR9A 1V3JA 3NA9L 5F1SA 3C6SA 1WIOA 1AE6H 3I6LD 4XB7A 5ADPH 4GAGH 5J57B 4G9FE 1X4ZA 3QIUA 1RZ7H 3PABA 2NY2C 3IXAB 2BC4A 5I2IB 4U7SA 5DMGC 1CXIA 2CRYA 4D3CL 1MCQA 4FQ1L 4JDVB 4AIZA 5AZEH 1F58H 3VXSB 3QUZC 3CIQA 5J56B 3LS4L 1R3KB 4YX2L 1HH6B 3P0VL 1INQB 1TVHA 4HQQL 1MI5D 3U0TB 3MLSL 1FHGA 3LS5L 5ESQA 3P77A 2WZPD 3PP3K 3BPLC 3BEVA 5DMIH 2VZ3A 1BFVH 1SQ2N 2PTVA 4IJ3C 1URLA 3TNNA 1AI1H 5HD8C 1BIHA 1AQKL 2AAVA 1KIPA 1C16A 3O4LE 3OKMA 4W4NA 1OSZA 3HCVA 3RY6A 1WGOA 1FVCA 5D1ZB 2XACC 5EZOH 3O4LD 1XT5A 5FYLL 4EJ1C 1HI6A 5AUMB 2D7OA 3HMXH 4G8IA 4XP5L 5C0AB 2ATPA 1AHWB 2APVA 2Q3AA 1JZ6A 4KUCF 2Z8SA 2Q86B 2WBJA 2HN7A 2BY2A 4P4RB 1KB9K 2QHRL 1IAIH 4NKIL 4L9LB 1IM9D 3S4SB 2O5YH 3SOBH 1OWWA 5BZDA 4JB9L 1NMBL 3DX7A 2K3TA 1WIPA 4HS6B 4ZFZB 3UXFA 1FNSL 1HHHB 4NCDA 3RUGA 1PX4A 2QSCL 1S7VB 4TVPE 3X11A 1H8NA 1N8ZB 2Y72A 1BOYA 1PSKL 5I1IH 3MV7D 4OIIL 3V6BR 4I1NB 3KPSB 1MY5A 5DD0L 4PGEA 4EOWH 4LSVL 4JG1H 1OGAE 2DLIA 5CJXC 3BSZH 3RAJH 3QEQE 3QXUA 4ZPTB 4GG6B 2EKJA 4U0RC 1KJVB 5IHUH 4FQXD 5IMMB 4BZ2L 5IQ9A 3IXAA 5EU4B 4ZNCD 5EO1B 4ZSOA 4NJ9H 1T1ZA 4JDVA 1E4WL 1ZSDB 3VXSA 1MFCL 4LHQB 1EZVX 3ZMRA 3VD5A 4APQB 4OLYL 3BKMH 2XRAH 3LSOB 5F7YC 1U3HB 3C08L 3ME0A 1P6AB 1R3KA 1YYML 1EMTL 1U8OB 3VRJB 1HH6A 4CADB 5EBWB 1INQA 3IDUA 5EIIB 3U0TA 4JVUA 4XPTL 2XG5A 4YWGL 1RFDL 3K1DA 1U8JB 4KZDH 4OT1L 3NIGE 5IB5A 4HD9A 4UV4H 1VSCA 2NTFB 5T3ZL 3VXNB 1NGQL 1MCSA 4IDJH 4K55A 1PJ9A 3WV0A 2GW5A 3OGCB 2GUOA 4YDJB 2QQNL 5B38G 12E8L 2P8MA 5GJTL 3MCLH 3V9FA 4HWNA 5IFHH 5JW4R 1V5JA 5D1ZA 1WTGT 2XY2A 3FO1B 5AUMA 5C0AA 1AHWA 1OVZA 5E8NB 1OAYH 2GJZB 1B0RB 3W2DH 2Q86A 1KJ3H 4P2CG 2WINB 4P4RA 5C0BE 3VMOA 4KQ4L 1YJDH 3SDAB 1GYAA 3AXLB 4L9LA 3HE7B 1YY9D 2WANA 3S4SA 4ALAH 3GIVA 3X14B 5C0BD 4M7KL 4BQCA 4OBRA 4GT7A 2KQMA 3KPNB 1EDQA 3F8UB 4U7KA 2UZIH 4MJ4A 5T3XL 3QQ3B 1IFHH 4HS6A 4L4TE 4ZFZA 3VGHA 3VG9B 3AM8C 1SYVB 2NXYC 3E2HC 1ZVYA 1S7VA 4Q7DA 5GRVL 1N8ZA 4ODVH 2VDOH 1HDMB 3LKRB 2Y23A 4NCC1 1TITA 3L9RB 1CN4A 4KXZI 3BN3B 4S1SL 1IAMA 3KPSA 1EXUA 1I1CA 1NAMB 1P7KB 3VMNA 2IALB 5L8JB 3HB3D 3FTGB 1HH9B 3I85A 3ELAT 4ZPTA 3UTTE 1OAUH 3T1WA 4GG6A 1NCAL 4JE4B 1YPZF 1D5BB 1KJVA 5DQ9B 5IMMA 5CMAA 3WNLA 5EU4A 4KHXL 3MV9E 3GRWH 1XGTB 1IKFL 3UTSB 2YPLE 2FR4B 1EBAA 2EXWD 1CD1A 3LN4B 2LU3A 2XQYG 1ZSDA 1WFUA 2XTJB 2BDNL 1MFDL 2KUTA 3ZKND 4MJIE 1QYGL 4APQA 1OAXH 5D7KD 2OZ4H 1TQBC 4DN4H 3VW3L 4YHOL 3VRJA 3V7MA 4CADA 5EBWA 4OF8A 3TN0A 4MJID 1ZVSB 3VI4F 2HMID 5EIIA 5IM7B 4LCWB 1FBIH 1BVKB 2DQGL 5D70H 1U8JA 4D2NA 3DXAE 4L3EA 3F7QA 1XF3B 2NTFA 3VXNA 2BVPB 2VLKB 3EO0B 3W5NA 2E7MA 3DXAD 4YDJA 1N7MH 3OGCA 2XN9B 4PRPE 2W0FB 1UM4L 1A1NA 1HHGB 4Y19E 4XWGL 4G8GE 4PRPD 2UUDK 4LVHC 3JXAA 1K5NB 4N90E 4AL8H 2DIBA 2YRZA 3ZHDA 4EDWL 2IMMA 2V2WB 5BO1H 1A6VH 5HHME 3FO1A 4L1HA 3GMMB 4Y19D 3VI3E 1T0PB 3ULVF 5E8NA 1KCUH 4GAJL 1B0RA 3MV8B 5E9DB 4GW4B 2WINA 5HHMD 1A1MB 5IGXH 3SDAA 4NZTL 4R97C 3AXLA 4PJDF 4X0KA 2A6KB 3HE7A 3HMWL 3D85D 4P5MB 1CXHA 1MHPH 2VH5H 2K9UA 3X14A 4KQ3H 4LPUA 4X99B 4NJAL 4HKBB 1X7QB 3QXDB 4KI5D 3KPNA 4ZOBA 4NM8L 3QQ3A 1DQDL 3DX9B 5DJ6B 4TYUA 3TP4A 4XAWL 5F7EH 2VXUL 1SYVA 3HAEH 4GH7B 4LPYA 1MQKL 4LPWA 4UT6L 4BJLA 3FO2B 3HZMA 3LPWA 5LG1A 3ZZ1A 1PG7W 2Y07L 2NY6B 1JK8A 1HDMA 5FHAL 3LKRA 4FG6C 4WCYH 3FKUS 4ZO8A 5I18L 1U8HB 1NAMA 1P7KA 2SEBB 2V2XB 3FTGA 4PRIE 3ZE0F 1D5ZB 5I8KL 1P9MC 5IT2H 3GJFK 3K74B 2VERN 4PRID 3RIFF 3UJTL 1D5BA 1KENL 1VFOA 5DQ9A 5D93B 1OQXA 1T1WB 3C2AL 3AAZB 5D6CB 3NIFE 3UTSA 3N85L 4M6OH 2V7HB 4XPBH 2FR4A 3I9GH 3MLUH 4ZFOB 3LN4A 1FGVL 4PUBH 2AQ1A 3BH9B 3CPLA 1FPTH 3KLAB 5EG6C 4LSUL 5E8DH 2IFGA 2DLGA 3CH8A 4F37F 1KCVL 4KTDH 4NQDD 4F3FB 3U46B 3C8KB 3N1QC 5LGKA 2VZUA 4HWBL 1MREH 3RNKB 1ZVSA 3FQTA 5DJCB 4O5LH 1BVKA 4ZUSB 1BMGA 2FYYB 5F7DB 1XF3A 2FH6A 4UINH 5L7XL 3WXVL 3VFGL 3KYKH 2BVPA 3EO0A 3V4PL 4GS7C 2F5BL 1YEDB 2XN9A 2AKRB 1M7IB 3SKNB 2ESVB 1HHGA 2VLJD 3PDDA 1JUFB 3P4OB 4HS3A 4PGJA 1K6QL 1MHHB 1K5NA 2DJSA 1INDL 2NY1C 3SKOB 3SHSA 4WFHD 3GMMA 1P4LB 1FFNB 4NQCE 2WNGA 3V52H 3HS0A 4UILH 3V0AC 3CDYA 3MV8A 1ND0B 5E9DA 5F9OL 4GW4A 3T0DA 1V7NH 1A1MA 4OGYH 4R6UA 2A0LC 2C3VB 4HAGA 1MJ8H 3GFUA 2A6KA 1QSFE 3K2UL 2F58H 4P5MA 5HI5C 4ISVB 3VFOB 4X99A 4X9HA 4HKBA 