5GS2D

Crystal structure of diabody complex with repebody and mbp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
226
Chain Sequence
VQLKESGPELVKPGASVKMSCKASGYTFTSYVIHWVKQRPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMDLSSLTSEDSAVYYCARYGVRGDYYAVDYWGQGTSVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Sugar binding protein/immune system
molecule keywords Maltose-binding periplasmic protein
total genus 41
structure length 226
sequence length 231
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D02
3VGFA 1FL5A 4IDLA 1IGCL 2NY7L 1GPOL 3WFDH 2VXTL 4EUPG 4LLDB 3MGOB 1J1OH 4G8GA 1O7VA 5I8OH 5ID1B 1KFAH 3D39B 3C6SB 3EYSH 1UA6H 3I6LD 1MCEA 4D9QE 5IT2L 5IJKC 4LVNC 1I3GH 4XMKH 3S9DB 4LSTL 1KULA 3T04D 1Y18A 2PYEE 4NT6A 4PJIF 3TIDB 4NC1E 4Z6AT 3MBXH 3I02A 5EUKB 2V7NA 4GW4B 3QRFM 3IFPB 3VGEA 4HD9A 3BIAX 4L8BB 2KQNA 3TNMB 4M3KB 5JLZA 1MCFA 2DYPA 1SJXA 3MLWL 4MNGA 4HIEB 5FDWA 3D69B 3MV8B 5FHBH 5DJ8B 1RULH 3NPSB 4QOKB 2NY1D 4NFCA 5EU4A 2V5MA 1AE6H 4X5WB 5I1CL 5I15H 4MJIB 1GGIH 1MAMH 5T33H 5FF6A 2DKSA 4K3JH 4LU5H 1INQA 1PKOA 4NHUB 4XBEH 1A7NL 5EIVA 4CU6A 1MRCL 1CD0A 4APQC 5TDNA 1QA9A 4PJ9C 3MRPA 4M48L 4WRLA 4YBLB 1J8KA 4W6WB 1PGRB 4LDLB 4Z7NF 2VZ3A 2A6JB 4PJ9A 3PNWB 4OBRA 1VFBA 5DHVB 3CFEA 4M6MH 3MRQA 2Y5TB 1Q1JL 4S0SD 3RIAF 1NLBL 3GUTB 3GJFA 5C9JA 5HYQA 4PJBF 1U92A 3RPKA 1S9VB 2NX5E 4MNGB 2YOCA 4I13B 2FB4H 2OL3A 4FNLL 1S7VB 3MO1B 4R2GB 5T1LB 2JK5A 4QOKA 2EDEA 4JFPB 4XP5H 4OCSH 3REVA 2E3VA 2L0DA 1Z0MA 3GMQB 5FHBL 2H3NA 1CD1B 4XH2B 3OGCA 2W91A 3O2DA 4OUUB 4PV8B 1ZTXL 4P3DA 2GI7A 3QUXD 3WXWH 3U7WL 5D7JB 1IFHL 4LL9A 1M1SA 3MCKA 4YR6B 5JMOC 1OB1A 4DVBA 2VZVA 2C3WA 1CFNB 3UBXI 1X9QA 4LCWE 3M1BA 4H25B 3LRHA 3P77A 4JG1H 3RGVA 1PJ9A 5IB2A 2Z4QA 2R2BB 3OAZK 4UIMB 1IT9H 4LFHD 4Y1AD 3K8LA 4Z7NE 4RNRB 1BF2A 2J8OA 4ZAKB 1NLDH 1OP5K 2Z35B 5DD1H 4OSUH 4HWZA 4QHLA 1OP3H 3D2UD 4XI5D 5J6GA 4OCSL 3CCHA 4TOYH 1V8HA 3L1OH 1GC1C 5CIPB 2WLYA 2HJKB 1MNUL 4OLVH 3E1F1 4KTEL 3ZDZE 2X44D 1BFOA 5EBMB 5KJRH 4H0GA 3QUYA 3SDCD 1Q9KA 3UCRA 1L0QA 4TTDD 3QYCA 1OM3L 4YUEL 5J57B 5JIPA 3MLPA 3I2CL 3NGBC 1BGXH 2HN7A 2OTPA 4RA0C 1DBKH 5ECJE 4NKMB 4WFFD 3BX7C 3RPIB 1S9KC 2CIKB 3RQ3A 1BBDH 2HH0L 3KYNB 1SEQL 4U6XB 5GGUA 2BVYA 4PJ7A 5AZ2H 2YD9A 5L9DL 1N4XL 2Y23A 3STBA 4WUUA 1A0QH 5AYQA 2P8MA 4N0CD 4ZFOA 3ULVE 2PYFA 5E2WH 2ZPKH 4JG0H 2EDWA 4WV1A 5T3XL 5EZIL 4R26H 3ZKMD 3DIFB 3EOAB 1K6QL 4Q0XL 4OSUL 1CF8H 1IARB 5E8OA 4ZTPL 3DUHA 4FXKA 2FWOB 1IVLA 4F58L 2WIIA 5IKCA 5C71A 1HZHH 3CFBA 1L4IA 3QRGH 5CUSH 3LKOB 4XI5C 4P2RA 5HD8D 4MAYB 1X5IA 1R5IB 4IDJL 5ICYB 1BJ8A 1DDHB 2FECI 1OWRM 3RY4A 4WFEE 3O9WC 1EEYA 4JO3L 5IROC 1EJOL 2BHUA 3S36L 1ZHBB 3C87A 2J8HA 3IGAB 2X9YA 2RQ8A 4ORZC 2YZ1A 4PJDF 5ITBH 5ILTL 4JR9L 3G6JA 4OGAD 1T04B 2KPNA 1S7XA 1TQBB 5CD5C 1XZ0B 2CUIA 4LSQL 3SDDA 2YHGA 4QHUA 2CK2A 1RURL 5DVKA 4MQ7A 2OBGA 1OSZB 4HUUB 3B9VA 5DA0B 1YDPB 3AS3A 2VLJD 2MCG1 3E6FB 5T3XH 5F21B 3MBEC 1IL1A 4YZFF 5C3TA 1SVCP 5D1XC 1S7TB 1U8OB 1GC1L 4F7MB 1OAUL 4HS8H 4HK3N 1ZA6A 2B1AH 1RUMH 2C9AA 3STLB 4W4OC 3OKEA 3SJVE 4R9HA 4JJHA 3T4YA 4O4YH 2YD7A 3BN9C 4X9IA 4WEBH 1U8MA 5C09B 2DM3A 5F71A 3LEVL 4G42B 4YAQB 3CSYA 3VFRB 4LSSL 4TUKL 5EO0B 2R56L 2A6JA 4K8RH 3WDJA 3ILPB 4Y5YA 2C1PA 3V0WH 1W8NA 1DBJL 1QO3B 1TZGL 4XPFL 5D93B 4J3TA 2FL5B 1BQHG 1S7WA 3RVTC 4U6TA 3O4OC 2B20A 3SPVB 4XVSL 4M6OH 2R69L 1MF2L 4NWTH 1QTYT 1VCAA 4MA3A 1CD9B 4PJXB 1KG0B 2FIKB 4JRXA 3V5KB 4WO4A 1OAXH 4A2LA 4JFPA 4XAWH 3MRGA 3STZA 1KJVA 4U6VH 1J0IA 3C8HA 1XT5A 1WBZA 1BD2B 5IFHL 4AEIL 2NY7H 4GKNA 2VLKA 2Q8BH 5I1KH 2MPAL 5KSAC 4P4RA 4PB9H 5IB4B 3FO9A 5HPMB 5GGSB 4TULH 5FV2A 1HIMH 3AY4A 5D7SL 3TJEL 3FZUD 1E4XL 4B5EA 1I3GL 3UC0H 2VLRB 3CFJB 4U1LB 3CX2A 4K23L 1DQJB 4HT1H 3MOAL 5IB3B 4HH8A 3CSBA 5KVGL 5A43C 4UTAH 4EJ1C 4DGVH 3BKML 1MSPA 3NIDF 1WTLA 5CWSB 1JHKH 5ID0A 2Y4SA 2QQQA 4LLWB 2ZJSL 1OW0C 2X10A 4BKLA 1TENA 3NA9L 4XPFH 3SGJC 5CKAA 2DWEB 5DEGB 3QDJB 1HKFA 1L0XA 4MD5A 3WIIH 2OMBA 1P7QA 3UZVB 1T22B 6FABH 3D2UB 3DBXA 1AE6L 2YA2A 1T7XA 2F53D 3HZVB 3D0LA 3BIBX 5FHAL 1FYHB 1N26A 4ZODA 4PB0L 2ZKHL 2DMCA 5EC1A 1VPOH 1SY6L 4F57L 1T66D 5JNYA 1FZJA 1LEIB 5I1JH 1CXHA 1GL4B 2WBJC 4ZXBA 3LIZH 2NXYC 4G6JL 2ZUVA 1KIRA 1A4JB 4YHLL 4J3UA 5SX5K 4KROD 4V1DB 4MX7B 1AR1C 4JAMA 1MLCB 4ONHA 1SHMA 1GRWA 3EDJA 3L7EB 1RQ5A 2H26A 3MLWH 4K8RD 2BXYA 2DM7A 4M4RA 5F1SA 3FO1B 5I1HH 3RI5K 2XWTB 5I15L 3QXDB 3B5HA 4XMPH 4QYOA 1GGIL 1S7SB 4MXQD 1R5IA 3O11A 1J12A 1YEEL 1FNHA 5CSGA 4GMTL 4BQCA 1NCCH 3G9AB 1WT5A 4XHJD 5DJ8A 5GS3A 1DFBH 3T09A 1L7IH 1YEJH 4OM1H 1CFVL 2BOBB 2HFEB 1YNTB 4G43A 5HVHB 4JFQA 3BD3A 5DHXB 4XCNA 3V4UH 2Q76A 4Z95L 3QFJD 1NMAH 4KY1H 3PQYB 4PJBB 4D0DA 2EZ0D 3GJFH 1I7UA 2EH8H 1ZHBA 1T2XA 3VI3E 1N6VA 3FFCE 5DJYB 2JJTC 4IRSA 1FZMA 1P4LB 3V7MA 1NEZB 4KXZI 4CNIB 3H9SB 5BZDB 1CFTB 3IDMA 1BZ9A 3TYFA 2VDLL 3QT2A 5DA4A 2ARJB 1TPXC 1FG2A 1HSAB 4P46B 5DK2B 2ED8A 2ARJQ 1MREH 3AB0B 4JDTH 4UOW0 4JKMA 4I3SL 4XCCH 1T21B 3QEUA 5GJTH 4JRXE 3IFNH 1ADQL 3RNQA 2CQVA 3UJJL 4MXQC 5SWZB 1ETZA 3O2VL 5E5RB 2XNAB 1KN4L 4NPYA 4Z76B 5IOPB 1JGEB 2R1YA 4K3DL 3A6BL 4B50A 1S7QA 