4XP4H

X-ray structure of drosophila dopamine transporter in complex with cocaine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein/inhibitor
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp4H01
4BKLA 1GGTA 3EZ8A 1GHFL 3QIUA 4EKXA 3BP7B 2GT9A 4CVZA 1H9VA 6FABH 4KDTC 1JV5A 3WKML 1F3RB 4IRJD 5C0BB 3PP3K 2X41A 1I8LA 3WLWD 3UC0H 1ULVA 4JY4A 2GJ6A 3VDCA 1JI2A 2HT4C 3MROB 2AV1A 3STBA 4X6DF 1JYXA 4OCWL 4Y5YB 2H41A 2WIIA 1N8ZB 2YOCA 4TVPD 3VXPB 4PBVC 1YEEH 1W8OA 1QFWL 4I5BB 4PIRF 2IBGA 4UAOC 3UJTL 3TT3L 4K07A 2PXYC 3QA3B 3MCLH 3MRPB 1ZHLA 2LTQC 1D5MB 1YEHL 1MQKH 4PRAA 4ZQKA 4TULH 3UTQB 2VWEC 4ZO9A 5CS7A 3MV01 3H7BA 2XA3A 1QVOA 1S7QA 4JO3H 4HMCA 5T1KA 5CBEA 1F4WH 5L7XL 5E24E 2VLJD 4JM2D 5FYJH 3RKPA 3QNXA 1QSED 2ZG1A 1BJ8A 1JRHH 3WIHL 1M6OA 1V5JA 4LQFL 4XNYH 1LO0L 4HHAB 1OARL 5HHPA 2I5YH 1FRGL 2GCYA 5FM8A 2YPLE 1ZLSL 2E7BA 4OT1H 1CXFA 3TVMB 3IGAB 5I18L 2V7NB 2KH2B 4YGVA 2VKXA 3QO1B 3P0GB 1A5FL 3OKNB 2Z8VC 3EYVB 3PWVB 3G6AA 1INEL 1AQKH 3HNSL 3O6LL 4YZFE 5DA4A 32C2A 3OKOA 1G7IA 1HINH 3BN9D 1T2QH 1PDKA 4M03A 2R2HA 3DTXA 3DECA 3N85H 3X14B 5D1QC 5ESQB 3NACH 2ZSVA 4KRLB 3TH2T 2CO7B 1A7QH 4X99A 3GO1H 3LVEA 1RJYA 3HCVB 2VQUA 4LLQA 1DEEB 1QLFA 4Z7UB 3SKNB 4TYUA 2YPLB 2RCSH 3LDBC 1LO5B 4YDKL 4U3XA 5GSRB 5D7JD 4RISL 3OPZL 2APXA 5DI8A 2X70A 1LE5A 3CAFA 4BZYA 4QRTB 1NSNH 1JWSA 1T22A 4NC0B 3ZE0F 2Q6WA 1IT9H 5FOBB 1MWAA 5MEPB 4U2YA 2GIYA 4M02A 5EUOE 5EH1A 2R23A 1JPST 4HUUB 3KGRA 3ZE2F 3ESVF 4X7TB 3HI5H 1HHHA 1G7MA 1B0GA 4DN4L 3MZGB 3MRDA 5A16B 1V05A 4GBXC 3O0RL 4DKFL 3CCHB 1FL3B 2H8PA 3EUUA 1YNTA 2AJZB 4KRNA 1YEKH 3DX6A 4P5TD 1QEWB 1WVZA 3QHFL 1E0OB 4OIBA 4FQ2H 5CJBA 1WBYB 4HIXH 4NQTA 1SBSH 3BZ4A 3CGTA 5JUEL 4EZMA 2FZ3A 1KJMB 4CDGC 3SBWA 1N59B 4WJ5A 4EI5B 3OMZA 3WFCL 4NZRH 4OGZA 2ZCKL 3HC0A 5EUOB 3MYJB 2DWDA 4ZUTB 1CXKA 4WI4A 4X4XA 1F4AA 4U1NA 4P4KA 3MLXH 4X98B 4ESKA 2GSGA 2P42B 2YMXL 3OV6A 5L8LB 1HN1A 4KMTH 3OAUL 3ALPA 2HG5B 5D7KE 3BUTA 4OI8A 5E9DE 3ARZA 4ZPTA 4TPRL 2W0KA 4XCNA 5IUSA 3DYPA 4JDZB 2X4QA 4ZD3L 4N0UE 5D7SH 5EIIB 4HULB 2DQDH 2X05A 1MWAH 2B4CL 1A22B 2XN9D 1UH2A 4L3CB 4YHPA 2R1YB 2CLVB 3K3QA 4R4BB 1M4KA 1N64H 2I24N 3O9WA 1CTNA 3V6ZB 1IBGL 5KVDL 3WO4C 4LCIH 3CFDB 2DQUH 4KK9C 1BBJB 5HSFA 1I75A 1Q1JL 3P0YL 1FNSL 1YEFL 4C83B 3WL9A 2E8YA 5CBAB 3BQUB 4BUGA 5KSBA 5E9DB 1D9KA 4PGZA 3MNVB 5MP6L 4XPBL 4WWID 4N0UB 1MEXH 4C56A 3OJDA 2IEPA 4OZGB 1FIGH 4LHUG 5CMAB 1F4XL 2ZCLL 1Z3GL 3GMQA 3S6CA 5I16A 5IFHL 2AXJA 1SM3H 5H2BB 4OD1H 2WUBH 3KXFD 2E5EA 2WUCL 2LV4A 1TQCB 3L3KB 3MYZA 2CIIB 3Q5TA 5I66A 1BZ9B 5IEHA 3MGAA 4EQ3A 1YYLH 5H94A 5DMYA 4WGVB 1AE6L 3AM8C 4CNIB 2HT3C 3LEVH 3RUGF 1F3DJ 1T03L 3QEGH 1V3LA 1OVZA 1NCAL 2I9TA 1AXSB 5HGGS 3QBTB 5IQ9A 3I6KB 1RVFL 4G6MH 3STLB 4F33A 4JPIA 2EXWC 4PJHA 4LKXA 4JLRA 4UNVA 4DGVH 1HHIA 2JJUA 1G9ML 3MRGB 4U6XB 3EJZD 1ZT7B 2E3VA 2AGJH 4FTVD 3QRGH 4N8VG 2QQLL 5KVMC 3QR2A 1YDPB 1G1CA 3JTSB 5D5MA 4AQ1B 1QQDA 3S9DB 2VDPL 1JGEA 4PB9L 5LGHH 1UQSA 4G8EA 2J1KA 2DD8L 1WQVT 2F5BL 2ICWI 4PRPD 1BHGA 2BVTA 5E5UB 1J87A 4POZC 1BFVL 1QP1A 2X4SA 4NQXA 3IFPB 4Q9RH 2HT2D 2SEBA 5I1DA 1MPAL 1YEDB 3NTCL 5F7YC 1IGIH 5I1HL 1S8DB 5JW4M 5DJ0A 5F93C 3RPKA 3HI6H 3KPPA 3W9DB 4R9HA 5HGBB 2BZDA 4TNVF 3HFML 4IDLA 4ODVL 3TZVC 2R8SL 4MA3A 4PJXF 1DBBL 1GC1L 3BDYL 1BLNA 3L3OA 3DVGB 4P4KD 5I2IA 4H20H 3BD4A 5DJDA 4ZFZA 3C09B 2R0LL 1EEZA 1AIFB 1HH6A 4YDIL 1CICD 1OAXL 3THMH 4M7LH 3N0PB 3UPAA 3BZEB 5EOCL 3VGEA 2NQCA 2O5ZH 4IRJC 5C0BA 3WLWC 1RURL 3UZVB 4M6ML 5D2LF 4GG6A 4C58B 3CH1B 3SDAA 1P84J 3VRLE 1CGVA 3VD5A 3X12B 4Q6IB 1MQ8A 2FJGA 2F54D 3WJJA 1AGBA 1U8OA 2NZ9D 4OFVA 5FYJU 4CVXB 3RQ3A 2WNGA 3CFKB 3QA3A 3FB5A 1RZIB 2N1KA 1NFIB 2FJHA 3B9VA 4GT7A 4N0YL 4YK4C 4UINH 4PJDA 1J0IA 2EYRB 3MC0A 5EN2B 1IKFH 2MHAB 1B6UA 1H8NA 4WI9A 4C56D 2OYPA 1VKXA 3SGJA 4OBRA 1G9EA 3BMVA 5JW5B 4JM2C 2M1KA 1TVHB 4IIQC 3QIWB 4WHYG 3VCLA 2VZ1A 3BGFB 2J4WL 2ZUQC 1RI8A 3QXAB 4QLRA 3SN6N 4MX7B 3VD3A 4WI6A 3O45A 2W91A 3BWAB 5F9AC 1I9JL 5K59F 4OLVL 1YMHA 4IM8A 1LEGA 5DK0B 4P99A 1RUKL 1P69B 3L5WA 5KVGL 5F7EL 2MCPH 1P2CA 4LAJH 3KJ4B 2AI0H 3PHQB 3BN9C 4XNQA 4MCYA 2WWMD 2DIAA 5ESQA 5LGKA 4H26B 4OGYL 5JOEA 3LRHA 3C5SB 4K2UL 1Z9OA 2YR3A 3OAZK 2LU3A 4G42A 3MUJA 3SKNA 1UACH 1XF4A 3MRRA 2VISB 1FFPB 1AY1H 2AEWA 5F9JB 5GSRA 5D7JC 5AG8A 4OLWL 1U36A 3V4PL 3U0WL 4K7FA 5DD5L 5IF0A 4TSCH 1YN6B 5C0GB 4QXUL 3MV7B 5KOVC 2GW5A 5DZOA 1XAUA 2C4FT 2DQEL 4XPFL 5JOPD 3P0VH 4LSTH 3U0PB 4JPKL 2HJFA 1T20B 1JPTL 2IG2H 4EI6A 3OGOE 5L88H 2YD3A 3NZ8B 1JN6A 5D6DC 3F6IA 5DHVB 4JANB 5A16A 1YEGL 4M7KL 5DO2D 5FUCC 3SPVB 3ABZA 4M6NL 3VH8G 1FL3A 4K55A 3GMNB 1EUTA 5DMKB 3PP4H 2BOCB 3ZT5A 2AJZA 5I9QC 5T3ZL 3FN0L 1JZ4A 3QRFM 1NGYA 4GS7B 4EN3A 2XZQH 5C7XH 1MFAH 3VGGA 1RD6A 2E9IA 2NX5E 1F8TL 1YJDL 5DLMH 1BGXH 3GMLB 2H9GA 1YYMH 4KAQL 5FGCE 3H3PL 1HI6A 1KTKE 4LVHB 5C0BD 4K3GA 5HGHA 1JGLH 2A9MH 3EYUH 3F6LA 4I18C 5CJQH 3D2UA 2XNAB 4HMEA 4KKBD 4WENB 1A4KB 2FJFB 3NFNA 2AQ3A 2OJEB 3O6FA 4AH2A 3PV6B 1S7VA 5EOQH 1BFTA 1RY7B 5DZLA 1V3KA 1PQZB 1BBDL 4HXAL 4K9EL 4U05A 2JJVA 1U42A 3DROA 1A9BA 5D96B 