5GS2D

Crystal structure of diabody complex with repebody and mbp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
226
Chain Sequence
VQLKESGPELVKPGASVKMSCKASGYTFTSYVIHWVKQRPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMDLSSLTSEDSAVYYCARYGVRGDYYAVDYWGQGTSVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Sugar binding protein/immune system
molecule keywords Maltose-binding periplasmic protein
total genus 41
structure length 226
sequence length 231
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D02
4NWUL 5I1CL 3LPWA 3QUKA 5I30L 2BHYA 3C5ZB 2OR8A 3JVGA 4P2RB 1QFUL 3RNKA 1P2CA 4ELMF 4DKFH 3RJDA 4JFYA 5I8OH 3FN9A 2ZSWB 3DTXB 5DTFA 3GBML 4NRXA 1OAZL 1T6WA 3REVA 1BLNA 1FE8H 5FUOL 1OTTD 3V4VH 4RMVA 4MQTB 1BF2A 2EO9A 2V7NA 4HWNA 3WMSA 5T33L 1CLCA 4X9FA 4RFOH 5AUMB 4Y4FC 3PGDB 4X6DA 1DQJB 3TVMC 1UM5L 2XWTB 3P4LA 5C08D 5CEZH 1JHKH 4M7KL 3OJDB 2NXZD 4P2OB 4JLRB 2GY7B 2ENSA 3BVNB 3QDJA 4PJXB 3ZTNL 5T3ZD 5JW4R 4TSCL 1PY4A 1MCEA 4CKVX 1YEKH 3ES6A 4GRWE 4XCEB 2F74B 5ICZB 1H5BB 4PJHB 4ISVB 4NRZB 4I9WD 3TA3A 1OB1B 3BIAX 1FRGH 3BAEH 2XG4A 1RZ7H 4LOUC 7FABL 3VI3F 4HH8A 4GBXB 4FQXD 4U6XA 4PJAE 2WIIB 5LCVH 3CLFL 1E4JA 1RUAL 3WJLA 1WZMA 3G5YB 2PTTB 1C16B 4QHMA 3DX9A 5TGBB 1MCJA 1ZVYA 43CAA 1GVIA 4HIHA 4IRJB 4LAQH 3D69A 1FPTH 4G8GE 3FQRB 3MUHL 2P7TB 4PJXA 2NNAB 1BGXL 4UINL 5IB2B 1X4ZA 5EFIA 3MLVH 2DI9A 1OM3H 1RK1A 3VXTA 4FFYL 3HI1A 4ZFFA 2M2DA 5ESAB 4YAQB 5I1IH 3HZKA 3MREA 3MXVH 4K07A 3G9VA 3MRMA 3WUWB 1IC5L 1F5WA 1IC4L 4P23C 4OLXL 1XAUA 4M5ZL 1A21A 3QCTH 1AGBA 1EX0A 1YPZA 3VXRB 3MLPA 5IUSA 3DARA 3B8SA 1WC7B 3RU8H 3MV8A 3VXSD 3HMXH 3KAAA 2XTJE 1DLHB 4OUUA 4DVRH 2DWEA 4LCUB 1E4XL 3WHE0 1R3JB 2VZ3A 4DZ8B 3IYLW 3ARTA 2QQLL 5C8JB 1JUFB 4JKPL 2EYTA 2XFXB 4TULL 2X4SB 2MHAB 5BXFB 4PS4L 3MCKA 2XA8H 1OGTB 3LPGA 3BKMH 4XNXH 5B4MC 5I71C 2GYSA 2NY2D 3T8XA 1B2WH 5L2KD 1KUMA 1T4KA 5K33A 3BD4A 1QA9A 4KI5F 3HS0A 3HCVB 4MXWL 1EGJA 2PCPB 4DFIA 3QUYA 3I9GH 2WQ8A 3MTRA 4BSVA 5F7WC 1OF2B 5FF6B 5F7DB 5IWLC 3OZ9H 5DQ9A 2CDEB 4QHUA 3O0RL 1MCIA 3GIVB 1DQML 4FFWD 4H20L 3BKML 3K4ZA 4JRYD 4OUUB 4ZOCA 3MLTA 1AHWA 4I13B 2NW2A 2Y7QA 4TULH 4D8PB 4PJXE 3EYVA 2X4SA 3NIFE 3PP4L 3QNXA 5GISH 5HHOD 3I02B 4UTAH 3KDMA 3WLBB 5D7LA 1OOAA 4K23H 3PWUA 1XGTB 1JTOA 5EU7E 3RU8L 2P24B 1FVEB 1J1XH 2PO6D 1IC4H 5JHDD 3C9NB 4NNPL 3CPLB 5J6HA 4ELMA 1Z6JT 1NMCB 1HWGB 2Y4SA 1JP5A 4Z78B 2J7LA 2P5EB 1C12A 2H32H 4YFLI 3H9HB 2LABA 2ZZUT 4QRTB 3WS3A 3VFTB 4CMHC 5FO7B 1R3HB 4MNHA 4OCSL 4PJFE 1OQXA 1WTGT 3SGDH 1P4LB 2J6EA 2HKFH 2FL5B 1AQDB 3QXDA 2PXYA 5AZ2L 5JPMA 4PJ5D 2VZUA 2KKQA 2PKDA 1VFBA 2OZ4H 1DSFL 4HEPG 3MBEA 1QRNA 2B2XL 3AREB 5BRZA 5CJXC 5ID1B 1MJ8L 5KSVA 1U95A 2AV7A 2X05A 1AGFA 3GJEB 4O9HH 3C2SA 4PRAB 4I2XA 5D1ZA 4PJCB 2PW1B 3RZCD 3FZUC 3HAEB 5DRZB 3MBXL 3QNZA 2XTJD 1RAMA 5ANMA 1QFWL 5IVNA 1R3LA 2Z31C 3UTSD 5C0RH 3FZUD 3TO4A 2WM0A 3CK0L 3RBGA 5L0QB 4KTDL 2ESVA 4D9QE 1XZ0B 3WXVH 2F53D 3W0WE 5KSAB 1HQ4A 1EXUA 1NGYB 5EUKB 5DR5L 1G7PB 5ILTH 2IQAA 3DRQA 1CF8H 3MRGB 1SM3H 1YEHL 5M7QA 5INDB 4LVEA 1RZJC 4K8RD 4U1MB 5I8OL 1SYVA 2ARJQ 3RDTA 5GJTL 1YNKH 3IJHA 4XXCC 4IOIA 2EZ0D 1T5WB 1KPVB 1SYSB 1HIML 2FZ3A 1AD9B 4RA0C 1X5FA 4PJ5E 3IJHB 1S8DA 3X13B 1HXMB 4DWHA 1U8JB 3IFPA 5C0IA 1UA6L 3X3GH 1AXTL 1NCAH 1MFBL 5C0CE 3QWOB 3GSVB 2W0PA 5KTEL 1AH1A 5C08E 2ATKB 4XH2B 4F9PA 1AKJD 5EN2B 4GUPA 4O2FA 4H8WC 1G6RA 5JNYB 4U1LA 4WY7L 3V7AG 3SDDA 4UQ3A 4GOSA 1JPST 1LD9A 2OJEA 1T66C 3INUH 4N90E 4P2RD 5DMKA 3RWGB 4F15C 2OL3H 4UB0H 3NIGE 5BVJA 3E8UH 5CD3B 2NY0B 1FFPA 2A0LD 2AABH 3MRHA 3QUZA 4HF5L 4QRUB 3VWJD 1ZTXH 4WO4A 3NFPB 3W81A 5C86A 2NW3B 3AAZA 1F02I 4YDVA 1IAII 5E8PB 3QUZB 3MA9H 4FTVA 5HHXL 5GSVB 4PYHA 4ODWB 4M6MH 3MRRB 3T09A 2J3SA 1Z0NA 2ERJC 43C9B 3OQ3B 1KTKE 4H0HB 4XPAH 5FGBA 1XR8A 1S9VA 2NY4D 1F6AB 1I1YB 3NIGF 4H88H 1YEDB 3O8XC 4EN3A 3I50H 3IT8D 5SWZD 5JNYA 3IDYC 4RA3A 3TBYA 3HUJF 1DBAH 2BVOB 4MSWB 4NJ9L 4NNXA 4O2CA 5DMGC 2KZWA 1FV1B 3SDXB 2EKSB 3MRBA 1WIOA 4GG6A 5D71L 2DB8A 1LDPL 1WUNT 4JRXA 2GCYB 2BVPA 3HFMH 3WLWC 3VGGA 1W8NA 4MZ3A 5HYSA 1A3LL 3JWDL 3VXUE 3BPOC 4FFVD 2FWOB 2VN7A 1MAKA 3QUML 2PNDA 2EC8A 1KTRL 5IB5B 3DURB 4M9OA 2DQTL 2RCSH 2X4NA 4M1DL 1X5GA 2Z8RA 1MRDL 1PKQA 3T0BA 1AXSB 3ZT6A 4DZ8A 2P5WD 2X4NB 35C8H 5HGHA 5DRNB 1TZGL 2VC2H 3G6AA 3S34L 3C60D 4NUJB 1MQ8A 5DQ9B 1QFOA 3B9DA 1XH3B 1KIUA 1CVRA 2QADC 2EDEA 1KSRA 2XXCB 3NIFF 2WBJA 3TM6A 1W2KT 3QRFM 1E28B 3GUTA 5DEFB 5HDQL 1MPAH 4F7TA 2L0DA 3D48R 1MRCL 2Z31B 5B38G 1T2JA 3TV3H 3O3BB 5BVPL 4NJ9H 5EOQL 2C1PB 3RY6A 3GSNB 1AQKL 1F6LL 5HVGB 4NJAL 5D5MB 4EIZC 3WFEH 3CFBA 1CT8B 3UTSB 4FOMA 4KK9D 4DOHE 3FQNA 2IANB 1X5KA 4HWBH 3MA9L 4RFEB 3WO4B 4PTUA 2IJ0C 3JV6A 3LY6A 4D0DA 3L3KA 4NPYA 3QIWA 1CQKA 5EU6D 4PJ9D 4XVTH 2FHBA 3R8BB 2HFGL 4P2CG 1HHKB 4MNQB 1QVOB 4M1CD 4YUEH 4DN3L 1G0DA 5J0BA 3MBEB 2IBGA 2XICA 3BD3A 1BD2E 4JANB 1JNLL 2CRYA 5HD8C 3GNML 3INUL 1JWMA 4WY7H 2CXGA 1HH9A 1I1RA 3QR2A 3WBDA 1J86A 3IB4A 2MQ0A 2SEBA 3G9AB 1EEYB 2AJXH 5I1HH 3K46A 1VSCA 5BRZD 1AXTH 1Z5LA 2OMNA 1ND0A 4U2YA 1GZQB 4WENB 5JLZB 1DN2A 4LL9A 5FYJL 4R8WH 5CEXB 5IT2L 4G9FD 2J2ZA 