5KVEL 3L3OB 4S1DD 4PJ7E 3QXDA 2AGJL 1QSFD 5F3HB 4XVUC 1OAZH 2R4SL 5BJTA 2DF3A 1RZKC 3DX9A 5DJ6A 3GI8H 1DBKH 1BJ1H 3KJ4C 5FM5M 2ZUWA 4RGNB 1I8IA 1KPVB 1I1AB 1ZLSL 3P40A 4GRLD 4WTZG 4FABL 1CD9B 2C1OA 3PE9A 4KMLB 4UBDD 3DMMB 1ZLVK 5JMRA 4PRHE 4PJHA 5F21B 3V8CA 1IT9L 2X4QB 1NCDH 2Y6SD 1I3RB 5HYIA 1U8HA 5C6PB 2SEBA 4MD0A 2AK1L 1MHCA 4PRHD 3N1PC 1D5ZA 2AQ2A 4OQTL 2CUIA 2VDQL 3BZ4B 3SJVE 2JKXA 4Z7VF 1HILB 2DBLL 3F7PC 4HFUH 2EYSA 4HMEA 5IW6A 1T1WA 3ISWA 3ARBD 3AAZA 1SY6H 5D6CA 5F1OB 1XGRB 2V7HA 5T1LB 3MROB 2OL3B 3VCLB 4LMQE 4ZFOA 3TJEH 3BH9A 3NAAH 3UPAA 1XAUA 3MBED 1II4E 2WBKA 5FGBA 2Z0BA 4F3FA 4MWFA 5B8CB 1LO4H 4M7LH 3U46A 3C8KA 4P2RB 1M6OB 2P47B 4KXZH 3RNKA 4K7FB 5DJCA 2P1YA 3QIBC 4ZUSA 2HFGL 2FYYA 5F7DA 3GSOB 5BRZA 2P42B 4YHML 1CFBA 4DKAA 3CCHB 1A9BB 3BZEB 4H1LB 4P5TC 1QPXA 1YEDA 5L2KB 2ICES 2AKRA 2OSLB 1M7IA 2ZWLT 3SKNA 1BQLH 2ESVA 4N5ED 3LKNB 5EBLB 5A16B 2AK4E 1JUFA 4HUUB 3P4OA 1MHHA 2QQLH 1IGJB 3GMRA 1UWEL 3QUXA 5E5RB 3S37X 3ZYOA 2AJVH 1ZHBB 4KKLC 4HUMB 3SKOA 2AK4D 4J1UA 1P4LA 3WUWB 4F8TA 4LARH 3X17A 5K9JH 1DFBL 4JCMA 4R90L 2G9HB 2C3VA 4Z7WE 5HXMA 1QRND 2ERJC 4ISVA 3LY6A 3WXWL 2F8XC 3VFOA 3WFBH 4QRRB 4LQFH 3L3OA 5IEHB 2H8PB 4X4XB 1J8KA 5F3HA 3LKQA 5KANI 5SX5K 1TZIB 3CX5J 3TC9A 4NN7B 5I6XC 3GJEB 5C2UB 1KPVA 1I1AA 5GXBB 3O3BB 4LEXL 3OKOB 5IK3B 5ALCH 1DSFH 4MB4A 4K3EL 4WHCA 3FMGH 5E5UB 5GS0H 2X4QA 3BJ91 3FOLB 3JWOL 4M3JA 3EOTH 1T80A 4Y2DB 3SBWA 1QO3B 1JGVL 5SV3A 3S96A 3PGCB 3WJJC 3ZE2F 3BZ4A 4I77H 1HILA 1SBSH 5ETUA 3O2DH 4XAKE 2I60H 1C5BL 1A7OL 1I8KB 4YBLB 3WNOA 4DCQA 1MH5A 4KK9D 2J88L 2EECA 5F8RC 2FEEL 5T1LA 3MROA 2OL3A 4Z7VB 3R8QA 3VCLA 2EE9A 1GGBH 1ZT1B 3GBMH 3FHAA 3A6CL 5B8CA 4P2RA 1M6OA 4P3CL 4JM2F 4K7FA 2JJSA 3JV4B 3TBVA 4PJGB 1DQML 3O6LH 4AJ0A 5KN5B 2ADJA 4WV1A 4MS8D 4OB5H 3GSOA 5DA0B 1JMZA 1KCKA 3GEWB 5E0QA 5J6HA 1KXTB 3RHWF 3CCHA 1A9BA 2A9MH 3BZEA 4H1LA 1EVTC 5GGQH 5L2KA 4PLKC 2RIKA 3O81A 2OSLA 2EIDA 5DVKA 3NH7H 3TT1H 3LKNA 1JF1A 5A16A 2E7LA 4LHUB 5TFSL 4HUUA 5E70A 4GKOA 4O00A 1IGJA 4NQTA 3QDJB 1KCSH 4POUB 3CFKB 1L7IH 3WUWA 1CLOH 4YEFA 4GRWH 1HNGA 3RRQA 4IS6B 5TQ0L 2G9HA 1ZTXL 3B2VH 2OR9H 5BS0E 1X4YA 2DL2A 5JTWA 3I2CL 4F7PB 1CD8A 1TTFA 2BNRE 4NDMB 3U9PH 5BS0D 4G7YH 2UV3A 4K8RD 4N0RA 4L4VB 5CEXA 1T6WA 5FOJA 1TZIA 1NGXA 4G6ML 5BMFH 4Y4KC 3GJEA 3TPUA 1AD9B 1IAOB 4P57B 1KULA 1HINH 3O3BA 1CF8L 1P5VA 4C54A 4CL7A 2XY1A 1ZWIB 3FB7A 5IK3A 1OTTD 3WN5B 3LQAH 1FP5A 1DANU 4NZUL 3QHZL 2Y9RT 1D9KC 2YMXL 1JPGA 3H3KA 3ARDB 4L5FH 1F42A 1E0OB 3TZVC 3SE9H 1CE1L 1OT2A 2AJSL 4Y2DA 5LBSL 1QO3A 1DP0A 3BGFB 5J13B 3PGCA 2Q1EA 2A6JB 3Q48A 3AC0A 2BJMH 1IGFL 2EDJA 4K23L 1I8KA 4ACPA 1G7QB 1CVSC 3NABL 1B90A 2JF1A 2A1WH 4YFDB 4JZNB 1MFAL 5DWUH 2HT4D 5D1XD 4WUUE 4U1IA 1ZT1A 1AGEB 2QQKL 4EI5D 4LU5H 3E3QC 4WUUD 3MFFB 1X5FA 3TFKC 4XTRC 3UJJL 1B6DA 1DL7H 3MJ6A 3JV4A 1HHJB 1AH1A 4LSQH 4PJGA 1QFOA 5KN5A 2Q87A 1RHFA 3HC0A 5KZCD 1DE4B 2MFNA 1WZLA 4XXDA 3KXFE 5J11B 4KMQA 2Q76B 4I8DA 3VGAB 4JM2B 4YR6B 5KVFL 3ZE1E 3KXFD 1FN4B 5FDYA 4QGYA 3DIFB 4O58H 4P4KC 2Q8BL 3BP6B 1KB5B 5L2JB 3DVIA 4LHUA 3QDGA 5AAMA 2YHGA 2Q7NA 1KLFA 3ZYZA 5JXEA 1BZ9B 1IQDB 3CFKA 3ARXA 3KAAA 1OQOA 4G8FB 4JKMA 4X4ME 1XF4B 1PG7X 5AYUL 2H2PC 2AV7B 3WFDH 4IS6A 2W38A 5E2UL 1U92B 3OAZK 4OSUL 2QL1A 2GJ6B 3SKMA 2CXKA 1SM3L 3KNBB 3RDTD 1HHIB 4Y4HC 4UTBH 1CFQB 2J4WL 3IGAB 3QO1B 4FNLH 5EUOB 4F7PA 4ZUUB 1WEJH 2BOCB 3PWNB 4NDMA 1X5HA 1U41A 1QBLH 4L4VA 3ZKMC 4Q9QL 5LAXB 3SGJA 4RWYL 5A2IH 5CZVL 3AVEA 1AD9A 4P57A 4WGVB 4KRPC 4O51B 3QUML 4BZYA 3CK0L 3MJ8B 1M7XA 1WWAX 1ZWIA 2EDTA 3RPKA 2R0ZL 3UJIL 3WN5A 1OHQA 4PJXE 2YN5A 4M1CC 2F54E 2V17H 3THMH 2XQBH 4KMTL 3QXWA 4XMPL 2XQYK 1ZA6B 1JRHL 1W0VB 4YXKH 3VRLE 4LVOC 3VGBA 3FB8B 5DQDL 3OGOE 2YR3A 2A6JA 2NQCA 2HLFD 3B2UD 1QLFB 1ZHLA 5EU3B 1G7QA 4OZGF 4WI2A 4MLIA 4LASL 3C6LC 3NPZB 3LEVL 4U6XB 4JZNA 4TULH 4HZLB 3HI5L 4V1DD 3S88H 4YDKH 1A7QL 2ZCKL 4NO2B 4WFEE 1AGEA 3TCXA 3BH8B 1UZ6E 3HNVL 1QUNA 1MELA 1RK0B 3QO0B 5C0ND 3L5JA 2VXSH 4WFED 3KVQA 3MFFA 1LP9A 4KV5E 5CIPA 4PIRF 4ZFGL 1A1OB 4XPFL 2FECI 1HIMH 1HHJA 3DGCR 4OZHE 3DARA 4OV5B 1DE4A 3VWKD 2VB5A 1A9EA 4WFGE 3T3MF 2O5XH 3VXTB 2Q76A 3VFMB 4HJJL 2QSVA 4JM2A 3ZT5A 2Z8VC 4PB9L 