5GS2D

Crystal structure of diabody complex with repebody and mbp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
226
Chain Sequence
VQLKESGPELVKPGASVKMSCKASGYTFTSYVIHWVKQRPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMDLSSLTSEDSAVYYCARYGVRGDYYAVDYWGQGTSVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Sugar binding protein/immune system
molecule keywords Maltose-binding periplasmic protein
total genus 41
structure length 226
sequence length 231
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D02
1QFUL 2FX8L 1T3FA 5KG9A 2NZ9C 3ULVD 4B0MM 9CGTA 1YEKL 1N59A 1XGUB 2V2TA 5GRYA 3H9HB 3VXMD 8CGTA 4PRBB 2K7PA 4QO1A 3MJ9L 1NUNB 2R2BB 3S35X 2DQFB 5ERWB 3MLUH 3CMOL 5CUSL 5DK0A 1EEYA 4WO4D 1OSPH 4MD0B 2GITA 2CLRB 4NM8L 4U7KA 2HJKB 4N0UA 4JPIB 2EDNA 3VJ6A 1MF2L 4PG2C 4BJLA 1BWMA 4TSBH 2XWTB 5I73B 3GSNH 1OAQH 5HHXH 3EFFB 3GSNA 3SGKA 2D7TL 2E6JA 4AMKL 5CINH 4BZYA 4GRLD 1KN2H 4I0CC 1OPGH 4NRZB 3LEXA 4FNLH 3MLTB 1B0RB 2DQIH 2XRAH 3SCMD 4W4NA 4QWWC 4HFUH 3FB7B 1ADQH 3EJYD 2WBJD 3JV6B 3TH4T 4M48H 3O6FA 1CXHA 3WO4B 5FYKU 2OTUB 3Q3GA 1IAKA 1XIWA 3O41A 5C70A 2SEBB 5IVXE 3TBSA 3L1OL 4WUKL 4Z7UB 3E0GA 5IMOB 3W81A 2NX5D 3VFVA 3SE8H 2GSIA 3F58L 3CU1A 1UB5A 2AV1B 5B3JE 2FLRT 4HIEB 3NIGF 5I1LA 1FFOB 4PJGF 1AJ7H 1KBGH 2IJ0C 2WBJC 4E41B 3SDAA 5MHSD 3F7QA 3HAEB 3CSYB 3LN4B 1R5VA 4IRJC 5H35A 2JJTA 2BSSA 3QDGD 3O81A 5JDJA 1DVFB 1VFAA 5J4MA 4CU7A 5DO2D 5CJXC 4NWUL 4POZD 4LCIH 4XVUC 3ULVF 1IC5H 2P5EE 3T3MF 2IADA 1YEHH 4XB8A 1S7XB 1AFVH 2VRAA 2VXUL 5E95B 3PHSA 3B9KB 4KGLA 3BKJH 4PLKC 4PJIB 4Y1AD 5IMKB 4K8RL 1JN6A 12E8L 2EDWA 4WEBH 4DZ8A 4LBEA 4X83A 3P40A 5T1KA 3RDTA 2R0WH 2ESVA 4L4JA 5I1IL 5MI0C 2MKLC 4NO5B 5D9SB 4DKEH 2DOCA 2WIMA 4XVUD 4OKVB 4NKMB 3VXUB 1C08A 5B38B 1NLDL 3EYOB 3G5ZB 1MCLA 4OM1L 4HLZG 1ZGLA 1QO3A 3RWGA 1DDHB 4XPAH 5CD3A 1INEH 1S7QB 4Z7VE 2A6DA 3VCLA 3TBVA 5IBUG 3PGFL 4K7PH 5BXFA 3IDYC 3E6FA 3V79C 3B8YA 4JO1H 4OIBA 1YNLL 4PGCB 3IAGC 3JTSB 1JPFB 1F3RB 3SDCB 2EE2A 2VOTA 1LDPH 1SMAA 5B39B 4L9LA 2X1OA 4J4PC 5IQ7H 5LXGL 5I6XB 1YEEL 3N0PB 5EO1A 2Q86B 2ED8A 3KG5A 1OM3L 1BOGA 3VFUA 1JNNL 4I2XE 3SE9H 5I1EH 3OAZH 4S1QH 4F33B 5CEZD 3VRIA 2HN7B 1BQLL 1I8MA 1CGSL 3TVMA 3UPRA 1ZT7A 2GJZA 1YYLL 4EIZC 2X4RA 3P4MA 4Z0BL 5DFVC 2EDXA 3U1SH 2F58L 1TJGL 5BRZD 1ZANH 3AB0B 1F4AA 4J4PD 4UQ3A 4L8SC 2EYRB 1EGJL 5I71B 2FB4L 4HV8A 1TITA 3ZYZA 4E41E 4XP4L 2ZJSH 4X8XA 4JZJA 3B9AA 5KSBA 2P5WE 4Z77A 4P57A 3OL2A 4GSDH 1BZQK 4GKOA 1V3MA 3B3IB 4NC2B 4HKJB 2F54E 3O4LD 1OAYL 4AT6A 1E4KA 1FGNH 3LH2H 1I1FB 3OKNA 5T5NG 1XEDA 1AXTH 5TDNB 1A7NH 5F9WB 4K94L 3P9LB 1XGRA 3VFOA 3PHOB 4O2EB 4QTHA 2AXGA 3FQRB 4QLRA 4NO0D 4WY7L 1ZLSL 1AGBA 3N9GH 3WUZA 2CRZA 3SJVE 1MCPH 1BOYA 4AJ0A 4LMQI 4DVRH 1T0MB 5MEQA 1ZOXA 1QPPA 2CK2A 3FQNB 3PE9A 2OXHA 2F53D 4Y4KB 4PJFF 1NBYB 2I5YH 4Q6IB 4ODBD 4NQDB 5F7MC 2M1KA 4WWID 4LAQH 1U8KB 2AXFA 2B4CC 1S7QA 1R0AH 1AD0A 1FNSL 4JM2C 3FO2A 1DDHA 2R4SL 4C56A 1UH3A 3JV0A 4ZD3L 4X9BA 5GS0L 2WANA 5C7XH 1F5WA 1C5BH 3DVGB 4RFOH 3FHQA 4OT1H 5JOPD 5B4MC 4PJFA 2J2ZA 3GK8L 4NKOB 1BEYL 3D18A 3LKRB 5DF0A 1RVFL 2NX5A 5ETUA 1AC6A 1EEUA 3C8KA 4HPYH 1BX2A 2HKFL 4F9LA 1FAIH 3DWTA 2VH5L 3H9SD 4JFZL 1CLYL 4M1GL 3MGTA 1HILA 3RVTD 1AO7A 4PRPA 2CGRL 1I7UB 1JGVL 2IFFH 3PWNB 2BRQA 1AQKH 4GKSA 2X9YA 3U30C 4YDIL 1R5IA 3TN0D 1FNLA 3IFPA 2NY2D 1F4YH 3G08B 2JIXA 2WBWB 1LVEA 1S9XB 1FG2B 2R9HD 4OCRH 1XF5A 5DJDB 3NAAL 1S9KC 3VG9B 1XGQB 1SBSH 1NBVL 4PB0H 5I1LB 3ZE1F 5I8CA 3I2CL 3PQYB 1TJHH 2VDPH 1U92A 3LQAH 1WWWX 3QSKB 2ED7A 4JFDE 2I25N 3GM8A 3BXNA 4JHAH 5DUPH 2DJ4A 5F96H 3RIFK 2D7PA 1I8IB 3TPUB 4N1CA 5LAXB 4C54A 2AJXH 2N56A 3ARGC 3RX8A 4YK4B 1RUKL 1KTRL 4QOKB 3QUXB 3DGGB 1XF2A 2IAMB 4LVEA 5DRXA 5AG8A 4K3DH 2VR5A 4CW1B 1EFXA 1TCRA 3DV4B 3X13A 2Q1EA 4NC1C 3ISWA 4NN6B 3IU4H 3F5WB 4UV4L 3TFKC 4UTAH 1J86A 3BPNB 4YEEA 1N5YL 4P2OA 1XR9A 3ROOA 4TNWF 4AG4L 1WBXB 2OK0H 3QDMA 3TN0B 2WINA 4OI9A 4PFEA 5K9QI 4Q9QH 4JAMB 3GMOA 2IALB 2P45B 4ETYA 3QUMB 4M6AA 4OAWA 5HHQB 2GITB 4GLRI 1T0NB 1NFDA 3FFCD 1DEEB 1KB5B 2HLFC 2Y1VA 1FFPB 2ICES 3NACH 4IMLA 4I3GA 2R2BA 4QY8A 35C8L 4GUPA 5J1SC 4G42A 3RVTC 1VA9A 2CJUL 2YD1A 3GMQB 4PJHE 1XGUA 2IGFH 1MJUH 4KKCD 4PRPD 2W0FB 4XCCL 4OLZH 3L3OB 2H2SC 2EXYD 3L5XH 5DQ9A 1ZLUH 4XWOC 2LQRA 3V8CA 4DK6A 4XP9L 4QT5A 2HFEB 4PGDB 2GY7B 1CDJA 1U8PB 3UTPE 4EDWH 3ESVF 2BVPA 4LLVA 4L4VD 2Y07L 4U6YA 5T33L 2VLJA 5HY9B 3VFSA 5KVMC 2OI9B 3SDCD 3U7YL 2DQCH 3SKNA 4U2YA 4LHUB 4FOMA 4MSWB 2FEEI 3JV4A 5C3LD 3MOBL 3HN3A 2DDQL 3MV7B 2AKRA 4GKNB 3TBTA 4J3UA 5DUMH 4QNPF 1JHLL 4JFPB 2WIIA 3QIUB 5H8DA 3KPLA 4IIQB 4JFDB 4U1IB 4WW1B 3V0WH 3VFPA 5E99H 3SDDC 1IGCL 1CDYA 1KJ3L 1GIGH 3MBEC 3CLFH 5EBLB 1Z5LB 2CDFB 1KSRA 2F15A 2W60B 3NH7H 4JKKA 1FIGL 3S3PA 1BFVH 1GC1H 4TRPH 3WEXA 2X4NB 1T89A 3U4BH 2O61A 1I8LC 4AZ8A 2E6PA 1QSFB 4JRWA 4QCIB 4M93C 2B8OT 3X12A 3UTSD 1VADA 3CC5A 3GGWB 4R90H 5SWZE 5D1QB 2OTPA 1RJZA 2LE9A 1G6RL 2EDKA 1WBYB 3NOIA 2AK4D 4KRMB 2D9QB 1QUNA 5GRVK 3RNKA 1QBMH 2H1PH 2DIJA 1GJIA 4DKFL 4NN5B 5J12C 1BBDL 2I27N 4W6WB 3FRUB 4UT9H 5SX5K 1UXWA 4QTIH 2NLJB 4O51A 1A6VL 3IB4A 5MERB 2WWKO 