5GS2D

Crystal structure of diabody complex with repebody and mbp
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
231
structure length
226
Chain Sequence
VQLKESGPELVKPGASVKMSCKASGYTFTSYVIHWVKQRPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMDLSSLTSEDSAVYYCARYGVRGDYYAVDYWGQGTSVTVSSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Sugar binding protein/immune system
total genus 41
structure length 226
sequence length 231
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5gs2D02
3MV9E 3VFVB 5E08H 1IM9B 3MREA 1I7TA 4Z7UB 4JZOB 1MFAL 3KXFE 4ONOA 2AEQH 4FQQB 1OAKH 1HKLH 5K9QI 1KTKE 4JY4B 1CL7L 1HQ4A 4LLWA 1NBZB 4MD0A 1XF4A 2X9XA 5FHAL 1MCHA 4WI2A 5DJ8A 5B22A 4JY5L 4K94C 5LAXA 3ZHLA 3VXRD 1ADQA 4PD4J 4IRJD 3SQBA 5B4MC 5IQ9A 5FB8B 4EI5B 1RMFH 3MV7D 4LLYB 1ZVSB 4GRMB 4Y8AA 5K9JH 3CU7A 4JY6B 4JPVL 1A6WL 1T03H 3WSQH 5JW4M 1UH4A 1RHHA 2X70A 5CEYB 1U9KA 1D5IH 5I1JL 32C2B 3TFKD 1DQDL 3OR6A 3ROLA 3BDYL 1X4XA 4N9GB 2WIIB 4ZFFA 1PYWB 3QCTL 5EPMA 2RGSA 3LDBC 5F7MC 3FHQA 4KROC 1T1YA 1YYLH 3WIIL 3HMWL 5GS2H 4RGNC 3CFKB 1G9MC 1LILA 3IDNB 3LH2H 3UDWC 3BPCB 4X98A 4P4KD 1EEYB 3D0LB 4HHAA 5F9JA 1AI1H 4RIRA 4NUJB 1UZ8B 2UV3A 1IBGH 5GGQH 4U1GB 1I4FA 4HX1A 4WWKB 3O6FC 5F9DC 4JEGB 5KOVC 4I8DA 2GTWA 3A6CL 1H8OA 3JTTA 4D0CB 2VQ1B 4HWBL 5HGAA 1XF1A 5T1MA 4OCWH 5CZXC 2EE6A 1JRHI 2FX7H 1QA9A 3R0MA 4L3EA 5AWNL 5J0BA 5C09A 5TGBA 1WBYA 1C08B 4J4PD 5I16A 2AV1A 2FX8H 4JZJB 1G84A 3PL6A 5EO9B 3CUPA 4ZAKC 1KEGL 3FL7A 3BHBA 4PGDB 2VISB 3WXWH 4U6TA 4Y5YC 5A2JH 3LN4B 1QSEB 3MRHB 5E4EC 4PLNC 1ZXQA 4NM8L 4OQTA 4HKXB 4D3CH 4FQXA 5L2KA 2X1OA 2PXYA 5GGTA 2HFGL 1RSFA 4QRTB 1F3DH 1NC2D 2VLME 3VXUB 3T08A 1S9YA 2I60L 2EIZB 4Z7VF 5ICZB 4AEIH 1CFVL 4JVWA 4CVXA 4NHCL 1R5WB 1WFOA 1XGUA 4WEUD 3BKML 1RUAL 5F7DA 2NNAA 4PJHF 1TTUA 1GRWA 4MQ7B 4YXHL 3CXHJ 4G43B 5EU7C 3PWVA 1U6AL 3VXSE 1CD9B 1WC7B 1LO4L 5I1KH 3WXVH 1OGAA 1FFOA 3FB8B 1CGUA 3QJFA 1U93A 5IESH 5IB5B 1G7QA 4BK4A 1MJ7L 4U2ZA 5D5MF 1YMMD 3PHOA 3O6KH 2ZCKL 1V5JA 1KTDA 4K8RC 3CFJB 5JHDE 2WWMD 3PGDB 2DBJA 5I74C 3PQYB 4XPTH 1JPGB 1RJZA 5C9JA 5J6HB 2P47B 4JRXE 3LEVL 1YEDB 5EUOE 1HILA 35C8L 3PWLB 1V3LA 4MB5A 5C07B 4JZNA 3I84A 4G9FD 5ESQB 4DKEH 1G7PB 4TOYH 3IRZA 4B7LA 1D6VH 1F2XK 5DQ9B 1KB5A 5AUMA 4U1HB 5EU6A 3UTTD 5C0CB 5E8EB 4PJIA 4ZDHA 3KYOA 2MKLC 4JM2F 4WI7A 3FOLA 5KSBB 2DWDB 1ROWA 4JLRA 1U2HA 3RX5A 4OJFL 3WNLA 4U1IB 4GO6B 5C0RH 4LL9A 1MFEH 2AP2A 1YN7B 1R3IL 4ODHL 4B7IA 2DQGH 5FHBH 2C3VB 3FONB 4I3SL 5FYLE 1XR9A 2ITDB 3V7AE 4L8SB 3GSXB 1UXWB 3JV6A 4JG1L 2AXJA 2PYFB 3BQUA 4JJ5B 5C7XL 1G6RH 4WNQA 1I8KA 4QTHA 1CCZA 1NSNL 5FKPA 2B1AH 1YEKH 4P9HC 4KJQD 4ZAKA 2J2ZA 2V9RA 4YDKL 5J13C 5DC0A 4TSCL 3P0GB 1LK2A 2QSVA 5FGCE 5HBBA 4QTIL 3KPSB 1F97A 3QEUA 3QH3B 4GRWF 2C1PB 4GAYA 5B38B 5I1IH 1EXUA 1LP9E 4PRHE 2Y9RT 4KKCC 2HFEB 4JFED 4D9RE 3Q6GL 3JSSA 5CMAB 1IGMH 4OTXH 3MBEA 1NMAL 4XNZC 5D71L 3I6KB 3O4OC 4R8WL 4XCEA 3VXMD 4KK8C 3MLSL 4JKPH 3QIWA 2Z31D 3ZDXF 4EDXA 3F8UB 4PJEE 1KBGH 3AREC 4G7VH 1ZT1B 1MCWM 2GJJA 5HHVH 4NKOB 2IWGA 1OTTC 4PRPA 2A9ML 5L7XL 1RZ8B 3HC4H 2VSCA 2XXCB 4Z5RB 5F71A 4CVZB 4XHJC 4MA8H 4XMLL 5ILTH 1I1CA 4HKZA 4JRYB 1FAIH 2YRZA 3SO5A 2DTML 4PJGE 3U1SL 2ARWA 5FDWB 2FYYA 1FO0B 1F5WA 2ORBL 4BH8B 2VB5A 4M93B 1J05A 4O2FB 3QI9B 1RHFA 1P7QB 3T0XA 5HD8D 3NA9L 2I9LA 6CGTA 3K2UH 2BVPB 2PF6A 3T0EC 1OPGL 4FFVD 3ORJA 3VFSB 1PAMA 3MX0A 2RBLA 4NQEB 4ZSOA 3L5IA 5GRVL 1NGZA 1ZANL 2VDMH 3GRWA 4X6CB 2VQTA 4LCWE 5I1DA 4IOSD 4S1SL 4LPWA 1CICC 3V8CA 3GHEL 3BP5A 2F15A 4MAYC 5BRZE 1JV5B 3HS0A 1KPRB 4PJFE 4LLQA 1GOGA 5SX5K 5L6YH 5D7IB 5INDB 4L1HA 2XTJE 1H3TA 2F54A 3Q5TA 4JDZB 1FORH 1VHPA 4YXLL 3BH8B 2XA8L 2FEEI 4X99A 1QRND 4NO2B 4KVNL 2DRUA 1IGTB 5D8JH 3C2AL 3K2MC 3N1MC 3TJEH 5A2IH 4JDTL 4G8IA 1ZEAL 2EE3A 4NN5C 2YEZB 1NC4B 2GITA 2XYCA 2YR3A 2NXZD 4GSDL 3KPLA 2Q6WB 1RZ7L 4XCNB 1L7IL 4JAMB 4XVJL 1U8OB 4HBQA 5IMOA 3A6OA 3O2DH 4LBEB 4BSVA 4OFIA 1IC5H 4L5FH 5A40E 2Y5EA 1QO3A 3ARUA 3OXSA 1NMCC 2BP3A 2QQQA 1AGBA 1MJUL 4IHOB 2VXVH 4Y4KB 5IKCB 4OCSL 4LLAA 3LHPH 3O6ML 2EYTB 3RX7A 1OB1A 1OW0A 4U1LB 2EDDA 4BSWA 2W0PA 3OF6A 4ZXBC 2HG5B 5IGXH 4FG6D 1MLCB 5FYLL 5BCAA 1ZHKA 4HH9A 3LKNA 3CC5B 2DDQL 2FL5A 4UIMA 1NCDH 4XP9H 3BO8A 2Z93A 1OCWH 3PHQB 5ADPH 2O5XL 4JHAL 2XV6B 4Q9RL 3AC0A 2X1PA 5EZJB 3BESR 1TVBA 3TT3H 1U8MB 3NCYP 1WVZA 4YQXL 2VWEE 5CHNB 5T33L 4AIOA 1S7WA 5BVJB 4HAGA 1UJ3B 2DQDL 4OFKA 5B4MD 1C7TA 1YEHL 3ZYIA 1EO5A 3B2UD 3E8UH 2HKFH 4JPIB 1X44A 5DLML 4N1HB 4LHQB 3ARTA 1T0MA 2BHZA 5TQ0L 2WBWB 3UX9B 3B9DA 1CICA 4MJIA 2OTPA 1JHTA 3EYVB 1F3RB 1G0YR 2EYRA 1M7DB 