4G3YL 1NCWL 3PIQA 4G9DB 2IQ9L 3CH1B 3BD5A 4U1MA 1XCTB 4YO0B 5FA3B 2BP3A 4ELKA 3MX0A 3QUYB 3L3OA 2AJZA 3BD4A 3QI9D 3O8XA 1N7MH 3ILPA 2APVA 4RFOH 1UWGH 25C8L 3C5SB 4WIQA 1TCMA 4LVHC 1DN0A 2EDRA 1KXQE 2WM0A 1NDMB 4F9LA 3GMOA 3T0VA 2IADA 3UTPE 3BDBA 4P59L 3S6CA 3H42L 4MNHA 5E6YA 1FFRA 2HFTA 5F9OH 3V0AC 2IPTH 2AJ3B 5GGSA 4OF3A 1N2RB 4N0UE 5FGBA 1UXWA 2VLJA 4QHKI 1CQKA 1ND0A 5INDA 2VDKH 1VESA 2NY2C 5J12C 3X12B 3MLZL 3O2WH 4IDJH 3VFPA 1PZUB 1HYRC 1U2CA 3FB6B 1VKXB 3HMWL 2CSPA 4ZPTA 4G6AC 2M1KA 3RWDB 4ZOEA 5E8OB 3MRLB 4Y2DD 4KH2A 4LP5A 1H3UA 3LKOA 4K3DH 5HI5D 4JZJC 4EQ3A 1A6TA 3QHZH 5GHWL 3TGXA 4PRHA 1DQLH 5JOFB 5L7XH 3EYOB 3X3FL 1DN0B 4X8JB 2ICWJ 3O6KH 3ZKQD 2HLFC 1TCRB 2DLFL 4RFOL 1GZQA 4I0CC 3LZFH 1WAAA 1UWGL 25C8H 4NUJA 4JANA 2DYPD 4P2RD 3RPIA 2ZUQC 4E42B 3EGSB 1G6RL 1GC1H 1FAKT 4U2ZA 1OTTC 4C56A 2YPKA 2ADGA 2EDYA 1WCQA 2GJJA 2P5EE 43CAB 1YA5A 1IAKB 3ZE1E 3PV7A 3ARGB 5CLWA 5MI0C 3QI9B 1G7PA 3REVB 1BQUA 3GK8H 2AJYH 2JE8A 3S37L 1F3JB 4PY8J 5F7HA 3MLZH 3O2WL 3ARSA 4UDUA 4XHQA 2Q7NA 3MJ6A 4Z7UB 3TP4A 5DDHA 2NY2D 4LSRH 1NEZG 5ICZB 2EXWC 1FG9C 2ATPA 5CZXD 2ERJB 3WFDL 4XNUL 4F80A 1G9MH 3EFFA 4BYHA 5I66B 4APQD 3I02B 3MRJB 3QIBD 2QQNH 1ACZA 1TTGA 1Q72L 3EYVB 4F7TA 5HGAB 4HH9A 4P57B 3AGVA 2YPKB 1I8KA 4AQOA 4JRYD 4YDVB 3CXDH 1G7IA 2EIDA 5FO7B 2OJEB 4AH2A 4NDMB 1JNLH 4TSCH 1CZ8H 4FQ1H 1T7YA 1G9MC 2Q8BL 5I1KL 2XWJB 3BZFB 3HC4L 3PGFL 4QXWA 1XF3A 4JJ5B 2BHZA 4M03A 1KC5H 3O0RL 2EO1A 3EYQC 4FQCH 2C3HA 3B2UD 5H37G 2H2SC 3QWOB 3BN3B 1YPZF 3SDCB 1LDPH 1TTUA 2Q87A 1F3DH 2C26A 3ARDD 1NGYB 4LHUA 4ZDHA 5T1DL 1UJ3B 2AK4B 5CJBA 3DV6A 1DBJH 1D6VL 2SEBB 3VWKB 2EKSB 4GJTB 4M1CC 4BH7A 4BELD 5C0GB 4HH9B 1D5MA 1UH3A 2V2WB 4CMHB 1RUQL 2AV1B 3ZE0F 1P7KA 4LEXL 3CSYB 3U9PH 3VFRA 2GIYA 2C3VA 4U0RB 1NJ9B 2HG5B 4U1IB 4MDIA 2ZSVA 2FO4A 3J8F7 4U6VL 2WINB 4MXWL 2BSRA 3CXDL 5HYFA 3BH8A 2GAZB 3QEUB 2ESVA 2BK8A 4P23D 5T5NG 1XH3A 2XY1A 2X4NB 2FB4L 1LO4L 5DYOA 1VB9A 1MHCB 1MCPH 2HJLB 3QH3A 3H3PL 3X3GH 5CZKA 3RX8A 4PLJC 1IM3A 1EV2E 2JTDA 3W82A 4CN1A 1A4KB 3VD3A 1MAML 1WWWX 2UV3A 3R1GL 4PJFB 3OB8A 4Y4HA 3INUL 4JO1H 2C3VB 4ODVH 3ARDC 5J13C 2Q20A 4LGSB 3RWGB 1NAKL 2FJHA 5F88A 3KJ6H 4LCWD 4J8RB 3F65A 2DI7A 2QQLL 5DVLA 3RL2A 2WQ8A 1C5BL 2VLJB 4PB0H 4FQXA 1QQDB 1LO3L 3MJ7B 3QULA 4LSPL 3GGWA 4HBQA 1XGTA 4KRPC 3ZKSD 4XAKD 2B39A 1B6DA 1KIPB 5KSBB 1A1OA 4P9MH 3ABZA 1N2RA 1CFVH 3SDXE 4JCLA 3RNKB 3ZKMC 1V7MH 4NP4L 1EHNA 2XWTA 3H3KA 1ONQB 1QLRA 4JFXA 9CGTA 1A4KA 5DI8A 3L5HA 1AIFA 2P5WB 5EU7C 4FABH 3OXSB 1FP5A 1QRKA 2P5EA 4AMKL 3V8CA 2PXYA 3VJ6A 3E3QE 3LMJH 4L3EA 4I77L 3M17B 4GS7B 4QNPE 1RIUH 2CIKA 2Y25A 2R29L 2EDBA 2CDGB 1IKFH 3H7BB 4LCCB 3V5HB 1I8LA 3SDXB 1X5LA 4XPHL 1KIRB 2HT2D 1YMHB 5IG7A 5HHMB 4F8QA 4YBQD 1BGXL 1XGUB 4S2SA 4KVCL 2OL3L 2ZUTA 3RWEA 3IKCA 3D9AH 1MREL 1UEYA 4OGAC 3TYGH 4Z78B 4XCCL 2NY4D 3GIZL 4MNQD 5I0ZA 5DURD 3HZKA 5D6DA 5DQJB 3X13B 1OAYH 3DXAE 5JORA 2BVPA 4P2OC 3RZCD 1KJ2A 4ZPVB 1LK3H 3QI9A 4XP4H 3V7AG 4GW5A 3HI5H 3V4PL 4Z95H 5FYLH 3NIGF 4I0PB 1KLGA 5E8PA 3ZT7A 4FMKA 1FNEB 2PYEA 4X5WA 3BP5B 2PTVA 5F89A 4UQ2B 5TDNB 1UB5A 3SGDI 3IFOB 4RISL 3BZ4B 5A16B 2KL6A 5E1HB 3UTSB 2QADC 5ENWA 5CCKL 4RIRB 1MJ7L 3EO1A 5EZOL 1IQWH 2BNRE 3NABL 3V6FA 1MJJB 3PE9A 1KT2A 3U46B 5B38B 1AXTL 1MWAH 3C5JB 1XF3B 3WIFA 3PDOB 1MVUB 2IPTL 4NYLA 4YDVA 2HT2C 4JM4L 5ILTH 5FO7A 4GAGH 5JHDA 5DEGA 4I0PD 1NL0H 4OLYH 5FEBA 1QLEL 2BSSB 1T5WA 2H3NB 5C8JA 4QF1A 4LHUB 2GJZB 2IADB 4ZDHB 1BBJB 3SY0B 5B3NA 3ULUH 4PJFE 1IEAB 4DGIL 2ESVE 2W0LA 2E5EA 2J88H 5I17A 1OAUH 5I75B 4YDKH 4C58B 4MA7L 1LEIA 1T3FA 5EO0A 3QG6B 3QAZC 4YBHA 4D0CA 4UNVA 3X17A 4YHMH 3NZ8A 4MD0B 2OR9H 3T1WA 5JO5A 3PV6B 1PYWB 1ZSDA 3HNSH 3P0VH 4LQ1A 4XPBL 5CCKH 4XVTH 4EVNB 1HQRB 1QNZH 4L3ED 4M1DH 1U8QB 3DX7B 4PJFF 5KN5A 1NANI 4TSAH 4LOUD 5FA3A 1CG9A 4OCMC 1P7KB 1MCWM 2LU7A 1NAMA 3UTZA 1ZANL 4RMSA 4ZFFB 3HE6C 1EPFA 1DP0A 2D2OA 5DYOB 2NW3B 3IDYB 5ESQB 5KVFH 4NUJB 1S78C 3RY5A 3SKJH 3KPRA 3LD8C 3MODH 1PQZA 2HYMA 4K94L 1MELA 4BJLA 1H5BA 2FHFA 2N1KA 2I07B 1D7FA 4MNHB 2IPUK 4JY4A 3ZYJA 3FONA 4HIEA 4AK1A 2NLJB 5L7XL 4X7CC 1UM5L 1IQDA 1MRFL 2B1AL 4R7NA 2MPAH 3MFFA 2YRZA 3I9GL 5E99H 3T2OA 4ELMA 1SYVA 4JKPL 3GI9L 2IMMA 2CXGA 4DQOL 3U2SB 1EJ6A 4Y0GA 4X7SL 4JB9H 4YXHH 2PR4H 4NNXA 4ZOCA 5L2JB 1SEBB 1TQCB 1WSST 4HT1L 1DZBA 4U1NB 4XPGL 5HI3D 5EWIH 3HE7A 1U8HB 5DMIH 1JYVA 3NIDE 3RWJB 1UG9A 4HIHB 4MMZC 4M7JL 3MUGB 3QXVA 1BWMA 2YR3A 2GK0B 2AABL 3Q2CA 2QKIB 4J4PA 4JLRA 4KK8C 5TE7L 3GUTA 5IESL 1Q8MA 1RUKL 3K8KA 4HW6A 3PHSA 5C0RH 3DOSA 3BEVA 5AWNL 1HK6A 1NFDF 4L8BA 4EBQL 2ICCA 4FXGB 3TNNA 2ADJB 4O2CA 5HGGS 2HKFL 5KS9F 5J56B 5F9JA 4ELMB 3MLYH 3JXAA 3MNVA 1IAOB 1NCUA 2F53E 4KZDL 4WW2F 3QFDA 1RZFH 1WAAF 3HA0A 2PUQT 3VXRB 5BS0A 1J5OH 4XHJC 3MV7B 2R0KH 1F11B 2F8VA 1MLCA 4Q9BA 4HFUL 3BH9A 3MV11 4G6FD 3MC0A 3QXWA 2A1WH 3GZKA 2CLRB 4U2YA 1ZHLA 4U1SB 1QR4A 1A1MA 5FYJD 4I4WB 1IC4L 1IAIM 2NPLX 1CTNA 1F4YL 3WFEL 5B39G 4L3CB 2GITB 1KN2L 4DVRH 4HUXB 3KPSD 1IMHC 4QTHA 4FRWA 4FFVC 4NCDA 3WS6A 4HX1A 3C5SA 2CLZB 1L7TL 3SO3B 4G8IB 3PWPB 3S8WA 4QRPD 3RVUD 1MCPL 3QZWG 5E6ID 2FBJH 5IESH 1EHLL 