5IG7B 4OGXH 5HDQL 4HIXL 1FN4A 1FNFA 4WFGD 5F1NB 3DIFA 5D2NE 1V3MA 5A2LH 3LH2L 3RVWD 1KB5A 5L2JA 4J2XA 3SDDD 1CK0H 1YEKL 4QRUB 4U0QB 4JFZH 4LMQI 5TE7L 5FUCE 1BZ9A 2D0GA 4AEIL 3UPRB 5IBLD 3AS3A 1XF4A 3G5VB 1EO5A 4M7JH 1GSMA 3QWRA 2AV7A 1U92A 3FN3A 2GJ6A 1Z6JT 3KNBA 1N5YL 1FO0L 1HHIA 4OLXL 1LQSR 5CFHA 2Z8WC 4K94L 3HR6A 2E8ZA 1YDPB 3VH8A 1X5JA 1CFQA 3IGAA 3QO1A 5EUOA 3EYSH 4X7EC 4ZUUA 3PWNA 3ABZA 1T2JA 5C08D 4P2OD 5FO7B 3QJHB 5SWZB 2V7NB 1PD6A 5LAXA 3NZHH 4QCIB 2MKWA 5CGYD 2ZJSL 4JAMB 5GIRA 2I25N 3MJ8A 3MRGB 3UYPA 4KJQD 1IM3B 4FHBD 1UGNA 3NZ8B 3BPOB 2AERT 2MCPH 1KJMA 2CK0L 4Q0XH 2I27N 1W0VA 2LV4A 2ZUVA 1B4JL 3FB8A 3NTCH 1BD2D 1SEBA 1KEMH 2JK5B 4JFEB 4OCSL 2NY0B 4GMSL 1QLFA 1UH4A 1BBDL 4XNZC 5EU3A 4HEPG 2VE6B 1JGUL 1YECL 2DLFH 2Q3ZA 3HC3H 3U1SL 1F90L 1E6OH 2H9GB 2BXYA 1Z0MA 3MXWL 4NSKB 4NO2A 5CHNB 2F19L 4N0FB 4OZGB 4EEEA 3BH8A 1WFOA 4KROD 3QO0A 1FL6B 3PIQB 5CAYB 1B2WL 3UTPE 3CSPA 3K1KC 1Q9LB 2DOCA 3TBSB 1ZT4B 4NKOA 1XGYH 1A1OA 2NR6D 3PV7A 1NDMB 2NLJB 3UTPD 1IC5H 3H9SB 4K9EL 6FABH 1YMME 5GGVH 3ARED 4ZO7A 3GO1H 2J8OA 4OV5A 2CLRB 5JW4M 2DLEA 1PYWB 3WS6C 3OKDB 1NCCH 4FRWA 3T0WA 3MRKA 1YMMD 2BNQE 1J1PH 2ZG2A 4LPCA 2B2XH 4OZFH 5IG7A 3V6OA 3G5ZB 1FORL 2BNQD 4PRNB 1A5FL 4MXQD 4K3DH 3RTQD 2Y5TB 4QRUA 5DJ2B 4OUUB 4FOMA 5DJ0B 1J0ZA 4ZXBB 3QIUC 1RY7B 1RUKL 2NXZD 4J3OC 3G5VA 5TF1H 3MRCB 4MXVF 2H1PH 3MRJB 3MACL 3VE0A 2OQJB 2R56H 3A67L 4XP4L 5GZOD 5JW4Q 15C8L 1NANH 5GZNC 2YD4A 3QCUH 5B3NA 1ETZB 1T7ZA 4JQXA 4PY8I 3B6SB 1CR9L 4TOYL 4Y1AA 2ARJA 3MMEA 2C4FU 5FO7A 3QJHA 3G6JB 3KPTA 2GQHA 2VMFA 3GHBH 2V7NA 1KT2B 4B53A 3TWCH 3D2UD 4G6FB 5C0CD 4RFNC 43C9B 2X4TB 4QCIA 2X4RB 3QZWB 5LXGH 3DYMA 3LD8B 4JAMA 2X40A 5FCUH 4MNQD 4YIQA 3MRGA 1WVZA 2A6IA 4ZS7H 1IM3A 2VKXA 4LOUC 3WFEL 2FD6H 4YBQD 5D5MF 1W2KT 4FQIH 5DJXB 4NPYA 5M94B 4PYGA 5F7FA 4MZ2A 4YHNB 3RY6C 4GKSB 5K9KB 1OSPL 2JK5A 5K9QG 3T0EC 3PQYB 5C0GB 2VE6A 3HI1B 2X5PA 3T65A 4XP9H 3QB7C 5J12C 2H9GA 3GBNH 2W92A 5T5NF 5CHNA 4QNPF 4RFOH 4N0FA 5I1GH 1CXKA 3B43A 2OI9C 5CILH 1YUHB 1C1EH 1FL6A 3PIQA 3WIHL 3ZTNH 5EZIH 2I5YH 1Q9LA 3TBSA 1GZQB 1ZT4A 2Z35B 3HPLB 3RZCB 1GGTA 4OQTA 4F7EA 1NDMA 1DEDA 3H9SA 4P46C 2JCCE 1K8DB 1QSEB 1PYWA 5DT1L 1K4CB 1ZANL 3OKDA 1F4XH 5IMOB 4EVNB 4PJ8D 3PNWB 5H35B 3PL6C 4XC1H 1DZBA 4HK3N 4PRNA 1SJEB 2I24N 4WEBH 5DXWA 3QSKB 2Y5TA 1AJ7L 5DJ2A 1REIA 4OUUA 2BHZA 4TQEH 2J5LC 5KTEH 2DYPD 4ZXBA 4FTVE 1N4XH 5EU6E 1LDPL 3WLBB 5B3JF 5DGRA 4JR9L 3C5ZB 4HX1A 1EVUA 2OQJA 4OCNC 5EU6D 5JZ7C 4X7DC 1LGVA 2LU4A 4PLJC 4I3RH 1HYSD 4OLZH 1ETZA 5DF0A 2B1AL 3B6SA 4ETQA 4GRWF 4HPYH 5E8PB 3MNVB 4KUZL 3G6JA 4FQJH 3VXRE 4FQCL 4IIQB 3DURB 1KT2A 5EIQA 43C9A 2X4TA 2H45A 3VXRD 1BBJB 3QZWA 1A3RL 5J3HC 5D7LE 3EHBD 2E6QA 2VZOA 3IAPA 3SO5A 1HXYB 4CKVX 3E6HB 3V4UH 2Z31C 4S2SB 4UT7H 5DJXA 4OCRL 4WHTB 4XBEL 4YHNA 3FRPA 4HT1H 2D03H 4RGOL 1T66D 3IRZA 1FL3B 4Z6AT 3QWQB 1IARB 4WI4A 3H6JA 3PQYA 2PO6B 1AHWC 5C0GA 4XI5C 1AE6L 5ADPL 3HI1A 4GAGL 5DHVB 2Y06H 1RZ7L 2X42A 4Q9RH 4KK8D 1LEIB 1FC2D 3IFOB 4PJCB 3DNKA 1YUHA 2IBGA 5DFVC 1QFWM 2NYYD 4MXWH 1DVFB 1U36A 1MEXL 5AZEL 5JOPD 1VGEH 1GZQA 2Z35A 3HPLA 3RZCA 5D1QD 1RIHH 1SHMA 1H3GA 4Y4FC 1DBBL 1AGCB 1P53A 1S7WB 1K8DA 1QSEA 3PDGA 3I6GB 1K4CA 4EVNA 3CVIH 3LRSB 5H35A 2ITCB 1E4KA 1KN2H 5DMIL 1SJEA 3EFFB 3T04D 2UY6A 4PYHA 1AI1L 3OAYK 4ONFH 3WLBA 2GK0B 4JFYB 3SKUD 4G42B 2NY4B 3C5ZA 4K3JH 1QACA 2MMXA 4KJYB 1FDLH 5EZOL 2HWZH 2PYED 5IFAH 4HWZB 2HTLD 4NIKB 4YDVB 4WHYH 1VADB 2IADA 3T77B 2XNAB 4PP1C 4GXVH 4APQC 5E8PA 3MNVA 1N0LA 1U3HC 1IAIL 4LPTA 5MHSE 5JOEA 2O5YL 3SOBL 4IIQA 1EEQA 2A73B 1I75A 3ILPB 2NX5B 5ILTL 3DO7A 5MHSD 1I85A 1BBJA 3WYRA 4IRZH 4KI1A 4QRSB 4U6VH 2PW2B 4G7VH 3FQUA 3QFJA 1KOAA 1HXYA 4ZUTB 5ECJE 4PJ5E 3E6HA 1EFXD 5IVNA 1G7JB 2AEQH 4WHTA 2FHBA 1F4AA 4YXLH 5DD1H 4G9FB 3GJFB 5FDWB 5I1IL 4MSWB 4PFEA 5I76A 2PN5A 1WZ1H 5GS1B 2XZQH 4YGAB 1FL3A 1JP5A 2IG2L 1AO7A 1AKJD 5GHWH 4N0UE 2PO6A 2EYTB 1CCZA 4EOWL 4JG1L 4CRPA 4FQLH 3BSZL 1A47A 3RAJL 5DHVA 2DDQH 4YEEA 3C5SA 4P49A 3S4SG 4DWHA 1AGDB 1QLEH 3SDAC 3NN8B 3QUMB 5IHUL 1MI5B 3HE7C 1BWMA 1LEIA 4I18B 4LGRB 1FFOB 3IFOA 4PJCA 4HGMA 2X41A 3C5JB 4NJ9L 1DVFA 5EZJA 3KLSA 3LRHA 5GSVB 1OCWH 5ENWB 1T3FB 4I13B 