5GS2D

Crystal structure of diabody complex with repebody and mbp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
226
Chain Sequence
VQLKESGPELVKPGASVKMSCKASGYTFTSYVIHWVKQRPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMDLSSLTSEDSAVYYCARYGVRGDYYAVDYWGQGTSVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/immune system
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 41
structure length 226
sequence length 231
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D02
4O02L 1NQBA 5SWQA 4MD0A 1DQJA 1A14L 1JHLH 1IJ9A 3ESUF 1OGAE 3ULVD 4Z8FL 5CGYC 3IFOA 5IROC 1TJHL 3GUTA 3BMVA 3U0TA 3VFPB 5LVEA 4Q74A 4GUPB 3MRBA 1OAKH 3ABZA 1ZVSB 4XMPL 3ARFA 2YD7A 2GSGB 4M4PA 2NTSP 5FYKU 4XAWL 5IVNA 4XAKE 1EBAA 1NUFA 2EYSA 2BNUB 4OGXH 2C5DC 3KPQA 3S35L 3SKJH 3QIWB 3QIWC 4FNLH 3BUYB 1EUUA 3LOWA 2OZ4A 4NZDA 4UDUA 1RPQA 3TZVD 3GSUB 3H2WA 5AZ2L 1IAIL 4H1LH 1DJSA 1NCTA 5L9DL 1YMHB 2QBWA 1RZKL 1LDPH 1AE6H 2XQYG 4IOIA 3EJZC 4YDIL 3VDCA 1NEZA 4KK6C 3WFZA 3HE6A 1EHLH 4I3SH 3H42L 5TE7L 1UYWH 4GKSA 3S9DB 3GHBL 4KVCH 2VMFA 5E8DL 3W5NA 2Q3AA 5F71A 2HH0L 4UIMB 5LGHH 2CDEA 4WFHE 4FQIH 3RVUC 3L5WB 2XFXA 4ZOAA 5I1LB 4PJEA 4EQ2A 5D7JD 2ATPA 4YHIB 2VABA 5DVNA 4PTUB 4MD0B 3LRHA 4ISVA 3ARWA 4OIBA 5EZOL 3GJEB 2LAAA 2LAGB 4HT1L 1D9KA 1AD9B 1UQSB 2CLRB 2AK1L 4P2OD 5FA4B 5AWNL 4LVHB 2EDDA 4LVHC 2GK0A 3MRBB 5MEOA 4K3DL 2G5BA 1BEYH 4JM2D 2OXGA 3ARFB 1EERB 3P11H 4NP4H 4P4KD 2BY0A 2EZ0C 4NOBA 5EN2A 5KAQF 3C6LA 3KPQB 4MNQA 4ZXBA 5BV7H 4OM1H 2VC2L 1HCFX 4AIZA 4LCUA 2J2ZA 4TUJA 5I9QB 3T0EB 3F58L 3T0EC 5I9QC 2IQ9H 5EO9A 4IOIB 4Y5XA 1NEZB 3HE6B 1GOFA 3HE6C 5IBUB 2FL5A 4U1HB 4PJAE 2B2XH 3V5KB 1MLBA 3BGMA 3EYOB 2DM3A 2A1WH 1H3PL 2JCCE 2VDQH 3DX7A 5F96L 3BZDA 2JELH 4H26A 2AABL 3HNTL 3D9AL 4Y88A 1S7VB 3NFSH 3QZWB 4LPCA 4MJ2A 2XFXB 3RJQB 2DQEH 4OI8A 3VXME 2GJZB 4XGZA 4AT6A 3X13B 3G5ZA 1IGML 1F6LL 2VABB 5HYQA 4AEIL 5IG7B 2X2YA 4QWWD 1IT9L 3P4MB 4ISVB 4HS6B 3MZTA 4K9EL 5AYUH 4LLYA 1T0MA 2XI9A 2R15A 1A7OH 5EOQL 3SDCA 5TQ0H 3KS0H 15C8L 2GK0B 5E0QA 3B2UC 5MEOB 2HKFL 1CG9B 2AGJL 1F13A 5GGTL 2C4XA 2C1PB 5C8JA 4I2XE 4K94C 1F8TH 1S3KH 5EN2B 4D9RE 4M7LH 3C6LB 4L4VD 3UZQA 4MNQB 4Z7NF 1BQUA 3MJ9A 2YRLA 4XCFL 1KCSH 2BHYA 3MRCA 4AIZB 4LCUB 2ORBL 3B5GA 3KPSB 1QR1A 3Q2CA 4TUJB 1N5AB 1P4IL 2H41A 3O41A 3SDXE 5EO9B 1RJZA 1T20A 2J4WH 4X99B 4Y5XB 3LQAL 4PB9L 5IKCA 3IAPA 3LKQB 3QUMA 3MV8D 2PYED 1MLBB 3BGMB 5D5MB 1TJIH 4MA8H 4C58B 5T1DH 4H26B 1UEYA 4LLMA 1LP9E 1NANI 5IWLA 1FORH 1IVLA 2XTJE 4WEBL 4XBEL 3B4NA 1I9IH 5EZJB 3LKNB 4JPVH 4CVZA 3PWPE 5HYQB 3QPXH 2R0LH 3ZDXE 4ONGH 3B8SA 2VLRA 2X1PA 4LCCA 5FV2A 4JO2H 2J8HA 1T0MB 4LLYB 4ZUTA 3SDCB 4NWUH 5CJOH 4PP1D 1YEEL 3BHBA 4OCWH 3DO7A 5L7XH 1MUJB 3TPKA 1GRWA 1DTUA 3GJFK 2EH8L 1GGBH 25C8L 1QNZH 4GG8B 3VFUB 5C8JB 2PCPB 1D6EA 1REIA 1WUNT 4TPRH 4PLJD 3CZJA 1XIWA 4JANB 1W0WA 4JFDA 1XR8B 1IZKA 1IAIM 4LLDA 3IVKA 5JOPD 1FFNA 3MOAH 4WW2B 4WW2C 2EIZA 4K8RL 4NO3A 4XNUL 1QR1B 3WNKA 5BRZE 1VHPA 1IQWH 3O41B 5EIIB 2XZZA 4LARH 2VLLA 4OZFG 3X3GH 1K85A 4KKAD 5IKCB 2HFGH 3NZHL 3QUMB 1KULA 3WN5B 3WN5C 4NQCB 2YK1L 4MDJA 1MCJA 1WIOA 1HCVA 3FO1B 3C60B 3C60C 3TVMA 4ZD3L 4O58H 2ZKHL 1T04A 2P42B 4LLMB 1KEGL 1MNUH 5IWLC 4GFTB 3D3VD 4BQCA 4ZSOA 4QNPE 2EEBA 1E4KA 4L8CA 2O61A 1A3RL 1WVZA 1EZVX 1J8HE 4CVZB 2WLZA 1ORQA 1ERNA 2ITDA 4YE4H 3BOVA 2YRPA 1EX0A 2VLRB 5GS2H 1U8KA 4FZ8H 4ZUTB 4M9PA 5F89A 4QYOA 5E2JA 4LHUD 4GRWH 3QA3A 4OQTH 3FT4A 4W70A 3OB0H 1BF2A 2JIXD 1CXLA 1HNFA 1D6EB 2CK0H 3FOLA 1D5XB 1WWCA 4MJIB 2ED8A 1K8DB 4N5ED 1W0WB 5JUEH 1YUHB 1T03H 1FFNB 5DJZB 2EKSA 2EIZB 4KI1A 1FL5A 4NO3B 4O2EA 4J2XA 3LN9A 4R4FL 2VLLB 4N90E 4X6CF 2P5WB 1INQA 4AH2A 2BVTA 4Y8AA 1Q0YL 5C6WH 4POZD 3X17A 1V3MA 2H8PA 3BVNA 3ULUE 3KXFA 3MUJA 4XNZB 4N0FB 5DSCB 1BBDH 4MCYA 3OKKB 4XWOD 4PV8B 4LKXA 4LSRH 1UCBL 4LSUH 1RZIB 2ITDB 4Z7UA 1KTKE 2V5SA 3FB8A 4WIQA 2YUVA 3MLXL 3QIUA 1JWUA 3EOBB 4L8BA 3OPZH 1U8KB 5F7UA 5EOCH 2CLVB 1T2JA 5JHDE 1JF1B 1P4BH 5F89B 4QYOB 4U1SB 3QO0A 3GSWB 2D0HA 3LKSA 5I6XB 5I6XC 2QL1A 2YMXL 4G42A 3BIAX 2GAZA 2ZUUA 4FQCH 4P57A 4DGVL 4PJFA 43CAA 1VFMA 5FCUH 5SV4A 4XVJL 5CINL 1FL5B 1SYSA 4O2EB 1NGQL 3QUZC 1ROWA 2XKSA 4JFQA 5MENA 5DVMA 1INQB 1Z9SA 1EBPA 4XVUD 5D6CA 1OQXA 5B3JE 3IU3A 1QSEE 3P0YH 3BVNB 3M8OH 3QIBB 3QIBC 3KXFB 3MLWL 1GL4B 4MA1B 1JPST 4MA1C 4NPYB 2FATL 1KB9J 1KIQA 3O6ML 5T1KD 4E41E 5IB4A 4KTYA 4OF7A 1O7SA 2ZCKH 4FMFA 5FYLD 5BXFA 4APQB 4APQC 3VXNA 3G5YA 3GO1L 3QIUB 1T7YA 4X7TA 4L8BB 3C2AH 2OJZH 2DJUA 3QEUB 4RSVA 3FCTB 2VZOA 1F4XL 1MRCL 4X80H 4OLXH 1EUTA 3QO0B 3LKSB 2I60L 4LFHG 3IETA 4MZ2A 3RHWK 4NKOA 4NUJA 1XF5A 3DUUA 1YYLH 2GUOA 3EYQD 4G42B 5ITFA 4PJ8D 4PB0L 1BIIA 2VDNH 2XA3A 4PRAA 4NBXB 3MLVL 4PJFB 5AEAA 1VFBB 5F9OH 4IOFC 1J88A 4OF0A 4X0KA 4XPFH 2IFFH 1SYSB 1AHWB 1AHWC 4LVOC 1FGVL 1A0QL 3E1F1 5BVJB 4DGIL 2G60L 4JFQB 4QRPA 5MENB 5DQDH 5HDOA 2BXYA 1DUYB 5D6CB 2EEDA 2AEPH 3IU3B 2B5IB 2B5IC 3MOBL 5B39A 2UUDK 3VDAA 1G7PA 1MFAH 5GRUH 3X11B 1KIQB 2CO7B 3PP3H 1YEJH 1FNEB 4NCDA 5KVMC 4JFFA 1CGVA 4WJ5B 1NBVL 3L9RB 4LCWB 5BXFB 1KN2H 3VXNB 3SE3C 2F19H 3KLHC 1JUFA 1Q9LA 1UB5A 