5LGJB 4ETQB 1Y6MR 1GOFA 1MLBA 3AS2A 1D9KB 3BUYB 1AC0A 3MBEB 1XCQB 3EOTL 1HHKB 2BERA 1CGXA 5T1DH 2XA3A 1ZXQA 3H3BC 2XWBA 2YC1A 2FLRT 2YA0A 4RFNB 3BKJH 1JZ3A 3EAKA 4R2GC 1YEEH 3DVFA 1KB5A 1G7QB 4FZEH 2VLKD 4NQSB 5T1KD 3ARPA 5J11B 5GRJH 1LNUA 3DURB 5HHOB 4D3CL 3LV3B 1K5NB 4XPAL 3OKEB 4KJPC 2EYTB 4G6MH 4X6DE 2GTZA 3JUYA 4KKNA 3QDGB 3WJJA 2ICWB 2V2TB 4POUB 2WWKT 1LO3H 5HGDB 5DUBB 4Z7QF 2X1WL 2FL5A 4QO1A 4NO5B 2CUMA 4OZGF 1DBMH 1CDIA 3GSNH 1XGRB 3O6LH 3H3PH 1AO7E 3X3GL 2P8LB 1CU4L 4HK0A 5FUOL 4KDWA 1AKJA 1JHTA 3OG4B 3QJFB 1ERNA 4P2QD 1FNSL 5D72L 4EI5D 3ARGC 3D85A 1MJ8H 5LGHL 5FYKU 3NZHL 4TVPH 3FQNA 5ADPH 3DIFA 5E6IC 1N59B 2D3VA 1SMOA 5FOBA 4WUUD 1B6UA 3MRGB 3STZB 3E6HB 3KS0J 4RGNC 1P6AB 1A6ZB 2GYSA 3KPMB 5MEQB 1C16A 1II4E 4WI6A 4JFDE 3CH8A 2R8SL 5T1MB 4M48H 5DSCB 2J5LC 4R4BB 5BOPA 4XX1G 3F7QA 4O9HH 1X5YA 5EOCH 5IBLC 4M6NH 3M17A 4U1LA 2NW2B 2IQ9H 1U93A 1I1AC 2F74B 1TNNA 4XX1E 5HXMA 1I1FB 4NRXB 3P9MA 3H9SE 4X98A 1A7PL 3SGEH 5EO1A 4LCUA 1EHAA 4WFGE 1BZ7B 1CGYA 4EIGB 2PYFB 4L8SB 1P7QB 2EC8A 1HHHA 3HC3L 3LQZB 4P59H 2BVQA 4JDVA 5DMJB 5I8EB 1N8ZA 5DD3H 1XIWD 4J23A 4NN6B 3KXFB 1IGTA 3EOBA 3QWOA 1EZVX 1KENL 5GJTL 4N90E 7FABH 1MJ7H 4JFXB 4WFHE 4ZD3L 4YXLH 5K9OB 5IVNA 4XGZB 5EUOB 4YHKL 2NQCA 4D9LL 5C0BB 2YN3A 1DUYA 1VEOA 2FX8L 4QRUA 2Y9RT 3L7EA 4LIQL 3VA2C 2AV1A 2G2RA 2R23A 4MX7A 5F7EH 3CDCA 5IW1B 4LLVA 1AGDB 2V7NB 3KPQB 5SWSD 1QG3A 1JZ7A 2VDPH 3HCVA 3REWB 5GRUL 1T03H 1UQSA 1R0AH 3BMWA 3OJMB 4ESKA 4NKDA 2D7OA 2E7LA 5FYJE 2ATKA 4Y2DA 3P30H 1PG7X 4Z7WF 4NN7B 5ICXA 5BQ7A 3PHQB 3V52H 1C5DB 4H5SB 3IAQA 2JB6A 5SV4A 1YN7B 2EE3A 5F9WC 1OF2B 3QUZB 4XPBH 3HMWH 2WUBH 2O61B 1RZGB 4Y16B 3VCLB 3EJZD 2ZG3A 4KI5E 5GISH 1WITA 2IH1B 4PJEE 5LG1A 4OJFL 5J1AA 5I17B 3OG6B 4OLZH 4NUGH 1J0YA 1TNMA 3Q0HA 1T3FB 1I8KB 5TE4H 4M9OA 4ONFH 2HFGL 1L9NA 3VFVB 1FGNH 2HH0H 5FUCE 2XIDA 3IXAA 4F7EB 3RVVC 3O8XD 1V3JA 2ED7A 4DGYL 2ORBL 2LV4A 4OT1L 1U8QA 2ZPKL 4HWEH 1JPFA 5HHXL 1IILE 4FN0A 4I2XA 2Z31C 1WF5A 2OL3B 1YMME 3PDGA 2H1PL 3QDJA 5ICXB 5L6YL 1ED3A 3HUJE 4P5KB 2A9MH 1HHIB 2NX5A 3HNTH 5HVFB 1TETL 1PBYA 1DN2A 2JCCA 5TF0A 4P46A 3ESVF 3WFHA 35C8H 1UM4L 3MRCA 2IBZY 4HG4J 2A9NH 2XWBB 2VLKB 5TF1L 4P5TA 2FX7H 2AKRA 4JFFE 2RJMA 2AJXL 1I8IB 4LBEB 4GW1B 2DQUL 3UTOA 2CKBA 1MFBH 4FOMA 1FIEA 3HFMH 5HTSA 4M6AA 4YO0A 1B9ZA 1F8TH 4RGMC 4PJIE 5CZVH 1QYGL 5KSAA 2DLTA 5GS0L 1TTFA 4PGBB 3R8BB 3QUML 4HWBH 5HYQB 4WO4C 1K4CB 1HCFX 5DJ2A 5JMRA 3R8QA 1A5FL 3O45B 5D1QC 4PJDA 2H26B 4ZFFA 2KQMA 4IRJB 4ZFOL 4X6BA 2YPLE 4GLRH 4Q9RL 1INEH 1IGCH 3F5WA 4RSVA 2X4OB 3BOVA 4G7YL 1C16B 5A3IC 4KGLA 4R7DB 1NCDH 5JORB 1U3YA 3VI3F 1WAAE 3G6AB 1BOGA 5JW4M 3CLEH 4HJJH 1MHPH 1G7LB 5E2JA 3H9SD 5MP6L 4WEBL 5GGSY 4RMQA 1VADB 3ZTJG 3TT3H 4ZQKA 3HFML 5JOFA 4LSSH 2R2EB 4JZJB 3U4AA 3LY6A 1MPAL 1N0XL 3O3AB 3FQXB 1K4CA 2DWDA 1TZGH 5DJDA 5I30H 4PRHB 5C0RL 4ONGL 3TLRA 5GGUB 5TPWH 4LEXH 2I27N 1MCHA 5FM5O 4U6YB 3PDOA 4Z7VE 4CN4A 4HDIA 4R8WL 1CFTA 4Y4FC 4GW4A 1OP3K 4Q9RH 1C5BH 4HX1B 1AFVL 4G7YH 3TNMA 2WK2A 3UAJD 3I6KB 4PRHE 4JGMA 3MV8A 3LEYL 3LKPA 3D69A 2VH5L 5E08L 3ME0A 2KDGA 4LLUA 5TGBA 3JWDL 1BQLH 4MQXC 3CLEL 1HHKA 1S7UB 4JY6A 2WP3T 1MRDH 5BVJA 1RIHL 4PRDB 5EA0L 4UT7L 3K1KC 1HYSC 1XR8B 5MHSD 1DUZA 1FC2D 1WIUA 1DVFD 1FO0A 4DK3A 3L7FA 4ZTOL 3FT2B 5I1CH 4G9DA 1RIUL 5GIRA 4YFLF 4FQ2L 4X4ME 2NR6C 3AMLA 4PJEA 3WEXB 2HJFA 2OQJA 5IBUB 1CYGA 1NAKH 1CK0H 2EC9U 2DQDL 4XPHH 1FNSH 2DQJL 4U1HA 2O5ZL 2VLMD 4CADA 3JVGA 4M02A 1MQKL 1DSFH 32C2A 4HS3B 5EBLB 2D03H 3D87B 1I8MB 2WLZA 1NKOA 1MQ8A 1GGBL 2CO6B 1F45A 1YN7A 4KROB 3QUMB 1S7VA 3MO1A 5T1LA 1Q1JH 5HY9B 1NMCC 4H1LH 1NLBH 1RUAH 2VE6A 5DMKA 3TYGL 1F00I 1FN4B 3CDFA 3DVNB 3U9UA 4BQBA 1H5BB 3NH7L 1DQDL 1CFQA 3W0WB 4H5SA 4EUPA 3HUJA 4JM2D 4O9HL 2VXVL 3BSZL 4PR5A 5EZJA 1YNKH 4F15B 1R5VB 1H3TA 5F1IB 3P4NA 3G5ZA 1IT9L 2ZP0T 3ARFB 1NKRA 4YLQT 2KZWA 1XGQB 2R29H 4NYLB 1KCVH 1BEYH 5LXGL 1GGYA 5E1AA 3OKKB 2JF1A 4YDIH 5IWLC 3KDMA 1RZJL 4HMCA 3PWUA 3F6IA 4NJAL 1P1ZB 4GXUN 4QRRB 4MQ7B 5LGHH 3NIGE 1JMXA 4BM7A 4RNRA 3S35L 4RAVB 1NDGB 1UH4A 1UVQA 5HPOA 1KG0A 1UWEH 2FIKA 1TJGH 5C08A 3V5KA 3UYPA 3QIWA 5DRZA 4OM0L 1VSCA 2JIXA 3DGCR 4M43L 3F7VB 5EUOF 2CR3A 5BVPL 4XPTH 4K7FB 4BFEA 4PRPB 2YPLA 4PJ7F 5D1QA 3MV7D 1I1RA 5IM7B 1K85A 3G08A 3K7UA 3GBML 1A47A 4TOYL 1U8MB 4XB8A 1IC5L 2EEBA 5DEZA 1B4RA 4YC2B 3JVGC 2CLVB 4HCRA 4UT6H 5C0DB 1TJHH 3FN0H 4MSWB 1Y0LA 4LASL 4DN3L 2NW3A 1FBIL 1S7WB 3KPOB 5HI4D 3KHQA 3RL2B 1INDH 1CGSH 3MXVL 1JPTL 3NACH 4NIKB 4I48A 4IRJD 5BXFB 4PJ7B 5HI3C 4HEME 2BY1A 5ESAB 1YEIL 1LVEA 3D2UA 3VFNA 5HYJB 3IJHB 1UWEL 3D39D 2N4IA 3QNXB 3ZHLA 5A2JH 2A77L 2D31B 1B0GB 3DX8A 2AAVA 2HT4C 3TBWA 1D6EB 4RFNC 4ZFZA 2HTKC 5MERB 4PUBH 3CGTA 2V5SA 3FQRB 3LOWA 3VJ6B 3ES6A 3VXME 4Y2DB 1YY8B 3GHEH 4Y89A 3ALWA 1EUTA 5IB3A 5ABDE 2FR4A 4I8DA 4IMLA 1U8KA 3KXFE 1VDGA 5E2TH 3IAGC 2SEBA 4JKPH 1MFEH 3PGDA 5DQDL 2QKIA 3AREC 4JLRB 4WY7L 4RZCB 5TH2B 3VRIB 2PR4L 3SDXA 1A9EB 1KBGH 5J4MA 2ICWA 2V2TA 4RFEA 5F9DC 3FO0H 1HNFA 3VRLE 5HHOE 1AHWB 2XQYK 4O58H 1JPST 4YNYA 2P5ED 4HKBB 1NMBL 3Q48A 2X4QB 4LLUB 1EAJA 3QZWA 4M7JH 3PWPD 4KRMB 1KYOJ 