5AZ2H 3VG9C 2CGRL 3BKML 3O8XB 2XRAL 3TO4B 1AGCA 5CWSA 5J06A 1S7WA 2DB8A 4S10A 4JGUA 1QBAA 3I6GA 4ZO9A 3IFLH 2F9BT 2YD1A 1CL7L 4AY0A 5E00B 3O4LB 1XIWA 4KZDL 1KXQE 5HYFA 2EIZB 3NGBB 5KJRH 3S35X 2ITCA 3NFSL 4L8BB 4IDJL 4LDEB 1JV5B 3ESVF 1IM9B 3BDBA 3EYQD 3MCLL 1CDIA 2VDRH 4NNPH 4X7SH 4X9FA 4JFYA 5IFHL 4G42A 3N1FC 4QRQB 3UO1L 1NEZB 2VN4A 4KJYA 4MA8H 4HWZA 4LNRB 3BQUD 1UQSA 4QRPD 5J7CC 4YDVA 3W2DL 3T77A 2XTJC 5I8EA 1KJ3L 2XNAA 1Z2KA 1N0XH 1NJ9B 4OKDA 3ARGC 1YJDL 4WWKC 2VDLH 5FB8B 1FJ1A 3MV7B 2A73A 3QPXH 5HYQB 3L95B 3ILPA 2NX5A 4OLVH 4F57L 1HWGB 3B9VA 2UZIL 2P5EE 3GIZH 1BZQK 4QRSA 2PW2A 4KRNA 1IFHL 1NAKH 1F6AB 5CBAA 1RUPH 3Q5TA 3V8OA 1G84A 3EYFB 3D0LA 4ZUTA 3OB8A 4JRXD 5JDJA 2P5ED 1G7JA 3WNPA 2YD6A 1KNOB 4ZQKB 1FO0B 2Z91A 4ODVL 5FEBA 1OGAB 1RZGB 4F33A 4FQXB 2C7UB 3QEQB 3GJFA 5FDWA 4HKJB 2DD8H 3OJVC 4HS8H 5GS1A 5IHLB 1OL0A 2NY2D 4NC1E 2LU7A 5FHBL 3RUGE 4L3AA 3ULUH 5D72H 5GRWA 2EYTA 3GMPB 4YFLI 1K4DB 2P48B 3OG4B 5HGAB 1OW0C 2ZG1A 3BISA 1AGDA 3EDJA 3U4EB 3MOQA 1R3IL 3QUMA 1MI5A 2YUVA 4TUKH 3GRWL 5C0RH 2EH8H 4KDVA 3C5JA 3HZVB 4Z78B 5TE4H 2IAND 5I74B 2QKIB 5EH1A 4KVCH 3C2SA 1DQTA 4MJ6A 5GSVA 3ZL4H 4MNGB 5CCKH 5ENWA 1T3FA 2DMBA 2CLZB 3O8XA 5GGRY 4K8RL 3TO4A 4LKXB 1OAXL 1G7IB 4JRWA 4C4KO 1T22A 4J7RA 2OZ4L 1H3XA 4DN4L 4ZSOE 1N2RB 4F7MB 5HD8D 2NY6C 3MLXH 1FBIL 4RNRB 5E00A 3O4LA 5D70L 3VFWB 4CDHA 2EIZA 2WWKT 5EOCJ 2DWEB 4MD4B 3K3QA 1JV5A 1WFNA 1N7ML 1IM9A 3JUYA 5I73B 2KZWA 2D7MA 5C0BB 4N5UA 4QRQA 4AT6A 2IF7A 3NACH 4FN0A 4AL8L 2HKFH 5AG9A 1NEZA 5KVGH 1A64A 5BO1L 5E2WH 4P5KB 1IJ9A 1A6VL 3UYOD 4LNRA 5CUSH 3U7YH 1KCUL 2W9DL 1NJ9A 4L4TB 3SDXA 3B5GA 5IGXL 1IE5A 4DK3A 1L6ZA 1S7UB 5I17B 5FB8A 3MV7A 1RPQA 4XNXH 1MHPL 1JI2A 4KQ3L 4MYWB 3L95A 2D4DA 5HYQA 5I9QC 1TZGH 1JWMB 3ZTJG 2H26B 3VGEA 3QDME 2NY5C 1A7PH 2B4CH 2UVFA 3MRRB 3BJLA 5F7EL 4MQSB 3K0WA 1L0XA 1H8OA 3QDMD 3EYFA 1G1YA 2R2BB 2IQ9H 4C55A 3STZB 1KNOA 4ZQKA 1FO0A 1OGAA 1RZGA 3NIFF 4FQXA 2C7UA 3QRGH 4WCYL 1MRDL 4M1DH 1SEQL 4HKJA 1RVFL 3GSVB 4GXUN 5FUZH 3MV9B 1I7TB 2R8SH 2AJUH 4HIEB 3WBDA 4IMKC 5DQJA 2YPLB 3GMPA 1UEMA 1K4DA 5HGAA 3CXDH 3U30B 5IT2L 4F9PC 3U4EA 2IAMD 1I3GH 5K59F 4MJIB 4NKMB 1QFUH 2FEDD 3ULVC 4AH2B 5INCB 4GQPH 3HZVA 4M6OL 4Q9BA 4XPBL 3H0TB 3I9GL 3MLUL 1YYLH 3PP4H 4GKNB 4UNTA 2CDGB 2QKIA 2ZUXA 4X6CB 1FPTL 4MNGA 3DXAB 5E8DL 3ZKXB 1T04B 1JIBA 2CLZA 5I1LB 5F88B 1Q9WB 4LKXA 1G7IA 5GS2H 4KTDL 1MREL 4PRPB 1N2RA 4F9LA 4EQ3A 5C1MB 4O5LL 4X98B 3B9KC 3DMMC 4RNRA 1J1XL 3VFWA 1G7MA 3GSRB 4Y19B 3FO0H 2VJXA 4ELMF 3C9NA 2JB5H 3O3UN 5D8JH 2DWEA 4MD4A 3K80A 3GK8H 5HHMB 4Z7QE 5J6GB 3DUSB 3HE6D 3LEYH 4HK0B 4PJ7F 5C0FA 5C0BA 5IMLB 3AB0B 4L3EE 1T2QH 4UOW0 5ALBH 4P5KA 2P5WD 4BSWB 1EBPA 1JNNH 2VDPH 3SE4A 4K2UH 3V52L 1GXEA 5JA9A 4UILL 2DKUA 4D9QE 4EDXB 1V7NL 4OGYL 4QYOA 1EHLH 4EIGB 2I9LB 2GTZB 3V7AG 2NXYD 5E6YA 2PW1B 1S7UA 4LCYB 4D9QD 3F65A 5I17A 3HZKA 1MCCA 3GSNH 1KLGA 2DRUA 1JWMA 5EWIH 4DGVL 2H26A 1OAZL 1S9VA 4Z95H 3MRRA 3GI8L 5KAQG 1DBKL 4YBHA 1SJHB 2XZZA 3PWPE 2R2BA 3STZA 5HBBA 4QWWD 3EUUA 5AAWA 2BHUA 4PRIB 3S3PA 4J3WA 1MAKA 1V8HA 3PWPD 1U2CA 5CGTA 4AG4H 3UPCA 3CU1A 1EIBA 3GSVA 4P9MH 1NCDL 4O02H 4PV9B 3E0GA 1I7TA 2JJTA 1E27B 4J3SA 5DRWB 3ESUF 4EBQL 3DV4B 4LPVA 3FJTA 3MLZH 4NQDB 3BP4B 4GBXD 3RWEA 1XGPB 5B38B 4MJIA 4NKMA 4KC3B 2F74A 4HFUL 2YEZB 5IMKB 1A6AB 4JZOB 4I0PC 3UTQB 5K9QI 5DO2C 4AH2A 5INCA 5CGMA 3GKZA 4HDIB 4FQQB 3IKCA 1CIDA 4GKNA 4X6CA 2CDGA 2CUMA 4ONHB 3TJEL 1YQVH 3DXAA 4R26L 1T04A 5DD5H 1JPFB 5I1LA 2L4OA 3G9AB 5F88A 3CC5B 4Q6IB 1Q9WA 4NN7C 5GSRB 2KPNA 3MRFB 3WHE1 1LO4L 4M7LL 4AEHH 4PRPA 4HUKB 3KPQA 1KPUB 3MYZA 5ICYB 4Y19A 3GSRA 3NPSB 3RVVC 5A2JH 2OMNA 5FK9B 5HY9A 1UENA 1GAFH 4ZPVB 4LP4A 3X13A 3ZDZE 4Z7WF 4TTDC 2WLZA 4OF7A 3BE1H 3T09A 5J6GA 4NQCB 3DUSA 5CSBA 2B7DT 1OP5K 2CR6A 4C59B 2EYRA 2YZ8A 1BQLL 3D85A 4PS4L 5H8DA 4YBLC 1WAAE 3RJDA 5IMLA 2QQLL 1QSFB 1UH3A 2QQQA 2AJVL 1K85A 4BSWA 5CZKA 5HGHB 5F9WB 4NNYB 4PJ7B 2HJKA 2XN9E 5AEAA 4LARL 4JLRB 5K9JL 4YPJA 4GRLB 1NFDA 9CGTA 4NQXA 2GTZA 2YD8A 4NHCH 1UCBH 3JVGA 2PW1A 1EFQA 1Z9SA 3V6ZB 1MY7A 4CDGC 3WFBL 4JKWA 4LQFL 2PTUA 4N8PA 5IVZB 1L7TH 4FG6D 3VFRB 5T1DH 2FATH 3ZSTA 3QG6B 4PRHB 4H1LG 2R4RH 2J6EH 2GY7B 