2N7BA 1OLLA 5MI0B 3V6OE 5MEOB 1IRAY 2IG2H 3A0OA 1IAKA 4UT9L 4WFED 5ENWB 3C08H 2YBRA 4CNIB 1EEZB 1FBIH 5DC9B 1YMHB 4Q9BA 1FYHB 1RJCA 4MD4B 3TCXA 4LSTL 5FO9B 4DGVL 3NFNA 1E28B 5E8PB 5GSRB 5CBAB 5JOPD 5KVFH 3LZFL 5DT1H 3G6JA 1P53A 5HYJA 4KKNA 5C0AD 1I9IH 1QLRB 2FD6H 2B5IB 4HKJA 4J6RL 1UVQB 1AQKL 4GG8B 2X4PA 3PWJA 4M3JA 3CSPA 1HQRB 4K3GA 4FMFA 1RJLA 3RUGE 1CFQB 1UCTA 1JWSA 3LKQA 3MODH 3QISA 5KVDL 5JOFA 4BSJA 3RVVD 1AGEB 3MJGX 4HV8A 1OWRM 2YA1A 4X6EA 2AK1L 4PJAA 1Z5LB 3C8KB 4LSRL 2Q3AA 4DN4L 4LIQH 3BKYH 4QHNB 4R4ND 5DRXB 4L4VD 3N9GL 4R97C 2MFNA 5GS2D 5FV2A 5EO1B 1CLZH 3ULSA 4P4RB 1A3RH 3W81A 5ITFA 2IAMA 3CH8A 3GMPA 4FQCL 4EOWL 4ZUWA 1S7UB 1CTOA 3DSNA 4CJ0A 4OF5A 1C5DB 1KLGB 2NY2B 4TUJA 2B39A 5EUKA 3TO4A 2G75A 2BJMH 5FIEA 3B4NA 1B90A 1M05B 4JHZA 1MFBL 2OZ4H 3MJ9A 4CMHC 3S3SA 3W9DA 4IJ3B 5JLZB 4QOKA 1YPZA 2BXZA 5GXBB 5DMJB 3QDGE 1CGYA 4HWZA 4NNYA 5EC2A 3STLA 2HLFC 3NFPA 1PKOA 1CDUA 3EO0A 4I4WA 5I30L 2KPNA 2H6PB 2D7QA 1K6QH 3D18A 3JWOH 3QUML 3FFCB 1K8IA 4Z18A 5ICXA 3ZDYE 3MPCA 5D7JD 3TBWA 1YY9C 4YHLL 3SJVB 2YD1A 5I17A 1UACL 5SWSB 1LO0H 2J8OA 5IW6B 1NFDF 3MJ8A 2BSTA 5DHVB 3DVNA 3G6AB 1MHHA 3TZVC 1U8NA 3DBXA 4UILL 1JHKL 5GGSB 4X83A 5JDSA 2A6IB 1WEJH 2X9YA 1GZQA 2YKLL 4UI2A 1NGYB 4HPOL 2JCCE 4KJPC 4PGZA 5F8QC 4PJBB 2WZPD 5C0FA 1I7RA 3KWWB 5FM5O 4DQOH 3ZHDA 4ONGL 2VYRE 1ZHNB 4M7LH 1JGEA 1MWAH 4PGEB 2GJZB 4UBDC 4NO0D 2A6KB 3H3BC 3LD8B 1IM3B 1RUPH 4WY7L 2IPTL 2CRMA 1DEDA 1MIEL 2GSGB 4LGPB 2PTVA 3FQXA 3V4PL 3GSOA 2ZZUT 3G9AB 3HE7B 2EKSA 3LSOA 1SBSH 4TULL 3KPRB 4KJWC 4NBXB 4LQ1A 3MRPB 3WJJC 3H9SA 1S7QA 2OCFD 4K7PH 1K3IA 4XNUL 4NKMA 2XQBH 5GRJH 1ZVHA 1TIUA 4GG6F 5EZIL 3AGVA 1E6JL 1YDPB 3ARZA 1N5AB 2BVUA 3C5ZC 2VN7A 3MNWA 3P3YA 3PGCB 4Y4FA 3QXTA 2H32B 3KS0J 4ODXB 4OZIE 4XHQA 2ZG1A 3L7EA 3T3MF 4PJ9D 4QRUA 1FL5B 1JPTL 1QBLL 3GSQB 4PJ5E 4YHKL 1TFHA 3N0PB 4KQ4L 1CE6A 2V2XA 1RZKC 2FHFA 2DQCL 3S35X 5L2JA 3U7YL 5C0EA 1HZHL 3ILQD 3HC0A 5IR1A 3RDTB 3IJHA 5CBEB 3L3GB 3UTOA 3RNQA 4IDJH 1FZKA 1WBXB 4UQ3A 5DJ6B 3ZKSD 1XT5A 1FRGL 3P9WB 2AQ3A 3QQ9C 1YEIL 1NBYA 1RV6X 3V4VH 3FTGA 5IEHB 3P4OA 3BW9B 3TT1H 3BZDA 4RFNB 2C3HA 5FOBA 5DEGA 3MRIA 4GT7A 3U6RB 2CKBL 5BVPH 5HHOA 2A1WH 5I6XC 5IJKC 3ARED 3BP7B 1OTTD 1EO7A 1K5NA 1MELA 5K59E 2P42B 3SDAB 5BZDB 2FIKB 3OXRB 5JIKA 5SX4H 1W72A 4KK9D 1ZHBB 1ZSDA 3FMGL 3RZCC 5A3ID 1JYNA 4DGYH 3LS4L 4DUXA 2AJYL 4Y1AE 3GSNH 4H0IA 1RK0A 3BPLB 3QFJB 1IQDA 1MH5A 3D3VA 3MRGA 2B1HL 2OR9L 3REVB 4JFFB 1KJ2L 4OCNC 3KPPB 4I77H 3QUYC 4M1GL 3MRBA 2YSSA 4OFYD 2PYED 4F58H 3O3AA 3L5HA 4Q58C 3CDGA 4ZUUB 3SPVB 3NIGE 1XF3B 5IBTL 4MAYD 2GT9A 2QHRL 1B0RA 4AQOA 2R8SL 2EDBA 4PG2A 4CKVX 5CJQL 3UBXB 1CDBA 4G3YH 3QJHB 4ZQKB 2OX5A 1I1YB 3QNZA 2Q86A 3FB7A 5KW9H 5LQBH 1WIOA 1QG3A 1ZLSH 3KR3H 3UROR 5HI3D 3I02B 1CF8L 1IQWL 3U4BH 1R0AL 1YNLH 4X8JA 3OKLA 5D1ZA 4X7SH 3E3QE 2VZVA 3NZ8B 3BH9A 4PRIE 5C08E 1DVFC 2DQEH 2VDNL 3DVIA 3PUCA 1X6NA 4AIZB 4EI6B 1K9TA 2AK4B 4NCDA 1PY4A 1QSFA 4Y4HB 3U0TB 4ZUTA 5BO1H 4PJXE 4YBLB 1AJ7H 3VI3E 4CDGC 1K3ZA 2Y25A 2Y7QB 4HWEL 3PDDA 2AJVH 5IQ7H 5T5NF 1KXVC 5LCVH 1CI5A 3ZTJG 5GJSL 4N1CA 4UT7L 4Z7OF 3RTQA 1V7NL 4F7PB 3BD4A 1MREH 3SCMC 1A6AA 3HNSH 4LVHC 5DUML 4XP4L 2VERN 1CFTB 3AY4A 5F1IB 4UNUA 4HUMB 3NGBC 3SGEI 1MIMH 4RGOL 4DAGL 1A1NA 1J8HE 5C9KA 4JM2C 5ACZA 2XZCH 2CRIA 1WTLA 4OZGF 3FN3A 5F70A 4BH7A 2QKIA 5GIRB 4TVPH 5J06A 4LF3B 2XIDA 3UPCA 4F80A 4LSUH 4ELKB 3G08A 3MV01 1QR4A 3IXAB 1GGUA 5T3XE 1X5AA 2EDHA 4JO2H 4U0QB 4KMTH 2J3SA 2P48B 3UJIL 3L3HB 4FQIH 4OAWB 1HXYB 4XPAL 1UYWL 4L8CB 1N8ZA 4B0MM 5EN2A 2MCG1 3RZCA 1NFIA 3WUWB 3Q2CA 1Q94B 2LABA 1ZLUK 2FECL 4D9QE 3T3PE 2ZPKH 1KJMB 1MI5D 3U2SB 1SBBA 1WAAF 3HNVL 3MROB 4PY8I 1D6EA 3WFHA 4JGUA 2W0FA 5JR1L 2X4QB 1NGXA 3PXJA 3NCCB 4U6HB 4J3WA 1P69B 2I5YL 5D2LE 3GK8L 5LJYH 3TN0A 2UYLB 1P7KB 25C8L 1ZK9A 4H26A 4Z7VA 2GJ6E 4G6AC 4H8WC 4I3RH 4L29B 3I6LD 5EBGA 2AEPL 3P9LB 5J4MA 4ALAH 5INCA 4PJ8C 3ARFC 4YX2L 4CVWA 1ZGLB 4MCZB 1FZMB 4GBXC 4PJHA 5DO2D 5AZ2H 1SJHA 5IW1B 3L3DA 3KYNA 1C8PA 3S96A 2W9DL 5MHSE 4U1MA 3QXVA 5SWQA 3HB3D 3VGHA 3HZVA 3VXRA 3X17A 2OXGA 2AGJL 5D5MA 5C0BD 1JF5A 3WS3A 1AY1L 3I3DA 3L1OH 2R2EA 1ZLVK 1A7RH 1QHPA 5E94A 3LRSB 1B4JL 4QXTA 2NYYC 1G7LA 1LE5B 5JO5A 4PR5A 2F5BH 1KACB 5FEBA 3FO9A 3VXPB 2UY7A 5A2LH 4PJCA 4HKBA 4NDMB 1I3UA 1RZIB 5EOCH 4ENED 5I0ZA 3STZB 1UA6L 3RGVD 5JNYB 2NY4D 4PS4L 3WO3B 4AEHH 1WF5A 3CCHB 2FNBA 4NZTH 1BFVH 3SCMA 4HLZG 1BHGA 2CMRL 3HG1D 1T66C 1I1AD 3C9NA 5I1CL 4PGCB 4ODTH 1FO0H 3ARGA 1VACB 1BD2D 3D85D 3QQ3A 4KHTH 4M48H 4P4KA 1PG7X 1A8JH 2P5ED 3BMWA 3INUH 3VJ6A 2DQHL 4JM2A 