2MQ3A 1G9NC 2XQBH 2BVYA 4X7TB 2R9HD 2NQCA 3MLSH 3TBWB 2J6EH 4HHAA 1XGYL 4HMEA 3V9FA 2ZSVB 1DQQA 2BHUA 3NFPA 3IETB 2ESVD 2QKIA 2OTUA 4NKOB 3BEWA 4D3CL 4NUJB 1XF5B 2GUOB 2DQIL 2C3VA 3VFRA 1NLBL 4ODXA 4MGXA 5FF6A 5JLZB 3F65A 4HWUA 4J4PA 4IEFB 1YQVH 4PRAB 4WI6A 5DFWH 2DLEA 2YUXA 3W82A 1IILE 1BZ9B 2H26A 1UCTA 3KJ6L 2D7PA 4X0KB 4KJQD 4IJ3C 5HGDA 3FRUA 4OI7A 1OB1A 1NL0L 3O2WL 3ZE1E 5FGSA 4QRPB 4NWTL 2VLJD 4BELD 1T89A 3OKEA 3REWA 3PWUA 1V3LA 4KXZI 4PJ7B 1FZOB 1J1XH 2AEQL 5C0GA 3WO4B 2IAMA 4JR9H 3WO4C 4YBQC 3OKDB 3T1FA 3ZO0A 1IL1B 4DZ8B 5HBBA 5C2BL 1U3HA 2B1HL 1G7PB 5C08A 2BCKA 1L7IL 4R8WH 5IBUG 3A6CL 1FBIL 1C16B 5A3ID 3GBLA 2Z31D 4WWID 1JUFB 1Q9LB 1UB5B 4ZFOB 2RBLA 1RZJC 4YXKL 4X4XB 4RMWA 5E99H 4OLYL 1L0XA 2WBJD 1SEQL 5INCA 4IHOA 1DQQB 1JF5A 1KFAH 1U8MA 3NFPB 4MDIA 3KAAA 2QKIB 2OTUB 4ZFZA 2E6QA 1VKXA 3SGJC 4Z9KB 4PGEA 2C3VB 5FF6B 1OP5K 3OAZH 1Z5LA 2BERA 4FFZL 2H26B 2DQJH 1J1OL 3S3SA 4P2RE 5CBAA 5IJVB 4FQJL 3FRUB 1WISA 3EO9L 3ZYZA 1CBVL 2HTLC 4HIHA 2DLFH 4NQED 4WUUE 5SX5H 2X4TA 3ET9F 5MP6H 3REWB 1HK6A 4Q2ZA 5C0GB 5TFSH 3NTCH 1INDL 1U3HB 1U3HC 2P45B 1S7SA 1YEIH 3QXAA 1OTSD 3MV9D 4QHKI 5CJXC 4BQ8A 4G8FA 4HPOH 4U7KA 1ZGLB 4M7JH 1AXIB 2C4FT 4YHPB 2AJVL 3DYMA 3OWEA 1NFDE 1F5WA 4K2UL 4MAYB 1F4YL 4MAYC 4WWKD 3JUZA 2X4QA 4PJHA 1RZFH 3UP1A 3MNZA 3WIHH 2DQUH 3BD4A 1CLOH 4UV4H 1UWGL 1NC4A 5KJRH 1F3JB 4XP6L 3QQ4A 3MV7A 4LLWB 5IB3B 3S88H 2EDQA 4NQUA 1FZJA 2X1OA 5INCB 2WUBH 4BQ9A 2CH8A 2OL3H 1X5FA 4KKBD 4MDIB 4HDIA 4NQXA 3CZFA 1BOGA 5DQJA 1S9YA 4HGWA 3K80A 1CK0L 2HLFC 2Z35B 2A77L 3BWAB 4P46A 3VXUA 1UZ8B 4YQXH 5CBAB 5E2TH 1FE8H 5FGCE 3VFTA 2B4CC 4ZYKA 5ESAA 3T09A 4HIHB 3IDUA 3SGDH 5BS0A 1A14H 2X4TB 1Q1JL 1RK1A 1JN6A 4Z8FH 1Y6KR 1TJHH 3I85A 4OI9A 1OAQL 2FX8L 1S7SB 1CS6A 1KCVL 3QXAB 3CLFH 5KZCB 4OF5A 5FYJE 5JORA 4G8FB 1A9BA 1I7TA 4XMPH 5IR1B 2YA1A 2C7UA 4DUXA 1JZ8A 5D5MF 4HKZA 4XAWH 2X4QB 4WI4A 5MHSD 4OZIF 4LNVA 3S35H 3MA9H 3QQ4B 4PRHA 4P2QE 4JZJA 3SPVA 1IC7H 1X5JA 4HWZB 5KVGL 5AZ2H 1IAIH 4YC2B 5L9DH 1FZJB 1ZVYA 1RZKH 4NRZB 4X9GA 4YDIH 5C9KA 3VWKA 4BH8A 4OFDA 5AAMA 3L3HA 2X4NA 3GHBH 1FG2B 4HDIB 4NQXB 1W72H 3ZKMD 3DHJA 3VXRD 5E8DH 2HH0H 4JJHA 2XICA 3C09B 3C09C 1HHIA 4HGWB 2BNQE 5LAXA 5T1LD 2X4SA 5KG9A 4XHQA 1BQSA 1P7HL 1K4DA 1T0NA 3MOQA 4P46B 3VXUB 5BZDA 3BH8A 3D48R 2W0PA 3GMRA 3VFTB 1JI1A 4HQQL 5ESAB 2WP3T 3VXPA 2VLKD 5C07B 1RK1B 5EZOH 3OR6A 1LVEA 4HT1H 3QDJE 3U6RB 5F88B 1DVFB 1DVFC 3L95A 4WW2F 4RX4A 2AK1H 4HUVA 2NX5E 5AWNH 2C1OB 3WO3B 4K3DH 3LKRB 5E24E 1A9BB 3GSQB 4TSCL 3W0WA 2CJUL 2C7UB 5DMGC 4AMKL 1MI5D 4HKZB 1J0IA 1RD6A 4I5BB 2FSEB 1PYWB 3JV0A 1S7RA 3HZKB 3FT3B 2IALB 1I9EA 3I6GA 4JFEA 4B7LA 4PRHB 2VC2H 4JZJB 4JZJC 1HOCA 4FFVC 3SPVB 2A6JA 5EG6C 1B2WL 2OP4L 3F58H 3N1QC 2NY6B 2V2TB 1BQLH 1M4KA 1M7DA 3ES6A 3VWKB 3VWKC 4OZHB 3VH8A 4M5ZL 4D0DA 2X4NB 2O93L 2P8LA 1DANT 5M94B 1H3PH 1ZLSL 5E4IA 5F96H 5HGAA 1JHTA 4JHZA 3HNTH 2X4SB 4K23L 5KG9B 1J8KA 1OTUD 1K4DB 1P5VA 2DQHL 2Q1EA 1IGMH 2NXYD 4PG9A 4Z7VB 3VXPB 1TTGA 4MD4A 1IT9H 1RV6X 3QCUL 4XT1C 2XKUA 1ZEAL 5J0BA 3OR6B 4K9EH 5FOBA 1I3UA 3AROA 2C3XA 3L95B 5EOQH 2E8YA 2XXMB 3A6OA 4MNHA 5CJ8A 4XRCA 2R2CA 2PTTA 15C8H 4JGUA 3S34L 1LO0H 2HKFH 2NTFA 2AGJH 5GGTH 4RMTA 4OFVA 4BA8A 4FQXD 4Y16A 3CXDL 2GYSA 3LIZL 3J8F7 3D39D 5DK2A 1S7RB 4HK0A 4JFEB 1OAYL 4XCFH 3VMPA 2CXKA 3AY4C 3PL6B 3PL6C 2ORBH 2A6JB 1LEGA 3NZ8A 1A6WL 1T7WA 3L5HA 1P4IH 3IGAA 2QQLL 4N0RA 3ES6B 2B1AL 3LQAH 2NY2D 4PB9H 3VH8B 5D2LA 4H25B 4D0DB 3SDDA 3QAZB 3QAZC 3U1SL 2QQQA 2P8LB 1WK0A 1ORSA 3M1BA 3RWGA 4CVWA 5JW4N 1JHTB 1P9MC 4EI5B 4EI5C 5E5RB 3VGGA 3K4ZA 2AVGA 5FHBL 4ZUWB 3CXHK 4I13B 4XBEH 4ZTOL 2MHAA 2YD5A 2F15A 4Y0GA 1WICA 2UY6A 2QSCL 4NFCA 1M05B 4MD4B 1A3LH 3CMGA 4G80A 1CVRA 5FGBA 3WL9B 4KFZC 5EIQA 2UYLB 4P23C 3IJYB 3VI4F 3PHOA 1U2CA 4K7FB 4DKFH 1NH6A 5F1KC 2CIKA 1YEEH 2PTTB 3LKOB 4Y4HB 4Y4HC 5HVFB 5MEQA 4J3SA 2EH8H 2NTFB 5I19L 1CIDA 3D85D 4LHUG 1WEJL 4Y16B 4Y16C 5KOVC 2GY5A 1BVKA 3QJFA 4I9WE 4XBGA 5DK2B 4HK0B 3W2DL 3V4UL 3ULSB 4K8RH 4XNUH 1NCUA 1N3NA 1CR9L 5C0DA 2ED7A 4CN1A 1NC2A 2GJ6B 1FP5A 3PHQA 4YDJA 3RKDD 5E8OA 1A6AA 5F1IB 4X5WA 1I1YA 1UM6L 4ZD3H 1ITCA 1ZA3A 2ZKHH 1FYTD 1ADQA 1KEGH 4RMSA 4XP9L 1IRAY 1E0OB 2OLDA 2YD8A 1MHPL 4GRLD 2MHAB 5E08L 1A3RH 2VNCA 4KK5C 1T80A 1TQCB 1IEAB 1M6OA 1TQCC 2V2XA 1KV3A 1HI6A 1G9MC 4LLQA 3W9EB 5FGBC 2R2HA 4HF5L 1TFHA 2AK4D 1N64L 3GKZA 3PHOB 3O9WA 3R4DA 3LY6A 3WE6A 2CIKB 4FMKA 3D0LA 5EULV 4F9LA 3MRJA 2DL9A 2HMIC 3VG0L 4ELME 1TTFA 3BO8A 4JJ5A 5B39G 4W4NA 3PE9A 4MCZB 5JDJA 1A2YA 4M1CC 3TNMA 2D03H 4XWGL 1A7RL 2J12B 3EJZD 5IEKB 3Q0HA 2YEZB 1BD2B 4KK6D 4JKWA 1CFSA 2AAVA 3IDXL 1N3NB 4UTAL 1GGYA 1T4KA 1KXQE 1BPVA 1HDMA 4IRSD 3BX7C 4WEMB 5IVXE 3PHQB 4YDJB 1ZT7B 4PRPB 1A6AB 2FX7L 4X5WB 2K9UA 4JY4A 4OQ1A 1MWAL 1INEL 3MRHA 3HAEA 2P5EB 3BKCL 3C6SA 3QO1A 5D72H 1FJ1B 1X4ZA 2ITCA 2BSRA 1M6OB 4R7NA 1FZMA 2V2XB 1T66C 1UCBH 3O2DL 4X9HA 1QLRA 5DRXA 5C0AB 4DN3L 4R3SA 2Q7NA 1JE6A 2R2HB 1RK0A 3MLXH 2QADB 2QADC 3RWHA 1M7XA 1NLDL 3T2PA 5H37H 5I1AB 4YDVB 4GMSL 3THML 3TESA 3WE6B 1G1CA 1UFUA 4JE4B 4F9LC 3MRJB 1YMME 5DGRA 4DUVA 3WLBA 2EZ0D 2YMXH 