3M8OL 5E70A 5SV3A 4X6CF 3HZKA 3GSNB 4PB0L 4UOW0 1UCBH 1MHHA 3IDIB 4LHUA 5JXAH 2X4PA 2NX5B 4K94L 4QRQB 5ADPH 2ERJC 3TBWA 5FGCB 4RNRA 5TE7L 2BNQE 1RK0A 5HDQH 5D9SB 3WD5L 1JGVH 2BVUA 2JB5L 5TPWL 1I9IH 2IH1A 5IT2H 3VFOA 4U1HB 1HZHH 4C83A 1IAIM 2I27N 5HDLA 4NN7C 3VJ6B 3ZTNL 2DJSA 5GRJH 5KTEH 2FWOB 4NQCA 5GRVK 3HAEG 1EHXA 2DDQL 5HYEA 1OT2A 2DLFL 4NN6C 5C86A 1YEEL 4MQ7B 1ZA6B 3RAJH 4UTAL 4RGNC 4F7PA 5MERA 2IMMA 1UXWA 2CUMA 1JWMA 1MQKL 2A9NL 4F15B 2J88L 4NOBA 3SGEH 1LEIA 1OAQH 4L4VB 5DHYB 2RFXB 4JO3L 1X4ZA 2VLKE 1H5BA 4JQXC 1FDLL 1WT5A 3A6CH 2NY1B 3Q6FB 4Z0XA 2BNUB 1UB6A 5DQJA 5KVEH 4GKOA 2HYMA 4XNYL 4YXLL 5ICYA 1OWRM 1UXSB 4MS8D 4OCYH 3G5YA 3MRGA 4QRPA 1W0VB 2I5YL 2B2XL 3EJZC 3TBYA 4HH8A 5CP7B 2ZUUA 2VL5A 4MJIA 4R7DA 1NCWH 2C1OA 2EE3A 1DN0A 5JR1H 1R5VA 3MXVH 5BZWA 1AQKL 3CK0H 5T3ZE 5JXEA 3HN3A 2F8VA 1U8QA 4YWGH 4O4YH 4WUUA 1HINL 4QHKJ 2R4RL 5ID1B 1L0XA 4X8JA 3D5OF 4KC3B 1H3TA 3QUKA 2VLKB 3VFVB 5JW4N 2P7TB 2VLRA 3N85L 2HT2C 3UAJD 3VFTB 3NACL 2OP4L 3B2VH 1RK1A 2D4FA 2HVKB 3O8XB 3PDDA 1KJ3H 4P2QB 2EDTA 2X4UA 1S8DA 5BVPH 1OTUD 4KTYA 5HI5D 1YMMA 5IVNA 2EEBA 1IGCL 1FJ1A 4NC1C 4EI5D 2DOCA 4UUJB 2ZCHH 3D9AH 3GI9H 1FVDA 1UCTA 3PDOB 2GUOB 5FA4B 5FDWB 5B38A 3CFCH 5JOFA 1IT9L 5DD6A 4P4KC 2AXGB 3BD3A 5KS9F 1B0RA 3B6SA 3D39E 3WCYA 3FFCE 1V7MH 4HUMB 1CICC 3MBEB 4HUVA 5T3XH 2L7JA 4NQVA 1IKNC 3WFEH 2ICEB 3OXRA 2E6QA 4BQ9A 1MCSA 3FFDB 3T3PE 3T2OA 1YEKL 5F7DB 2HVJB 4J1UB 3QIBA 1S7WA 3CH1A 4FZEH 4OKVB 4X7CC 5DVKA 1T1XA 3ARVA 4PJGF 5D1XA 3RL1B 3DO7B 1M7IB 1NCDL 3L3IA 4QRSB 2FSEA 2HFEA 2NZ9C 3MLWL 4XBPA 1F3JB 3IRZA 2Q3ZA 4NZTL 4ELMF 4U0RC 1NC4B 1FNGB 1LO2H 3PP3H 4TOYH 4PREB 3ZHKA 3IF1B 1B3JA 3D39B 5IBLD 3FFCB 1N5YH 4JFHD 4N0FB 1NEZB 3TA3A 4J3WA 5CWSB 5E9DD 1CQYA 4NQCD 3T8XB 5SWQB 4J3OC 5IQ7H 1N7ML 3AREA 2XWBA 1IC4L 4OGAD 3MNWA 3QXVA 1XF2B 1OB1B 3QIWA 1CBVH 1MOEA 5IJVA 3TC9A 4P48A 5HHME 2HKFL 5L2JB 5IB3A 4ALAH 3KYAA 4PP2B 1MCOL 4M9OA 5EPMA 4YHYC 3CDYA 3KWWB 5ETUA 3BWAA 3HUJB 3RY4A 3K4ZA 3T3MF 1MJ7H 2C4XA 3DURA 3PABA 5F6IB 5IFJA 4OTXH 1KXVC 5DK0A 4NQUA 5AWNH 4MNHB 4MJ5B 1J10A 4HAFA 4NN5C 2R15A 2DQFB 4LCIL 5BW7C 5FCUH 2IPKB 2N56A 1KN4L 2YC1B 3BRDA 2CDEB 4OZIA 3JWOH 2GTWB 1AJ7H 3SKJH 5DMIL 3H42L 4DOHE 1X5XA 3MLYL 2GKIA 4NO3B 5IVXB 2WWMC 2X9YA 4HGKC 3BISA 4U1SB 5T3XD 3TV3L 4RGOH 5CAYB 5TFSL 4H26A 3T0VA 3LV3A 2VDRH 4JJ5B 1BD2A 5HHMB 3HPJB 1KTLA 4MA8H 2BSED 3MRIA 1FIGL 2A77H 5DJ6A 3RU8L 3WUWB 3BIBX 4JPVH 5F9JA 3KPRB 1KELL 4OF5A 5JXED 1LO3H 3BO8A 1CFQB 1DDHB 4WUUD 1UJ3C 4C4KT 4MNGA 3L9RB 1YNLH 4U1GB 3MV7A 2VERN 3VWJB 3LEVL 1MI5A 1TETL 1K9TA 1H3VA 1ZWIB 4MAYA 2VXTL 4NM8H 4BELD 1G7LB 1IEAB 4JRYE 5DHVA 5BRZE 4NHUA 2XY1A 5DO2C 1J8HE 1U9KA 4MD4B 2R1WB 4L8SB 3H0TB 3HNVL 3SDXF 5IBTL 3FB7B 2B8OT 3K2UH 3QWQB 3VG0H 4HH9B 4P46A 3WYRA 3NPSB 2XKNB 1TCRB 4RGMB 3B9EA 4NPYA 1TITA 3MRMA 1CF8H 3UEZA 4QYOA 4LGPB 2VYRE 3FKUS 3GMLA 4FMFA 1VFAB 1G7PA 3C6SB 4X7FC 5C08E 5B8CB 3HI1B 3IDMB 1B9ZA 4KKBC 3QIBD 3C60B 4Y5YC 4EDXA 1H3WM 3FO9B 3V6FB 2FLBT 1J8HB 3PV6A 1CDUA 4HG4K 4FFZL 4B53A 3SY0B 3WJJC 1MVUB 4HCRA 2DTML 1MFBL 4X5WA 2C7UA 1CIUA 4Y89A 1AQDA 5GISH 2C3GA 4HAGA 4KI5E 3GSNA 3IDIA 4QHLB 4HUKB 3TA3D 1HILB 4XHJC 4HIJA 4ODHH 1S9WA 3SKOB 5FHBL 3ARED 5FO9A 5DHVH 1BVKB 5C08B 4U7MA 3SGJC 4HIHB 2ZOKB 5CKAA 2NY3B 4L29B 3QIWD 4U31A 1J12A 2WW8A 4KZDH 5I1AA 4R0LB 5FO8B 4JDTH 1T1WA 4QRRA 2D7TL 1EA9C 3MRJA 5C0JB 1JHKL 4M5YL 3MMEB 3WFDH 1UB5B 4YE4H 1HSAA 1XH3A 1KTDA 1FL6A 1NLBH 1XFPA 4JGUA 4JE4B 4KQ4H 3RDTB 4M5ZH 4P9MH 3DMMA 3MLSH 5ENWA 3QWRD 5BV7H 2APWA 4GMSH 2AXHA 3OX8A 1TZGH 2OMBA 1QSZA 4QOKE 1VFOA 5F1NA 1U3HB 3MOBL 1NUNB 4JKLA 4YDJA 4OIAA 5KSUA 4W81A 5IK3B 3BKMH 4HF5H 4UINL 4HUXA 3O2VL 4S2SA 3CVIH 3O81A 3ZSSA 4KTEL 2BVYA 2LAGB 4L4VA 4HLZG 4G9FA 43CAB 2A38A 4HCRH 3QDGA 1ZMYA 5E8DL 4JPWL 4YHOH 5T1DL 25C8H 2FL5B 5EU5B 3GSNH 2BNUA 1S3KH 2O5XL 4I8DA 1MAJA 3MA9L 2Q8BL 4EDWH 4MS8C 1KB5L 1W0VA 4JR9L 1DFBL 1OAZH 2Y25A 2N7AA 5J12B 1UYWL 1FIEA 3MV7D 1MFDL 4O58L 1JYVA 3ROOB 4XMLL 1MI5D 1EEQA 1U3ZA 3GB7B 3I84A 2VXVL 4GAGH 1T6VN 2AJYL 3X13B 4Z0BH 4ZFOL 3F7VA 1YEIL 4GFTB 1C5BH 5HXMA 1BEYL 5J8OA 4U7KA 1BM3L 3T4AA 2V2WA 3VRIB 2P7TA 3IJHB 4D0CB 1OQOA 4OV6F 3UAJC 2V9RA 4YX2L 1PZUB 5TDNB 1OTUC 5HI5C 3OKEB 4HS6A 5IR1B 1H3PH 3GKWH 2UVEA 3ULUH 4JFYA 4POUB 3PUCA 5E08H 1P1ZA 3RWGB 1VGEL 1FQ9C 1BAFH 4EI5C 4LCYA 1Q38A 4ERSL 3H9HA 3S37L 2F53A 1PY4A 4MA1B 4P5MA 1HHGB 3Q6GL 4AENB 2ZZUT 2W9LA 1ZT4B 4LLMB 4HPOL 3AU1B 1K3IA 5GZND 2UY7A 1QR1B 1I7UA 5HYSB 4LF3A 3QEQE 2DQTH 1Q0YL 3C5JB 1H3GA 2OQJB 4HWUA 4G6KH 3BYTA 2PYFB 1UWGH 4LSRH 5DVLA 3U1SH 1R3IL 1G0YR 4GLRH 5C7XL 4NJAL 4JN1H 1MFAL 2QQQA 3RIAF 4JG1H 3KPSE 3HC3L 3S5LB 2I60L 2E6JA 1BGXL 4FQCH 1YYML 4GKNB 5IKCB 4OQTL 5DSCB 4K3EL 5TDPB 4UNUA 4QRRD 3WBDA 3T4YA 4BSWA 1QFOA 5IBLC 4XCYA 4XX1G 4PRIA 3EYUL 4TNVK 2H2PC 5CJQL 1IE5A 5FFLA 2CKBL 1FORL 3LKPB 5SWQA 3P3YA 1FFQA 4RQQA 5GS1B 4OGAC 3QEQB 3LEXA 2MOVA 5EOQL 1U95B 1QRNB 5HYJA 5IBUG 1E4WL 1V7NL 4EOWH 4NZDA 4Z7OE 1TQCC 1BFOB 1NGWA 1TVBB 4FFYL 4NBXB 4UB0L 3KWWA 4TQEL 5GIRA 3QG7H 1UCBL 4K8RH 2A83B 