5A16B 5IWLA 1KN4H 2X4RB 3UPRA 3GUTB 5GZNC 3DYMA 3HMXL 3M8OH 3AAZA 4CU7A 4J1UB 2VN4A 2P8PB 5LXGH 5HHMB 1V7MH 1ZLWH 4J12A 1FLTX 2XFXA 2ZCLH 5MP6H 3CPLB 3O11A 2BDNH 5CSBA 3PDOA 4HMCA 2G60L 4HLJA 3GIVA 2R39A 4DWHA 5IFJB 4S11A 3VFWB 3ECBA 1R3KB 3BGMA 1C5BL 3UYOD 2X41A 2GI7A 4QRRB 4QHMA 1JNLL 4M5YL 3LKSB 2DS4A 1JIBA 3DMMB 3V5KB 4R7NB 4MXWH 1A9BA 4UB0H 2VDRH 5E1AB 1JNHA 3V52H 5EZOH 4JKWA 4GFTB 1FVEB 3EHBC 3ZTNH 4CN6A 5T3ZH 4MDIB 4MSWB 1P5VA 3QB7C 4P9MH 3G5XA 1KOAA 4R4FH 1HQ4B 4LLWB 4NKDB 1IKFL 4WJ5B 4MD0B 1XF4B 3U9UA 5GGRY 3O41A 1PY9A 2ZSWB 1KC5H 1P4LA 1NC2A 2BVYA 4HUWA 3BPOB 5LAXB 5J8OA 4N0CC 3S5LG 1DSFL 4GQPH 4FFYL 3PP3H 3ULUF 5H37G 5IQ9B 5EA0L 4GXVL 3ARFA 3VWKD 3GJFK 4GBXA 4H25A 1A1OB 4ORZC 1JYVA 2OR7A 4HK3N 1ES0B 3QEHB 4IS6A 5C0GA 3RWEA 5KSVB 3K74B 1RHHB 5AAMA 4OLUH 4OLYH 4HIJA 4UU9A 4E41A 1U8IA 4UBDD 4MQTB 2I07B 3ROLB 5B39B 3SKJH 3IFNH 2CGRH 5T3XL 1JHLL 4RDQG 1BGXL 4ZFFB 1N64H 1YMMA 4JFDD 3ME0A 5J3HC 2B0SL 5EPMB 5LKNA 1AD9A 3QPQC 4P2YA 1SY6H 4X9BA 2GYSA 2UWEE 3NIDF 2KDGA 4P3CL 4Z7QE 4NZDA 5ALBH 4LHUG 3L5WA 1AFVL 3IVKA 3L3OA 3I3EA 3WFDL 5BOPA 2RCSH 4DUVA 4X98B 4HHAB 1S9VB 5HY9B 5ESVA 1FE8H 3GBNH 4Y88A 4R6UA 1MAJA 3CVHA 2GTWB 5HPMA 3JTTB 1FIEA 1A7PL 3X3FH 3UYRH 5HGAB 4YDIH 3V0AC 5KANI 1IC7L 5HGBB 3SY0A 1QA9B 1H5BB 1L6XA 3QDJD 5E6IB 5BS0E 4L3EB 2R1XA 2OI9C 5C09B 5TGBB 1WBYB 4NWUL 2VLRD 2BERA 5L9DH 5IFAH 1A1MA 3P0YL 1RZFL 3QWQB 4PB9L 2J8UB 2VDOH 3CLFL 2XXMB 3IKCA 3HI1B 5HYQA 1BF2A 3QULB 1HHHB 5AD0A 5F6IB 1U2CA 4NQTA 2X42A 1HSBA 1NGPL 4HXBL 3CUPB 4N8CH 1GGBH 4PPTA 3BHBB 2C7UB 5DMIL 4MS8C 1CBVL 1JK8A 4NJ9H 4HZLA 1Q38A 4UAOB 2ZUYA 4K9EH 2FBJL 4LVNB 1KG0A 4RGNE 4FQXB 5L2KB 4LHUA 4XP5H 4P2OD 4OIAA 5LWYL 1S5IH 4HBCL 4EN3B 4HCRH 5JOPE 5EU6E 1T22A 4P5TD 4QRQA 3IAGC 3ARVA 1GAFH 1XGUB 1DFBH 1KB9K 4S0SD 4M1DH 2NNAB 4BUGA 1CT8A 2V2TA 2BC4A 4Q6IB 4PJ7B 3PWVB 5GS0H 1S9WA 1U8PA 2BY2A 1OGAB 5DA4A 4X4MA 2NY7L 3I9GH 5IEKB 4O2EA 4ODWA 4TSAL 2IFFH 3PHOB 1JUFA 2X2YA 1DR9A 3VXMA 4W6YB 3RWHB 3C6LB 2B20A 4Z7NF 5C9JB 4UTBL 1F3JA 3HE6D 3H42L 2VXTL 4M43H 1T1ZB 3MV8B 2O5YL 2P46B 4R96A 2OL3A 1OSZB 1ULVA 4NO5A 3SE3C 3K7UA 3BZ4B 3RVWD 3QHFL 2FB4H 4IRSB 3SE4A 1CR9L 1XF5A 5AUMB 3H3PH 3QO1A 2VRAA 3OBAA 1GOHA 3KYOB 2BOCB 3MNVA 4YPJA 2DQFA 3DX7A 3MTRA 5EU7E 4JLRB 3WFCH 2YA2A 3PIQA 3SO3C 1HNFA 3O45A 4NPYA 2HWZH 1EHXA 3ARRA 4M8QA 4MA3A 4WO4C 1QKZL 5HPOA 1FHGA 1GGIL 2A0LD 4ODUA 5F7KC 5F96L 1T80A 2AS5M 1DLFL 1OGTB 2R0KH 5I76A 1A0QH 4RZCA 4FABH 1FL6B 1SJEB 3G5VA 1L0XA 3JV6B 4D94A 5GZOC 3V0VA 4N8PA 3BQUB 4WNQB 5F7EH 1E4WH 4X7FC 5FKPB 1X4ZA 3B9KC 1G1CA 1T6VN 2NZ9C 3H3KA 4YFLF 4F15B 3IJSA 1E0OB 1LO5A 3HTLX 1LK2B 4OQTL 4EUPA 4MD5A 2P43B 1KCUH 4Z7UF 3WKML 1J5OH 2A77L 4D2NA 1AIFA 3QEUB 3IDYB 1T7ZA 4I48A 4GAYB 4H88L 1J11A 1NFKA 1L4IA 3D39D 4JREC 3NPSB 3EJZC 3C60D 1MUJB 1ZV5A 1DCLA 2BX5A 2VZSA 3ALWA 3R8QA 5CP7B 3ZYJA 2ESVD 3MBEB 3L5JA 4K94L 4XCEB 4EDXB 3QIWB 5I8KH 4APQB 1RAMA 3LQZB 4N0FA 1XAUA 1A47A 2ZOKB 5F9WC 5GGVL 3N85H 4PRPB 2NZIA 2FDBP 3TF7C 1MVUB 5TQ2L 2DQJH 5JPMA 2M2DA 3BKCL 4P23C 2VZTA 5DFVC 1SYVA 4HJ0D 4HQQH 4RNRA 2ZUTA 1SEBA 4HKZB 1KYOK 4XBEH 1JWMB 5E8DL 2R4RL 2VLJD 5F7UA 1QFWL 3GMNA 4KKAC 4KK5D 1J05B 4LEOB 4TVPD 3U79A 1M6OA 4LARL 5J6GB 1ONQB 4P46D 2I9LB 3MLUH 4Y8DC 2CUIA 1B0GA 3DPBA 2NR6C 3SDCC 4ONHA 1VEMA 5DHYA 1G9ML 3QUXD 3OB0H 4GXUM 2HN7A 2EZ0C 1KB5L 1TJHH 4PY8J 4HMEA 3S88L 1OT1A 1BFSA 3EFDL 3WLBA 3BE1H 4MX7A 1FVDA 15C8L 3QIBD 3ZE0E 1S5HA 3IDJB 3QXAB 4HXAH 3VG0H 4X4ZA 3EYFA 4OZHF 3UTZA 2NY0D 3BP4A 4FP8H 3O0RH 3HS0B 3HC3H 4LLQB 1WZLA 1U8QA 2VXSH 1N0LA 2F54B 1TZHB 1Y6KR 2H9GA 4LNRA 4XC1L 1T5WB 3ARXA 4WI5A 3NN8A 3TVMC 3OAYH 5KBNC 4XAKD 1DBKH 1YEFH 2F53D 2GEEA 1EEUA 4RGMB 4G8IB 1T66D 4AEEA 3I75B 5B3JE 1RJYA 2YK1H 1IGCH 2GITB 2JJVA 2F74A 3KPLB 3T0EE 3E0GA 5DJCA 1T7VA 5T5FH 1A22B 5IMOB 2ICWI 3QPXH 4EBQL 1JMXA 4XCCL 4BSVB 1HKFA 1PKQE 1YNKL 2CXKA 4GQ9L 3V6FA 4JCMA 3DIFA 3NACL 4X6DE 3GDBA 4E0RA 1QO3B 1DLHA 1PG7L 4MGXA 2OMBA 1CD0A 5E9DA 3OXSB 2EXWC 3SKMB 4XNYH 4HEPG 5F7FA 1JRHL 4FTVD 3N06B 4KRPB 4GG6A 3LPWA 4MNQA 1OB1B 4XBPA 5DYOB 1F58H 1S7XB 4L4VA 2R0ZH 4J23A 1PQZB 3MZGB 3D2UD 3EO9L 4UDUB 1N59A 4K8RL 4HH9B 5DWUL 2H41A 2IANA 7CGTA 3FB6A 3CSYA 2W60A 2FL5B 4JFXA 4WFFD 5GJTL 1D9KB 4LSDA 3WIHH 3BD3A 2J88L 3QQNA 4NKIL 2D7NA 4YNYB 3SDCA 5DJZB 1S7WB 3RAJL 1PEZA 3A67H 3ALXA 2YC1A 1BX2B 3W9EB 4UQ2B 2JIXD 5DUPH 5KSBF 4Y5VA 2VITB 2SEBA 2V6HA 4G80A 3VFOA 4HK0A 3LB6C 1INDH 4V1DD 1AC0A 3LQMA 3VXQB 5F3BA 3RVUD 5I19L 4JQIH 4MJIB 1JHTB 3RX8A 2EYRB 1ZHLA 1OSPH 2GTZA 1TCRA 4O58H 2W9EL 1FNSL 3MLXL 4Z76A 