4XP4H

X-ray structure of drosophila dopamine transporter in complex with cocaine
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/inhibitor
molecule keywords Dopamine transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 41
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp4H01
1V7NL 3G08B 4C4KT 3QDMD 1JWMB 1MELA 4GLRI 2R0ZL 6FABH 3NCJL 5BCAA 5JOPD 1K2DA 2YA0A 3IDNA 1BQSA 2Y23A 4L5FH 4NFDA 4ZFZB 3FO9A 1EZVY 3WFCL 2VWEE 3WJJC 5KSBF 1NJ9B 4P2RE 1FFPB 1KPUA 3QH3B 1OVZA 5DK0B 5BOPA 5TQ0L 3VRLE 1P53A 4C56A 2Y7QB 1I9JL 2BVYA 2QQNH 2QHRL 3D39B 3MRFB 4PGBB 3G6DL 5ID0B 1CE6A 1BGXH 1KCSH 5KBNC 4LSSH 3P9WB 2X5PA 4Y1AE 3H8NA 3EKCA 4M6AA 4JFEA 1VENA 2C7UA 4HX1B 2I07A 4KJYA 4Y16C 3H9SB 5C0JB 3BP6A 3GMOA 4L3EE 2IQAB 4XP1H 3X12B 1NC2A 2LAGB 4JLRA 1KXQE 1MVUB 3PIQB 3Q1SL 4U3CA 2R1XA 3QDJB 1QRKA 4HIHB 3GMNA 4G80A 4NZTL 2JJSC 4JFXB 3EDDA 5ANMA 5HD8D 2BSSB 1UKSA 3IXAB 1IKNA 3WIIL 3EHBD 1W72A 4X9IA 5DT1H 5EPMB 1T0NB 1LD9A 4FQHA 3KPTA 1WSST 4UT7L 1DUYA 2R4RH 4HD9A 3UZEA 5I1AB 4CRPA 1IAOB 5FYLE 3OGCA 4DN4H 4NJ9L 4LNVA 4X83A 4YWGH 4AK1A 3P30H 4ZFFB 4OQTH 4M5YL 3NCFB 4Z7UF 4ZO6A 2APBA 2DM2A 3V6FB 5KSUA 2J1KA 3BDYH 3TEUA 4NJAL 3D85A 2YPKA 3AM8C 1A9BA 3V52H 1MHPH 4YQXH 4DWHA 5D6CA 4MHHG 8CGTA 1A6WH 3G9AB 3I6GA 3UBXG 1H0DB 3MCLL 5JXAL 1F3RB 2F53D 2YD7A 4X99B 3MODL 3BHBA 3OZ9H 2NY0B 3RAJH 1Q0XH 3W9DB 1X7QB 1XR9B 5EO9B 1OARH 2HT3C 4P23A 3EZ8A 4RGOH 5IUSA 5DMKB 1QYGH 3WE6A 5GRJL 2W1NA 1NCCL 2BSRA 4RWYL 2D0HA 1RHHB 4FQQA 4S1QL 1A1NB 4ODVH 4XPGH 4OUUA 3UYOD 4N5EC 3I3EA 4FZ8H 1QFUH 4OZFB 5E9DA 4JFOA 1HSAA 3OXRB 2IAND 1KLGA 3I85A 1A6AB 3KG5A 1LO0H 4MB3A 4RDQF 1D6VL 4JZJB 3FQTB 2HAZA 1F45A 4WWKD 4E42A 2J4WH 3MCG1 2XN9E 1MI5A 3VFWA 4U1HB 1SJHA 1U3HC 1TTFA 2A6IA 1F4YL 4TSCH 3WS3A 1JNHA 5IQ9A 3VFNA 4NO5A 3WFEL 1DSFH 1JF1B 1MIEH 4LCIH 4UZGA 4M6NH 2IAMB 4ZUVB 1JPFB 2VLKB 2XXMB 4PJ9B 4MD0A 4G8GD 3RI5K 5C09B 2DBLH 2OI9C 3MFFA 5B39G 4Y4HD 3GZKA 5DI8A 3ABZA 2ZUQC 3F6LA 1UZ8A 4GRMB 2E8ZA 5CSGA 5F7KC 1XF2B 1YY9D 3NIFF 4GKSB 5DHYA 2WBJA 1UENA 5J6HB 1U8OA 3IAQA 4CAGA 5BV7B 4RCAA 4ODXA 2X4PB 4NSKA 2Q8BL 2Z31B 3EDKA 4JFFB 1P7QA 3MNWB 2OZ4L 3QCVL 5EFIA 1KELH 4HIJA 5FYJD 4RIRB 1OL0A 3S34L 3BKMH 3I50H 1BJ1J 3DVNB 2C3HA 2IG2L 5CSZB 1HZHH 1E0OB 4XWOD 1JHTA 4HKXA 3MRMB 5IW1B 2VDNL 2E9BA 4JPIA 2PW1A 2R29L 1FFNA 2OQJA 1ORQB 3GHEH 2NNAB 3MRBB 5F7DB 1OB1B 5E24E 1JGLL 2Z92A 4Z6AT 3REVB 4Y8DC 3ARGC 3MACL 2H32H 2D0FA 3LD8B 2AJUL 1LO3H 2FLRT 1XCQA 1NGZB 4R2GC 3WUWG 4XVTH 2RBLA 5K9OB 4AEIH 4U1KB 2VKXA 1KN4H 1YNTB 3PGFL 4MB4A 3A6OA 3QQ3B 5BS0D 5KG9A 4KI5F 3DSFH 1EEYB 1KCVH 1ZEAL 4LLMB 3TBSB 4J1UA 4GH7B 4Q9RL 3K74B 4FQXC 2RHEA 3U0PA 2A73B 4RGMC 3TYGH 1KXVC 1ZTXH 1RIVL 3UBXB 5DJYB 2ZG3A 3FO1B 4I0PD 4LGRB 4DAGL 1S8DA 3S5LB 1M7IB 4LP4A 1KB5A 5ALCH 1OTUC 4ZQKB 2F54B 3G5XB 5DMJB 4M7KL 2R9HC 1KJMB 3L3OB 3UCRA 5ANME 3EBAA 3IDXL 4NQVA 1OP5H 2I24N 1H3PH 5DC4B 1HQRA 3S3SA 3MJ7B 3RWCB 3UP1A 5DYOB 4G3YL 1HXMA 1VADB 3HE7A 3WN5A 3QUML 4J4PC 4LVOC 1JGVH 3QEQD 4J2XA 3HFML 1P9MC 3TO4D 5DWUL 5GGSY 4MNQA 4YFDB 3T0BA 4QY8B 4PGJA 3O3AA 4ODSH 2P5WE 5J3HD 3W0WD 4QLRA 1SMAA 2NMSA 2DD8H 1QBLL 2W0PA 4TN9A 2ARJA 3TJEH 2A6JB 4G43B 5GGUB 3P4NB 2LU4A 1XGQA 3KPNB 5CZXC 2ZP0T 2VDKH 4NC1C 1KLFA 2NX5E 3D2UD 3QPXL 2OXGA 3VFVB 5T3XD 1GPOL 3QQ4B 5C0IA 1CXLA 4HUUB 3RTQD 4YHMH 4Z77B 4OFKA 1CDGA 3DRTA 3VD7A 5DO2C 1MQ8A 5B39B 1HDMB 1ZS8B 3AFLA 1QLRB 3BPNB 3NZ8A 3ZKMC 3INUH 3FQXB 1GZPB 4YEEA 3MV11 5GSVA 2CLRB 1T21B 1BBDH 3OAZH 3VFGL 5C2UB 1RMFL 4YHPA 1GC1L 5CIPB 1NUFA 2AP2A 4QHKI 4YHZH 1YNLL 3WSQL 1NAMH 2BZDA 3CCHB 5HBBA 1FVCA 1QSFB 4X4ZA 2H6PA 4PLKC 2EZ0C 5MI0B 1MRDH 4PJ5D 1RZFL 4PTTB 5FHAH 2CJUH 2W9EH 3AB0B 5DURB 3P4OA 4ZAKA 3U79A 4R26L 4Y2DB 2A2QT 1I1AC 4RMTA 1JL8A 2VL5B 1BQUA 2JIXD 3HPLB 2VQ1A 4QCIA 4PPTA 4ZUUB 3TN0C 2BRRH 4APQB 1T5XB 4R7DA 5E7BA 1KTKE 3BQUA 4HH9B 2CK2A 1YY8B 4JRXD 4LLUB 4HWZA 4PGDB 1S9KC 2DQFB 3EGSB 4JAMB 3U30B 1ZHNA 3T04D 5T1KD 4XCFL 1PGRB 2Z91B 5I76B 4GUPA 1EGJH 2VR5A 4TVPH 2X4NB 1YUHA 5E2WL 3WUWB 5EU3A 3E6HA 5CBAB 3F58H 2GFBA 4OI9A 5IV2B 1CGXA 3I3BA 3NCYS 5EZLB 3WO4B 5IFJB 4FQLH 3QSKB 1EERB 3FFDA 1G9NH 5JQHC 5D7LA 2YPVL 2CK0H 3X14B 4LLQB 4PD4K 3IDUA 1HINH 2B39A 5BVPH 2A38A 1VFAA 4W4OC 3JZ7A 1MHEA 3UEZA 2XA3A 2AK4A 3CH8A 3D18A 2EE3A 4NN7C 3QWQB 4L4JA 4LSTL 4OLWH 4R97C 4QRRA 4OFPA 3EO0B 3JTTB 3PHOA 1UJ3A 1R3KA 2AXFB 1YMHB 4WI3A 3HUJB 3GJFB 5KZCD 2NY3D 1TPXB 2EXWC 1Q1JL 2C1PB 3T0EB 2R0KL 2A74B 5I1LB 4FTVA 2DQIH 1A1OA 1FL5A 1RVFH 4I4WB 3MUGA 4Q74A 2DLEA 1U95B 1UM4L 2DJUA 2LFGA 1ZLWK 5KW9L 2F5BL 1OW0A 1T5WA 1NUDA 1ZT1B 5IB5A 1L6ZA 4OF8A 2NY5L 1KB5L 4YBQD 1AJ7L 3T0WA 2XACC 5HYJA 2X4OB 1JHKH 1NFDE 3G5VA 1IGCH 1MJUL 2FD6L 3VXSD 1LE5B 1FZOB 4HT1L 4D0BB 2D7MA 1EX0A 4D8PA 1G7HA 2BERA 4JREC 1FH5H 4BELD 1U92B 5ID1B 4WFFD 1ZKAA 1MFDL 1V7MH 4NC0B 4C58B 4PG9B 4UUJA 1F90L 1ADQA 2L0DA 5F6IC 5C0FB 4N0YH 4KFZC 3K3QA 3ISWA 1E4KA 5KSBA 2F8VA 3MV8B 1I8MA 4S1RL 1YEEL 1QUNA 4KKNA 4BFBD 1YEJH 4CMHB 3PQYE 4M00A 3DX6B 1GGIH 3MNZA 3TT1L 1FZMA 1WT5C 2JK5B 4ERSH 5DJ2A 5I8CA 5DK3A 2UZYB 3NA4A 