1XF5B 3TVMB 1RUQH 1I8LA 4YZFE 1NBVH 4PRIA 2ZUQC 2EC8A 1WJ3A 4IRJC 2C1PA 1S3KH 2PYFB 1LO3H 5ALCL 3SJVB 3ARBB 1DSFL 1WCQA 4G6AD 2X9YA 3I3BA 3QAZB 4H0HB 4NGHH 1KIUA 5SWSE 3FMGL 4XNUH 3VGFA 3WUWG 5GS0L 4PV9A 3KS0H 5JXEC 4GG8B 1E27A 1NLDH 4JVWA 4UNUA 1TETH 4S0SD 1E4XI 4DK6A 3MUHL 4HW6A 5SWSD 3EOTL 5HI3C 4Y5XC 1S7RB 3DV4A 3MBEB 2VTFA 4CVZB 5JR1H 4NQDA 4I77L 3BP4A 4PTUB 1SBSL 3O2DL 2I60L 5IW3A 4XVTH 2XG4A 4PJHE 2YEZA 1KFAH 1A6AA 5IMKA 3UTQA 2EC9T 3DRTB 4TRPH 3VDCA 4HDIA 3UROR 4FQQA 2J8UB 5GRZA 2YC1A 4ONHA 1GGBL 3DJ9A 1U9KA 3GBML 5BW7A 1QNZH 3GNMH 4TSBH 4WU7B 4YNYB 3SGJC 3CC5A 4PTTB 1CGSH 3MRFA 3SCMB 3TIDB 1MJJA 2VLJA 1NGWA 5CEZE 2DTML 4S1RH 5E03A 4XZUA 1RUAH 3O6LL 1KPUA 3HI6H 4OB5L 2AK4B 5ICYA 3PWJB 1EEZB 2ZSWB 2MJWA 3ARDC 4Y2OA 1HKFA 2NY1D 3RVUD 1FLTX 3C87A 2BNUB 2DQJH 4GW5B 3RWDB 5GGQL 5GRYA 3BGFC 5DJYB 4DFHA 3NH7L 3B3IA 4WDIB 3GM0A 1NLBH 2A0LD 4Z7WB 4M1GL 1DBAH 5BRZE 1QSFA 3BPCB 4TUOB 4L8SA 1KCSL 1CQKA 5HI5D 2IWGA 1RJLB 3CVHH 1L7IL 5HGHA 4DQOH 3PGFH 4ZTOH 2NNAB 4NNYA 1G6RH 3RNQB 1EEUA 1GRWA 4JLRA 3QEHB 4GRLA 3RP1A 2OR9L 1GOHA 3QQ4B 4X9IA 2AJ3B 4UIMB 3V6ZA 1ORSB 1ZXQA 4HC1A 2OMBA 3U9PL 1TZHB 5IVZA 3L5IA 4PRHA 2VWEC 4F7TB 2FH8A 1XF5A 2GAZB 4PRBB 2M8XA 5BMFL 3VGAC 4JM2C 3CX5K 1HINL 1AXTL 4LHUG 4XNYH 5EOTB 2PYFA 4WJ5B 3LQAL 3ARBA 1RURH 5E08L 3IDYC 3BYYA 5DYOB 1ED3B 3IXTA 4GG8A 4UIKH 4L5FL 5IHBA 1K2DB 1RV6X 3TM6A 1S7RA 4IRSC 3MBEA 4NO0D 4M8QB 4CVZA 2DMKA 1WTLA 2WUBH 1C5CH 1LEKB 3DRTA 4LRNH 1LEGB 2A1WL 3ULUF 3LV3B 3AROA 5DWUL 1U3JA 2BX5A 4R4FL 3MNZB 5C0EB 2J8UA 4HWEH 3IFNH 1Q1JH 2XT1B 3OBAA 1DEEB 1MJUH 2D2OA 1MQ8A 4GFTB 4LU5L 4WU7A 4YNYA 5L9DL 4LF3B 1BEYH 1NMCB 2CJUL 3BKJH 3G6AA 5EO0A 2HT3C 4R4NC 3TIDA 2IH3B 1QSVA 3MRMB 5DRXB 4P5TD 5EORH 2E6JA 2G2RA 1DL7L 4H20H 1NBZB 4LSQL 5F6IB 3ALXA 5K33A 2AK4A 3PWJA 2E9JA 4XP1L 3DYOA 1EEZA 3MXVH 4W4OA 2ZSWA 3BGMB 3FOMB 3P0GB 1JNHB 4GW5A 4WGWB 4P2RE 5DZLA 3RWDA 3EDFA 3F5WB 4OD1H 1HQRB 5DJYA 2CKNA 1J0KA 4CU6A 1QRNA 1N59A 1T7VA 3LCYA 4LQ1A 4WDIA 2VDMH 4PLNC 5BS0B 3WS3B 3BPCA 3CH1B 5IB1A 4TUOA 1MCOH 2GEEA 1RJLA 2BNRB 3FONA 1MCLA 1W0YT 3RNQA 4X6DB 5I15H 1JGEB 1BOGB 5GPRA 1A6PA 3WFDL 3X3GH 2IBBA 4PJXF 1I7UB 4AK1A 3QQ4A 3DI2B 1AFVH 1DBMH 2AJ3A 4UTBL 1OY3B 4UIMA 4FNLL 1AIFA 1WEJL 3BN9C 1ORSA 1A0QL 3GMOB 4PJBB 3KGRA 1Q0XH 3RBSA 4LHJB 5DEZA 2E9IA 4J6RH 2GAZA 4PRBA 4YHKH 2EXYC 5JIPA 1EEYB 4D0DA 5EOTA 4WJ5A 3DLQR 3U36B 1IRAY 5DI8B 4X6BB 4RRPA 3F12B 5D1XB 2V17L 4KJPC 2XQBL 3P30H 5DYOA 5DMKB 1MUJB 1UZ6F 2MQ0A 1ED3A 1G7PA 4NNXB 4RBPK 3U79A 4YXKL 1K2DA 4LLQB 3O2VH 4AEEA 5ITBL 4EI5B 4OFVA 1YEIH 4WUUB 5FYLE 1HK6A 3OXSB 3VFTB 4M8QA 5BVPH 2GKIA 3P4LA 3VH8G 5DUPL 4ODTH 1X5GA 5EOCH 4JO4H 2EDFA 5FYLD 3LV3A 5E8EB 4JQXC 3MNZA 5C0EA 1M1SA 4YDKL 3F7YB 1DEEA 1KCRH 4AQ1B 5I1AB 5HYSB 1CLZH 4HH9B 3N0PB 3KXFB 1SMOA 2ICEB 3KJ6H 2VXSL 1DDHB 3T2NH 2PETA 4LLMB 5A1AA 2IH3A 3EJYD 3EO9H 3MRMA 4LSTH 5DRXA 4CN1A 4CUCA 3JWDC 3P2TA 4PLKD 1HIML 1B6UA 1E4XH 1ZVHA 3U0PB 3UZEA 5CZXC 1KEGL 1RMFH 4LVEA 3TLRA 2O5XL 3BGMA 3FOMA 2X4OB 3GRWA 3MV11 3RDTB 5TQ2H 4OGXL 2OTUA 3F5WA 3EJZC 3KYOB 2APBA 4JRYE 1J8HE 3L6FA 4ORGB 4PJGE 4GSDH 2DIAA 4MNHB 1CK0L 4DUXA 3WFHB 2HJLB 2QJDA 1ULVA 4JFZL 4UV7L 3REWB 2HRLA 3WS3A 5BS0A 3CH1A 4JRYD 4LBEB 5SX4I 3CXHJ 1J8HD 3EDDA 3GSUB 3F6LA 2BNRA 3D6GA 1I8MB 1XFPA 4X6DA 1JGEA 1TDQA 4IOSD 4HMCA 4UOJA 5E2TH 3R0MA 5LJYH 5E56A 1MJ7H 1J0HA 2FBJH 5F93C 5JQ6H 4G6KH 4OCMC 1I7UA 3IJHB 2O26U 4NWTL 4OJFL 3QDGE 4NN5B 4AENB 5KVDH 4Y4KD 1TJIL 5C92A 4KK5D 1H3PH 3EYSL 4DAGH 3GMOA 4JHAH 4PJBA 2BY1A 2F54B 4LLWB 1D9KD 2YRLA 1T89A 2Z93A 3NZHL 2JLLA 1NDGB 5T3ZE 1A6ZB 1EEYA 3TZVD 3MLRH 4NUGL 4MAYD 1AC0A 3U36A 3IAQA 5DDHB 3W5MA 4X6BA 3F12A 3BRFA 5D1XA 4U1HB 2MCPL 5DMKA 1MUJA 3MCKB 4Q0XL 4NNXA 2WP3O 4ZXBC 1DR9A 4LLQA 2FJFB 2WMPA 3NTCL 4XNQB 4EI5A 4WUUA 5DFWH 2DMCA 3VFTA 1BPVA 5D7JB 4WW2A 1NGZB 1QLRB 3S36H 2KKQA 3IF1B 5E8EA 1ZHKA 3TT3H 5TE6H 3F7YA 1G7HA 1YNTB 3P9LB 5I1AA 1EGJA 5HYSA 1ZHNB 4OZHB 3WD5L 2HH0H 4HH9A 5T3XE 3KXFA 4JG0H 2ICEA 1X5IA 1DDHA 3QCTL 5CJ5A 1OT1A 1XGYL 5T3XD 5D2NB 5IVXA 1PQZB 1QSZA 4P4KD 1IC5L 1N3NB 6FABL 1BVLB 4XGZB 3U0PA 3TNMB 5GGVL 2X1QA 3NFNA 3GO1L 3S7GA 1GIGH 3A6BH 2XFXB 