1FVEB 3KPSB 5DFTA 4PYGA 5JXAL 2UWEF 2OL3B 5D2NA 3SDCB 2G75A 3MRCB 3U6RA 4J4PA 5F96L 5HHVH 2D3VA 4L4VD 4MNHA 3BGMA 4DKEH 3QXTA 2EXYD 5HDQL 1JPSH 1NMBH 1H5BC 4GAJH 1JGVL 5ID0A 2NY1D 3S36L 2WBJB 4UIKL 2XQBH 4Y16B 3BVNA 4WFGD 4GAYA 2RR3A 2QADB 3FTGA 4HWEL 4HKZB 5DFWH 3IAGC 4LMQE 1UM5L 4XP4H 3SQBA 4S1SH 5J4MA 1D5IH 4F2MB 1DL7L 3L5HA 5FF6B 3X17A 3CDCA 1MRFL 4Y1AA 4OZHA 5DTFA 4ZUVB 1IGYA 3FAXA 4O2EB 3KPRA 5CSBA 3WO3B 4WEBL 3SKUD 4Z18A 1CFQA 3RAJL 2ZUWA 2X4RA 2NNAA 2QHRL 2HFGH 1KB5B 5F7NC 4CBPA 1QHOA 4U3CA 2VLKD 2XA8L 3V4VH 5EZLB 1P6AB 1T04B 3NCBB 2ZOLB 4WW2B 2IFFH 3OAZH 4PJIF 4P2QD 3IS0X 1DQLL 4WUKH 5JO5A 3ULSB 4JFXA 1EX0A 3IDXL 4NO0B 4D2NA 1WIUA 2GAZB 4YLQT 1DVFB 3FO1B 4M61A 4YAQB 5IGXH 5A2JH 4NRXA 1G1YA 4TNWF 1KEGL 1O0VA 5LBSH 4MD4A 3WIIH 2F53D 3RVXD 5BS0A 3BKYH 5HD8C 4IOIA 5T3ZD 5C0IB 3VI3E 3GIZH 2KKQA 4K8RD 3L7FA 4TRPH 1NCWL 1N6QL 4OLXL 1TCRA 3C09C 2OLDA 3FONA 4S11A 3O6KL 3BHBA 4RFEB 4OIIL 1LP9F 3EOAA 1RULL 4JFQB 4ZS7L 4PTUB 2BVPA 2DL9A 4LNRB 4D9RE 3G6JA 4QCIB 3HI1A 4HFUH 3JWOC 3O11A 4Z76B 1I9EA 1W72L 2GY7B 3QIBC 4X6BB 3NPZB 1NBQA 4Q6IC 1AKJA 5CIPB 3GDBA 4Z77B 5BVPL 1BQHB 1QR4A 4MD0B 3T65A 3VD4A 5A1AA 2XFXA 4X83A 4TUKH 3D3VE 4I0PB 4Y4FB 2ZCHL 1MRCL 4NQDE 2QQKH 1S7UB 3RHWF 1T5WA 4P2RA 3G9AB 3FFCD 1NAKH 4CGTA 2YSSB 1Z0MA 4PRID 2Y5TA 4ETQA 3TA3C 1CLYL 2X42A 3GEWB 1DBKL 4WTZG 15C8L 1BVKA 1MCEA 5KSAA 3GSRA 4L29A 3QIWC 2ARJB 4OGXH 2LAAA 3BGFC 5FUOH 1CLZH 2XG4A 4LFHG 2PKDA 3RWEB 5KVFL 4TUOB 3ZHDA 4X4ZA 4NJ9H 4J4PD 4FZEL 5FGRA 3RUGE 3D3VB 4DKDC 1BWWA 2XY2A 3K8MA 4NQDB 1NGXA 4FOMA 3JV6A 4XC1H 3SCMA 4RZCA 1A1OA 1G7JA 3AY4C 3QG6B 1L6ZA 4JHAH 2A6JB 5I8OL 3V6OE 3TNMA 4IBLT 4ZS6D 4TOYL 2H45A 3B8YA 4LVEA 3SJVA 4P49A 3IB4A 3RX8A 4XT1C 5HHMD 1C1EH 3L3DB 3QFDB 3T0EA 1U8KB 3OB0K 2BSRB 5J89A 4XCEA 4LSUL 1DP0A 3KPRD 4JZOB 5A2FA 5ICZB 3WNLA 5ISZA 4ALAL 3KHQA 3RUGB 2AJXH 4PLJD 1I7TB 3BESR 5DRXA 3PV7A 1G9MC 4RWHA 2Z9TA 1QD0A 3V79C 2WANA 3CSGA 1X5ZA 2CR3A 3ROOA 4K3JH 3ZZ1A 2FEDD 5IMOB 3EGSB 4HLZH 1NUFA 2V5MA 3SDDB 1FPTH 3I02B 3O4LA 2HWZL 3GMPB 4J3XA 2ITDA 4IHOA 1AJ7L 4EIZC 3GM8A 4LVNB 5DJXA 1EO8H 2R1XA 3OHXB 5DT1H 5FV2A 1BJMA 4F8QA 4BZ2L 3C8HA 2J8UA 4FABL 4MA8L 2OJZH 1AGFB 3V52H 1C5CH 2A77L 1MRDH 3H9SA 5EC1B 3PWLA 4R26L 1HNFA 4KROB 4OLYL 4LVHC 1T4KA 1I1YB 1S7SB 3O3BA 4NKIH 5F7MC 5C3TA 1GC1C 1AD9B 1EVUA 2VH5L 5T1LB 4G6AD 1BP3B 3SQOL 5I1EL 1T21A 3C60D 1KIPA 3LAFA 5AUMA 3GSUB 4AENA 4UDTA 1AKJD 4U1JB 5EBWB 4ZFGH 1SYVB 4X5XA 1JZ5A 5GZNC 4MQTB 1NKRA 2UVFA 3LRSA 1S7TB 2WWKO 3CPLA 4ZXBB 1AFVL 4G7YL 4QY8A 3QI9B 4P59L 4QRPE 4D9QE 4J2XA 1W72B 4ZO6A 3K2UL 1A0QH 4LCWE 2NCMA 4N8VB 1TIUA 5C08D 2ZPKH 3ARUA 4NFCA 1LK2A 4KY1H 3S5LA 4OF8A 2NY3D 1OD7A 1ACYL 5AYQA 3G5VA 4X6DA 3EO0B 3W9EA 3F7YB 2EDWA 2R4SL 1FFNB 1G6VK 3MODL 2YUWA 4DEPC 5F1IB 3V5KB 1ORSB 5K59E 2WINA 4G3YL 4GRWH 5B39B 1XF3B 1CQKA 3V8CA 4D0DA 4XP1H 4C59B 1UM4H 3RWCA 4X6EA 1GGCH 4M93B 1U95A 4WEMB 1YMME 3RFZC 4PRHA 2FX9H 1FZKA 1R3LA 1BOGA 3MBXL 1BREA 4LCWB 4LPTA 3T0AA 3KYOB 1JNHA 1KV3A 1SHMA 2W9EL 3CVHA 3OZ9L 4F15C 1A3QA 4F7TB 3QSKB 3ZDYF 3B9KB 4DQOH 3SDCA 2YD5A 5GHWL 4G8GA 3P9MA 3V7AE 1RZ7H 4ZSOA 5CLTA 1SJVA 4NUGL 3SGKC 4CW1A 1I8MA 3FQXA 1WZ1L 2EXYC 2YBRA 2A74B 3QULA 5C0CE 2NY1C 3QJHA 4Y16A 4LARH 2FDBP 1QSVA 1OP9A 4MXVF 1WWBX 2I9LA 4JDTL 5DRZB 5ILTH 5DD0H 4I3SH 4KVNH 1LE9B 4OJFH 2KDGA 1FL5B 1OTSD 4PGEA 4KQ4L 2CLZB 3OAYK 1QPPA 2JELL 3D18B 4KI1A 1C16A 1NLDL 1AGDA 2VOTA 1MFNA 4F3FB 1CWVA 1TJIH 2YPKB 1F00I 3Q3GA 1CT8B 4JM4H 3U4EB 5KG9B 3G9VA 1NCBL 1IQWH 4LCCA 3TCLA 4OBSA 3ZKNC 5C0CB 1RU9H 3BT2H 2AEPH 3BPOB 3SE4A 1A21A 1XGTB 4DUVA 4U6VH 5SX4H 3H9SD 3FO1A 1PKQE 5AD0A 1FZMA 4GSDL 4CN6A 3CVHH 5EU4B 1LILA 4EDWL 4U1LB 4FP8L 5IW3A 3GGWB 3RVXC 1OAZL 2QR0B 2DIBA 3CDGA 3P73A 2Q20A 4K8RC 1WGOA 5GRWA 2CUIA 4GG8B 4LK4A 2Y6SD 4RFEA 1YJDC 4GMTH 5C07E 3WLBA 1P7KA 5F7HA 3JV0A 3P9LB 1IQDA 5HHOB 1CI5A 3PL6A 1U8PB 4RRPA 1A6AA 1D5ZA 1J0ZA 4WY7H 4Z76A 1U6AL 1PKQB 4X6BA 1AR1D 4FQJL 5CIPA 4Z77A 1A7NH 2ZUSA 4QXTB 1N0LA 5HYIA 3GSQB 3WS6A 4PJ9A 4WDIB 4UV7L 3EJYD 4K9EC 4Y4FA 1EGJL 4KUCF 4Q6YA 1LNUA 4LBEA 1H0DB 3TO2B 2EDKA 5ACZB 4ONFH 1RSFA 5DF0A 1B2WL 4PGCB 5DMGC 4P3CL 4LHJB 1S9VB 4N0CD 4G8FA 4NO5A 4L9LB 2PTVA 2F5AL 5FK9B 3MLZH 5DHXB 2V2TA 3HS0B 5KAQG 3TWCL 2EEAA 1QRND 4JFFE 4ZAKA 1ZVYA 1RHFA 3FOLB 1G0XA 2ED8A 2UYLB 3I3EA 1OAYH 3RWEA 4Y5VA 3LIZH 3KPSD 1CDIA 2H6PA 1NCUA 4G6KL 3SDCD 3VH8B 3AFLA 4G8GD 4LSRL 1TLKA 1SJXA 5F6IC 4WI8A 2R0ZL 1HQRA 3BIKB 4OCSL 4LRIC 4JN1L 1C08A 3H9ZA 3LN4A 3OJ2C 2BRRH 2WBJD 4Y16D 1FH5H 1RUPH 4O9HH 3N1PC 4FQHB 2EE9A 4ZS6C 1JIBA 4F9PC 4YBQD 1VACB 1OAUH 5C09B 3LN5B 3BW9A 5HHXH 1CFTA 5CIPH 3LKQB 4JFFB 3L3DA 4UI2A 1MCHA 4Q9QH 1L9MA 3AAZA 2ARWA 3LKSA 1IJ9A 5I19L 3KYKH 3NIFF 4WCYH 4QHNB 3AMLA 4M1DL 2GHWB 1I4FB 4KRPB 1C8PA 5LQBL 3OQ3B 5DJZB 4PLJC 5GGSA 1UVQB 1CDBA 4Y2DB 3ZMRA 4HWNA 4U1GC 3ARTA 3ULVF 4PD4J 2EO9A 4LDLB 4KVCH 2FEDC 2Y7QB 2W59A 4QHMB 1JPSL 5D7IA 1NC2B 3SDDA 3QISA 4LKCA 5IM7A 5GRZA 3LOWA 5J1AA 3DUSA 4V1DB 2WZPD 3VFUB 2G9HA 2CD0A 4XZUA 2IQ9H 3EDDA 3VG9C 5F88B 4L8SC 2BC4B 