4MNGE 4YFLF 5IMLB 3BKYH 4NNXB 1R3IH 2Q7YB 3R4DA 2R23B 2JELH 4W68A 3BZEA 1H15B 1FZKB 5KVDH 5LAXB 4X0KB 4DZ8B 1QG3A 3V0VA 4TPRH 4GW1B 2BNQE 1DBMH 1KNOB 1V3MA 4MJ4A 1F2XK 4X7TA 3LH2L 1SMOA 1MNUL 5D2LB 4XNXL 1N6VA 1CVRA 2XFXA 3JWOL 2C4XA 5TF0A 1BOGA 3IRPX 3L5XH 1A3LH 1T22A 1BZ9B 1IMHC 5FO8A 1R6VA 2CR3A 5HVGB 1UC6A 3UTZA 4QNPE 4HFWB 5C9JA 2CQVA 2ED9A 3IDMA 4LPYA 4PJAB 3HG1D 4HG4K 5TPWH 2MFNA 2HVJA 1JP5A 1MWAB 4S1SH 2VUYA 1TJGH 1QQDB 3E3QC 5K59F 3IFNL 4Z7UA 1QVOB 5D70H 4P46A 1FNHA 1CXKA 4U1JB 2V2TA 1RIUL 2ZZUT 2XNAB 2UYLA 3RDTD 2LVCA 5DD5L 4QOKE 2AI0H 3T2OA 1RUPH 4D9QD 1Q9OB 4P57B 3QG6A 3VXMA 2VDPH 1BX2B 3U2SA 2VLLA 3QHZH 2VLJE 1JZ2A 4Z18A 1J5OH 2E7LA 1A0QH 3X13A 5IVXF 3V5HB 5J6GB 4MB5A 5CJXA 5I6XB 5IEHB 2D31B 4YR6B 3ZE0E 1MAML 1RQ5A 1LQSR 1Q8MA 3SOBH 3HNSH 1K8DB 4JZOB 5E08H 4OLVL 4P3DA 5DRNB 3T3PE 4ZUSA 1MCCA 2VDLH 1VFMA 1MF2L 1LDSA 3EOTL 2YD6A 4CVXA 4OLXH 2AJYL 5GGSA 2YD9A 5EULV 3WFBH 2N7BA 3VWKD 1UQSB 4OJFL 2XQYK 1QFPA 1RJYB 5I1IL 5HPMA 2CLZA 4UV4H 4QHMA 1A7OL 1T1ZA 5IBTL 2CIKA 3RFZC 4V1DB 1JYVA 2Y4SA 1SJXA 4F37F 5I73B 1L9NA 3SJVA 1OAYL 1V3JA 1NCAH 2DS4A 3UTSB 2MKWA 3VD3A 1WCQA 4KQ4H 5EZJA 3M8OH 5GS0H 5I30L 1KEGH 2J2ZA 1I1CA 2X1WL 4LCCA 4GKOA 3RPIB 3WD5L 4P23C 3QUXD 1FBIL 4JPWH 4PYGA 1A7NH 2V17L 2CDGB 2YMXH 4V2CB 3PWVB 5J1SC 4K2UH 5T1LB 3HUJF 4OIBA 5F3BB 1FAIL 2QQLH 5FCUL 3U6RA 3FQRA 1T0PB 5I0DA 3O6FB 1W2KT 4R4BA 5L6YH 4K94L 4JFPA 1GC1C 3L7EB 4TVPE 5GRUH 2NY1B 4AIXA 3ZDYF 1JUFB 4XP9H 4YK4C 4HUVB 4RAHA 4HPYL 5JW3L 4WCYH 2XKNB 2HJLA 1ODAA 4HGWB 2R2HA 1XF5B 5D5ME 1UWXH 43C9A 4QHNA 4ZDHB 2O61B 1L6XA 3MUY1 3IVKA 2DKMA 5CP7B 3FKUS 5LBSH 4Q9QL 3P0YL 2WLZA 4JZNA 4PRPE 2ADFL 5T33H 3G08A 1DQML 3R06B 5E8PB 2NXZC 2ARWA 4KMQA 4JG0H 2AJ3B 4MJ2A 1WIOA 4YDLC 4WO4D 2M8XA 1DANU 5DC0A 4BFIB 4ZFZA 5EIVA 3GHBL 2WBJC 3S35H 3N1FC 3LRHA 1CGSL 4IJ3B 1FFPA 1FSKC 1WAAF 3QH3A 4EOWL 3VRIB 3AGVA 1A7QL 2Y7QA 3D39A 3MRFA 1K6QH 5ID0A 4TTGA 1YPZB 3VFPB 1TQBB 4S11A 5IT2L 1JYWA 4NNYB 2J88L 5C8JB 1IZJA 3U9PL 5M94B 3ZSSA 3HZYB 5JPNB 4MD5B 1AI1L 1NBZA 5C0JA 3X12A 1IAIH 1Z3GL 5FKPA 3DXAD 3PIQA 2Q87A 2E6JA 2IGFH 3B43A 3I6KA 4KVNL 4NQEE 3QDJA 2CDEB 4RFOL 4JFXA 5D2LF 4EDXB 2BSSA 3IXAA 5GRWA 5L9DH 3R0NA 4L9DA 3IXTB 4GBXB 5EPMA 1T0NA 1UEYA 1DEEB 1K8IB 2E8YA 4NUGL 5HPOA 2Z8WC 4PJAF 1G6VK 3U7YL 1IAOA 3UC0L 1WUNT 3OKYA 2B1HL 4ZFFA 4UOW1 5F7EH 3V6FA 15C8L 1FE8L 3UPCA 5ETUA 3SE8H 1DL7L 2NTSP 4YXKH 1CBVH 4RISH 2EEDA 3VMOA 4HZLB 3TA3C 4M4PA 4X99A 1RZGA 3B2VH 4KAQH 2ZJSH 3LS5L 2DF3A 1X7QA 5ELIA 4OM1L 5EO9A 1UCBH 1P4BL 5DMKA 3AVEA 4PV8A 4F8QA 1T1WB 4TSAH 5JW4M 3BP5B 3HE7C 3WN5C 1RHHA 3MV9E 4L4VB 5E8DL 1A1NA 4D0CB 4Y16D 1HKLL 4IOSD 5JXEA 5CHNB 3ARSA 4OZFA 5GGTA 4BH7B 2MNUA 4AL8H 4NZUH 3ZL4H 3F7RA 2VO5A 3OXRA 3JWDH 5D1XC 1EHNA 2EYTB 4JZJA 3QAZB 3VCLA 4PY8I 3FQTA 3MRRA 3QIBB 1IJ9A 4I0CC 5ITBL 3NBNA 1PEWA 4U1HA 3MBEA 1RFDL 1JNLH 3NACL 1JF1A 3OKMB 3QFJD 1BQLH 2I27N 5EA0H 4CU8A 4UTBH 3ULUL 2IAMA 4KY1H 4LQ1A 1JPFA 3HS0B 5F8QC 5C09A 3O2DL 2DLIA 1H3WM 4ZS7H 3ZKNC 4HWBL 4XBGB 3RRQA 3SDXB 1XGTB 5ISZE 3NIFE 4DKEL 5EG6C 1DANT 5T5NF 5IHZB 4OF0A 3QUZB 3TLRA 2CKBH 5HHXL 1AGFB 1XF2A 4GKSA 4JY6B 1EZVX 2GUOB 3DROA 1FJ1B 4G6KH 5J6HA 4JFQB 3M07A 4M1DH 1CFQA 4LK4A 4X7DC 1P69B 2P46B 1FL3B 3V8OA 3OKNB 4KRMB 4WJ5B 2VQUA 4ZXBB 3GSVB 5JIHA 4JFFA 1S7TA 4ZAKC 2JCCB 3MNWA 5E1HB 4N5ED 3M1BA 2DQDH 4RIRA 1NLBL 4XHJC 4Z7QE 1QA9B 3W5NA 4PJDB 3DVNA 4LCYB 3BQUC 5IW3A 4XCCH 2HWZL 4OLUH 1CICB 4OD3H 3QNXB 2DQHL 2AERT 4PRPB 1A6TA 3MRMA 4IOIB 5HYIA 4UT9L 1CDHA 1WZLA 2O5ZL 4ZOAA 1U3HD 4AY0A 5HTSA 1ORQA 4GW4A 2YN3A 1ZA6B 1OB1A 3K1KC 4U2ZA 5IIEB 4LSVL 1YQ2A 3G5YB 4KU1A 1NGZA 2HT4C 4JRYE 5K9OA 5C0GB 1LK3L 5T1DL 3QZWG 5I1EL 4R7NB 4U1KA 1I3GL 4QT5B 3VMNA 3QQ3A 4ZTOL 1X5GA 5SWSE 1EEYA 5C07B 1IKFL 4LLMA 4FQJL 5E2VH 1WBXB 1U8MB 1DJSA 1MCJA 2DMCA 2P5ED 1FYTE 3E8UH 2A73A 3GIZH 3T4AB 1CZ8L 1T2QH 1YPZF 5DJYA 3UBXA 4JM2B 4EDWH 1N59B 2NZIA 5CZKA 3HI6L 1QRNB 2PF6A 3S5LA 1M7IA 1W8OA 1FO0H 1A47A 1UADC 3SBWA 4AIZB 4ZQKA 2F54A 3G5XA 1UJ3C 3L3OA 3UZQA 3P9LB 5DLMH 5C86A 1KJ3L 5MEPA 3VW3L 1BOYA 4M7ZB 3MJ7A 3RWCA 1N7MH 2FZ3B 2UUDH 5GJTL 3DV4B 1VADA 4I2XB 2BSED 4HXAH 5C08E 2G2RB 3DHJA 1LP9B 4HQQL 5DGRA 1YDPB 5I19H 3W81A 3ZLQC 1A3RH 2AJVH 3NAAH 3ARVA 1SEQH 3TIDB 4YBLB 1VDGA 1CXEA 3LN4B 2DTSA 3K80A 4Y89A 4JCLA 3Q48A 5DQDH 4JHAH 1OW0C 4LMQE 4CVZB 1CFBA 1KPVB 2QADB 4JJ5B 2DQGH 1KPRB 4S10A 4U3XA 1K5NA 3VXOA 3QRGH 2A6JA 5GGUA 3P4NA 3DX8B 2H26A 3ARGD 1SBSH 3KPNA 4YHKH 4L8BB 4XAKD 4K94C 4R2GD 1PAMA 5DTFB 5F7YC 1FC2D 5CEXB 3NIDF 3AUVA 1IRAY 3QQ4A 2OYPA 3RHWK 4HUUA 4Z77A 4QTIH 4E41A 2BNUB 1WEJL 4HWUA 5B39A 1HDMA 2DLTA 4FQXD 4P0DA 5K9KB 1QLRA 4OM0H 1T66C 2DM7A 3FQXA 1WZKA 1A6ZA 2X10A 1GZPA 4N9GB 1NEZG 3GIVB 3KJ4B 4NFCA 4HULB 3MUJA 2RCSL 2YKLL 1KJVB 2YPLB 5CIPA 2XKUA 2JJVA 5HGHB 4EI5B 4HIEB 1OTUD 1T20B 2CSPA 3CCHA 3PUCA 5F7WC 1F42A 1IC4L 2WBWB 5CUSL 1TCMA 1QSFA 3AMKA 1YEFH 4EKXA 3EO9L 2OL3B 4P3CL 4YIQB 1J05B 4JJHA 3BPLB 1T80A 4Y2DA 5C3TA 3MLRL 5IVXA 3H42L 4P59H 4C4KO 3V79C 3FJTA 4HBCL 4MXVF 3RVXD 4HH9A 4TVSa 3LKSB 1JN6B 1YY8A 4CMMB 