3I6KA 3QEQA 1UADC 5B21A 3QUKB 5IMOA 1UZ8B 1FL6A 3FQUB 4ZXBB 3TF7C 1MHCA 3JWNC 5F89B 3MRDB 4HIIB 1NAMH 3DX6A 4MAYD 1UYWL 4NQCB 1A6VH 4GBXB 4WI5A 4FS0A 5C07B 5E99L 3L5IA 3MA7A 2E9BA 1Q9OB 1QFUL 3EO1B 4OAWA 3FB7A 4Y5YB 1EFXB 4O5LL 1JWSB 4CADB 1MUJB 4XC3L 5FM4A 4PJXE 2H1PH 4P3DB 4PJHE 3ULVF 4KQ3L 3FFCA 1X5JA 1AXIB 2YRLA 5DRWA 1MCKA 4PBXA 1CS6A 1HSAA 3CDYA 3QJHB 3HLAA 2M2DA 1PKQE 4EOWH 1Q9WA 3WFCL 1FDLH 4UAOC 4LPVA 3ORJA 2OZ4A 4XTRC 3RDTB 5I1DA 3N1GC 3DLQR 3LEXB 3WS3A 4NO0A 2HKFH 4GFTB 1U2HA 5EZLB 1A3RH 2H41A 1BOYA 1NC2D 5IB4A 5FCUH 2ZJSH 3FB7B 5BW7A 4GAJH 2CKNA 4H20L 2XY2A 5E8NB 1NCBH 5I8OL 3ESUF 3KPPA 2HKHL 3VH8G 4HFUH 3W39A 2IQAA 3MROA 4JQIL 1KXTB 2BRRH 3WO4C 3M07A 1OGTA 4YHZL 2H32H 1X5ZA 2FJHB 2YBRA 5F88B 5IBLD 1CLOL 4TSBH 4F33A 5DUML 1KN2H 3OL2A 1NDMA 3QQ9D 3NCBB 1S5HB 4JFFD 4P23A 1AGCA 3N1PC 1IGJA 2ZNWA 4PBVC 1NFIA 3SKNB 2NY6C 4S1QH 1MFAH 4KI5F 4FQCL 4B7IA 3JWDH 3OQ3B 1ZGLP 3TA3A 1X3DA 4G9FA 2LAGB 3L3DA 1U6AH 4KMTL 4MXVF 3DRQA 1RIHH 3TH3T 3RNKA 2VDML 2APBA 1U3HA 5HD8C 3BPNC 4G8GD 4WV1B 5CP7A 3D39E 4P2RB 1ES0A 4JPWL 3I3DA 4JN1L 5FCUL 3O9WD 5HYEA 1N0LA 4PTUA 4HLJA 4OFYA 2QEJA 1XCTA 3D3VA 1P2CA 1KPVB 1TLKA 4Y16A 3VCLA 1FH5L 1SYVB 1VADA 3CUPB 3MLRH 1OD7A 2VJXA 4LSDA 3RVXD 1ZS8A 5L2KA 1S3KL 5DEFA 4R3SA 4M6NL 1S7XB 4G8GE 1P5UA 4HV8B 1DLHA 2KBGA 5BXFA 5HHME 5HHPA 3HE7C 4Y4KB 1LE5A 3B6SB 4L4TE 3VFNB 5K9JH 4ELME 2W9DH 5DRNA 2F53B 4E41B 4CVXB 5KOMC 2LVCA 1KPRB 2AQ3A 4Y5VC 1E6JH 3DSNA 3L5WB 4BSVB 1IKNC 1ZT7A 2GJZA 1FO0H 2YWYA 3GSRB 1EGJH 3SJVD 5IEHA 2UUDK 1A6UL 2HT3D 3G04B 4MNGE 1F3DJ 2YWZA 3INUH 3OAUL 3PQYA 43C9A 5JA9A 5HVHC 2BNUA 1JUFA 4RFEB 1MI5D 1VA9A 3NCMA 4JFED 1B0RA 2Q76B 2FATH 5F93C 4ZD3H 1F6LL 3HS0B 4HWUA 2W60A 5J13B 5HHMD 2MSPA 3K8MA 5IHBA 1DBKL 2ED9A 4ZSOE 2Z92A 3QQ3B 4PGCA 4C4KT 3TYFB 4E5XA 2C1OB 5JXAH 3K4DA 5CEZE 5FO9A 4ZOAA 1G7IB 4NJ9L 2F53A 4Q97A 3UJTH 5JHLH 3OJVC 5BS0E 4QRRA 1G7HB 5E2WL 4YHNA 5K9JL 2R1WA 3QDGD 5CEYB 4JE4B 5KVDL 3HE7D 4ETQA 1RAMA 4UDUB 4DZ8B 1GGUA 4ZSOB 4ZTPH 5E6IA 3CMOL 4P5MA 4J4PC 4NPYB 3QCVL 4Z76A 5IOPA 43C9B 1PKQA 5DD3L 4MS8C 3V52L 1FVDA 2VDQL 1BQHB 3MRPB 4HBCH 4Y4KD 4DEPC 5D1ZA 4CVWA 2EE2A 1IKFL 4ONOA 3IDNA 2XQBL 2J2ZA 3LAFA 5I66A 4PR5B 3CFEB 5EZJB 3QHTC 2M26A 5FYLE 2DM4A 1KIUA 3P4NB 5DT1H 4H0HB 4DTGL 4HZAA 3O2VH 2QR0A 5ADOL 3MREA 3EW3B 5ALCH 3ECBB 4G3YH 2FX8H 4LVNB 5TQ2H 1SEQH 2N7AA 4MDIB 2EDNA 3VDAA 3GBNH 2ZUSA 5D5MA 3PWUB 1ORQA 2AEQH 5ANMA 4UT9L 5MENB 1WWAX 2AV7A 4JRXD 3RL1A 2VDPL 3D85B 5CMAB 4I48B 1TDQA 3DSFH 4Y5XB 3BE1H 4RBPK 2YPVH 2P7TB 5E4EB 2UY6A 1SJVA 3QCVH 2EYSA 1HH6B 4N0UB 3UXFA 2Z8SA 1PZ5B 1H0DA 2BOCB 2A6IB 3PP4L 1RVFL 1P4IH 5AYUH 2GJ6A 3JTSA 4NQEA 1JIBA 4HMEA 5CSZA 1A6TB 3FO0L 5D7KD 1HILB 1QSEA 2DS4A 2R4SH 3A67H 1JI2A 3OZ9H 3V0WL 5MENA 1FYTD 3B5TA 3PGDB 4BA8A 2Q3AA 5CMAA 4GT7A 1S78D 1CR9H 1F6AA 2FGWL 1AI1H 5L2KE 4WI3A 4U7KA 1EFQA 3GSVA 2ICEA 4FQLH 3CFBB 2R1XA 3TN0C 4GUPB 4ODUB 1KJMA 4X4XB 1ZWIB 1AXSB 4PJ7E 3GSQA 3VWJD 4YHOL 4L4TA 3AC0A 4ZQKB 1BECA 1G9ML 1D6EA 5EUOE 1QEWB 1OP5H 1W72H 1IGFL 3MRNB 4WY7H 4ZAKD 2AJVH 5HDBE 4PRBA 2X1XR 4WEMB 4XWGH 4WGWB 1HQ4B 2EZ0C 4XVTL 4ODBD 4LHUG 2GTWA 4LF3A 4CL7A 3IRZA 3ZYIA 3MJ8A 4I4WA 4KV5E 5TDOB 4IRSB 1R3IL 3HI6H 4QTIL 3GHBL 1LE9A 2E7BA 2Y5TA 1DQML 3BP6A 1Q0XH 2FEEL 3UTTA 4RMRA 3NA9H 1OSZA 15C8L 1FL3A 4D0DB 1C5CL 1QSZA 5KZCD 2ICEB 2HFFA 1FFOA 4XCFH 2GSGB 2AJSH 2FGWH 3KLAA 1CBVH 2IPUG 3CFKA 1JGVL 1HXYB 5TGBB 4OD1H 4HKBA 5DK3A 5KAQG 2D0HA 3WDIA 4FQLL 4LPCA 2BMKB 1A64A 2V2XB 2MQ0A 2ARJA 2PXYB 3O41A 5I1GL 1AFVH 3DXAA 1KJ2L 3IVKB 4K7FA 1OWWA 3HG1A 2XTJB 3FT2A 4XNMA 3V5DB 3GSRA 3B2VH 4ZO7A 4YJZL 4JQIH 3B4NA 1ADQA 3QCUH 1JF1A 4YHZH 1FJ1A 5B8CB 1GVIA 3AM8A 5DUMH 3BP6B 3GSWA 2J8UA 3TBYA 2IFFH 1FPTH 1YJDH 3DV4A 5F6IC 3ILQD 3RFZC 1KNOA 3VXNA 2BNRA 4E5XB 4ORGB 4HIXH 5HY9A 4I2XB 2CDEA 4JRYB 3BVNB 4C54A 3GIVA 2LABA 5F96L 2AJZB 3BIKB 4WFGD 5FGCB 4D0BB 3VW3L 2DDQL 3QUXC 1KACB 2BVPB 3S4SB 1BD2A 4LRNL 4MHHI 3WO3B 4WVRA 3DJ9A 4H20H 3IDJB 1EVUA 2C4FT 1P7HL 2YUVA 2X4NA 4JN1H 1BP3B 3GSOA 3L3GB 4Y2DC 3QH3B 3QISA 1LK2A 3O3DA 3PABA 1JRHL 1JL8A 3D0VB 4NQDB 4X0KB 4PJDE 4LQFH 5I73C 4G6JH 1RJCA 2V7HA 4X6EA 5IHUH 3TWCL 3TZVA 3QCUL 1QSVA 1IZJA 2IEPA 3CX5K 1QFPA 2J12B 3QDJE 4NSKA 3VXSB 4X5LA 3T2NL 3VXQA 4XT1C 5CAYB 4DZBA 3UTTD 2J3SA 3WXVL 4XNZB 1KCRL 3B2UC 4GKZA 3UDWC 4B41A 3E0GA 3L3KB 2HLAA 4TQEL 3EYOA 5EORL 3ZHDA 5BRZA 1QUNA 3MLSH 4OCLC 4HIJB 2OI9C 4XRCA 4UV7H 4EI5C 1MQKH 3SDCC 4IRJC 4KJWD 2X9WA 3VMOA 3KGRA 2KKQA 3KYKL 3WNMA 4E42A 3L95A 2VDOH 4OGXH 2X70A 1OSPL 1NCCL 5F7DB 2DL2A 4BUHA 2WMPA 1DQDH 1FV1A 5CEZL 5BVPH 1YMMD 3R0NA 1T1WA 3OB0H 3V95A 4XPAH 5D7IA 4FQXD 3FT3A 5HDQH 3BSZH 5CWSA 3RZCA 4J6RH 1WGOA 5FECA 3BZDA 5EUOA 3MRRA 4BKLB 4BFGA 3EIFA 1IC5H 3MRJA 5HJ3A 4OZHA 4QGTA 3RJQB 4HKJA 1Z3GL 5FA4B 1OCWL 1N7ML 5I16A 1PX4A 1JTTA 4XXCA 4YDIL 1VERA 3HS0A 3SKMA 2DWDB 1S5IH 1EBAA 4LSVL 1KLUA 3HZKB 2Z9TA 2GJ6D 5CJXA 2PO6B 8CGTA 3X13A 2I07A 1T2JA 5DRWB 3BESR 4RX4A 2R9HC 3QO1A 2BCKA 5KW9H 1WTGT 1CXFA 1EGJL 3VXSD 1UACL 1NC4D 4AH2B 3FB5B 3GMPB 1UFUA 4JEGB 4PGDB 4R4FH 4Z0XA 2FATL 1WZLA 3W11C 