1HEZA 2Z31D 1CZ8L 1I3UA 3V2AR 5CP3H 5ACZB 1JPTL 1KLFA 3TC9A 4GRWB 4MHHI 3OJMB 1RJYB 1WSST 3B8YA 3FB6B 5C0AD 2X09A 1ZHKA 3CU1A 2FR4A 2HG5A 4DKEL 5E5UB 3BH8B 3V6OA 4YXLH 1DUYA 3C08L 4QY8A 4AEEA 2A2QT 3U36A 2ORBL 3VWKD 1CYGA 3NA9L 3V6OE 4PJ8B 4JN1L 3G08B 4MB5A 4GUPB 4P2QD 3GK8H 5T1MB 2WUBL 3QQ3B 2X9YA 4MCZA 4JCLA 4XT1C 4KV5E 4YHPA 3WS6C 1RULH 4JDTL 1A7RH 4LCCA 1LK3L 4G8GB 1KLUA 1ZA3A 3VH8A 5HDBF 3RNQB 3VXOB 4YDLB 3V6FB 5FO8B 4OFDA 1QSFA 2VLJE 5H2BB 2R29L 3S37L 4QRQB 3QULB 4LPTA 2WUCL 1RIVL 3HZKB 5D5ME 3K0WA 4EDWL 2UZIH 3O2DH 3O2VH 2G5BA 2W1NA 3LS4L 3G04A 2NZ9C 2A6IB 3BEVA 4PJXF 3WHE1 3VWKA 5MENA 1CI5A 1TNNA 3QCVL 5T1MA 3MXWL 4OFVA 4EXPX 5IHBA 1VHPA 5C0EB 5DVMA 4WUUD 1UZ6F 4RGNB 2CUIA 4TYUA 5IIEB 5CINL 4UQ3B 5F1IA 43C9A 2P8MA 12E8H 1RK0B 4X9HA 3UJJL 4ODXB 3BZEB 1ZLSL 3W11C 4GAGL 5DJ6A 2AP2A 5IFAL 5E2VL 1OVZA 4PPTA 1H5BA 2NNAA 3QQNA 5CD5C 2VDPH 1TCRA 4DK6A 5K9KA 4N0CD 5BZWA 3O6KL 3FFCE 3O4LA 1AC0A 3VFWA 2GEEA 2XKNB 3O3AB 1CGTA 2Y5TB 3V5DB 3BKJH 3FB8B 4WWID 3H3PL 5I74C 2DD8H 4YHOL 4P0DA 1F3DH 4J3TA 5GSRA 3CMOH 5IW1A 4WUUA 3BDXA 3OXRA 1MY7A 5J56B 3WFBL 4JFEB 1UQSB 4IS6B 5DD0H 1B0GB 4BZ1H 4YHYB 3CZFB 5AD0B 4C4KO 1DQMH 1IGML 1YPZE 5L8LB 2X1OA 3VXPB 3GMNB 3NVQA 4BSVB 2GY5A 4HGWA 5GGVY 3I9GL 5EU5A 4ODBD 2WP3O 1I7TB 3NIDF 5E94A 2QTEA 3GSNH 2P5EE 1QSFD 4YBHA 1TQCB 1PYWB 2ADGA 3EO1A 3N85H 1LEKB 4LBEB 1IQWH 3QUYB 3T3MF 1RVFL 3MRPA 1HH6A 4OD1L 4LQFL 5B3JE 4HSQA 2C4FT 4HJ0C 1INDH 3F5WB 4NOFA 5DHYA 3KPNB 3LPFA 5EU6A 2HVJB 3O6FB 1FG9C 5MI0B 2MKLC 1C08B 4N0YH 4Y5YA 5I75B 2YWYA 2BXZA 4XB7A 2XKSA 3HMXL 1HILA 1DEDA 2I9TA 2UWEF 3P4NA 3BMWA 4F7TB 4YDIH 2GQHA 4LU5H 4Y19B 1HXYB 5DO2D 4DQOH 1IC5H 3QQ9C 3BUYA 1KLGA 3S4SB 3CFKB 3OGCA 1U8OB 1ZHBB 3DVFA 3MLRH 1D6EB 3IAPA 4QRTA 3WS3B 5B38A 2P5WA 3E3QC 1DBJL 3PGFH 4D0BB 1HEZB 4UINH 4PV9B 4JN2A 3LKPA 1AFVH 1FPTL 1FC2D 1NEUA 1U91A 5L2JA 5JPMB 2RHEA 4RFEA 1FBIL 2GKIA 5ELIA 5TE6L 3QPXH 1BAFH 5EZLB 3CFIC 1RPQA 2AXGA 1JWMB 3E6HA 7FABH 1S7RB 3IFNH 4MD0A 4OZFA 4JKMA 4R4ND 4JANA 3WHXA 1OSZB 3EOAB 3SKUD 1J7VR 3O8XA 3WD5L 4HKJA 3OKOA 4P5MB 1P7QD 3WXWL 3QDJB 1N8ZB 1JNNL 1DVFC 4BYHA 4TSCH 1I7ZB 1WCQA 2I07B 1LO5B 4NZJA 4OD3L 3WO4C 4MAYA 1CD0A 1FNSL 4YFDB 3S98A 4E41D 2BSTA 2V7NB 3BZFA 1XR9A 1UM4H 4PJ7B 2EDBA 5K9QG 4UBDD 1UB6B 3PGDA 1N0XH 5DZOA 1QLRA 3BISA 3HMWH 4O2FB 2CUMA 1BLNB 4U3HA 5LBSL 4P23D 1AGEA 5EU3B 2V9TA 1OAZH 3U46B 3LQAH 4MAUH 4RAUB 5JW4M 1EJOL 4ZFZB 1OAUH 3EGSA 4KJYB 4LCIH 4HUUA 4F7EA 2P5ED 4L9DA 3QUKB 4JEGB 3MRHB 1NBVL 2IMMA 4WHTB 1OAYH 3TF7C 4PRBB 4ZO8A 4AIOA 1WK0A 1GHFH 1UWGL 3MRMB 1CBVL 3VFUB 2R1WA 5EZIL 5FGBC 1ZA3B 4Y19E 4XXCA 3K80A 4HAFA 4LCWB 3HNTH 3BN3B 3QWOA 2B1HH 3S37X 4LOUD 1TJGH 3VFVA 1AGEB 1DLHA 1EHAA 2IAMA 5F9WB 5LWYL 1CFBA 4M1GL 2Z91B 3RDTD 5C0DB 1FN4B 2LVCA 4HJJL 4JDVB 4JG0H 2MCPL 1QPXA 2VIRA 5L7XL 1TXKA 1G9MH 3DO3A 2FSEA 5HHQA 1YC7A 3ZKMD 3AMKA 2X70A 4X5LA 4N9GB 1QR4A 2LTQB 4G7YH 5IB2A 2GSGA 3Q5YA 4NZTH 4MA1B 3FN0L 3MMEA 1G7QB 4RGMB 3DHJA 1QFPA 2NY2B 5DEGA 5LGHL 4CJ0A 4HHAB 4YGVA 3QIUA 2Z35A 3MV7E 3GMOB 4JFZH 4JRXB 4PP1D 4B53A 3KPLB 3KPRA 3B43A 3RWCB 5MHSE 5F8QC 5L6YL 5FKPA 4NQED 1K3IA 5LGJA 4FZEH 4A6YL 2XIDA 2R2EA 1HCFX 1EIBA 1FNHA 1I3GL 4X99B 3Q1SH 2ITDA 1P4IH 4POZD 5T5FL 5ISZE 3HG1E 3C60A 3TT1L 1X7QB 3ARVA 4X6CF 2PN5A 3TWCL 1N2RA 3QXAA 4H25B 4M02A 5KVEH 4PGDA 4X0KA 3MMEB 4DAGH 2HTKD 3TJHD 4WIQA 1XGRB 3R0NA 1U8NB 3O6MH 2ZG2A 3KLAA 1IGYB 2BY0A 3T65B 3K8MA 5C09D 4WDIA 4PV8B 4XHJD 3V6ZA 1IKFL 5C3LD 3KPSA 3FCTA 3ZKNC 5I76B 1Q0XH 5C6WH 1ZHNB 1C1EH 3FOLA 4YHZL 1ADQH 4NT6B 3B5TA 3WIIL 3TLRA 5T5NF 1QHPA 2AJ3A 2EDWA 5HHVH 4AENB 4NHCH 4OKDA 5F7NC 4X80H 3VMNA 1QTYT 4BFIB 4OV5A 1FSKC 3OB0H 3D18B 4AENA 4WU5B 2DDQL 3HG1D 3PHOB 2VLRA 3RPIB 2W65A 4JM4L 4ODVL 4GO6B 4X7SH 3ARFA 3JV5A 4LIQL 4YIQA 3IFOB 1NCWL 2D2OA 5FDWA 3SOBH 1ETZB 1EEYA 3BT2L 4OLYL 4XWGH 3X12A 2ZOLA 3C6SB 3OKDB 4UIKH 3T1FA 5IB3B 1GIGL 3RA7H 4Z8FL 3N9GH 1C1EL 3QEQD 1L6ZA 3Q2CA 4L4TB 1MNUH 3ZE1E 4R7NB 3HKFA 1VEOA 1TVBA 1FL6A 5J4MA 4WEMB 1T6VN 1D5XA 1ZA6A 5FO7A 5IBTL 1NC2B 1EEZB 1SY6L 4PGZA 4G42B 5CHNB 3M8OH 5CFHA 5GS0D 4I77L 4I18A 4UNVA 2I07A 3DVGA 3QJFB 5T3XE 4S2SB 1EBAA 5FYJE 1JYNA 5F93C 2NX5A 5JZ7D 2UUDH 3VXRD 1U95B 4X7DC 4Z0XA 4FG6D 2C4FU 4OIIL 3GJFH 4YHLL 3LN5A 2PW1A 4RRPG 3FT3B 3CH8A 4JVUA 1S5IH 1W0VB 2V9RA 1DLFL 1LP9F 5IOPB 1GZQA 5JLZA 1KEML 2VZ1A 3RTQA 4J4PA 4LSVL 3MFFA 1GL4B 3OMZA 1T0PB 3MRIB 3N1QC 5DJ8B 1G6RB 1U8KB 4QXUH 1KJVA 1RZFH 4YHIA 3QZWG 2DLGA 4FHBD 2D7QA 4JQIL 2G5RA 1YN6B 2ZJSL 4FG6C 1LE5A 3MOQA 1NBYA 1KN2L 2CLZB 1W72L 2LU4A 2AJYL 3MCLL 1N8ZA 1NGQH 1FZMA 1CK0L 4R3SA 3P0VL 1N0LA 3VD4A 2FSEB 1T04A 4PRHB 2FECL 2O5XH 3BVNA 3VXNB 1S78C 1CIDA 4Z7UA 1T5XA 4N9GA 2B0SL 4OAWB 1LEIA 1DL7L 1T2XA 4XBEH 4Y5VB 2ICWB 3SDDB 5A40E 5E8EA 1G9ML 3LKSB 3WNLA 5DUBA 2MKWA 3MLUL 4JJ5A 3O6LH 3W2DL 1BIIB 4M1GH 4R4FH 2DLFL 4N8VG 3IFPB 5C0IB 3SE8H 1SVCP 1TQBB 4G6AD 3T2NL 2OI9C 2FX7H 3V4UH 5IMMA 1QLFB 5CEYB 3HNTL 2LFGA 3PL6D 5CGYD 3FRUB 3WCYA 2XWBB 4PRHA 2WWMD 5JMOC 3TZVC 1S9XB 5ETUA 3MNZB 4DKDC 3JVGC 1HHJB 4U6VL 2E9WA 4KJPC 3IU4H 3CDFA 5CSZB 1PVHA 3FQRA 