4LLUA 2DQFA 4JAMA 3TH4T 3O6MH 1MJJB 4WI2A 5IWLA 5KSAB 5CZXD 4A6YH 2DQTH 2EIDA 3DTXA 5I76A 2DQEL 4R96B 2X4NA 4J8RB 1AGBB 3MQIA 4OFYD 4Z76B 5CBAA 1ZA3B 1JBJA 5IV2A 1ZVYA 2NY6C 4DW2L 3ZYOA 4P46C 5DO2D 5EZLA 4ZO7A 5IFJA 1BQHG 3HMXH 4IRZL 1KSRA 4UAOC 4XC1L 3ZKMD 3AS0A 1AE6L 3KYOB 4NRYB 4ONHB 1YA5A 4UINH 4RX4D 4J3XA 4DFIA 4FABH 3GSQA 3TH2T 4NQXB 4F7PA 4KK8C 3JVGA 2JCCF 2QSQA 3QEGH 2E7LC 3BZFB 1G7QA 5CJXC 4M1GL 4KHXL 4P2RD 4TQEH 4R3SA 1RURH 2EYSB 1D5MB 3O0RL 3O4LA 4PRNA 4PLKD 2EZ0D 4Q2ZA 5DJZA 3EO0A 2DWEB 3JTTA 5L8JB 4PJDF 1YYLL 3PV7A 2ZCKL 3WXVL 5DHVH 2AXFA 1YMHA 1F3JB 3G9VA 5CAYB 3HUJA 3GJFA 1FN4B 4AMKL 1D6EA 1I1AD 2C1PA 2J6EH 4XT1C 3BISA 3T0EA 2PXYB 3TN0D 1PKQB 2MPAH 3K46A 4KROC 4B53A 1MOEA 1NUGA 1H5BB 4HK3N 4I4WA 5D2NE 2AEPL 4XPAL 5IR1A 4HUMB 4MCZA 3RU8L 1KYOJ 3RL1B 1C8PA 5EUOB 1R5WB 1I3RB 1ED3B 1ZT1A 4JG1H 3DVFA 4OI8A 2X4OA 1AO7D 3F7YB 4OCXL 3S7GA 1NMBH 4PJXB 3C8DA 4MSWB 3FHQA 4YC2B 3CFCH 2NYYC 5FYLD 1RZIB 4JM2F 3VRJB 4KTDH 4WFHE 1XAUA 4LCCC 5J89A 5ID1A 2YK1H 4LHJB 4RGNE 4JHWL 3MV7E 3WKML 1E27B 2IADB 1NEZB 2W9DH 4PG9A 3FZUC 3ULUC 1HXYB 5C0FA 3LN9A 1ZK9A 2PW2B 2UY6A 3G6AB 5KVEL 2HH0H 3MV8A 3ULVL 1WAAA 5TE7L 4YUEL 2A9NH 4G6JH 2P7TB 5EZIH 3QWRD 2K3TA 4JM4H 4G6AC 2Q76A 3MGTB 4AM0A 3S37H 4E9LA 4LASL 1Z9OA 4U0RB 1GOHA 4OKVB 2EXWD 1RUMH 1RU9L 1OHQA 3THMH 4BQ8A 5F71A 4G8EB 2R23A 3L6FA 1N8ZB 4P4KA 1H15A 1FZKA 4Z5RB 4X0KA 35C8H 4DZ8A 4MJ5A 3CDYA 2VH5H 3WUZA 2GHWB 1EJOH 4GW1A 3BD4A 1KNOA 2XTJC 4E41E 3I9GL 5D2LA 3P4MB 4MHHI 5D7JD 1BZ9A 3UBXI 5C9KA 1JYXA 5E2JA 4HFWA 2DYPD 2PYEB 1J10A 5GS2D 1OP5K 2BOBA 2ID5A 2W0FB 4PJAA 3B6SB 5LWYH 4K8RH 4KI5C 1MWAA 1BQHB 4ZMAT 1QQDA 3W11D 1QVOA 4OCWL 4U1JA 5FM4A 4WHTB 1GRWA 1NPUA 4G42A 4M61B 2A77H 2XNAA 4XVJL 4UOJA 1A02N 1TVBB 5JA8B 2G60H 3DUSB 4OCRH 4Z0XB 5IVXE 1YEKH 1Q9OA 4O4YL 4P57A 5JHLL 2ZCHH 5T5FH 5J11B 4UB0H 1DN2A 3OKEA 5HYSG 2BRQA 1BX2A 1FHGA 3LIZH 5ESVB 4R90H 4OF7A 3V5HA 5J6GA 5FOBA 1AKJB 4G6FB 5IEHA 4PS4H 4YR6A 2R1YB 1NH6A 4LARL 3OXSA 3V0WL 1K8DA 4KTEL 4XC3H 4UTAL 3D9AH 1PY4A 4XPTL 3MUZ1 5DRNA 4UNVA 4HMCA 1JCKA 1DZBA 5D1QB 5I1GL 1P6AB 3OAZK 1UQSA 3T0AA 4GKZA 1P7KB 5FUOH 4JN1L 3CVHH 3V7AG 5BJTB 1RJYA 3WL9B 5D96B 4Y5YB 4BQBA 4K7PL 1EVTC 4MX7A 3BKCL 4JFHE 1R3HB 1BVKB 4POZC 4V1DA 3BPCA 4NKIL 2DDQH 2GJ6B 2JB6A 4OCSH 3S88L 5KS9B 2AV7B 2DBJA 1KB9J 5I9QC 2B2XH 3QXUA 2MMXA 5DD6B 3BW9B 3O4LE 3UTSA 4C56D 4WFED 5MP6L 2NY0C 4L1HA 4ONOA 1FNSL 1O7VA 4BK4A 3S35X 4X5WB 3UTTB 5B3JF 2B4CH 4PB0H 4JFED 1F6AA 4OZIE 1T7WA 4ZYKA 3HC0B 1A5FL 5DD0H 3G6JF 5T1LA 1NC2D 5IG7B 3VXRE 3IU4L 5F3BA 1AGDB 2BOCB 2VLRA 2YD4A 4PV9B 3O6FA 5TE4H 4JZJC 3HC3H 3S98A 3L7EA 1YMMB 4NT6A 2R8SL 1KCUH 1GGTA 3GB7B 1UA6H 2C26A 2KZWA 5HVFB 1C1EH 5EUOF 1JUFA 1J7VR 2A0LC 3DURB 4HUVA 3MJ9A 3MBEC 3RIAF 4HPOL 3U0WL 1UWEH 4N0CC 4V2BA 4PIRF 2R0WL 1M05B 3QIWA 5SWZB 3VGAB 4HGWA 1XF5A 2C3WA 4GT7A 5IBLD 4PJCE 4WEMB 2IAMC 5HHME 4KQ3H 1UJTA 4WHYH 3PGCB 4ZDHA 2O61A 1FG2B 3K2UL 4HCRH 5CP7A 1JNNL 3D85D 4EN3A 1A64A 4P2QA 1CXIA 3FO2B 3ZE2F 1P7HL 4UDTB 1WWWX 2H8PA 1CIDA 2R15A 3R06A 3DUHA 5FK9B 3ARDB 6FABL 3LMJH 1H3UA 3SE4A 3GSWB 5J13B 5EUKA 1DQDH 4F57L 4L5FL 3WJLA 4BFIA 4YPGA 1MY5A 1ZLSH 5LGKA 1UH2A 5D4QA 5BV7C 2E7BA 2XT1B 4P23D 3TBWB 1YC7A 3KLDA 4NDMB 2QQNL 3VRIA 3GK8H 1QR4A 4L4TB 2BNRA 2BJMH 5JORB 1BGXL 1KCSL 1YPZA 4X6DE 3LQAH 1UEMA 3C9NA 4M3KB 3VFPA 4GRWB 3RNQA 1U2CA 1Q72L 1OGAE 5HYSB 5E9DD 3LKQB 4WU5B 5C8JA 3T4YA 3HZYA 1S7VA 3B5HA 3TO2B 4MD5A 5JPNA 3C6LB 4XP1L 3QFDA 1WWCA 4M8QB 3MRGB 4K3DH 3LKRB 1TJIH 1MI5D 1EUTA 5F89A 2D7PA 1MWAL 5DT1L 1PW3A 3GBNH 1REIA 3LD8C 3IXTA 4GBXA 4KXZH 3BEVB 3OHXB 4U6HB 1DEEA 1AY1H 1K8IA 4H26A 4YE4H 2XWJB 2ZUYA 3K1DA 4OCYH 5EO1B 3CFKA 2YZ8A 2F58H 4JEGB 1EK3A 5TFSL 3P30L 3GSXA 4ORGB 1SYSB 3DPBA 4OQTL 1OTTC 4KRPC 3EYOB 1NFKA 1TNMA 2GCYB 1MHPL 4YQXL 5C2BL 3SKNB 4JB9H 5ESQB 1A6WL 2WBJD 3W39B 5ERWB 1AR1C 2AKRA 4HZLA 4PREB 3O6LH 5DS8B 4M9OA 2R2EB 3SBWC 5B21A 3RAJL 1Q0XL 4LCUB 5CMAB 3RZCA 3CDGB 1MFAL 1ZT7B 1P7QD 5JIKA 1FG9C 4RGOL 3PWPB 1IT9H 4PBVC 4Y2OA 3MLSL 4ODVL 5J12B 3BP5A 4L4VA 3T65B 4NBXB 4D0CA 4YXLL 1UWGH 3I02B 3E0GA 4HKBB 2FBJH 5CJOH 3ARXA 5D7SH 4FZ8L 1QFUL 3CC5B 1OM3H 1K3IA 4OIIH 2V7NB 4IRJB 4BH7A 1IILE 1NSNH 1CLOH 2XWBB 2EH8L 4H88H 1LO0L 5HGAB 2R56L 4KZDH 1R24B 5M7QA 2EYTA 5HDBF 1U8JB 4PY7A 3ZKSD 3QIBA 4Q0XL 4JN2B 1T83C 5JLZB 1OOAA 5DZOA 1U8KB 2V9TA 4LCIL 1MIEL 2FATL 4AYFA 3HB3C 1MFBL 4XI5C 3SO3B 4M6NL 4S1DD 3LN5B 5KS9F 2WWMC 3GFUA 3KPMA 1CR9L 1NANH 1J0ZA 2DBLL 4WTXA 1JZ4A 3HS0A 4S2SB 3CFBA 4UQ3B 5C1MB 2X4SA 3ZKXB 2Z35B 3BPNC 4GXUM 4UILL 4XBGA 3EUUA 4GQPH 1XGTA 4ODTH 5GIRA 2PUQT 1DBBH 3A67H 1B90A 5IHZA 2GTWB 5L2KE 5C0NC 1BM3H 1MCPL 3NOIA 4JY6A 2VLRE 2GUOA 4A6YB 4YAQB 2D7QA 3FT4B 5MI0C 2NTFA 3RJQB 1FL3A 3OKNA 3HE7D 2X9WA 4W4NA 1RJLA 3AB0C 5CBEB 3GSVA 2AJXL 1QZ1A 2JCCA 3KPRE 3CK0H 3P11H 4Y2DC 5EIIB 1I4FB 3SCMB 4MNQD 1IGIL 3BKML 1I7ZB 2XZZA 3I50L 4APQC 3BFOA 1EMTL 1QSEB 2X9YA 4PJDA 4OGAD 4MGXA 3ZTNL 1A3QA 4Y19A 1HZHL 5H37H 4ZOBA 3SDCA 4O5LH 1G7LA 1HHKB 4P2QE 4IOIA 5K9JH 4M48H 3N0PB 2WW8A 3U30C 4KGJA 5F88B 