1IZJA 1J10A 4X6FB 4M93C 3QPQC 4NRYB 1NCCL 1X9QA 2IPTH 1J1PL 2X4OA 1AY1H 2B2XL 4P99A 1P1ZB 2DQCL 4X4MA 3RDTA 5F6HJ 1LP9E 5J1TC 2H2PD 3KYOA 3WNMA 1UWXK 4YFLF 4MNHA 4NRZB 4K3DL 3WFHA 2HJLA 4XX1E 5C08B 3REWA 4J3TA 2ZKHL 5EIVA 4Y4HD 4LBEA 1NCNA 1JMXA 3BT2H 4WEMB 3RKDC 3KYNB 1I8MA 3T4YB 5TF1L 4PG2A 3IS0X 1HOCB 2X4NA 2R56L 3LAFA 4OZ4B 3FCTB 3IJHA 4U6TA 4AENA 2VDKH 3QCUL 1PGRB 1H3VA 4LIQH 4KRPD 2ZOKA 3WKNA 3PXHA 4N0CC 3D25B 4OFIA 2M26A 5GRUH 3GHBL 4NC0B 2FX7L 4M1CD 3TWCL 2GJ6E 1NDGA 4ONGH 5DVMA 5LXGL 1MCNA 1A6ZA 1MLBB 4JO3H 5EUOE 5FCUL 4ZS7L 1O7SA 2FD6L 5JLZB 1K9TA 2EKSB 4U1HA 4FQIL 3MCKA 4YGVB 4JFDD 4PR5B 3RVTD 4OD2B 3LKPA 1IGMH 5IBTH 3BI9X 1WWWX 4H25A 2FJFA 3TV3H 5JUEH 4XNQA 1YY8B 4KROB 1YN7B 5MEQA 3FFDB 5A2FA 1JBJA 3RWFA 1IGCH 3BVNA 3X12B 1NGZA 1QLRA 4XPAH 4OFYD 2OLDA 4A6YB 2A74A 2CDFB 3EAKA 4XP9L 3AREB 2XKSA 3VWKA 3GBNL 3HHRB 1YNTA 2EDYA 4HIJB 4RFOL 1YMMB 5I1GL 4IIQC 1ZHNA 4OZHA 1GOGA 5CILL 3QZWG 4N1CA 5GGSY 4B41A 4OIAA 4IDLA 4XHJC 3ZTNL 2BNQB 5EZIL 2I5YL 5EOQH 1S8DA 3SDDA 3RTQB 3VU2A 3G6DH 1PQZA 1N3NA 3VXUD 1BVLA 1IC4H 3HKFA 4XGZA 3TNMA 2W9EH 1IKNA 1NMAH 1PEWA 5DC9B 1PY4A 2DBJA 2XFXA 4Q2ZB 4X6FA 3FRPG 5EUKB 4NRYA 1KTKE 4BK4A 1IZKA 3RGVD 5KW9H 4MB5A 3ARSA 2CLVA 1P1ZA 1EUTA 2NY7H 3RKPA 3FT2B 3SE3A 4WEBL 2PO6C 2YUZA 5IROA 3WMSA 5C08A 4NN6C 2DIJA 3PWUB 4P2OA 4TQEL 5KTEL 3H9HB 5D2LE 4HBQA 3KYNA 3D2UB 3T4YA 3VDBA 4XMLH 1DLHB 3V6OE 5DRNB 3FO9B 1HOCA 4NO5B 5E99H 4N1HB 5H37H 4OZ4A 4OBSA 3FCTA 2LTQB 4I3RL 1DVFC 4MNQB 1RZJC 3U83A 4HPYL 1JPTH 1U93B 3PWLA 4GOSA 1MF2H 3D25A 4EN3C 4TTGA 5FGCE 4BFBD 1QD0A 2AP2A 4FQJL 1VFUA 3RWGB 3G5XB 3ET9F 1BD2A 4ERSH 3V95A 5FYJD 1NAMH 4OFPA 2H2SC 4U6HB 1MLBA 4Y1AE 2CH8A 3Q5OA 1FNHA 5JLZA 3V4UL 2EKSA 4UT7L 1AD0A 4YGVA 4PR5A 4OD2A 5EPMB 4YK4B 3ZKSD 1YY8A 4HT1L 1YN7A 4PBXA 3FFDA 2NY4C 1CGTA 3X12A 4BFIB 3CFEA 1MCKA 1BWWA 4XBGB 4A6YA 4PJIA 2CDFA 2ZUSA 3AREA 4XCEB 2Y06L 5T33H 4R7NB 1XMWA 3K4DA 3DRQB 4Q9RL 2V5YA 1YMMA 4MHHI 3EDEA 2JCCB 3KPPB 4JY6B 3UZVB 4PJ8B 3ZTJH 3TIEB 4MXWL 2BNQA 2MQCA 1VGEL 1JZ4A 1UM5H 4BQ9A 3RTQA 2C3HA 4P3DB 5FA3B 1DN0B 1RIHL 2WSKA 3JV6B 3U4AA 2DYPB 1D6VH 1U58A 3RY4A 4YQXH 3O2DA 3Q6GH 4Q2ZA 1TJGL 5EUKA 1QFHA 5AG8A 5D96B 4X4YB 1ACYH 3FT3B 4CMMB 4FTVB 5EU6B 3N1MC 1KTLB 3CVIL 1KELH 5GS1C 1OP3K 1J05B 4XPHH 3EO1B 2VL5B 1TXKA 3FT2A 1KN2L 1HWHB 4QTIH 2QTEA 3L3JB 4U3CA 2YUXA 4KZEH 1Z9MA 3PWUA 5GZND 3H9HA 3GHEH 4ONFL 2AXGA 5GGVY 3D2UA 3SGKC 1DLHA 5DRNA 5C0CA 3FO9A 4I18C 4K3JL 3VXRB 5T5FH 1VPOH 1FDLL 2HWZL 1RIVH 5IFAL 4MNQA 3MRNA 1VGKB 3MUGA 3DSNA 3PDOB 3N1GC 4JGMA 3OXRB 4GXVL 3O8XC 1U93A 2EDXA 3TO4C 4BA8A 3RWGA 4LOUD 4CBPA 3G5XA 3S37L 4F58H 5DMYA 4UOW1 3IS1X 2FIKB 4IRZL 3MA7B 4IMLB 4U6VL 3CDGB 3ILQC 3NGBC 4X80L 3T0ED 4H0IA 3RZWA 2AEQL 1F3DJ 2Y5EA 1I4FA 5EPMA 4YXLL 5DD1L 5CJBA 1OAQL 3SO3B 4EUPH 1UWGH 2VXQH 4TN9A 1WZ1L 1F02I 2MHAB 2XZQL 3NIDE 2OK0L 1JYNA 1J1OH 5GHWL 4BFIA 1CXEA 3OKYA 3GMNB 1A7NH 4XBGA 5D1QB 2H41A 1Z5LB 4FQLL 2DDQL 2Y36H 4XCEA 2H6PB 1QLEL 2X9WA 4R7NA 3DRQA 4FFZH 2XZCH 2PTTA 2NY5H 1VENA 4P46D 4ZDHB 2JCCA 3KPPA 4JY6A 3CDCA 4PJ8A 1GH7A 3PQYE 4LLVA 4DKDC 3OHXB 2YK1H 1X5LA 1CICC 2XA8H 5GGSB 3UEZA 3TO2A 2BERA 4P3DA 5FA3A 3PL6D 5AZ2L 5GRVK 1A7RL 3JV6A 1QZ1A 2DYPA 2HT2D 2V9TA 3LEXA 3NCFB 1DUYB 2WIIB 5ID1B 3KPLA 1TCRB 3ES6B 1FNEA 1Q8MA 2APTA 2BOBA 3IFLL 1CZ8H 1P7QD 3FT3A 4RMQA 4CMMA 4X5WB 5EU6A 3INUH 2PYEB 1KTLA 5AWNH 1KV3A 1EO7A 1WBYB 1NGYB 4XT1C 1J05A 5KJRL 2VL5A 1PLGH 2PXYB 4WFFE 3L3JA 1Y18B 4OCLC 4PLJD 4RAHA 2IEPA 4BQBA 1QSEE 3ULVH 1JTOA 2VDRL 5FO9B 3MX0A 4NNPL 1FIGH 4X7SL 3VXRA 3BXNB 4MA8L 2VLRD 3ECBA 5I1HH 1VGKA 5I74C 2P7TB 1UJ3B 3MRPB 1EFXB 1N0XL 3OXRA 4ZNEE 4PV8B 5EA0H 3NBNA 2Q20A 1I9RH 1X44A 1MNUH 2YPVH 1A14H 5EU7C 4URTB 2VDLL 5TH2B 4N9OB 2Z31D 1ONQB 3QPXL 3RUGF 1FG9C 1LWRA 4JN2A 3MUZ1 1AKJB 2FIKA 4YDIL 3MA7A 4IMLA 3CDGA 3MRHB 1NAKL 3QHFH 1RUPL 3ARZA 4HUXB 1FV1A 2VAAB 1U3ZA 4N0UB 3RIAF 4R7DB 1H0DB 4PJFE 4XI5D 1UT9A 1YY9C 2G5BA 3OJ2C 3QJFB 2A9NL 5HDBF 1NEZG 2CMRH 5I73C 4QXUH 1W72B 1IGIH 4U1JB 1JYXA 2G60H 2OL3H 1G0XA 5I75C 4HS8L 2MHAA 4QO1A 2G75B 3QFJE 3WNKA 3I50H 4M6MH 4G6JH 4FFYH 2CKBL 3ULUL 2B0SH 5F7WC 2W59A 3O3AB 5D72L 3OB0K 3UTZB 5D1QA 