1A6TB 1P69B 4Y4HB 5JPNB 2JCCE 5D1XA 3MZGB 3QUMA 3ARED 1RUQH 3TNMB 4PJ7F 4MAUL 1HCVA 3UTPE 3MNWB 1I1YA 1G7IA 2R2BB 4MQXC 4HS6A 4XI5D 1FSKB 4NNYB 1G7HB 2D7OA 5I1KH 3O3AA 5BOPA 3HHRB 1D6VL 3GMOA 1L7TL 1TQBC 1UWEH 1D5ZA 3PWPE 1VGEH 2ZUYA 3KPPA 2YD7A 3QIBB 4KK8C 1NMAL 5CP7B 3BE1L 5BZWB 4AIXA 5BMFL 4GXVH 1KTDB 4CJ1A 5KBNC 3C60B 5KSAD 2YMXH 5FOJA 2BVPB 2K9UA 4GMSH 2ENYA 4WO4D 2PW2A 1AR1C 4OZHB 1ZGLM 5DDHB 2HKHL 4K8RH 4U1HB 3WD5H 3WFHB 3C6LC 2ZP0T 5I1AA 1RK0A 2PYEE 1CDIA 3RWCA 3O2DA 2AW2A 1JBJA 1Q9OB 2A9NH 2NXZC 3IVKA 4NWTL 1LP9E 1J8HE 4PRHE 3WJJC 3MRCA 4XVJL 1CFSB 1NUFA 4D8PA 5BW7C 4N0FA 3KHQA 4EUPH 4FQHA 2ID5A 1KCRH 1BAFL 3UPAA 4BZ2H 5TE6H 3ARRA 3U4EB 2VUOA 3B9AA 3C8KA 1FYTB 1BQSA 5DHYB 5BS0A 3SKMA 2HN7B 4LCWD 4R4BA 3KNBB 1Q1JH 1LEKA 1NCCH 2CGRH 1DEEB 4HXAH 1MAJA 3JWOH 4LVNC 2X4OB 4XAWH 4YR6A 1T0MB 4JZNB 1I85C 1BEYL 1JVKA 2HLFD 2NY1D 5DRNA 2X6MA 5HVHC 3V52L 4YDIL 1JMZA 4YK4B 4Y8AA 4U0RB 2E9BA 3OKEB 4KY1H 1DQLH 4EEEA 1EUTA 1DUZB 2DMBA 4KVCL 1A6VH 3VGAB 3WN5B 5DFVC 3ULVF 3Q0HA 4LBEA 5C07A 4ELKA 1MUJA 1NCCL 4X6EB 3QNZB 1FZJA 1INDL 2JCCB 3QISA 4RMTA 4QXWA 2OQJA 1A7NL 3Q3GB 1I7RB 5FIEA 3U9UB 3D18A 5K9OB 1IQWL 3FB6A 3ZE1F 1WFOA 3GJEA 5B39G 2D0GA 5EO9A 4C4KT 4G80A 1KCRL 5TDNB 4X7TA 2E6QA 4OFYA 3QI9D 2HJFA 3X11B 2A9NL 1NGWB 3O9WB 1AO7E 2HTKC 3IDMA 5IBLD 4X6FB 1B3JA 3AU1B 5DD0L 3QIWD 1I8KB 5ECJE 1D5MB 1F58H 5D93C 3IRZA 3ZT7A 1NEZB 5ALCH 2HT2C 1K8IA 4YDJB 4Y4HC 4XX1G 3GMPA 3W9EA 4NSKA 1K9TA 5CJOL 5DD5L 5FFLA 5A2IH 1UYWH 3H7BB 3O6FD 4GRLB 3BD5A 1QBBA 1NBYB 1IGIH 2CLZA 1YEFL 3GMPB 3W9EB 3F12A 2UV3A 3RHWF 3QNYB 2VDPL 1UG9A 1V7MH 3VJ6A 4APQA 5E2VH 3DETD 5IFAH 5TE4H 2IAMC 2XWTA 3RL1B 4Z7NF 4G8IB 3ZTJG 4YQXH 1BWWA 5H35B 3U48A 4CMMB 3VRJB 3QDGB 1FAIL 5I2IA 1N59B 3GSOB 2GJ6A 3CSYB 4HFUL 1JPFB 1FC1A 1D5MA 5F1IB 4Z6AT 2ATKA 2VNCA 5C0GA 4CN4A 5D6DC 2GJ6E 4YHPB 1SBSH 3KPMB 1P6FA 2OTUB 4PJHA 1FFNA 5ITFA 3CVIH 2V9QA 4PYGA 4ZS6D 3G04B 5DFVD 1A2YB 5ADOH 3SQBA 5ESQA 3BPLB 4Q9QL 2Y06L 4IBLT 3QIUC 4HGMA 4PB0H 3UTTE 1OPGH 2DQFB 2O61A 3ARZA 4LDOB 4KKAD 3LS4H 1ACZA 3PDOA 3O2DL 4HWEL 3VFMA 3UYOD 1GGCH 4OGAD 4MQ7B 1CVSC 5HHPB 2XWBA 5I17A 1ZWIB 5INDA 5JW5A 4LNRB 2R0WL 3A67H 4BQ9A 2EYTB 5F8RC 4HGKC 1A1NA 4JJ5B 4BH8A 4ZUSA 3ULVC 1LK3H 3MCKB 3L3HA 2DYPD 1JCKA 2Z8SA 1CLYL 5ERWB 3VXMA 4QEGA 1ZMYA 3ZDYF 2D4DA 1IVLA 1IBGL 4JN1H 3JSSA 5HY9A 4NKQB 4OLEA 1SY6A 1XGQA 2QJDA 3RIFK 4YXLL 1NMBH 5F72S 5MP6H 3P0VH 3HI1B 1ZEAH 4ZFFB 5KVDH 5MEND 1U8NA 2N4IA 3SJVD 2QEJA 5BS0B 2AJYH 1A6PA 2IADA 2CSPA 4KMTH 4C83A 4S1DC 3O4LB 2H26B 2P46B 5GS3A 4BZYA 3MLWL 5AG9A 1CZ8H 2G60L 3EO0B 1X5AA 1FNFA 3MC0A 1RZFL 2YA0A 1WBZB 5EUOA 5JOFA 2DBLH 1OAKL 2JB5H 5J9PA 1R3JA 2ADIB 4I0PB 5ID0A 4NP4L 3UAJD 3WDJA 1V3LA 4LSVH 1RFDH 1XT5A 1UJ3C 5I1HL 2GFBB 3SDAB 2FB4H 1VCAA 3BXNB 1JWSB 4POYA 1R24B 1KB9K 5IK3B 2DJSA 5J11B 3LEVL 5CS7A 3WNPA 4OZGF 4YXKH 2PXYD 1E4WL 4U2ZA 3S96B 1ODAA 2Z8WC 4YXHL 1F8TH 5E7FA 4E5XB 2ZCHL 5FXCH 3BO8A 3MRBB 1RURH 4P2QE 2BNRD 2HFGH 3RX7A 3MRNA 1H15B 15C8H 4HG4K 4LSQL 5D96C 1D7FA 1MNUL 2EYSB 2V7HA 4Y19A 2ADIA 5ID0B 2FJHA 5I16A 3MNVB 2J88H 4Y5YC 1B9ZA 3QUYD 2AXGB 3GSNA 5A16A 4L4JA 1NCWH 1NGWA 3QPQC 4LIQH 3QIBD 3RI5K 4NJAH 3U4BL 3BIKB 4LASL 3PNWB 4RWYH 4P46B 2RBLA 3KPOA 3W5MA 2X4TB 3D2UB 8FABB 2QQKH 2Z92A 3HR6A 3T2OA 5HDQH 1PQZB 1HYSD 2PR4H 4NHCL 4FTVD 1CN4A 3KJ4B 3VXQA 3NH7L 4OLVH 1U3JA 4GLRI 4NO2A 3DMMC 4W81A 4IMLA 1AGCA 5HGBB 1CCZA 3CZJA 1XIWA 4ONGH 3W39B 1IQDB 1DCLA 4FQ2H 1NCDL 4G8FB 3U0PB 3QIBC 2VC2L 3MLYH 3FAXA 4P9HH 4NOBA 3EFFB 1XIWB 1Z9MA 3W39A 4EKXA 2I27N 3J8F7 2Q7YB 3VRJA 2VERN 1F13A 1H8OA 1WAAA 2BVQA 5TQ0L 4X7EC 3VI4E 4K3EH 3PXJA 4O58H 5CSGA 2Z92B 4OCRH 3CXDH 1TZHB 2WLZA 5KVEL 2B39A 3UTQB 5MI0C 2UWEE 1G7MA 1WBYB 1Q9LB 3OKYA 5KANG 2RR3A 3Q1SL 4NZDA 3FRPG 4KQ3H 4NO0A 2HRLA 2N56A 3SO3C 3T0VA 1BD2A 2KL6A 2Y36L 2W07A 2B7DT 5I1EH 5HI4C 4P48A 1ED3A 1QBMH 4OZFB 4PJGB 4PJ7A 5DS8B 1EBPA 3QUYC 1DBAL 2JKXA 2X9WA 4QGTA 5MEQB 5DMIH 1DQDH 2DTML 3PV6A 1CXLA 3I50L 2HMID 4GSDH 1IAKB 5LGHH 2LU3A 3MV9E 3F6LA 3LZFH 4MJ5B 1CLOH 2PTUA 4XPAL 5F7EH 3E2HC 2CRZA 4NZRL 4NZTL 3RIFF 3PL6A 3UTQA 3ARGB 1KIPB 4RAVA 4DTGL 4FFWC 5IOPA 5GSVA 3VW3L 5BO1H 3V0AC 2DS4A 1JI1A 1JNHA 3NCEB 1FGNH 3MRKA 1J05B 4PRIA 2V2WB 2HJLA 3IDJB 4FQXA 5C0BB 3V6FA 2MCPH 2AGJL 4HJJH 4JG0L 5C0DA 5EBWB 4ZFOL 4M6OH 2WWMC 1A4JB 3I75B 4WWKD 2CKBL 4KC3B 3UMTA 3DSFH 3SE9H 3EOBA 3WIHA 4JFDE 4JHWH 3HC4L 3LEYL 3GBNH 4QTHB 5KJRH 4YO0B 1KEGH 3TYGL 1E6JH 3LN4A 3B3IA 2ZSWA 3LS5H 4ZODA 5D72H 5EO1B 2BOCA 4JO3L 3T3ME 4PIRF 4NQEA 3HE7C 3VRIB 2GK0A 1UA6H 2ZG3A 4JPKL 4JQVC 5GRZA 4DOHB 4ZUVA 3T77A 1IC1A 4RGNC 2VABA 1GGUA 1CE6A 4LVOC 1SMAA 3P0YH 3HPJB 4QWWC 1K2DA 2ILLA 2H8PA 2ZSVA 4ZUVB 2EXWC 5D9SA 1YNKL 2RQ8A 1FNGA 5E2JA 4HPYL 3CGTA 4ZTPH 1GPOL 4CDGC 4OM0H 5EWIL 2H2PC 1KB5H 5DR5H 1AGBB 4YBLB 4GRWH 1J1PL 4GXUM 4P3WA 1RUMH 4Z7VF 3W5NA 3TPUA 1CICD 1FNSH 5A2LH 4Y4FA 3GMQB 4WHYH 5BV7H 4OD3H 5C0RL 3S96A 1IILE 3HRZA 3MBXH 4F2MB 1I9RH 3RY5A 4IHOB 4U7KA 2K7QA 3QIBA 1NLDL 3QDME 4JZJC 3VXPA 2HH0H 1QBLH 1T89A 2LV4A 5F7HA 2P44B 1BPVA 1MJ8H 4TPRH 2ED9A 4WEBH 4IS6A 1QNZL 