3K74B 4Z95H 1HK6A 3TEUA 1HHKB 1VDGA 2XNAA 5HHVH 4JFFA 1WZKA 3PP3H 5CIPA 1YMHA 4NPYB 3NZHH 1XAUA 3WIFA 4NM4H 4UU9A 4Y4FC 5EOCJ 1NCWL 4FZEH 4FFWD 5DWUL 1UADC 1GOFA 3W82A 4U2ZA 5C9JB 3EO0A 2W0LA 3N1PC 3KS0H 4HQQL 4ELKB 5DS8B 2ORBL 1JUFA 5IB4B 3SQOL 3WFBL 3LMJL 3HTLX 4HGMA 5F3BA 2Q7YA 4LSQL 3SKOA 4OZGB 3GMNA 1IZJA 1F90H 1SYSA 3OKOB 2NXYD 4YHZL 5ENWB 5MENE 4WCYH 2DF3A 1GCFA 2H45A 4X7CC 3EO9L 3QRGH 4KTDH 4QXUH 3RGHA 4NKDB 5DJZB 1A3QA 2HRPH 5IG7A 3JVGC 4UQ2B 1G7HB 5FUZH 3TZVD 1U58A 3PL6C 3ES6B 1DLFL 5J1AB 5HTSA 5I30L 4WFFE 5CP7A 3FQTA 4XPFL 3MA9L 4OGAD 2IC2A 3CAFA 5C0JB 4GW1B 5C2UB 2B4CL 3CSGA 4JB9L 1NSNH 4AM0A 4HUWB 4H0GA 3MUZ1 5AYQA 4D0BB 3DVIA 4OTXH 4ORGA 3CZJA 1QFWI 3MV8B 5I76A 3VE0A 1SY6L 2GQHA 3ALWA 3IF1A 3PL6D 4J3SA 1FFQA 3MOAL 1MJ8H 2O93L 4NQEB 5INCA 3LZFH 1AGDB 1QNZL 4GMTL 3VA6A 3VXNA 1ZA3B 4HWEL 5I8OH 2QADD 1MCNA 5CBAB 3D2UA 4OCXH 4YHNB 3EFDL 1DL7L 4KK5D 1DQMH 1KACB 3LEYH 1JPGB 3Q48A 1IQDB 4OZFG 4X7DC 5I2IB 4ZFZB 3IKCA 5M95B 5SV4A 3NCJH 4ZSOA 5JR1H 3VXSD 3IDGA 2F8VA 3EDEA 4HCRA 5DRZA 4N0FB 1KFAL 3RA7H 4JRYA 4QRQA 5AZ2H 6FABL 1A2YA 1DBBH 3SBWC 3QNZB 4FQIH 2HRLA 1KENL 4FQJL 3IVKA 3OKMA 3O11A 2HVJB 2AI0L 3SKJH 5D93C 1Z0NA 3N1FC 2OR9L 4O9HH 4P3CH 4PJ5B 2VC2L 1YN6A 4M7LH 2O5YL 5TGBA 1R3IH 5IROA 3O3BA 3K8KA 3MRBA 5CSBA 3QCUL 4LSPH 3E6HB 3GHBH 2YSSA 3BGFC 3HNVL 4OSUL 4P0DA 1KCVL 4MJ5B 2JKXA 1HINH 2X10A 1MJJB 4HG4J 4UT7H 3TIEB 4FQXD 3WYRA 1J88A 2Q6WA 2F8XC 8FABA 1G6RB 3V5HA 2IPKA 3M07A 4JCLA 1MI5A 3KHQA 1H8SA 1YEDB 3T0WA 3WE6B 2X9WA 3FN0L 1KPRB 1KG0B 3B5GA 1RJCA 1KELL 1NDGA 2R0LH 1D6VH 5T1DH 3TA3B 5LBSH 2J8UB 5HPOA 4XXDA 3UYOD 2NR6C 5CLTA 3SGEI 4U1JA 4D0CB 5GGSA 3X11A 4QHMA 1ZTXH 2A6JB 1DN0B 1P9MC 4GG6E 3GSVA 2WK2A 4YGVB 1KJ2B 2X4SB 3VGEA 5FO9B 1LK3H 1SJXA 4M6ML 4MAUH 1H3WM 4GS7B 1JZ2A 3ARGA 2CMRL 4PJXF 4HG4K 4I4WA 1MCWM 4ZUUA 3QUXD 4HS8L 3QG6A 4KKBC 4Y4FB 2F19H 5DA0B 4OZHF 2H26A 1S5HA 1D9KB 1ETZB 3QG7L 4KAQL 3L6FB 1P4LA 3IDNB 5ACZA 4OBSA 4NHCL 4EN3B 4X4XA 43C9B 1MEXH 1X7QB 1BBJA 3FQXA 1RZ7H 3O2DA 4G8IA 3WIIL 4XNZC 5IIEA 2AXJA 3C09C 5CBEA 5KOMC 2DIAA 1E4XI 2YRLA 3V6ZB 1T21B 3B6SB 1KPVA 5FECB 4PY8I 3IXTB 2P4AB 5HGDA 3H42H 3LRGA 5JPMA 1EMTH 3K7UA 1HE7A 4JPWL 1RHFA 3CFJB 3CJJA 5C0FB 2I9TA 1I1AC 1S7WB 3TV3H 4PTUB 1CK0H 5FV1L 3PGCA 2VUYA 2KDGA 4Y4HD 1CICB 5KS9A 4ONFL 5CEYA 5JUEH 4HFWA 3BOVA 2J8OA 3GSXA 3OKEA 5GS2D 4JLRA 2ARWA 4JQIL 1E27B 3ARYA 4U1KA 5EN2B 1GXEA 4YNYB 5JW3H 2FLBT 2W07A 1CG9B 4F7EB 2LAAA 3IDMA 5FGBC 1TQCB 5FDYA 1XF4B 1FSKB 2PCPA 4FQXB 1CXFA 3Q6FB 2WWMC 2AJVL 4MQSB 2DLFL 2NX5E 2WWKT 4CNIB 3L7EB 3ARFB 3PWVA 2Y7QA 3GBNH 1UG9A 4PJGE 3PIQB 5JORA 4HMEA 2XTJB 4HJJL 4HUUA 3MQIA 1GAFH 2H8PB 5ID0B 4R26H 2YR3A 3C9NB 1CCZA 3PL6A 1OP5K 2N1KA 3WNNA 1ZLVK 1QA9B 2ICWA 5SWSE 1U8LA 4PJ5D 1J8KA 5FYLL 4HULB 1FPTH 2QTEA 2R15A 3T0EB 4FXLA 3WSQL 1WEJH 4X6EA 4EBQL 1T7VA 3VGHA 3WNKA 1FNFA 4I48B 1PY9A 4K7FA 4ZTPL 3EOTH 4FXGB 5FDWA 1V5JA 1N8ZB 1G1CA 3F7PC 4Q7DA 4NUGH 3EJZC 5F97E 4QOKE 4XCFL 4N0CC 3O6MH 32C2B 1NDMB 1IKFL 4NDMB 5JA8B 3WFCH 2BNQE 4JGJA 5B4MD 3UPAA 1NL0H 4KTEL 3C2AL 4DVBA 4E5XB 5FHBL 5C2BL 2EDBA 1ZMYA 3BPCA 4PJIF 3MNWB 5ANMA 5AZEH 4WW2A 2XQBH 1EJOL 3IRPX 1WITA 4QRPA 2BC4B 3S98A 1WCBA 4PRHA 1KIRA 3K4AA 1ZT1B 2QSVA 3RZWA 4Z7VF 5KTEL 5DT1L 3T4AA 3WHXA 1F2QA 4MNGA 5EOQH 2FBJL 4PP2B 4YPJA 2JJVA 3TO4B 3GO1H 1KB9K 3C8HA 2NYYC 3I6LD 1FNEB 3ZKQD 3E2HC 4W70A 1QSVA 2UZXB 4G80A 3I84A 2XPGB 1HHHA 2CUIA 4ZUVA 4PJIE 3CFCH 1MIEL 2FJGB 3ZKSD 5HPMA 1A9BB 3GJFB 5D7LB 3FONB 2GJ6E 5GS1A 3CFIC 5IROC 1G9MC 3DETD 5E8EB 1BP3B 3ALPA 5FIEA 5BO1L 2HFTA 5IW1A 1JMZA 1LEGB 2QHRH 5ADOL 2OL3L 4G7YH 3MNWA 3MJGX 5F7YC 1TQBB 2K1MA 4AK1A 4DOHB 5BRZE 4LCYA 5J3HC 3DYMA 3GMMA 1XGTB 4YDJA 4ZNCD 2VLKB 1I7RB 5DDHB 1A9EB 1UCTA 5HJ3B 5TE4L 1DTUA 3R06A 4M02A 5L0QC 1NCCL 3L5WA 1U8JB 3QB7C 5HGAA 5E2TL 4KV5F 3DETC 1FO0A 2DICA 3D85A 3LDBB 3AUVA 4OKDA 3LY6A 4Z78B 3ZL4H 1ZWIA 3OR6B 3RY6C 4ZYKA 4ZFOL 5FDWB 2OP4H 3DI2B 5J56B 1DSFH 4OM0H 3W0WE 2H6PB 5DEGB 1T1WB 1R6VA 4X6CE 1QOKA 1HN1A 4LP5A 3V7AG 4QNPE 3U79A 1EDQA 2E27H 2IBGA 3MRLB 2YPKB 4I3SH 2FHCA 2RB8A 4I0PC 3TT1L 1D5XA 5DMGD 3ABZA 2C3WA 4KHXH 4FA8A 2CLZA 5F3HA 1JWSB 1QR1B 3MV9B 4QHUB 1RMFL 3SDAC 5TH2B 2O5ZH 3A6CL 4FFVD 1QLEL 4DW2H 3FFDA 1LP9E 1HYRC 3VXPA 4PV9A 1F58L 3DLQR 2PYEB 4X7TB 4K94C 2YD4A 2CRIA 2NTFA 4NOBA 1YMMB 3RP1A 1AGFB 1FNHA 4PJXE 3QXTA 4XNMA 4F3FB 3QXUA 4MD5B 4Y19E 4NBYB 2Q76A 4WFFD 3WLBB 1KN4L 4KY1L 3NVQA 3KJ4B 4JM4H 4A2LA 3AREC 1QRNB 5E8NB 3HMXL 3OBAA 2FYYB 3QQNA 4P3WA 4ODVH 2E7CA 3MRRB 2EYTA 2JCCB 2RFXB 2Z91B 2EDOA 5EBMB 1M7DB 2FECL 5CZVL 3RDTC 3WHE1 1BQSA 4D3CH 4YZFE 1B4RA 4R3SB 2NPLX 2OQJA 4PJAA 1QVOA 1UEMA 3HS0A 1TNNA 2ATKB 1L7TL 2VE6A 1PG7H 2GW5A 1HXYA 3SBWA 1LE5B 4BH8B 2R0KH 2NY4D 4H0IA 4HZLB 1LP9A 4YE4H 4EI5D 5EWIH 2X09A 5HHPB 1WUNT 4YHOL 1AR1D 1JNHB 2Y9RT 1P6FA 3OV6A 1A7PH 5LGKA 4NRXB 4NOFA 1S7SA 5IB5A 2VB5A 4XMKH 4RWHA 3BPLB 5E7FA 5E4EC 3MNVB 3ULUH 2DI8A 5A2LH 4Y4FA 5FKAA 1BVKA 4MLSA 3BH9A 2VZOA 2X1PA 3BDYH 4P4KA 5F1KC 2J12B 4QF1A 2GSGA 5L0QB 5SWZA 4J23A 3OPZL 4LKCB 3FB6A 4O00A 3HZYA 5ANME 2UYLA 1CLZL 1A7OL 