4G43B 3BRGC 3OHXA 1EJOH 4JHWH 3GI8L 4S1SL 5E8EB 1HWGB 2HN7B 5HBBA 4ZFFB 1JTTA 5CJ5A 1T1YA 1A3RH 1I8IB 1AGFA 3NPSC 4RGMC 4X7EC 4ENED 1WBZA 3LS5H 4HDIB 3HAEB 3VFMB 1KLUA 4PGJA 5E8OB 4HS8H 3RGVB 3WV0A 3DJ9A 4OCXH 5J7CC 3CMOH 4N90E 2VDKH 5CP3A 3BKJH 3PL6D 2FBJL 5JHLH 1YECH 2E9WA 1CVRA 2H32A 1UZ8A 1AD9A 5LVEA 3C8KA 4G6AC 2CJUH 1A6VL 3C60C 4YFEA 2IFFL 2K9UA 1FGNH 3P30L 4HGWB 3V0VB 4WUKL 5EBWA 5LGJA 1SYVA 4G9FE 1OF2B 2OTUB 4PJXA 3BPCB 5TQ0L 1XIWA 1RJLB 1K6QH 1YY8A 5CGYD 2QSVA 4Y4FD 2AS5M 2WM0A 3UTZA 5LBSL 4HKJB 1HXMB 1HNGA 3DGGB 1S5HA 3VXOB 5E7BA 2EDDA 4TRPL 5F9OH 4Y8AA 3NFSL 4HFWB 4OF6A 5D2LA 2C1PB 2NY3C 4I48B 4JAMA 1PSKL 4ZAKD 2ATKB 2E7HA 3F7YA 1IL1B 4R0LC 3LQAL 1P53A 3R06A 4NYLB 1T2XA 4IMKA 4KJYA 4YBLC 3T3ME 2NTFA 1NBZA 1P84K 4QTIL 4LNVA 4ELMB 4JG0H 2C4FU 5CGMA 3MFFB 5D70H 5D72L 1U3YA 2EDEA 4NQDD 5GGSY 4IRZH 4KI5C 1J1OL 3U2SB 2E27H 5CP3H 5J3HD 3I6GA 1MFEL 2XOTA 4KJWD 5E99L 1IAIH 1Q9LB 5KSVB 1MF2H 1U3HC 3CFEB 1MREL 1CCZA 2H32H 4JO4H 4RIRA 1NAKL 4U2ZA 3B9KA 1I3VA 2PN5A 2GTZB 4ODWA 2ORBH 3UZEA 4OZFG 1MFCL 2A74A 3JZ7A 3DVIA 3LQZA 4HJJL 5IROA 4OGXL 4KKAD 3RIAK 5FUOL 1YPZF 1CR9H 2BCKB 2DLGA 5DRZA 5MENE 4FQXB 2HH0H 3HC4H 1EFXA 5GGTL 3K7UA 3LKNA 5DJ8B 1CL7H 3Q48A 1WAAF 4NQSB 3ZKXB 3VGDA 1BQUA 1OTSC 5C6PB 3U7YH 3HMWL 3AB0B 4Q7DA 1KIQB 3SDDD 4OF0A 2IANB 1XGPA 4JHAL 1WITA 5GJSH 5IFAH 4JFPB 5D7LE 4LOUD 4I77H 1U8HA 2MKLC 2X4TA 3SDXE 1X4YA 5EO1B 4XCCH 3MGOB 2ZNWA 5MENB 3GJFK 4ODTL 3L95B 5TE4L 4NWTL 1OSZA 1Q8MA 3QDME 5E00B 3TNNB 1NJ9A 3LEYH 4KROD 3QXDB 3FRUA 1T83C 1A7OL 3C87A 5E8NB 4MA1C 4JKMA 1CDGA 2QR0A 5T1LD 4JFEE 1OGAA 3WNOA 1OLZA 3TN0B 4M1CC 4KXZI 3MLTB 3BH8B 3WDHA 2A1WL 2VXUL 3S3PA 5D7LB 1CFVH 1FPTL 2EDXA 1ZGLP 2Y6SC 3SDXB 1FYTE 1DE4B 1RUAH 5HHOA 1LVEA 2LE9A 2VITB 4OSUH 1F42A 4ZXBD 3S4SA 5L6YL 1XCTA 4I2XE 1TJGL 3QI9D 3KJ6H 4WTWA 4Y0GA 2EDQA 1IGMH 3QDMB 4Y8DC 1W8NA 1AR1C 3TBVB 3LZFH 1NFDF 3JSSA 4Y4HA 4XNZB 5EBMB 4YGAB 2VDMH 1D6VH 3L5IA 3EJYC 4PJ5E 2QLVB 4JFEB 2OZ4A 3R8QA 4O5LH 4JKWA 5KN5B 1DSFH 3KPMA 1KOAA 4RMWA 2D7MA 1FBIL 3CMGA 1CE1H 5J1SC 1MCLA 4M6OL 5IHZB 4FXKA 4HBCH 5E1AB 4J8RB 5GSVB 2M26A 1FYTB 4QHUA 4XRCA 1V3JA 4N0CC 4L9LA 5GS1C 2HFFA 1TFHA 2UUDK 1DUZB 1NANI 4WWKA 4X6CA 5FK9A 1PKOA 5EU7E 1IEBB 4KTDL 1AXIB 4PJCE 1KNOB 5DQ9B 3NA4A 3QQ4B 5FAAA 4D9QD 3FOLA 5J6HB 1FO0L 4Z7VA 1MHEA 5EBLB 4YDLB 4LCWD 3PWUB 2NXZB 2NY6B 3NH7H 4CMMA 1HE7A 3B9KD 3HG1E 4UV4L 3SDCC 3JVGA 4UT7H 4LEOB 4F58H 1T66D 4BM7A 4PJ5B 4YDVA 4BJLA 4QNPE 5KJRL 3OSKA 3QNZA 5FGBA 1A0QL 3SE9H 1F90L 2VUOA 2EH8L 5BJTB 1PLGH 3OF6D 5E2UH 2EYSB 2WBJC 3GMMB 4Y16C 1A47A 5FYKE 4FQHA 5C70A 2X89A 3RWDA 5CJ8A 3LPWA 2WBWB 1X5KA 4AZ8A 1VACA 4YBQC 3SKMA 3KDMA 3S35X 1CGSL 1FLRH 4CUCA 4PJCB 4PY7B 3T77B 3RHWK 3HR5A 3C5ZA 1MCPL 1M05B 2OZ4H 3BDBA 3MUGB 1GGCL 3A6BH 4N0RA 4ZNCD 3HG1B 4QHNA 3K80A 4LMQI 2FX9L 3GBMH 5F3BA 1FNEB 3FB6B 2VLLB 4LCCC 5HHNB 1T7VA 2A6DB 3PWJA 5DDHB 3IDUA 2YD4A 3G6DH 4P2RE 4P9HL 4KRMB 7FABL 5EOTB 3OB0H 2X1WL 5D1ZA 3A67H 4GW4B 1U8JA 1I1FB 1OM3L 1KCKA 2YS4A 1KCSL 4F7CA 3MLUL 5EUKB 3UYRH 4MCZB 3TESA 4YZFF 1ED3A 3QWOA 1E6OH 1KXQE 5J0BA 3UYOD 1NGPL 4I3SL 3ARDA 3VXTA 4JVPA 5GGQH 1OGAD 4JQIH 4LLWB 4S1RL 1JGUL 5FCSH 2PCPA 3QPXL 1ERNA 3HRZA 3WHE1 3MQIA 4ENEC 4H25A 2ZUVA 5I17B 1HHKA 1JF1A 4AL8H 5IV2A 4HDIA 3F7PC 2P5EE 1Q94A 2DIJA 3MJ8B 1QFUH 3TIDB 5HHOD 3CH8A 1PYWB 1MHCB 1AH1A 1IARB 3PL6C 3MREB 2W38A 1CFBA 1QSFA 3AUVA 3E8UL 3HZVA 2HTLD 1MVFA 5J57B 1RU9L 5JLZA 4NIKB 3BJLA 2XQYK 5DUBA 3TYGH 4MXWH 1ZHKA 4O2CA 3M07A 1HOCB 4NSKB 1OCWH 1QO3B 3WS6C 4RWYL 3IDYB 5IEKB 5CGYC 5F8QC 4Y4FC 1LDPL 5KS9A 5F7UA 2EC8A 5HVGB 5IB5A 4Z7QE 3R1GL 4RAUB 5ISZE 1Y0LA 2V17H 1P4IH 1FFOB 2YKLL 4R3SB 3KPNB 2P5EB 5HI3D 3RZCA 3QQNA 2EH7H 4O02L 4WWKD 5BMFH 1DQQA 3F12B 1BQSA 4I48A 5DD3H 3U9UA 1MY7A 4ZAKC 3VRJB 3RRQA 3B8SA 4PJGA 4GUPA 3CSYA 2HFTA 4S1QH 5EA0H 3PWNB 2OR9H 2DM2A 2OXHA 1I1AB 3MLRH 1S7XA 3ECBB 3UBXB 4ELMA 4EBQH 5IW6B 1T1ZA 4XPGH 2MPAH 4PR5B 2EC9U 2G5RA 1FGVH 1TPXC 4KK5D 3TEUA 4JKKA 4KHTH 5I30H 1NGZB 5EG6C 4GJTB 5J3HC 1Q9OA 1U41A 3H3BC 4KJWC 4KKLD 3A6OA 2FD6H 4S10A 1FO0B 2X89D 1A7PH 1RZJC 1JGDB 4E5XA 1I8KA 2JJTC 2L4OA 1AP2B 3P4OA 5C09D 4NKQB 3D0VA 5CHNB 5FM5O 4I0KA 5C0EB 2FNBA 8FABA 4PJEA 3DLQR 4LCUB 3C5ZD 1KIRB 1OSPH 3HPLB 1GAFL 5J13B 4F80A 1JPFA 4KKAC 4KRPD 3WDJA 3C8DA 3FO0L 3GKZA 3O6MH 4MLIA 1VHPA 3RY6A 5DD1H 1GVIA 3LIZL 3GM0A 4QRUB 1INQA 4NQSA 1N4XH 1SYSB 3QDAA 1MNUL 3UDWA 2CPCA 1CFSB 5E4EB 4PJIE 5KW9L 1KJVA 4LSPL 3V6OC 5D1ZD 1YN7A 4JQVA 2AJ3B 5C9KA 3BAEL 4Z8FL 3FHAA 3SDDC 1VADA 4PS4L 2N7BA 2BRRL 5HHQB 5I8KH 4U6YB 3CUPB 2IANA 4AEHL 4V1DD 4PJ8B 2FR4A 4O9HL 1IC5H 2CUHA 2DQGH 3MGTB 4RX4D 3WFBH 3QUZB 3FQWA 4JFPA 1WWWX 4LOUC 4LVNC 4WU5A 3E6FA 1J1XH 5DJCB 4S1DD 2GSIB 1NL0L 1ZHNA 2AJUL 2XRAL 2IQAB 2DB8A 1GPOL 4P23A 2BHYA 2GJZB 3OAYH 4PUBL 1W0YT 2FO4A 3VXRB 3L95A 4MWFB 1SJHA 2NY5L 4DZ8B 4JFDA 1U8LB 5D71H 1Q72L 1LP9E 3RGVD 3KYNA 4KROC 3IU4H 4OCLC 2BY2A 4DK3A 4PJIB 4PRHE 1EEYA 3ELAT 3PQYA 1QSFD 1RUQH 4KK8D 1WBXB 1U8NA 5GGUB 1UC6A 2XZCH 1K8DB 3ZE1F 3TPKA 3R0MA 5I1KH 3VWKA 5E94B 