1J0HA 4JPVL 4O51B 5HHOE 1G7HA 1JF1B 1RZGB 3IJYA 4ZXBA 1D5BB 2CO6B 1FBIH 4RIRA 3W0WA 4M6AA 3WEXA 3OKKB 3LKNA 4D9LH 4F7MA 3ZDZE 4KI5C 3R06B 3K4DA 4U31A 4Z7QF 4UTBL 4L3EE 1T83A 3T0EB 2FECI 3C9NA 3ZE0E 4HFWB 1E28A 2IBZX 3THMH 3CX5K 5L2KE 4JR9L 2CIIB 4U0RC 1NPUA 1JZ3A 4L4VB 3ARDB 4MX7B 3ILPA 1U3HD 3LDBC 2IH3B 1EHXA 2HAZA 2EE6A 1U8OA 1ZHBA 3QWRA 3G6AB 5EOCH 3QIWC 1OTUC 2ICES 2C3XA 4M48H 4N1HB 3WFDH 1YY9D 5IEKA 4WW2A 5C09A 1CT8A 2X44D 5E2UL 2XQYG 4KMQA 3EYFA 4WHDA 4EXKA 3RFZC 1GOFA 1MJUL 1MI5D 4RGNE 4WW2B 3IFOA 4MA8H 1AHWB 2EZ0C 5E08L 1MJJA 4H1LB 3SHSA 4ZUTB 3S4SG 3RGVD 1A9BA 3Q3GA 1WWWX 2D0HA 2CKBA 4ONHB 3IDNA 2YC1B 5I6XB 3TT3L 1A1MA 3P0GB 4H1LA 4AG4L 1XF3B 1PG7L 3HAEG 4Q2ZB 1NCTA 1NC2D 1VFAA 2R2HB 3O3EB 4OCNC 2KZ1B 4PJCA 4CW1A 4M5YH 3MRGA 2WBJC 3PDDA 2MNUA 3MV7D 4WUUE 3VU2A 3U46A 1FNAA 3K4AA 2XA8L 2GJ6B 4I5BA 1MIML 4MZ2A 4UAOC 4XBPB 1NFKA 2NLJB 3MJ8B 4KTYA 3WHXB 4JKPH 4NQDE 4PG2A 4TN9A 2OL3A 5L2KA 3L95A 1CXEA 4LLMB 3QXUA 5B3JF 4GAJH 3SDCB 4ODTL 4O2EB 1EFQA 3V4PL 4PRIB 3GJFB 4MB3A 4PRNB 3BI9X 5BQ7A 1T3FB 5I1IL 1CU4H 4L8DA 4FZ8L 2XN9E 4KKLD 1ZLSH 4JY6B 1Y18B 3RI5F 3PL6B 1BGXH 4L3AA 4PRNA 3G5YA 5HYJE 3K8LA 5DMKB 4C55A 1S7TA 1MCSA 3RUGE 2FLRT 1B90A 2EICA 4QYOB 2NTSP 3OKOB 4HIHB 1S7SA 1FNEA 4IRJA 3ULUH 3QUXA 1CIUA 2PUQT 5C0CB 1T22B 1HSAB 2XNAB 4PJEA 3SPVB 4D9RE 1F3DJ 3BH9A 5L2KB 2F5BL 1HK6A 1OB1A 3B6SA 1I75A 3NOIA 3VWKB 2HJLB 3IDJA 3PQYA 2FJFB 2L4OA 1ZGLB 3L5XH 5DJ2B 4DN4H 1BBJA 4WEBL 1FRGL 3BAEL 1IT9L 4MYWB 5IBUG 3X13A 3O2VL 1KTLA 3F65A 1Q38A 4ISVA 2P43B 2Q20A 1L0QA 2CKNA 1U3ZA 2R29H 5GRUH 3ECBA 3TIEB 4Z76A 5ETUB 5DJDB 3UC0H 1BZ7B 2X4UB 3KWWB 2DQDH 1LO0H 5AUMA 4R96B 4G8GA 1YMHB 4PREB 5TF0A 1BECA 3QUZC 3B5GA 5IKCA 2NR6C 1UM5H 3QHZL 3A6OA 3BJLA 1RULL 4JDTH 1H0DB 2CDGB 3HE6A 3GMNA 1KIRA 3L5JA 4LRNH 1KB5L 4WUKL 4Y4HA 1S7UA 4X98B 1FZKB 1KV3A 1DBBL 4OM0L 5EWIH 4LP5A 4R7DB 2A6IA 5DUMH 5GGRY 2ERJB 1GPOH 4WUUB 4ZTPL 1T80A 3ZKSD 4U1KB 5AAWA 1QFUH 1A0QH 3VXME 1F45A 4QXGH 4EIGB 1K2DB 1DEEA 2C3HA 3QDJE 1MFDL 2B4CC 5JQ6H 2EC9T 4JHZA 2EDNA 5C0JB 2NR6D 2XZCH 4Z95H 2I24N 5DJ6B 1B0GA 1QYGH 3QT2A 3NN8A 3U4EA 2JIXD 1KIRB 3V6ZB 3IDIB 3EOTL 5FOBA 3OAYH 4F7MB 3LEYH 1MVUB 3QEUA 1BF8A 1IGYA 3GHEL 4LF3A 2AJSH 3BN9D 1IGTA 5E6ID 1D5IL 4GRMB 1U8IB 2CIIA 1EFXA 1O7VA 1ZT7B 3VA6A 1ZV5A 2Y25A 4OQTH 1HDMA 3CFDB 5GHWH 1OAXH 4G3YH 3UTSE 3RWIB 3DROA 4BFBD 4P46D 3L3DB 4OV6F 4HWBL 5ESVB 3RWHB 4F7PA 3M17A 3BPNC 1VFMA 3LKOA 4KUCF 4M7LL 1YA5A 5D7KD 4PTUB 4E41A 1S7RA 3LZFL 5HI4D 3WFEL 5I16B 5TDOB 2J6EL 1PX4A 1DQDL 4LLUA 2WK2A 3BN9C 3P77A 4MS8C 3ZZ1A 4UV7L 2LU7A 5BVPH 2EECA 5KZCD 3P4OA 4X6DE 1QBML 3UO1H 3TV3L 2F58H 1QPPA 4OFPA 3TGXA 2GJ6D 3IU3A 4IRJC 1JV5A 1MPAL 2IANE 4M7ZC 1HYRC 5HGBA 2P5EA 5ICYA 4Y4HD 3VFGL 1XF3A 4U0QB 3GSUB 5HI3C 4D0CA 4JN2B 1A6ZA 3PHOA 4M8QB 4ZNCD 4HJ0D 5FYKU 3U0WL 1RJZB 4V2BA 3CXDL 3S34H 1CG9B 1A7PL 1TJHH 1OWWA 2BX5A 3SDAD 4AMKH 4NKMA 35C8L 4WFED 4X6CA 1J5OH 5JORA 1AGDB 3D0LA 1T0NB 3FRPA 4J8RA 3OV6A 4KRMB 2JLLA 2FBOJ 5DK3A 4IIQB 2ZCLL 1CL7L 1MRDH 4HK0B 3N50A 4JREB 5IW6A 3O3BA 4AMKL 4P9HL 3MLYL 1A7PH 5D7IA 1Q72H 2ATPA 4WGWB 5FB8A 3BZFB 3QUMH 4XVSH 1A6UL 2YPLE 4PLJC 4YHNA 2ICWA 3MRDB 3GKWL 2PR4L 4HH9B 4P4RB 2E7MA 4HLZH 4M8VA 2ARJA 4P9ML 4OCWH 2GTWB 1EUUA 5D1XC 1I1AB 2F58L 5EIIA 2ZUUA 2ZG1A 4FFZH 4TQEH 1HHKA 4MNQA 4UV7H 3C09B 1BVLB 3ARGD 1VFUA 4AK1A 4ZUSB 4BH8B 4LASH 4NDMA 4UOW1 4PJBE 3TCLA 5JR1L 1I7UB 2ADJA 1HZHL 5DUBB 3VJ6B 1MI5E 4OTXL 5IHUL 4L3EA 1FNEB 1RIUH 4ZD3H 4M6ML 3CAFA 4YDVB 1KB9J 1T7YA 1NKRA 2BSTB 5KG9B 3K1KC 3MRRA 4G9DA 4KK9C 3BRDA 2GHWB 2AJUH 2PETA 5KG9A 4UB0L 4IEFB 4YXKL 1WBXB 2V17L 1R0AH 4JGMA 2VKWA 1XF5A 1DQJA 2EKSA 4M93B 5J1TC 3CSYA 5F44A 1QSEE 2JJTC 3MODL 5F1NB 4JQXA 3L7FA 5C0ND 5T1KD 4K71B 4GQ9H 4EI5C 3OKLA 4LK4A 4H0IA 1FN4A 3VD9A 2Y07H 4S1QH 1MFBH 4UOW0 2E27L 4UU9B 3X3GL 1TTGA 1HXMA 3LD8B 3QDAA 4N8VB 5A1AA 3GFUA 1NUNB 2A6KB 5FA4B 1A1NB 4NRZA 3TA3B 3E3QE 2UUDK 5SWQA 4XC3L 4EI5A 3VFPA 2VR4A 1PEZA 3VFNA 2NMSA 4L3CA 3FONB 2W60A 4N9OB 3QDMD 1UB5B 5DUML 4NGHH 5HHOB 3MFGB 5MP6L 1KPUA 5CMAA 4P49A 1M6OA 1W0YT 3NPSC 3EZJB 3BRGC 3B3IB 5FOBB 4XPHL 4Y8DC 4CN1A 3ZHLA 1XH3A 4GMTL 4Y0GA 4RDQG 4N68A 5A3ID 1II4E 4O02H 4OI9A 1PG7W 3PWPD 4D2NA 1JNJA 4PJ9B 1CLYH 3TBSB 3D0VA 4K2UL 5F7DA 3SKOA 1Y0LA 3SGJA 4KK5D 2YD9A 1LO0L 2RJMA 3HE7D 1XGYL 1S9VB 2KBGA 4OF0A 2OR7A 3LV3A 5DGQA 3PL6C 2QSCH 3V6OC 2CR6A 4O9HL 5ESVA 3IAGC 4XPBH 1KN4H 2HLFC 2NY1C 3LQZB 2MHAA 1DSFH 2GCYA 5DURB 3L5XL 4PB0L 1WCBB 4G6KH 1VPOL 1X6LA 4OZIA 1HDMB 2BRQA 2ESVE 3C5ZC 4GJTB 5E99H 4FABH 3PHQB 5IEKB 5LG1A 2VXSH 3CMGA 4DZBA 1NFDF 4J4PC 3MRCB 5HPMB 1SBSL 2DM4A 4HIEA 3BXNA 1MAML 1RZ8B 4ZXBB 2DI8A 1XMWA 3D5OF 1A6AA 3N1GC 2X4OA 4DZBB 4ELME 1KCSH 3IJSB 3M17B 2H3NA 3ARBC 4FZ8H 1ZANL 2EH7L 4JREC 1G1CA 4JFHE 1U8QA 4E41B 4OI8A 2BMKB 5TDNA 1EA9C 3KPSD 3ALWA 3EAKA 4A2LA 4R2GB 3F58H 1A02N 3LKPB 5TDPA 3U9UA 3RAJH 1UYWL 1CFSA 1RZKH 4JB9L 4Z7WA 1FFOB 5DD5H 4JZOA 2KUTA 5CHNA 4X6DF 4P2QA 1SJXA 3CUPA 2E6JA 4GS7C 1A3RH 1FH5H 2XQBH 3MRQA 4EVNA 3U7YL 1I4FB 1MIMH 3OJ2C 4LNVA 1TFHA 1A6AB 4KH2A 1K3ZA 4JFQA 2DJUA 4OT1H 