1F6LL 4OIIH 1MFEL 2A6JA 1IGJA 2VITA 4RMTA 4Y16B 3ZDYE 3GSQB 5J9PA 1QLFA 4KZDH 4XI5C 2R2HB 4N0RA 3QDJD 4R7NA 5EZOH 3VXOA 3HMWH 2OTWA 4F7CB 2PO6C 2D03L 2GTZA 4POZC 1T7WA 1YEFH 2DD8L 5D5MB 4YDVA 1IGTB 2EE6A 4DUXA 3DXAE 4P2QA 1PQZA 4YR6A 2DQJH 1A14H 4O58H 5DVKA 2H3NA 1Q9LB 4GAFB 4BKLA 5FA3A 1A4JA 1JWUA 5C3TA 4N5ED 2NNAA 5IR1A 4PJXB 1T2QL 3DRQA 1QRND 2BOBB 5D1XC 3RWIB 3BP7A 4B41A 3L7FA 3VA2C 3F8UB 5I1JL 4GW5B 1G7JB 3MLWL 4YC2B 7CGTA 5IEKB 1NAMA 1JTTA 5C0IB 1IGFL 4C59B 3RZCA 1W2KT 3VI3E 3JTTA 3L5HA 2BNRB 4W81A 2FR4A 4HUXA 2FGZA 5GJSL 3QO0A 4P48A 3NCMA 1S9WB 4YGAB 2MNUA 1JP5A 1A6ZA 2IF7A 3WKMH 1X5HA 3BDBA 3VWKB 1FH5H 3QO0B 3EJJX 3KYAA 4LCCA 4NQCB 5BS0B 5JW4Q 4EI5C 4PY7B 3QIUC 1NUGA 5T5NF 3HNTL 1OB1B 4H25B 4R4BB 4FZ8L 4IRSA 5D8JH 3D0LB 2I9LB 1I1CA 1IQWH 2J6EA 1IARB 3IYLW 5D7IA 5L2KA 2AGJL 3WD5L 4MXQD 1I1AA 2VAAA 5HHMD 5E6ZA 4TTDD 1KCKA 2E6QA 2Q7NA 5FA3B 5D4QA 3NCBB 5F21B 1JPGA 5C08B 2ICWJ 3W0WD 1AO7E 3RPIA 3TJHD 3SGKC 4YDKH 4CGTA 2IANB 4NJ9L 3QIUD 4LFHG 2A6KB 5EC1B 1MWAA 1LMKA 5CP3H 4RGOH 3IF1B 3B9DA 1P7QD 1UT9A 2OJEA 4KHTH 4ODWA 3GNMH 1T1ZA 2D0HA 3HE6D 3DV6A 3KPMB 3O6FC 4XGZB 4IRJB 4X98B 5CILH 4NN7C 4BH7B 1IGJB 1EUTA 5IBLD 3D3VB 5HYQB 4X7SH 5FGCE 3KPOA 2XIDA 1QYGL 2DQHH 3HZYB 1SJHB 3O6LH 2AAVA 2BSED 1JZ8A 3QUZB 4X6CB 3EZJB 5JLZB 1MVFA 5I1KH 4U49A 1MHEB 1WQVT 4U6XA 1G7HA 1SJHA 1YJDC 3HLAB 2VKWA 3FQUB 3MTRA 3RQ3A 4OCSH 1P4IL 1BVLB 2ADGA 1OSZB 5F7DB 4YHPB 3QDAA 1RK0B 5FA4A 4PJDF 3VWJD 3GMNB 5I19H 4HF5H 5GGVH 4AEIH 3MRCB 5GS0C 1N7MH 3RGVB 3SE4A 1P9MA 3FRPG 2P5WD 1EO7A 4NHUA 4AY0A 2DQGH 3HPJA 5D7IE 5L2KE 1CD8A 3C08H 4D9LL 4Z7WF 3LV3B 5D1ZC 2IAMC 4PRPE 4TSAL 3UYPA 3TWCH 3QXAB 4E42B 4EN3C 5J6GB 3VH8B 4FQ2L 4FN0A 3FZUC 3VI4E 4Q74A 2IMNA 3M1BB 2BY2A 1WZ1H 5GGSY 2ZKHL 3V4VH 3CPLA 1MRCH 2R56L 1E6OH 3VXTA 1YUHA 2WMPA 4LCUA 3SDYH 1XFPA 4LDLB 4RFEB 1PW3A 5F6HI 1NJ9B 3MXVH 3RL2B 4YDLC 2IQ9L 4LVHC 2PF6A 3HRPA 2A9NL 3FRUA 3GIVA 4K7PY 2Q3ZA 4PJ9B 4G6MH 1CD1A 1N4XH 4KFZC 5CWSB 2NY3D 1WWBX 3VI4F 4XWGL 3WHE0 4K2UH 3VXPB 3R1GL 2WLZA 2HJLB 3JWDH 3QEQB 1DBML 4KMLB 1IBGH 5EUOA 5IEKA 5E08H 4LEOA 3G6AA 3L5IA 5KVEH 2VZUA 1JWSA 3WFZA 4OD1L 4GAJH 5GSRB 5IBLC 4M00A 1RUML 1H3PH 1FORH 3NGBC 4F9LC 5JMOC 3MRLA 4G8FB 5FUOL 5T3ZE 3ZSTA 4HGWA 4M5ZH 4ZPTB 4QYOA 2QSCL 4IS6A 2BVYA 4FFYH 4LIQH 2PXYA 2DWEB 4I77H 4YDVB 1E28B 5D5MA 4F37K 1RFDH 2LAGB 5F9JB 2CXKA 4KZEL 3BHBA 4PS4H 5T1KD 2PYFA 1MI5E 3T77B 4NIKB 1NMBH 3V4UH 4LRNH 4LAJH 4KPHL 2CK0H 2OTWB 2R29H 5DJ2B 3RY6A 1QBBA 4Q58C 2ZOKA 4KVNH 1GGCL 2YA0A 1A9EA 5DDHA 3QO1A 2BK8A 3HE7C 4PJ9A 1TETL 2X4UA 5E9DA 3HFML 2MPAL 4RGNB 1QQDA 2I07A 2J4WH 4AEEA 1P7HL 1M6OA 1H0DA 5L6YL 2A0LD 4LKCA 1YJDL 1ZHNB 4MSWA 3MUJA 4M7JL 2P8PA 2CDEB 1T1YA 1MSPA 4P2RA 3ZYIA 4OZ4A 4ZXBC 3SGDH 4MX7A 1CIUA 4FG6D 4S1DD 3DUSA 1RZFL 3V8OA 4LARH 3CDYA 3L3KA 3MREA 3QUYC 4H8WL 5F1NB 3SDDD 3DO3A 4E42A 5J6GA 4RDQG 5FF6B 3MBED 2JELL 4XC3L 3BZEA 2P5EA 2EO9A 1FYTE 1PKQE 5IWLC 4XVSL 3O0RL 2BMKB 4FP8H 3HS0B 3HG1E 4OZIE 1F4XH 4XCYA 5IHUL 1NGXA 3N1QC 4ZXBD 2R23B 5BW7C 3FMGH 2GT9B 3TJEL 1A3RH 3MRIA 4JVUA 5FA4B 3BGMA 4BQ8A 2CRMA 1UENA 4G6AD 3QCTH 1F6AB 4WVRA 3T2NH 4P3DA 2DYPD 4LNVA 4NDMA 2HG5B 3CFDA 1D6EA 3KYOA 2P7TB 2PTUA 4JJ5B 5IMLA 3OKYA 1MWAH 4B5EA 4YWGH 1E6JH 2DM2A 4P5KA 3RNQA 4K7FB 1A1NB 3WKNA 2M26A 4LSUL 2VZ1A 1T1ZB 5E8DL 2JIXD 2AP2A 1KIPA 2KUTA 5GS2H 5FYKH 1U3HD 1LD9B 3KPSA 4JRXB 4Z7WB 1UM5H 4JHWH 1LD9A 1TENA 5ID0A 1CFNB 4PYHA 1OARH 5AEAA 4MB3A 1KLUA 5C0CE 3GUTA 5F9OH 4F7MA 5GISL 1C12B 5JO5A 2H32A 4M1DH 1NGQL 3PQYA 3RVUD 3T65A 2EDLA 2VXQH 3EDFA 1A1NA 3D0LA 1TZGH 1EHLH 2ZSVA 2PN5A 1HEZB 2PCPB 4FQXA 3QP3A 3GSWB 5IVXA 3FO1B 4CVZA 4XH2B 3EYUL 4XVTH 5F93C 2UWEB 4KH2A 4YDJB 1F3DH 3MBEA 3ZTNH 3FQWB 4N0YH 2VWEE 3T1FA 4WHCA 3O9WC 5I75B 5C0FA 3BGFB 2BNRA 2X1WL 3MRIB 4KK9D 3RVXC 2E7LA 4PP1C 3RIAK 1FE8L 1RK1B 4JN2A 4PRPB 4JM2B 4NP4H 3BGAA 3OB8A 5C0EB 2ATPA 4QHKI 1WCQA 4GW5A 4GG6B 2DI9A 4H8WC 2XOTA 4ZUWA 4LSTL 5GS1B 3IT8D 4I3RL 1X6LA 3CXHK 4UIMB 3H9SA 3CVHH 1JFQL 3V0VB 4PRDA 4EN3A 3OGOE 1ULVA 4P2QB 2ZG3A 3HE7B 1RZIB 1KT2A 2BCKB 4JM2F 3KS0J 3QHZH 3VD3A 4FFWC 4HBCH 4Q2ZA 3VGGA 5CAYB 3BP5B 3UTTA 4AL8L 4X7FC 2XWBB 2R0ZH 4Y16A 4S1SL 1JF1B 2EDFA 2JB5L 1B88A 4PJEF 4ZOAA 2Q8BH 1NPUA 4XNUL 5C07B 3GMPA 5D7KE 4AIOA 5C0RL 1U9KA 4NJAL 2VXSL 4MNHB 5IJVA 15C8H 2A9MH 2XKNA 2C7UA 5D70H 5EU4A 1Q8MA 1MIMH 4L1DA 4ODHH 5D2LF 5GRUL 3QZWB 4MNQE 3CFKB 5F9JA 5A43C 3IJHB 4WI9A 25C8L 1YEGL 2OX5A 3MRJA 3ME0A 4JQVC 4Y5XC 3HB3D 3OQ3B 3DIFA 1T6WA 1X5XA 5DSCA 2NY5C 1NANI 4OCYH 1A6UH 1JL8A 4BH8A 3HC4H 5A1AA 5L8LB 3RY5A 1RU9L 3JSSA 1I4FA 1W0WA 3MUHL 3CIQA 3P2TA 1KXVC 1NMAH 1FO0H 3QEQA 2VUOA 4YBQC 4OLUH 3BPLC 4CNIA 3HG1D 3KWWA 4TPRL 1CD1B 1DQDL 2B1HH 5DR5L 2R8SH 4R4FH 5J6HA 1VEOA 3MBEB 4PJHA 2F9BT 3IVKB 5FYKD 5TJWK 5E8NA 2YKLL 1G7PB 5AUMB 5JZ7D 3LH2L 3QQ3A 2QQKL 3S5LA 3ZE0E 1G7PA 5AUMA 3KPPB 3GSXB 4K71C 2G9HB 4L9LB 2VLMD 5FHAL 4JR9H 1UFUA 3CPLB 1NMCB 2A38A 4XNMB 3VGAC 5HD8D 4PJBE 5I1GL 4ONHB 2XQYG 3RZCC 4NT6B 4B50A 4WDIA 4KRLB 2B20A 3VRLF 2V7NA 3GUTB 5FFLA 3DMMB 4YXHL 1NGPH 1RJLA 4RGND 4PG9B 2AJYH 5IUSA 1S7VB 