1FSKB 2X10A 1IAKB 2DLFH 5T3ZD 3WFEH 2YBRB 4NQCD 3EOYG 2ZNXA 1OTUC 2PTTB 1J12A 3RA7L 5HI5C 3NFNB 4HUVA 3UJJL 4G7YL 2ED9A 3G6JB 2X4TB 5IB2A 1CLOL 2Y6SD 1MF2H 4P9HL 5DK3A 4ZG1A 5JXEC 1HNGA 4KZEL 5T5NG 4YR6B 3DRQA 3DYPA 1NCWL 4NO0A 3PWJB 1EVTC 3ARDD 5DVOA 3IAQA 1LEKA 1O5DT 1AGFB 1RJLB 3IFLL 3DUSA 2CUMA 1LNUB 1FN4B 1JWSB 2DYPD 2DIJA 4OB5H 1ETZA 4M6ML 4EVNA 2IPKA 1CWVA 4PRAA 4HV8B 1YEJL 1N0XH 2AJXH 4F2MB 2OTWB 4PRDA 6FABL 4LKCA 3KYMB 3OKOB 4QXUH 2J4WL 2QLVB 2ZP0T 4O5LL 5D6CB 1J0HA 4YFEA 4PG9A 3QUZB 2IAMB 3GMPB 4IOFD 4ZUWB 4LSVH 5HDBE 3VGEA 5I75C 4O4YH 5EUKB 5EBWB 1WIPA 3TO4B 3UP1A 5KZCB 2G75B 5FUOH 4PJ9A 4R90H 2E7BA 1B9ZA 3W9DB 1BWMA 3S6CA 1YC8A 4QOKB 4YJZL 4K2UH 1YPZB 3MRLA 1T3FA 2EDEA 5KS9A 5EH1A 5CJOH 1FZJA 5EC2B 3STLB 4OGXL 4Z0BL 3EO0B 4DKFH 3H9SE 1FNFA 4I4WB 1JZ7A 2D4DA 2DAVA 2QQKL 2D7TL 4WU7A 3D18B 5C6WH 4I5BA 4L8DA 2FZ3A 1HEZB 4GAFB 4X6CF 1E4KC 4XPHL 4YGVA 4KUZL 3QRGH 4GKNA 4OKVA 3ARWA 3TBWB 5CIPB 5I17B 5GISH 1D5ZA 2HT4C 4QY8A 1J0YA 2W65A 3HFML 4OZGA 3P9MA 2WV3A 3DXAA 4XP1L 1HI6A 2BSTB 2PR4H 1CGXA 1R5IA 1G6RA 1MHHB 4RWHA 1U8NB 2BVOA 1OARH 2EXYC 2QSQA 2D7MA 5D7IF 2NY1B 1BZ9A 3FT3A 1HYSD 1SMOA 3GMQA 1JGEB 1A6TA 3QG7L 3TNNA 3WS6C 1P84J 2WMPA 2Z8RA 5C0JB 4NM4L 2EIDA 3B5TA 4M7LT 1W0VB 5D1QC 1WAAA 1CGSL 3VRLE 3FQXB 5JXEA 4MYWB 4XTRC 1IC1A 2YMXL 1MSPA 4PB0L 4WI3A 4NQUA 2CQVA 2EKSB 1MEXL 3LSOB 5DJXB 5ISZA 2H2SC 1C5CL 1OAXL 2Q8BH 4OFYA 1S7QB 2BMKA 2EDFA 4LAQL 4YDLB 3DROA 4NKMB 5DQDH 1ZOXA 1TPXB 4MB4A 1RIUH 5T1KA 2V5YA 3ULUC 4LOUD 4A6YL 3KPOA 2R15A 3MGAA 5I8OH 1FFNA 2J6EH 4Y4FB 4YBQD 4F3FA 5GZOD 2HTLD 1A6VL 2VDLL 3NAAH 5E2JA 1CDGA 4P2RE 4NQDD 2IPUK 2JJTC 3U30C 5D96C 5L8JB 1MHEA 3BISA 4XX1E 3S37L 2UZIL 5IW3A 3EIFA 3BEWA 1CE6B 1DQJA 3CVIL 4S2SA 12E8L 1GCFA 3EOAB 5D7LE 5IR1B 2HVKB 4NGHH 2FEEL 3IJHB 1C1EL 4JFDE 3VDBA 4UQ3B 4JR9L 4I2XB 3W0WB 4OZFH 5E03A 2COQA 3FTGB 3PWPD 3V79C 3P4OB 4L5FL 2LTQC 2EDKA 4BFGA 1MFAH 2OJEA 3MA9L 5HHOB 3BWAA 5DK2A 2NXYC 4MWFA 1CL7H 1GC1C 2QADD 4DKAA 1E4KA 5FHAH 1K5NB 5F7WC 3MYJA 5DJAA 4QNPF 3VGDA 4JY5H 3ZKMD 2D4FA 2VR4A 3MR9A 1TTGA 3DNKA 2LQRA 2V7HA 1Q0XL 5D1XC 1W72B 3IF1A 2FO1A 2XWTA 1RIVL 1WIUA 1AKJD 2R9HD 2HAZA 5AEAA 4HIXL 4JPVH 1A6WH 4R3SA 1CQKA 2Z35B 3D48R 5I1JH 1IQDB 1MH5B 3NH7L 1DQDH 3MRGB 3HNTL 3WBDA 5E8NA 1GPOL 3BDYH 1F00I 4WI8A 4LLVB 3O2DA 4PTTA 1DUZA 3QCTH 4WUUD 3D69A 3WS6A 1BFTA 2YSSB 3WIIH 2E3VA 5D1QA 3HMWH 3L7FA 1DL7L 3DSFL 5KTEL 2ADFL 1OTSC 3MRNA 3CDGB 2PO6D 3JZ7A 1IVLA 5DJDA 5LG1A 3ZKNC 1H8SA 1B0RB 2HRLA 3EBAA 3F12A 1U8KB 4PGJA 5JW4R 3W39A 3QNZB 3MLPA 3A6CH 3HPLA 4HDIA 3FB7B 2Q86B 1EV2E 3R06B 1JGVL 3VFGL 4GS7C 3VFUA 4HWBH 3T0VA 3VFMB 1NBVL 3WO4B 1R3JA 5J11B 1X7QA 4Q0XL 3O9WC 5CAYB 3DV4B 1U3HD 4BZYA 5D1ZB 4XCYA 5AWNH 2Q76A 4U1SA 2WAHA 4LPVA 2KUTA 1Q9KB 4MA7L 4YXKL 2JJTA 3VFRA 3DI2B 1QSFB 3BXNA 4JQXC 1Q1JL 4ZUTB 2AJZB 4OD1L 5IVXB 2Q3ZA 3F7VB 4BELD 1G0XA 4YFLI 3QNYB 1KIQA 4C59B 1KEGH 4N0UB 3RPIB 3DX9A 3RTQB 1LD9B 2E9BA 4PLKC 1FGNL 4UDTB 4Z7VE 1WBZB 2CR3A 2VAJA 3RGVA 1OD9A 3OAUL 4MA1B 2VOTA 1NEZG 2FH6A 5D72L 2HFGH 4ZFZA 3HRZB 1A1NB 3JV4A 3QT2A 4LSPL 3OKKB 2I60H 5ACZB 1CFVH 1HXMA 1IARB 2WBKA 5D6DC 3HG1A 4M7ZB 1I1AA 4NHCH 4BH7B 4HJGB 1BD2A 3D85A 3BKMH 2ICWJ 1JPST 1RUAH 2VXQL 4PV9A 5SV3A 5CWSA 4YBHA 4YXHH 5D5ME 3G08B 1DQML 4BZ2L 1U6AH 5FK9A 1LO4H 1X3DA 1A6PA 5DZLA 5D1XA 2BNQB 4LPXA 5TE7L 1N8ZB 1MJ7H 3FB5A 1UM4L 3HLAB 1NFIB 2ZCKH 4WFGE 3W11C 1W8NA 2NY3B 4K23L 2I26N 2DTSA 3LEVH 3OJDB 3O4LD 35C8H 1NGXB 5IHLB 1IKNC 2IPUG 2Z4QB 5C3LD 2IALB 1QYGL 4LCIL 3EDJA 4H26B 1NAMA 1I7ZA 1NEZA 5EFIB 2C3XA 1XCTB 4CADB 2A6JB 5MERA 5INCB 4X8XA 4ZFOL 1T2QL 1P5UA 2YD4A 4HPYL 4PJHB 1SJHB 2P24B 1VFMA 3S96B 2A9NL 4EI5C 4U1MB 5J89A 5MEND 4C4KO 1M4KA 3X11B 2ESVE 3HZVB 3VXRB 7FABL 4XNMA 4WUKL 4GJTB 4IRJB 3WHE0 4OJFH 1V3JA 1JNJA 4QLRA 5EBLA 3VWKA 3RIFF 3WS3B 2BNUB 4E5XA 3MV7B 1T0NA 2R2EB 2YN3A 1R3IH 4ODHH 4AENA 4HS3B 2P8LB 4H0GA 3BVNB 4I3SH 5JO5B 1JWUB 4NFCA 3FO9B 1FYTD 2LU3A 4PJCB 5EG6C 4AM0B 3FZUC 1DE4B 1W0WA 3IAPA 4JG1H 2P5WE 1RZKL 2YD5A 4QRPD 4TNVK 5C7XH 1NSNH 3CXDL 1EX0A 1UT9A 5DGRA 2VLJE 4GRWE 4ZS6C 4W6XB 4YDKH 5GSVA 1Z3GL 4TSCH 3OGCA 3SBWC 3BGFB 4U1GC 4K71B 5EBMA 4WWKC 3VWJD 4QTIH 5J9PA 2PCPA 3QQ3B 2HRPL 4P4KB 2QL1A 2VDPL 1X5KA 3RWCA 4K7FB 1IT9L 2PW1B 1RU9L 3BFOA 4X5XB 3UPRB 4P3DA 3AAZB 4QGTA 3Q6GH 4GLRH 3ZDXE 4C58B 4ISVA 3SEPA 4IMKC 1BQUA 1J1OL 1PG7W 1NMAH 3L95A 5D71H 4E41E 3O11B 4PBXA 43C9A 3PDOB 4R8WH 4C83A 4DVRL 1UWXH 4XB8A 1ZKAA 3MLSH 3GIVB 2VLRA 3H2WA 2ZWLT 4W6WB 4JZJC 2XZAL 1AQDA 4F7MB 1AGDA 3ECBB 2A9MH 5L7XH 3BGMB 4OFVA 3TBYB 