1AD0B 3DYOA 4NO0B 5E4EC 1QVOB 3WUWG 5DT1L 3MACL 3G5XB 1YQ2A 2H2PD 4X9HA 2B4CC 5ADOH 4FMFA 4JPIA 2GKIA 3LKQB 4Z7UE 1UJ3A 2AK4A 3L3HB 4P2OA 3WJJC 5TDPA 3ZSTA 1X7QB 2W60B 4LIQE 3ARDA 3MLTB 3PHOB 4F9LC 5H94B 4BH7B 3GJEA 2VKWA 3BE1L 4DGIH 2J8UE 4LGRB 4NGHL 5SX4I 3H42H 1PW3A 2ZCKL 4HXAH 3TVMA 2AXGB 5DURB 1XCQA 3MBEA 3W2DH 2ZCLL 4NNYB 5EO9A 3SKOA 3HZYA 3O3BB 5IQ9B 1JK8A 4NQCA 1IAIH 1H15B 1U8IB 3EZ8A 5FF6B 4XWOC 4MMXC 4O2EB 4HWZB 4QHLB 4XTRD 2IALB 1X5GA 5LAXA 2FJGB 4YXLL 3EJYC 2VR5A 5E9DA 4ZUSA 3OBAA 4PJBA 1IGMH 5DUPL 2C7UA 3LV3A 5DLML 1NFKA 3S4SG 3OKNB 1U8PB 4ETYA 3BP7B 3W11D 3GBNL 1AP2A 3WS6C 5FK9B 1X7QA 3LS5H 2AEQL 3MNZB 2A6IA 2H2PC 2OI9B 2R2EA 4JZJA 3MODL 4LKXB 2JB5H 4I3GA 3SE3A 2O5XL 3BKCL 4LCCC 4C57C 4TPRL 1TVHA 3TVMB 1G9EA 3O3EA 3QXUA 2I25N 1QQDA 4Z9KB 3DROA 5EO9B 4Z7UF 3GSOB 3L3GA 3SCMC 4YHOH 3ARVA 5FGBC 3MJ9H 2QHRL 5ACZB 3I9GH 3RL1B 2DJUA 4BH8A 2V7HB 3S37H 2XNAA 4EOWL 3F62A 4RX4D 4JKKA 1AQDB 4X8XA 4CAGA 1L9MA 3TH2T 3VXSA 3QNYB 1KJMB 4OCRH 4UILH 4X4XA 3T0EA 3C60A 2ZG1A 2P47B 3ISWA 2YXMA 1C12A 4L4TB 1IGML 1BFVH 5DUPH 4NQTA 1D6VH 1LO5A 5JPNB 5TE7H 1F6FB 2XKNB 3O4OB 4R4ND 3VFSB 1KF9B 3F58H 1R24B 4DKAA 4M7LT 1AC6A 3KPOA 1LO2L 4KTYA 1E6OL 3A6OA 1EEQA 2AXFA 3RHWF 4FQHB 4HF5L 4G7VH 2VIRA 3IJSA 2J6EA 3P9LA 4MVBD 3S7GA 2HVKB 2FRGP 4KKAC 1KCKA 4ODWB 3HNTL 4IIQB 1TETH 2NXYD 5F1KC 4R96B 1B0GA 1ZT4B 4YDLB 3RVWD 5J9PA 1T1WB 4U0QB 4WFED 1M7IB 5BMFL 2CIIA 2AS5M 4ODUA 1A21A 1QRND 2V5RA 3WBDA 1R3LA 4QRPA 2ADFH 4HQQL 1IAOA 1G0XA 5BJTA 1IKNA 5I19H 2X41A 1YY8A 3MLVL 4YXKH 3R1GH 2P5WE 4NT6B 1T0NA 3GSXA 4GQ9L 4YK4B 3U0WL 2GITA 5E8DL 4OZGE 3MR9A 3I6LE 4HV8A 4OD2A 4EDWL 1RZJC 1EHLH 1RZ8B 3VRIA 4JZNA 1MF2H 2Y7QB 2DOCA 1E4KA 3DXAD 5C09A 5C0EB 1UA6L 5J6HB 3D1MC 3WIHA 3VW3H 2GSIA 5E1AB 4U31A 4IIQA 4R4NC 5GJSH 3V9FA 4MWFA 4WUUE 4I9WD 2DM2A 3TO4A 1IC4H 5IK3A 4S1RL 4NQXB 3ZE2F 3BUYA 3DI2B 2Z93A 1M05B 2IANE 4PRHD 5DK2A 5LGJA 1T5WB 1MFAL 2I9LA 3JWOC 3ZDXF 1Z5LA 4XVUC 2LU4A 3KLHC 1HIML 3SY0A 1T21A 3NPZB 4WDIA 3UZEA 1MHPL 4PGDA 2VOTA 1QPPA 4L1DA 3VGBA 1YECL 2O61A 4DGVL 4J4PD 4ZUWB 2A38A 4ZO9A 4UZGA 5BV7C 4JZNB 4QRUB 3GO1L 5EH1A 4Y4KC 5C0EA 2DIAA 3S3SA 3KPRD 3U0WH 5F96H 2QSVA 5DMGC 1MJUH 4NZRH 4PJGB 1YEDB 4OZIA 4HAGA 4MSWA 4LLMB 3VWJA 3Q6GH 3HCVB 1UZ6F 4RDQF 4C83B 3CK0H 4XBGB 4RAVA 4M61A 4GKZB 2DTMH 2A0LD 2H9GA 4Y4FB 3VXTB 3GIVB 5C08B 1F6AB 4ZNEA 2EDDA 1JZ6A 5D7LB 5T5NF 5JHLL 1UXWB 4M9PA 3OX8A 1I9RL 5E5UB 3KXFD 3QI9C 3ZLQC 2CK0H 4FABL 3GMMA 2XA8L 1RI8A 3HZMB 4OZFB 3SE8H 5IMKA 3SDAB 2D7QA 4N0FB 12E8H 1QSED 3OF6D 2PYED 3GKWH 4CJ1A 5DWUH 2R0LH 3W39B 4P2QA 1U93B 5GZND 2C1PB 4U49A 4I5BA 1TVHB 4G9FE 3C08H 4WW2B 4IRSC 1LGVA 4OQ1A 4LLDA 4NSKB 2EC9T 5F9AC 2CRMA 1EZVY 1GZQB 1U8NB 4EDXA 1I4FB 3D39A 1KB9J 3O9WB 1I1AB 2A73A 2VDOL 1GGBH 3DVGA 5TQ2L 5SWSE 3EKCA 2I26N 2DQGL 4U6HB 4PP1C 3NFNA 4JY5L 3TEUA 5SV3A 4LCYA 4OCXH 4P23B 5DJCB 1P6FA 3RWJA 3NH7H 2PETA 3U82B 4KJPD 1NLDL 2NZ9C 3L5XH 3G6AA 4ODHL 1N3NA 2WWMD 4PRAB 5D5MF 1GH7A 1UZ8A 1J8HE 5EU6D 1F42A 4HKZB 1TMCB 5HDOA 3WNPA 4P9HH 1R3KB 5C0BA 1C12B 3V5HA 3MNVB 4ERSL 1JV5A 2V17L 1QZ1A 5DWUL 3U0TB 4G43B 4WEUD 4XP9H 1R0AL 5DGQA 1ZS8B 1P4IL 4R90H 5AYUL 1MEXL 2GHWB 2MHAB 2OX5A 3GGWB 1JPGA 4JFZH 3DWTA 2RFXB 4JM4H 4LLYA 1W2KT 5DJXA 1C8PA 3L3HA 1ZWIA 2BSTB 4OM0H 4GRLA 1BMGA 2W92A 4X99A 1V3MA 3P73B 4UT9H 1J1PH 5IFAL 2AEIT 2PCPB 4ZPVA 2DQCH 2XTJE 4CVXA 3WL9B 4OV5B 2CLZA 4JG0L 1CFSB 2BY3A 5FM8A 1KN4H 3PL6A 4LSUH 5F72S 1P9MA 4YH6A 3U48A 2F15A 5HYJD 4CDGC 1VGEL 1YUHB 5EZLA 4EQ2A 4Y88A 3NCYP 3NCYS 5IROA 2OZ4L 1QKZH 4XWGL 1S7QB 4JO2L 1H8SA 1FSKC 1DANT 3B8YA 4JRWA 1D5IH 1CGSL 2H2SD 1HDMA 1KCUL 1DBAL 2WNGA 3K2UH 1TVBA 4DUXA 4MDJB 1FNLA 4I3RL 3MGAA 5C86A 32C2B 5EBLA 1JNHB 2OXGA 3B83A 2VXSH 3ILQC 3SKJL 1OP9A 3L3KA 4QXUL 2ESVB 2BZDA 2GY7B 1C5CH 4N9OB 2VZOA 1J1PL 1AI1L 3MRKA 3PQYE 1F90H 1HHIA 3D18A 1NBYA 4Y2OA 5JHDD 1WIPA 1I85A 1YMMB 1A02N 3G6JF 1RULL 3SQOH 5ACZA 3L3DB 2ERJC 3L95B 4M8QA 3IDXL 4MB3A 3RIAK 4ZSOA 3V79C 1DUZB 4MAYC 4EKXA 2J8UB 3TBYB 3G5VB 2G75A 4OZFG 3IDNB 4P2YA 2Y06L 3LRGA 1XF5A 2WBJA 1ZLSH 1T89C 5E2TL 1QSFD 2AJVL 4GS7C 4JB9L 4YXHL 1JBJA 1A5FH 1KJ3L 2OZ4H 3MV8D 5JDSA 2ESVD 3CPLA 2IQAB 3MROB 3ZKXB 3MCKB 1LO0H 4P3WA 5EWIL 2R2HB 3SGEI 4X98B 4H8WC 2Y07L 1ZV5A 2IAMB 4G9FD 1FPTL 3P4OB 3N1FC 3MJ7A 3QULB 5DFTA 1NBYB 2VB5A 1KLUB 3NTCL 2FBJL 2VIRB 5MP6H 4NQEE 3EJZC 4H26A 4NWTL 2OLDA 4OCRL 4FXLA 4UILL 5FM5M 4JFYA 1QSEE 2HVKA 1F3RB 2MJWA 1XIWC 2NCMA 1A9BB 1N6UA 3L9RB 4LHUD 1AY1L 5IMLB 4WWKC 4K3EH 5JIHA 5C0CE 3BFOA 3EOBB 1OL0A 3CSPA 3SDXF 3IS1X 5D2LE 3IDXH 5JXEA 2ITDA 1HHHB 2Z8VC 4U1MB 3RVVD 4HC1H 5EOCJ 4K9EC 2A1WL 3G5XA 2EEAA 4PP2A 1PEWA 2XXCB 3TO2A 2HTLC 3GJFK 2AJUL 4PV9A 3CC5B 4QCIB 3IDIB 3ZL4H 2BRQA 2HRPL 3VFUA 3ZHKA 1A14H 3TIEB 1AGDA 4AEEA 4ZNCD 3LN9A 1QFWL 4BSJA 5ESAA 1I7RB 4HIXL 2C1OA 5DD6A 4GAFB 3WIHH 3QG7L 2JLLA 4YIQB 3WIIL 4GUPA 3W9EA 2VN7A 1HSBA 2QL1A 4MJ4A 1H3WM 1URLA 4NKIH 3V6OE 4PJEF 3RY6A 4YC2C 1H3VA 4JFFB 2WBKA 4HZLA 1VPOL 1XR9A 1MNUH 1MJUL 3VWKD 1BM3H 1DQQA 2XV6B 1Y18B 2VDRL 4P5TD 4TRPL 1S9XA 2C7UB 3U0TA 3Q6GL 5L8JB 3THMH 1DDHA 