4MHHI 1MRDH 3P3YA 1KEMH 4QXWA 4G8IB 4NWTL 1KIQA 3M17B 3F7YA 3A67H 4DTGL 4PJCE 1CU4H 2NY2B 2L4OA 3QR2A 5H94A 4PG2A 4LF3A 3D9AL 5FB8A 1S5IH 3T09A 3W39B 1OSZA 5F7DA 5K9JH 3ALXA 3LD8B 4J6RH 3TT3H 4P4KD 5D71L 3BMWA 4DCQA 2C7UB 2XKNB 5EU4B 2HKFH 1GHFH 3DRTB 4LHQB 4U1MA 4YHLL 5FGBA 3NA9L 4JY5L 1VFMA 3AROA 3DX9B 2X44D 3G04B 4LSRL 1OD9A 4NCDA 5EZLA 2DIBA 1NAMH 5DD0H 1OCWH 3LKPA 4PREB 3N85H 5ENWA 1I9IH 2UWEF 2P8LA 2PTVA 4RFNB 1B2WL 2GT9A 5L2JA 3MCLH 5E8EA 4ODWB 4YBLC 2XZAL 5ACMA 1TNMA 3V4PH 4E41A 1ZT4A 5BRZB 1NGXB 3DARA 4HS3A 1WISA 2ZUQC 2BCKA 2VLKE 2DTSA 4IIQC 3GJFA 5D7LA 5DHYA 5LJYH 4HD9A 4XCNA 1G6RA 2DBJA 3SGJA 1IC4L 1N0XH 2PR4H 5CJ5A 4PLKD 4G80B 4RIRB 4XNXH 4CJ0A 2YHGA 3V6BR 4L3EA 4AEFA 3RKPA 5IEHB 2SEBA 3TESA 3L3KB 4K3JH 2AVGA 2Z31C 5JQ6H 3RWDA 3GIZL 1VENA 4N8CH 2UWEE 3Q3GB 2OTUA 3RAJL 2YSSB 1MH5B 2OI9C 3QDGE 4NPYA 1DFBH 2GK0B 1I9JL 1T1YB 2VMFA 3HAEG 3SE4C 4B7IA 5IB1B 3UJTL 3RKDC 4BFIB 3UZQA 3VWKA 2CO6B 2HMID 4NGHL 1U36A 4GRMB 1FDLH 3VG9C 4FQQA 4Y5XB 3UROR 2IAMD 4XC1L 2HTLD 4ZS7L 3AU1A 1ONQB 4EI6B 3DBXB 5TF1L 3AMKA 2QQQA 4G6KH 3FO1A 5C6WH 4NFCA 5C0IA 1V8HA 4XP1L 1HZHL 1B4JH 4NQEE 2E7BA 5BW7A 5DJ0A 4Z7UF 4R8WL 4FTVB 4YX2H 5IESH 4PJ8D 4XP5H 3M8OL 3LS4L 3R8BB 5HI5D 2O61B 2MWCA 2ESVE 2HKHL 4LQFL 4ZPTA 2VLRD 1JPTH 2HTLC 4G43B 1BQUA 2BNRD 4ZQKB 5GGTA 5KG9B 1PKOA 5FYJE 5IM7A 3HMXA 3VXNB 1D5IH 3KPSB 3NFPB 1L9NA 4Z7WA 3ETBF 3ECBB 2LTQC 4NO2A 2PUQT 3ARFA 1CDCA 4OZHA 3BP4B 3U7WH 3QH3B 3GI8H 5J89A 3GSQA 1EK3A 1T7YA 4JFPA 3HE6B 5C0JA 4LSVL 3GMLA 4U1SB 4HX1B 4N8PA 1BM3L 2KKQA 4DGIL 2AKRB 1BWWA 5CEZE 2MQ0A 2W9EH 4GBXD 2QL1A 2Y06H 4JVPA 5HHOB 2FJFA 3CFDB 4OZFH 4UQ2A 3VXTB 4TSCL 5C08D 3WFDH 5CHNB 5FAAA 1J05B 4JGMA 3ET9F 4MQ7A 1P69B 4F7TA 5ESVA 3M1BA 3PP4L 4PTUA 3ZE0F 4HIJA 4KRPB 2DM3A 1QLRB 4JVWA 3RX7A 3CFJA 2APTA 4NQXB 1SYVB 3HC3L 2A77L 2VXTL 4L29A 4DKAA 4ZFFA 5KVGL 1IFHH 5TQ0L 3ROLA 4Y5YC 3B6SA 4GBXC 2AJSL 4TUJA 3LV3A 1MREH 5F72S 4P9HL 2CKBH 4IRZH 1HWHB 4OGXL 3THML 4KV5E 4TUJB 2X9XA 1AXIB 1G9EA 2NY1D 1WAAA 5JHLH 1T4KA 2BSTA 4IMLB 2ZWLT 2VXVH 1A02N 5JOFA 1FC2D 4DQOL 1XCTB 1PGRB 3AB0C 5A2FA 4WWKA 3Q5OA 1HQ4A 2R9HC 5EBWA 1WWAX 4U31A 2Z9TA 1F3JB 5CP3A 5L9DH 3QCVL 1UCBL 1H0DB 1A6TB 3RRQA 5IFHL 3RU8H 1KJ2A 1AGCA 1CZ8H 2F5BL 5E8PB 1EERB 4Y5YB 2HP4A 4PTTA 4ZAKD 4GXVL 1SEBA 1OGAD 4FQ1L 4KKNA 4KI5E 4HH9B 3ARRA 3GZKA 1BIHA 4D0CA 5TE7H 1MLCA 1XR8A 3KPMA 4P99A 1LHZA 2HT2D 3AVEA 1YNTB 3KLAB 1O5DT 4M9PA 3JBG7 4MAYB 3MLXH 3O3UN 2OJEB 4M3KB 3ECBA 5JXAL 5I18H 1A4KA 1QR1A 1SJVA 5DQJA 2CLVA 1UM4H 3BHBB 4ELMA 3R4DA 1T03H 5I8EA 2BRRL 3CFEA 2OJZL 5GS1C 4DWHA 2PXYB 5KW9H 3RVWC 2VL5B 4HJGB 3UMTA 1A6WH 1IEHA 4F8QA 1KCUL 2G2RA 2VN4A 4O4YL 4BUHA 3WFEL 1SM3H 3S36X 5I1HH 2H2SD 4TTGA 1IAIM 3MLVH 3O6KL 3RTQD 2XA8L 5D6DC 3TYFA 4IRSB 3BUTA 2Q3AA 4KROB 1FO0B 1HKLH 5C08E 1LO2L 3BP6B 4XNYL 4NUJA 1Z3GH 3VRJB 4UOW0 1P84K 1RHHB 4IIQA 4NQCA 4P23B 5BS0A 3R06B 1YY8A 2C26A 3PJSB 3LEVL 4Y5XA 2BZDA 5ITBL 5DJYB 4F57L 4FQLL 3K2UH 3P4NB 3ZDXF 4M7KH 1LP9F 2BFVL 1E4XH 4H88H 3VW3H 1AP2B 5IW1B 3U0TA 1JHTA 2XY2A 3LRHA 4XVJL 1HXMB 3MGTB 3UX9B 2BSRB 5FGCB 3MV7E 4U6YB 4LCWA 5AAWA 2W0PA 1BFSA 3ARED 4WFGD 1X9QA 1AHWB 1RJYB 5ILTH 4RCAA 3CZFA 2AEPH 1ACYH 1U42A 3ZKXB 3NCYS 4MNQA 3V2AR 1AQDA 3UO1L 3V6OE 4JFHD 4UNVA 1WGOA 3W2DH 3T0VA 3KJ6L 4UB0H 3DTXB 2W0FA 3T4AB 3WHXB 1RURH 3RHWF 2NW3A 1ZT1A 4OCMC 1RULL 1D5BA 2A1WL 5DHVA 1QFUH 2FX8H 4OF3A 3SCMC 2HT2C 4BFEA 1DVFD 3O2VL 5C0AA 4F2MB 1UC6A 3MLSL 3ARZA 1FCCA 2B1AH 3FQUA 3FQTB 1MHCB 1IGMH 3ARSA 1OLZA 4Y2DD 2VLME 3DX9A 1JPSL 3FB6B 3G04A 4WFHD 5FO8B 1W72B 3NGBB 2UV3A 1NDMA 32C2A 2AXGB 5E24E 3U9PL 2E8YA 3CDGA 4LPWA 3QDMB 4X9FA 1J11A 2B5IC 4OLYH 1KFAH 1XGRB 4JO3L 3UAJD 5IG7B 1MF2H 4OD3L 4O02H 3ARFC 4CVWA 4HKZA 1TVDA 5EUOF 1I3VA 2ZCKL 4P4RA 3DV4A 3X13B 3QFJD 1TCRB 5L7XL 5H94B 3IFOB 4Y89A 2Q7YB 3VXRD 3EYSH 1H3UA 3QFDB 4M43L 1WICA 4QHLB 1KIQB 1TTFA 4HH8A 1I8KB 5DJCB 5ID1A 1OAKH 5DS8A 1QKZH 1U8LB 1UWXH 4GAGH 2A6KA 5EC1A 3UTOA 4KUCD 4L4TA 5FOBA 2NY5L 2E7MA 1AXSB 3O45B 1RV6X 2H8PA 1VFUA 5E2WL 3RPIB 4OGYL 3FOLB 4PUBL 1YDPA 2HH0H 4XPHH 2PO6D 4XX1G 5LGHL 4G6JL 2DTMH 4OUOA 3PWVB 1ED3B 1PFCA 1J8HA 4HWBH 3OAYH 4UU9B 4U6VL 3TCLB 4NT6A 1WBZA 4ONHA 4URTB 4KK9C 3RVXD 4PJDB 3VXMA 1IC7L 4MZ3A 3ARVA 2BHZA 1XF4A 1ZAGA 3DX7B 3O2DH 2YEZA 2UY6A 4LHUG 5BOZG 3SDXF 1AIFA 3BSZL 3QQ3B 4BQCA 1MQKH 1NBZA 4JLRB 1AI1L 2JIXB 3QYCA 1LQSR 3IS0X 4EOWL 3MCKA 1Z6JT 1S9WA 1CF8L 1MCBA 2HLAA 4X7TA 3ULUE 3DURA 5I1CL 3U4AA 3B9EA 1YY9C 1T21A 3RWGB 4RZCB 4RDQF 1A7RH 2RCSH 1AFVL 1BX2B 2VXUH 3NIFE 4G6FD 2QEJA 3SDXE 1IMHC 1E4JA 2NNAB 2IH1A 3QUML 5D1XA 1JWUB 5ISZD 1JYXA 4YR6B 4S0TD 2PYEE 4LLDA 3WEXB 4PJBF 3MRJB 1J0IA 4GO6B 4AIZB 1ETZA 3I9GH 2XZQH 3IS1X 4EJ1C 3VRLE 4BZ2L 4UINH 4PJ7F 1N3NA 1ZWIB 3OR6A 4Z8FL 1JGLL 2I26N 5BVPH 3SO3B 1TZIA 4OM1H 3GHEH 1N6QL 1QLFB 1FYTB 1PKQB 1EA9C 3FZUD 4FQCL 2ID5A 5C07A 2IEPA 4TNWK 2JCCE 2X4SA 1U8QA 3CCHA 4MA7H 2UYLB 3S8WA 3BH8B 3HB3C 3JWOC 4GKNA 1CFQA 2FX7H 5DC4B 3O2WH 3BT2L 2XZCL 1U8MA 3HE6C 4LASH 4NQVA 4X6DE 5GGSB 4U1JB 1PSKL 4QF1B 4LLAA 2C4XA 1GGBH 4J3WA 4J7RA 1BVKB 3OKNB 4P4KC 