1FAIL 1LDSA 4KVCL 1CL7I 5JW3H 5CEZD 4G5ZL 4Y19E 4E42B 2YUXA 3G5XB 4U6HA 1ZGLA 2AVGA 4DVRL 3BKCL 4MAUL 2VITA 4LVOB 4ZXBC 1PD6A 4M1GL 1LMKA 3ZYIA 3QI9C 5ANMA 1EJOL 4N1EA 4PJBA 3MZTA 4RAVB 1LP9B 3RZCD 4ONHA 4AJ0A 4YHKL 4N90D 4KMQA 4Z5RB 4LU5L 3VFSB 4AY0A 1JHTA 2NLJB 4JKPH 1IFHH 1BZ7A 4DFIA 3CMOL 4HJ0D 2F58L 3UTSA 1XZ0A 2YN5A 3FQUA 5JPMA 2AJVH 3I9GL 4NDMB 3EFDL 4M6AA 4Y19B 2CJUL 4IDJH 4XVJH 5K9JL 1S9YB 5IMLA 1ZV5A 4A6YA 1I7RB 3IKKA 2XKUA 1E4KA 2VJXA 1K6QL 3QQ4A 3ZDXE 3W5MA 4HUWB 3MJ9L 2J8HA 3OGCB 4XH2B 3T0WA 5JDSA 3B9KC 4NZJA 5JIIA 3QJFA 4L1DA 3LQMA 3B5GA 1DLFH 5CD3A 4NP4L 4XAWL 3DV4B 2X1OA 2JB6A 2EYSA 2CRIA 2FHCA 3VFNA 3C2SA 3VW3L 5CZVH 3P4NB 1BVLB 1HDMB 3DUUB 5E2TL 3ZL4H 4GXVH 2C26A 1KIUA 4CMHB 4LLVB 3EDEA 3P77B 1BQLH 1DEDA 2D0GA 5CSGA 4YPGB 1QG3A 3CX2A 2CDFB 5BQ7B 2DLHA 3MUGA 5D6CB 3ILPB 3PG2A 1F4YL 3DXAA 2IAND 2Z4QA 2BVQA 4HPYL 2HJKB 3FB6A 4HIEB 3LS4H 1WWAX 5DJAB 1QA9B 1JK8A 2IAMB 5A43C 5GS0H 2BJML 3FRPA 2CXKA 4P23D 2COQA 3BD5A 3BPOC 3NCEB 4A6YH 3MV8E 2B0SL 4GRLA 1OAKL 3U7WH 5MEND 5DFVD 1QFWM 1A6ZB 5HVFB 2D4DA 1DLHB 3RVVD 3ARYA 5T33L 2AKRB 5TGBB 3BEVB 4KH2A 3UZQA 3HC4L 1MCDA 1N3NB 4NCDA 1F58L 3TN0D 1HSBA 3CZFB 1TQBC 3VFPA 1R5IB 3K1DA 5D7LD 1ZT1A 1A1MB 1MJ8L 2HA1A 2VZUA 1MSPA 3EO9H 1MJUH 3BXNA 3MV8B 1E6JL 3NN8A 1RIUL 3CFBA 2EO1A 4P5KA 2D7OA 1FZOA 3BP6A 2R0KL 2B1HL 2HTLC 5SWZE 3QDMD 1P4LB 4X4ME 3I2CL 4XCCL 3VFGH 3M1BB 3QQ3B 1K2DB 5IHUH 1VEOA 2I26N 2PW1A 3OR7B 5I1CL 5L8JB 1C12A 4MSWB 4H1LB 4MDJB 5IEKA 5LJYH 1F6AB 2AK1L 4ELKA 1G7HA 2IBZY 3MA7B 3K46A 3J7HA 1CYGA 3QDJB 4BZ1H 2HRPL 1OPGH 1EHAA 3VA2C 5HI3C 1FYTD 1SY6L 1D5BA 4L9LC 3GHBH 4WWKC 5DEZA 5GS0D 4J3UA 3WHXB 1MCBA 4XTRD 4CDHA 5SWZB 1KTRL 2IPUG 2EIEA 4Z7WE 4YQXH 3M17B 4OSUL 5M95B 2NXZD 3B3IB 2NY6D 1A3LH 3GSOA 1F02I 2W0LA 1IAOA 3OKMA 4DWHA 1EHLH 3D69A 2Y36L 4D3CH 4KK5C 1GIGH 4PJAA 1QKZH 4NT6B 3RTQB 2FRGP 4KKLC 1KCRH 4M4PA 5DRNB 2J5LB 5F7FA 1KLFA 1YQ2A 2DYPA 3JTTB 3MLVL 2JIXB 4JZNB 2QSCL 4UZGA 2Z92A 1MIML 4ZNEE 4Y4KB 2ZUYA 4KPHH 3D85A 1J8KA 1ZHBA 5E1HB 3O4OB 2X1QA 1GZPA 5C0EA 3LH2H 2DLIA 2EDJA 1DN2A 3FOMB 4YNYA 2I07B 3V4UL 3W5NA 3C5ZC 4L8DB 5INCB 4YHLH 2R2CA 3OKKB 4CAGA 1J05B 5GZOD 1W0WA 2UWEA 1YY9D 3QH3B 3HG1D 3DXAD 3GJFA 1OL0A 2CGRH 3IDJB 3QZWA 3TPUB 4DVBA 5CJOH 4KRPC 5FM5M 3KPOB 1JWUA 1A8JH 1EDQA 1BIIA 2D03H 5HGAA 5FKAB 2EYTA 4M3KB 4Q74A 4UT6H 4Y2DC 2AV7A 2BFVL 1SYSA 4UT7L 5FYKD 3PWPA 5LAXB 5IESH 4L8BB 3DSFH 3ZKSD 4GAFB 1PLGL 4M8QB 4WU7B 5E2UL 1ZOXA 1VFBA 2ADGA 4NUJB 4L8CA 2WBKA 5ITBH 4W68A 1AO7A 3FMGH 3ZKMD 2XWJB 4NCC2 4JY5H 4S1DC 4IMLA 1EAPA 1U2CA 3KS0J 4QGYA 1IAKA 2VDNH 3QUXB 5BXFA 2YA1A 2ZSWA 3RWFB 4DGIL 4RDQF 2OZ4L 4PG9A 1IGTB 5KANI 4YO0A 3ZTJH 4LEXL 1U8LA 2Y07L 5DK2B 4LSQL 2Q7YB 2VDOH 3RGVC 1JF6A 2ICES 2EDFA 1KENL 2QTEA 4XPAL 2YHGA 5GGVY 3V5DA 4ZUSA 2EIZA 3L6FA 2XZAH 4KK8C 3PHSA 2YUVA 3QDHA 4HX1B 3CDFA 4LLYB 3HNTH 5DUPL 4WFHE 3GJFH 5FHAL 3NCYS 4E42A 4NKDB 1L0YA 5C0ND 2BOBB 1DQMH 1Q9KB 4L5FH 3IXTA 1T5XB 2E9BA 4PJFE 3CX5J 4K23H 4ZPVA 5SWSA 4NRZB 5GGQL 3RZCC 1FV1B 3DX8B 3F7RA 5JW4R 2YK1H 2HKHH 5IG7B 3MJGX 4QF1B 4OD2A 1LD9A 4EXKA 3UTTA 2DKUA 4N5UA 4PRBB 2CH8A 2O61B 1JMXA 4NQEE 3GFUA 1BVZA 4HJ0C 3O41B 4H5SA 3L3HB 4L4TA 1HQ4A 1I1AD 1X7QB 2ZJSH 4NKMA 3QUML 4YHML 1F6LL 3IRPX 5ADOH 1YQVL 1IM9B 4EUPA 4U1KA 1F4HA 4MXWL 4UOW1 4R97B 4G8IA 4BFIB 2O26U 3BH9B 1OCWL 1TJHH 1A4JB 1ZKAA 2J6EL 5AYUH 2XG5A 2DQCH 2FH6A 2DYPD 3WS3A 2GQHA 2Y06L 1T0PB 4D8PA 3D85D 2F74A 3T0XA 1SEBA 5ESAB 2DLEA 1XGRA 3I50H 5LWYL 4KZEH 3T3PF 2Z93B 1WC7B 2UUDH 5ESVB 3TT1H 1EIBA 2MTPA 2NY0B 4WI3A 4APQB 2HJLA 1KG0B 5HYQB 1WEJH 3NIFE 3DOSA 3JWDL 2XT1B 4GRMB 5DYOB 2XWTA 4AYFA 1BVLA 2R0WL 3DUUA 1CD9B 1N0XL 5J6GB 4FQXC 2NR6D 1A7RH 3GRWA 3RY6C 1DBMH 2MQ0A 5L8KB 5DEGA 2DRUA 3WXVH 1QBLH 12E8H 1YNKH 3BFOA 4YEEA 2QBWA 4J3SA 3HA0A 3PWPD 4YPGA 2MPAL 5CEYB 4MB4A 3NCJH 2VNCA 4LHQB 1AI1L 4P3WA 4N1CA 4PJ8D 3DI3B 5C6TH 2NW2B 3QUZD 3QUYB 2YRZA 4N9GB 5FUZL 5T5FH 1INDL 4EUPH 2DS4A 4P23C 1K4DA 4HXBH 4WV1A 1XR9A 2CK2A 1WZMA 4W4NA 4BSVA 3VXRD 2C5DC 4HUNB 1A6ZA 5DFVC 5C0RH 1DLHA 1ADQA 3RVVC 2EEDA 4J6RH 1KCUH 4PJ7E 2ADIA 2MCG1 3ARBA 1O7VA 3O6ML 3WE6A 4YXHH 4BH8B 4I9WE 1PG7L 3U36A 4AQOA 4HV8A 5IB4A 3TN0C 2DI7A 3TBSA 5IIEB 1DUYA 1T0NA 3DVNB 3SDYH 4NC2B 4LLDA 2VSDA 1KLGB 1KPRA 3TIEB 4ODXB 3GRWH 1U8IB 1KGCE 2DQGL 2CLRB 3F58L 3T2QA 3QFJA 2GY5A 2D2OA 1J1XL 5SWSD 2AK4A 4NHCH 5C0AA 4OUUB 4AM0B 2AQ1A 3I75B 3IJYA 4JFZL 5IW1B 4NZUH 4KKCD 3CLEH 1L7TL 4XI5D 4XNZC 1BFSA 5L2KE 5D71L 4H1LA 2B20A 2DJ4A 3U46B 2ICWA 1H3XA 1VB9A 3Q1SL 1GSMA 4L3EE 2YD9A 3QDJA 1ZA3B 1UM6L 3TZVA 4MNQE 4L4TD 2VZTA 3ES6B 4MB3A 2DTSA 4X80L 2UZIL 4R4ND 2W0FB 1OP3K 3PNWA 5I15L 3QHZH 4W6XB 3WJLC 3WXWH 4BQ6A 3I6LD 1ADQH 3C2AL 2VQ1B 5I1KL 3VFRB 5BVJA 4K71B 4LIQH 4PY8J 5GS0C 2YN3A 5CINL 3WHXA 4GKSB 2NW3B 1JNLH 4XTRC 2P4AB 4JN2B 5F6HJ 1FLTX 4P2CG 3ROLB 4P2OB 5I1IL 2AJSL 4H88H 5DRWA 1HKLH 4YH6A 3LQAC 3M17A 4YFLF 4YDLC 4IRJA 2NXZC 2NY6C 5TH2B 1FE8L 3EYSH 4F9LC 2J3SA 4FMKA 4OLUH 4ZTPH 3WN5B 1FG2B 5L2KB 1L7IL 1A9EB 4XNUH 4UTBL 1A2YB 1RFDL 4L3EB 1PFCA 