5DFVD 3SE4C 1XR9B 1Z5LA 3OKNB 1ZKAA 2H6PA 3ROOA 3HRPA 4Y4FD 5DGQA 1A21A 3QEUA 3PHQB 2KH2B 4BFEA 2D9QB 1RZKL 3ARFC 1BJ1J 5C0RL 2EH8L 1AO7E 2BC4B 3EYUH 4K07A 3LB6D 5TE4L 2PR4H 2OP4L 3OHXA 4KVCL 4V2CB 4H1LH 5GGSA 5CCKL 4GRMB 2VLME 3OKKB 2EDDA 3F7VB 2WIIA 1ZLWH 1TCRA 3ES6A 1RHHB 3MYJB 1MSPA 3MLXL 1S9WB 4JQIH 1T5WA 2PYEA 4PP2B 5DK2B 1E28A 1Z0NA 3BQUB 3DX8B 4QRPB 1NGYA 1AGFB 2BY3A 4FFVD 3MLSH 3E8UH 5B4MC 3P77B 1ITCA 3BFOA 3VWJC 3BEVB 32C2B 3MBXH 1Y18A 4LRIA 4LCCB 3KPOB 3W39B 3CD4A 3U30C 5GRJL 4PP1D 5FO9A 1GPOH 1D6EA 1OSZB 1U3HD 3NACL 4WO4D 5CKGA 2HKFL 5KVGL 3BXNA 3GSQB 5IESH 5CUSL 1HI6B 4MA7H 3U7YL 4KK6C 2P7TA 4JRXB 2P5EB 1H9VA 1EFXA 1MAJA 4CU8A 4PV8A 3ZKXC 1A2YB 1MWAH 2EDWA 3GB7B 4WENB 2QSQA 1KYOJ 1IBGH 1ZLUK 1S5IH 4XNXL 1ONQA 2WUCH 3CJJA 5ACMA 1CXFA 1A7PL 2R0LH 4AZ8A 1AKJA 2NW3B 2VO5A 1SJXA 2X4SB 4HUXA 1ADQL 5EFIA 2VAAA 2IQ9L 4N0UA 5ESAB 3V0VA 4R7DA 1H0DA 2OR7A 4H26B 3K81A 3QRGL 3QJFA 1FCGA 4GUPB 4U1JA 4HJ0C 4M1DL 3T0AA 1ROWA 5FUZL 2G75A 4GG6F 3P4MB 2R8SL 2AJUL 3O3AA 3UDWC 1BAFL 3UTZA 4KUCD 4KGJA 2MWCA 4PGEB 1A3LH 1V05A 3OKNA 3CXDL 3W81A 3TJHC 5EO9A 2NZIA 1I3GL 1QFUL 3SDYH 3PHQA 4BSVB 1MCFA 1UC6A 1GGYA 4JKPH 5DLMH 5I0ZA 1KCLA 5IQ9B 2C4XA 2DJUA 4ZSOB 4Z7QF 3PP4L 1YYLL 1T1ZB 4BZ2H 5I71B 4GRMA 3VD3A 5GJSH 1MVUB 3OKKA 5ABDE 2VIRB 1RUMH 1VB9A 3F7VA 1MI5E 1AXSB 1C8PA 2VR5A 1RHHA 4HLZH 1T1YA 3MYJA 2WQ8A 5DUMH 4ODXB 1S9WA 3V5KB 1XGQB 1YYMH 5E4IA 4PP2A 5DK2A 3EYVB 2IFFH 3BQUA 3FO0L 4RMSA 3DX8A 4QRPA 1AGFA 1EERB 1FVDB 2EEAA 4XPTH 2JB5L 2ORBH 5D8JL 1RFDH 5IB5B 5D7IA 3AY4A 32C2A 3GK8L 1CIUA 4LCCA 5J9PB 2HTKC 3KPOA 3W39A 2GUOB 2A38A 2DM3A 5T3ZH 3V79C 3LEYL 5BVJA 3ZYJA 2P8MB 1UB6A 4RA3A 3ARGD 3W11D 4KJWD 4WWKD 4CW1B 2ATKA 5ALBL 3GSQA 2X6MA 1JNNL 2VDPL 2VDNH 5FYJU 1XCTB 4LCWD 1NBYA 4OUOA 3QDMB 2A83A 4JRXA 2P5EA 1A2YA 4Q6IC 3GB7A 4XCNB 2F5AH 2VLKD 3GSNL 3GIVB 1KBGH 1DANT 1PKQA 5EWIL 1VEMA 2B5IB 2RCSL 2K7PA 4Z95L 1JYWA 3KLDA 2W9LA 2LE9A 5DHXB 3NPSC 2NW3A 4KH2A 1X6LA 4D9RE 2X4SA 3SDXE 1X5ZA 4HWUA 4GXUM 3MSPA 1T4KB 3O11B 2IAMB 5ESAA 5CJ8A 1Y6KR 3MV7E 4RWHA 4D9RD 1EHXA 2HRPH 4YE4L 4H26A 1NUNB 3MJ7B 2X09A 4AG4L 4R2GC 4GUPA 4U1SB 2WQRA 3MUY1 3VFUB 5ICXB 4N0YL 2IANA 4LPXA 3V0WH 5J1SC 3P4MA 2D0FA 1NL0H 1EXUB 5F9WC 1IC1A 1E6JL 1JI1A 2YS4A 3MLZL 1OLZA 3BWUC 3D87B 5L88H 2RAMA 4BSVA 2EDOA 4UBDC 5CMAB 1VFAB 3ZDZF 4ZS6D 4RMUA 4RGMC 4KHXH 3VFNA 1CD1B 2ADIB 1YQVL 2DKSA 2BCKA 2W91A 3HRZA 1MVUA 4NRXB 5DD5L 3TVMC 2VIRA 4PRAA 3HE6B 1H5BC 2GJJA 3LZFH 3LMJH 4UMGA 1KB5H 2VR9A 1AXSA 5E8OB 4AEHL 4MJ2A 4KKCC 3T0XA 1YNLH 4JN1H 4ODXA 5F7LB 5KOVC 3TN0B 3V5KA 1XGQA 3Q1SL 4M8VA 3QAZC 2P5WB 3M17B 3EYVA 4MNGE 2HKHH 5I8OH 4L3EB 2YOCA 1FVDA 1GAFL 3L3KB 1RU9L 1YPZE 2R1YA 3MLPA 4FA8A 3BE1L 5J9PA 3MBEC 4HBCH 2NXYB 2EO1A 3E2HB 2WP3T 4YLQT 2AXJA 3TYGH 1G0DA 1A1NB 1R24B 1LO5B 2X1WL 1IGTB 4CW1A 3F58H 4U1KB 2DQIH 3P4NB 1QPPA 1XCTA 5DD3H 3QDMA 3R1GH 3PV6B 4M03A 4N1EA 1ZEAH 2D31B 4P2QE 4PJEB 3PWPB 4NHCL 4XCNA 5K93A 5CJXA 3VG0H 3SCMC 1HKLH 4X0KB 2H3NB 3WIIH 4P2QD 2DLTA 2EDBA 2CSPA 3R0NA 5BOPA 1L7TL 5T1DL 2FATL 4NJAH 1BQUA 3WDJA 5E24E 2J6EL 2V5TA 1RUQL 1EK3A 4NM8H 1T4KA 4PJHF 2YUWA 3HZMB 1UCTA 3O11A 2IAMA 4GBXB 1OWRM 1NBVL 3DO3A 2FEEI 4UT6H 3MJ7A 1S3KL 1LO3L 1YEHH 1JK8B 4U1SA 5DK0B 1TQBB 4NGHL 4XNUL 3VFUA 5ICXA 1L6XA 4PREA 3G9VA 3ULVD 1JZ7A 1F4YH 5JNYB 2OTPA 1TETL 4X5XB 5FCSH 2FB4H 4XBPB 5KS9B 5D71L 4XB8A 5HVGB 5JR1L 3QQNA 3WL9B 4XVTL 1KFAL 1JHTA 3QISA 5C2BL 1H8SA 3GMLB 2R39A 1VFAA 3UJTH 5JIKA 4DOHB 1TNMA 4HHAA 1TQCC 1WC7A 2VQUA 4LVHB 1F97A 3C2AH 2ADIA 3B9KD 3DMMD 1QNZL 5D7KE 3CPLB 5E1HB 3GNML 4QHKI 4NRXA 4TSBL 3HE6A 1FGVH 1LO2H 1CGSL 5E8OA 2DICA 4S1RL 1FYHB 4QF1A 5KAQF 3WO4C 3ZE0E 2EH7H 1IGYB 2B1HH 3FQTB 1QBMH 1RUAL 4X6CE 2P5WA 3M17A 1L9NA 2RHEA 3LN5B 4J4PC 5MEOB 1ZLUH 3L3KA 4XXCA 1UFUA 3MODH 4LL9A 2X70B 2H32B 3O9WC 3AM8A 4K71C 3TESA 2K1MA 3Q5YA 1T83C 1G1CA 2AJZA 1R24A 1LO5A 1NLBL 4NQSB 1HSAB 1DBAL 1IGTA 5B39A 1BFTA 1UB5A 4HS3B 4MS8C 4Z7UA 1F3DH 4U1KA 3CVHL 5JPMA 4DQOL 4ZTOL 3P4NA 1G6RL 2LABA 3PV6A 3HS0B 1EUUA 3JWDH 4ORZC 2D31A 4U1NB 4PJEA 1NMCC 3PWPA 4FFWD 5F9OH 2XWTB 4KI5E 1AQDB 2H3NA 3LDBB 3PF2A 3OX8A 3K2UH 4D0BB 5SWSB 5BJTB 4M61B 5CP3A 