1ND0A 3BO8B 2EO1A 4PJ7F 1JK8A 5DJAB 4Q9CA 5HYSA 3T77B 3SDXF 3TNMB 2YA2A 4CBPA 3T0ED 2YC1B 1N0XL 4OGAD 2YD3A 5CINH 1CFSB 3OJMB 1GGCL 1NGQH 1T4KB 2VYRE 5EBWA 1HDMB 3HR5B 4LQ1A 2F53E 3I3BA 5DHYB 4NO2A 3HC3L 4P59L 1CL7I 1EXUA 4OJFL 4I8DA 4MNGB 3H3PL 3BN3B 3MLWH 3DGCR 4JO4L 1MCWW 4X6DA 3MRHB 1JZ3A 1RIVL 2FATH 4G6FD 3V95A 3O6MH 4CU8A 1EGJL 4I0PA 3RL2A 1PDKA 1FZMB 1A6ZB 4LVEA 3F7VA 1QLRB 5HDBF 5DRXB 1EZVY 3MX0A 1MQ8A 3MSPA 5CLWA 4U6HA 5EZLA 4YFLI 3GO1H 3UTOA 3NCYP 5F3BA 3B2UD 4XMLL 1F4XH 1MRCH 1NBYA 3V0WL 3LS5L 2HT3C 4TSAL 1GGTA 3GDBA 5L8JB 2I60H 3RIFF 5EU6E 4NQDE 1PY9A 1ND0B 4G43B 1JTOA 4PB0H 4LRIA 5FYJU 3KPSD 4JFPA 3MLVH 5KN5B 4U6VL 5DD5L 5CFHA 3NH7L 4O00A 2BP3A 4A6YL 4YHLL 1U8IA 4RFNB 4RFNC 4X4ZA 3V8OA 1FGVH 2Z8VC 2WAHA 5GGVY 2O5ZL 4DGIH 2G60H 5ISZE 1SBBA 4LPVA 1Z0MA 4KDTC 5IHUL 4NO2B 4ZUSB 4HG4J 1Y6MR 4MD5A 1EXUB 1IC4L 3LN4A 3ZT5A 3MA7A 5DVOA 1X6LA 1NGWB 1S78C 5DI8A 4X6DB 4ZOCA 4HFWA 3ARPA 5IEHA 4PLKC 3LRSA 4N9OB 3ARQA 3VG9B 3QUYA 1F3RB 4I0PB 4I0PC 3RL2B 3ZYJA 1H3WM 5F7WC 4GMTL 3F7VB 3L7FB 2EE9A 1NBVH 3T2QA 4GG6A 1CFVL 4U6HB 3GNML 2VQUA 1R3HA 3D69A 3CMOH 3HMXL 3K46A 3ULVH 4TSBH 1NBYB 2ZUSA 1XGYH 3ARTA 2GT9A 4L9DA 1CCZA 2O5YL 3JWOC 2HAZA 1XR9A 2ICEA 1CTNA 4RZCA 4D3CH 3CSBA 1NLBH 5CILL 4XNMA 3CNKA 4YZFF 3VWJD 4C54A 3I6KB 4JFPB 2A6KA 4FQHA 1U8IB 3KJ6H 1FIGL 5E8EA 1QFWI 2IBBA 2DRUA 4QRSB 5F1NB 1LE9B 4NQCD 5CKGA 5TF0A 1U8LB 1FZKA 1NL0H 3O2WH 3SEPA 2VL4A 5EU4B 4L3EE 3FO0L 1RUAL 5HDLA 4L4JA 3EJYC 3T3ME 2KH2B 5JPNA 2AEQH 4HCRA 4LHJB 3WXVH 3GI8L 3LN4B 5C2BH 1S9VA 4QGYA 5AD0A 3OXSB 4EN3A 2B1HH 5CEXA 4AL8L 4WFFE 3P0VL 1WWBX 1T5XA 4GO6B 4ETYA 5JR1L 3A6CH 3EGSA 1FBIH 1ZT1B 3QUYB 5BJTA 3D1MC 3ME0A 5F21B 3CH1B 4S1SL 4XNYH 3B9KA 4GG6B 1SM3L 4YIQA 2V7HB 5LJYH 4HLJA 3WMSA 2YD2A 4WFEE 5B4MD 3ARED 4OLYH 4N1HB 5EB9A 4O51A 1SEQH 2AJYL 1WWWX 4LQFH 4EI6A 2F54D 5HYIA 2GT9B 1XT5A 4MJID 4CUCA 2H9GA 4YPGB 3AXLB 2ICEB 2YOCA 4RZCB 3DVNB 3B9VA 1V05A 4DKAA 1BQHA 4FTVB 3LS4H 4XNMB 1Y6NR 3PGCA 1KGCD 1J1OH 1HYSC 1UZ6E 3L5JA 5B3JF 3N85L 4FQJH 3EO9H 4N8PA 1CBVH 5K9QI 4KUZL 1HSAA 1MHHB 5JPNB 1KUMA 2EXYD 3Q5YA 2OTWA 1INDH 5AD0B 4EN3B 1G9EA 1VEOA 5CEXB 2YKLH 4Y1AA 3VH8G 3DXAE 1T5XB 1QBAA 3GRWA 3ARVA 4OZHF 4XCYA 1AGCB 4HEPG 2ENYA 1Z0NA 1N6VA 4P3WA 5BJTB 3P30H 5HI3C 3B9AA 3ZT7A 4K2UH 5DZOA 1F4YH 4Z7QF 3BZFB 1KF9B 1UWGH 1BVZA 3PG2A 4YIQB 4ONFL 1U8NA 4XP6H 2EYRB 5KOMC 1P7QA 1MIEL 4P5MA 3FQUA 2IH1A 2B20A 1DEEA 2E9JA 2VXUL 4EOWL 4L4TE 4EI6B 3GMNB 4Z7VF 5TE6L 4HWBA 4PJIE 4PJ9A 2H9GB 2P48B 5TE4L 1BQHB 3WFCL 5CCKH 4XAKD 4EIGB 3QUZD 1MCDA 3N50A 4KH2A 1IM9A 1R5WA 4NIKB 5HYJA 5F7MC 3PV7A 2RAMA 3QIBD 3GSRA 4A2MA 1X7QA 3RUGA 2IGFL 5H94B 5I1EH 1OAQH 2FX8H 4HBCL 3DOSA 1KCVH 4HIJA 5CEZL 1JVKA 2E9IA 3RZWA 1LWRA 2DM2A 4APQD 2FEEI 4XCYB 4XXDA 5GRVK 1SY6L 4OZGA 5I75B 5I75C 4QXGL 3RA7L 4FP8L 3U0WL 1W0VA 1QFUL 3EDJA 4WY7L 1A4JA 2DLHA 1BWMA 1QQDB 4AG4L 1P7QB 5KVGH 3FQUB 2IH1B 3TC9A 1DEEB 3TT3L 3VXOA 2DF3A 5B8CB 5B8CC 4IBLT 1FVDA 3IRPX 4IOFD 2YPLA 3HKFA 1GC1C 2H6PA 5C0BD 1FG9C 1FFQA 1CFQA 2R0ZL 1VCAA 3SCMD 3NABL 3DTXA 3T2NL 4DGYH 2JJVA 2FBJL 5I8EA 1FLRL 1IM9B 1R5WB 5KSBA 1QBML 5HHMB 4HQQH 5HYJB 2FEDC 4DW2H 3BESR 1B0RA 1OGAA 3GSRB 5H35A 4JFHD 4NC0B 5IV2A 4U1MA 3HMWL 5CZVL 5I1GL 2KDGA 1OP3H 3IS0X 3MNWA 4LCWD 5GGRB 1SQ2N 1Y0LA 2EO9A 4TSCH 2CJUH 4G3YL 2F8OA 3OGOE 1CF8L 5HY9B 4JKPL 4GQPH 2Z93A 1OPGL 1ZLUH 4V1DE 1KCRL 1B2WH 1RZKC 3UBXA 2OP4H 2DDQL 5KSAB 5KSAC 4M3JA 1DN0B 4RGOL 1RUPL 5D7LE 3MJ7B 5EO1A 4M5ZH 1K6QL 2IH3A 2QHRL 1BFVL 5EC2B 5ACZB 1FVDB 3VGFA 5C0CE 4NNPL 1ZLSH 1MCLA 5LBSH 2YPLB 1AR1C 3MMEA 1V7NH 3BPNB 3BPNC 4K23H 3NCYS 3MRFA 2E9WA 3DTXB 4BKLA 2DQHH 3EFDL 5I8EB 1EVUA 4QRRE 2G75B 4YBQD 5FO7A 4TQEL 3HTLX 5JNYA 4FS0A 3QCUH 3U0PB 1ZEAH 5DT1L 1B0RB 1OGAB 5GS0D 2PW1A 5H35B 4LNRA 4MQSB 5IV2B 1A6PA 2JK5A 5E5MA 2DI7A 3WS6A 5EA0L 4F37F 4U1MB 1MAKA 2XN9B 3MQIA 1E4WL 3S34H 3ECBA 3MYZA 5J1SC 1YEDB 3MNWB 3BIKA 3V6OE 2MFNA 4W6XB 3UJJL 1Y0LB 3IDYC 4LSQL 4AQ1B 3CXDH 4PGCA 3LIZH 3PWPD 4HH8A 3HAEG 3MACL 4TVPL 2VN7A 1OAYH 2Z93B 1JF6A 2E27L 1DDHB 1IM3A 4XX1E 3QULA 4I4WB 4N8CL 4YHYB 4YHYC 1UADC 1A6WH 4GW5A 2JF1A 2GQHA 2QQLH 5M7QA 2B1AH 3F12A 1CD8A 4PJAA 2IH3B 4KRLB 4XP4L 4G6KL 1NCBL 3UX9B 2COQA 2JCCA 1OY3B 4H20L 3A67L 3PWJA 1KT2A 4GRWF 3RNKB 2BY3A 4Z7WB 1QUNA 2GIYA 2BSED 3MRFB 5DQ9A 4UT6L 1HSBA 3GM0A 4DOHB 3RDTB 3RDTC 4BKLB 4ZTOH 3ROLA 2K1MA 3VXMA 5IB1B 1XGRB 1KB5A 1D3CA 4OFYD 2QSCH 3NIGF 2I27N 3BYYA 3JV4A 4I48A 5HYSG 3ULVE 2CGRL 4XB8A 5FO7B 3DLQR 4K9EC 4BYHA 2PW1B 5JW3L 4LNRB 3IF1A 4I1NB 2JK5B 3SO3B 5E5MB 3SO3C 1I4FA 3V52H 4D9QE 3WS6C 5GSVB 5SWZD 2BJML 1MCOL 1CGSL 3DJ9A 4MAYD 1S9KC 1ZHBA 3OKNB 3KPOA 5L2JA 5I19H 4PJXB 4OFIA 4ACPA 3FQNA 4ODVL 1RZGB 1WEJH 3KPRB 2W60A 2XY1A 1JWMA 4NO0A 4PGCB 3L3JB 4M61A 1J8HD 3CFKB 1DN2A 4UAOB 4UAOC 3W2DH 4P5TC 3V4UH 5T1MA 4Z5RA 8FABA 2FYYA 1IM3B 3QULB 5T5NG 2YXMA 1CR9H 4PUBL 3ILQC 3BT2L 4UT9L 1RIHL 5ALCL 4ODBD 1NCWL 4PJAB 3FN9A 3ISWA 1YPZE 2N56A 4EUPA 1AKJB 1UM6H 1VB9A 2JCCB 4HC1A 4P48A 2Q3ZA 1I1RA 1LP9A 4XP9H 1MHPH 2NY1C 2NY1B 3ROLB 5F7HA 5E08H 4JGJA 1KB5B 1BMGA 4R97B 