5TDNA 1KPRA 2N7BA 4OFYD 3WE6A 1QFWL 1S7SB 5IB5B 2CRYA 3RJDA 1KJ2H 1TPXB 3V52L 5D93B 3QPXH 1OLLA 5C0DA 4NNPL 3O41B 3RUGB 1AE6H 5DMIL 4ZUWB 5I15H 4QXGH 4R26L 3FRPA 3HUJB 1NCTA 2OL3B 1WCBB 2ILLA 2ENYA 1RIVH 7FABH 1YN6B 3VMPA 2LU3A 4NNXB 4HZAA 4Z7WE 5CEZL 5HI4D 3RZCD 4TOYL 5SWSB 1RZKC 1B90A 1T0NA 4KK5C 3GRWA 1MFCL 3B5HA 1K4DB 2VLJD 4DVBB 4EN3D 1IE5A 1ND0B 1DBKL 1QRNA 3OKKB 2BVQB 1CVSC 1H15B 4OB5L 3TO4D 1BOGB 1J0KA 4H5SB 4HW6A 4GW4B 3BRGC 1Q9OA 1OY3B 3WLBA 5EBGA 5HDQH 2Q76B 3NZ8A 5KSVA 3DX6B 3I6LE 5A3ID 1FL5B 3RWJA 5KVFL 4ONOA 3HI6H 5IJKC 1IAMA 1RUPH 4PLJD 5D5ME 4HLJA 3WFCL 3S36L 1A0QL 5IMMA 1PZ5A 2FJHB 1RPQA 3C2AH 3E3QC 4PRNB 3QUYA 5L2KD 5DRXB 1JGUL 1I3GH 4M6OH 5FCUL 2I5YL 5F3HB 1WWCA 1S78C 3EYOA 4LAQL 4NO0B 4P5MA 3DO7A 1AGDA 4U6TA 1JE6A 3HHRB 4NQEA 5TPWL 3BISA 3QHFL 4UBDC 4J8RB 5CJOH 3ARBC 1H3TA 3MV8A 5I76B 4PJEE 3IDXH 4K71B 4D0BA 4IRSC 4LK4A 4RFOL 4UMGA 4LPXA 1J1XH 2VDNL 4LBEB 4WWKD 4X99B 1Y18A 3CSBA 2EDEA 4WI2A 4ODSH 5EH1A 3LVEA 3Q5TA 3BIKB 4EXKA 5HYSA 3MLZH 1F4HA 5F70A 4OD2B 5CP7B 4MJIB 1PBYA 4OQTH 2A0LC 4QHNB 3DSFH 2IADB 5EUOE 1U8IB 3L3GA 1YNKH 4KU1A 5HJ3A 3HUJF 1KGCD 1A1OA 2X2YA 2FATL 1L6ZA 4ENEC 3HCVB 1DVFA 4LIQE 1CD9B 4XBEL 4M61B 4EQ3A 3OG4B 1J1OL 5IF0A 1LEGA 5T3ZH 1R5VB 1YC7A 3EZ8A 1ZLVH 3MFGB 1URLA 4L3CB 4NQUA 1DUYB 4L8BB 5IT2L 3V6ZA 5IW6A 1XGYH 1U8HB 2O5XL 4KI5C 5CSGA 5F71A 3AFLA 5TE6H 1CGWA 1FRGL 1DSFL 4OM0L 2AV7A 1CFVL 5D2LA 5HYIA 2I60H 3TBSB 1J12A 4ZNEA 3LQAL 2J5LB 2W91A 4DZBA 5BV7B 3TO4A 2H26B 1IZKA 1UJ3A 3BWAA 4MX7B 3MBXH 4DFHA 4KMTL 4XBGA 4JJHA 5D2NC 5F1IA 3NPSB 5B8CB 4P2RB 3QULA 4I4WB 3MLUL 1LO0L 3HPLA 4D2NA 1DZBA 2BC4A 4XMPH 4NQDA 5CUSH 4DUWA 1KCLA 3O3DB 4RAVA 3MLTA 4F15C 3DYOA 3BPCB 4KKCC 2Y36L 1JTOA 1UXWB 4QRRB 4CU8A 3ULUF 3GSNB 3EFFA 3MV9E 3HZKB 3X17A 3C6LD 3KXFB 5KJRL 4HK3N 4HXAL 4MCYB 3T3PE 4Y4HC 1N5YH 2A73A 1X4ZA 3FJTA 4FHBD 4YHKH 3WJLC 3L3IA 2XG4A 4X6DF 3ZHDA 2BDNL 2DB8A 3ARXA 1S3KH 3S35L 3MNZB 4OFYA 3VDCA 1QSFA 4DJMA 4GT7A 3OX8A 4PP1D 4P57B 4OF8A 3ARDC 1MRFL 4IS6B 5CZVH 1KNOA 5J57B 2MHAA 3G6DH 1PZUB 4RMRA 1S7RB 4ALAL 1NKOA 4WI7A 4L5FH 4JZJB 1H5BC 3TYGH 4HK0B 1FN4A 1JRHH 2VQUA 5LCVL 5HI3C 3E8UL 3U36B 3GDBA 4LEOB 3UTSB 3DROB 3L5XL 3PIQA 1PG7L 1CVRA 2EEBA 5J13C 1FP5A 3OHXB 4ZO7A 1AH1A 4EQ2A 4GJTB 3AREB 3KPLB 4K7PX 5DFWH 4L1HA 3MA7B 4JPVH 4M9OA 5DD3L 3K1DA 5F6IB 3HI1A 3CLEL 3E2HB 1EAPA 4WI8A 3TH2T 2WBKA 2FWOA 4EDWL 1B0WA 3MLYL 1OGTA 3UP1A 4PY8J 5SX4I 3D6GA 1N6VA 4FNLL 2R69L 2DQIL 2DQCL 1KYOJ 3KHOA 1ZHBA 3A6BL 1X5LA 4HFWB 2C4FU 3SDCA 2WUCL 1FL3B 1S7WA 1G9NH 1LO3H 5DUML 4WGVB 5HVFB 4HKXB 1INDL 4Z0XA 3W9EB 3AS1A 2VQ1A 5FV2A 5KVDH 1INQA 3MRFA 5CD3B 3P77A 1ES0B 3D2UB 4YHNA 3LN9A 3KPRA 3TNMB 4C55A 3I6GA 1ZA3A 3ZDYF 4G9FA 5CBEB 3SE8L 1P4BH 3STZB 1A3LH 3HZMB 2WUBL 1X5IA 2Z4QA 4AEHH 4P5TC 3ILPB 4XT1C 4IDJH 4QY8B 1OAUH 4XPAL 1L7IH 4JPKL 2MJWA 5HHNA 4JREB 1BHGA 4PJBB 4LGSB 4JQXC 4Z7UE 1KEGH 5J1AA 5DFTA 3PDOB 4JAMA 1RUQL 1T83A 5KOVC 3D39A 2FEDC 2OMNA 4P2OB 3ROOB 4L4VA 1WIPA 1K5NA 1BF2A 3SE9L 5IFAL 3X11B 5DHXB 2DQEH 2BNRE 4G5ZL 5C71A 3EYQC 4N9OB 1SYSB 3M45A 2EKJA 1N2RA 4QTIL 3MRGA 1K85A 2HTKC 5KZCD 4IOSD 1RY7B 4DN3L 4QRRD 5DQDL 1JWMB 5EUKB 1J7VR 4Z9KB 4FFZL 1KG0A 1WFTA 4JDTL 5I1IH 1CYGA 4DKEL 4JGUA 4MXWH 4LHUD 4YXKL 3H3KA 4WO4A 3IFLH 3AS0A 1XF1A 2OZ4H 3C60A 4Z7OE 5IMOA 1Z9SA 4HHAB 5C08A 1IEBA 4PJ7A 2MSPA 3C60B 1IAOA 1VEMA 2G60H 4HPOL 1I1AB 3I6KB 1CTNA 1QBLL 1GL4B 2HT3D 2VAAB 4WTXA 1S7TA 1G7QB 1QHPA 1FAKT 3O6FB 2RBLA 1IEAA 4RISL 5IFJA 2P48B 4C58B 3MRGB 4UTBL 3H3PH 4PY7A 1UQSB 4NZRH 1N5AA 4LSSH 1M4KA 2MCPH 3WS6A 1LGVA 1F11A 5I1EL 1NCDH 3E3QE 5ALCL 5E70A 4Z7VB 2VZ3A 5E6IB 5CD5C 1NC4B 3PG2A 2RIKA 3INUL 3W5MA 1D9KC 4DGYL 2YPVL 4S1RL 4QRQB 4PJ7E 4G7VL 1H9VA 3O6LL 1YYLH 5D1QA 4JQVA 3UJJH 4JKLA 2B2XH 1OAZH 1KB5L 3P0YL 3T2PA 1GOGA 1QD0A 3UBXB 2BHYA 3PXHA 3PUCA 5DVLA 2ZSWB 2XTLA 3VD7A 4PJXA 1VGEH 2EH8H 4W4OA 3GKWH 2FB4H 2AQ2A 1TFHA 1CICD 3CXDH 5AYUH 4GKZB 2QQNL 1R3KB 3GK8H 4YXLH 1BZ7B 4JG0L 4PRIE 5C8JB 3DVNA 1I7TA 5INCB 5GGQL 3FT4A 3FKUS 3TC9A 1XCQA 3VE0B 3PF2A 5KSBF 4YFEA 2AXFB 2BNUA 4KJPD 2D7NA 1G7IB 1AXTL 3B2UD 3RUGF 2R2HA 5C0AD 1YY9D 1NBQA 4QWWD 1CLYH 4Q6IA 1FL3A 1DJSA 1I9RL 4M4PA 3T04D 2NY4C 2IH3A 4XBPA 3D0VB 4QGTA 5SV3A 5GHWH 3EYFA 5DD6A 3RI5F 1MPAH 1A1MA 1S9VB 3W11D 5I16A 3GBML 5JR1L 4YDIH 3K4DA 3MRMB 3NBNA 1MRCL 3BUYB 5ELIA 2YPLB 1F4YL 5DJ6B 1DLHA 1ZK9A 2D2OA 3P9LA 4V1DD 3T8XA 3WDHA 4NQDD 5FKAB 1I8LA 3K3QA 2ZUWA 4RBPK 2AK4E 3TF7C 3AREA 5GSVB 4NRXA 1NGYA 43CAB 2WNGA 4OLWL 4P59L 4U1LB 5GGVY 5K59E 5I66A 2EEDA 2VISB 1N4XL 3NMEA 3UTSA 5JW5B 1C5BL 1I1RA 4E9LA 1MJ7L 4KKLC 2XRAL 4P46D 2AJUL 5E9DE 1YEIL 1Q94A 2O5YH 3QDGA 1Q9KA 2GAZB 1BAFL 1QVOB 4DUVA 5HI5C 1Q0XH 4RAHA 1T5WA 5DUPL 5K93A 2XTJC 1U8OA 2NTSP 1FV1B 1MELA 3GMQA 4I8DA 1S8DB 3ARWA 4J3TA 2YA2A 3AM8A 5KSAA 1OF2A 4FMFA 4R2GD 1DEEA 4K23L 3UPRB 2PETA 5D7SL 2CGRH 4M5YH 3F12B 3KNBA 4FQHB 4I5BB 2AJZB 5HGGS 4OAWB 4NZTH 3MJ8A 4UIKL 4JFXB 3TVMD 4BZ1H 5GGTH 3S34L 2J88H 1C1EL 4Q9RL 1RIHL 3MR9B 4O51B 3DECA 4UUJB 3D39D 1NANH 1TVHB 3D3VE 4P9ML 4MD5A 1XF3A 2HA1A 3KYMA 3JTSA 5D2NE 4Q9CA 