2PCPB 3GHEL 5ECJE 5IWLC 1BPVA 3CD4A 3K4AA 1ZA6A 3OB8A 1RZ7H 4ORZC 3D0VA 1MFEH 3S3PA 4Z78B 3HR5B 4ONGH 3G5YA 3GSNB 3BD3A 1F4XL 3Q6FB 2OTUB 5LGHH 1GZQB 3WO4C 5C0GA 1KN4L 4R7NA 4QT5A 2OJEA 2OK0H 1DQLH 3PWUA 1U3JA 5C07A 1RZJH 4U7KA 2EO1A 4PJEB 3C8KB 4E0RB 1U8MA 3T08A 4QEGA 2UV3A 4LKCB 1WICA 3L3HB 1EJ6A 3JVGC 2C1OB 4JM2A 1AQKL 1CF8H 2DI8A 1N59A 1KV3A 2X40A 5FYJH 1QRNA 2DAVA 2V2XB 1OGTB 4AIZA 5J1TC 2W60B 3RGHA 2AXHA 3UXFA 3ZKQD 4U1IB 3P9LA 4WEUD 1IFHL 1LO5B 4JHZA 1CL7H 5F9DC 5EU6B 1H3PL 1JV5B 4X98A 1TPXC 1JI1A 5EU4A 4QXTA 5CP3A 4XHJD 3BO8B 2FZ3A 3T0EC 3DV4A 4I2XA 4XWGL 1JGVL 4XPFH 1YDPA 3BQUD 4MQTB 3LN4A 2ED7A 4LCWB 4MXWH 4ODSL 5AAWA 4JPVH 2DD8L 2HLFD 5F6HI 4CVZA 4JFDB 4OV6F 4JJ5A 3TJEL 1KPRA 3P3YA 2CLVA 1BFOB 3L9RB 3NIDE 4B5EA 4L3CA 1KYOK 1QPPA 4GMSH 2ICWB 2VDKL 2RJMA 2HT4D 3EAKA 3N06B 5DTFA 5FYKU 3CZFB 5CEXA 3RGVB 4P4RB 1J8HE 2C5DC 1PSKH 5D7LD 4BM7A 3I84A 1AD9B 1GGBH 3QT2A 4P5MA 5HJ3B 1RSFA 2ZNXA 2P8PB 4F7EB 3RL2A 5MEQB 4NQSB 4HBQA 3AAZB 4XXCA 5K9KA 3INUL 2P8LB 1Z9MA 3QIUB 4PRDA 1NLDL 3GIVA 1BBDL 2AK4D 4OGZA 4C83B 1KJVA 1VCAA 4QRRD 5DFWH 3CFJB 4KJWC 4CMHC 1D5IH 5HGHA 4EI5A 2VZTA 1NAML 4HIEA 1T20A 4HJ0C 4L3AA 3MJ8B 3RY5A 2NY7H 2NQCA 2ZOLA 1MRDL 4LQFH 5D1ZA 2ESVB 4P2OA 2Y07H 5FHAL 1ZV5A 3QDME 2OL3A 4YIQA 4FTVD 4MXVE 5FUZH 4P4KC 5JOPE 3G5ZA 5GRZA 4DTGH 4X7EC 3EOYG 3TESA 5DJCB 4ZFGL 5GGVH 4ZOEA 2BRRL 3DMMB 1ND0B 5AYUH 3N1QC 3P9MB 1YYML 4GRLB 1KN2H 3BGFB 4JFZH 4ODUB 4UIKH 3H3PL 3OKLB 4JQXA 4NHCH 4NRZB 5T3XH 4TVPD 1JN6A 4FXGB 4CMMA 5HYJD 1HCVA 4QRPE 1Q9LA 2R4SH 3CVIH 1MJJA 2BVEA 3TJHC 1FDLH 4G9FA 5E94B 5KSAA 1EGJL 2AS5M 4R96A 4J8RA 1AGBA 2ITDB 4Z76A 4ODBD 2J3SA 2XRAH 4O2EA 5IBUG 4BZYA 4ETYA 3F58L 3AXLB 3OV6A 5JUEH 4HEPG 4BFGA 4YFEA 4PP2B 1G9NL 1BAFH 3O2VH 3ROLA 4YEFA 2V5MA 2IQ9H 2ZKHH 3KYOA 4NRYA 4ONHA 5BVPL 4JDTL 1ZHLB 2Q8AH 1HIMH 4NQXA 4NUJB 5A2FA 1UKTA 3CFEB 2P45B 2WQ8A 1PVHA 5I6XC 4OLWL 1GSMA 2OM5A 3VA6A 2EYSA 1D5MA 2MTPA 2BY2A 5MENB 4ODHH 3RWJB 2DWEA 5EU7E 5ADPH 3DJ9A 2Z0BA 3S37X 3HNTH 5KJRL 2OR8A 3KJ6H 3G6JA 4H1LH 4GMTH 1F11A 3K4DA 1PKQA 1YJDH 5FGCE 1MUJB 2DQIL 4I9WD 3PDOB 2F53E 1RVFL 2Y9RT 4RAVB 4TUOA 2Q86B 4PJFB 4NGHH 3G04B 3RL1A 3KWWB 5EUOA 1R5WA 1I3RA 1ED3A 2O5YL 4O02H 5JR1H 1JHKL 4HK3J 5INDB 4PJEF 1IGCL 3C5SB 3F7YA 5I73C 3VXPB 1MVFA 3BXNB 5IB1B 2WUBL 4MSWA 1TQCB 1WFOA 2NY6D 1EBAA 4MS8C 1FH5L 2IANE 3VRJA 5C0BB 3DV6B 5HYQB 1PLGH 2DQUH 3T2NL 1DLFH 1KB9K 1V7ML 4AQ1B 1E27A 2IADA 1NEZA 1MSPA 4PRIB 1OAQL 4N0YL 5DJ0B 3VXMD 3BKJH 2PW2A 5DJ8A 1TCRB 5C0EB 1YEJL 1F58L 2P7TA 4P99A 5C0CA 1IL1B 5DFVC 4XHQA 3O6FC 3L3GB 1WIPA 3MGTA 4ERSL 9CGTA 3ROOA 1UVQA 1KJ2B 5JHDB 4CADB 1S7XB 2EO9A 2NY1C 2HKHL 4OKVA 4NZJA 2JELL 2WINB 3TPUA 5KVDL 1N8ZA 1D5XA 1F6LL 4KROD 4Z5RA 3LKOB 3EYSH 4TPRL 2DKSA 4PRBA 3DO7B 5SX5H 2D03L 4LSUL 5DVOA 2VXTH 1FRGL 4MVBC 3P4MA 4PJIB 1A3LL 1P4IL 1IEAB 2BK8A 1AQDB 4AH2B 2DQCL 3SE4C 3L3DB 5FYJE 5LG1A 3SJVD 2VN7A 3U9UB 3CXDH 5IBUB 2NYYD 5FEBA 3B6SA 3WJLC 5TPWL 2NW2B 2OL3L 2UUDK 1MPAH 4R0LB 3GMMB 4S1SL 1BQHA 2X4UB 4IJ3C 3EYFB 3IU3B 4WV1A 5MHSD 2XA8H 3ALXA 2W0KA 4FFYH 4LEXH 5AD0B 5DEGA 3FZUD 4M61A 1TVBA 1UB6B 3DUSA 4L8CB 4Z0XA 3O45B 2VXUH 4Z95L 3UPRB 2UWEF 1QLFA 3GM8A 3QHZL 2Y36H 3GI9L 4NPYA 1I8LA 2CDFB 5KVFL 1MEXH 4HS8L 5KVGL 1AKJA 5BS0E 1BFVL 3BAEH 3HR6A 4J3TA 2BY0A 2VOTA 2VZ1A 2BY1A 3VFUB 4G9FE 5E08L 3LVEA 1NC4A 1L0QA 2VDLL 2D0GA 3SDAA 2JJUA 3BWUC 5GS1B 3B9AA 4OLXL 4LLWB 4GBXC 3MRDB 1ULVA 3J7HA 3TFKC 5EORH 2XTJD 4KUZH 1AHWB 4F37K 3W5MA 2HMIC 5A2LH 1P7KA 3M17B 1IM9A 4IS6A 2JLLA 5DJ6A 4UV4L 4Y5YA 3VG0L 4JO1H 1HWGB 4L8SB 1FLRL 4G9DA 4RZCB 3SO5A 4XCYB 1U8NB 3GI8H 1R3HA 1BVKA 1J1PL 2EKJA 1IAMA 2GJ6A 5GS0D 4KI5D 5E1AB 5KS9A 4TNVF 1NCAL 2BXZA 1CDYA 4XMLH 5DD6A 3BW9A 3MOBH 4KQ4L 3FHAA 3W0WE 4AJ0A 3HRPA 2BVTA 3GO1L 3NGBB 4X5WA 1G1YA 3G6JE 1IGMH 4MDJB 3B9KA 5EB9A 4XXDA 4FS0A 3KXFA 2H1PH 1ZANH 4YO0B 3HC0A 1T0MA 2WV3A 5IG7A 2C3XA 1YEDB 3PWLA 2QQLL 5T3XE 3DUUB 5KOVC 5F70A 4FQIL 2BOCA 3QDJD 1JZ6A 4HK0B 5L6YL 4PV9A 1TZIB 3QAZC 2F5AH 3QIBC 1YMMA 1B88A 2D7TL 1F4WL 5GRUL 3GB7A 1YNKL 2HLAA 3H6JA 4XP9L 2IPUG 3KS0J 2LTQB 3FQUB 1M05A 1FC1A 4H8WC 2W65A 1EHLH 1QD0A 2B20A 4TSBH 4XCNB 5LBSL 2PO6B 3MLWH 4I77H 3BVNB 4PJ5E 3RY4A 1EFXD 2A9ML 5T33L 4POUB 3SPVB 3CMOL 4JQIH 3IJYA 4KDWA 5FK9A 3SKMB 2XYCA 3GSWA 3QUZC 3D69A 3RVTC 3IFOB 1F4HA 1KBGH 5C0CE 4G8GB 4OFIA 3S35L 4RNRB 5DD3H 6CGTA 1NGQH 3I75B 1HH9A 2F9BT 3VI4E 1CGVA 3TBWA 1OQXA 4Y4HB 4NDMA 4NWTH 2DJSA 5I15H 2XI9A 1BBJA 4L4TA 4ZXBC 5IB3B 5JXED 4ZNEA 5CJ5A 5HYSA 4EQ2A 4WU5A 4KDVA 3BH8A 4G5ZH 3EZJB 1INQB 4O58L 4Z8FH 3C6LA 1WITA 3SE9H 4NYLB 1EPFA 1CICC 1CT8B 4M5ZL 3MRGA 3BE1H 3LDBB 3LKRA 5DK2B 5EBLB 1R3JA 2ZOKB 2IGFL 1J86A 2EC9U 2XZAH 1CFNA 4LPTA 1GAFH 4QXUH 2A0LD 3ARZA 3MBED 5E2TH 3Q5TA 1BHGA 4N0CD 4X8XA 3OKOB 1UZ6F 5L9DL 3VI3F 3WLWC 2E27L 4WY7H 5E00A 1T7ZA 4NQCA 2YA1A 4FXKB 4J23A 2IAMD 3BEVA 3OHXA 4U6HA 4ZPVB 4MCYB 5C09D 4B7IA 1G6RH 4IDJH 3WFDH 4ORGA 4H1LG 3O9WA 1SYSA 3ZDXF 3QXTA 5F7EL 5A2IH 2IBZY 5KOMC 4A2MA 5MEOB 2ILLA 2GCYA 4RRPG 1MHCB 4AT6B 4YXKL 4JM2C 3SKNA 4RISL 3P0GB 