2JCCE 3AGVA 1OGTB 4MNQB 4MDIA 1SQ2N 3MRFB 4ZTOH 2OTWB 1IFHL 1DTUA 3BMWA 5DRNA 5HGDA 1YPZE 5JIKA 1UG9A 2FATL 4Y4KA 3UO1L 4RFOL 4KI5F 4NGHH 3FT4B 5EU7C 3KHOA 1WAAE 4XPTH 4YEFA 2GK0A 5C2BH 5EFIA 2XIDA 1VA9A 3G5ZB 2ZWLT 4S0TD 4H1LH 5EZJB 3GJEA 2H1PH 5GRYA 4DJMA 3BEWA 3BP4B 2WP3T 2LU4A 5GZOC 3GMOA 4LAQL 3O3DB 1YY9C 1D5XB 1F13A 4JM2A 1GGBH 4IIQA 1NBVL 3UYPA 3B2UD 3IXAA 4KFZC 3M45A 3VXQB 1QNZH 1JHLH 1XGYL 1G7QB 5C0FB 4HIIA 4HKBA 1R0AL 2IAMD 1CE6A 5T1MA 4HEME 4KKNA 3NABH 4ZDHA 1WISA 4X7SL 1YPZB 5JPNA 5FM4A 4FQ1H 4JFOA 4WU7A 1JCKA 4XBEH 5CZVL 5F44A 3WIFB 3ZL4L 3ARBD 1U2HA 3INUH 2XI9A 3ZKMC 4HW6A 1FZJA 4ZMAT 3QQ9D 4OUOA 5ALBH 3HZYB 1E4XL 2YRPA 1I85A 4XP6L 3QUXA 1AGCB 3W2DH 4TUJB 3FQRA 1RZFL 1HEZA 2DICA 2EDLA 2G5BA 4OCRH 3IU3B 1ZVHA 4G9DB 1QLEL 5D7JA 3BUYB 4LRNH 3QCTH 3MV8D 3EYOA 1U91A 4WFFE 3S35H 3LS4L 3QFJD 5TDOB 5C0AD 5BO1L 4WFEE 4Y2OA 2Y72A 5DWUH 3LY6A 3GSVA 4FQLH 1NDMB 1NFDE 4G80A 5E6IA 3IDGA 5C0DA 3NA9H 1ROWA 4JRXB 4W6YB 2P8MA 4U1IB 5C0NC 4H8WH 1Q9KA 3IDYC 4OZFB 7CGTA 2ZNXA 3S88H 2BHUA 1R24B 5I71B 2JLLA 3QDJD 4R8WL 5F3HA 3KPLA 3UBXI 4JO2L 5HJ3B 5I1JL 3L3JB 2DMBA 3GIVB 2AW2A 3FCTA 2VR5A 5KSBF 3W0WE 1YUHB 3RJQB 4QF1A 2P5WE 3U9PH 2ESVE 2Q86B 3S34L 3F65A 5SWZD 3EO9L 4N8CH 2O61A 4AMKL 1HXYB 3QCVL 1NFDB 3L3HA 1I1AC 3BP5B 3OKLA 4I18A 1JZ2A 2P8LB 5H35A 2UY6A 1D6EA 5IHUL 2QKIA 3VFWA 4FXLA 5E6YA 1RIHH 1XGQB 3GNMH 4U4BA 2OSLB 2P8PA 2HP4A 1Z9MA 2JIXD 3WFHA 4Y4KD 3P11H 1CK0H 1UZ6F 1CFNA 4PJHF 2XN9A 2P5WB 4YHZH 2E7MA 5K9OB 3X3FL 2ESVB 3FQTA 1H15A 3ARFB 1S9XB 3CXHK 5HY9A 1OLLA 1JPGB 1JI1A 1PVHA 5EORL 1ETZA 1NGQH 5J13C 5IB1B 5D5MF 5DYOA 3BI9X 4PGBB 1UA6H 1NCCL 3X11B 3MJ7A 2WLYA 3MX0A 1B4JL 2NR6C 3AS0A 1DQDH 3P40A 5DVMA 4I3RL 3NZHL 4D9LL 2PR4L 4PJBE 2EDRA 3IFLH 1P4BH 1XCQB 4Q2ZA 5IVZB 1JBJA 3QEUA 1J1PH 1LEKB 5DXWA 2EDOA 4O2FB 4PJ8C 4LPXA 3KXFA 5I1LA 3QUZC 1KT2A 2A6IB 2X7LA 2JTDA 5J9PA 4Z7OF 5DK3A 1Z0NA 2PO6B 4YHNB 1A1NA 2A73B 3BGAA 3VGAB 1NMAL 3NCFB 3QUXD 4F7MB 1QYGL 4YHLL 3KPQB 3C6LA 3C9NB 2V5TA 4X9BA 4PRDB 3G04B 4JQXA 3BZFB 3CXDH 1RUMH 3GSXA 5FB8A 4WW2F 3JUYA 2P24B 3F5WB 3HZMB 2Z31B 2P45B 3PJSA 2D03L 5TF1L 4HEPG 4AEIL 1KCVL 5CD5D 5IMMA 1QBML 3PGCA 2CIKA 5GGVL 4FTVA 3LSOA 4PD4K 3CFJA 4XXDA 3QCUH 5E2JA 2VXSL 1RZ8A 3V8OA 5E6ID 3IKCA 1T0MA 5F9DC 1MLBB 4M48H 3X3GH 3BE1L 4LSSH 4X0KA 1NAML 3PXJA 1CZ8L 4R7NA 4ODXA 1QFPA 2DWEB 1R5WB 1N2RB 5ICXB 4UDUA 3LKOA 4LVOC 4PRPA 4DZBA 1NBYA 3J8F7 2IH3B 4IS6A 4JY5L 2ED9A 1U93A 4PGDA 4PRNB 5DJ2B 5ALCL 4O51A 3EFFA 4YXKH 2PTTB 4PJDF 2CMRL 1TZHB 4NO2B 1ZTXL 4KKCC 4XI5C 3OG6B 1CG9A 5E5MB 1KC5H 1G6RA 1KJ2A 3O2WH 1AGEA 4XCFH 1RHHB 3DO3A 3V5HB 2V5SA 5B4MD 2VDOL 4HC1A 3ILQD 4KWUA 5C71A 1LO4L 2D0FA 4ZUUA 4HJGB 5JQ6L 1ACZA 2R69H 3EAKA 2YEZB 4WFHD 5GRUH 4W6WB 5TE6H 3MOAL 2W0FA 4R4NC 4HKXA 1BX2B 1XT5A 4HS3A 3MOQA 4KUCD 3VI3F 1RMFL 1MCKA 3PGFH 1IM9D 1R3JB 3ULVH 4OLZL 3SOBL 3GHEH 2NW3A 2Q8AH 1CICA 2FGWH 4JN2A 4WNQB 2B39A 1BECA 4L5FL 1SMOA 3FQNB 4TTGA 1J18A 1IKNA 3FT2A 1GZQB 2Z91B 5FKPB 3REWA 5C6WH 1I9RH 3S3JA 2O5YH 4WHTA 4YBHA 1ND0B 4TVSa 2NY0D 4APQD 5JQHC 4NM4L 3DSNA 4HWZB 5I75B 3TYFA 2F54A 1CD1A 1RJZA 1MH5B 4ZUWA 3VXSE 5IOPA 4MD5A 3EDJA 3IFOB 4BQBA 4OV5B 4CMHC 4I3GA 4QHKI 4OCNC 3O2DA 1N5AA 1G6RH 3G5ZA 1KJ2H 3TP4A 2R29L 1S78D 4LSVH 5ADOL 1DJSA 5E2VH 4HC1H 2G2RB 3LCYA 1JNNH 2RB8A 5AYUL 1Q0XH 2H26A 3HMXA 2DQCL 3B2UC 3VXQA 2NZIA 5FECA 1HCFX 4RA3A 4RGND 1EXUB 3QUYD 3R0NA 1HIML 3L3GA 4I4WB 4ORGA 2IAMC 5CLWA 4CVUA 4H0IA 3P4MB 1RZGA 2DI8A 3MXWH 3FT3A 3TT1L 4WV1C 5C8JB 4GOSA 2FB4L 3VXSB 3C6LD 4XNXH 1PJ9A 4K7PH 1U92A 1K4CA 5BW7A 4U49A 3MRQA 3BSZH 3ULVD 4X9HA 1HKFA 3ARBC 4AEFA 5F89B 1DBML 4K3DL 5MEOA 3QQ9C 1R3KB 4PV8B 3ZE1E 3RNQB 3DV6A 2W9DL 1WCBB 2Q76A 4RA0C 4YUEL 2F19H 1CD0A 4BA8A 3DHMA 4OFDA 4OM1L 5I8CB 1WFNA 2NY5C 4PTTA 3QXWA 4NNYA 4OM0H 4G9DA 2VAAB 4PJAE 2ZUXA 5DJYA 2DQIH 1E27A 1MIEH 3EHBD 2ADJB 3SE8H 3MO1B 4LASH 2H3NA 4PV9B 1UJ3A 3NAAL 3O2DH 2WSKA 3PGDA 3D25A 3DBXB 3QAZB 3QEHB 4P4RB 5EU6E 5E03A 4UIMB 4WO4B 1ES0A 1T3FB 3MRBB 3TJHD 2VWEE 5CSZB 4K7PY 1NDMA 1IM3B 4HT1H 3HMXH 2FX7H 1K5NA 5EO9A 1UJTA 1NAMB 4I9WD 1EBAA 1KCUL 2YWYA 4J6RL 5I6XB 5CEXA 4OAWA 2X4OB 2XTJE 3LHPL 4FQQA 3B5HA 3NFPA 4RMUA 5K33A 3U0TA 5INDB 3CLFL 1KGCD 2VABB 2QQNH 3IFNL 4DAGL 5E8PB 5ITFB 4X4YB 1YUHA 4URTB 2WK2A 1JTPA 3BP7A 4P2OD 4U7SA 1OP5K 5EU3B 1PEZA 3WEXB 4R96B 3U79A 4FQIH 5L2KD 3G08B 5E2WL 2P8LA 3MROA 3VXME 4NWUL 4Y5YA 3QPQD 1N8ZA 4ONGL 3VXPA 3T2NH 3P9WB 4XMPL 2XTJB 4MNQD 3RTQC 4HQQL 4MJ2A 4I5BA 1XGQA 6CGTA 2BY3A 4UILH 1RIVH 5B38G 1WICA 2OSLA 4UQ2B 4YC2B 2VXQH 5AG9A 1ZSDB 1VEMA 3MRPA 1D5MA 2NTSP 1MELA 2V7HB 4Y4KC 3O4OC 3UTQA 2R2BB 2OS7A 5AZ2L 1NCNA 1JPGA 1PZ5B 1DBJH 1G9NH 3C08H 4P57B 1JNLL 2V2XB 3UJJL 3MR9B 5FYLL 4FZ8H 4HHAA 5D1QB 5L9DL 4H8WC 2IGFL 1CU4H 4XP5L 3VXUE 3KLDA 1YEJH 3QO0B 3TVMA 3IGAA 5MHSD 1KFAH 2V7NA 4RMQA 1WTGT 1XCQA 4ODSL 3QO1A 3OKNA 1TTUA 3EYVA 2B1AL 3PWVA 5EIQA 2EKSB 1P5VA 1FNAA 5CZXD 4XVTL 4BQ8A 5GGRB 2JE8A 2PO6A 5I1GH 5LCVL 3X14A 2XZZA 1KEMH 1NEUA 3TM6A 1I85C 3QUXC 5EWIH 3I85A 2V6HA 4R2GB 3HCVA 2YPVH 1DEEA 