4LEXL 5DGQA 1EPFA 4XPBL 1SBSL 1EFXB 1UKTA 4RMVA 1ZLUK 2C1OB 4YUEH 5IB2B 4PLNC 1XF2B 5D7JB 1OGAE 4QOKA 1I8IA 3TPUA 2DI7A 1BJ1J 4HS8H 5DD1L 1FLRL 1JZ7A 3BXNB 1CDGA 5D2LB 5D9SA 2AV7B 5GS0D 3I50L 4KWUA 3WIHH 1HHJB 4LARL 5ISZB 3D25B 5E2UL 1HOCB 5SWZD 1NGZA 4LVNB 5DD5H 4MXQC 4UV7L 1N0LA 2BNQB 4HCRL 2W65A 5IQ9A 5FYJH 3VWKC 3VXRB 3QIBD 3K8LA 3QNYB 1XGQA 2CIIA 5AWNH 1U8JA 4NNYB 1T83C 2AABL 3DJ9A 4ZOCA 5ABDE 3QIUA 4L8CA 3MZTA 4R7DA 2VLKA 3FO9A 1OTUC 2P1YA 2EE3A 3TJEH 1A3RL 1WSST 1T22A 1ZLWH 1Q9WA 2FBOJ 3MODL 3MACH 1CL7L 1GGIH 4KQ4L 4GKSB 2QJDA 4Y1AB 3OAUH 3ULSA 3VWJC 5I8KH 3EKCA 1EV2E 4OD2A 1UM6H 2VLJB 3MYZA 3I02B 1IAIH 1I1YB 5EIVA 4Z7QF 1NGZB 5HPMB 2DQUL 4ZUVB 3DUHA 5CJQH 4ONGH 1LK2A 3MXWH 4YQXH 4BQ6A 1EBPA 1IAKB 1XIWB 2YUXA 3EOYG 4XNQB 3GBNL 2EDDA 3O4OC 1WTLA 4RWYH 4MJ4A 4TVPL 3RY4A 5MEND 2A6IB 2ZUXA 5DK3A 4ETQA 1KIRB 2HT4D 2R1WB 4HEME 2V7HB 4KK8C 1A64A 4DKDC 5ANMB 3U7YH 1TZHA 5D1ZD 5C0BB 2FGWH 5EDXA 1G6RH 5HGBB 3X3GL 5T5FH 3JZ7A 5F88A 3WN5C 1TVHA 1EIBA 3FL7A 2NY1C 2IALA 3G6JA 4OI8A 4QTHB 5EC2B 3QPQC 1WBXA 3VJ6B 4MA8H 2ZOLA 2X6MA 5D6CB 5D2NA 1N8ZA 4J3XA 4MD0A 3F5WA 3WS3B 5HYJD 3UYRL 3LN5A 4M8QB 4KI1A 4TQEL 2R1WA 3T2OA 2VDML 1S8DA 4N0YL 4JY4B 1U8OB 4EXPX 3UC0H 2WZPD 2IBBA 2A74A 1PLGL 2P5ED 1AKJA 2YC1A 1Q9KB 3PWPE 3UZVB 4BSVB 3QRFM 3VXRE 4TULL 2N4IA 5KTEH 1JTPA 4NCC2 5BZWA 2NY2C 4ERSH 1DEDA 5GGRA 5I1DA 3LAFA 3IU3A 3MUGA 1DQLL 5C7XL 3WV0A 1BREA 3VH8G 2HAZA 1VACB 5TFSL 3GJFH 1YECL 1CFTA 3HE7D 1CD0A 1CFSB 4PV8B 1ADQA 5J0BA 2NY6B 4JHZA 5D7JC 3SY0B 3KPNB 5D7IF 1U3JA 3QI9D 3P30H 3QRGL 4HIXL 1IM3B 2R1YB 1K6QL 1PX3A 4OCWH 1S9XA 3BN9C 4ODTL 5EO1B 2WQRA 5K59F 3BH8A 4LNRA 5LGJB 1U8QB 1D5MA 1UA6H 1KYOK 5HHVL 3PGCB 3FTGB 3JV5A 5FGRA 5EIQA 1WV7T 3MO1B 4NNYA 3OB0K 1HIML 1Y6NR 4G9DB 3TBVB 4FFVC 2P44B 3UJIL 4B7LA 1VB9A 3NN8B 5EU6B 1ZGLB 4FZEL 1A7QL 4ISVA 5HDBF 3S7GA 1WJ3A 5F7FA 1R3KA 3UDWA 4MDIA 1BBJB 4X5LA 3MOAH 3WN5B 5FEBA 3W5NA 5IVOA 2DN7A 1KC5H 4JEGB 1QRKA 4HWEH 5TQ2H 1N64H 4QEGA 5D1XB 3QPQD 5D72L 4C4KT 1G7MB 4X6DA 2D4DA 2ZSWA 4ISVB 5DGRA 1XIWD 2E27L 3BQUC 4YFLF 1FL6B 3PABB 4WHTB 4GAYA 1YYML 4NKIH 4Y2DC 1NC2A 3ARGB 2C1PA 2C1OA 3NCJL 2F5AL 2QKIA 3IGAB 5ALBL 4O2CA 5FO9A 4NKQB 1ZGLP 3FTGA 1EGJA 1OGAB 1QFWM 1XF3B 2DKUA 4PGBA 2CIKB 3MCKB 1HH6B 1F11B 3MR9A 4BUGA 2OSLA 1N5AB 1RZJH 2HWZH 4JZJC 4M7LT 3S3JA 5EU5A 2GIYA 2AI0H 1M7XA 2ZPKL 3IFNL 3ZDZE 1KJMB 1MCCA 5EPMB 4U0RC 1SBBA 1HSAB 4LLWA 3QXVA 5C6TL 1ADQL 2BNQD 1E4KC 1FYTD 5GRXG 2IBZX 2EEAA 1R24B 2LVCA 1DBJL 2Q6WB 3IU3B 4UI2A 5GGRB 1KTDA 3MFFB 3ZMRA 2FIKB 1RZKH 4NC1E 4WTZA 4NRYB 2BXZA 1CS6A 1MJUL 1E4WL 2BY3A 3WFHA 4DN4L 3JV6A 5E2JA 4WUUE 4JY4A 2VISA 2EDJA 4F15B 5F9DC 2WP3T 1OOAA 2ED9A 5DMJB 4M8QA 1CR9H 3BIAX 4YHOH 4JFFD 5IOPA 2KL6A 2CSPA 4HKZB 3QBTB 3C5ZA 3DUUB 1FNAA 2DMCA 5BMFH 1J87A 4A6YL 4Z7NE 1HHIA 1DLHB 2AK1H 1KTLA 4CMMB 3C6LA 3L3JA 3D39B 4JO2L 3U48A 5HHXL 3ULUL 2Y07H 3O8XA 3MRMA 1I85A 5J8OA 5D71H 2KQMA 2XN9A 5GRJH 1OPGL 2Q86A 5DC9B 4Y4FD 1K4CB 5IVZB 2NZ9D 3ULVC 3IDGB 2DS4A 3DXAD 5B39A 4K3EL 3RPKA 4ZDHA 4XPTL 1VPOH 3RHWK 3VXQB 4DOHE 5EO9B 3U0WL 3KYKH 5C0AB 5JIHA 4XRCB 2D31A 4W6YB 4Q6YA 3VFNB 4HXBH 4PR5A 4XP6H 5I2IA 3WS6C 1LO4L 1CT8B 2C9AA 1OCWL 4PRBA 3MMEA 4WU7A 1LO5A 2DBLL 5A16A 4KAQH 3FO0H 3FB5A 5C0CD 1MAJA 5MENB 1T3FB 1I7TB 1Q1JH 5C8JA 5JIIA 3K4ZA 1NFDE 3FB5B 1YQVL 1J9CT 4EUPH 1VFBB 3RBSA 2DWDA 4M62L 1UACL 5A2IH 3F7VA 3NH7L 4KKAC 5CGYC 4F9PA 3U9UA 1FIGH 4HKXA 5J11B 3V7AE 3BKMH 4AM0B 3NIFF 3G6JE 3HG1A 4OZIA 3OF6D 1T2JA 4KJWD 3T3PF 3BD5A 2V2WA 3I02A 3VD5A 3BKYL 4U0RB 4PJIA 5T1MB 3TCXA 4RGMC 2X4PB 5C0GA 5LWYL 3SOBL 2EDTA 4JFQB 5I1JH 2JJTC 1SEQH 3VFMA 5I71C 1HSBA 5SWQA 3C6LB 1OL0A 1IC5L 2K7QA 5ICYB 4NCC1 5DJZA 2ESVD 4O5LL 2V17H 3MA7A 4MVBC 3FO9B 4NN6C 4R7DB 5L88H 3PJSA 5I74B 1YY8B 3SCMA 4S1QL 4TUOA 3RJQB 5DJAB 3VGBA 1D3CA 3GSUB 2QADC 2GUOA 3QIBB 3BP6A 2JCCF 1HKFA 2WBJA 3QG7H 3NTCL 4Z95L 2J6EH 2NZIA 4KQ3L 4KDTA 2COQA 3BQUB 1G7QA 1HI6B 4Y5VC 1UB5B 1LE9A 5E94A 3C60D 1EGJH 4Z7UA 3PWJB 2AGJH 3KR3H 1VCAA 4X5WB 3OXRB 1BGXH 4S0SD 3CFEB 1NCWH 3WLWD 4LLWB 2FO4B 2J3SA 1UYWL 5ACLA 3H42L 5EOTA 3WSQH 4YZFF 1A4KB 3MJ9A 3HNSL 3RGVD 1NUFA 5D7JA 2ZCLL 4OLXL 1N2RB 3KLSA 3BAEL 3KXFA 4WJ5A 3K8MA 1YC8A 4LSQH 1REIA 4XCFH 2A83A 1CICC 5INDA 2EIEA 4OJFL 4WY7H 3QISA 3QEQD 4O2CB 5DEZA 4CBPA 2AJVH 1CGSH 4DGIH 5E6ID 1N26A 3HAEH 2VSCA 2VJXA 4GAYB 3CK0L 4RGNC 3MJ8B 3B2VH 2XQBL 4EVNB 3BZ4A 1EJOH 1B0GB 3X12B 1S9YB 1ZVSA 4G8GD 3TVMC 4U33A 1R0AL 2X4QB 4JDZB 2R4RH 1T4KB 2BSTB 5C09E 2AEQH 4PB9L 3OXRA 1GGTA 5HHOE 3SE3C 1FBIH 4JO4H 5EZIL 2FBJH 2OR7A 3Q2CA 1FV1A 3ZE2E 3H9HA 1SHMA 2ZJSL 5JPNB 3STLA 5AD0A 2YWZA 1U3HA 3L3DB 2A77H 1UKSA 2ENSA 2VXTH 3WO3B 3S97C 5I19L 4AEIL 1F2XK 1GPOL 1DE4A 5CMAB 1QSZA 5GZNC 2VDOL 3CFCL 1MJ8L 3MRFB 4JKPH 5DRWB 5CIPH 2HYMA 1FVEB 1FGNL 2NY4B 1CE1L 5D2LE 4WHDA 4U1IA 4WW1A 4JFDA 1NGYB 1IC1A 4TSAH 3KPQA 2XZZA 5IK3B 1V7ML 1BFOB 2UZIL 2A2QT 1WFNA 1J05A 1MAML 1P7QA 2P5WB 4N90E 5ECJE 3N9GL 3CMOH 3U2SA 5HHOA 4F58H 5FHBH 3IDYB 4OV6F 4DVRL 1GRWA 1ZV5A 1GZPB 1T66C 3QEGL 5BQ7B 3KPNA 2F54B 2X05A 1XZ0B 1EAPB 3L9RA 3RWEB 3HC0B 3EOAA 