4TUKH 5ESQA 4LMQI 3MRQB 4MJ6A 4FQ2H 3W39A 5ERWA 4PREA 1AFVH 3B2VL 3LZFH 4KMTL 2R2EA 3GMRB 3UAJD 2ZJSL 4Y5VA 4JKLA 3C2AL 3CDGA 4JFFD 1ZT7A 1UCBL 5IF0B 3SHSA 3QB7C 4M7ZC 1B0RB 2ZUTA 4PJGB 4I0PB 2QQQA 3D1MC 1S3KH 5CEZL 2GJZB 3VXSE 3VDAA 3I02A 4HKBA 3VH8G 5HDBE 3CC5A 4YBLC 3GSRA 2V7NA 4IRJA 1Z6JT 3MSPA 1WZ1H 3ZL4L 2BHYA 1Q9KB 3A6BL 3JWDL 3QWOB 4WFFE 5DRZB 2XWBA 4KMLB 2Y6SC 3QDGB 3QUMB 4EXKA 3ALPA 3T3ME 2C4FU 4K71B 5FKAB 3HN3A 5DVLA 1EFQA 1U8JA 1TJHH 5F7FA 5I2IB 4XNZC 3WEXB 3KR3H 1HKFA 3WYRA 2EDTA 4JN2A 4I48B 1EUUA 3QEQB 5JLZA 2WM0A 3QO0A 1U8KA 2HVKA 2VSDA 1JNLL 3TO4B 1N5YL 4HC1A 3V6BR 2VR9A 1U93B 2Z8RA 1G6RA 2M26A 4UTBL 1OT1A 5I74B 4KY1L 2GTZB 3LN5A 5F97E 5JW4N 4QHUB 3S4SG 3N85L 4H0GA 1OTTD 4KRPD 1NBQA 3P0VL 4B7LA 4S2SA 1OAZH 4WUUB 4ZS7L 4UQ3A 2ENSA 1EH9A 2Z35A 5KN5A 3KXFE 4NKDB 3KJ4C 4KV5F 4LPCA 1NDMB 2CKBL 1AR1D 3V5KA 5AG8A 2OR9H 4EI5C 4LBEB 4KKBD 3IFLL 2F54D 4G6KL 1XF4B 3HMWL 4RGND 4YAQA 3FT4A 3LOWA 5DSCB 4M1DL 3NFNB 1OAXH 5H2BA 5D1ZC 4P2OC 2VYRE 4TTDD 4DVBB 4JO3H 4X6EB 3BPLC 3S36X 3HRZA 5EIIA 5DZNA 3HG1E 1KT2A 3SCMA 4DOHB 1I7ZA 5DMIH 4ZUTA 4ZNCD 4YDKH 1QSEA 2K7PA 4XCCL 3RWFB 4OD3L 3SEPA 5I16B 1VEPA 4JQXC 5F7UA 5HXMA 2EIEA 2I9LB 2O26U 1G0DA 1NGYA 4MJIB 5F88A 2PCPA 4CL7A 5KSAC 2VDQL 1N6UA 5EIQA 1EHAA 2YD1A 3JSSA 4BH8B 3DECA 3HB3D 3IRZA 5GSRA 2KKQA 3HR5A 4XI5D 3LB6C 3GSNA 1ZLWH 1CN4A 2WWMD 1INDL 4E41D 2XQBH 3Q6FA 3ORJA 2OTUA 4JRXB 1GZQA 2OS7A 5BQ7B 1RZ8B 1BIHA 1JNJA 5T1KB 4M43H 3CSYB 4NO2A 5E2VL 3DNKA 4KRNA 5GS3A 2VRAA 1E4JA 4PJEA 3C8KA 4E0RA 4LHUB 1NMAH 3KPSA 3JXAA 2ADJB 3GIZL 4LKCA 3S9DB 1OSZB 5C0ND 1T2QL 3L3HA 4EDWL 2DMBA 3HZVB 2C1OA 5FCSH 1C5DB 2EIBA 2P8MA 1IGJB 1LEIA 2C9AA 3HNVL 1FO0L 2V2XA 2MWCA 1A9EA 3TV3H 1XF3B 4DVRH 2W60A 2RQ8A 5DLML 4U1IA 4NQTA 1LO5A 2JJSA 5DURD 1FNAA 5EU6A 1MCWM 1JV5A 3RWDB 4Y2DD 4CJ1A 5I1KL 4BUHA 4NQCE 2VZ3A 1U58A 3B2UC 2J5LB 4HXAL 2PXYC 2FX7H 3VH8B 5I1HL 5I19L 4WI9A 3V9FA 1GJIA 2DQJH 2AJVL 1H5BC 1SEQL 4MD4B 5B38G 4LCWA 1N64H 1PZ5B 2P4AB 2X7LB 3RWEB 4H25B 1XH3B 2AJSL 3TGXA 2NY3B 5KZCB 4OAWA 3QRGL 4JR9L 4LLDA 1BWWA 3MRPB 1QNZH 3RUGB 1BFOA 3QJHA 1SBSL 3L9RA 2XY2A 2HFEB 1IM3B 2ICWA 3BX7C 1RUKH 4UT6H 4YC2C 2X05A 12E8L 4EVNA 3CZFA 2Z8SA 3R8BB 1VGKB 3RGVA 4P4RA 2JB5L 4M1CC 1E4WH 4QTIL 5CD5C 1AD9A 2A6DB 5HJ3A 1QPXA 5F8RC 3AC0A 2Z9TA 3MLXH 4OM0L 4XBPB 1FNGB 3AAZA 4XP5H 2P8LA 3QIUA 1S78C 4RBPH 3MROA 1N2RB 2CRIA 4IM8A 4NWUH 4C83A 4U1GB 1VPOH 3KLHC 4PJGF 5IEKB 3CFJA 3B83A 3O4LD 5AAMA 1T2JA 3FMGH 3E6FB 3IJSA 1HNFA 3PGDB 3CNKA 4U0RC 3PHQB 1CCZA 3T0ED 2UWEA 3VJ6B 5FDWB 1RZKL 4PFEA 4GQ9H 5K93A 3O11B 5ADOL 5DJCA 4JDVA 1LILA 4I18B 1IC7H 2X09A 3DMMA 5IQ7H 3GSUA 5DFTA 1ND0A 4MAUH 3P9MA 3UZVB 2X4TA 2M2DA 2IPTL 4GRLA 5F93C 4ODUA 3OKLA 3NTCH 2QQKL 4FXGA 1VGEH 2HRPH 5I75B 3O6ML 4W81A 2X4QA 1N3NB 4A6YL 5ITFB 5E94A 3EJYC 3MRLB 2Q6WB 1AC0A 1JF5A 4NO3B 2HKFH 3TNMA 4DK6A 2ITDA 4UNTA 4MNHB 2WWKT 4FN0A 4GLRH 2OJZH 3C08H 4D9LH 5A1AA 3BRGC 5IGXL 3AXLA 3CZJA 3E2HB 1BD2B 3HMXL 3VDBA 3DXAE 3LV3B 2FJFB 4OZ4B 2OR7A 5BRZA 4PP2A 4O2FB 4PJ7F 5DA0B 3F12B 2ICEA 1IC1A 2EYRB 4HIIB 4JO2L 4ELKB 5C6PB 4AEHH 4ZO8A 3MV8D 1N4XH 1H8SA 4G8IA 3NPZB 5BZDB 1QEWA 1ZHLA 4QYOB 4M93C 3CDCA 4NUJA 2FJHB 5CLTA 1I8LC 1DVFB 3CFEA 3WNOA 3QRFM 4HJ0D 5D7IB 2VXQH 2QSCH 5L88L 2YWYA 3RDTB 5MENA 1CGTA 3T09A 5FM5M 4TRPL 4XMKH 5E4EB 3P40A 4O2CA 2JJTA 2WUCL 4NRXB 4ONFH 2V9QA 4P4KD 3SDAC 3BJLA 4BK5A 5D1QC 2MPAL 2GSGB 2FX8H 5JW4R 3VGGA 5I66B 4X9FA 4X6BB 4OD1L 3QEUB 5B38B 4X7CC 2A83B 5CCKH 2X1PA 4CVWA 2R69L 2I5YH 1CK0H 4RAVA 1VEMA 2Q86A 4BQ9A 3GMPA 4G6ML 4F33B 3G04A 5D96C 4Y5YC 3PABA 1JFQL 1MH5B 1TETH 1Q0YH 4W6YB 3KPSE 3OAYH 4KHTL 3MRJA 3TJHD 3RVUC 5E8OB 1HEZA 4PGCB 4KJPC 1F2QA 1YEHH 5INDA 1L0XA 3C5SA 3F8UB 3VXPA 1T2XA 1GGUA 3BXNA 4M03A 5IB1A 4BA8A 1A14H 3VFRB 5CKGA 1V7NH 3DV6A 5CLWA 4N0FB 1SBBA 3SGDI 3NCJH 4C55A 2L7UA 4AIOA 3MXWH 4BSWB 2W9DL 2H41A 5DJ0A 1JJUA 1MJ7L 1DP0A 2VE6B 4J4PA 3GRWA 1SJEB 3QFJE 1TCRA 5E56A 5C0EA 2A9NL 4G6JL 1B6UA 3UJTL 3G6DH 5GGRB 5FECB 4JO4L 1IL1A 3S37L 1T89A 3C5ZD 4I3SL 1KJ2A 5JHDA 1JRHH 1S7XA 4N8PA 3THML 1RAMA 2FDBP 2FO4A 4HZAA 2WINA 3RUGF 2JJWA 3VGAC 4F9PC 35C8L 3LKOA 3Q1SH 3MR9A 1BJ1H 4IBLT 3DO7A 1EJOL 1S5IH 2AQ2A 3TZVB 5EOCL 4PJBF 5GGQL 1I3UA 3WIIH 4XNYH 1BJMA 5JZ7D 3EFDL 4H20L 1IEAA 1CFVL 4AH2A 3ARDC 4OCMC 2HFFB 5J13C 5SV4A 1SEBB 4HAFA 5L2JB 1FGVL 2YD5A 4NJ9H 4IMLB 3U9UA 5DDHB 3UTSD 1R5VB 4K8RL 4MS8D 2QTEA 4YGVB 2PTUA 5F72S 3FONA 4M5YH 4YHLH 2P43B 4PRHE 5GRYA 1W0YT 3VGBA 2X4UA 5HDOA 3IU3A 2A77L 3QG7H 1JHLL 4OCRL 3NFPB 3MMEA 5C0AB 1CXHA 4L8CA 4GAYB 4WO4B 5JXAH 3O45A 4O51A 5T1LD 3MODH 2ZCHL 4FZEL 5IHUH 4M62L 3TPKA 4UB0L 3UPRA 3EOBB 3LIZL 3C6LC 2VLRD 2FH8A 5DFVD 1HHIA 3O6FD 2CDFA 3ARBB 3LEXB 1M1SA 2W38A 5GRJH 1NCCH 4RWYH 3AREA 3DI2B 4M7JH 4S1QH 2NY1D 3MCKB 1VFBB 1DUZB 4KC3B 3VFUA 4DN3H 4NQDA 4NQUA 4AENA 2UY7A 2MQ0A 5AYQA 3QIWD 5GS1A 1BIIB 4W70A 1I1FB 1UYWL 1U9KA 2J8UB 5T1MA 1V8HA 1JF6A 4PG2A 1D6VH 4X6CF 1GHFH 5GS2H 1EAPB 1AHWA 3ZZ1A 5FUOL 2WQRA 4EN3D 3CVHL 5BRZE 3M17A 2IPUK 4P2QD 3HI1A 2JE8A 3O9WC 5HVWA 2GKIA 3DGCR 3D3VB 