4R97C 3D87B 5A2IH 4M5YH 4RAVB 5CBEB 5F6HI 4N90D 2A74A 4XC3L 4HF5H 5KZCD 4ALAL 1N64H 3LEXB 1I4FB 1VERA 2W1NA 5A2JH 1OL0A 1JL8A 1KPUB 1V7ML 3SKUD 5CSBA 1NUNB 3VD5A 1VDGA 3VG0H 4JFXA 4U05A 1FHGA 3FQNB 1SJEA 4PP2A 2W60B 1JWMB 4NO0B 4M61B 1JCKA 1U8JA 3MBEA 4XWGH 2VE6A 5T1MB 1AJ7L 2Y5TA 8FABB 1R24A 2FYYB 3RZCC 3RZCB 2KZ1B 1CXFA 1QFHA 5BRZA 3IDXH 4TYUA 5I8CA 3MRQA 3WUWA 4X5XB 4UTAH 5JHDD 5FUOL 4F15C 3RBGA 2EDRA 1S9WA 3BP5A 2CUHA 2K7PA 3SDYL 3QR2A 3VXSB 5DXWA 2LU4A 4Y89A 3VXQB 1LEIA 5E6ZA 1LP9B 1KCUL 1R3JA 1MWAH 1UA6L 3MJ9L 1INEH 1BHGA 4NUGL 3PF2A 1R6VA 4U1LA 3BKCH 4Y4KA 5C07D 4S2SB 1DBJL 1X5ZA 3S5LA 2F74A 3O2DH 2H2SC 3QUML 1U91A 4UNUA 1H8NA 1DVFD 3VMOA 4DN3H 2A83A 4LLUA 2A74B 4KTDL 1NLDH 4NDMA 1FIEA 3THMH 1QSED 2OK0L 3N1FC 3RWIA 4YDKH 4RCAA 5DMGD 1A8JH 2FEEL 1XAUA 1HILB 5K9JL 2D0GA 4L4VE 4EVNB 1ONQB 1SJEB 2LV4A 1F58L 4N9GA 4JRYD 1WZMA 1U8JB 3MBEB 3MGOA 5ESQA 5DC4B 1F6FB 1N0XH 1SBSL 2D7TL 1QTYT 4QTIL 1E4JA 3UDWC 5IF0B 5D8JL 2Q20A 4V2BA 5BRZB 3MV8E 1GGCH 2PYEE 3MRQB 4ZO9A 1E4XI 2DWEB 4UINL 4QT5B 1U8PB 3GMMA 3OJ2C 1T22A 4OLZL 1RU9H 3V0VA 1Q94B 3HC3H 4P59H 2VDPL 2V9RA 1G7JB 1RHHB 1AGFB 5ETUA 3FQRB 3RIAK 4OJFH 1QFWM 4ZFFA 4LDOB 3F6IA 3N1MC 3FB7A 1RIVH 3IDIB 1EH9A 3FB5A 1QVOA 4Y4KB 1PKQB 3S5LB 3IDNA 3AC0A 1BQHG 3WXWL 1U91B 5FDYA 3SO5A 3KYOA 2EDKA 2DM4A 3ZE0F 2A83B 2DMCA 4LLUB 3VFWA 1JFQL 4AQOA 2UWEE 1UWXK 5DZLA 2Y07L 3CDCA 4XMLH 1PQZA 2E6PA 3U7WL 3O3EA 3RQ3A 4NRXB 2SEBA 3LS5H 2F5BL 3C08L 1V8HA 4TSAH 4CU6A 5IMOB 3BRFA 1QBLL 5J9PB 4WI3A 5IBLC 5JOFA 4WO4A 3T4AA 4N9GB 3RY6C 5JOPE 5I1CL 3PL6D 1LK2A 1OGTA 4F33A 5IFJA 1C7SA 4U6VH 4F7TA 3NH7H 4YHLH 2R4RL 4O2FB 1K8IB 2O5ZH 4U2ZA 4NYLA 2PNDA 4Y2DA 3GMMB 4EI5D 1T22B 2EC9U 1I1AA 1S8DB 1PAMA 1BFOB 1F4HA 1IC4H 4OUOA 4ZFFB 3FB7B 1OP9A 5F8QC 4F3FB 5IB5A 4E41A 3FB5B 3C5SA 4BM7A 4OLUL 4R4NC 4HJJL 4H1LA 1SVCP 4GMTH 4P23D 2BSTA 2H45A 5DVKA 3GKWL 3KYOB 1BAFL 1CFVH 5GQBA 3GNMH 3X12B 4OV6F 4Y4HD 2N4IA 3MLRL 4M4RA 3HMXH 1CICA 2MKLC 1F4WL 1QRND 1BZ7A 1D5BA 6FABL 3T04D 2O5YH 5J13B 5J13C 4KHXL 5D1QD 5FUCE 1U8QA 3T4AB 3HUJE 4F58L 1AIFA 3K81A 5CILH 1AFVL 4J3XA 1OGTB 1I3VA 4RQQB 4TTDD 5IVXF 4F33B 2A0LD 5IFJB 2PXYA 4PYGA 2HVKA 2GJ6D 1FIGH 4JRXB 4UQ2B 5LQBL 1AGEB 2W0LA 4FG6C 4WHYG 3CGTA 2CRMA 4BK4A 4AEEA 4ELKB 5JQ6L 4U0QB 2NZIA 4NFBA 5ICXA 3FO0H 4NYLB 5KVFL 1DQML 1RUAH 4DK6A 1LK3L 3PV6B 3WIFA 2FECI 3TEUA 3GI8H 4HX1B 5E2WL 4ZUUA 3OTTA 1ZVHA 2YR3A 4KK5D 3VGAB 3SDAD 3VGAC 4AL8H 3P0VH 5L0QB 5L0QC 5JR1H 5IB5B 4E41B 3MREA 4L8SA 5CHNA 3AS0A 3C5SB 3H3KA 3QHFL 5HHOB 3WKML 2ZG3A 5DJ2A 3QSKB 4RFEB 2BSTB 4S1SH 1RAMA 1SM3H 3QCVL 3BP7A 5IQ9B 5C3LD 1PSKL 5HXMA 3STZA 4O5LL 5F44A 3FO9A 2Y7QB 2HMID 2N7BA 5I0DA 2AJYH 1JGVL 2VITA 1BZ7B 1D5BB 1KPRA 4M1CD 1I7UA 1CD0A 4IDLA 4GSDL 4OCSL 3T0BA 1TCRA 1H15A 2XNAA 5IGXL 1P1ZA 1BD2D 3CC5A 4MQ7A 5MEPA 4POUB 2D0FA 1UJ3A 2PXYB 2PXYC 3AMLA 3EDDA 3KDMB 3GIVA 4KK9C 1MAML 3UTQA 3CU1A 1KXVC 3N85H 3ARGB 3ARGC 5BW7C 3LEVL 5DTFA 1JMZA 4YHOL 1XGUA 4YAQA 5ICXB 2Z91A 4KUZH 5EPMA 3I3EA 1U8OA 3UBXG 3RVWC 5ICZA 1VGEL 5IK3A 2P5ED 3ARDA 5D7IE 2Q8AH 4HPYL 1T66D 2WANA 5C0AD 3MREB 4L8SB 4L8SC 5CHNB 4GKNA 5D7KD 5E7FA 2DYPB 3CK0L 1DQDL 2DB8A 5D1XB 5D1XC 5IMLB 4YX2L 3GJFH 1O5DT 3EJJX 3ARBA 4KQ4L 3BP7B 12E8L 2WIMA 2ARWA 4ONFH 1HZHH 1MIEH 3IB4A 3PGDB 2VXUH 5JW5A 2A9ML 3SGKC 4EOWH 1KPRB 2AW2A 1KIPA 4F57L 1OLLA 3MRNB 3DX6A 3PIQA 4R9HA 1H15B 1QHOA 4NNYB 1TXKA 5TE4H 4LASH 1P1ZB 4MQ7B 2HP4A 1UJ3B 1UJ3C 3ZHDA 2EXWC 3CH8A 5FM5O 3GIVB 3UTQB 2HRLA 4P2RA 5D1ZC 2XTLA 5DTFB 3BSZL 3QDGE 4YAQB 2YD4A 2Z91B 3G9AB 3GMPB 4WUUA 3TLRA 3MR9A 4WTXA 2J8OA 1FFPA 2X10A 5EPMB 2R1YA 2IGFH 1U8OB 1PJ9A 3ARDB 3ARDC 4X4ME 3FQWB 2AXGB 5CEZH 3H9SA 4U49A 4JQXA 1JJUA 4OBRA 5HGHA 4GKNB 2YD6A 5BQ7B 1SY6H 1MHCA 1NFDA 4QXGH 3RA7H 2X89D 4FP8H 3REVA 3U0WH 1QFUH 5IM7A 3QEHB 4BK5A 4Z7WF 5KSVA 2HT3D 2EC8A 4I77H 3O8XC 3R8QA 4IRJA 3O4LB 4JM4H 5GSRB 1ODAA 1JGUL 5I73B 5I8KL 3TT3H 4NO5A 4WHCA 1N5YL 4QCIA 5BO1L 2X4OA 3PIQB 3LD8B 3LD8C 3JSSA 2AEIT 4PJDF 2HJKB 3AS2A 4DUWA 4BFEA 2R0ZH 2IWGA 4R6UA 4G8IB 5C09E 3T2NH 1KENL 4WNQB 2Y1VA 4PJXF 4AZ8A 2FBJH 4WW1A 1TVBB 1E4XL 3DRTB 4ODHL 3LPWA 1CE1L 2VAJA 3QI9D 3RIFK 3TT1H 1KXTB 1S78D 4DZBA 1ZSDA 3MR9B 1IC5L 3HB3C 1P2CB 2Z4QA 4NSKA 4CRPA 32C2B 5JZ7C 3HMWH 3O81A 4DQOL 4S1DC 5CZVH 2UY7A 3H9SB 5I1GH 3MCLH 4JQXC 5HHQB 5HGHB 3DBXB 3JUYA 4OIIL 1HKLL 4EUPG 3B8YA 2IANB 1YDPA 3DSFL 1NFDB 4G3YH 4MJ5A 2C9AA 2ZSWB 1CIUA 2DTSA 1QPXA 3QCTL 5IM7B 1CF8H 1I9RH 4U3CA 4DJMA 2K3TA 2AJZA 2XIDA 4JKPH 1DUZB 3WJLC 4QOKD 1OPGH 4AM0A 4P2QA 5FECA 1EJ6A 4M8QA 4RMRA 1UWEL 1KCRH 3MRPA 3KPNA 2KQNA 1TVDA 4NO5B 1KTLA 4RGOH 1RUPH 4YNYA 4QCIB 1K6QH 1UZ6F 2QHRH 1BFVH 4KI5C 3EO0A 4Z0XB 3I6LD 4J7RA 5DK0A 4NNPH 1EFXD 2BNQA 2HN7A 4DVRL 2VDKL 1JMXA 4Z77A 3VI3F 5JMRA 1JZ4A 4NQEE 1KJVA 3HE7B 3HE7C 3EFDH 4GLRI 5FGCB 3QWRA 3VJ6B 3KYKL 4Z7NE 3MRMA 1NCNA 1URLA 1LNUA 1A1NA 2AJ3A 4TQEH 1KJ2A 3OKYA 3UYRL 4CVXB 4DZBB 1UVQA 2L4OA 4G9FE 5DT1H 4KPHL 3UTSA 4N1CA 3MV9E 3QDJA 2A9NL 2Z4QB 4NSKB 3WUWG 5EA0H 2NX5A 2FH6A 2DICA 1E4WH 2BY2A 2CUIA 1YJDC 3QFJB 3HI5L 4WRLA 2BC4A 1YDPB 4MJ5B 