1CD0A 1NFDE 5J8OA 4S11A 1A4JA 3QIWD 4WRLA 4GBXA 1I8IB 5C09D 4XNYL 1A6TB 1VCAA 2Y25A 2FCBA 3O2WH 1RURL 5DK0A 2C1OB 1VKXA 4PJHB 1WBZB 4I0PD 3OJDA 5DO2D 1S78C 5JNYA 4MCYB 4X5XA 4QRRD 4MD0B 1MHCB 4XBPA 5KS9A 1OD7A 4QXWA 2AK1H 4GS7B 1OPGH 1C5CL 3WL9A 1S7QB 2GITA 3CU7A 2VDQH 1OTTC 3PP3H 4Y8AA 2EYSB 3GMLA 5IW6B 2ED7A 1HNFA 5FECB 4HWEL 3IFNL 1Q1JL 1DQQB 4HLJA 2NY1B 5C3LD 1MJUL 4NQDE 3B83A 1T89C 4X83A 1BEYL 3BKJL 4M7ZB 2EIBA 2CKBB 4MWFB 4RRPG 4RX4D 2YA2A 5FYJL 1IGYA 2YBRB 1WAAA 3LN5A 5HHOD 2ZP0T 5MEOA 5FF6B 4JEGB 4HIIB 5BRZB 3D39E 3MXVL 3A0OA 3HNTH 4CN6A 1G9EA 3L5WB 1N64H 1NBQA 4JZJB 4EI5C 4M00A 2X70A 5DJZB 2CR3A 2H32A 3IB4A 4YHMH 2VLJE 4YJZL 4OD1L 2HG5B 3D39D 2N7BA 1Q9KB 2NCMA 1FGNL 2AXFB 3S97C 3O6KH 4NQSA 4XWOC 5E6IC 4WFHE 1HSAA 1MCOL 3GMRB 3UYRH 3QUXB 1UADC 2D7PA 4PBVC 1IAKB 4J1UB 5I15L 4H5SB 4IOIB 2BZDA 4Z8FL 5JW5A 2IC2A 3NA4A 3UZQA 4NZDA 3ULUC 4U1NA 4JQVC 2YKLL 3CFIC 1DBML 2DQTL 2XWTA 1AQDA 1JRHI 4IRJD 4ZFFB 3OR7B 3U9UB 1Q0XL 3FFCE 1JGLH 3OAUH 3LKQB 2R23B 4D0BA 5SWSA 4M61A 4NO0B 2GTWB 2APFA 3O6FD 4J6RL 3QDJD 3GSXB 3FFCD 1QVOB 3BDYH 4YHKL 3RDTC 5HI3D 1KJ2B 3CX2A 4R4BB 5ESVB 1A6TA 2M2DA 3MLVL 4LEXH 4P59H 1FLRH 2P45B 5BV7B 1WBZA 5EB9A 3DBXB 4MA1C 2VL4A 3SE8H 2O61B 4MCYA 1U8QB 3O2VL 1YEIL 3V6FB 5BVPL 2R29L 1QFWL 3S96B 4DGYH 2DI7A 4ODTL 4P5TB 5EOCL 4JO4L 5ETUB 1S7QA 1OARH 4JVPA 4NN5C 4XVSH 4DUWA 4DCQB 1MH5B 1E4JA 3S8WA 1FNAA 5FECA 1TPXC 1M4KA 1DQQA 3DVGB 1RIUH 5B22A 1KCRL 3T2QA 3GSWB 1CLZL 4PJGF 1SVCP 4QOKE 3KJ6L 3ARDD 4XC3L 3ARYA 5D6DA 3T2NL 2CKBA 3EO9L 1NKRA 3HR5A 2FBOJ 4E42A 5CP7B 3RWIB 4Z9KB 4QOKD 1N5AA 2J8UE 2HFEA 3TBVB 2YBRA 2ADJB 4WV1B 5FF6A 1RMFL 4HIIA 3L5WA 4MDIB 1FZOB 2B8OT 5J6HB 4E0RA 3OG6B 4JZJA 2B4CC 5DJZA 1HCFX 5TQ2L 2HG5A 3OPZH 1CBVH 4LGSB 1Q9KA 5HHVL 1WF5A 2AXFA 5D7JC 4GSDL 5FM4A 1JF1B 4FZ8L 3QCVL 3AMKA 1YN6A 1IAKA 5HYSG 3TBWB 4RFEB 5J1AB 4H5SA 4IOIA 5HHXH 1G9MC 1QRNE 1MJ7L 3S35L 1T5XA 1X5YA 2FBJL 2ZOLB 5JQ6L 4G5ZL 3ARRA 4G6KL 1T0NB 5LGHH 1BQSA 5DJDA 3GUTB 5KVDL 3RVWC 4FQ2H 1H3PL 5C8JB 4DAGL 4ZFFA 5D2NC 3OR7A 4JHAL 4RQQA 3U9UA 1C5DA 2MQ3A 1I9IH 2R23A 5IBLC 5FYKH 5CEXB 4DTGH 5HI4C 4NO0A 2GTWA 3CZFB 4UT9L 4I2XB 3D5OF 3GSXA 1NGXB 5FUCC 4C57C 4OM0H 1QVOA 3TPUB 1MPAH 3MLRL 4IRSD 1KJ2A 4R4BA 4OKVB 5ESVA 1ODAA 2O5ZH 5DHVH 4Z0BH 3FB7B 3BMWA 1MOEA 2HFFB 5BXFB 5IROC 4JJ5B 4X9BA 1OTUC 3DBXA 1UM6H 2CIIB 1JPGB 2CK2A 3NVQA 2O61A 1U8QA 2YMXH 1T21B 3KWWA 3V6FA 4LEOA 1RZJH 3K4AA 3TA3D 5ADOH 4P5TA 3S36L 2AJXH 1MVFA 4KJQC 4KKAC 3RI5K 1ADQA 2HT3D 4R4ND 1I1YB 3TT3L 5TE6L 5KSAC 3NABH 3DVGA 1LP9F 2NW2B 4NBYB 4U1IB 3HUJB 2MTPA 3L7EA 3GSWA 5A3ID 2HH0L 2UUDH 5ID0A 4JG0L 3MCG1 1MIMH 4PJ9C 4EI6B 1BX2A 5CP7A 3RWIA 3MV01 1JPST 4DKFL 1WWBX 4JRYB 4J8RB 5HHQA 1J8HB 5L6YH 3A6BL 3J7HA 3HC0B 4WVRA 4G8EB 4XXDB 4MDIA 1FZOA 2DTSA 3D9AH 2IPTL 1AY1L 3CDFA 3AS1A 1HSBA 2N56A 2XYCA 2EZ0C 4LDOB 3X3FH 2LAAA 3IT8D 1PVHA 4R0LC 1MCIA 3FT4B 1MRCH 1G9NC 3E1F1 5T1MA 4X6EA 3QDGB 4KTEH 4TPRH 3AREC 4F37K 3BT2L 4YHLL 3BN9D 3TBWA 1D9KB 4RFEA 5FKAB 3H9ZA 5J1AA 4AM0B 1CFNB 3BZDA 4S1QH 5HTSA 5EUOF 1W8NA 1FSKB 3WLWC 1C7TA 2Y7QB 3TZVB 2ZOLA 3ZLQC 3SKMB 1T0NA 4MAYB 3WJJA 3KPRD 3GUTA 2VDKL 1P4BH 4OSUH 3U7AA 3BMVA 4LIQL 2EXYD 5C8JA 3CFBB 3GJFH 2GY5A 4C83B 2W0KA 4X6DE 4AQOA 5GRUL 3IKKA 1D3CA 4KJPD 3KLHC 1UZ8B 3CZFA 4I2XA 5DUBB 3BWAB 4ONGL 4U4BA 4EXKA 5TJWK 4JO3L 4OKVA 1FYTD 2WWKO 4PJBE 3L3DB 3QQ9C 4W6YB 2LAGB 2ZCHH 2HFFA 5BXFA 2FJGA 4HMDA 3QUMH 4JJ5A 3CK0H 4G3YH 4YAQB 4OI7A 2X9XA 4O2CB 2CIIA 1IGML 5JUEL 3TV3L 3QXVA 1T21A 1F6FB 1OOAA 5DC0A 2AEPH 3IRPX 1JRHH 5SWZD 1U2HA 1RQ5A 1IGCL 3VMPA 2GSIB 4XPAL 4J12A 2CXGA 1JWSA 3SDCD 1ZHLB 5JPNA 4X4ZA 1I1YA 1CGYA 4YBQC 2F15A 5F9AC 1YEGH 3PHOA 1LK3H 4FQHB 5C7XH 2NW2A 3DUHA 3HUJA 3BEWA 1L9MA 2DJ4A 2ICWJ 2WV3A 5CZXD 5C0IB 2FHCA 2FSEB 2BSED 1YNKH 3CFDB 2OJZH 3BD3A 1MCEA 3ARQA 5B21A 1KSRA 2IH1B 5EOQL 4EI6A 4WW1B 4JDZA 1LP9B 5HYJE 5CIPB 5D2LF 4NKQB 5DD6B 3EJZD 1GJIA 2EE3A 1FZJB 4JFED 3MA9H 1NPUA 4JRYA 4J8RA 4JHWL 1IC4L 1J8HA 3U7WH 1NMAL 1UG9A 4DW2L 4LFHD 5HYJD 2P44B 4PY8J 3LKOB 4G8EA 5I19L 1A9EB 1Q0YH 1JNLL 1CDHA 3BIAX 5KW9L 4CVWA 4YK4C 4AMKH 1G7LB 4JHZA 3QRFM 1R5IB 2NY7L 4JPKH 2AI0L 3FT4A 5IVXE 3ULSA