2VO5A 5ETUA 1DL7H 1ODAA 3CZFA 2DBJA 1LE9B 3O8XC 3FFDB 3KYAA 4WI2A 3EGSA 3QB7C 4WNQB 2PCPA 4XNQB 3O6MH 2DF3A 4AJ0A 1G7JB 1D5BA 1QFWH 3U36A 3QUYC 1F02I 4C56E 4L4JA 1I8MA 4LARH 1T0PB 1TIUA 1QHOA 3LD8B 4IOSD 1F3JA 1JGDB 4DFIA 5I1HL 5GRYA 3HC3H 4OCWL 3KLAB 3KJ4C 4GRWE 3RWFA 1RHHB 4LLQA 4ODSH 4OFKA 3BPNB 4JREB 5ESVA 3HNVL 3DI3B 5CUSL 4JO1L 3KG5A 2R4RL 5AG8A 2JJSA 3UTTE 1HH6A 1IM3B 1U3HD 4KKCD 1CGWA 4CNIA 1ITCA 2Y1VA 3RGVC 2YN5A 5FGRA 3BEWB 2WBWB 4UMGA 4CGTA 5D2NB 1LEKA 2DQGH 3U7AA 1E28A 3ETBF 1CT8A 1K3ZA 1HH9A 5ITBL 3DECA 4WHYG 1BVKB 3JWOH 5KSAB 4G6FB 1JNHA 3QJHA 4LSQH 5ESQA 4EDXB 5E5MA 2DAVA 4QRTA 3BVNA 4ODHH 3WV0A 5HHVH 4YEFA 4KWUA 4X9BA 3GM8A 2FJGA 5ISZE 3FQUA 4R7DA 3QRGL 5T5FH 1OY3B 5FKPB 1IEBB 4PJDB 3WLBA 3H9ZA 3I50H 4KUCF 3F5WB 4BZ2L 1N6QH 3QFJA 4LASH 2VN4A 1RPQA 1RJLB 1OB1B 1IAIL 5T1KB 3HE6D 4HUKB 4Y5XC 5DR5H 4AL8H 2FLBT 3WFBH 3FN9A 1JN6B 4WU5A 5KSUA 1D9KD 1EJOH 1UH2A 1F4WH 3HHRB 4HKZA 4NUGL 5IR1A 1T1ZB 4POYA 5C0ND 1W0WB 5ELIA 1NCNA 3DUSB 5BOZG 5F7EL 1SQ2N 1A4JA 4Q9QH 4MJ5B 2E7HA 3LHPH 1WFOA 2NXZC 2BVUA 3KLSA 5E2VL 1KLFA 1G9NL 3X14A 3HI5L 2HLAB 3KAAA 2B5IB 1JPGB 3KPSA 3UAJC 5IIEA 5CIPH 5H37H 5L88L 2X9XA 4KKAD 1JPTH 3NACL 4HXAL 1CICB 2GSGA 1A8JH 2NXYB 3IYLW 3LPFA 5FB8B 2GK2A 2XI9A 5D9SB 4MQXD 5DJCA 5M7QA 3PUCA 1RUML 2VQ1A 3P4MB 2CXKA 4JKWA 4RISH 1V5JA 3LDBC 5DQDH 1NUDA 2OTWB 5F7DA 4ALAL 3MV7A 4O4YL 4UIKH 4HG4K 3V6OA 1JYNA 4OJFH 8FABB 1WFUA 4RGMB 4NBXB 1CXIA 2F58H 1OHQA 1MCWW 3VFUB 1PD6A 5TE4L 4DTGH 3MV9D 3V6BR 4BQ8A 2MFNA 5ALCL 4X5XB 3QIUA 1RK0A 1M7DA 3MJ8B 4F3FA 4HWBL 1ZMYA 3QUMH 4H8WH 5EIIA 4YNYB 1T20A 1OVZA 3GI8L 2MHAA 1FIGH 2V9QA 4DFHA 1KNOB 3VXNB 1KIPA 1CIDA 2CIIB 5F3BB 3QO1B 4XAWL 2WAHA 3HTLX 3TN0D 3WCYA 2AXJA 4WWKA 1HXYA 2VSCA 4BK5A 5L88H 5JPMA 4U1HB 4W70A 2AXHA 2B2XH 2CMRL 2HWZL 4P4KB 2FX7L 1JCKA 1LDSA 5K9OA 1FL6B 3ET9F 3QCTH 4JPKL 4PTUB 1KJ3H 3VXUB 4DOHB 2YKLL 3SO5A 1MFBL 4ALAH 5F1NB 4GRMA 3D25B 2DMKA 1XFPA 1G7MB 5KS9E 1JUFB 4ODXA 1F8TL 5F6IB 3BKYL 4MWFB 4LSRL 5GS0H 1B90A 1J88A 2Y07H 3OKKA 4LFHG 2OJEA 4R3SB 4Y5YC 4F7EA 1DE4A 2WANA 5ALBL 4F8TA 2ZUWA 2XWJA 3BZFA 2EEDA 2UVFA 3VXQB 1AGFA 2QBWA 4K94H 1OT1A 4R2GD 4ELKB 4LEOB 4O5LH 4LPYA 4D8PA 4KTDL 1TVBB 4AZ8A 1BZ9B 2VXUL 1MCIA 4TSCL 3CFIC 3TC9A 4XMPL 1SY6H 2RR3A 2HKHH 3I75A 1T6WA 3S37X 3ULVC 5F1OB 3UP1A 5GXBB 3D0LB 4KU1A 2RB8A 5EC2B 4F7PA 2FSEA 1IGFH 1PKQB 3ARED 3QAZB 3T4YB 2PW1B 4GXUM 1YMMA 5J1AB 4MLIA 4AM0B 5BCAA 4PJ8B 4F37K 4YAQA 1R3JB 2WW8A 3FN3A 3TT3L 3SDAD 3WFZA 3ARBA 4XNZC 4U3XA 5F8QC 2YPLB 1MAJA 3TZVB 1CT8B 4KKLD 3DTXB 5K59F 3K0WA 1SBSH 3IXAB 4X9FA 4OKVB 5HYSA 3OKOA 2B5IC 4LEOA 4AIOA 2VC2H 5EN2B 5IJVB 3M8OH 5L2JA 5IW6B 3SBWA 3VXSE 3S34L 2NY1C 2Q6WB 3BDYH 3TBTA 2VDLH 4IOFD 3EJJX 2BSTA 4FTVB 1S9WB 4HXBH 1RJLA 2VXTH 4KZDH 4V1DE 5CJQL 1AGEB 2X09A 4PRIB 2W0KA 2VAAA 4X4ZA 1DFBL 5JLZB 3QR2A 3WL9A 4OV5A 4PJFA 3BGFB 5DXWA 1BM3L 3KR3L 4LVOB 1QACA 1IGYA 4GRLC 4PYHA 4UT7H 1P2CB 3ULVD 1MI5E 1FE8L 4NNPL 3GSUA 4KMTH 4XXDA 2AJUH 1F4YH 3B9AA 1YNKL 2JJSC 1NMAL 4KI5C 4N8VB 1U8KB 3RWHA 5JPNA 4J8RA 2R0ZH 5J3HC 2VYRE 3C60B 4EN3B 5LJYH 5FYKE 4MQSB 3PWNA 5C2BL 2QSTA 2AK1H 2FYYB 3IJSB 5ANMB 3M8OL 5DEFB 4DWHA 1G6RB 1AHWA 3CC5A 4QCIA 3S34H 4JQXA 3N85L 2NX5D 4GG6A 3GJEB 4MA1C 3T0EE 4KK5D 2ZSWB 4HULB 3C6LB 3C6LC 1F5WA 1EO5A 1BOGB 4K3JL 4LU5L 5JW3L 5ISZB 1CIUA 5A2FA 1G7LA 3V4VL 1LD9A 3IFNL 4IOFC 3EO9L 1JRHH 3I3BA 2VDRH 4GOSA 4TRPH 5B39B 3EHBC 3HZYB 4XXDB 3T0EC 1I9RH 4Y5VB 2VUYA 2YEZB 3I6GB 1O7SA 3QUKA 5IMOB 3J7HA 2IH1A 4PJAE 5DGRA 4ZUSB 2Z0BA 3CFDA 4U3CA 4A6YA 2NY6D 1KTDA 3UJIH 3LN5A 5GHWH 3MRDA 5TQ0L 3OXRB 5D7JA 3X11A 1U42A 2EDJA 5CEXA 5CKGA 1RZJH 4S11A 5C07A 5C1MB 5KS9A 1Z9SA 5KVDH 4HDIB 1Q9OA 1MWAB 1OD9A 2DLFH 3HPJA 1INDL 3LZFL 3VXRE 2EE9A 4IS6B 1FQ9C 1YDPA 5CEYA 4FXGA 3TNNB 3FKUS 4Z7WB 4X4MA 3PG2A 1KLGB 3TPKA 2NYYC 4OGXL 5GGTL 3IETA 3CJJA 4R0LA 3NA4A 1TJIH 2HRLA 4JY6B 4JFQB 3LKRA 4OZIE 5FAAA 4AL8L 1CD8A 4KK5C 3O81A 3C5ZA 4ISVA 4QHMB 3U6RB 1OAYL 1XMWA 5LAXB 2ZUYA 3C2SA 3GHEL 3H9HB 3U0PB 3QHZL 4OIBA 2FBOJ 4OB5H 3DPBA 5IV2B 2Y36L 3WN5C 3MREB 3BW9A 3LQMA 5AAMA 4PJGA 5IQ7L 1KTKE 3UJIL 4Y1AA 1PX3A 4M5ZH 3B9KA 5E8NA 1A2YB 3B8SA 1XIWA 3F7RA 1QKZL 3C2AH 4IRZH 3MXVH 5EZOH 3EUUA 1KBGL 2K3TA 4KKBD 1LEKB 4PV9B 3HE6A 1D5IL 4PG9A 4O02H 2VE6B 5F7WC 3TIEA 4NFBA 3VRJA 5DMKB 1WZ1L 4G80B 2FD6L 3K2UL 2NY0B 3ZSSA 4QRQA 4YX2H 3GEWB 1WWCA 4U7SA 4UNUA 5IFAH 1QBLH 1KC5L 4R97C 4U3HA 5FYKH 3CCHB 4L1HA 1HSBB 2CD0A 1F90L 4PJ8D 3H6JA 5F1IA 1A1OB 4H88L 1CICA 5FB8A 3D0VA 3DSFL 1T89A 5SWSA 5C92A 2XZZA 4B7LA 4TN9A 5GSRB 1KV3A 3OJDB 2E6JA 2XPGA 1MFNA 1BFOB 2I60H 1KPVA 4PFEA 2P5EB 4I9WE 4MAYA 5IFJB 4Z77B 1A2YA 4IBLT 4XMLH 1HHGB 1E4KC 2YMXL 1G9NH 1FIGL 1AD9B 1NDGA 1J0HA 2P43B 1NUFA 1W0WA 5A2LH 1FHGA 3H2WA 4QRQB 1EBPA 1FZOB 1CZ8L 4XXCC 1ZA3A 4HPOH 1ZGLB 4QOKE 1H8OA 1QFHA 3RUGB 1WZ1H 5SWQB 3SDYH 2ZCLH 3DMMD 2DQTL 5DF0A 4QXGH 4CU8A 5FYKD 1NMCB 3O4LD 4P2QE 1EFXD 3U2SA 3FO2A 5J06A 2MNUA 1Z0NA 4QOKD 3S36H 4JHBA 1I1YA 3OKDB 1G6VK 4N1CA 4PRDA 5JOPD 5D7IB 1KOAA 3NIFE 1Q0XL 3EYUL 3MGOA 4PJ8C 3MRMB 2BNUB 4GRWF 4Y4FD 4M7LH 3UTSD 2IMNA 1QHPA 