4Z7UA 4PRDA 3G04A 4GBXB 4XGZB 4DTGL 2YPLA 3VXUB 4M7JH 1DBAL 1LO5A 3KVQA 3ESUF 3U4BH 1XGUB 5CD5C 5CCKL 4QRTA 1G0DA 3STZB 4DN3H 4CKVX 3NABL 4XAKD 5FGSA 2NY7H 3TJEL 5FOBA 5MEPA 1EBPA 3FL7A 4TSBH 5E6IC 4JRXD 4MA7H 4HUUA 2ICCA 4R90H 4NRYB 4X7TA 3FB8B 1CLOH 4PLOB 1KBGL 1ZANH 5BZDB 2AP2A 2ZKHH 2BSTB 3CCHA 3GBNH 2DKSA 3HE7B 3EW3B 4TVPL 3MUZ1 1NUGA 5JDJA 1OY3B 4ISVB 1QEWA 4OD3H 1G84A 4XBGB 4AG4L 1WBYA 2CK0L 5DEFB 3AVEA 4WFFD 4Z95L 1Z5LB 2ATPB 4RAHA 3TO4B 1RHHA 1IGJB 1KJMA 5B4MC 3ILQC 5CILH 1N59A 4EI5A 4LL9A 5HTSA 4Q0XH 4HJGA 2IADB 4IEFB 4FG6D 5EUOA 3MYJA 4ZUTA 5EC2B 5CUSH 2VLME 4X98A 3WO4B 3SE3A 4JO1L 1M71B 1QBBA 2LQRA 4JCMA 3BJ91 2BNRE 3NGBB 4R97C 2HG5A 2VMFA 2G60H 1ODAA 1GGIH 2FBOJ 4G6JH 4JDZA 4JY6B 4M8VA 5JHDE 5EIIA 4OZIF 1OP3H 4E41E 4QTHB 4L3CA 4PLNC 2R1YA 2CLVA 2R56H 2ESVD 2VO5A 4R4BA 1R3HB 4XHJD 4YHIB 1I7ZB 3MV9E 5FYLE 2K7QA 2DBLL 3RWJB 1WZKA 2NY0C 4APQC 3V6ZA 2FYYB 2Q87A 3CFDA 4GKZB 3ZSTA 1BBJA 1UWEH 4KGLA 4N8CL 1MH5A 6FABL 4JEGB 4XNMB 3WMSA 3LPGA 1CGTA 3RPIB 5CBAA 3UC0L 3BQUA 2BNRB 4UBDD 2AXFB 3TVMD 4GQPH 5E9DA 3OKDB 1MJJB 3MNVA 1S78C 4N0UA 5JHDB 3E6HB 4MHHG 4OZGA 5CMAA 1EO7A 4E41B 5H2BA 4XVSH 3MV9B 4OI9A 1OT1A 3L3KA 3MCLL 2CIIA 1JUFB 1BZ9A 2PO6D 3QUYC 1KACB 3OXSB 2BNQB 5EB9A 3D0LB 4TULL 4YHZL 4CNIA 4HZLB 4GW5B 1GHFH 1MLCB 4FRWA 2I25N 3C6LC 1AXSA 3WKMH 1F4WL 5AAWA 4M43H 3I6KA 2YPLD 1K8IB 5FYJL 3STLA 3RA7H 3ULVC 1JRHL 1J0YA 4LGSB 2Z31D 5F89A 4U6XA 4OCWH 1IVLA 1ZT7A 4FXGB 4OT1L 3I3BA 1JYWA 4HG4J 4NBYB 1YDPA 3IJSB 1QFWH 1P4BL 3JTSA 3CNKA 3UJTH 4TVPE 3TT3H 2CKNA 1YEHH 3EOBB 3Q2CA 3EHBC 3L1OH 4Y5XB 1T2QL 1DCLA 4KUZH 1A6TB 3O3EB 4P4RA 3IFPA 1YEDA 1A7QL 5EO0B 1WUNT 5L7XH 5CSZA 3TJHC 3GO1L 1WK0A 2EE6A 5FOJA 4LQFH 1LO0H 1OARH 3L5XH 5JORB 2RCSL 3MNZB 4MLSA 3W9DA 2FIKB 3DHJA 5HGBA 1FRGH 3OR6B 1B6DA 1ZLSH 2VLJE 3B83A 1QSEE 1P5UA 5I18H 1FN4B 4IOFC 4NNXB 1NSNL 1E28B 1A5FH 3DVGA 3TF7C 1INEH 3T1FB 4K71C 5F1OB 1X5AA 3HNSH 5E8PA 3O6LH 3EO1B 1AIFA 2X5PA 4M4RA 1MUJB 2VZVA 5JMRA 3CC5B 4HK0B 3HI5L 5F9WB 3S37X 43C9B 4P2OC 5JTWA 3BZEA 4EVNB 5FIEA 5F97E 3WN5C 4XXCC 3ULUF 1ONQB 5B3JE 4IRSB 3V0AC 4E0RB 3RWIB 3QPQC 4FQ2L 4M7ZB 1TZIB 3X12A 5D93B 2VLJB 4Q6IA 1QSEB 4YDKH 4HIXL 3H2WA 4RISH 1SBSL 2ZUQB 3NCYP 3O2WL 4U1MB 1S5IH 4LGRB 3V0WH 4RMVA 3ARGB 4CVXA 3CFKA 5JNYB 3JV4B 1RZIA 2GITB 4NZRL 3MRLB 1NFIA 2V7HA 2FECL 5GRUL 3KLSA 3S96B 3BQUD 1BF8A 2EYRA 2H2PD 5EN2A 5D7KD 2MHAA 3MLXL 3S8WA 3PGFL 1JP5A 2HLFD 2C3HA 4KMTL 4DN4H 4OF7A 3O0RH 4DKFH 2CDGB 3JWDC 5JW5A 1TVHA 4O00A 3QXAA 2PYEE 4MX7A 5D7SL 2C3VB 3QHFH 2DQDL 5FUCE 1MWAL 4X9IA 2W07A 5FYJE 2J2ZA 1GOGA 5F7KC 3HB3C 3IETB 1N64L 4BH7B 2O5YL 5JUEH 2JKXA 2KZWA 3VXSD 3QWRA 3RGHA 1LWRA 3WFCH 2DQUL 1NEZG 3AY4A 2K7PA 2ZCKH 5CZXC 3W39B 3PHQA 4CVWA 2W65B 1IILE 2YMXH 1QBAA 3MCKB 4Z6AT 3OAUH 4JGJA 1GGYA 3C5SA 4LPWA 1G6RL 1KJ2L 1U58B 2CQVA 2GJ6E 3MRHB 3S36X 5E2VL 5HDOA 2PYEB 4TPRH 1MEXL 4M00A 2VISA 1FFPA 1MCFA 3RNKB 1T7XA 1SM3L 2B4CH 4OD1L 2WUBL 5E7FA 5CZKA 4P5TB 1A7BA 1ORQB 1VFUA 3IYLW 4LPVA 1YN6A 5C0GA 1YYLL 1XF5B 2KQMA 4AT6B 4PLKC 5KVDH 1T7WA 4RFNB 3SO3B 4K3HA 1UKQA 3QIUB 5DC9B 4OZ4B 2EC9T 3QEGL 3U0PA 2GT9B 2JJWA 1Q1JH 1IZJA 4XNXL 1FNSH 4CVZB 4DOHB 1JV5B 4K7PL 1T20A 2LFGA 3NZ8A 4G6ML 4JANA 1G9NC 5I71C 2BSTA 3SPVA 4JY4B 2GJ6B 2AV1B 4DGVL 3GMNA 3HE7A 5MP6H 4XPBH 5DMKA 1RPQA 2BOCA 2AGJL 5HD8D 3QRGL 4ISVA 4XBGA 1F4XH 2ZCLH 5IFHH 2DKMA 2ATPA 2WUCH 1ZHLB 5LGHL 4PRAB 4ZQKB 1AE6H 4PG2A 1F45A 3H7BB 4FG6C 1QVOB 1S7QB 3FAWA 1T03H 3KR3H 3H8NA 4Q9RL 2XNAA 5T1KB 1NCAH 2C3XA 1A4KA 1F2QA 5CBEB 2QEJA 1NDGB 2FJFA 4JRYB 5BRZB 1IGIL 2OJEA 5H37H 1RVFH 3QNXB 2XTJD 1M6OB 2EDYA 3F62A 3HI6L 5HHPB 1G9MH 1PQZA 4JY6A 1UT9A 2GCYB 1EZVY 4NN7B 2BVOB 2QQLH 3RWHB 1MHPH 9CGTA 1JVKA 2IF7A 2GK2A 4YGVB 2NX5A 4QRQA 2VZ3A 2D31B 3G6AB 3RY5A 4H20L 2VDPH 2DD8H 2F5BH 32C2B 5D9SA 3OKOB 3MTRA 3UROR 1G7IB 2IMNA 3THML 4M7LL 1BFVH 3DTXB 1PGRB 4JCLA 4U1HA 5ACLA 4IJ3B 1MPAH 1F5WA 3NTCH 2O5ZL 1MCWW 3LKRB 4X99B 3VJ6A 4UBDC 3TGXA 3E3QE 1B88A 1RJYB 4LLQB 3TVMC 2FWOA 4WRLA 3DARA 4N68A 1QLFB 3SGDI 3HFMH 4ODVH 4PJCF 4UILL 2R8SH 1RIVL 4MQ7A 1ZA6A 1LE5B 1DBBH 1GC1H 3BDYH 4CU7A 1OD9A 1T22B 2PO6C 2RGSA 5B21A 1MWAB 2BNQA 3VGAC 1U0QA 2R0LH 1IKFL 2R23B 1E4XI 1MLCA 4QNPF 4YDIH 5DHYA 2RFXA 1OAXH 3SGKA 3KG5A 4R2GD 1HHHB 1B0GB 2W92A 3MRDB 5EOCH 3Q6FA 4P0DA 2H8PB 1RURH 4M6MH 2Z31C 2APBA 1UXSA 1YNTB 4OLEA 3DX6B 1J0JA 5CP7A 4CADB 4FXGA 1RZKC 4QOKB 3BZ4B 2E6PA 2FZ3B 4PP1D 4RCAA 4WJ5B 4HMDA 3DYMA 1NMCB 2MCPL 3EOBA 4N0YH 2DWDB 2AI0L 4X4XB 5ID1A 3TLRA 2VLKA 3HE7D 4P4KB 3LB6D 4U1NB 3VFVA 2GSGB 3VFTA 4C55A 2HVKA 1I3GH 3O8XA 4P2QA 5KSBE 5AZEH 4ZPTB 4XCNB 2J4WH 3DRQB 1UACL 2A0LC 4C56E 1AY1L 4NKOB 4UUJA 2P46B 3O9WB 3PDOA 2GUOA 1RUKH 4TSCL 5FA4A 2K1MA 5KVGH 5FDWA 3T1WA 1MCJA 5F7EH 3PF2A 3CSBA 2AXGA 2YD2A 3SE3C 4TSBL 3P0VL 4LSTL 3EO1A 3FN3A 4U0RB 1T7ZA 2IG2L 5L88L 4HK0A 3MBEA 1QFWI 3PXHA 2RJMA 2LU7A 2ZKHL 4OGYH 5KSBB 2ICEA 1UZ6E 1GJIA 4K2UH 3K81A 1D9KB 4PJHE 3PP4L 3ME0A 3FFDA 2NX5D 5F7DA 2HVJA 4J1UA 3OJDB 4OKVA 3RWIA 3RL1A 4KJQD 5I16B 3GMQB 2XZQL 4Q9BA 3DO7A 