3I3EA 1MRFH 4CVZA 1MCFA 1ZSDB 3K7UA 3OZ9L 5I8EB 5FUCE 5E8DL 4IJ3B 4MXQD 1DUYB 4AG4H 3WE6A 4K9EH 4TVPL 3B2VH 8CGTA 4MXWH 2HFEB 1R3LB 5D6CB 1P53A 1QEWA 4GKZB 5DRZA 4OGXH 2VLLA 4HIXL 4U1MA 4URTB 2HFEA 3JUYA 5ACZA 1DUZA 1AP2A 2OL3B 1CLZL 2ATPB 2VUYA 2AV7B 1MUJB 2X1XR 1F90H 1KENL 1NGYA 4KZDL 2Q7YA 4HLZG 5IEHB 5H8DA 4XNQB 5E2UH 4K71C 4NRXB 3WLWD 3QG6A 4M48L 1J18A 3HPLB 1GOHA 5IV2A 2CO7B 1T5XB 4QXTA 3VFOA 4AH2A 1CGUA 3SE4C 3FOMA 4JE4B 2WBKA 1KJ2B 3PP3K 2ESVB 3BZ4A 1L0YA 4TRPL 4NCC1 3DMMA 4M3JA 3VXNA 3PIQA 1TETH 1U2HA 3ARFD 3P11L 4JO4L 1BQHG 4K7PH 1DE4B 4DGYH 1NAKL 4LAQL 2FCBA 4G9DB 2R15A 1EO8H 1I1FB 1CDJA 1T1YA 3PWNB 1UXSA 1YN6A 4GG6B 1WICA 3IKKA 1T21A 1V7NL 1K5NB 3EZ8A 1GSMA 4XXDB 4QCIA 5LCVL 4ZG1A 1Y6KR 4G6ML 5CBEB 5GRVL 1HHIB 4N0UE 1RZ7L 1FFQA 1I9JL 3G5VB 1CS6A 1J1OH 4NCC2 3KLDA 1QRNE 1C5BL 4DJMA 2VTFA 3HR5B 2HH0L 2C5DC 5MEOB 4B41A 1MCNA 5CP7A 2DOCA 3SCMB 2YPVH 2Q8AH 4MWFA 4GMSL 1QSED 2Q3AA 4PRDB 2WINB 3LRGA 3S97C 3QI9A 1JHKL 4M7KH 1NMAH 5GGTA 3SQOL 2JK5A 5SWZA 2R23A 2F53E 1VGEL 4J23A 3MV7A 4RFOL 5CIPH 1IAIH 3RL2A 3UROR 4MQXD 3DX8B 1D6VH 3BX7C 4JKKA 5IIEA 1N6QH 3V5KA 1R5IA 4HEME 1P84J 5GS1B 4PP1C 1BQHA 3BKCH 5E9DE 3PWLA 4XGZA 3REWB 1LWRA 1BQLL 4NNYA 3U30C 3GBMH 4M43H 4QRRD 4EUPG 4U1SB 1T2QL 2CDEA 1LE9B 5IF0B 1HH6B 3SN6N 4F9PC 5F6IB 3MUGA 1JRHL 5I30H 3MLTB 2APVA 2DF3A 3RWJB 5C70A 5I1CH 1L6XA 2IADB 2BSED 3B9VA 1QHOA 3RZWA 2X1PA 1VADB 4JPKH 2AJVH 3H9SD 4NQCD 3TVMB 5T3ZE 2F5AL 4JO3H 2XTJC 3QHTC 1HNGA 5FK9A 3LMJH 3VXTB 1AE6L 1E6JL 4Q0XH 3CFCL 5E6YA 2E7BA 4XNUH 3WNOA 3I84A 3B83A 3SE9L 1PZUB 1GGIH 2DM2A 4LCYB 5E00B 4XNMB 1KACB 4HUVA 2CRMA 4OSUH 3MLUH 4MAYC 3MJ9H 2DWEB 2VXUL 4RGOL 4QRSA 3OXRB 4ZPTB 4D0CB 3QCUL 5J6GB 1DL7H 3CDGA 3MJ9A 4G8EA 3KNBA 4NFDA 2R0KH 1MHPH 4KROC 4NKDA 2W38A 4Z7WB 4NZRH 2Z4QB 3IGAB 1DQTA 4EDXA 4P23B 4O4YL 4H1LH 1G6RH 5BRZB 3MCLH 1HHHA 1MCBA 2KDGA 2NQCA 4HFWA 4DEPC 4M6NL 4RIRB 1LNUA 1OTUD 5JMRA 1B4RA 3T2QA 1F97A 4APQD 3IXTA 4MLIA 3T65A 5C2BH 2V6HA 2GITB 1FIEA 3L5IA 4E5XA 1IAMA 1W0VA 5IV2B 5EORH 3TVMD 4I48A 2DRUA 2ZOKA 3CFEB 4NKOA 1A7OL 1CTOA 2GT9B 4CU6A 2C9AA 5IVXE 5KOMC 5IQ9B 5CJQH 3F12B 1AIFB 2Z4QA 3IGAA 4J3SA 2X89D 4J4PD 2MOVA 4O58L 2HT3D 5DQDL 4LSUH 3TEUA 4OCLC 3BJ91 2ZPKL 2V5MA 1JGVL 1A4KB 5IMKA 5BS0E 5E9DD 4QRPE 1ZLUK 2KH2B 4ETQB 3M8OL 3W82A 2H1PL 3L95B 5FB8B 4NQCA 4RX4A 5E5MA 3WE6B 2F54E 2NXYD 5K9JL 4AEHH 3RNQA 3VXOA 5BV7B 3MV8E 4X5WB 4XVUD 4XP5H 4LGPB 3FN3A 3LOWA 1Q9KA 3REVB 1J0YA 2I60L 4XWGL 3S5LG 4ACPA 4NO0B 3IF1A 4ZOAA 2A77L 1JZ5A 1DP0A 2GTWA 1ETZA 5IB1B 1T1XB 3R0MA 3TO4B 3WKNA 1LEGB 1F3RB 5D7SL 3ELAT 4Z7VA 4JM4H 5HYIA 5L88H 1JGUL 2DDQH 5JA9A 1J87A 4HUUB 3ROLA 4WFHE 1T03H 5GJSL 2W91A 1G9EA 2VE6A 1T5WA 1BZQK 2IALA 4ODUB 3GMLA 4BQ8A 2NYYC 4WHTA 5FYLD 5I73B 4H0GA 1KJ3H 3BGFB 3MYJA 5D7SH 4FN0A 2J1KA 4YE4H 1T89C 4YO0A 4GRLD 1BOYA 4TOYH 3GRWA 2YN3A 3C6LA 1OP5H 4JFPB 4OZFG 3U30B 3HZMA 2XNAA 4PJEB 3SPVA 4XP5L 3H3BC 4X9IA 2APTA 4PY8J 4AEHL 5BV7C 4Y89A 4QY8B 3FQXB 1XR9B 3Q6FB 2BERA 1U8MA 2LAGB 3V5DA 1ZLVK 1JGDA 5DEGB 4P9HC 1JGVH 1F3JA 1H5BC 4GG6F 1N3NB 3X14A 4LSUL 3D3VE 2VN4A 2EXYC 3AY4C 3BKYH 4PR5B 3LB6C 4DAGL 3OKMA 1AHWC 3L5HA 1ZGLP 5F7YC 1X4XA 3C6LD 4YBQD 3EYQD 4LHUB 5MERB 5ACMA 3TT1H 5IVZB 4HZLA 2XG5A 3HR5A 2FDBP 5T5FH 4P5TB 1K5NA 5IVXB 2MFNA 5D1ZD 5DK2A 5KSAC 4XVUC 4FZEL 1NH6A 5BW7A 3DX8A 1KCKA 4XBGB 2F8OA 3WJJA 1Y0LB 5F3HA 1X5IA 5C9JA 4FTVB 1G9NC 4QKXB 4CUCA 3GIVA 1HHGB 3UTZB 3T0WA 2PYEB 4O4YH 4J12A 4JFFA 4N5EC 1HOCB 4TNVF 3E6FB 3WO3B 1J10A 1S5HA 2H6PA 4GLRH 5JUEL 5EO0B 4L29A 1KF9B 2MJWA 3QRGH 2W60B 5EC2B 1I8MB 3I3DA 3HG1A 4C56A 1RUKH 3UYRH 1FYTE 5HHQB 4YPGA 1ZVSB 2VKXA 1FG2A 3MUGB 1OGTA 3P30L 5L7XH 1JWUB 3H0TB 5HY9B 3CFJB 5D2LB 4XC1L 2Q7NA 1CL7I 4K94C 5HVWA 3NIDE 4R26L 2CXKA 1SEQL 5LWYH 3A67L 1YYLL 1E4KA 3EFDH 2YD3A 3RKDD 4E41E 5IGXL 5J8OA 5I76A 4I3RH 2VLRB 1NJ9B 2YBRB 3BGMB 3SDXF 1MFNA 1GGCL 5IG7B 1YJDC 2NY6D 2AEPH 5E94B 4ENED 3NZHL 4E42A 4NQVB 1UH3A 1YEEH 4OD2B 5F3BB 3CVIL 2X10A 2FBJH 1MFAL 3MV01 3SCMC 4ZUUB 1NBVH 2DLEA 4PLOB 3OAYK 1JRHH 3E2HB 8FABA 1CGXA 4HFUH 4R2GD 4NM4L 4WI8A 3H9SA 3GIZH 3SCMD 4M43L 3D3VB 4L8SB 3KG5A 1GAFL 2VB5A 4K94L 1TVHA 5SV3A 4MNQD 3STLB 4EI6B 5C09B 2F19H 1K4DB 4WDIB 3BKCL 1NC4D 1MFEL 4JFDB 1V7ML 4ESKA 1UM4L 1KB5B 1SJHB 4GS7B 3GHBH 4Y16D 1AO7B 4JM2D 2JCCF 2UY7A 3GMRA 4UT6L 4XCFH 2X4RA 2GI7A 4YLQT 3SQOH 5CJOH 1AR1D 5KSVB 3UPCA 4MA7H 5E24E 5F96L 3QJFA 1E6OH 1JNNH 4LEOA 4DKAA 2Q86A 1EMTL 4FTVE 4KK8D 3FQNB 4OB5H 3CFKA 1K8IB 4YDJA 2R1YB 3MRQB 3I3BA 4I3SH 1UJTA 1N5YH 5K93A 1I7UA 2ADJB 4JY5L 1YZZA 3RVWD 4AEIH 3KYAA 4G5ZH 4RMRA 4XBPA 4R97C 3QEGH 5JTWA 1PKOA 1FL5A 2IFFL 2QADB 3GSQB 5DA4A 3O2WH 4JY4A 3U1SL 3GMRB 3GSVA 1FO0H 2P8PA 1MI5A 3H7BA 1NAKH 2GJZB 3SDCA 1PSKL 1MH5A 5M95B 1NGPL 1HI6B 1UVQA 4JPWL 4QOKD 1QEWB 5HVFB 1F3JB 1JZ4A 4AYFA 3MGOB 1DBJH 3PGFL 4JLRA 1F4WL 4MDJB 1A6VL 1Q9WB 4I18B 3RWGA 3MLRL 3DRQB 2R0ZH 2VLRE 4JFDD 1QLFA 3ULUF 3MJ8A 4XP1L 4XPFL 4I18C 1EXUB 1B6DA 4U3XA 2VL4A 3RVVD 5F7LB 3UJIL 2VQTA 1H9VA 2O5YL 4MCZB 4X8XA 5MENB 2RFXA 4KQ4L 4HUWA 1CDHA 5I2IB 4KZDH 2K1MA 3TO2A 4GG8A 