5J1SC 5TH2A 4DQOH 4CJ0A 2IPKA 3A6CL 5IEHB 4EI5A 5L0QB 1G7MA 1JV5B 4C56B 1FYTB 1Q9LA 2OMNA 1YMHA 2ZOLA 4YDJB 3KPNA 1LD9B 4U33A 1XF2B 2GEEA 5F9JB 2QLVB 1J0ZA 4IOIA 5C0BE 5T3ZE 2UYLB 3QFDB 1I8LC 1RUKH 2AJXH 4LRIC 3FZUC 1RV6X 1RIVL 1R3HB 1F11A 2DQUH 1JNNL 4PRPE 2BMKA 4UQ3A 1AY1H 4WHTB 3SOBL 1CFSA 3DX6B 4OZ4A 4NKOB 2BOBA 2HFEA 4M5YL 5SWZD 5C8JB 4Q6YA 1E4WH 3BAEL 3QFJB 3MLYL 3S3JA 5I1EH 5M95B 1A7OL 1J1XL 4OAWB 4A2MA 3U30C 3AAZB 3FQTA 5I9QB 1NFDA 1UGNA 2XACC 1G7JA 4WCYL 4KKCC 3K2MC 2Y5EA 1HE7A 1YEDA 1DR9A 2C4XA 2NTSP 1O0VA 2FX9L 4JM2C 3QZWB 1MFCL 4XZUB 3GMLA 4M4PA 1WZKA 3MBXL 1NANH 1NC4A 4ZUVA 4JRYA 3BQUC 2YC1B 1MVUA 5C0CD 4RA3A 3CXHK 2RBLA 4PJXA 4AYFA 3T1FA 2E8YA 2JIXB 3T3MF 4PBWD 3GIZH 4XVUD 4WHTA 2JELL 2EIEA 5EBGA 3WIHL 2AERT 2F54A 3K81A 5I2IA 4Y4HC 4HIIA 4NKIL 1F4AA 4X0KA 4F2MA 3UBXA 5IHLB 3ZZ1A 2B7DT 2UUDH 1LK2B 4OUUA 2BOCA 3BYTA 4JQVC 3FAWA 2P7TA 4Y8AA 3KNBA 4GH7B 3NN8A 5EORH 2GY5A 4ONGH 3BUTA 4PJBE 1DEDA 4TUJA 5DC4B 3ARBB 1JWUB 2WINA 3PV6A 4OIAA 3G6JE 3DTXA 2BVOA 4OQTH 4X5XA 4M6ML 4NM8H 2IBZX 3S35X 5IG7B 3JTSB 4NQEB 5CJQH 4CVZA 1JZ5A 1IM9B 1MCCA 2DI8A 2IGFH 3U1SH 1A3LL 5JW3H 2A73B 1XGUA 2XZQL 2ZNXA 4P3CH 5EG6C 2NXZB 2FH8A 1LEGA 1CL7I 4OLXL 3O6LL 2FCBA 3VWJC 4XP4L 3RHWK 1CL7H 1CDGA 3L9RA 4NNPH 3E3QC 2LQRA 3EDKA 5C0JB 5D7KE 3KPLB 4IEFB 4ZAKC 4ODSL 1FZJB 5D2NC 5L0QC 1Z3GH 4O2CB 1A1NA 4X9GA 5FECB 3I50L 4BZ2H 3MXWL 3BGAA 4MLSA 5JW5B 4PP2B 4X6FB 4N0YL 4PGJA 4HKXB 3WXWL 2XN9B 3PXHA 2YUWA 5I16B 1HHGA 4PJIA 1OGAD 4UU9B 5ENWB 4GKOA 4EN3A 4NO2B 5L8LB 2ZUQB 3C5ZD 3T0WA 2JJVA 1I7UB 3ROLA 4LLAA 4FHBD 4U1NA 4GMTH 3D3VE 4QT5A 5HGHA 2VWEE 3MNWB 3UJTL 1FORL 1TJIL 2QSQA 3DRQB 1N8ZB 1YEJL 1DLFL 2P46B 2F5AH 1SMAA 2OTWA 1BFTA 5GS1C 1UKSA 3ZDYF 2AGJH 1M7IA 2E27H 2AEPL 4XGZA 2GUOA 4R97B 1N6QL 3GKWL 2VZ1A 1AD0A 1M7DB 2OR9L 2VABA 1OLLA 1MRFH 3FOMB 1D5XB 3MZTA 4NO3B 4N0YH 4HLZH 4YUEH 2X1PA 1QA9B 4PJCB 2XZAH 1PYWA 4EI5B 4KJWC 3REWA 4OGYL 1ZANH 1A1MB 2ID5A 5B4MC 3SDDB 1U3JA 3TO4B 3BP4A 1YJDC 4HUUA 3C5ZC 1I7ZB 3MRFA 4MCZA 4HUVB 4G6AD 4OZFH 2F5AL 2OR8A 3C8KA 3KPRB 1NCWH 1ZT7B 4XP6L 5DLMH 3VRJB 3V7AE 3W81A 4H26B 5EOQL 1DBBH 1IAII 2APFA 5DC0A 1FVDB 1A9BA 3STLA 1D5XA 3SHSA 3X12A 2CMRH 2IALA 1TJHL 1RK1B 1B0RB 4MQTB 4NZTH 1NGYA 2CRZA 4Z5RA 3IF1A 5CSBA 2V17H 3NCEB 1FBIH 2VZUA 4EN3C 3MR9B 5D7JC 3GSUB 2W9LA 4WFFE 4OZGB 1J18A 4PRIE 4XVJH 5FK9A 2PO6C 4LGPB 5GSVA 5D71L 4NNXB 1ZLWH 4YX2L 2GT9A 1R3IH 1UCTA 3HI6L 3VWJB 3WFEH 3SDYL 2AQ1A 4ZAKA 1TZHA 5DJ6A 3SCMA 4JVWA 3MV9E 4XC1H 4QF1B 3PWLA 3MRCB 4GG8B 4HUWA 5GRVK 4K3HA 4EBQH 3PWJB 1WUNT 4H88H 5B4MD 1CFQB 3HAEA 3SKUD 5E24E 1QBBA 4W6XB 2IAMC 2UVEA 3PWVB 3QNYA 1QFWI 5I1GH 3LN4B 1JZ4A 3GNML 4N8CH 3MSPA 3E6HA 4G8FB 1BZQK 4Y5VA 2X70B 5FUCC 2BVOB 3KPSE 4WUKL 2P49B 4O2FA 4KQ4H 5D70H 1YQVL 1LO5B 4Y19D 4RWHA 1MIMH 3DUUB 4M7KH 3N0PB 3U4BH 5DJZB 2VDNL 4EN3D 3L3JB 1DQMH 5T3ZH 5ETUB 3PWLB 4HUWB 1TCRA 2IPKB 2XXMB 4XWOD 4QRRD 2AJYL 3MV7E 5HHPB 1WLHA 5KSVA 1JVKA 2IG2H 4PJAB 5IGXH 2R0WH 1JGVH 1ZA3B 3T3ME 4OD1L 1ZGLA 1T2QH 3R0MA 1NGWA 2DDQH 2WQRA 1CXLA 3LN4A 2VXUH 1MCLA 3HZMA 4OZFA 1DQTA 4P0DA 1QEWA 3TN0A 1EEZB 1G7PB 5D96C 2PO6A 5DI8B 3OKLA 3RWHB 1EH9A 2BCKB 5DQ9B 5J8OA 3AS0A 5ITFB 3QEQB 2GJ6B 3OKMB 4XC3H 1EEYB 1J8HA 4HHAB 4DEPB 1E4XH 3H9HA 4X6FA 3UC0L 3H7BA 4LCCA 1NBVH 1C1EH 1GAFH 2G60H 3MZGB 4B0MM 2G5BA 2VISB 3CVHB 2N56A 2EYTA 5E0QA 2C3GA 4GSDH 4MAUL 3TCLA 1DBML 4P23C 1GHFL 5TJWK 1AHWC 3BXNA 1BIIA 3ARFC 2BJML 5IVZA 4TQEH 2OR7A 5KTEL 5AZEH 3ARTA 4HSQA 4PLJD 1UB6A 3TBWB 2OP4L 3HRZA 2ZOKA 3SOBH 5TDPB 2B1HH 4NDMA 2R0WL 6FABL 1XF2A 4FQPA 5J12B 5ISZD 2YS4A 5L2KD 3BYYA 3O11B 5DVOA 1J1XH 2I9LB 3IU3B 4RRPG 3PF2A 5AEAA 1WFNA 3O4LE 2MQCA 1ZGLM 2YD5A 3UPRA 3CFDB 3V4VH 2VH5H 3C09B 3VFMA 3IB4A 5KJRL 3OXRA 3TWCH 1RJZA 4MVBC 4PREB 2OJZL 4RCAA 4QTHB 5EA0H 1FFNA 4TSBL 4YR6A 3C9NB 1YECH 4RMUA 4LHJB 2QR0B 2IGFL 5D4QA 5F3HB 3MBED 1J9CT 5D1XD 5JOPE 5TE6L 1NEZA 1Z9LA 2RGSA 2X4RB 4FA8A 2AK1L 1TZIB 1W0YT 3MLSL 1JRHI 4GRWH 1CL7L 3DMMB 3ARQA 2L4OA 4K7PL 1V7NL 1F13A 4ELMF 4PJCF 1VENA 1Q0YH 2D4FA 4CVZB 3ARFD 5HVGB 3RUGA 5CINL 4UINH 2XKUA 1P84J 4PD4K 3MV9A 2N7BA 3MOBH 3QDJD 1ZT1A 5IV2A 1MCRA 2VITB 4N68A 4Z0BH 3GMMB 3NFSH 1PZ5A 5HPMA 3IU4H 5GGQL 4EXPX 1GOGA 4A6YH 4WW2A 1PY9A 4NO5A 5I8CB 2OJZH 3DV4B 3CFJA 3MYJB 1T66C 3UROR 4P2QB 4OF6A 2IAND 5L8KB 2VLRE 1CDUA 2RCSL 1BEYL 5IQ7H 4P2OD 4HIJA 1RJYA 4UU9A 4MXVE 4LVEA 3RZCC 1V7ML 4NP4H 2WSKA 4LPXA 2OTUB 5D96B 4S1SH 3K74B 1T20B 1N59A 1V7NH 1E6JL 1S9WA 3O6FD 4EXKA 1BLNB 5DHVH 3I3EA 3ZTNL 4ERSH 35C8L 4JY5H 2R4RH 3MCLH 4W4OA 4NN5C 5TF1H 1XF5B 2WBJB 2I5YH 3BDXA 2UWEB 1WBYB 1EAPA 1HINH 2XZAL 1D9KC 4OLZL 4OZHF 4PJGF 4S1DD 5F70A 3KWWA 4CMHC 3GM0A 4P46D 4Y19B 4PJ5B 5C0IA 5I1AB 2BC4A 3D9AL 3T0DA 5BVJB 4KHXH 5D1XA 4OD2B 3SEPA 3IS0X 1DLFH 3F7YB 4FZ8L 2JB5L 5DS8B 2I24N 4V1DA 5EIQA 1A6WL 4KRNA 4M5ZL 1U8JA 1MCBA 3QNXA 1CDBA 3PWNB 1NFIB 4Q2ZB 1N5AB 2X89D 1F97A 3MRHA 5JQ6H 4IRZL 3IFPA 4TPRH 4K71B 4K71C 4PJEB 3WEXA 2ZCKH 3IDYC 3ZYZA 4OZHE 4XMKL 1OAXL 2ZWLT 4LMQE 5JHDB 3QXTA 3MJ9L 5IFHH 3HRPA 2A9NL 3CU1A 5GZNC 3WJLC 3BT2H 1K8DA 4MJIA 3W0WD 