3WFEH 4HUKB 4NM8L 4OZGB 4L8SA 4RZCA 3QBTB 4XCYA 1J11A 1Y6KR 3W82A 3BIKB 5F44A 4CU7A 4X9GA 5E1AA 3FT2B 3VXQA 2B2XL 1JE6A 5BW7A 1KFAH 1T7VA 1FORH 4Y5VC 3LEYH 2BNRD 4RAUB 5ALBL 1MRCH 2B4CL 1E28B 3TWCH 4K23L 3DIFB 1HH6B 4XNQB 5J12C 3RI5F 4XAKE 3NH7H 3BIAX 2ICWJ 5DD0L 1OP9A 4MA7L 4YO0A 5IW6B 3NCCB 3IJHB 3IB4A 2UVEA 4IRJC 4PR5B 1YEDA 1C7SA 3DUUA 2F15A 1KCRH 1JGDB 3NVQA 4X4MA 4HHAB 2Q8BH 3SGEI 1QP1A 4HK0A 5A16B 1LO4H 2OZ4H 4WGVB 3TYFB 1TZIA 3OGOE 4QRTB 4BYHA 1EHXA 5E6ZA 1CGWA 1KCUL 3C6SB 3S34H 3CFDA 1UA6L 5CILL 4K9EL 1CTNA 4GG6B 4GBXD 2EC8A 2X1QA 4ZUWA 1UWEL 3MOAL 4PTUA 2IG2H 4UOW0 1YN7B 3TFKD 4HUWB 3V6OA 1DQJB 3FQUA 4PJHE 3FB7A 4Z7WA 1FPTH 3GBLA 3SO3C 2HMID 4WTZG 4YZFF 4KQ3L 5IHLB 2R29H 4GAGL 1RZKC 2XIDA 1PG7H 3JV6B 4Y4FA 4HCRL 4YGAB 5JPMB 4UBDC 1JGLH 4XCNA 2PO6A 4GG8B 5D72H 3BVNA 3MACH 4Z7VE 3ZKXC 4HKZB 3IKCB 1FNFA 3SPVA 5H94B 4LEOB 5AUMB 2FGWH 3LKPB 1WC7A 3OAUL 1IAKB 3RKPA 4JDZB 5TH2A 1DQDL 4ZS6C 1KJ2L 3IFOA 5EOTB 1U8IB 2ENYA 5DVNA 1J8HD 4P5KA 2CO6B 4RNRA 3RZCD 1P4LB 3I75A 2RFXB 1F8TL 1CG9B 4OF5A 3FB8B 2GIYA 2ICES 1WK0A 2BJML 2XQYG 3LQAL 5IB3A 3MO1B 4XP6L 4YHNB 4NC1E 5GPRA 5E6YA 1W72H 3ARUA 3SCMC 3ZE1F 2QJDA 4M7KH 1G9EA 1X4ZA 1INQA 4HUXA 3MGOB 4NYLA 1CT8A 1YN6B 5GJSL 3T1FB 2FJGA 3QIBD 5EBLA 1UZ6E 5J4MA 2ZOKA 1MLCB 5EC2B 4J3WA 3WIHL 4N0UB 3RWHB 3X3FH 4RMUA 2VITB 3FQNB 1QKZL 1X5IA 4FXKA 1AY1L 1SY6L 1BP3B 4OCYL 1AD0B 4ZPVA 2F58L 4YHOL 1M71A 4KKAD 4FQCH 3ULSB 5KAQG 5EWIL 1T04B 1RUQL 4QRPD 1A6VL 3QPXH 4NCC2 3SY0B 5MEOA 4U6YB 3QUKB 3RVTD 1GPOH 1MHCA 5BZWB 4AT6A 2KL6A 4HIXH 1X5XA 5DRXB 1BLNB 2PR4L 3AS3A 3MRQA 3EYVA 3F62A 3AS1A 5ACLA 5HHOB 3QJFA 3GMRA 2HTLC 3H2WA 1KC5L 3HAEH 1I1RA 5E5UB 1QHOA 3OTTA 5SX5K 2Q3ZA 4JE4B 4NQDE 2P5EB 2ZUQB 5FO7B 1RMFH 5IF0A 1GC1H 1S5HB 2EDNA 1B0RA 2YXMA 1ZOXA 1YNLH 4PJGA 1AO7E 4I0PA 5IVOA 4WU7A 1AGCB 2GJZA 4EUPB 5IB4B 4LSQL 4CW1A 5D7SL 4NN6B 4Y19D 4DUVA 1OM3L 3T2QA 4OIIL 3SDCD 2EDHA 4OZHE 4DEPB 1DBJH 3UROR 1RZFH 4K3EH 5IK3B 3QWOA 3NMEA 5DRZA 4KZDL 3N1MC 3QDGA 1IGTB 3QUMA 5I8OL 2PYFB 5FKAA 1XF1A 1KIRB 5CINL 3SDDB 5I2IA 3WEXA 2DL9A 2D4DA 3WLWD 4Y4KB 1DQTA 4ENEC 3FO0H 4I48A 1AXSB 3GUTB 4ELME 2CPCA 4F7MB 3Q5YA 1U93A 4B0MM 2GY7B 3RGVC 1ERNA 3QR2A 4FHBD 2GTZA 1PX3A 2CRMA 4GS7B 4KXZI 3ZHDA 5C07D 4QHUA 1ZT4B 4P9MH 4LLYA 4JKPL 3T0VA 3LRGA 1WCBA 3O81A 4WI4A 4WUUA 1ZWIA 4LDLB 4LSDA 3S3JA 2B7DT 1V3LA 3DYMA 3QIUC 4ODTL 5JMRA 4NKDA 4JM2D 4R2GB 1VESA 1DBBL 2NZ9C 3A67L 5L8LB 2APFA 1BM3L 1QRND 1KGCD 2DLHA 4N8VG 5GZOC 5F96H 5IKCA 3ARYA 1I1YA 3BYYA 3HAEA 5F7LB 1ITCA 2YPVH 2ADIB 5HHQB 1XF4A 4PJ7A 1WGOA 5HI4C 1EO7A 3U36A 3X17A 3EYQC 1VSCA 3C5JB 3NCEB 1R0AL 4KK6D 3ZTJG 1NGPL 1RULH 4X6EA 1X5YA 4N1HB 4YDIH 4J6RL 1KTLB 4Z7WE 1SYVA 4GG6F 4HMDA 4WUKH 1Y0LB 3DMMC 4GXUN 3FAXA 1JTPA 2Y6SD 5CD3B 5I8KH 1X3DA 3QP3A 3CPLA 4GRLC 3WNMA 5I16A 3BGFC 4W6WB 5K9JL 4M48L 4EBQL 3WLBA 2I9LA 2R0KH 4J3VA 4KKLD 3MTRA 4MJIA 2J12B 3HI5H 3BZ4B 4ZSOB 2PETA 4OBRA 4C57C 4BH8A 3H3KA 3ULUF 2O5XH 3OJ2C 2BFVL 1UM4H 3KYNB 5EN2B 4EXPX 1FZJB 2IH1A 5LGHL 4O9HH 3NABH 1KB5H 5BQ7A 1RZ8A 1HHGB 2OK0L 5T1KA 1XGYL 3CSYA 2EKSB 1NANI 2IBZX 4HT1H 3L3JB 4LHUA 5HHVL 1I85A 2EDRA 4PB9L 2ADJA 1OSZA 5F1NB 2FL5A 3L3IB 3LY6A 2NR6D 4EI5D 3QUYA 1CF8L 2VQTA 3HZVA 1MFDH 1C5DA 3RWGA 3FQWB 5FYJL 1IGJA 4DFHA 1Z0NA 1FCCA 2IH3B 5D1ZD 4P2OD 3O6KL 2JJTC 1K9TA 1CL7L 2HFGH 3S36L 1BVLB 1YEEH 1J1XL 2VJXA 3STZB 1QHPA 2ATKB 1DBKL 3VH8A 4L8DB 4P2RB 3UTPD 1KIUA 4XPFL 5C71A 1LNUB 3E3QE 5J56B 3PJSA 1NEUA 4C56E 1WWAX 4WFEE 1C5CL 4MD4A 2XV6B 2X7LA 4I5BB 1IBGH 3O3BB 2JTDA 1XH3A 3C60B 4G9FD 1J0KA 5KSAD 4Y1AB 4MXQC 2QR0B 4NKOB 3MLYL 4JFEE 3X3GL 3RUGA 3IDIB 4TULL 2OX5A 2MHAB 1OP3K 3LB6D 4FQ1L 4L3EB 2Q20A 1NCBL 1JPGB 4PJBA 4F2MB 3TA3A 1TQCC 5JQ6H 4K9EC 1VGKA 3TNNA 1NGWB 3FFCA 1NKOA 3QDHA 2N4IA 2YRLA 5DA4A 4XBPA 5IHBA 1FNGA 2SEBB 1TZHB 3QNYB 1J12A 1N2RA 4JGUA 4LIQL 5A3IC 2A6KB 4XVSL 3EYUL 5IEKA 5JOEA 1RK0B 4CJ0A 3BGMA 3R0MA 5HI3C 1IGYA 1WF5A 3E6FA 4WI5A 5D1XA 1HHHB 3PL6B 3PGDA 5DD5H 3SQOH 3K2MC 4LU5L 5TF1H 4ACPA 3B3IA 1T89C 4LQFL 1OTSC 1LO2L 3BH9B 4FQPA 4L29B 2KPNA 4Z7NF 3B2UD 5FUZL 4MZ3A 2I9TA 5FDWA 3CFIC 1NBVL 4NN7B 1CL7I 2EDQA 3MRKB 1MAMH 1MCKA 4LDEB 2K1MA 3GM0A 4I18A 5JNYA 1HILA 5AYUL 4OLVH 1KN2L 1UT9A 4NHCL 5T3XL 4R6UA 1QBML 3CIQA 3EOTH 3K4ZA 3BN3B 5FM8A 3MRHB 3KDMA 3VXUA 1FDLL 1N3NA 4PRAB 3GGWB 4X6CA 5E9DE 5AG9A 4OJFH 4FFZH 1IQDB 4PLJC 5I1IH 4LFHD 5CFHA 2XRAL 4MNHA 4R0LC 4M1CD 4NNPH 4PJ7E 5JUEL 4CN6A 5CD5D 2NXYD 3NZHL 3C87A 5D7JB 1BD2A 2AQ1A 3LV3A 2FJFA 2PN5A 2XN9B 3O2VL 4OZ4A 1BFSA 1EVUA 1MI5E 2IQ9L 2FHCA 2DYPB 4N1CA 4G7VL 1S78D 4FA8A 1HOCB 1S7SA 1OAYH 2H9GB 4HIIA 4ELKA 1X5HA 3KLHD 3NN8B 2EDLA 5BZDA 2BCKB 1HIML 4QYOA 3IDGB 2IPKB 5C0CD 1A7PL 4LNRB 2FJHA 2AK1H 3SDYL 1DVFA 3RKDC 4MYWB 4IRSB 1CU4H 3AREC 4ODHL 4OGYH 1AGEB 3QULB 3HNTL 1Z9LA 4NRXA 1J88A 4GSDH 5GS1C 3OPZH 3IKKA 4PG2C 4XZUB 5SX4I 5CEYB 2QL1A 1FAKT 3ESVF 3IDJB 5I66A 3O8XB 4K94H 1UCTA 3QEUA 1AHWC 4X6BA 2E9WA 3M45A 2A83A 4X7SL 1BEYH 4NGHL 2CXGA 3OB0K 4QHKJ 4X4XB 4HPYH 3PP4H 5E8OA 4L8SC 3EJYD 4MWFB 1TVHB 4PGCA 1ADQH 1IQWL 