1G6RA 4LSQH 5E5UB 3CDGB 3WBDA 4WV1B 4WV1C 4TVPH 2AJZB 3NIFF 3FONA 5FECB 4AM0B 2FHCA 4M8QB 5E9DB 1L4IA 3CFJB 3MRPB 4N8CH 1ETZA 3S5LG 2QHLA 2CR6A 2XA8L 1IGCL 2V5TA 3RVXC 3DUHA 1KTLB 5CIPA 3P77B 4FTVD 4YNYB 5B22A 4UIKL 3EO0B 3ARSA 4XP4H 2HFTA 4G6KH 1NCBH 5IMMB 5JO5A 4H20H 5DK0B 3A67H 3IYLW 1HYSD 2BNQB 5M95B 1FNHA 4UT6H 1MH5A 3BQUA 1KJVB 1FYHB 3CDYA 5CZXC 2X4RA 2B7DT 4TNVF 5K59F 3MRMB 1LNUB 1A1NB 3CVHA 3UTTD 4ORZC 4JHWL 1KJ2B 2X6MA 4MLIA 1JPFA 3UTSB 2VWEE 2UVEA 3QDJB 3V7MA 3UZVB 3D18A 5ANME 2NX5B 2BJMH 1MCOH 1NPUA 4G7VL 5HI3D 1CGSH 4GW4A 3VGEA 1MCSA 3ZYOA 1N0LA 5MHSE 1CWVA 2BC4B 3VD3A 3V6ZA 5C9JA 4ODVH 3FKUS 1G6RB 2FX9H 3HG1D 1R3IL 4BJLA 3H3BC 1IKNA 3MODL 2CSPA 5D4QA 3H9HA 4UILL 1KYOK 1BWWA 4MXVF 1ETZB 4PUBH 3BT2H 4UT9H 5KW9L 3VXRE 1RIHH 5ALCH 5I1IL 1P6FA 1FL3A 1NCWH 4UQ3A 5CIPB 3NVQA 4NC1C 2WSKA 4YO0B 5HI5D 5HD8C 2I25N 4K94H 4PY8I 5JO5B 4UOJA 1CDCA 3C5ZB 3C5ZC 3TO4D 3ZKXB 1UH3A 1JP5A 3WNMA 5IHLB 3ZHLA 4UV7L 3BQUB 3GBML 2VLKE 4PJBA 2MQCA 2WINB 1WFUA 1DBAL 5DRZB 3CVHB 1A7BA 3VW3H 1JPFB 4XC3H 1UXSA 4QKXB 3CUPB 5FUZL 4ALAH 5C86A 1MFCH 4JFOA 4X6CE 4JGMA 5ENWA 4KJWD 1MI5E 5F9WB 5F9WC 1EO5A 5CSGA 1IE5A 3TA3D 3QNYB 3CSYA 3V6ZB 4TNWF 5C9JB 5AAWA 1O7VA 2JJSA 3PXHA 1ZLVH 4NC2B 2FH8A 5FO8A 3NA9H 1AH1A 1KN4L 5E00A 2FJGA 1UEMA 4H1LG 2V5MA 5FUOH 3MRKB 1HXMA 3SDYH 1FL3B 3QQ9C 2FGZA 1YMMD 3OBAA 1K9TA 3MBXL 3AGVA 1TNNA 1SVZA 1KCUH 1UA6H 3MJ9H 5GRJH 4NUGH 4NKIL 4PJBB 5C0FA 1E6OL 1A7QL 3DV4B 2M2DA 1DBJH 2OSLA 3BISA 3QUMH 4HUXA 2D9QB 5GJTL 3ZKSD 1AO7A 1MJUL 4MHHG 5I30L 4HIIA 2F53D 3IT8D 1UXSB 3BKML 4XCEA 4JFOB 2E7HA 5DRWA 5ENWB 3RL1A 1NFIB 2OK0H 3QG6A 3PNWA 5GZND 4OLWL 4ELMA 1NEUA 4OB5H 5K9JH 1OW0A 4LCIL 1S7XA 3CSYB 3IRZA 1NDMA 4AEHL 2FIKA 1NAMA 3FFCA 1F58H 4B53A 9CGTA 1G9ML 2DLGA 3BRGC 4JG1L 4KDVA 4B5EA 1MJJA 4ZMAT 5D71L 2D7TH 1SBSH 4U3HA 5KSAD 4QTIH 5E00B 2VQ1A 5D8JH 1NCAL 2FJGB 5E2VL 4WDIB 4Z76A 1CGXA 4U1NA 3QWQB 1HXMB 1ED3B 1NSNL 4UINH 5CEZE 5FM5M 2A73A 1JHKL 4NQVA 1AR1D 3BD3A 5I76A 4OLZH 1QKZL 5EU6D 3F5WB 2VDPH 4M8VA 1MWAB 2MQ0A 1LILA 3BD5A 3FN0L 3WIHA 3UPCA 3KYNA 2AS5M 2WWMD 3GMLA 1YEGL 5L88L 3EFFA 3ROOA 1YZZA 2EDHA 3L3DA 2BVOB 2OSLB 3WXWH 1AD0A 5C0JA 5J89A 4HUXB 4WEUD 3QDME 2OL3A 1AO7B 2YD1A 5GRVL 3P4OA 4PBWD 4QHNB 1B88A 4G5ZL 4XCEB 1JFQH 2DAVA 1E27B 4U1KA 5L2KD 1ADQL 2Y07H 2XWJA 5DRWB 1P4LA 4NM8L 3KYAA 3U7WH 2C26A 2FHBA 5GZOC 1A9EA 2F5BH 3PNWB 1NDGA 3B9EA 4ELMB 5DUPL 3LSOB 1NDMB 2P7TA 4PRDB 2FIKB 5F7EL 5J3HD 3OB8A 1NAMB 3FFCB 4IDJL 5SWSB 4KWUA 1YY8A 3RTQA 5I1CH 4QO1A 5D2NE 1UKSA 2FJFB 2ZOKA 3C9NB 1MJJB 1TQBB 1TQBC 5C0EB 1BBJB 2VDLL 4RFOL 2R4RH 4ETQA 5EBMA 4QRTA 2VUOA 2XKNA 2Y4SA 1J05A 4G8EA 1EAPB 3EBAA 3IDJA 1AP2A 1KPVB 3RWEB 4QXTA 3R8BB 2A73B 1R3KA 4M7ZB 4M7ZC 4NQVB 1FYTE 4OM0L 3FTGA 1FVCA 2VTFA 4JY6A 4F8TA 2CO6B 3RDTD 4KC3B 4M62L 1CU4H 5IFAL 4JRWA 3LV3B 2ADGA 3KYNB 2BRQA 4LGPB 3B2VL 3GMLB 3K4DA 2C3HA 2ZCHL 4CMMA 1CYGA 2NZ9C 3EFFB 4QHUA 5K9KA 1S7UB 3U4EA 5CD3B 3ROOB 4OLUH 5JA8B 2AK4E 3L3DB 4JY5L 1AD0B 2LABA 3GKWH 2HA1A 1BAFH 3P4OB 1MCBA 1EIBA 4H0IA 1MLCA 3B3IA 1W72A 1FPTH 3MLRH 4NZTH 1JPTH 4OCRL 4KROB 4KROC 1KOAA 2WK2A 4W6WB 1A9EB 5I66A 1NDGB 1X5XA 3KPRD 3OB0K 1M1SA 2FDBP 4WFFD 2HFEA 4NQDA 6FABH 5GPRA 2V2WB 4LKCA 3B43A 2P1YA 2AP2A 4P5TD 5FO9A 1IAOB 1YY8B 3RTQB 2LE9A 4F58H 4HZLA 1AFVH 2ZOKB 4A6YB 1BLNA 3BN9C 3PQYB 1IGYB 4ZPVA 2NY0D 1LO5A 5EBMB 2XZQL 1NUDA 1FVEA 4LDEB 3EYUL 4QTHA 4G8EB 1AP2B 4Y19A 1AKJD 5ISZA 1DE4B 5AG8A 5KVFH 1DQMH 1LK3H 3FTGB 2ICWI 4YHNA 4JY6B 5E2WH 1XCQB 2W9DL 2VZVA 3IJHA 4MVBC 5T3ZL 4TVPE 4XMKL 1QSFB 2FO4A 4QHUB 3GFUA 5K9KB 4OLVL 1YA5A 2WNGA 1F42A 1KNOB 1UGNA 3G6JB 4OUUA 3QCVH 1PSKH 4O5LH 1MLCB 2FWOA 4R0LA 3INUL 3AMKA 4LBEA 5DJ0A 1A47A 5GRXG 3G6AA 4RDQG 5F70A 2HFEB 3BPCA 3DXAD 1JWSB 5E6YA 3T0EE 5INDA 5DJ6A 4KZDL 4OCSH 1LQSR 5DJYB 4K8RD 5IGXH 2WIIA 3RZCD 2BNRB 4I18A 3DIFA 1BLNB 4P9HL 3SJVD 4X6FA 4HSQA 8CGTA 1MAMH 3TH4T 5CJ5A 3VXSD 1FVEB 3UBXI 1PG7L 3LEVH 4R7DA 3QXUA 2GTZB 1MF2L 3TJHC 4Y19B 4YHOH 1P53A 1VEPA 5IVZA 3JWOL 4L3EA 5ISZB 3GMOB 3S37X 4BFBD 1IKFL 4ZOEA 5GGTA 3OMZA 3KYMA 4PJCB 4DKDC 2AV1A 3LQMA 1VGEH 3IJHB 4Y7MA 3MFFB 1HWHB 3SE4C 1RURL 1I3RB 2H3NA 2VZ3A 2GTWB 1WAAF 3U30B 3U30C 1HWGB 3O6FA 3TYFA 1FSKB 1FSKC 4FN0A 2UWEF 3DURB 1YEFL 4KI5F 3CK0H 1DQDH 2AJUL 2PTVA 4JFZH 4YX2H 1PX4A 12E8H 5A2KH 3OAUL 5CWSB 2HLAA 2FWOB 4R0LB 3I75A 4R0LC 3E0GA 2DQTL 3VFMA 5DJ0B 5CUSL 3UROR 2A9MH 2J7LA 1UKTA 3GSXA 1MAJA 1YN6B 3KPSE 4F57H 4PJGF 5DJ6B 3IDGA 4OZFB 2EDWA 5LGJA 4I18B 4I18C 5C7XL 1A22B 1RZJH 4I0KA 4KRPC 5D5ME 1OTTD 5IIEA 4HJGB 3EDKA 3M17A 2W91A 5EUOF 4R7DB 5I15L 1CVSC 5IVZB 4XTRC 2BX5A 2XYCA 4X6BA 3KYMB 3V4PL 2AV1B 3QPQC 1JZ2A 1CI5A 3MO1B 3PP3K 4OLEA 1W2KT 3TGXA 5I1HL 1H3GA 1BX2B 2I24N 4OV5B 1GGUA 4YEFA 3GJFB 4MX7A 2YBRB 4WTWA 1U92A 1NGZA 3D2UA 4HCRL 2VKWA 3U9UB 4ZUVB 5E8NB 4LGSB 2I26N 3D0VB 5J1TC 3RGVB 3RGVC 2FBOJ 4PRNA 1JGUH 3VFMB 5IBLD 3HC4H 3MUHL 1RFDL 4M1GL 5I8KH 2VZ1A 4L4TA 3GSXB 4PJIA 4PRBA 1MEXL 1XH3A 1N5YH 5BO1H 3A0OA 3PDDA 3IDGB 4MWFB 4TRPL 1N4XL 3L3KB 1OLZA 4R96A 5LGJB 4NQCE 2R1WB 4YHKH 2GKIA 1JZ5A 3S36X 5F1SA 5IIEB 