2VABB 4QHMB 4D8PA 1G7HA 4XMLH 4UT6L 4M8VA 3RBGA 1A9BB 3QDMD 4LCUB 4OBRA 1I9EA 2V2WA 1JNHB 3U7WH 2DTMH 3U1SH 3VFVA 5C92A 4U7SA 4Z7UA 2ORBH 4JZOA 5JOEA 3G5XB 1RZGA 1BIHA 1U95B 3ELAT 4JKKA 4OF7A 3NA9H 3K1KC 1P4LB 1NC2B 4HUWB 4ZO6A 1OPGH 2YOCA 4P5TA 1IAOB 4Y19E 5CLWA 1A6UL 1EZVY 4POYA 4FQJL 1ZANH 2DQUL 4H25B 2K1MA 4ZMAT 4AL8L 3TBTA 1BQSA 4KQ3L 4LLYA 5C0GB 1WSST 4S1SH 1ZVSA 3RWEB 3MUGB 4YHPA 1P4BL 1JGUL 3GHEH 3TIEB 3AS3A 4UU9B 1MRDL 2YUVA 4ACPA 4OUUA 32C2A 1ZLWK 4N68A 2IADA 1YMMB 3VW3L 5FOJA 2DKMA 5C0DA 4XTRD 1T0PB 5DK0A 3QEQD 4YXLH 4DK3A 2XA8H 3L3OB 3HE6A 5HYSG 4KVNH 2Y5TA 2EDNA 3BPCA 3C2AH 5ESVB 4Z9KB 3D1MC 3D0LA 1FL3A 4JDTH 1UZ8A 1ZEAH 4G9FB 1FJ1B 4G3YL 3CVHB 2GCYA 5C2UB 1N2RB 2ARJB 4GSDH 1RZ7H 1L7IH 3QEGL 3QIUD 4D0CA 4X4ME 3SY0B 3UTTB 3S5LB 3ARSA 4Y16D 1J18A 2R1XB 3SOBL 2XG5A 4OZHA 1A1MB 5HDOA 1URLA 2VLKE 1UGNA 2EYSB 3GSNA 1C08A 2XWBA 3IKCB 4IMKA 4LFHD 5HYQB 3PP3K 1MJUH 1E6OL 2YPLD 4L8SC 4QT5A 4OCSH 4P59L 3DX8A 1HSBB 4V2CB 3O6MH 5E5UB 4JZJA 2BNRD 3NCJL 5EO9A 1OT2A 2HJKA 1JK8B 3DUUA 4M61B 4QO1A 4HZLB 2AJVL 4PGDA 2VISA 4CRPA 1CGTA 5FYLH 1KG0B 1QSEA 3MRHA 1ACYL 4GW4A 4Z78B 5IMMA 2DDQH 5HYSA 1T22B 4QRQB 2O5XH 1S9XB 4JHAH 1FFPA 1R3LB 2EIZA 4Q9RH 1JN6B 4U3CA 3BUYA 4M6NL 4NC1C 3GO1L 2XG4A 3ZSTA 4YQXH 4IIQB 1CD1B 4G8GD 4G6FD 5T33H 1CT8B 2V2TB 3KAAA 4H8WL 1S9WB 4JO3L 4L4TD 2DQDH 3CIQA 3OJVC 4JFEB 3C60A 1YEHH 1HWGB 4A2LA 3FB8A 4ODWB 2EC9T 5HGHA 1UC6A 4FQIL 5DLMH 4NJAL 1JCKA 4OV5B 1OD7A 5KSUA 5K33A 1PZ5A 3VXMB 1E4XI 1A7BA 5TQ0H 2Z31B 1X5HA 4S0TD 2ZPKL 3GBML 5DFTA 4EDWL 1JPGA 1JMZA 5J6HA 4UT9H 4YAQB 3QWRD 1EZVX 1YEDA 4KXZI 4R96B 5FYKE 2OL3B 4OM1L 2NLJA 4M93C 4DGIL 4ZFGL 3QI9C 5AZEL 4NO5B 4X7EC 4NFDA 4HIEB 5C07A 4LSTH 4YZFF 1CQYA 4DGVH 1UZ6F 3ZKND 3HA0A 3FQTA 4OF3A 3LZFH 1FG9C 1G7PA 1XF5B 2APFA 3QO1B 4W4OC 3SDXB 4J3VA 5DQ9A 4P46A 3TH3T 1IGIL 4J6RH 2Y06H 1AQKH 5C0CA 1Y18A 3MNVB 3FCTA 3DX7B 3QUXA 4U7KA 3PIQB 5KSBA 4IOIA 4NPYB 4YC2B 5KVDH 4M8QB 3FN9A 4MA3B 2F58L 4ODUB 3QIBA 1WZ1L 3RNKA 2AK1H 4UV4L 4LSRH 4DN4H 3AS1A 1A7RL 2DLEA 3N9GH 3A6BL 3FONA 3PV6B 1CXKA 5FCUL 3G5VB 3V0VB 2FJGB 4JFQA 3KYAA 5HJ3B 5CD5C 2PYFA 4J8RA 4JFHE 4FQCH 4EOWH 1CVRA 4FA8A 1NKRA 1DBBL 3IJSB 1LO5B 2C4FT 4F37K 3K4AA 1QRNB 1AIFB 3RL2A 4FQLL 1W0YT 2XOTA 1MFBH 1MCWW 3KPSA 4KHTL 4I48B 2F53A 3VD5A 2C1PA 2W9LA 3IU4L 1J88A 3F7PC 2DM7A 2NXZB 3P2TA 3T65B 5I30H 1JTTA 3T4YA 4I0PD 2CH8A 1CXHA 2JE8A 3QUMH 2R56L 1BP3B 2APBA 1NFDE 2ZJSL 4Y4KC 4R2GD 3I6KA 1XGYL 5KJRL 1SVCP 2OP4L 4N0FB 3N1GC 4LDEB 1KJVA 4DUWA 4YHLH 1ZT1A 1UACH 4KUCF 5E5RB 4DZBA 4C4KT 1CD8A 3BN9D 3MFGB 4DW2L 4RNRB 4MXQD 4X4YA 5HHQA 1SEBB 1CXFA 4KK6C 4UILH 1JHKH 3PGFL 4JRYA 3RKDC 2YKLH 4HPOH 3D2UA 1XGPA 1JFQL 3GJFB 1FO0A 1M6OB 4ONGH 3AS0A 4F9LC 4O2FA 2CUHA 1KTLB 1B0GB 4ONHB 1NUFA 4WY7H 2IPTH 3EOBA 1MIEH 2HN7B 1UJ3C 2Y23A 4XMPL 4U31A 4W4OA 3E1F1 3V4PH 4B5EA 1PBYA 4NKQB 3BAEL 4NQEA 1WWBX 5E9DE 4KV5F 5BV7B 3ARYA 1AO7E 1B4RA 1FVDB 4G42B 5E6YA 1WICA 4TULH 1S5HB 3B3IA 3RGHA 3LQAC 4X6CA 3E2HB 3EYFB 3BP4B 5FA3A 5ACLA 1WLHA 4XNUH 2J8UF 5DA0B 3DARA 4NN6B 3SKJL 1KPRA 4LAJH 5MI0C 3H9ZA 3M45A 4V1DA 5EZIH 4NRYA 1E6JH 3ZDZF 3MRQA 2V5MA 5TDOA 2KQNA 4RX4A 2IANE 4NZUL 1UXSA 4JDZA 5ALBL 1RPQA 4XNQA 4CGTA 3RVXD 3BH8A 3MV9D 5E70A 1JPTH 1QBLH 1FCCA 2BCKA 3G04A 4NO2A 3G5ZA 4NQCA 2EDWA 3KXFD 4YHKH 4AG4L 1IGTA 4KQ4H 2MWCA 4KKBD 4Z7WA 2DQCH 5FYKL 3U7YH 2B5IC 1HZHH 4DN3L 5GRXG 2F74B 4XWOC 5TF1L 2YEZA 1RULL 1NC4A 2B8OT 3SGJA 2R1YA 4W68A 2Q6WA 4ZD3L 5C0AB 1U8OA 1QLFB 2CIIA 5FO7A 3ZYOA 1FRGH 1QHOA 1YEIH 3DIFB 1TZIB 5I73B 2EEAA 3T2NL 4PJ7F 1LDSA 5KSAD 1HHKB 5IFAL 3OB0K 3D0VA 1I9RL 2DQIH 2DYPA 2MHAB 3B9EA 5CJ8A 1I7UA 2CKBH 4LGRB 4GG6B 2M1KA 4HG4J 4Y4KA 1SY6A 1UM5L 4NT6B 3IJYB 2CXGA 2F8VA 2ZG2A 4L4VB 4U1LA 5L88L 1N59B 2HG5A 3RI5K 4MXVF 1B6UA 2NY2C 4Y5YB 1CG9B 3SKNA 3FB6B 3CSYB 5FO8B 3FMGH 1DP0A 3VXUD 2W60B 5IT2L 1MAML 4JFXB 1QBML 4PLOB 3ZKXB 4IJ3C 3VGGA 3HRPA 3EYQD 3IDXL 3LS4H 2AJYH 5DJYA 5J1SC 2B1HH 2OR9H 3GSVA 3IU3A 1KJ2H 1XIWD 5CHNA 2VL4A 5IMLB 4M1GH 1UJ3A 1KXQE 1Z9OA 4Y5VB 2X4SB 4KTDL 2SEBB 3VFOB 4JPIA 4H5SA 5GPRA 5IBTH 5E8OA 4L3CB 2QHRH 2R8SH 1CU4L 3L3IB 5CJQH 5IV2A 4PP1D 4C56E 2GTZB 5BXFA 5D7JB 5JIIA 4Z76B 4XVUD 1M7DA 1A02N 3T2OA 5CGTA 5MEOA 4GMSL 1Q9OB 2HTKD 5ENWA 3DURA 1CF8H 1IQWH 4ELMB 1R0AH 4XC3L 1OAZL 1YMHA 1BQLL 1IAMA 2VDNH 2RQ8A 3KPQB 4MD4A 4HUVB 3LD8C 5FO9A 1E28A 2VLMD 3MXVL 3ARBD 3DWTA 3DRQB 4HWEH 2X09A 4GH7B 4NO0B 3REWB 3HE7C 1IL1B 5CUSH 4ZOCA 3WNNA 3DUSB 4AT6A 1HHJB 5GJSH 4KGJA 5I66B 4UT7H 1V7NH 3OTTA 3UTPE 4I9WE 4GMTL 4K3DL 4EVNB 2IPKB 4PRAB 5DUMH 