1UACH 1T7YA 3L5IA 4UQ2B 3KPOB 1AIFB 1CLCA 5FUCC 1KIQA 5IFHH 1T3FB 5BW7C 3VFSB 2DIAA 3VFRA 5LGJA 4PP1D 2R1WB 3VE0A 2E9JA 1PLGL 1DQMH 2EDFA 5ENWA 2Z4QA 4N0FA 3NGBC 4BSWA 3GHBH 2V7HB 5T3ZL 1ONQA 4PBXA 3FCTA 4DCQB 5ICZB 3DX7B 1SJEA 4EOWH 1AKJD 4G6FD 2YR3A 5GGRA 3O3EB 5FECA 2X44D 4X6FB 4NN5B 3VRLF 1V5JA 5JW4Q 1NC4D 5IT2H 2C7UB 2J88H 3SDAD 5F1KC 3U9PH 2I07B 2VMFA 1AI1H 3MC0A 4BKLB 5KANI 1J1OL 1UH4A 1ZMYA 3H7BB 4XCEB 1Z3GH 4MAYB 2LTQC 4PJBE 3V6OC 4OGXL 3BD5A 4BSVB 5IJVB 2KQNA 3EYSL 3NFSL 3VFTA 1IM9D 1X5AA 5ANMB 1W0VA 1NCWL 3FFCE 3TZVA 4Y4FC 1XGUA 1TTUA 1AP2B 2PO6C 3BGAA 3RVUD 4KJPD 1MHHB 4FQHB 4NZRL 3ZSTA 1DUYB 1TTGA 2GJ6D 4NUGH 1T1YA 3OGCB 2HFFA 4EQ3A 3U7YH 1SEBA 3CXDL 4MNQE 3QCTH 5L2JA 3UC0H 4XH2B 4IMLA 5FGBA 2P5WB 5DDHA 3CMGA 1R5VA 2VLME 3KGRA 4YGVA 1MPAL 4PJ8A 2FYYB 2YPKB 15C8H 1FE8H 2XA8L 3K8MA 3KYKH 4LEXL 4HLJA 3TBYA 3B9KD 4GAFB 3I6GB 3NFPA 1FNEB 2F74A 3KXFD 5C0AA 2NX5B 4GAYA 5E7FA 3ULVF 4LVEA 4YX2L 1G7MA 2IFFH 2VXUL 2NY4B 1ORSB 4F9LA 3EOBA 2E6PA 1YQVH 3LS5H 1MCQA 2YUVA 1X6LA 2IMNA 4P23B 5FYKD 3UJJL 3ARBA 4L1DA 4P2YA 1PX4A 1JGEA 3LDBC 1MREH 3BDXA 3BAEL 1YMMD 4DGVL 5E8DH 4LRIA 3VXUE 1S9VB 1VFBA 1DUZA 4IEFB 4OB5H 1HKLH 3QEHB 2DL2A 5C0DB 3EDEA 3OKKB 4TUJA 4X6CE 1WFUA 1HSAB 3ARQA 1KLGB 1BIIA 2YN5A 1ZHKB 3MRCB 4RBPK 4XWOC 3NPSB 4LVNC 4HWEL 1UM6H 3VFWB 2KZ1B 4TNVK 2HP4A 5E95B 1JNHB 4OV5B 1EO5A 1PG7X 3MZTA 5C6WH 4P49A 1C16A 1RFDH 2E3VA 3D3VA 2XPGA 1K85A 1IC5L 3JTSB 3MRIB 3N9GH 3GI8L 2R2BA 3ULUH 3VA2C 1G0XA 4MD0B 1CLZL 4QRQB 3MOBL 3Q2CA 5TDNB 4BZ1H 1ZVSA 5FXCH 4DKEH 5HI5D 4L4TD 3GKWL 1E28A 4J3SA 3DIFA 1HH6A 4M6OH 4LOUC 4XNQA 4I0PC 2H1PL 1ZANL 3QXAA 1G0YR 3C6LD 4XNMB 1JWSB 3DLQR 4ODWB 3ZT5A 5IW6A 4ODXB 1UM5L 4HKJB 4PR5A 3ZO0A 5HGGS 5JW5A 4ZODA 4NSKB 3KPLB 5D7LE 1JGDA 4HHAA 4YDVB 1NCTA 5A16A 4K71C 5EFIB 1I8KB 1CDBA 4KJQC 4OQ1A 1G9ML 3TYFA 2F5AL 3QQ9C 4QRTA 2W9LA 1NLBH 3C6SA 3ZDZF 4DKFH 1ZE3C 4NQCD 3SKOA 4GG6A 4YZFE 3TO4C 2AK4E 5TQ2H 2W91A 4HUWA 1JHTB 2DQHH 4QRRE 1DQJA 4JQVA 1EHLL 3FL7A 3HE6D 5EH1A 2J8HA 5GISH 3MNVA 5I74C 1FFNB 4Z7OE 2MKLC 2WIIB 3O9WD 2AXGB 3D87B 2Z92B 3JV6A 3MLVL 3BUYB 3MLWL 3PV6B 1MCOL 1XGRB 3U7AA 4GG8A 4HKZA 3VD9A 4JQIL 1Z0MA 5H94A 4FTVE 5AUMA 3LKPA 4K55A 2N1KA 1IAKA 1LK3H 1QBAA 4JDZA 5T1DH 3O2DA 3X11B 3T1WA 3OF6A 1JWUB 1KBGL 4ZTOH 5C70A 4HWBA 5D71H 5EOTA 1U8IA 4HEME 1P2CB 5DD3L 1NGQL 4NC2B 2RFXA 1E4XL 1CG9A 5HYJE 3FB8A 4K7FB 1NFDB 4KKCC 5DUML 2XOTA 4JVPA 3MO1A 4YHNA 3OAYK 3SGJA 4AG4L 4ZD3L 4IRJD 2F19L 1VEOA 5GQBA 3STLB 1KJ3H 1HQRB 1YEGH 2CIIB 3BE1L 1YN6A 3FN0H 3T1FA 1HXMB 3BT2L 2WWKO 3RA7L 1TDQA 1MLCA 4X7FC 4XBEH 5EC2A 1U6AH 1GAFL 4HQQH 1JWMA 3RWHA 5E99L 5KSBE 2VITA 1Z9SA 3RX7A 3PQYB 5AZEL 3EJJX 3BJ91 3QA3B 2XKSA 3VGDA 1AD0A 1NJ9A 4MNGB 5DK0A 4UBDD 1XGQB 1FGNH 3UYPA 1V3KA 2H32B 3WXWH 1A1MB 1B9ZA 4I3GA 3ULSA 4PGBA 2ZUXA 4XB7A 5CWSB 5EO0B 2OP4L 1ZLUH 3MA7B 2FR4B 1JPTL 2XY1A 1I85C 2CMRL 3SY0A 4EJ1C 4LGPB 2YRZA 4P5TB 4WFGD 4U6YA 5LVEA 3TVMB 3QUKA 1EEQA 7CGTA 3RJDA 4ZS6D 5BZWA 3QUYC 4HX1A 5INCB 2BNQB 5B8CB 3H9SA 1BLNA 4I9WE 1Z5LB 2IQAA 3CU7A 1AFVL 4OZFH 5GGTH 1MVUA 5HHOA 1TZGH 4OFVA 4HIHA 2RCSH 5FO7A 5TDOB 1PD6A 2Z8VC 3RHWF 1E4XI 2ERJB 3SCMD 1PG7W 2J5LC 2QHLA 4YH6A 1AGCA 4EUPA 5IB4A 1QSED 1XIWB 3S96B 2H6PB 4Z7UE 5I1AA 1UH3A 5A2JH 4YLQT 3ALWA 1WZ1L 1I7RB 3EO9H 5IK3A 4P3CH 4CVUA 4NO0B 3P4OB 5IJKA 4QOKB 2PYFA 5FB8B 1PQZB 3CSBA 5LQBL 1D9KB 1KIRA 3SDDA 2VQ1B 3H42H 3MGAA 4Y4KA 3VXME 4HBCH 4R7DB 1L7IH 2WK2A 3Q5OA 2VLJB 1IGFL 1AXSA 2YUXA 2MQ3A 4NKMB 3GUTA 1H0DA 4WTZA 2NY5C 4LP5A 3BRDA 5I18L 1ZHNB 4PLOB 4K7PY 3VDCA 2BDNL 2FECL 4GUPB 4LSRH 3W9DA 4XPBL 1XR9A 5BV7H 3KPSD 1OAZL 4KVCH 1U3YA 3E6HB 1T03L 2GFBB 2EEBA 5CZVL 1O7SA 1EO8H 4DW2H 4U1GC 3R1GH 4DUWA 2OR9L 5TJWK 4IRZH 1HSBB 2HTLD 1A6AA 1AE6H 3MJ6A 1C5BL 2ADIA 3ZYIA 1OAXL 5EU6D 3C5JA 1VFAB 1CXFA 1B4RA 2QKIB 1NAMB 4HXBL 4KHXH 3SJVE 5CGMA 1CDCA 1KTLA 3O0RH 3QHFH 1CDIA 5DMIL 3DI3B 4KZEL 4LCWD 1YYLH 4I18C 4M6MH 1Y0LA 4ZUVA 1JTTA 2VLKA 1S7UB 4FRWA 4PJ9A 5MHSE 4QXGL 5F1SA 4AMKH 3ULUE 4FTVB 5I75C 4ENED 3FN3A 4YJZL 1QOKA 1A1OB 3BZ4A 4ZSOA 3JWOC 2AEPH 4GRMA 1RJCA 4XPAH 4RDQG 2Z93B 3RGVD 5CJQH 3KYNA 5EN2A 5IB5B 1HNGA 4I3RH 1FZJA 1D5BB 4WVRA 3E2HC 1QBBA 1RUAH 3V4UL 2HT3D 4AEEA 4Y8AA 4KI1A 1HHGA 4M43L 4U6TA 4OCXH 3UYRH 2X4PA 3QIUD 5E5RB 2EKSA 2FECI 1NMAL 2Z31A 3MUHL 4PY8J 2NZ9D 4D9RD 5L7XH 5D5MB 4OFYA 4PGEB 1NFDF 4LRNH 5GZOD 4FMKA 3QNZB 4JHWH 1DVFC 2XTJE 3FQWA 4OBSA 4PRHD 3WKMH 2XXCB 5CSZA 4UI2A 2D2OA 5HI4D 3EYQD 5J7CC 3RDTC 4ZFOL 2IH3A 5IW1A 2MCG1 4DVRL 5E4EC 3OJVC 1EAJA 4NBZB 4O00A 5KVEH 1I8MB 2NNAA 3MRBA 5F7DA 3BYTA 1BVLA 3V4PL 3ULVH 1T7XA 5TE7H 3REVA 3STZA 3MNZB 2CRYA 4MA1B 2APXA 4KI5E 3DMMD 4L8DA 3ZHKA 3OR6B 4JKWA 1LNUA 3RWIB 3JUYA 3VD4A 4GRLD 2YD8A 5FA4B 1YNTA 3D39E 5M95B 4HDIB 1RU9H 3LS4H 1JPSL 4I5BA 2YXFA 3O3BA 3KLSA 1CD0A 4X80L 5F9WB 3BZEB 3C60A 4RMRA 3TBSA 4Y1AA 5KTEH 1X5ZA 1QNZL 3E1F1 2QR0A 4P2CG 4NKOA 3V0VB 2EIZB 3IDIA 3L1OL 2MHAA 3H9SE 4ISVB 4L3EA 4KDTA 3FO1A 1RUKL 1G9MC 4RSVA 2X42A 1JPGA 5DJAB 4F2MA 5CIPH 1AXTH 2EH7L 4NQEB 5BRZD 1E4WL 3QDJE 2VKWA 