1KENH 3WHXB 3M17B 4GRMB 3WS3B 4ZQKA 4GAJL 3G04A 3VFSB 2PO6D 1CE1H 5T33L 4NGHL 2HJFA 1ZLWK 4NNXA 5JXEA 1QR4A 1IC5H 2IADA 3P4LA 2D4DA 4HV8A 5DEGA 1YECL 2X1QA 1PEZA 4X5LA 4R4ND 2R1XA 5CEYA 4DQOH 2XG5A 3MYJA 4Z0BL 1VPOL 5FHAH 4GXUM 4B0MM 4OIIH 1HKLH 4HIXL 2ZOLA 3DSFH 3O3AB 4Y4FA 2R29L 4FQ2L 4ZAKA 1PZ5B 1WT5A 1H0DB 4MX7B 3QCTH 4QRRD 1NGZB 4Z95L 4JN1H 4M7KL 3H8NA 3QT2A 2VR9A 2D7QA 4MJIE 2X4UA 2DWDB 3QUXA 1P5UA 1UWEH 4PRNB 5LCVL 3ORJA 1VGKA 3GRWL 4L4TB 4PJIB 4PRBB 1XH3B 2NW2B 3Q6FA 3EDEA 3C5JA 3OAZK 4U7MA 5HHVL 4R96B 4YXHL 4JRXD 2P5WE 1TJGL 4HJ0C 1A02N 4DVRH 2VDKH 2OJEA 4OFKA 3MRGB 4WCYL 3KYKH 4XP5L 3G04B 5IJKC 4HWBL 5D7IF 5SX5K 5KS9B 3UYRH 4HXAH 4N0UB 1HHJA 1F2QA 5JXEC 3MUGA 2IADB 2Z8RA 2ATKB 1GC1L 1QG3A 5DEGB 3DGGA 5HDQH 1PY4A 5HHOD 1MIMH 2R1XB 4X8XA 3MYJB 4F9PA 3TFKD 1XF3B 3BIBX 4UNTA 3QB7C 3FOMB 3HI5H 4AIXA 2MOVA 3K3QA 4Y4FB 4Y4FC 1P84J 1WT5C 3V0AC 4XPAL 2DQGL 1HINH 1I1FB 2AXHA 4LSVH 3FO2B 4V1DA 2XPGA 2X4UB 3QUXB 2PO6A 4OAWB 4D9QD 3H7LA 4GBXD 5HJ3A 5AZEL 1EEUA 3VI4E 5D7LA 5HYEA 5DUBA 3LAFA 3QEQA 2J8UA 3Q6FB 4UIKH 5C3TA 3RNQB 5C0CA 5DYOA 4KY1L 3ARGD 1R0AH 4FXLA 4IIQA 1CDYA 4ODUB 2ZUWA 2OJEB 5IESL 1Q72L 2MCG1 4JHWH 2FZ3B 5DJDA 3RVWD 2ENSA 1HHJB 3MUGB 3DNKA 5D6DA 1GZQA 1I8LA 1S7QA 4G7YL 4LIQL 4PGJA 5CMAA 2QR0B 5IW1A 2DYPD 5T3XL 4G7VH 5DMKB 1LO3L 4PRIB 5D1XD 3WIIL 5DEFA 3V6OA 4EEEA 2OYPA 4OKDA 1A5FL 3Q6GH 2NY4B 2NY4C 3NGBB 1NCDL 3NGBC 5SWQB 1DQJB 5E6ID 2VXQL 1L7TL 2MMXA 1R3IH 1JRHI 3TM6A 3IFOB 1IZJA 3GUTB 4O4YL 3QH3A 3MODH 4MMZC 3U0TB 4ONOA 1IARB 5IOPA 5ID0A 4K3HA 2VISA 5KW9H 3ARFC 2HTKC 2EEAA 2FD6L 5C0BE 1IQDA 3QEQB 2EYSB 2GSIA 2AI0L 2J8UB 2EXWD 4MA3A 3HS0A 3VE0A 2AKRA 5D1ZD 4UDUB 4IIQB 1HHKA 4IIQC 4UV7H 3TP4A 3GBMH 1FV1A 2Y36L 1E28A 2CDGA 3CX5J 5EU7C 2GHWB 1DBAH 4GKSB 4JFHE 5DJDB 2O5XL 4M43L 4ZDHA 4BUGA 2DOCA 4XBPA 1GZQB 2CDEB 5FUZH 1S7QB 1OD7A 2D9CA 4LCWE 1II4E 1HH9A 5CMAB 2R4SL 2HRPL 4PJEB 2ATPB 1MFDL 5DEFB 2EIEA 3STLA 3O8XD 4PGDA 3O4LD 3TZVA 5GRWA 1D9KB 1D9KC 4WTZA 3RJDA 2I9LA 1WTGT 1KN4H 4XP1L 2CXGA 1B0GA 4HAFA 4JDZA 3UCRA 5IOPB 4S1QL 5ID0B 2G5BB 2VISB 3TIDA 1MREL 4OCYL 5CJQL 1MQKH 2QLVB 5IHZA 1YPZA 5EO0A 2GSIB 2YPKA 2DBLL 4MA3B 3HS0B 3C6LC 3MBXH 5GIRA 3VE0B 3W11C 4ZXBB 4ZXBC 2AKRB 3FT2A 4GJTB 5D7JA 4PJ7E 3VDBA 4MHHI 5BMFL 3G5VA 1FCGA 1WBXA 1FV1B 4KHTL 1E6OH 4Y5XC 5JHLL 1E28B 1A7QH 2CDGB 4ONHA 4P3DA 3U36A 1CDUA 3O3BA 2FL5B 1TPXB 1TPXC 3UTPE 3AU1A 4P2OA 5GJTH 1QACA 4MYWB 3DI2B 3DX7B 4ZDHB 4JDTH 4WI5A 1MJUH 4PREA 5I30H 3F7PC 3BKMH 3O0RL 4R4BA 4MMXC 5F9AC 2OCFD 4JM2A 2AJXL 4XZUA 1HH9B 5J11B 5J11C 3FHQA 1HE7A 3V2AR 4PJ5D 4P4KA 1J1PL 4XGZB 3P4NA 4AT6B 3G5ZB 3KR3L 5GS3A 1KB5L 4OLWH 4V2CB 4LCIH 1CLYL 3DECA 4AEHH 1ZA6A 3BUTA 3PP4L 1G9MH 2G9HA 4PGDB 4Y2OA 3TZVB 4JG1H 5D71H 2I9LB 3K1KC 3SDCC 2DKUA 3PXJA 5HDBE 1C1EL 3MROA 1B0GB 1RJYA 4JDZB 2R56L 4KI5D 3TIDB 3WD5L 1JHKH 3G6JF 4RMVA 2OM5A 1RUQL 1RULL 3VRIA 5IHZB 1QKZH 4X6EA 4YUEL 4G6JL 1UG9A 3ILPA 3HE7D 3QNZA 3FT2B 3MRCB 5D7JB 3FN0H 1QHPA 3S4SA 1BZQK 2ZPKL 1WBXB 1YEGH 3EYSL 1RJZB 4U1JA 1MCRA 1T20B 1VENA 1OWRM 4P3DB 3U36B 1F90L 1U93A 4LSDA 3P73A 4GT7A 5DFVD 1KLGA 4P2OC 4P2OB 5SWZE 2W9EH 2R23A 4RAHA 4HC1L 3TYGL 4IMLA 5GGVL 2PYFA 4R4BB 4G5ZH 3SOBH 1ADQH 2WW8A 3WYRA 3QFJD 4NM8H 2CR3A 3QDAA 4OCXL 4LSPL 2LU7A 2YPVL 5GS1A 5GJSL 3T4YA 1JV5A 4L4VA 1C8PA 1KB9K 5DUPH 5A2FA 4PJCF 4IDJH 2G9HB 2AQ1A 1TETL 3BZEA 4LCCB 2ZP0T 2Y23A 4GXVL 4LCCC 2LVCA 5E9DD 3SN6N 3BMWA 2VDLH 3BHBB 2D4FA 3DO7B 1HYRC 1MCFA 1RJYB 1EO7A 3MV8A 2PYEA 1YEHL 2MPAL 2Q76A 4I3GA 4HFUL 4KMTL 4XCCL 1DEDA 2IQAA 4OM0H 2Y6SC 3PWLA 1I3GL 2L7JA 1RMFL 1XIWB 1XIWC 4JFDB 4BSWA 4RGNB 4RGNC 4LLDB 3IVKB 4M62H 5IFAH 5DHXB 5CZXD 3S4SB 3B5TA 3RX8A 3BP6A 3GIZL 4P2YA 1FDLH 1QRKA 2Z9TA 2ZCHH 4QWWC 4BZ1L 2X41A 4U1JB 4YZFE 2MNUA 4HKBA 4JY5H 4MDJB 3I2CL 3P73B 5I2IA 4JFYA 4BQBA 1KLGB 4PR5A 1IEHA 3TVMB 1OF2A 2OMNA 3TVMC 3LH2L 2R23B 2FJHA 1T04B 4IMLB 4XNZC 4HEME 3CFCL 4ZSOB 1CLZL 1T7ZA 4H8WL 4OCRH 1E4KC 4L8CB 1WBZA 2O61B 3EIFA 2CMRL 4OCNC 4P49A 2CIIA 1C5BL 4UOW0 1ORQB 2M8XA 4TNVK 4MXQC 5KANG 1CFNA 1SYVA 3BKYL 4WENB 5HVGB 3BZEB 2CRZA 1HHHA 4HXBH 2WMPA 4KV5F 3C8HA 2OX5A 3QA3B 3O6KL 2QSTA 3EYUH 3FT4B 4LVNB 4LVNC 5HD8D 1MJ8L 2X9XA 3WDHA 1A21A 3C5ZD 3CFBA 3FOLB 3MGTA 4IS6A 3DMMD 3D3VA 2VH5L 4E42A 4ZODA 3LB6C 4BSWB 2QQNH 5C07E 2EKSB 4X98A 5T3ZH 2FIRT 1T1ZA 3BP6B 4OD2A 2MKWA 3T1WA 1HXYA 5HTSA 4OLVH 4NHCL 4AH2B 4HKXA 4ZS7L 4B50A 4ZG1A 5LG1A 4JFYB 4PR5B 4LHUA 2H8PB 2FJHB 3WFHA 5IB2A 3ULUL 1M7IA 3INUH 4G9DA 3GBNL 2JIXA 4MCYB 1WBZB 1FNGA 3QBTB 1X4YA 4JRYE 4PRHE 4LKXB 3E8UL 5E94A 1Z6JT 5EZIL 4KZDH 4Z7UB 3L5XL 3HUJA 3FB8B 1JRHL 3WCYA 4F2MA 1SYVB 4OZHE 1JWUB 3QIUC 3SKOA 4UBDD 1OARH 4RWYL 1HHHB 1R5VA 1G7IA 1XF4A 5C71A 4P9HH 3AAZA 1GGIL 3DSNA 4Z7QE 2VERN 1PG7H 3V4VL 3EW3B 2R0WL 5IUSA 4Q6IA 3JWOH 3ZLQC 5DJCA 2VAAA 3D3VB 2GAZB 4WUKL 1IKFH 3QEGL 2R2EA 4P57B 1CQYA 4Z6AT 4D8PA 4WFGE 4EQ3A 3UC0H 3DROA 4Z7VE 43CAB 2P4AB 4OFPA 2ARJA 1RURH 4X98B 1T1ZB 4FFYL 4ZO6A 3T08A 3F7QA 4L3CA 1YEFH 2WV3A 3E6HA 2AJUH 5EH1A 2H1PL 1DQLL 1N59A 3QDGD 4LGRB 2ZZUT 4LHUB 3QHZL 4RBPK 1H3XA 4UDTA 