1EVTC 4JO2H 4X7TB 5D2LB 3RIFF 4TULL 3QUXA 4G8GB 2W59A 2DQCL 1WQVT 1P5VA 2VAJA 4HJJL 1NCTA 1AXTH 1CTOA 3BRGC 3ARWA 4K8RC 1J86A 1DQQB 4BFBD 5J7CC 2EIBA 5CZVL 3O4LA 4UTAL 4FTVD 1U8JB 4ZO8A 1CGTA 3WSQH 1SM3L 1CI5A 4YHIB 1PLGL 2F5BH 4TUOB 1KCSH 1QO3A 5E8EB 2UYLA 2AVGA 5E2VH 4LPTA 4X6CF 3SPVA 5TPWL 1CDCA 2DJ4A 3EDFA 1DBBL 1MWAA 4FQIL 4ZOBA 4UQ3B 5HDLA 1M7XA 1NGQH 2UZXB 1EGJA 1NCDL 1VFOA 2V9TA 4YHML 2DQTH 3IRPX 4GKNB 4K94C 3W5MA 3GK8L 3MA7B 1RMFL 4Y5XA 1A7RL 1RVFH 3MRBA 4N5UA 4UIKL 3IKKA 4NO0D 3VXMB 5C0JA 4OIIH 5D70L 4EUPB 3CH1A 4PJ8A 5E03A 2F58L 1OTSD 2LU3A 2OXHA 3CAFA 5I1IH 2DBLL 1QFWM 1JGEA 2R1YB 1CLYL 1IGIH 4LKXA 5GQBA 1K3IA 4XC1L 4NQUA 3L5JA 4WHDA 1QFUH 4EVNA 2MOVA 1VEMA 2PNDA 5E9DE 3FQXA 4G5ZH 4LK4A 5KSBE 1HILA 1QSEB 4BQ9A 5C6PB 3MUZ1 5E95B 4J3WA 4QKXB 1CGVA 3EZJB 1MFCH 2W1NA 4DZ8A 4U6YA 1H15A 1U8IA 3HC4H 4LVOC 2DIJA 2FHBA 2D9QB 1IEBA 4GW1A 4WGVB 4NFDA 2VQUA 1BVLB 4IJ3B 4BFIB 4PRAA 4EI6B 1YYML 2ZG2A 2ADFL 4HQQH 3P3YA 2B4CL 1MFDL 1JN6A 2VXVH 4WU5B 1HHJB 4X7EC 1E4WL 3BAEH 3FQRA 5DQ9A 4MAUH 1OAZH 4G8FA 2BFVH 3GHBH 4CVUA 4TTGA 4L8CA 3ZKND 3IJYB 2DTSA 2DRUA 4D94A 3RWGA 2IG2L 5IGXL 3JZ7A 1ZHLB 4U1SA 5LXGH 3TO2B 3FCTA 1U58A 1QBML 2P8MB 5DD6B 1CBVL 2D03L 5D5ME 3S96A 2YPLD 3FRUA 4WHCA 1VEPA 1IAKA 5I71B 2XQYG 1QR1B 1WC7A 4IS6A 1RUAL 5MEND 1J5OL 1A3LH 2PKDA 2XZQH 1EIBA 3PP3H 1ZLVK 3UYRL 3VFGH 5HI5C 4QGYA 5EU3A 2VXQH 1A0QL 2ZOKB 4HS6B 5HGBB 1XR9B 3MA9H 2CK0L 3QDMD 1G84A 2IH3B 2NTFA 3VXOA 1XGYL 4J7RA 5IP4A 4KDTA 1YNTA 1CLCA 4DVRL 1EAPB 3RY6C 2EDFA 2DKMA 3QDMA 3IF1B 3EBAA 5IW3A 4AY0A 3KYNA 3MNWA 4GBXA 2C5DC 4UT6L 4Z7OF 4NJAH 4P4KD 2Q86A 2Y6SD 2G2RB 5I1LA 1FYTA 1Q9LB 3ARGD 2XTLA 1XZ0A 3ARYA 3VG9C 4Y1AB 1AGBB 3PL6D 2EKJA 3X14B 2LVEA 3KPRE 3EFDL 3THML 4M1CD 4ZS6C 5INCA 3E6FA 1DL7L 2DTML 4JJ5A 1RZIA 1D5BB 2EECA 4M43H 1ZEAL 3W0WE 2WIIB 4JDZB 1FORH 1U36A 5JPMB 2EXYC 1BJ1J 5C6TL 2NTFB 3QJFA 3Q1SL 1C5DA 2AQ2A 3KR3H 1G1CA 3BWUC 1K8DB 5JXEC 4JZOA 3UO1H 3MA9L 1FE8H 3RDTA 5I1DB 4HC1A 1OAQL 1MCNA 1KIQA 3LEXA 4PV8A 5KANG 3G6DL 3SE9L 3FTGB 1RK0B 3D48R 3QIUB 5I1LB 4HPYL 3GSNA 5IWLA 3BP4B 2LTQC 3UTTB 2BSED 5K33A 2X4PB 3C9NA 3VGGA 1Q0YL 4TNVF 4NZDA 5T3XE 5JOEA 3SDDD 4JFZL 4JDZA 1G6RH 2OL3H 3WD5L 5DJ0A 1BVKA 3RTQC 4PG9B 1YEKL 5E7FA 3U83A 3ROOA 1GCFA 4MJ6A 3P9MB 1H3PH 3PL6C 2P8LA 4WDIB 3KVQA 1VACB 5H35A 5DR5L 4TNVK 4L4VE 5HYJA 3MLXH 4AT6A 1X5XA 4HGMA 3MUY1 1HEZB 3VFPB 1X5AA 3V4PH 5GGVH 5EOCL 5BO1H 3ULUE 3LCYA 5EOTA 3VFTB 4DKDC 1MAKA 2AEPH 2IAMD 4ZO6A 4NZJA 4G9FB 5F9WB 5E94A 3TM6A 3ZO0A 5I2IB 2Z91A 3CMOH 4ZNEE 3KYOB 4D0CB 4CW1B 3UBXB 5FGCE 3RGHA 3CFCL 5GS0D 1E4XI 5BW7C 4Q9QL 1W72A 1A6VL 4GXVL 3OKYA 3QUYD 2E7LC 4X7DC 3VI4E 3RUGF 5JQ6L 3ZE2E 2BNRB 3GFUA 1VFMA 2D9CA 1M4KA 2CRYA 1ACYL 2G5BB 2VISA 4LPWA 2VUOA 4OLWH 2WV3A 4GBXD 5KVGH 4FQ1L 3WD5H 1NSNH 4I18C 4YQXL 3IDJA 1BZ7A 5JTWA 5GGRY 1U3HC 1UB6B 3Q3GA 1N3NB 1EMTL 3HR5B 2F54D 1H8NA 4MB5A 4WU7A 3JV4B 2X4UB 2NY5L 1JE6A 2X42A 4I0KA 2J88L 1A1NB 1R3KA 3W9EB 2YPVL 4OB5L 4W81A 3SJVB 5AD0A 3L3JA 5C0CB 3QEGH 3DO7A 3P0VL 5HYSB 5DMYA 3KLDA 4WTZA 3FRUB 5C0IB 5I1AA 1CDHA 3U9PL 4JFEA 1NC2A 3CZJA 1ACYH 3BISA 1M71B 4KQ4L 3TBSB 1PSKH 3QWQB 1YQVH 5DJXB 4FQIH 3P30L 1CE1H 5F3HA 4QRSA 1D3CA 1G6RA 4M7KL 1X6LA 4Z78A 5DRXA 2VXSL 3W2DL 5DHVA 3GMRB 4HS6A 7CGTA 3EYFA 4OF5A 1FDLL 2ZSWA 1NGXB 1FYTE 5EC1B 4U1KB 3VH8B 1A7RH 1CR9L 1U92B 4OFYD 3JV0A 4GG6E 1RFDL 5FIEA 2FJFB 3NPSC 3LH2H 2VDMH 1X5HA 2G9HA 2ITCB 2UZIH 1REIA 1A6PA 1V3LA 5D6CA 4YWGH 4MGXA 1PLGH 1C7SA 4W68A 1OTUC 3C09C 4OQTA 4HC1L 4E0RA 5F1NA 2NXZD 1IBGH 1QSFB 2EKSA 3L7FB 3BXNB 3VXMA 6CGTA 4H1LG 4LNRA 5EPMB 1ZLVH 4E41E 2NY4C 4LMQI 4LPUA 1AGFB 3KJ6L 4CN6A 1CLOH 5C3LD 3KLHD 3P0GB 4KXZH 2QQLH 3M45A 2J4WH 3LKSB 3BZEB 4U1IA 2HP4A 4WW1A 1HNGA 4M7ZC 4QLRA 3GRWL 1ZLUH 3GMLB 1RJYB 2AABH 2BNQB 1AR1D 4YE4H 4GMSL 1WWBX 4JRXB 4WI7A 4DKEH 4CUCA 2PW2A 4P9ML 1JNJA 1Y6NR 4NHCH 1JPSL 3RIFK 3CNKA 5BRZD 5B39A 2HVJA 1KIQB 5CFHA 4GO6B 1GSMA 4K3EL 5FYJU 3C8KB 1SBSL 4AMKH 4NRYA 4KHTL 4K7PY 3VD5A 4AENA 3SE4C 2VC2L 3QEQE 4NM4L 5CHNB 3Q6FB 3T4AB 4NRZB 2HJKA 2YD3A 1R5WB 4Y4HB 4XBEL 3WNNA 2VLLA 1T7VA 3OAUH 1QOKA 2FEEI 2BNQD 4KVNL 1ADQH 5JO5B 5I74B 4TUJB 5IJVA 5SX5H 1S3KH 4UB0H 1YN6B 2DIBA 2YD6A 4RRPA 5D1XB 2AK4E 2X4PA 4LLWA 3QQNA 4KVCH 4GSDL 1WK0A 3BMVA 4YGVB 3HE6B 1TZHB 3SCMB 3ECBA 3BQUD 5TE6H 5FO8A 4PJHA 4OCNC 2MCPL 1ZVSA 2W9DL 1XF4B 2DQHH 2HVJB 3QG7H 4LCYB 1J05A 1LWRA 4DKEL 2B4CH 4Y4KA 1RIVH 3MPCA 4Y4HD 1QRNA 4XNXH 4AENB 4HCRL 3O6FB 3O6FC 3ULSA 4PRIA 5HYSG 5B22A 1V3KA 3KPSB 5IIEB 4X6CB 1R5WA 5C2BH 1A7NH 4KHTH 4NQVA 3MOBL 4BSVA 3I85A 3CD4A 4NM4H 1F4XH 3OR7A 4Q6IC 3L3OB 3JWDC 3L3IA 3BJLA 2VDKL 2YBRB 5KZCB 4U05A 4MJ2A 3B9KB 1IQWL 4H25A 5BRZB 2NNAB 4OCYH 4A6YL 3EFDH 1EXUA 2R2BA 2EIZA 2P8PB 1BAFL 1AJ7L 4FFZL 4M93C 2Z92B 4IIQC 3CX5J 1TPXB 3EO9H 1DQLL 1J87A 2Y7QA 3Q1SH 1NGWB 4PLNC 5KVMC 4LKCB 3RTQB 3ULSB 4BZ1L 1TXKA 3SDAC 2YRPA 5KSVB 3B9EA 5A2KH 2W38A 2HFFB 3TPUB 4JDVB 1FAIL 1OAQH 2P5WD 4ZTOH 4PJXF 1WEJH 2R1XB 3HNVH 4ENED 3WHXA 3U9UB 3L3IB 1S7TA 1J8HD 4KJQC 2XTJD 1OSPH 2XPGB 4HPYH 5HBBA 4GKSA 3U7WH 2DQEH 4LCIH 1I75<