1OAUH 3PG2A 4XP4H 4PLJC 1BREA 4OCLC 3DXAE 1TVDA 4DAGH 4RGOH 4PRDB 3C8KA 2ITCB 3ZL4L 5DRXA 5JHDD 3OKMA 2R23A 3K4DA 4WFHE 3V8OA 4PG9B 4JRXD 4FS0A 3UTQA 5TDPA 3RP1A 5D2NA 1S7UA 1C5DA 4NQDA 1U8LA 3UJIH 4POUB 1KLGA 4PJ9B 4XPAH 1UYWH 3RDTC 1FQ9C 1WAAE 1ZA6A 1M05A 2Q7YB 3MRLB 1T3FB 4H0HB 5KS9B 5ISZE 1FZJB 2MMXA 4WHTA 5AYUL 3B2VL 4QRPE 1BBDL 3HNVH 4P5KB 3SGDI 1S7SB 5JR1H 4RFNC 3NBNA 4WU7B 2H6PA 4I5BB 4Y89A 3EUUA 2I5YH 4M02A 4ZO7A 3GK8H 3PWPA 5JQ6L 4YGVB 3UBXI 1Q9WB 3GEWB 25C8H 1A7QL 3GFUA 4Y2DD 4MJ6B 5M94B 4QY8B 3P9MB 3SJVA 5FYLD 2AEPH 5ANMB 5KOMC 5SWSA 2Z8SA 1XFPA 1R5IB 2V9TA 1G6RB 3L3KA 1CLCA 5IW6A 1JGDA 4YX2H 5DHVA 2EDXA 2BVOB 3G6AA 3DECA 2AJSH 1S7VB 2W9DH 5GGSA 1BZ9B 2A6IA 5JW3L 2I27N 1F6LL 5SV4A 2X4OA 3LPGA 5DRZB 5C6PB 3MLYL 3GMQB 2AGJH 4LRIC 1A6TB 3BPLC 3KWWA 1AY1H 3TNNB 3BWUC 1A9EA 4MJ5B 3UTSE 3MUY1 1B4JH 3HZKB 1VGKB 1EDQA 4YUEL 3KPTA 2GSGA 2H3NB 1L7TL 4PRHD 3O8XD 2K9UA 4D9RD 1UA6H 1ZGLM 4PS4H 4WUUA 1JGLL 1PKQB 2BMKB 2PYEB 5IF0A 2CMRH 2NQCA 1BQHG 2PO6A 1AR1D 5B3NA 5I1CH 1EK3A 3PABA 5HHPA 3K0WA 4I18A 4F3FB 4S10A 2DQHH 3FRPG 3K3QA 3HMXH 5A2KH 5GGRB 5AYQA 1GGYA 3Q3GA 1EHLL 1JI2A 1FL5A 1U3HA 1I3VA 3BEWB 3GSQA 4Y4HC 4S2SB 2G60H 4YBLC 3K81A 4K3JL 2WBJD 3FN0L 2WP3O 3QFDA 1KJ3L 1C5BH 5IVZB 4Y5XA 1HH9A 1JNLH 1H3VA 4M5YH 3GM8A 2BSSA 5DJ6A 1NGQL 1RK1A 4U7MA 2F9BT 2OJEB 5GRZA 4LCWD 4J3OC 1XZ0B 1BMGA 3BWAB 5DK2B 3C8HA 3U6RA 4MWFB 2XKNA 5HI4D 1IKFH 3ULUE 1FIGL 3BP7A 5SWZD 1BQHA 3MYJB 5DJAB 5I1AA 5IG7B 4L9DA 3MR9B 1QSVA 4PGBA 2XTJD 1DSFH 4DOHB 2V7HB 4FFYH 3SDAA 5EA0H 4GXVH 4FMKA 2KKQA 3FRPA 1KENL 1T4KA 2XWTB 1VB9A 2FIKA 2H2PD 2MQ0A 5IROC 1DQLL 4R3SB 4BZ1L 5F9OL 3T4AA 1N5YL 5DI8A 3TLRA 3NIDE 3QFJA 5T3XH 1BJ1H 1JHLH 3G6JF 1BGXH 2R29L 3DX6B 4PTTB 1DUZB 4WHYH 2B0SH 4JFFA 1KIRA 5IB4A 1MI5B 4H1LH 4P3CH 3L7FB 4HWNA 2DWEB 5C3TA 1AFVH 1MHCA 4N90E 3MRNB 3WFDH 1G7MB 5DJDB 3QG6A 4P2QE 3UZEA 3FO0L 3WE6A 3BSZL 5IJVB 4ZUUA 4PTUB 5ITBL 2BVEA 1ZVYA 1TLKA 4NQSB 1ODAA 4ZO9A 1UWEL 3F65A 2YRLA 4FFWC 3SDDD 3HPLB 1GGTA 3BUTA 1BVLA 3QJHA 4OSUL 3VFUB 1A7PH 2YD9A 4G8GE 1X7QB 1IC7H 5EIIA 3MSPA 1ZMYA 2EH8L 5A2FA 2P7TA 3I02A 4NWUH 2X44D 5MENA 4FQ2L 3DO7B 3P0YH 1RZFH 1I3GL 3EDEA 4PB9H 3CLFH 3WIHA 4AIZA 1EPFA 1BWWA 4CU6A 4NZRL 4HIIB 5C0BB 5C6TL 3U0TA 5DMYA 3MOAL 3L9RA 2D7OA 1NGPH 4HXBH 2R2CA 1KIQB 4MCYB 5DMIH 1YPZF 5K9OB 1CBVH 3DO3A 1FYTA 2FBJH 4OCYL 1MCOL 3RGVB 3WNMA 2NY4B 3CFEB 4KY1L 5LWYH 1IEBA 2GK0A 3NFSL 4HBCH 1CFTA 4ZFZB 5DMGC 5TFSL 3JV4B 5C0IA 5EO0A 2OTUB 1GL4B 1AH1A 4F9PA 3DGGB 4U6XB 3HG1B 1I1AB 4DFIA 1WJ3A 2M26A 1BD2B 3D85B 4YHNA 3LN5A 4UOW0 4LU5L 3RJDA 5GIRA 4PV9B 5CWSB 2P5EB 3TYGL 5IHZB 3P77A 4O2CA 4BJLA 4F33A 2NY7H 2D03H 4LASL 4TSAH 1HXYA 4L8CA 3ZKQD 2WSKA 3WUWA 1TZGL 3DMMC 4DVBA 2HT2D 4HGKC 3MGOB 4MJ4A 2MTPA 1KJMA 3U2SA 4UTBH 1F4XL 3CH1B 4JKMA 3ES6B 1LEGA 2VXTH 3H42H 4W81A 3MROA 3GMRB 2JB6A 4BFIA 2O5YH 5DMKA 2NW2A 2FX9L 3F7RA 2X4QA 1T89A 3GSRA 3QDMA 1L6ZA 4U6HA 2JTDA 5JPNA 1LO2L 1NQBA 2UYLA 1RUML 1PEWA 2ICEA 1GH7A 3QHFH 3BPOC 3B5HA 4OD3L 1CR9H 4L29A 1H15B 2G2RA 4LRNL 2OK0L 3HUJB 1VA9A 5FF6A 4FN0A 3MCLL 3H9YA 2NY6D 3IDMA 3ULUL 4CBPA 2NX5E 2XN9E 3RWGA 4UOJA 3PHSA 4HT1L 5EBLB 3VWKB 4E5XB 1QKZH 1T0NB 2YXMA 3S34L 4AENB 1GGIH 4HS8L 5F96H 4NYLB 2MPAL 1DLFH 5HXMA 4ZUSB 1MRCL 1Z9MA 3IGAA 4HFUL 3VXPA 1KN2L 3QCUL 3QDGD 1CVSC 4JFDB 3KPRD 3WLWC 4Z7UE 3HHRB 5CCKL 5GSVB 3TM6A 3QEQA 4QHUB 3CCHA 4FNLL 4OQTH 1KFAL 1SYSA 3WKMH 3S3PA 2A77H 2PCPB 2F5AL 4F57L 4PGCA 3RWCB 3BRGC 1VACA 1CDJA 4X5LA 1BJMA 4H88H 3KLHC 5E6IC 3K4ZA 4LLUA 2D7PA 3GUTA 3OHXB 1GC1L 1RUKL 3OSKA 4ISVB 1MWAB 3QDJB 4K94H 4C83B 5F6IC 3CPLA 2VLRB 4D0DA 3RHWF 3PL6C 5GGVH 2ED7A 4JPWL 2J1KA 4OZFG 5TQ2H 5IFJA 1U58B 3JVGA 2QJDA 1YQVL 2MOVA 4KI5F 1R3KA 4UAOC 1G7HB 5HTSA 3BKCH 4D8PB 1S8DB 4LVNC 3PP4L 1I75A 1WT5A 3V5KA 4FQXC 4R7NA 2BNRA 3PXHA 3S9DB 1GVIA 5E8DH 2X05A 2R4RH 5E1AA 4QF1A 4RMUA 1QFWH 4NIKB 2R0LL 1FVEA 5HYIA 1A7NL 1RZGB 1G6VK 4LNVA 3RUGF 5D70L 2BVQA 4LARH 4MDIA 4MSWA 4ODVL 4P2OB 2Z9TA 2AABL 3HCVA 4OI9A 2J6EA 1NAML 4NKDA 4WJ5A 2YRPA 3S4SG 1G9MH 2ZSWA 1S78D 1EHNA 4B53A 4P5TB 4Q6IC 1KB5H 2ZKHL 1OP5H 1GIGL 3S88H 4KU1A 3AMLA 2VC2L 3EFDH 4M1CD 3HZMB 3TBTB 5DGQA 15C8H 2JJWA 1A1OA 2KL6A 2ED8A 4PJ5D 4YHPB 1ES0A 3QEHA 2WINA 4Q2ZA 5KSVA 3MMEB 3KPNA 3C6LC 1AXSA 4OUUB 2IADB 1HIML 2I07A 5B39A 1UB6B 5IVXF 4PRBA 2WANA 1EFXD 4OZFA 5C0DB 1QSEE 2OYPA 4G8FB 5DK0B 3U4AA 1A4KA 4XC1H 3HE6B 4JHWL 3QWRA 3VXUE 2Y5TB 2WP3T 4IRSC 4JCLA 1F11A 1IC4L 3EDKA 1FL3B 2UZXB 1S9VA 5HY9A 5FCSH 1I8LC 1BFOB 2GCYB 1X5YA 4NO3A 2VJXA 2VNCA 3WCYA 4EBQH 4XCCH 5TJWK 