2X4PA 4M3KB 4MS8C 1G7LA 3WFEL 4CVUA 5IB2B 1M7IB 2JIXB 2DQTH 2ZUVA 5D70L 1MCEA 3SKJL 5IB4B 3TN0D 1WITA 4FNLL 4JFEE 4TVSa 5CUSH 3DMMA 5JIPA 1A1OA 5KS9F 5DMIL 5E94B 1I9JL 4K7PX 5IW6A 1JZ6A 1ULVA 1AE6L 3G5YB 4F2MB 1EHLL 2GJJA 1N6QL 4NFDA 3SKOB 4RWHA 5C7XH 1R5VB 1G7IB 2RQ8A 1MY5A 2X9WA 2JJUA 4JN2A 1EEYA 4FQIL 1WGOA 5I15H 4POZC 1FH5H 4HZAA 3DUUB 2PR4L 5ITFB 5DJCB 1D5ZA 2VAAB 1BIIB 2FCBA 2R2EB 3BZ4A 1N2RA 4D8PB 3V4PH 5T1KA 3DROB 4LEOA 4XWOC 5GISL 1A7PL 2GI7A 5D7IA 3E2HB 3E2HC 1JYXA 1K5NA 5I1HH 5I18L 1DZBA 4KKLD 1N7ML 1S9XA 5C09D 4U6XA 4L3CB 3E6HB 5T5FL 4B41A 1OCWL 1G7QA 1QEWA 5A16A 4UUJA 5B39B 1WZ1L 4HCRH 5GZOD 4UDTB 2X4PB 4NP4L 4LSTL 3WJJA 1QRNE 5DURD 5CGTA 4Z18A 4M1GH 1RFDH 1B6UA 5BV7L 4PJ8A 3RWFA 5SWSD 4J12A 4JFFB 1MEXH 5IW6B 1KSRA 3MTRA 4TRPH 1N4XH 2GJ6E 1RSFA 4CGTA 2NYYD 2B2XL 2KPNA 3BI9X 2ZG1A 1EPFA 4HHAB 5IW3A 4UTBL 4JN2B 4XVUC 1EEYB 4GAJH 2EDNA 3BEWB 4NGHH 3RHWF 1D5ZB 3IS1X 4YXLL 3VFRB 4ODXB 3BXNA 3BZ4B 2V9QA 1N2RB 4ZFGL 4XX1G 4J4PC 5T1KB 1I7ZA 1I85A 1YECH 1ZHLA 4X4MA 4Z0BH 1K5NB 5HGDB 5D93B 1VPOH 5D93C 1OB1B 4D0BA 1A7OL 1S9XB 4Y5YA 2R8SL 4HIXH 1T89C 2R29H 3OKEB 4FQ2H 3OG4B 3HZMA 1U3YA 1G7QB 3PWUB 1QEWB 4JHAL 2IAMB 2IAMC 4UUJB 3T1FB 1CFTA 1TZIA 3WJJC 3WDIA 5LKNA 1YEKL 4G9FD 4WU7A 5C08B 1S3KL 3EO1A 1C08A 2BCKB 2ESVA 5LCVH 5K9QG 4NHUA 1EHXA 3OX8A 3NAAH 1QD0A 4BZYA 4PJ8B 4PJ8C 3GRWH 5ACMA 1BD2E 5GHWL 1TZGL 4QGTA 1OOAA 3BN9D 3PQYD 1MPAL 5HHVH 4YXHH 3IXAA 3W39A 1KEMH 1TJGH 4PRPE 1ZK9A 1NJ9A 4PJEF 1X5GA 5K93A 1YNKL 4HKJA 2VLJA 5ELIA 4WCYH 4KGJA 4IHOB 4XP5H 1U8MB 4ZO8A 1X6NA 1PVHA 3SKNA 4HWBH 4ZFZB 1EAJA 5E70A 4WTZG 1ZGLP 1I9IL 1VKXB 2P5EE 4C83A 4PGEB 4HW6A 1WBYA 4MVBD 3BXNB 1Z5LB 4QRQA 1GC1H 1I7ZB 1QSFD 5C0AE 1I85C 5D7KE 5CAYB 4NN5B 4NN5C 3U4BL 5JOEA 3SHSA 2HWZH 4JO2L 3NPSB 3NPSC 1Z9MA 2Z31A 3ZT6A 4D0BB 4NWUL 4GRWE 4O02H 2XOTA 5EBGA 4OCWL 4Y5YB 2P44B 4PGBA 4Y5YC 1ZT4A 4XPAH 3ZMRA 4Q2ZB 2DQGH 1VFUA 2WBJA 3NIGE 3QXWA 4WU7B 3EO1B 2ESVB 4NHUB 3RBSA 5I17A 1WZKA 5AZEH 1DFBL 1N8ZA 2BNRD 3GSNA 1EEQA 4PJHB 3VFVA 2MCPL 3MNZB 4KVNL 3X3GL 1JNHA 1NC4B 2HFGL 1QZ1A 4KJQC 3IXAB 1XF1A 4KY1H 3W39B 3MV7B 4GOSA 1IGFL 4J3UA 3TJHD 4EDXA 4K07A 4HKJB 4YC2C 4NQEA 2VLJB 5J6GA 4MNGE 5IESH 4JKKA 1Q72H 3H42H 3RWCA 1J0YA 4PY7A 5TE7H 2VRAA 3SKNB 4PBXA 4C56D 3CZFB 2CKNA 1BOGB 2DKSA 5DQJB 1FNLA 3FFDA 1WBYB 1LMKA 3MV9A 3EKCA 1S9YB 2LTQB 2LTQC 4G7YH 4LIQH 4RA3A 5A3IC 3WLWC 1KACB 4P46C 1CGUA 5T3XH 1LO3H 4WWKA 4YHZL 2Z31B 2Z31C 4WGVB 3WIIH 3BFOA 4ZYKB 5FXCH 1LD9A 5BS0B 2VXQH 1L7TH 1U95A 1ZT4B 3HC0A 1R3LA 3GSVA 3S4SG 1EHNA 1JN6B 2IF7A 2IG2L 1U0QA 3S97C 4O4YH 2CK0L 3KHOA 4FQQA 4P3CL 5CLTA 2DD8L 5TJWK 5JORB 4J6RL 1I7TB 5FYJL 5I17B 1YJDL 4CADA 2P49B 5T3ZE 1N8ZB 2ZNWA 2Y9RT 3GSNB 1PW3A 3VFVB 1J5OL 2AI0H 4KRPD 1JNHB 2WLYA 3QFDA 3SGDI 3S8WA 3DVGA 4OF8A 3EYFA 5SX4H 2NY6C 5J6GB 1GZPA 2R2BA 1CZ8L 1H8SA 4BH8B 3K2MC 3RWCB 4PY7B 3QPQD 3L3HB 4ZNCD 2O5XH 1T1YA 1MCNA 2AABH 5E2UL 1HHIB 5LAXB 3D9AH 1QOKA 3HLAA 1KJMA 5ANMA 1L9MA 3NFNA 2R4SH 1T0NB 1T6WA 1OP3K 1F3DJ 3OKOA 5BZDB 3BH8B 3GMRB 4PBVC 1T1XA 4AEIH 2HVJA 1IAII 5KTEL 4QOKE 3UZEA 3HCVA 1KJ2L 1U95B 1R3LB 3GSVB 2H32A 3QRGL 3RGVD 3ZHKA 1ZLUK 4HUVB 4M6AA 4FQQB 1X5IA 4KKBC 2CDFA 4F7CA 3I6LE 3VXRA 1OQOA 3W0WB 1DBML 4CADB 2NY7L 4LF3A 5CJQH 5T1LA 3HZYA 1JPSL 4PD4J 1G6RL 4NCC1 3SGEH 3EOAA 2DBLH 3VA6A 5GGUA 1HHGA 3KPLA 3I6GB 1FL6A 4G8GD 1I8KA 3JVGA 1HOCB 1I1CA 3DVGB 4JZNA 5BMFH 1CGYA 5B21A 2VLKA 4U3XA 3EYFB 4KHTH 2HT4C 1M7DB 1GZPB 4QHLA 5JHLH 4HH9A 4HUUA 5DHVA 5ESVA 4K3JL 2OMBA 5CEZD 5HGAB 2ZCKL 3O0RH 4X6CA 3RWJA 1KJMB 2AJXH 4ORGA 4WEBH 4GXUN 1MI5A 4HGKC 1IBGL 1ZWIA 1J1PH 3C2AL 2OJZL 3OSKA 4Z7OE 3PDGA 1F02I 3KR3H 1KB5H 4A2LA 4PG9B 2HVJB 2IPUK 3VU2A 1CLYH 2WBWB 3CVHL 4HIEA 4OLXL 3H0TA 3HCVB 3FL7A 2H32B 5FOBB 4XPHL 5JMOC 4MNHB 1HQRA 4XRCB 3QDMD 1C1EH 1AR2A 1CE6A 4FTVE 3ZE0E 2R56H 2Q8BL 25C8H 4XH2A 3ZKMC 3VXRB 4JPIA 3WD5H 2NR6D 5DC9B 3UTZA 5T1LB 1RULH 1RUQH 3OQ3B 5GGUB 4G6JH 1UJTA 4JEGB 3ZDZF 3OJDA 4ZO7A 3GMQA 2V7NA 4CU7A 4LPYA 5F6IB 5F6IC 3BW9A 5I1KL 3JVGC 2JJTA 2WBKA 1LEGB 3LN5A 3NZ8B 3RP1A 3UTTE 3EYSH 3IGAB 4QHLB 4HH9B 4JREB 4Z7UF 4MB5A 1F90H 5D2LB 3NZHH 5DHVB 3K4AA 5ESVB 4HLZH 4KRMB 2YK1H 3SDDB 3SDDC 1CDHA 1ORSB 3M1BB 4ZPTA 3F7YA 3RWGB 1L6XA 1GXEA 4HC1H 3TYGH 5GGVH 3UMTA 4X6CB 3AUVA 2YN5A 1WFOA 2F19L 3WUZA 4ORGB 1UH4A 2XQBL 1MI5B 4LSPH 2YPVH 1EDQA 4FQXA 3HG1E 2APTA 5GJSH 4Q7DA 4Y5VA 4LFHD 2QJDA 5CGYD 3D39A 1KG0A 3IFLL 2E7BA 4HIEB 4G80B 5CP3A 3H0TB 4PJFF 1TETH 3IDMA 5E4EB 5E4EC 4U6TA 2FNBA 4XI5C 2HG5A 3MRDA 1CE6B 3OGCA 1AC0A 5MEQB 2JE8A 2X7LA 4XH2B 2Q87A 2MPAH 1VFAA 1XGQA 3CCHA 4HFUH 4JPIB 4OF3A 4KMTH 3NN8A 3GGWA 3QIWD 4XCCH 3RVTC 3UTZB 4E5XA 4F7EA 3BRDA 1BVKB 3EHBC 3QJFB 5C6TL 4XBGB 2VDOL 1NMCB 1NMCC 1RMFH 1Z9LA 4JZOA 3MZGB 3OJDB 3GMQB 2V7NB 4FQLL 3BW9B 2JJTC 2NXYB 1VESA 3LN5B 4WI2A 2FLBT 3GIZH 5F9JA 3M07A 5C0DB 4R4FH 5KVEL 1NC2B 3MLPA 1ZS8A 4JPKL 3Q5OA 1Q0YH 2APFA 3IKCA 5DR5L 5E8OB 3I2CH 4BH7A 1A6UL 1BREA 3RVUD 1I1YB 3F7YB 3LH2H 1ZA3B 5K33A 5C0RL 4PRID 3CFCH 3D85A 1CLZH 5KANI 4H8WH 2YWZA 4HG4K 2NY4D 2CMRH 4FQXB 4FQXC 1NGYA 4Y5VB 