1EO5A 4HXAL 1CE6B 2A38A 4JPWH 4RMSA 3ZYJA 3J7HA 3ARFC 4HIXH 2AK4B 1YMHA 4PREA 3C60C 4LKCA 1YUHB 2ZUTA 4QGYA 3FFDB 2R23B 3QAZC 3U1SH 3WIHL 3HNVL 4MA3B 4MQ7A 2QL1A 1HOCA 1UXWA 4LKXB 5FV1L 3IFLL 1YN7A 2EEAA 3GSNL 1U92B 1O5DT 2D31B 1AD0B 3F7RA 4G5ZL 1B0RB 1WTLA 2C7UB 2BJML 4RSVA 4AEIL 3MJ7A 4XNZC 3BH9B 4RDQF 43CAB 3NCYP 1CGSL 2EE3A 5F3HB 1INEL 4N0UA 1WVZA 3PQYB 1ZGLA 3VXRA 3OKLB 2HKHH 4HZAA 1WFNA 4I0KA 5DHVA 4MDIA 1NANI 1NGZA 1J05A 3MRKB 5KVFL 2XQBL 3DXAE 3L6FB 3G6DH 1OAQH 1E6OL 3PV7A 2R0LH 5DFTA 4POZC 4CMMA 1RSFA 1G7QA 1RK1B 4Y5XA 4IOSD 3HAEH 3PF2A 1YN7B 3GHBL 2VLJD 2FX8H 2YA2A 2LAAA 5JO5A 4M4PA 2B1AL 3T4AA 1NL0H 2B5IB 4CVUA 4ZNEA 3GMQA 3O11B 2DQCL 3T08A 3OF6D 4NM4H 1TTFA 2AXFA 2IGFH 1UWXK 1U42A 4QO1A 4R7DA 5DHVB 3U0TB 4OJFL 5DDHA 2ZUXA 3TZVB 3MV9D 4PJDB 1QKZH 5C0AA 2FGZA 2NCMA 1J0IA 1U8HA 3TESA 3AGVA 4NYLA 3IU4L 2DLIA 1RHHB 4NKIL 1C08A 3O3DA 1IEBA 1MJ7H 3HRZB 4YR6B 3HCVA 3JTTB 3RDTC 2YEZB 3LV3B 1XGPA 4X4XA 2AEPL 1YQ2A 4EDWH 2QSCL 5IJVB 1XGQB 1KLGB 4LHJB 3H9ZA 3P9LB 4APQC 1R6VA 3V0WL 3EFDL 2IBZY 1MCKA 3OF6A 3NMEA 1MIEL 1YPZF 2VISA 2CH8A 3BGMA 2DWDB 4R26H 3FO2B 1S7QA 4XCYB 4NT6A 1K6QH 5FHAL 3SEPA 5GRJH 3F8UB 1S7QB 2WUBH 4MD4A 3UYRL 3TYFB 4TTDD 3GK8L 2IH3A 2XT1B 1EJ6A 1YYMH 2QR0B 1NEZG 4XPHH 3T4YB 1ERNA 2X40A 3NA9H 3ARPA 3QO1A 2C1OB 5I66A 4W70A 4PG2C 1I3RA 1PGRB 4X83A 3HUJE 4WVRA 4U6HB 4BKLA 4XAKE 4OLZL 5E2TL 4XHJC 1NGQL 3KPOB 5CJXA 3LRHA 3P73B 3VFRA 5LXGH 4DCQA 5HDLA 4XC3H 1W72H 1S3KL 1JIBA 1JPTH 2ZJSH 5TE7L 4LAJH 3OWEA 2V2TA 5D4QA 1G0YR 2D7MA 1VDGA 4PLJD 2X1QA 3LKQB 4B7LA 2PXYB 3GM0A 4HUMB 2H45A 4QXUL 3EO9L 4P46A 3VWJB 2J5LB 2YSSA 3OPZL 3P77B 4TNVK 4D3CH 4PGCA 1H15A 4S0TD 1CQYA 4P57B 1DVFD 3AC0A 4HIIB 1OW0A 2NXYC 2SEBB 2VAJA 4M7JL 1MY5A 3RWDB 1S5IL 1N64H 4NUGL 1BD2B 1DBKL 4HBQA 1U8PB 4L8DB 4UT9H 3GNMH 1I1AC 3GZKA 4YNYB 5HVHB 5J6HB 3GSWA 5FA3B 3ARUA 1I7ZA 3C8DA 4YUEL 1TVBB 3FFDA 4PG9B 3ZDZF 1G7JB 1FP5A 5DJ8A 1QSFB 5H2BA 4YGAB 2J12B 3UDWC 5SWSA 1KGCE 1QP1A 4ZO9A 5J12B 2NY6B 4Y2DD 2FO4A 5IWLA 1MCRA 5TFSL 5F6IC 5IB4B 5ISZD 1AQKH 2FZ3B 3D39E 3U0PA 3OL2A 4DUXA 3UZQA 3QQ9D 3SBWC 1NKOA 1T03L 4OZIE 2OCFD 1F4AA 1MLBB 2AAVA 5DJCB 3MJ6A 4OCWL 4ZOEA 3BH8A 2Q6WB 4PJFF 1IMHC 2ZUWA 4OF7A 4XVSL 3P9MB 5C0BE 1KLUB 4Z7UE 1ADQL 4LSPL 4F7EB 2BFVL 4LSDA 2GAZA 1H8NA 4YHZH 4MAYD 5A43C 3FB5B 4R2GC 1Q0XL 1FZKA 3S36L 5IMOA 5SWZE 4Y7MA 3FO9A 5D2NE 1YEGH 1Q0YH 4G9FA 1UCBL 1LGVA 4C54A 2GTZB 2E3VA 3PG2A 4PJ8A 3QJHB 4TNWF 5F1SA 1MCOH 1YEDA 3RGVA 4JHAH 1J5OL 5J11C 3PDOB 4M1DH 1V3KA 3G5XA 5FYKH 2NY2C 4G43A 2DQTH 5DJCA 4HX1A 4KROB 4WI9A 1S5HB 3RRQA 1L9MA 2YOCA 4OGYL 3ECBB 3U0WH 2OXGA 1RD6A 2ZUVA 3G6JE 5EC2A 4XWOC 1FFNB 2CDFB 1A7OH 4X99A 4N90D 1I3GH 4P2RE 3SCMA 3D69B 3VFGH 4Q97A 2E7HA 1YEIH 5ESQB 2BVOA 4NNXB 1ZS8B 3HFML 2XZQH 5SX4H 5C2BL 1PFCA 4HIJB 2NY4C 2EE2A 5J13C 4LF3B 3TZVA 3QDMB 3KGRA 4PRPA 3RWFA 4U6XB 5C0BD 2X9XA 2XZAL 2J6EH 3H9SE 3AS0A 4YZFE 4Z76B 3O41A 4ZDHA 4PJFB 6FABH 1KCVL 3DV6A 1CDUA 2FIKA 5FUZL 2YZ8A 1QFWI 1KELH 2DYPB 1YNTB 2CLRA 1K4CB 3HB3D 3BMVA 5CLTA 3EYSH 3UTTA 1BVKB 1ZTXL 3NPSB 4HF5H 2M26A 4QHNB 1KJMA 2AABL 4KUZL 4YFEA 3GI9H 3PGCB 4FQXC 2YD8A 4RQQA 5DC9B 2VABB 4JCMA 5DJ0B 2OL3L 3SY0A 1D5IH 1SBBA 2CUHA 3ALPA 1GGIL 3ZKXC 3QDMA 3GHEH 4NUJA 3STLA 2B1HL 3DOSA 1H8SA 3PHSA 1TCMA 3QIUB 4K7PY 4OF5A 3EOTH 1OF2A 4ZTOH 2NX5D 3ARFB 2F8XC 1NANH 4RFNB 1NCAL 3O81A 2XN9A 3U83A 1GHFL 1JPGB 1UWGH 4AT6B 1UZ6E 5JXEC 1CBVH 4X7TB 2ZNWA 1MFDH 3OXSB 3JV0A 2VWEE 3T0EE 1MCPL 4UILL 4JQVA 5GS2H 3O9WD 3QO1B 1QA9B 4P4KB 4QXGL 1B88A 1KCLA 2JJSC 3L3OB 1A0QL 2QHRL 4LCIL 3TYFA 1HILB 3GKZA 4CVXA 4PRAA 2JCCA 2I9TB 4Y1AB 1N6UA 1T2QH 4HUKB 4PGJA 1P1ZB 1LMKA 4M7LT 2EDJA 1YNLH 1BQLH 5LBSH 3VXRE 1CF8L 4NKOB 3VG0L 3HMWL 3R1GL 1AXSA 4KKBC 1QSEB 1QUNA 5CJ8A 2Y5EA 3S88H 2LQRA 2VWEC 3C87A 2BCKA 1MLCB 3WXVL 4E0RA 5DJZA 4R9HA 5D93B 1XZ0A 3LH2H 4HCRH 4U1NA 4CMHB 3CK0H 4RRPA 3WFCH 3JWOC 4H1LG 2KQNA 2IPTH 3NBNA 1A9BB 4APQB 4Y2DB 1FGVH 2DQDL 3QPQD 4P3DA 3KPQA 2NY7L 5AAMA 5FCSH 2Q8AL 3UZEA 4UV4L 3ULUC 3QYCA 4PJAA 1KT2A 5JOPD 4PP2B 4D0DB 3B9KD 3U6RA 4Z7VE 1NLBH 5ANME 1WLHA 2A1WH 4DN4L 4IOFC 2OZ4L 2CPCA 2F8VA 2HRPL 1IGCL 4G6MH 2GUOB 1BX2B 2A6DB 1MELA 3U7WL 1UACL 3FT4B 4MD0B 2EKJA 2JJWA 4HIIA 4ZFGH 5I71B 2PO6A 4XTRD 2X89A 5DJXB 2GUOA 4TUJB 5DK0B 5EU4B 1Y18A 4MAYB 1KBGH 3MOAL 5E4IA 4XCNB 1YMMD 4U7SA 4DGYL 5F9OL 2I26N 4FQQB 2J8UA 3K81A 1LO5A 3NGBC 3CH1A 1JHTA 4HKXB 4XP9L 4HH9A 4P4RA 4TRPH 5GRWA 4KK6D 4Z5RA 4P2YA 4BK4A 3P2TA 4XMPL 3QUXD 5DYOA 4DVBB 3V4PH 3FO0L 4IRJD 3AUVA 4DQOL 1L7IL 5FKAB 5D7IB 3EYQC 3U9PL 4CL7A 1M05B 2A6DA 3EYUH 4K23L 1H3XA 4G9FB 5INCA 3DUUA 2WWKO 4YHKH 1W8OA 3C6LB 3K2UH 2G75A 3DUSB 4HMDA 4LHUD 4LNRA 2F74A 3HTLX 3HI6L 4QHKI 3FL7A 2IH1A 3P9MA 3O4LD 1JHLH 1XF4A 2DQGH 2B4CH 5CJBA 2IALB 2RIKA 1EEUA 3L9RB 4M62H 4U6YB 2K3TA 4ZAKD 4YHYC 3TT3H 3VH8B 2BNUA 4YAQA 3KLHC 3FO1B 1HINH 3HZVB 4F15B 4MVBD 2WP3T 4I4WA 1IGMH 3BPLC 4M61A 2HWZL 2YXFA 4OT1L 4XNXL 4PRID 3DUUB 4PS4H 5KVGL 4JAMB 5F9JB 4PJDE 3D85D 1LE9A 5EZJA 5LKNA 1SJVA 1Z3GH 1Q8MA 4PJDA 2W0FA 3CMOL 3OKNA 5DFWH 3BEWA 1UB5A 4YHOH 4OCXH 4F33A 1SMOA 