1YNKH 2CLRA 5HGBA 4GQ9H 5HVHB 3MRDB 1H5BA 5E6IA 3NACH 4OZHB 2D3VA 3VXTA 1PG7H 3RKPA 3GSNB 2DM2A 2A2QT 2XWBB 5K9KA 5LGKA 4GRLD 2J8UA 5GRVK 3HI1A 1JRHH 3PQYE 4QT5B 4Y1AD 3QULA 1HHHA 3DX8B 3J8F7 4L8BB 3BQUC 3FAWA 5LBSL 1TENA 2K3TA 1N26A 2HJKB 3DUUB 1UEYA 1IGFL 2C7UA 4F15C 3EO9H 4JVUA 4K8RH 5C07E 5DWUH 5F6HJ 3RWFB 2F19L 4GW4B 5IMMB 2QSCL 1I1RA 3TBVA 3IDYC 5HYSB 2HT3C 1AXIB 4QEGA 5I15L 5GJTH 4EN3A 1T83C 5CZKA 3U4EA 4F8TA 1FFPB 4EZMA 5C0CE 1MFDL 2J88H 4PJDB 3BUYB 4TUKL 3PNWA 2RB8A 4ODSL 4NKIH 5KSBE 2J7LA 3U0WL 3VRIB 3RAJH 5DZNA 3MBEC 4U3XA 3ROOA 2BFVL 3D39B 5CSZB 4LQFL 4Q6IA 2APVA 2E27L 4PJ7A 3C60B 3EZJB 3WFZA 3QIWC 2J5LB 1CK0L 4APQC 4PRID 5C08D 5HGHB 5IEKA 5KSUB 3ZYZA 3UAJC 2WW8A 3J7HA 1PZ5B 5I19H 4YFDB 5CJXA 3VRJA 3RWHA 2CDFA 3C6LA 2W9EH 2RAMA 1FNSH 3MLXH 1VFBA 4HC1L 5BJTB 4PJCF 3LAFA 2GKIA 1ZGLP 1T1ZA 2NLJB 3MV8A 1BJ1J 3BIKB 1EVUA 3MRRA 1NBQA 3THML 3RA7H 1OSZA 3KPSE 3P11L 3RVTD 2VLJB 1C12B 2KZWA 3FQTB 3UJJH 4G7YH 1XMWA 4WTZG 3BZ4A 1CLOH 1J8HD 4P9HH 4EQ2A 4IRSA 5CD3B 5DD0L 1MCQA 4KZEH 4XPFL 4P46B 1TQBB 4NC1E 3CX5K 1NCWH 1Y18B 3MV11 1I8LA 3FCTB 2UUDH 5A1AA 3QUXB 2BOCA 5CJ5A 3IFLH 4IOIB 4M6MH 3TA3D 5T3XD 1SQ2N 2HP4A 5F1OB 1YEJH 3QIBB 3RNKB 2E6JA 4WENB 2ZG3A 3KS0H 2NY0B 6FABH 1OGTA 2X1QA 2J4WH 2A83B 4O5LH 1I9JL 4JRYE 4D9QD 4JFQB 3JTSA 3NA4A 1FL6A 1SJEA 4POZC 5D7KE 4J8RB 4KKLC 4L9LA 2R69L 5DFWH 1AD0A 3FQRB 2AJ3A 4FOMA 4RGMC 2D2OA 4YE4L 1GOFA 2BXYA 3MCG1 4OM0L 3MV9A 3RL2B 4CN4A 1P1ZA 4WDIB 4N5UA 4OLXL 1T6WA 2GJ6D 3KXFA 2F53B 5DJ0B 4WTZA 3NIGF 4NQEE 3O2VL 1T83A 3CJJA 2N7AA 5KVEL 4OGXH 5DF0A 4Z0BH 4X6CE 5MHSD 1KCRL 1MUJA 1WFUA 3T4YB 2QQKH 5CP7A 2Q87A 2D7TH 2XQYK 1S7TB 5C86A 4KRPC 3V2AR 4XPHH 4KUZH 4EQ3A 5KSAA 4APQA 3OGOE 1KJVB 1OW0C 4YHIA 3LQZA 2ZOKA 5D7IE 3HFMH 4DZBB 1IAIM 4WCYL 1RIHL 4XP1H 1MVUA 1MNUL 4FTVB 4X4YB 5HHQB 5JW4Q 1EAPA 3TO2A 2PTUA 3KLDA 4PJXF 1NCAL 2BSED 3VI3F 3S98A 4J2XA 3U7WL 1JWMA 3LS5L 4FHBD 3D2UB 3RJQB 1YY8A 3QZWB 1D9KC 1XGPB 5DRWA 2JJSA 1D7FA 3QG7H 2VIRA 4LEOA 5BQ7A 1KULA 5J6GA 1JPSL 1BAFL 1ONQA 3VE0B 1QR1B 3EOBB 4NM4H 3GI8L 4MVBD 3WDHA 3Q5OA 1CGSH 5H94B 3MCKB 4AK1A 4NCC2 2YMXH 4PB0H 2CDGB 1IEHA 1U8JB 1MEXH 5L0QB 3B3IB 1XGTA 4MJ2A 4AEFA 1C5CH 1OAXH 1AXTL 3IDJA 2CJUL 3QXAA 5FA3B 2JIXB 4LAQH 4HGMA 4F7CA 1CTNA 3CX2A 3IFOA 3TJHC 1FSKC 4V1DB 5SWZE 4A6YH 4NRYB 3V9FA 2HMIC 2CO6B 2Y36L 2A6DB 3MRQB 4JANB 5TDOB 4UZGA 1FNEB 1A6VH 1TZHA 2VDLH 4RDQF 1UXSB 3WLWD 3CGTA 4TTDD 4XNQB 1TQCB 1T5WA 1XR8B 3T1FA 1IAII 5DD3L 2BCKB 3G04B 4URTB 3G5ZB 2UZIH 4NQCB 4YHOL 3S37H 3WJLA 1AGCA 2P1YA 2VLLA 3CVIH 4Z7WB 12E8H 5IBLD 1ORQB 2QBWA 4NC0B 3I75A 5HVGB 1TETL 2VKWA 2BVTA 1C1EH 5JORA 2R1YB 3KLHD 2IQ9L 1M7XA 5B8CA 3ARBA 2CIIB 3O2WL 5FO7B 4JR9H 2FEDD 3R1GL 2DIAA 2Z8VC 3ARDB 1CS6A 4K07A 3D0VB 2DYPB 3MA9H 3EJJX 1QBAA 1RD6A 3IS1X 1I7UB 1NCCL 3QCVL 3VXSA 4QNPE 3SKMA 3PL6D 4QWWC 3ULVC 1VERA 3SE9L 2GK2A 1MJ8L 3T8XA 2P4AB 4D9LL 3QUZC 2IAMC 3U0PA 1WWAX 1KPVB 5DYOA 3V7AG 3GJEB 1S7XA 5JHDA 2R2HB 1FFRA 1PQZA 1Q0XH 2EEDA 2AI0L 2PXYD 4LEXL 4UDUA 3TO4C 5I9QB 3SKNB 2VR5A 1RIVH 5FYKU 2W0LA 5CGYC 1DANT 1V05A 1NCUA 1VGEL 4HIXH 3NTCL 2DM4A 5IB3B 2BHUA 1D9KA 5I2IA 5DJYB 4X80L 2VDQL 3DETC 5GS1B 1SJVA 3NH7H 3OKYA 3HNTH 1GPOH 2LVEA 3GSVB 3IU3B 3SDXF 4BYHA 1EGJL 3MC0A 3VDCA 4YNYA 4BUHA 5DJZA 4AQ1B 3W5MA 5DURD 3RWDB 4KJYB 4XXCA 2X1WL 1VKXB 3EDDA 3RHWK 1BX2A 3RQ3A 3W9EA 5SX5H 1DL7H 3DSFH 5BS0D 4UQ2A 5KTEH 4Q9QL 2ADFH 4QYOA 2VITA 4WHCA 2XRAL 4H5SB 5E8OB 4NRXB 4JFZL 3VXQA 5IV2B 5BXFB 1MFNA 3VMNA 5JZ7C 2R0WL 2E7MA 4Y2DA 2NY1C 3EW3B 2UVFA 1JGVH 3VFGH 4LVOB 4ESKA 1RURL 1NBVH 4KROD 4Q0XH 3V4UL 3DURB 1E4XL 4E42A 3JWNC 2YWYA 5JA9A 4G6ML 4RGND 2PTTA 3WNOA 4MA7H 4YXKH 2XQYG 1Q1JH 1A14L 5EU6D 4OD1H 2X4TA 4UUJA 2XTLA 1GHFL 4N5EC 3O6FD 2BY0A 4YR6A 2Y06L 5CS7A 4AT6B 3VI4F 4KH2A 1AGFA 5CZXD 4FQ1L 4JFYB 3FFCE 4HULB 3T2PA 1LNUA 4PRHA 4YDLC 1FN4A 3O8XA 1FGNH 1MJJA 1TPXC 4UIKL 3OAUH 3SJVE 2GY7B 5D72H 5SWSE 5FYJE 4RAHA 4X5WA 4F2MA 2OTWA 4LSPH 4Y4FC 3KYMA 3OKOA 3OKMB 5F44A 2R23B 3WD5L 5HGDA 5D6CA 2AQ1A 4ZAKD 3GMOA 3MLWL 4RMVA 3UTQB 2VXQH 5TDPB 4WU5A 5D2NB 3QUZA 4RAVB 4PJBE 1DQMH 4XGZB 4BZ2H 1H0DB 2QV2A 4NQDB 1U8LB 4M6AA 5TE7H 4Z7QF 4KDTA 5EBWA 3OX8A 4RMTA 1ZA6B 1UM4H 4NWTL 1XF2A 3IRPX 2P8MA 4N0YL 2YXFA 1BM3L 2IC2A 5BMFL 2WBJA 4WHTB 4K23H 1JVKA 1N3NB 3EO1A 3VFPA 3KPRE 1XCQB 4Q97A 4OGAC 4JQVC 1VADB 3VXOB 1NH6A 1QYGH 3PWPB 2AEIT 2X4UA 4LCIH 1HN1A 1HEZA 4JN1L 5DSCA 5E24E 4XPBL 4LCWA 1MCIA 1PDKA 5CIPA 3P4MB 2QTEA 1CDCA 4K8RD 3L3KB 3LQAL 2P45B 1JGDB 5BRZA 1V8HA 1T2QH 2QADB 3L6FA 4HPYH 4OLWL 3V6OC 1QNZL 3M17A 