5T1MA 1CFSA 1FVCA 1HDMB 3ZKND 2D7QA 3BIKA 1TQCC 2IH3B 4FQIL 3B9KD 4LLVB 5F9AC 4WU5A 4LOUD 3NAAH 5EA0H 3GSNL 1DANU 4PJ8A 3HG1B 4OZIB 1BD2E 1VACA 2D7TH 4AMKH 5IGXL 4GXVH 4WUUB 3DROA 4G3YH 2X1QA 5L8KB 2KQNA 5I1DB 3RWCA 2FO1A 1H5BA 4U1GB 1T66D 1F4WH 1WT5C 1RVFH 4ZSOE 1XH3B 4FTVE 2YC1B 2FD6L 2ZCHH 3VWJA 4M48L 4U05A 1Z2KA 3UTZB 4HPYL 1A7BA 2VWEC 4JREC 4N8VB 3HNVH 3B9KC 3UZEA 4PJEA 2YD6A 4G42B 5GQBA 3OX8B 2BRRH 2H2PC 4M1GH 4E41D 5FUOH 4NYLB 1RUAH 4U7SA 5DC0A 3TH3T 1S9YA 3NCFB 3VDAA 5DJ0B 5ADOH 2UVFA 1FL5A 3HRZB 1EBAA 5J1TC 1OQXA 5KSVB 3C6LC 3H7BA 5E1AB 1KPUA 5FO7A 2G5BA 2E9BA 4UTAL 1EZVX 1KELH 1IVLA 4BYHA 4YHYC 4M7ZC 1NC4D 3HZKA 3SKMB 2Q20A 4XNYH 5F88B 3NFSL 3KYNB 1K4DA 1CFBA 4OCRL 4PJCF 2H2PD 4GRMA 2W9DL 1A6AB 3LPFA 2OYPA 3SJVA 3TBYB 5IOPB 3IETA 1MCFA 4NNXA 2FX9H 3L3HA 5F7KC 4Q97A 3QUXA 4ETQB 5KSBE 3GRWH 4XBGB 5F1IB 4M8VA 5JNYA 3RUGE 4POUB 4X5XB 3SPVA 3I6KA 4P23D 1OP9A 4BSWB 3QIWB 4WGWB 4K8RH 2F19L 2AEWA 5ADPL 2DMBA 3BPNC 2AJXL 1R24A 5DZLA 5J3HD 1U92B 1LE9B 1IM9B 1KCSL 1G7LA 3OZ9L 2WLYA 3PWPB 3SDDA 1IGIH 3U82B 3BKCL 4R9HA 4OV5B 2BVUA 5EUKA 1RZ7L 3WIIH 1A7PL 2GTWA 4L3CA 5JDSB 1OAQL 4YK4C 2Z31A 2IMMA 1FG2A 5T33H 1HYSD 4LU5H 4HKBA 3LKPB 3QFJE 4Y4HA 4OFPA 3TBWB 2VTFA 4Z76B 5KN5A 2QBWA 2C3VB 2BX5A 1Y6MR 3QIWC 4K9EL 1TMCB 1MCOL 3EYVB 5HXMA 1MCKA 1U8IA 2KPNA 1ORSB 2IPUK 2FEDD 4PJ9D 4DCQB 1ZSDA 1FL6A 3PABA 1OM3H 4F7PA 2AQ3A 5D7LE 2V6HA 1IGCH 4Z18A 4H20H 1Y18B 5GJTL 1X4XA 3ZTJH 3V5DB 5ETUB 3MUY1 2AQ1A 4JFOB 3EYQD 1A8JH 2C3GA 4TNVF 2DLFH 4P2RD 3F7YB 3FT3A 4FXKA 1F13A 3QIWD 5L7XH 3GI9H 2P8MA 4EEEA 4PJFB 3HZMA 4XP9H 4LSUH 1FVDB 4H1LA 4M7ZB 4WV1A 4Y88A 1P84J 2CUHA 5MENA 4RX4A 2VABA 2NY1B 3CDFA 5JW4N 1Q0YH 1UM5L 1CT8A 1KV3A 3DURB 1NCBL 3IJYA 1C5DB 4RMUA 4YIQB 3FB8A 4WDIB 2FJHA 1LNUB 4FABH 1TJIL 3MGOB 2K3TA 2ICCA 5EO9A 4ZPVB 2YUWA 3GM0A 5BJTB 1PEZA 4GSDL 4LNRB 5IVZA 1K4CA 3HI5L 3MRQB 3KPPA 1MFDL 3CVIH 4X80L 2NYYD 1MFAH 5ICXA 1MVUA 5ITFB 1L0QA 3O8XB 5GS3A 2EXYC 4OIIL 4U1GC 3U46A 1IC7H 4Y2DB 3WKML 3MRDB 2KBGA 4JANB 2QSTA 3FFCB 3ARDB 4JFXA 4I5BA 5E99L 2PXYC 2GFBB 3EDDA 1FNGA 3CX5J 2HJFA 4PRIB 5LQBH 1GIGL 1OT2A 3NPZB 1NLBH 1MCPL 1OTTC 1QR4A 1P53A 3O3EA 3LB6D 3VG0L 1JBJA 3P11L 4IJ3C 4ZFGH 1CF8H 4GFTB 4Z77B 1YDPB 3E1F1 3FOLA 4AQ1B 1W0WB 3D5OF 2NY0C 3VXME 2EKSA 2GAZA 2P46B 2HT3C 5FOBB 2FIKA 4NP4L 4WFED 3BESR 3QDGB 4J12A 2VLRB 2GCYA 4GRWF 1P2CA 2J8UE 4Y19B 1J8HE 4UQ3B 1A6PA 3TA3C 4TUKH 1NCAH 5E9DD 1IGYB 3SO5A 4HMCA 43CAA 3PP3K 4A2MA 3MNZA 1YEEH 3CFKA 3WS3A 4PRIA 4KVCL 4DAGL 4Z7OF 3B43A 4XXCA 4HC1A 4J2XA 5EPMA 1G9MH 3ARDA 2ZOLB 5LVEA 3OKDA 4JANA 3MRDA 1MOEA 3DVFA 1K8IB 4KTDL 5K9QG 5BV7C 1BD2B 1MVUB 5ICXB 5ITFA 4MMXC 3D69B 2FECI 5EU7C 5HGBA 5K9OB 1ITBB 3BE1H 4JFDD 3CVHB 2D0FA 5C0BA 4PGZA 4S1SH 5IBTH 3SHSA 1UZ6E 1CLOH 4I9WE 3O3DA 4RAVB 5HGHB 5D8JL 3D39E 3QA3A 2XWBA 4YIQA 4WO4C 2V7HA 2W0KA 2C1PB 3HPLB 5DHVB 1D5BB 4X9GA 4KROD 3QDME 4Q2ZB 1AR1C 3FOMA 3DTXA 4KJYB 5CD5D 3FT4B 2B0SH 4UILL 4OTXL 1UWGL 3P4OA 3ZL4L 4MS8D 1I85C 3S37L 4JFYA 1GC1C 5T3XH 3FT3B 1CDIA 1RJYA 2D3VA 3NFNB 1TJHL 2VLJE 5T1KB 1WVZA 4PRAB 3GMRA 1KJ2L 3SDCC 3V52H 4KI5F 2IH1B 1WK0A 3QPXL 4JRXE 5IW6B 4YEFA 1BJ1H 4LCWB 3P0VL 4JHAL 2XTJD 5IVNA 3TT1H 2VR9A 1J10A 5DMYA 3W11C 4YHML 2IANE 3FFCE 5FUZL 1OD7A 1Z9OA 5E6IA 4M61A 3U6RA 1T22B 4K3DL 7FABL 5JHDE 3AXLA 1DLFH 3CUPB 2NY7H 1DBBL 3B2UC 1A1OB 3TJHC 1FGVH 1DQDH 4L8CB 4UOW1 1RHHA 5H35B 2YA1A 3ELAT 5CINL 1L0XA 3ESUF 5IVXB 5B3NA 4P3CL 3VFWB 1HEZA 1L4IA 2ZG1A 1T20A 4PV8A 2QQKH 2CXGA 1CN4A 1RSFA 1V7NH 5BZDA 3X3FH 1SY6H 2HFFA 4ODVL 1Y6KR 3O6FD 2DLIA 2JK5B 1J8HB 2DQGL 5ISZA 3UAJC 4F7MB 3QCUH 4LSPL 1KJVA 4M1CC 1IEBB 4P5TB 5I8OL 2F53E 3BI9X 1CFNA 1YEKH 1WFOA 5DA4A 1JHKL 1AXSA 3O45A 3QIWA 4BSWA 5I8EB 3DO7B 3LCYA 4BSVA 1FZJA 2FSEA 2IQAA 2AJYL 3MJ7A 1JWMA 1J5OL 1U8NA 1OSPL 2RHEA 1AHWC 4NQCE 5BS0E 4CVXB 1KBGL 2E7LC 1B0RA 2R29L 1OWWA 1EO8H 3SJVB 1Y0LB 4WEMB 1QSEA 5AZ2L 6FABH 1WC7A 2ZP0T 3IDIA 3U83A 5E8PA 1AGCB 3DX6A 1YN7A 4CADB 3WBDA 1S5IL 4UUJA 1ZTXL 4NQDE 1Q9OB 5F7NC 4GW4A 3LKSB 1HQ4B 5EBWB 4BM7A 3SKJL 1D6EB 1KN2L 2G5BB 2VDKL 5FO8A 1KPUB 4HAFA 2Z31D 2R2CA 1F6AA 4X6FA 4M7LL 5B22A 5F7HA 3NA9H 1NC2D 1KCRL 2JB6B 5JOFB 3KPSE 4YPGA 3LQZA 1EVTC 4U0QB 4ZNEE 1OF2B 1AD9B 4IHOB 4R2GB 1NAML 3QNXB 5F96L 3RWHB 3VGAB 1CGUA 12E8H 2OL3A 5L8JB 1EAJA 1U6AH 3STZA 4MXVF 1KJ3H 2BMKA 4XMLL 3T08A 1H5BB 3KPRB 3TNMA 5C0DB 1XGYL 5FF6A 3FN0H 5C92A 3IU4L 4GMSH 5I66B 4HUVB 1MNUH 4WFEE 4Z0XB 1JMXA 3MV9D 4NQXA 2R0LL 2CKBA 1IC4H 1D7FA 1J0YA 1WZMA 4PJ8B 5DFVD 3ZHKA 5JHDB 4MQ7B 1F6FB 3T8XB 2XG5A 5IHBA 4OZ4B 3LD8C 3QAZB 1T2QH 4U1HA 3SJVD 4LQ1A 4TTDC 4RX4D 3QCTL 1AP2A 3P9MA 3JWOL 1LDPL 3U4EA 4R90L 3PGDA 3TNNA 5L6YH 2XICA 5IQ7L 1MHPH 4FRWA 3P4NA 2I07B 1U2HA 4K9EC 2OM5A 4XMPL 3QUKB 4MAUL 1KUMA 3LKNB 3EYFB 4FQXC 2FZ3A 1YEHL 4MMZC 1GGUA 3STBA 1ZS8A 5HBBA 3MC0A 4OF0A 3KPQB 2ADJA 2X4TB 4NGHH 4P2CG 5FM4A 2IGFL 3QH3A 3RVVC 1X6NA 4OLEA 3WLWC 2EIZA 1ZEAL 5CGTA 2F53B 2APVA 2BNUB 2J8UF 5DJ2A 5DRWA 4L8SA 1DBAL 3QNYA 1N3NB 2V5YA 4X9HA 3RWFB 1UZ6F 2PYFB 3T77A 4HIHA 1ZANL 5LG1A 2ICWI 3U7AA 5E8DH 4HK0A 1D5ZA 4AIZA 