1C5BH 4TVPD 4LPUA 3D39B 1RUKL 1HI6B 1RUML 2EC9T 1XMWA 2QV2A 4LLQB 2AXJA 5TF1L 3BKYH 1OHQA 3JV5A 3V6BR 4L3AA 1JPGA 3O9WB 3O9WC 3ARFD 3MRDB 2NY2B 2NY2C 2YUZA 3D0LB 4J3WA 3O6KH 3TPUA 1ITBB 2X7LB 1L0YA 4ZOBA 3AS1A 1VFAB 1XGQB 4JJ5B 3CCHB 5C0NC 1MJ8H 3LCYA 4U1IA 1BM3L 3GGWB 1FYTA 4JKMA 4E5XB 3GK8L 4F7EB 3KLDA 1A2YB 1NAML 2VH5H 4DGVH 3Q3GA 5HYJE 2PUQT 1U36A 4GRLA 4N5UA 2Z92A 1XCTA 3LEYL 1GCFA 4XVJH 1CDJA 3HE6D 5L6YL 1J18A 3GI9L 2PF6A 3JXAA 3O6LL 4JCMA 5F9JB 1HQ4A 2J5LB 1ZKAA 2J5LC 3ALWA 1ZS8B 4NHCH 2AK4A 4KKCC 4ZS7H 4S10A 4TULL 4HPOL 1ZVSA 4M48L 1IAKA 3P9WB 4PLOB 2GSGA 4JY4B 4GS7B 4GS7C 3C8KA 2DN7A 1U9KA 4JPWL 1U3ZA 3ULUH 3I9GL 3E6FA 3WNLA 3WIHL 3HAEB 3D85B 4QF1A 3QIWA 3C6SB 3BUYA 3RU8L 3QO1B 3FQTA 2ITCB 2BSRB 3E8UH 3GB7A 4R7NB 3GSUA 1R5IA 5EZIH 1D9KD 1YMHA 3L5XH 4R3SB 4P4RA 1RK0B 5TDNA 1N6UA 2OL3L 3B6SA 3RWHB 4MB4A 4RWYH 2OR8A 4IRSA 4UIMA 3RKDC 4LIQE 4F80A 3WLBB 4H0GA 3C6LD 5T3XE 2R0WH 4MNQD 2ZWLT 1JK8B 4U1IB 4ZXBD 5I1LA 1FYTB 1FE8L 5HYSB 4YHIA 4WUKH 2Y72A 4FQ1L 3K74B 3Q3GB 4PTUA 4GRLB 4GRLC 4L1DA 2Z92B 1T6VN 1XCTB 5DWUL 3GJEA 2G2RA 1H3TA 1AI1L 1L0QA 2JB6A 3CJJA 3ETBF 4W68A 5I8OL 1AD9A 4FFYH 1HQ4B 1UQSA 1A0QH 2CLRA 5EBWB 2UZXB 5FA4A 3VRLF 3WFBL 2XT1B 2XN9E 3OAYH 3CLFL 1CDIA 3PGFL 2AK4B 2H1PH 1DQLH 5L2KE 4QHKJ 1IAKB 3MOBH 2CRIA 3QHZH 3V6FA 3C8KB 3WFEH 5KAQG 2W59A 3E6FB 3T0AA 4QF1B 5DO2C 5D70H 3VG9C 3MA9L 5HYFA 3FQTB 2EDFA 3GB7B 5DMIH 1I9JH 1IC7L 1NKRA 1R5IB 3T0EA 1CN4A 3SDCD 2BRRL 4D9LL 5EZLB 2X70A 4P4RB 5TDNB 3B6SB 3MV11 4U1HA 5F3BB 1N6QH 3KLAA 2F8VA 3V5KA 4P9HC 1H5BA 3EYOA 1W72L 4IRSB 4IRSC 5AG9A 1KCLA 1S7VA 4Z7WE 3CSPA 3QZWA 3WV0A 1EVTC 4DOHE 3K8LA 3PWVA 3U82B 2PR4H 2GJZA 2DQIH 4LRIC 4QHMA 3X13A 4NQSA 3MC0A 2WZPD 5IG7A 3IFPA 3P4MA 5GISH 4HS6A 1A7PH 4KAQL 1T7XA 2G2RB 2VDRL 2JB6B 3U4AA 1FRGL 2JTDA 5I18H 4PJDE 1ZXQA 3S35X 1N7MH 3C60D 4PJHF 1JIBA 1VFOA 4NWTH 5T5FH 35C8L 1IAMA 3QXVA 5TGBA 1OCWH 4NN6B 4NN6C 1CG9A 4PJXE 5L8KB 2C1PA 4MD5B 1WZ1H 1NANH 4M6ML 3MA7B 3V6FB 4LSTH 5LXGL 3KPRE 5C1MB 5DI8B 4HFWB 1L7IH 5IEHB 1IFHL 3LRSB 4UNVA 3KG5A 3P9LA 3QUYC 2VLRD 3KPSA 1N5AA 5DD0L 4NBZB 1BQLL 4X99A 4OGAC 2X70B 4NZUL 3LKQA 1R3HB 5JQHC 1I75A 3KLAB 3D69B 1B90A 1T83A 5IQ7L 1H5BB 1H5BC 5D5MA 4YXKH 3T0XA 1AQKL 4UTBH 4OZIA 4YPJA 2Y6SD 2DJSA 5F7YC 1XR9B 2J3SA 4TUKL 1XIWD 3PWVB 4JFDD 4RGND 5EZJA 3LKNA 4YXLH 4QHMB 4NQSB 2BVEA 5J56B 4G6FB 4ZFGH 4FFZH 4DKEL 2A6KB 3IFPB 4FQHB 5E8EB 2P5WD 3GHEL 3UPRA 2DL2A 4TUOA 4RMUA 1FZKB 3TVMD 2R8SH 1MUJA 4TOYL 1LO0L 3PJSA 5TGBB 1BIHA 3VI3E 4JHAH 1UM4L 4GG8A 3VFUA 2PCPA 1S9VB 4EN3C 1YEKH 1FFRA 3C8DA 4KDWA 1QP1A 1WCBA 3EGSB 4JANA 1XR8A 2FGWL 4MXQD 3P9LB 2AJVH 4WW2A 5GHWH 1TZGH 3VWJA 1TVHA 2JJWA 3TWCL 5EIIA 4EXPX 3DHMA 1F3DH 3B9KB 3B9KC 3SJVE 2NLJA 4BSJA 4K7PY 4KZEL 1MPAH 2EE3A 3VXSE 3WN5A 4NQCA 2KL6A 1T83C 3FO1A 1YNKH 3C60A 4EDWL 2GY7B 1JYWA 4O51B 3N0PB 4OZIB 4GAGL 5L8LB 3NIFE 5E8PA 3LB6D 2C3WA 2DBJA 3L3IA 3BWUC 1JGEA 1JNLL 1Y18A 3NACL 4LPXA 1CK0H 1A3LL 3PGCB 3NIDF 4FXKA 3RWDA 4URTB 3U4BH 2A77H 3T3PF 3ZE2E 2F58L 1OVZA 3UPRB 5D96B 5D96C 4TUOB 4FHBD 4DKFL 4X4YA 4XPBL 4Q9RL 1QSVA 3KXFD 1Q1JH 3PJSB 1HSAB 3AREA 2OTWB 3E3QE 5K59E 2ZJSL 1RI8A 1D5XA 2F54A 4MJIA 5F7NC 4Y1AB 1K8DA 2B0SL 1WCBB 3T65A 1YUHA 5DJZA 1DFBH 4JQIL 2EIBA 1OD9A 3QIUD 1M71A 3VWJB 1TVHB 3VWJC 2MCPH 4KVNH 1PGRB 1GVIA 2NLJB 2G5RA 3U2SA 2VUYA 2P5WA 1U8NB 2I5YL 4N8VA 1IGFH 4P5MB 2ZNXA 4IOSD 4N0FA 2EECA 4PJ9C 4PJ9B 4YFDB 5DSCA 2ICWA 5E8PB 2KZWA 3L3IB 3OKKA 4PV8A 1JGEB 4MXVE 1Y18B 4AIOA 1PKQE 4P5KA 3U48A 1AC6A 3BKJL 3QHTC 1RZIA 4FXKB 3RWDB 1PX3A 5MEND 4NKDA 2W38A 4Q0XL 3EOBA 3FRPA 4ODWA 4YHZH 3RVVC 2CLVA 1JF1A 4X4YB 3G5XA 4X9FA 4RGMB 4RGMC 4U1SA 4MS8D 3ZKNC 3PHSA 3GSWA 3AREB 3AREC 5B4MC 1X7QB 2DS4A 1CL7L 2IG2H 1F45A 1ZHKA 3RUGB 4BSVA 3P40A 3WEXA 4HIJB 2F54B 4P3CH 2D03L 2DD8H 3R06A 3T65B 3KLHD 4XXDB 5D2LF 4J6RH 5FYJH 1YJDH 4X9IA 3WDJA 4AMKH 4OZGB 1M71B 3NCCB 3B83A 4CKVX 3QUZA 1W0VB 1J5OH 4IRZL 1A4JB 3U2SB 1FLTX 4N8VB 1FNAA 5C92A 4MB3A 3UJTL 5F7FA 1MFBL 3QIBA 4K71B 4K71C 1P7KA 3VXOB 1CZ8H 4NPYA 4CJ1A 3Q5TA 2EXYC 1SJVA 2ICWB 5D72L 4KMQA 1TLKA 2H6PB 5E2UH 4P5KB 1BGXL 1CFQB 4APQA 5BOZG 1B4JL 4QRPD 4NKDB 3TH3T 3RPKA 5FCSH 3QEUA 4ODWB 3ZYIA 3FCTA 3G5XB 5KSBB 3SE9L 5KTEH 4ODTL 1KJ2H 5JIIA 3QRGH 4BSVB 1ZHKB 3RAJL 1NAKL 2XXCB 3UTPD 4PYHA 3WEXB 3ARYA 5TQ2L 4JFFD 3R06B 4OSUL 1VFBA 1CXHA 1DBMH 2X05A 4JRXE 5HHNA 2NY7H 5C0BA 1AHWA 2IBGA 3QUZB 1JPSH 1G6RH 1QA9A 3SCMA 3FAWA 2X42A 5BVJA 3A6BL 2QSQA 2DI8A 1U2HA 1PG7W 3BGFB 3BGFC 1DUYA 4LCYA 3UBXB 4M02A 1P7KB 2E7LA 3EUUA 2DQCL 4KMLB 5EO1B 3X11A 1OM3L 4K3JH 4J4PD 5SV3A 5CIPH 3U1SH 1FNEA 1FO0A 5HHOE 1X5KA 3MMEB 4WJ5A 3L9RA 4LCWA 3SE3A 5FHBH 2OZ4L 1QFWL 3LVEA 2HTLD 1IBGH 4QRUA 4RA0C 4WHTA 2W0KA 4FABL 1DBKL 3CFDA 3TBWA 2IAMD 3LHPL 1ZAGA 3CVHH 5JNYB 1U3HD 4KXZH 2ZSVA 1SHMA 5C08D 5H8DA 2JKXA 3DETC 4XPHH 1G6VK 3NPZB 5EC1A 2B8OT 4DCQA 5JLZA 3ECBB 2Q8BH 3BIKB 1BZ9A 1J0KA 3ZKQD 4HUNB 2CUMA 5FK9A 5HHNB 5C0BB 4F8QA 4LVOB 4J1UA 2DLTA 4I2XA 1QA9B 3SCMB 3SCMC 2FO1A 4K3EL 2B39A 3O4OB 3O4OC 3HRPA 4LSSL 3MXVL 3TH2T 4H5SA 5I1KH 4PJ7A 4HUWA 1FZOA 4LCYB