2OBGA 4JFEA 1D9KC 3H3PH 3NFSH 5I17B 3ZKXB 1A4JA 3I75A 3RAJL 2XKNA 3QUXB 3WFHA 5C0CA 3DRTA 1BZ7A 2X4UA 3KWWA 4I0PA 4XCCL 3QCTL 4OLXH 4U1IB 3PWNA 3TJEL 3OHXA 5H37G 3FHQA 3OKMB 1EH9A 1T20B 1JPGA 4JRXD 3ARDC 3MXVL 3GB7A 1VACA 3MLVL 1OM3L 4U1GB 4EBQL 1S7WA 1PX3A 3UJJH 2HVKA 2FEEI 1UJ3A 4NC1C 4UTBH 1CR9H 4P59H 4RZCB 1PD6A 1MAMH 1E27A 3BPOB 4KI5E 3D6GA 3DO7B 3NCCB 4LPYA 3BSZL 4UDTA 4KJWD 5E6IA 3RWFB 2YRPA 4I2XE 3ESUF 3MXWH 5EIQA 3MLSH 5EBMB 3M1BA 1F4YL 3CX5J 3I02A 4M4RA 3VD7A 5EBLA 2HT2D 3CC5A 1MCWW 1Q94A 4GRWF 1KN4L 4TPRL 2FD6H 2UZIL 5JHLL 3OB8A 4PJCF 1RIVH 2VISB 2OZ4A 3O3UN 4G9FE 3L3OA 4MQSB 4HKBA 1J0KA 5E7BA 4L8CA 1XGYH 3WN5A 3ZTNH 4PJHF 2P8LB 3B2UD 4K3JL 4QRSB 3G5ZB 3PABB 4EI6A 5JIIA 4K2UH 1A1OA 2W9DL 5D1QA 3S36X 1BBDH 2ED8A 4O02L 4IDJL 4BSWB 2BCKB 3WIFB 3C5ZD 4OKVA 5BXFA 4QRPD 5D1QB 1RQ5A 1QLEH 2Z31A 2ORBH 1BFTA 4TVSa 4DKEH 4KDTC 1P1ZA 4HPYH 4DKFL 2A74B 4KFZC 2G2RA 5FHBH 3VXQB 4CU8A 1AP2B 1I8LA 2P1YA 2OQJB 3MBEC 1PQZA 3P0YL 5SWSE 1AIFA 4BSJA 1R5VA 1YMMB 3V5HA 2CQVA 5FYJH 2VDRL 1RZJL 3EOYG 5E5RB 1NCBH 4S1QL 2YPLB 4OCMC 3LS5L 3HI5L 1FL5B 2GITA 2HJKA 3TYGH 1P7QB 1TZIB 2FLBT 3HC4H 1UADC 3F7VA 4P5KA 1ZSDA 4F58H 2NY5H 4X5XA 5E9DB 3QXVA 1IM3B 3DSFL 3TNNB 2CKBH 5T1LD 1RUPL 4JO2L 4UQ2A 4XMKH 2IMNA 1HH9B 4M6OL 3ZE2F 3LSOB 2V5SA 1CFQA 1XF2B 3KS0J 4D9QD 3OR7B 1N7MH 1AKJB 5JHDE 3FTGA 1DQQB 1Q9LA 4KZEL 2D4FA 1RJLB 1MI5B 3PP3H 5F21B 3MR9B 5BO1L 4I2XB 2J8UB 4QNPF 4DTGH 3GRWH 3GSQA 3ISWA 1QFHA 3TO4D 2FO1A 2NY3C 5EU4A 4NQDD 1KJ2H 1NDGB 5D2NB 2ZUSA 2EH8H 2EIDA 2AK4D 3CFEA 5CUSL 3PWVA 3LKRA 1JTPA 4L5FH 1IAOB 5DMIL 1OGAE 3BDYL 1WZ1H 4JAMA 4L8SC 1U3HB 2COQA 4IMKC 3X11A 4WGVB 4TQEL 2HT4C 3K74B 2YRLA 4HT1L 3N1FC 1H3TA 5I1EL 1MRCH 3KYMA 1VEPA 5FA3A 4BQBA 4DUVA 4KXZI 3QO0A 5GGVL 4ODSH 2QSVA 1DQQA 4KWUA 2G9HA 2QLVB 4XI5C 3A0OA 4IMKA 2IPUG 2CDFA 4ZS7L 2AK4A 1WFUA 3JTSA 4IOIB 5FGRA 4WI3A 2XPGB 3WL9B 4OCRL 5IP4A 5EU6E 2Z91A 3FMGL 4BA8A 5LGKA 3I6KB 4QRQA 4XRCA 1EVTC 1CTNA 1P6AB 2VDLH 5L8JB 2YD4A 3OKNB 3FB5A 2C4XA 1AY1L 5DD3H 4Y16B 5D7JC 4HUXA 4NQSB 3EDDA 2ADFH 4QTHA 1TJHL 2RCSL 1M7DB 4JFFD 2YD1A 5CCKL 5T5NG 1NCDH 1YJDH 3PE9A 3MX0A 1CXFA 5FYKD 3O4OC 2GJJA 5HI5D 1GC1L 1KC5L 3PQYD 4EI5B 4FNLL 1A2YA 1A3LH 3JWDH 2AQ2A 5EB9A 2VAAA 2R1XA 4UMGA 1V3MA 5DD6B 4Z0BH 4U33A 2DQFA 1LDPH 1PG7X 3ULVE 4H25A 1ZT4B 5F97E 2BOCB 4JG1L 5DD1H 3PWLB 3REWA 3FQUB 4PJIB 3NCFB 4MHHG 3U4BH 4WTXA 3M1BB 4H88L 4ZSOE 2AXFB 3DBXA 2EEDA 4S1RH 2J8UE 2MTPA 4PUBH 3N1MC 4HWZA 4LSQH 3TIDA 3QDGD 4WO4B 1FNLA 5IHZA 3BZDA 1U58A 3DVNA 4GH7B 4P23A 1F8TL 4F37F 2ZUQC 3E8UL 2GSGB 4ZFOB 5FYLH 1ZT7A 2AJSL 2J8OA 1T7WA 2B8OT 5C9JB 2EEBA 4AZ8A 2D9QB 4HG4J 4PUBL 1IGFL 3WLBA 3KPRB 3FFCA 2BP3A 4S1RL 3D25B 1N5AB 4HUVB 1RFDL 4X9GA 2YN5A 4OLUH 4E0RB 4Z95L 5ICXA 4NP4H 3UTSA 1P7QA 4FQJL 3BP4A 3MYZA 5JQ6L 4PJ8D 1RV6X 1OAKH 2JB5L 2ZOLB 3C6SA 3T1FB 3RUGF 3WKML 5HHNA 3ARBD 4F9LC 5JW4Q 4NC1E 4G8FA 3QG7L 2R2HA 4ZPVB 3TBWB 3H0TA 3L5WA 4KKLC 4OV5B 3ORJA 1I3RB 4KMTL 5C07B 4ELKB 1R5VB 5D8JL 2P4AB 4Z0BL 4C58B 5E6IC 4J3OC 3T0XA 2AJ3B 4CGTA 4NN6B 5KVDL 1BD2D 2G2RB 4ZUTA 3QFJE 1Q9KB 5KS9F 3ARGC 5GGTH 1AR2A 4JM2F 3TN0C 3VXUA 1EAJA 4KTDH 3GSXB 4R90L 3O3EA 4CW1B 2GSIA 1IAOA 5L9DL 3ILQD 1YMMA 3V5HB 5I9QC 4KRLB 3UC0L 2HA1A 4NO5B 4JKLA 2BY1A 4PJAF 4HKZA 2YXMA 3FMGH 5GRYA 1UH4A 4PJIE 1MLBA 3RDTB 2F54A 5ID1A 3OAZK 4ZS7H 2B2XH 1W0WA 2MQ3A 1G7LA 1P7KA 4QLRA 3QEQB 1FL3A 1QSZA 2BK8A 1Z9LA 1BP3B 2BZDA 1NSNH 3LHPL 2F5BH 1XF2A 3MRFA 5IM7B 2VXVL 2BNQA 4OCSH 3BWUC 4G8IA 5JHDA 1BJ1H 2FL5A 3QUZD 4WCYL 2NX5E 1WZ1L 2W92A 1TJIH 3ILQC 4DEPB 4JDZB 4L5FL 1IE5A 4UUJA 1S7SB 5MEPA 2DIBA 3TIEA 3FQTA 5TE4L 1J88A 1MHEB 5B39A 5BQ7B 2GJZA 3W9DB 1T1YB 2EH8L 5HYEA 1KJ2L 4PR5A 4OBRA 1CDYA 1X6NA 4WV1C 4RX4D 2D03H 1BFVH 5E6ZA 4PFEA 4PJBA 2IQ9H 1KIPA 4RAVB 4GAJL 4HLJA 1T3FA 1J1XL 2VO5A 2XOTA 2DTSA 3DMMB 3MLZH 3Q6FA 4KAQL 2GW5A 3QJHA 2EIEA 4KDVA 5E03A 5GISL 3UTTD 4WI2A 3WUWG 5C0EA 3MJ7B 5IMOB 2P45B 2W9LA 2D31A 3O0RH 4N0UB 5JXED 4M5YL 4F57L 3L3HB 1BVLA 3BP7B 3BP5B 2VITA 1DE4A 4Y16A 3TP4A 1NCBL 1IM9D 1KPUB 1X5YA 2DMCA 1YUHA 2QKIB 4XX1E 3OJDA 4L3ED 2VDRH 1KULA 2AEQL 2R1XB 1KPVA 1SYSA 1XIWD 2JELL 5K59E 1H3GA 5FO8A 1B2WL 4R96A 2ICEB 1F6FB 5DUPL 3MGTA 1TIUA 5IMMB 1HSBA 2XACC 5E08H 4NM8H 4MA8L 1IEAA 5FHBL 3BEWB 4XP6L 2QV2A 4YHML 1VGKA 1TLKA 4PGDB 4X0KB 3ARSA 4FXGA 4XNYL 3QQ3A 2VYRE 4KVCH 2GTZA 4JKWA 5GZOC 5DQJB 4I0CC 5FM5O 5B8CA 5DC4B 3SJVA 2BVYA 5IBLC 3ZO0A 4U1SA 2OR9L 4IJ3C 4IDJH 1OQOA 4AM0B 4YPGB 3DGCR 3QEQE 5GSRB 5CZVL 3AREC 3DIFB 4FFYH 3NACH 5J12C 3JWOL 1PDKA 4Q9RH 3LKOB 5FGCB 1Q1JL 1QD0A 2Z0BA 3C8KB 2FNBA 4ODHH 4L8BB 3GB7B 1QFWM 5I1JH 3VRLF 2UWEA 5K9KB 2JF1A 5IHZB 4ONOA 2YD6A 2FIKB 1VKXA 3BQUB 4TUOB 3ET9F 4V1DB 5I8CA 3S9DB 1K4DA 2JJSA 3T0ED 2AKRA 1G7IB 1PLGL 3MNVA 5EBMA 1WBZA 1U9KA 2EDFA 5FM8A 5E1AA 5TF1H 3T4AB 5JXEA 3C5SA 5MENE 1VACB 1O7SA 4WFFE 1I9RL 4R4NC 3AROA 4OIBA 3L3KB 4NPYB 2HVKB 4Q9RL 4Q6YA 2R9HC 2XWJA 4MMXC 5CEZL 5C3TA 4LPUA 4NRYB 2E8YA 3CDGB 3HE7B 1P4BH 3OJVC 5FYJU 4ZAKC 2C3WA 4DCQB 2DQUH 4GRMA 4MGXA 5D7LB 4ZO7A 2OR9H 4XCCH 1F42A 4PB9L 1BX2A 2DLTA 3F7VB 1QR1B 