3D25A 5HVHC 3STLB 4R96A 3VXSB 1HWGB 4WNQB 4FP8L 3S37X 5IESL 1BMGA 4NQSA 4X4YA 4PYGA 3WNMA 2X4QA 4JDZA 4Z7QE 4MHHG 4AYFA 4XAKE 3C09B 4HEPG 5FK9A 3PGFH 5DWUH 1EEZA 4HMDA 1JPTL 3UBXA 4M6NH 3TV3L 4EVNA 1DQJB 5KZCB 5BOPA 1B6UA 2HJLA 1D5IL 2FH6A 3ARUA 2X7LA 3FT2A 1JGEA 1FZOA 3T2NL 2MQCA 4HH9A 3QQ9C 1WT5A 4ZAKB 4GLRH 2Q8AL 2ZNXA 5A3IC 1JNNH 3V0WL 2Z0BA 4N5UA 4ODUA 1NGWA 2HT4C 1AIFB 1WTGT 5KSUA 4BFIA 3BPOC 2HRPL 5C2BH 1JF5A 1A5FL 4H0HB 5B8CA 1XCTA 3U1SL 3OXSA 5IFJB 5EOCL 1QFHA 1UJ3B 1MH5A 3BWAB 3SDXA 1AGEB 2R69H 3BO8B 5T1LB 1EZVY 3WNLA 3CXHJ 2X1XR 2WUCH 4LSTH 2MFNA 2ITDA 4XP4H 1CDUA 1W0VB 1PG7X 4HHAA 4XCEA 3WXWL 5K9KA 3BZFB 1JFQH 1JNLH 1PAMA 4PJDE 5MP6H 1WEJL 2V2XA 3BQUA 4EBQH 4WHYG 1I8KA 1J1PL 4ZTOH 1OAYH 3RGVA 3B9VA 1UXSB 3DMMD 1QBML 2H1PL 1QNZH 4I2XA 5H2BA 1P4BL 1HNGA 5BV7H 3S88H 4X4ME 4UT9L 4HIJB 5JXED 4K55A 4LSDA 5F7LB 5FM5M 1A6VH 1XIWC 1CDHA 4PGEA 5CHNA 3OAYK 5IJVB 3HLAA 2ERJB 3S96B 4P2OD 3CDGB 4JFFE 1B9ZA 3QJFB 5JLZA 3NZHL 4ODXB 3ZTNL 1CQKA 4OLVL 3GJEB 1S9VA 5I16B 1YEJL 3MSPA 4XNUH 3TIDA 2VYRE 2X42A 1ZA6B 4NSKB 3FCTB 3RFZC 1OAXL 3D0VA 5IV2A 3MXVL 2P47B 1NCUA 5D70L 4WTWA 4IRJA 4BH7A 4MJ6A 1DN2A 3PWPD 4LLYB 4XAKD 4OZFA 5TF0A 4ZD3H 5GS0H 1RIUH 4G6ML 1RZGA 2Z4QB 4N0UE 1EHAA 4IOFD 3QQ9D 1IBGL 5E08L 4P5MB 1BZ7A 1AQDB 2Z8WC 1T04A 4BK5A 1A6UL 3AGVA 3ARDD 4L4VE 4B53A 1QPXA 4MXWL 1H3PL 2MMXA 1AHWA 4L8DB 1RU9H 2DQDH 4LKXA 2D31B 1UZ8A 5HYJB 1PZ5B 3CFBB 1G0XA 3VXUE 3W9DA 3MLPA 2QR0B 2OL3H 4NBZB 1DQQA 4OIAA 3HR5A 1HXMA 2YXMA 4HPOH 2G9HA 1JHTB 2V5RA 2F54D 2WWMD 3O4LE 4EUPB 5I73C 5KBNC 4XWOD 2BVOB 2XA8H 3OKKA 1NC4A 5C0RH 4YHIB 4AG4H 4GBXB 1NSNL 3QDJE 2QQLH 5J6HB 2MCG1 3BJ91 4X7EC 5DZOA 2L7UA 2XXCB 5GRVL 3MOQA 4HJ0C 4TNVK 1UQSA 3VRJA 2VLKD 4CN4A 4M7KL 1MQ8A 3NABL 3TYFB 1DVFC 3MJ6A 4HC1L 4NFBA 3KPRD 3Q1SL 3LS5L 3OKLA 2CMRH 1PJ9A 3T0BA 5HDOA 3RWDB 1UJTA 3T0ED 3HUJE 4MD4A 4N1HB 4XCCH 5DSCB 1MFBH 4PJ7B 2XFXB 3EOBA 1MCWW 3GKWL 4JZOB 1LEIB 4H8WH 4WO4B 5DURD 3IJHA 3TO2B 1CGYA 1HSAA 1QSFD 2Z92A 3VXOB 1AKJD 1Q38A 4H1LH 1HH9B 4HUNB 2NY3B 1R3JA 4MNHA 4Y8AA 1YNTA 3KLAA 3DX8B 4ZODA 4OZIF 4EKXA 3DGCR 1GHFL 1CFQB 4ZS6D 4PTTB 1QSEE 4Y5YA 3IAPA 3PWUB 4OFVA 4YHLH 2HFGH 1FQ9C 4ZMAT 1F3JA 5E00B 4BQBA 5DUBA 2P49B 4I0PA 1R5WB 5MEPB 3QQ4A 2DKSA 3IGAA 1A7OH 1CLZH 3BMVA 5D1ZA 3VXSE 1TZIB 5EULV 1X4YA 4KDVA 3BP5A 4PJBA 5HHME 3LSOB 4P4KB 5DMKA 1FC1A 4HUMB 4V2CB 3U9PH 2ICEA 3V6OA 4U1NB 3VFGH 3MRKA 4IOIB 1NGPL 3ARTA 4OLYL 1G7MA 3MCLL 4LF3B 4YBQD 5FB8B 4DZBB 2V9RA 2H9GB 4OLZL 3WUWA 4UDUB 1Z9LA 4POYA 2NW2B 4DEPC 4OF6A 4QGYA 1AJ7L 1BFVL 1GC1L 4TRPL 3EDKA 3MX0A 4HGKC 1U8HA 3BX7C 3MRHB 3I6GB 1GVIA 3U4BL 5DTFA 4R3SA 3C5ZC 5EU6A 4PG9A 1UVQB 4QXTB 4KUZH 5K9JL 5C0EA 1F02I 2YS4A 4QRTA 3ZT7A 4D94A 1JZ6A 4TVPD 3B4NA 4A6YA 2L0DA 2XKUA 4XZUB 4OFKA 5GGUA 3K81A 2HLAB 4KRPD 3T1FB 4LCIL 4F7TB 3KAAA 1EEQA 1XT5A 1OTTD 3HCVA 2YD2A 1D5MB 2HVKA 3MRRA 2FHBA 1RAMA 3BRDA 1ZHLA 1U95A 3PWLA 4LLMB 2EC9T 3EO1B 2DDQH 5MI0B 2AW2A 2DLTA 2DYPA 5DI8A 4ZTPH 3BKJL 5D7SH 5DD0L 2VIRB 2YMXH 1TZGL 4JKMA 1JHLH 1MFEH 3ARPA 4XH2A 1VESA 4MJIA 4X8JB 2QV2A 1A47A 3N85L 5CLWA 2ZSVB 3DSNA 4U1SA 5EZOL 1MHHA 2XZAH 1AY1L 1WBZB 4KXZI 4WW2F 2DM4A 4IRJD 3BP4A 3SE3A 3X14B 3CH1A 4YH6A 5E6IC 1X5AA 1CBVL 5GIRA 4NO2B 1KLUB 5I1AB 3JVGA 1OW0C 3MV9A 4QHUA 5ICZA 4KGJA 1I4FB 2DQJL 2DMKA 1NFIB 1FN4B 4N68A 3W0WB 1IL1B 2A74B 1M7IB 5EU7E 1T0PB 1KIPB 4N8CL 4V1DB 2MHAB 3EJYC 3QFDA 4LLUB 3ZKMD 4HQQH 4MB4A 1XMWA 4PBXA 4FTVD 3RTQA 4JY6B 1FCGA 5LXGH 1I3RA 3QZWA 3SQOH 3WFBH 3LQMA 3MRNB 3SO3C 5E2UH 3DXAB 2LFGA 3GI8L 2VDQL 4Z78A 3NZ8B 5CILL 2VDLL 4UNTA 4APQA 5FYJL 4HLZH 3H7LA 4RBPH 5HDBE 1D9KD 4X7SL 5HHMB 4NO3B 4S2SB 3MV8E 1F42A 2P24B 4FQQB 1YMME 1N6QH 5GRZA 3UXFA 4BK4A 1GAFL 2DQTH 4Q0XH 3C5ZD 3LHPL 3MA9H 1V3LA 2WQ8A 2Y6SC 1I3UA 2WV3A 2EDQA 2XZCH 4U3HA 5JMRA 2LU7A 3QULB 2GK0A 3M8OH 3LS4H 2B4CH 4RFNC 1PSKH 2A6IA 1EXUB 4XCYB 3FONA 1IFHL 3RI5K 2E9WA 1N7ML 2CR3A 5F7EH 4XNQA 3GB7A 1GZQB 1IRAY 1MREL 4ZUTA 4L3EB 4ODHL 3WNOA 3D87B 5E4IA 1JIBA 2ADFH 4P46C 2DQUH 3GB7B 2QLVB 1BFTA 4HS3B 3EGSB 4YHZH 5BRZA 1ZT4B 4W68A 3O6ML 1IKFH 4W6XB 5C0CA 5L2JB 4ZOBA 4QXUL 1AE6L 2CDEA 3N06B 4XX1E 2BJML 4MXVE 2ARJA 4ZFOB 4PJFE 2DQHL 5TDPA 4NM8H 2R56H 1ZHNA 1SMOA 5F7UA 3RA7L 2Y06L 2YD5A 4NZDA 1T80A 1S78D 2P24A 5BCAA 3QCVH 2UWEA 2IQ9H 4OZHE 3RX5A 4XPGL 1FYTA 1PKQA 4PJGB 5EOQL 4GRLB 5C07D 3PP4H 2W59A 4IRSD 3GO1L 2EICA 4JM4L 4WHYH 2VC2H 5HYSB 3UBXG 3BZDA 5IQ9B 3F62A 3JWDL 3WCYA 4N5EC 1JGDB 4RMWA 1R3IL 5JIPA 1E28A 4X99A 3RTQB 5I18L 4N1EA 4PRHE 1UM4L 3S36H 3M17A 4J8RA 1I9EA 1FORL 2WSKA 1PD6A 1X3DA 4EI5B 1F8TL 3KLHD 3RKDD 2GK2A 5FCUH 1S7VA 4HDIB 3MJ9H 5CZXD 3L95B 4GOSA 4MAYD 4YBLB 1KGCE 2EXWD 1RJLB 3H8NA 5GIRB 2Y7QB 3AY4C 2APWA 4TULH 3UEZA 2AJ3A 5EWIL 2RGSA 4CVUA 5E5RB 5DVMA 4TSBL 4RQQA 2DLGA 4OF7A 4JFEA 3RWJB 1G0DA 4LPUA 4NZUH 3D9AH 4P5KB 3RNQB 4XMKL 4FQJH 3QDMD 4YBHA 5DHVH 5A2KH 5IFHH 4R0LB 3RU8L 4CU6A 1EHXA 1NBZB 2XWJB 3RL2A 2A9NH 1BZ9A 3S5LB 4Q6IC 4PJ8C 1H15A 3CU7A 3DX7A 1P7KA 3I2CH 1YUHB 1ND0A 4LCUB 5F1OB 1UWEL 2VDPL 1U95B 1YZZA 3PWLB 4LLMA 4K2UL 1CGVA 2YN5A 4V2BA 5CEYB 4FQH<