1M7IA 4HD9A 5I75C 4QRSA 4OLWH 5D5ME 2WV3A 3V4PH 5I66B 3U0WH 5IEHB 1F3JA 5DD5H 5DLML 1OP5H 5H94B 4QXUH 1NC4A 1FNGA 3MRLA 4PREA 35C8H 3IF1A 3D39A 3FFCA 4N0FA 4XPFH 4Z7QF 2BNRD 3BQUC 1JGLL 2A9ML 1NEZA 5CWSA 4JPKH 2I9TB 3T8XA 5IQ9B 4WIQA 1F97A 5JHDD 1EHNA 2HLFC 4F33B 4JPIB 1XF2A 4M7KH 1JJUA 1OB1A 2L0DA 4PJHB 2W60B 1WFTA 4JLRB 3MCG1 4M6NH 1HHIB 5GS3A 1HYRC 1QUNA 5FYLD 5L2JA 1GGIL 3MV9D 3K2MC 3RZWA 1KSRA 1FG9C 4PP2A 1T7YA 2OMNA 5T3ZH 3FN0H 4X7DC 2VR9A 2BNQD 3HUJA 3S5LG 2YD8A 5D5MB 3IETA 1QQDB 5ADPL 4LRIA 4MJ5A 1JGEB 1F8TH 1NFKA 1UQSB 1YJDH 4G8EB 4KAQH 1BJ1H 2DQFA 3H3PH 1Z6JT 2IPKA 3IAPA 2YC1A 1UWEL 1I9IL 2CDEA 2X4SB 4NQXB 5IT2L 2GTWA 1HZHL 3FN9A 2SEBB 5I1DB 4F9PA 4NO3A 5I0ZA 5IVXA 2W65A 4U1SA 4EEEA 5C0BE 1BOYA 4JJ5A 5DJ0B 3PHOB 5GRJL 5KTEL 3EZJB 3HPJA 3VA6A 4GG6E 3KPPB 2E7LA 1BBDH 4HXAH 4K9EH 3WUWA 3M8OH 1J88A 4PB0H 4MA3B 1DDHA 2Q3AA 1D3CA 3UP1A 1IZKA 3ZKND 1BLNB 3L3OB 5I2IB 3L9RA 3QAZC 4OF3A 5DJDB 4ZFZB 5TE7H 2X40A 3VWJA 1EEZB 3WD5H 4PJDE 4M62H 4POYA 1OAQL 1HH6B 3O8XD 4OZ4A 5TPWH 1ZWIA 2JB5H 4LQ1A 4ZFOB 3A6CL 4M43L 1G7LA 5I6XC 1IEAA 3RA7L 5KVEL 3EDFA 3ZTNH 2E7CA 4GG6B 4OCYL 3SDAB 2R1WA 4L8SA 2FGZA 3H0TA 2DDQH 3WNMA 2DLFH 1CDCA 3FB7A 4JHBA 2FJGB 1AGBB 4HH9A 1U8OB 2XKNA 4UTAH 5JR1L 2EDBA 3FB5B 3MXVL 2DLTA 3CK0L 2A9NH 3MBED 2FJHB 2J88H 1CGWA 1VFAA 4YWGL 2P44B 4O4YL 4PJDB 3C6SA 3L1OL 1EFQA 4B7IA 4KUZL 2EICA 5B8CA 2NXYB 3IDMA 3EYFB 1ZVSB 1V3MA 1NDGA 4IRSD 1VKXB 3B2VL 3C60A 1FDLH 4JRYA 3FO9A 5IVOA 5BRZA 3V6FA 1KJ3L 1J8HA 3VCLB 2XTJC 4YXLH 3SY0A 1BWMA 3L5XL 4W4OC 1MVUA 3ARGD 4Z7UE 3O45B 4ZOAA 2B2XH 2JK5B 4YC2C 1H8SA 3D9AL 5GXBB 3GI9L 1NC4D 3ZYZA 2BVOA 4YJZL 3RWHA 1IAMA 1YMHB 2OX5A 3D39D 2B4CC 1LEGB 4PBWD 4CRPA 4QHLA 3O3AB 3L5WB 3BPNB 1HILA 3RX5A 3CFCL 2D31A 5DMGD 5DC0A 3SKOA 1P2CB 5C08A 2BX5A 1V7ML 4RRPG 4GO6B 4HIHA 2ZOKA 1WTLA 2R4RH 4CJ0A 4XNQB 4MCYB 5T3XL 2N4IA 4R0LA 5FO8A 2OP4H 3LKRA 3WFEL 1BQHG 5C0JA 1JL8A 3MMEA 1UB5A 4G42B 2CKBB 1XF4B 3MRRB 4G6FB 1IGCH 3DYOA 3RDTA 1DANT 3K74B 2GYSA 1L4IA 1S5IL 3GK8H 3NCCB 3V0WL 1GRWA 2M8XA 4K7FB 5JIPA 1U3HA 5IF0B 3KJ4C 4XMKH 3ZDXF 1LO2L 5IK3A 5HVHB 1HHJB 1N5YL 5I76B 5F72S 3PE9A 2HJFB 43CAA 4EI6B 4R2GC 1SJEB 5IQ7L 2PYED 1JN6B 2IC2A 2FL5A 5EU5A 5FYJD 1CBVL 2ADFH 5MI0B 4C57C 2A2QT 1NGYB 4CADA 4EN3B 1NCDH 3D87B 1MJ7L 4QOKA 2YD6A 4OTXL 3VWJD 5E6ZA 3GB7A 3QIUD 5AWNL 3MLWH 4PP1C 2XPGB 4NZTH 3X13A 2H9GB 1HI6B 4RMSA 5FCUL 3KLAB 3AS3A 3JWOL 2P43B 5HGHB 3EYQD 1FC2D 3SKJL 2GJ6D 3D2UB 4DK6A 3VRIA 3HE7C 2NY2B 3LB6C 3NFNB 3IJHA 4D0CA 3O6FB 3IT8D 4RGOL 1N7MH 4AH2B 1IC4H 2VDRL 4JFHE 1S7VB 4W70A 4GS7C 5TDNA 1EK3A 5JZ7D 4NQCE 2HKFH 3DRQA 2AEIT 3OKEA 3DROB 1A9BB 5IR1A 1KB9K 1MCOH 3TO4C 4JPVL 1TTGA 4OZGE 2H2SD 3RWGA 3HZKB 4NKOA 1LO3L 1MHHB 4LHUB 1FHGA 2X4PB 4PG2C 3UCRA 1T83A 1UH3A 3TBWB 1IMHC 1YNLL 4RNRB 3TH4T 5T1KD 4C4KO 1HHGA 1RK0B 2J7LA 4JRYD 2DN7A 4WW1B 5BRZD 1ZT4A 4LLMA 1J8HD 1KN4H 3NIGE 3S98A 2IH1B 3AU1A 3NGBC 3VFOB 4NM8L 5DMIH 1EV2E 3H42H 3RI5F 3MLYH 1QR1A 4ZG1A 5DS8B 3TV3H 3T08A 3BIAX 5HYSA 3NIDE 5D96C 5TFSH 3VMOA 3F8UB 1X3DA 2Z8SA 3C5JA 3ZT7A 1NH6A 5CJXC 4NQCB 4YPJA 3P4LA 2OQJA 2PYFA 3ZKQD 4MJ6B 5T3XE 3KNBB 1LQSR 3RU8H 4KJQC 1KELH 3VG0L 2ITCB 4MJIE 2UZXB 5MERB 4F7PB 1CF8L 1UXWB 1JWMB 3OTTA 4GKNA 5IKCA 1LEIB 3RP1A 2E9JA 5DSCA 5TDPA 4WUUE 1TETH 3I3DA 1P7HL 4MQXD 3KR3L 2VLRE 2VXTH 3BYYA 3RJDA 3LKPA 1H5BB 3H9YA 4Z0XB 3RDTD 5GS1A 3QEQA 1UB6B 5DQJB 4KI5D 4LDOB 4MQSB 2W60A 4XB8A 5AAMA 2Y5EA 5ICYB 1QRNA 3G5YB 4QRPB 4OI7A 5D7IF 1U3HD 3TBYB 4Z7WF 2AAVA 2Q1EA 3HNVH 5GISL 1BFOA 1TVBA 1ZLVK 2CRMA 5IBTH 3ARQA 1MHPL 2A83A 1FVEA 3KPSA 1MCWM 2VL5B 4MJIB 4R7DB 1A6WH 2C1OB 2OL3A 4PBXA 3MRCA 5MEQB 1DN0B 3EBAA 3RVUD 1R5VB 5J06A 4ODHL 5BZWB 3SHSA 1U8QB 4XWOD 4J7RA 4WUUB 4CN4A 2QSTA 2WBJA 4X8JB 1FAKT 3QUKB 1VEPA 5B39G 2VLRB 4JDVB 4KZDL 4HKZA 4PYHA 3L5JA 1RK1B 4KXZH 2X4UB 3WFDL 4YE4L 3PHOA 4FFZH 4QOKD 1YMMB 1NLBL 4F2MA 5FF6A 2DTMH 4JREB 1MFBH 4M5ZL 4P9ML 1FJ1B 4ZO8A 3MLSL 4ZUVA 5BV7L 4GMSL 4O2EA 1TZGL 1FVDB 1C7SA 4Y5XC 5B38B 1KB5A 5JOFB 5DD6B 3BKML 4HF5L 5FHBH 3CVIL 1B0RB 3B6SB 5EZLA 1T04A 4WW2A 2ZOLA 2OI9B 2MSPA 3O8XC 1SMAA 4HCRL 5CFHA 4HUVB 5TJWK 3ULSA 4ZFOA 4YHOL 4NO0A 5B22A 25C8L 2GAZA 1DVFA 2XKSA 4YAQA 1JYNA 2D7TH 4NQVB 3GSNL 1S3KL 2EZ0D 1JHKH 1URLA 4M5YH 3OXRB 2OL3H 2DQJH 3QIBB 1S7WB 3O9WD 2BHZA 1T1XB 5D1XB 1NANH 3L3IB 1ZAGA 5C0IA 1Y6KR 2FSEB 3V7AG 4M1CD 2HFEB 4GAGL 4R6UA 3K8LA 4XBPB 1X5IA 3MOBH 4Z0BL 4YR6B 3MBEC 3QYCA 5F9WC 1C5BL 3O2VH 4JFQA 1NKOA 4PTUA 4KTEH 3TA3B 4LNRA 4OZIE 1D9KD 4QCIA 1VPOH 3EYFA 4XB7A 1ZVSA 3AREB 4JPWH 5E8DH 2XWBB 1JNJA 3RVTD 2YRLA 3MNWB 4IRSC 5T1DH 1OOAA 1I3GL 4M7ZC 5BOPA 4U0QB 3AXLB 5D93C 5HVWA 5IJVB 1BD2E 2O5XH 1BQHA 5AZEL 4MD0A 5IB3B 3MA9H 2Q8BH 1H3PL 3GKWL 3ULUL 5EPMB 3ARGC 1KB5H 5E08L 4JR9H 1DFBH 1BAFL 2JK5A 4I0PA 5EULV 5ETUB 1UYWH 3K0WA 1PG7W 1S7UA 3DURB 3PABB 1MFDH 4O58H 5IFJB 2DMCA 2VUYA 4XMLH 2HMID 4PJFF 2YSSA 2VXVH 3O3AA 4K94C 2AJYH 4MNGE 5C07B 3IS1X 2IJ0C 3MV7E 1YEIH 3BPLB 3S4SG 3QEQD 4AEEA 1MI5E 1BEYH 4OZIB 3S7GA 2ARJA 1BM3H 2YUZA 1GYAA 4OQTA 2DQTL 3K4AA