1KJMA 2WIMA 5J9PB 1NGWA 3W2DL 4OI7A 2V5SA 1LK2B 4P9HL 2HVJB 1BECA 4OLYH 4QNPF 5DYOA 1LHZA 2SEBA 32C2B 4MMZC 4NWUL 1VPOL 2ARJQ 2I25N 2VDRH 2V2TB 3RX5A 2A6KA 3CX2A 4QY8A 4XVJH 3FMGL 1RK0A 3WS6A 3PL6A 4Z7NE 4WEBL 4O4YH 4U1NB 3RBGA 5JHLH 4G43A 3BH9A 2ITCB 1HHJB 5F3HB 5DMGC 3WHE1 2V5TA 2WP3T 5C0RH 1T83A 2AABH 3OJDB 4GQ9L 1DEDA 5H35B 1CD8A 3MRKA 3VFVA 3B4NA 1IC7L 5IQ7L 1EEZB 3EO1B 3PWNB 3TZVC 4MAUL 4U3HA 3V0WH 1GGYA 1MAJA 1B2WH 4KTEH 3ZE0F 1DDHB 1G1CA 2G75B 4MXQD 5GGSB 1ZS8A 1VGEL 3MV9B 3MRHA 5LXGL 3T3PF 5J06A 1KENH 2CLRA 1T21A 4PRAA 3GGWA 4JANB 3PWJB 2GAZB 5FGBC 2HKFL 4MQ7B 1B6DA 2CLZB 1NMCB 4QHMB 3C08L 4PJ8C 3WNPA 1A6UH 4D9LL 2R9HD 4K7PH 3S6CA 1ZGLB 2JKXA 2CIKB 3WNNA 5D7JA 2XN9A 3QXDB 4PTTA 3S88H 4CBPA 4XTRC 5BMFH 1HOCA 4J4PD 1N4XL 3GJFH 5FO9B 3NN8A 5EZJB 4F9LC 2VL5A 2BCKA 5AWNH 2Y72A 2NCMA 3HPLA 2VLKE 4ZUUA 2IPKA 5HI3D 4APQA 1T5XA 3FRPG 4LNRA 4TNWF 3ARBC 3P73B 1N0LA 2VXQL 5C09E 2QSCL 5HDQH 3U1SL 4IRSA 1OTSD 4U49A 5JHDD 5ISZB 4LRIC 4PGDA 5GXBB 3DBXB 3EGSA 2DI9A 3OMZA 1AGEA 2NY2C 3QULA 4OT1H 1FP5A 1WFNA 5KSVB 2Z91A 5KVMC 3IU4H 2MQCA 1F02I 2ZCLL 5HGBB 3ARRA 3SDXF 1O5DT 4OZFG 1QFWL 3D25B 3WUWA 2FX8L 4R4BB 1I7TB 3P4LA 3QZWB 3IDJA 3O8XA 5CCKL 4Z0BH 2R0LH 4FP8H 2I5YL 1SHMA 3DHMA 4LLVB 4XMPL 3WNLA 3QCUL 1DLHB 1CDUA 4X4XA 1LGVA 1TETL 4HPOH 3U0WH 4JFFE 2HJLB 3X14A 2R0WH 4LLQA 3I2CH 4MWFA 1TVHA 43C9B 4QHNB 5IMOB 1F3DJ 4PLJD 3WFZA 3KPOA 3TIEB 1AIFA 3HPJB 4K3JL 4OTXL 3VG9B 3K2UH 4U6VL 5D5MF 1A14L 4JZNB 1T3FA 1FVDB 3VFSA 1Z2KA 2R1WA 3GDBA 5TDPB 2VIRB 2VXVL 2FH6A 4NZDA 4OUOA 3IT8D 3MXWL 4AQOA 3A6CL 1XMWA 4F57H 5BOZG 1SJVA 1X5FA 2V7HA 1DFBH 3DSNA 4HJJH 2A74A 4JRYB 5I1LA 2DLFH 5AEAA 4DCQA 5ICZA 2BMKB 3DX7A 4IHOB 3RKDD 5IROA 5SWSB 3ARED 3TBVB 3DRQB 1U95A 3O3EA 2OMNA 3MLTB 4X6FA 4YXHL 5ILTH 1Q72H 4NQDD 1FYTB 4QF1B 1JRHL 4JKMA 1NBZB 4JVUA 2BX5A 4BKLA 4KRLB 2VDOL 3H7BA 4XCEA 5FKPB 2IBBA 1LE5A 4MAYA 1FZOA 3TBTB 1U8LB 4D0BA 1OLZA 4JQVC 4BSVA 3I6KB 5IJVA 2CGRL 1JZ8A 2F54E 5ICYB 1S5IL 1QFWI 1I9IL 1U92A 1MWAH 5DC9B 1CD1B 3N1GC 4XNYL 1AP2A 4PGZA 4OSUL 4X8JB 1X6NA 5FYLL 1YC8A 1EIBA 1LE9B 2QEJA 1MHHA 1W0WB 5C08B 3BRFA 3KPQB 4LGSB 4HF5L 5I1JH 3FTGB 3LEVH 3K0WA 3WCYA 1C08B 5TFSH 5C7XL 4XH2A 2P5WA 3MYJB 1LP9F 3DX6A 4YHLL 2FYYA 2JK5A 5ETUB 3ULVE 1EFXB 2HJKB 5C2BH 1MJ8H 3QG7L 5IMLA 3GJEB 4NNXA 4WDIB 5IP4A 1FNEA 2Q7YA 5I9QB 2NX5A 2DWDB 3SGJC 1RZGB 4F7CB 5LAXA 5IHUL 1ORSA 1JK8B 3S5LG 2NW3B 3MYZA 1MFAH 4H5SB 3BSZH 2ZG1A 4PV8B 3V2AR 4M7JL 3MLSH 1KG0B 1OAKH 3U82B 4YXLH 1S9VA 4DN3L 3N50A 3QEHA 4M02A 5C0DA 3L7FB 4A2LA 3OKKA 5K59E 4WNQB 2JF1A 1JRHI 3QISA 2EH8H 1DBAH 2ATPB 3AS2A 2R56H 2DIJA 1ZHKA 3MRCA 3T77B 3VCLB 1GHFL 4NM4H 3MRRB 4Y4FD 2J7LA 4L9LB 1QSFE 4RQQB 2PO6D 4Q0XH 4F7TB 1UXWB 3MBEB 4OV5A 4NP4L 1OAUH 1IE5A 2FATH 3JTSA 3MRIA 1MFBH 2GYSA 3CUPB 1IZKA 4FNLH 4OQTA 1CR9H 5E2UL 2ORBL 3CAFA 3D48R 1HCFX 4QRQA 1JGUH 3WKNA 1KTDB 1KFAL 2D31A 5TDNA 1FORL 4M8VA 4UILH 3LEYL 2EEAA 3WFHB 5E6IB 1MRCL 3TWCL 4JZOA 4X5LA 4H0IA 3KYAA 2ZUUA 1MCPH 3DROB 3U4AA 3NH7L 3MJ9H 2ZSVB 4XNMA 1JWSA 4NN6C 4ODWA 1CFQB 2DM4A 5ACMA 1P5UA 5D8JH 4DEPC 4HKJA 1KCRL 4P9HC 3ZDZE 3KPLA 4LPXA 2NLJB 2CD0A 4JY5L 1S7TB 5IJKC 5C6TL 1LO4L 2AJXH 4YDVA 3PF2A 3BMWA 1I8KA 3M1BB 3SDDC 3MXVH 1IGIH 4Y4KC 3VWJB 1EMTH 3ZTNH 5F1IB 1A6TB 4Z7QF 3CLFL 1MCHA 2IBGA 3KYMB 3EW3B 1FPTL 5D6DA 1J87A 1OCWH 4GS7C 2WIIA 4GW4B 1PG7L 3QQNA 2AXGA 4D3CH 3RPIA 4F58L 3BUYA 3PV6A 5D72L 1XGRA 1J0YA 3HUJE 2B5IB 1NFIB 1MQKH 1BJ8A 3T0EE 1N0XL 1F4XH 2CDGA 2FGWL 1MRFL 3AMLA 3MA9H 3PWVA 2NPLX 2B0SH 2DTML 3X11A 1H3XA 2YD2A 5D2NB 1JWUA 5CKAA 1TITA 5F9JB 1KEML 4JRWA 1P2CA 4KRPB 5DZLA 4Q6IB 1J8KA 3ZDYE 3RIFF 2EDEA 2CKBB 5IESL 1CVSC 1SM3H 4LOUD 4K7FA 3GBMH 1NFDA 1AQKH 4R8WH 3H9HB 5IFAL 4S0TD 4HMEA 4WI6A 1W72L 2XKNA 5EOQL 3LHPL 3IYLW 1IVLA 4RGNB 4PJXF 1IFHH 3MV7B 1GH7A 3QDGD 1X4YA 1A2YB 4PJ9C 5MEPB 3STLA 43CAB 4KJQD 2CIIA 1L9MA 2PTVA 3QQ9D 3BEWB 4HV8B 4P59L 4PUBH 4XWGH 3X3FL 5E8PA 3QI9B 3BESR 1GOGA 3MV8E 2AJ3A 1WAAE 2P24B 3PQYA 3RVXC 1WZMA 1F13A 3QA3A 1UXSB 1K5NB 1U42A 3VXOB 2YUZA 4CNIB 4MNGA 3OL2A 2H26B 4FQCL 2H32A 4WUUD 1A1MA 5CWSA 4XAWH 2FCBA 5EO0A 2YUWA 2Z31C 2EE9A 3MA7A 3OKDB 4LSSL 4QHLB 2FR4A 3WHXB 3UDWA 3GKZA 4P5TA 4NNYA 3TVMA 2UZIH 1MCIA 4HIXL 5INCA 2BNQA 5B8CA 4E41B 1Z5LA 3MLZH 4OLZH 5D2LE 2D3VA 2DM3A 1A4JB 1ZAGA 1A6ZB 1B4JH 1NLDH 5DUPH 4KKCD 3WIFB 2CDEA 4EIGB 5BVJB 4WENB 4EDXA 5TDOA 1FO0B 4PJAE 1S9WB 1U2HA 2ZPKH 3I6LD 2E5EA 2VWEC 1FFOB 5F1OB 2R4RL 1XIWA 5F9OH 3S96A 1WTLA 5D93B 1HK6A 2L4OA 1DBJL 4DN4L 4H8WH 4I13B 4K3EL 4YWGL 1I7RA 4NO0A 1PEZA 4MJID 4QOKA 3C60C 2NXZD 3BDYL 3MLPA 5FB8A 5IVXB 1PQZA 1D9KA 1M4KA 4ZFGH 3V52L 3FO0L 2VAJA 4KDTC 2VLJA 1YYMH 4NKMA 3H3PH 25C8H 1KULA 2IALB 3OZ9L 4N8CH 2UVFA 4P9ML 3DTXB 3EIFA 1OARL 3O2WH 4LHUD 1H8NA 1QYGL 3EDFA 1T1WA 5JDSB 5FGSA 4XPGL 3QUYD 2GI7A 2FX9H 4LLAA 4N68A 5CHNA 5F96L 5GGVY 1HSBA 1XFPA 2LABA 4XVUC 3WS6C 3PL6C 2DRUA 2VZUA 3K8LA 5I1DB 1INEH 4DGIH 4JDTH 3ULVC 3GSQB 3Q6GH 2J4WL 4F7PB 5CGTA 4URTB 3DARA 4V1DE 1RULL 2QKIA 1NAMA 4MQSB 2VB5A 2QSTA 1G7QB 4TSCL 4YDIL 4R3SB 1DSFL 4PRNB