3LEXA 4PJEF 2QR0A 4G7VL 2W65B 5CKAA 1G0XA 4PGBA 1WBYA 3BWAA 2VXTH 4NKMB 1U91B 2X5PA 3LEXB 4YIQB 2JTDA 2VLLB 1KT2B 4NM8L 2PXYC 4NO2B 5KS9E 2F54B 4NQEE 4HWUA 5DUPH 4ZUWB 4BQ6A 3UBXG 4U6VH 4X8JB 4G6JH 3VG9C 1Q9WA 4RAHA 4LQ1A 1HINL 1OP3H 4M8QA 1FL6B 3OB0K 3ZHDA 1GGYA 4M62L 5D72L 1FZMB 3NCMA 3VFOB 4AH2B 4F57H 4GT7A 1KEGL 5EC1A 5IB1A 1X44A 5KJRL 2HFTA 1RIHH 2FX7L 4PRPE 4X6CB 1H3PL 2HFFA 4FP8H 5J1AA 1IKNA 3SE8L 4JGJA 2ESVD 4Y4KC 4XZUB 4IMLB 3RQ3A 2VDOH 1U8KA 2WBJD 4KGLA 5FGCE 3BWAB 2AEIT 4XTRC 2AGJH 3E6HB 3M07A 4NBYB 5CBAB 1WT5C 1FGNL 4GKZA 4M00A 4BUHA 2APWA 1DVFA 2VXQH 4Y5VC 1XF5B 3QA3A 1JHTB 4HKXA 4X6BA 2QKIA 1IL1A 5GGUA 5B39B 3HMXA 4XCNA 4PJGE 1VB9A 2HP4A 4Z5RB 1CLOL 3WDIA 1LO3L 1E0OB 4YH6A 1KN2H 3KYMB 2OTUA 3MOAH 3TNNA 1G9NH 2XY1A 2Y72A 4WCYH 4TSAH 3NZ8A 4U1LB 5I0ZA 1M7XA 2OLDA 3GDBA 3HZMB 4ZFGL 5IMKB 2PTTA 4F33B 4EN3B 1LO4L 3RL1A 2YPKA 5DMYA 3QFJA 4IRZH 2V2WA 3NABL 4HS8H 2HRPH 4NO3B 5KW9H 4KKAC 5DSCB 5EA0L 2A1WL 1DLFH 2VDQL 3L1OL 5I1DA 4CRPA 2HTLC 1FIGH 4M61B 4NQXB 1U8MB 4FQLL 1IEAB 2DKUA 1HHJA 3ES6B 5C6TH 2NY7H 5TQ0H 1OCWL 3UDWA 2BNUB 4ZOBA 3X14B 5J13B 1MCHA 1C5CH 2AK1H 5BJTB 5EG6C 1EHLL 3SKOB 3FRUA 3NZ8B 3CLEL 3MUY1 3FQXA 5F70A 3VRIA 3DETC 1N4XH 1OARL 1GGBH 5ERWA 5F9JA 3RA7L 1UGNA 5L0QC 1T83C 2XZZA 4OM1H 3F62A 2D0FA 5GRVK 5BS0D 5JPNA 3CZFA 5AD0A 3L7EA 5JA8B 3NH7H 4OLVL 1YNLL 5T1LA 1U92A 4YJZL 2NY3D 1FG2B 1ZT1B 5FCUH 3HPJA 3NPZB 5D8JH 4KK6C 2PCPA 5SWQB 4HKBB 5KSBF 1VENA 4L29B 2GK0B 4HV8A 4L3CB 1KTLB 4WI7A 4OF3A 4WW1B 3TA3C 1MCPH 4UILH 4XNMA 1KCUH 4ERSH 3VWKC 1RHHA 2RB8A 3RGHA 4LMQE 1OHQA 4OLUL 5T3XD 3FCTB 3AB0C 3U0TA 5IKCB 5DT1H 3K8KA 2EYSA 4CU7A 5GZND 3FOLB 1F4XH 3S35H 3ULVD 5IJVA 4OFKA 4IIQC 4UT7H 2Z93A 4RZCA 1BVZA 2XN9D 3DURA 1RURL 3V5KB 5FYLL 1IKFH 4ZFOA 5DK2B 4F7CA 1HYSC 1PBYA 5DA0B 5JXAL 1E4WH 4FQPA 4QRRB 5CZXC 1KJMB 3STBA 3GGWB 1ES0B 3EYSL 2FIRT 5DRXB 5HPOA 3ARBB 4HK3J 1MHCB 4XWOD 4G8EB 1MWAL 3MUJA 4CNIA 3P4MA 3R06A 1U8LA 3PWUB 2ZOKB 6FABL 4WWKC 2VR9A 4NQTA 3VDCA 3LAFA 3ZE2E 4LLDA 3EDKA 2R2EB 1QO3A 3QP3A 2DBLL 5I1LB 3K3QA 1JE6A 3RBSA 1W72B 3HE7A 2WSKA 1G1YA 1QSEA 4KKCD 5I73C 4JFZL 1YECL 3OAZH 3MV8D 3LKQA 3C09C 3GSWB 3EJYC 4KI5D 4PP2A 4BKLB 1CXIA 4AY0A 1AGCB 3BYYA 5F1OB 1K8DB 1ZEAL 4IDLA 5GIRB 2JJVA 4MA1C 4CVXB 1KC5H 3O6FC 1EVUA 1AO7A 3JV6B 3NTCL 3DYMA 4UAOB 1IBGH 5I75C 4ZUWA 1ZA6B 4X6EA 1OGAD 3EYVB 4O5LH 5J6GA 3BW9A 5FYKL 3ZT5A 2ADFL 3EDFA 4K7FA 3UXFA 1T1XA 2VDMH 5C7XH 5IB4A 3RY4A 1G7PA 5FDWB 1UCBH 3OBAA 4TUKL 1WJ3A 4S0SD 3MO1B 3SGKA 1NAMA 1YEGL 4HK0A 1LP9B 1J8HB 2HFFB 3CVHB 4Y2DC 3S36H 3I2CL 3ZDXE 3VI3E 1OTSD 4AJ0A 1M7IB 4U1JB 3GJFK 2DQIH 5EC1B 1RZKC 2Q6WA 3OX8A 2BVEA 5HGDA 4OF6A 2IF7A 1S9KC 4G8GD 1J9CT 2Y06H 4J1UA 5D6CA 5KSUA 3Q6GH 1LEGA 1CICB 2WZPD 2ICWJ 1A6ZB 2DM3A 1LE5B 4JM2B 5CZKA 1H3UA 2OP4H 3RVXD 3AFLA 2O5ZL 2PO6B 2IPUK 3LQAL 1FDLH 4XP4L 1H3VA 2R56L 4TVPE 3ULVH 1LK2A 4KJPD 4J3UA 1BZ9A 1NDGA 4Z7UF 4FRWA 4YWGL 4GKSB 1QLRB 2VSDA 1A7QH 3GI8L 1G9MC 5DC0A 1UVQB 3S3JA 3IS0X 3HAEA 1OD7A 4FQXB 5C0BA 5CILL 3RL2B 1M71A 3LN5B 3ETBF 3KLHD 4U05A 2OM5A 3Q5OA 1NCUA 1ORQB 3RUGB 4ZS6C 5E8PA 1N7ML 3KYKH 1T7VA 4XPTL 3HRPA 4JRYA 1F58L 2DI7A 2YPKB 3WXWH 4K55A 1CGVA 1WQVT 4UIMB 4FQCL 4LSSH 3EHBD 1BFOA 3QHFH 3ZL4L 5E4EB 5HDBE 4HX1B 2NY5L 4UUJB 2VLRD 1I8IB 1KJVB 4M7JH 1ZOXA 5DS8A 5GGSA 4J6RL 3MNWA 1KXQE 5CBEA 2AI0L 4HC1A 1UM6L 5EZJB 2A0LC 5E8OA 1DFBH 1RZJH 4KVNH 2A73A 2VMFA 2DM7A 1OSPL 1UXSB 2FATL 1U6AL 4FXLA 3B2UC 4ZSOA 1B4JH 1WZLA 3EYOA 5TE7H 1A7BA 3KHOA 3MQIA 2R1WB 4ALAL 4GG8B 5LXGL 4EQ3A 4KRNA 1NFIA 3VFMB 4LSRH 5DD6A 1IGTB 3RGVB 2CIKB 5C1MB 1SHMA 4LU5L 1U3YA 1YYML 2Q1EA 3V52H 5D1XB 2HVJA 1BBDL 3QDGE 1DN0B 2W9DH 3NA4A 1Z2KA 4LCUA 5C8JA 5AG8A 5FUCC 1YY8A 5H94A 2GIYA 3QEHB 3S3PA 3PGCA 3MGTB 2W0KA 1OP5K 5CMAB 5CWSB 3SDDC 1FO0A 1PYWA 2ADGB 3EYOB 2VZOA 5ENWB 4MNQE 2MSPA 4JO1H 4LQFH 3VD5A 2YEZA 3G5ZA 4RISH 1CD1A 1RVFH 3UTTB 5KANI 1R5WB 3MRPB 3ULUD 3O3DB 3V7AE 4I0PD 4QHKJ 5JQHC 4M93C 5CGYC 5TJWK 9CGTA 1XGPB 4MB4A 4R97B 4X4XB 3IVKB 1CDCA 4NWTH 2YK1H 1F4YH 1FV1A 3HUJB 3MLSL 5E6IB 4ZYKB 3SDXA 1V5JA 5FKPB 2GT9A 4GXUN 1UFUA 4XPGH 1QKZL 4R0LA 4U1HA 1AO7D 3ARXA 4K8RL 1CWVA 3ZLQC 4BZ1L 2D7TL 4R6UA 2MCG1 3KPSB 4BELD 1CE1L 1Q9OA 1MWAB 2IGFL 4P59L 3WFBH 3W0WD 4HDIB 1KXVC 1MF2H 5EOTA 1S7WB 5I1GL 3IDIA 2BVUA 4GXVL 3KPRD 3KPPB 2XTLA 5DRWB 3DROB 3QIUD 2B1AH 2OMBA 3V8OA 1L7TH 3DPBA 5IFJB 1HHHB 1KB5A 4OLWH 3QH3B 5FO9A 3UBXA 2P5WE 4LLWB 4GRLC 1S9WB 2XXMB 1JI2A 1MVFA 3NFSL 3ROOB 2PF6A 1TVHB 3D25A 1RJCA 4HPOH 4A2MA 4PBXA 1OAQL 3G6DL 4OGZA 1P9MC 5IFHL 4JFDA 1Z3GL 4XZUA 2C1OA 1FYTD 5C0FA 3O9WA 5CINH 3QSKB 3WFZA 2D7TH 5KVGH 4I3GA 32C2B 3VXUB 3VWJA 3BOVA 4XPGL 4TNWK 3U6RB 5D5MF 1ED3B 3U79A 4P5KB 3T0DA 3STZA 3QCVH 2VSCA 2H32A 2BJMH 2VQ1A 3ARQA 2YUVA 3RNKB 4WRLA 4D0BA 5JIPA 3TBVB 1CICA 5A2JH 3T2PA 2NY1B 2FR4B 3F7QA 3HB3C 3WIHH 2WUCH 2DQGL 3SDYH 1JHLL 5JZ7C 5I66B 1KJ2A 1NAMB 3V4UL 2N7AA 1JRHI 1D9KB 3CFBB 1JGLH 1M7IA 4PGBB 2G75B 4DGIL 5F6HI 2A74A 5EU3A 2NLJA 4IM8A 4RNRB 4YHKL 4B7IA 1OT1A 1A7RL 3B9KB 3EYUL 2P42B 5JORB 5JOPE 5HDOA 1JPSH 2B0SH 1CFTA 5IJKC 4ETQA 5E2W<