4C54A 2A9NH 2ZUQB 5JA8B 3OMZA 4S1DC 7FABH 2QQNL 3VD9A 2X4OB 4WUKH 3P30L 4NRZB 3RPKA 3W2DL 2PW2B 1AKJB 1PW3A 1A9EB 3OKNB 4KI5C 4U1JB 3UMTA 4Z8FL 1J8KA 1TVHB 3U82B 2GW5A 2ID5A 3GMLA 5C0JA 2NY5C 1IFHL 1W0VA 4HS6B 1RZKH 2WM0A 1DBJL 4WUUB 3CXDH 5DJXA 4HMDA 1Z3GH 4OI8A 4PG2C 5IF0B 4AZ8A 2PO6B 1JJUA 3Q0HA 3PABB 2HRPH 2VDPH 5HHPB 3X3GL 1F45A 1IT9H 1INQB 4I18B 4WW2B 1RFDL 3WO4C 5J11C 1RU9H 5D1ZC 3SDDA 2BSRB 4PD4K 2CR6A 3DTXB 3Q3GB 5IMKA 2HKHL 1J1OH 5D7SL 1U3HB 3R8BB 3ZT5A 3QFJE 4DVRH 5JIPA 1Y0LB 1EEQA 1EAJA 2XZAH 3EOAA 3FT2A 1Z9LA 3QFDB 4NBYB 2HVKA 2C3GA 2K7QA 1T04A 2PETA 3X14A 3CK0L 4QRSA 4Y5XB 3E6HB 1HH9B 2YWZA 3RTQC 4ZO8A 4OLVL 5GGVY 4UT6H 3LIZL 4KKCD 2BSSB 4H20L 4ZTOL 4I2XA 3C09B 3W0WA 1YJDC 1RK1B 2IBZX 4MA1C 3AY4C 4TQEL 3KLAA 1Z2KA 3FRUB 1JTPA 4GKZA 2DQIL 2V5TA 2CD0A 4JQVA 4KK8D 3VFTB 5HDLA 3PWNA 4M7ZC 2XKNB 3MO1A 4PREB 1BQHB 3HZYB 1OQXA 3OF6D 5I1AB 5TDNB 2C4XA 4PGBB 1OF2A 4XHJD 5FYJL 1TCMA 1A6UH 4FQJH 1T4KB 2DQUH 2VDKL 4M7KL 4LLMA 3V6OA 3V6BR 4AL8H 2AK4E 4KQ3H 4U1NB 4JG0L 5M7QA 4ELMF 5EOTB 4ORGB 2E9WA 1P4BH 1JGUH 2Z92B 3T4AB 5DI8B 1MRDH 2Z35A 5T1LD 1IEAA 1P4IL 1MOEA 2NY3C 4KGLA 5EIQA 1MY5A 3T0ED 1F6AB 3GNML 3VW3H 4LLVA 1KIRB 5IB4B 3N1PC 2X4NA 2VR9A 3TN0C 3HI6L 4PYGA 1MHCB 3O4LB 1NANI 3QG6B 2CKBA 5TF0A 3WE6B 1OP3H 3RUGA 5EC1A 2DM3A 1CICD 3CDCA 1ZS8B 5FM4A 1U8KA 1BVLB 4CAGA 2LE9A 4Z77B 3QEGH 3R06A 1YZZA 1F4YL 3VFMA 5EIIB 4IRJC 3D9AL 3JWDC 2P7TB 3SOBH 1GZPB 3CXHK 1CE1L 3DV4A 2WWKO 5MENB 4PFEA 4JFPA 5KG9B 5HYJD 1Q9KA 1WGOA 1E6OH 1AHWB 1HHIA 3TFKC 2AJZA 1KJ2A 3NOIA 4MHHG 5IVXA 3L9RB 4P59H 3F7VA 2I24N 3NCJH 5KS9F 3QNYA 3V0WL 5CUSL 1FYTB 4N0UA 3RPIA 3O3BA 4ZS7L 3EYUL 5HHXL 3BGFC 3QDGA 1LD9A 1ACYH 4K71C 4UDTA 1OAUL 1WBZA 1IEBB 2GK0B 3ARGC 3QYCA 4P4KC 2YPKB 2DMKA 5EO0B 5C0IB 1SVZA 3BDXA 3HRZA 4W70A 3WHE1 3ULVD 3OV6A 3QDAA 3OKKA 4NNXB 4GRWH 3VWJB 5IWLC 3UEZA 4YHNB 3LN5B 4M6NH 4HJGA 3GO1H 4NCC1 4ZNEA 4ZXBD 4N8VG 3SGEH 2HFFA 3P77B 1T2XA 3VMOA 4H8WH 5HHNA 3MACL 4JO3H 2MKWA 1Q0YL 2ERJB 4O2CB 3ALPA 5KZCD 4F33B 1LMKA 3KJ4B 2B4CC 2BNQA 4NJAH 1CYGA 2Y07L 4I1NB 5ID0A 3HLAA 3ZT7A 3U9PL 1XEDA 4DVBB 3GBMH 4EDWH 4KAQL 2KZ1B 1LEGB 3OJDA 2JB6B 5B21A 3VA2C 4BFIB 5DMKB 1UZ6E 1WFTA 2NW2B 5J56B 1DDHA 2X40A 3TGXA 1OY3B 3GSRB 4HUXA 3QDMB 4OM1H 3F7QA 4DGIH 5GHWL 4ZFGH 2Z4QA 5JPNB 5AZEH 2IALA 5DS8B 3OQ3B 4YWGL 2NPLX 2FGWL 2ICEB 3EOTL 4X6DF 1N4XL 4XVTL 5DUBB 2DICA 1BZQK 5EFIA 5E2VL 1XCTA 2G2RB 4CADA 2A6JA 2EO9A 4OIIL 3SGKA 1IGIH 1KT2A 5FF6B 2AJSL 2P24A 2JK5A 3IDMB 1MQKL 4RBPH 1F4AA 3CMOL 1F2QA 3RWGB 4N8VA 3X11A 1WZKA 5DD5H 1J0JA 3CZFB 4IRJA 2F58H 4OZIA 2EC8A 2BNUA 1WZ1H 2E8ZA 3MV7A 3AVEA 5E56A 3WDJA 3RY6C 4UV4H 4PJ5A 3ILPB 4HS3A 4QRRE 5DJ2A 2P8LA 2WWMC 3A6BH 3BVNA 1JWUA 3LKRA 5FCUH 4HZAA 3IGAB 4AM0A 1DE4A 1RZJC 4IMLB 2DMBA 1CIDA 3K8MA 3H9SD 3QSKB 1RUQL 3B5GA 2H8PA 3H6JA 3QEQB 1DBBH 1MLBA 1O0VA 5ALCL 3IB4A 1SYSB 1KLUB 1ZA3A 1H3XA 4FQLH 4HUUA 4FXGB 1E27A 4X0KB 4U0RB 1K4DA 4K7FA 1VFAA 2PW1A 3IU4H 4JO1L 3F58L 5TPWL 2YZ1A 4LLUB 3ESUF 3MLTA 3FJTA 4X5XA 4YHYB 2GSIA 3QIUB 5C70A 4Y16B 2FWOA 4HAFA 2R56H 1X5XA 5KJRH 2ZJSH 4ERSL 1XGYH 1VENA 1FV1B 4D0DB 2OP4H 4LHJB 2BOBA 4LSQH 4J4PA 4F7MA 1DBAL 2YPLB 2HJFB 3TBYA 4DW2H 2VABA 2O5ZL 4P3WA 1N6QL 2HLFD 3PGFH 2BNRB 4LCUA 3HR6A 5EU5B 1DQTA 4KJQC 3TIDB 2PN5A 4QF1B 3CLEL 5LGHL 4HFWA 1JFQH 2BVQB 3HCVB 5C2BL 1U95A 1YY9D 3TV3L 3DUHA 3PJSA 3M07A 4IIQC 2H1PL 2DLIA 2OLDA 4XMPH 3TZVD 3VFNA 1IAOA 4L3EE 5C09E 3BAEH 5GS3A 4B50A 4P2RD 4G6FB 4JRWA 2J8UE 4KJPD 1NAKL 4L4TB 2WINB 4Q2ZB 4FZEL 4WHYG 2Z31C 3MUGA 3KPNB 1MCFA 3D3VD 1JPFA 4JN2A 1AXSB 4MNGB 4PRIA 3TIEA 5HDBF 4F7EB 3LMJL 1UCBL 5D7LD 4H1LG 3CFCL 5F7LB 4PRBB 3NIFE 4OZFB 3RY6A 3RRQA 3I85A 4PJXA 1YYML 1O7SA 3E6FA 3VGAB 4NZUH 1A4KB 5L2KE 1CGVA 3RBSA 2G5BA 4KJWD 3SE4C 1F11B 4AG4H 2C3WA 2A73B 5DD1L 5HD8C 5FYKH 3O6LL 4DN3H 4EUPH 5C8JB 5FM5M 5TF1H 4G9FA 1RULH 1FJ1A 2VUYA 4NO3B 4FFVC 5TE6L 1N2RA 2ARJA 4O9HL 4PJ7E 3C5ZD 4RA3A 3S4SB 4ZD3H 5L8LB 1OGAE 5E99L 2CLRB 4YC2C 3WN5A 3UTTA 3HPJB 3S5LA 4DTGL 2V17L 4KWUA 1MCRA 3VXTB 3T2NH 3P73A 4ONFL 5K9KB 1I9RH 2EYSA 1OP5K 1UADC 2VH5L 4U6VL 4HUKB 4MXVE 3Q48A 1UM5H 4LMQI 2AXHA 4H1LA 3MV8E 1MCLA 1IZJA 4M61A 5GRYA 5L88H 3BKJH 2RR3A 3QQ9D 3VRLF 4ETQB 2Y1VA 2A74A 3TBVB 4Z78A 1G9NC 5IT2H 1MAMH 1QBMH 3BDBA 2E8YA 1CGWA 3U4EB 3IDXH 1RQ5A 4PJIE 3C5SA 3BX7C 3C5JA 1S9XA 4PIRF 1R3LA 3PNWB 4KFZC 2NXZC 1JN6A 2GJ6A 5F88A 5CGMA 3CFDA 1FVCB 1KIPA 3ROOB 5FFLA 1BIIB 1CD1A 4IIQA 3HUJF 4NUGL 1IE5A 2VSDA 4ZOBA 3I2CL 1QFUH 4MDJB 1ADQL 4LP4A 4KTDH 4JFEA 4OV6F 2D03L 3GGWA 3RZCD 2EE9A 1A3LH 3NCFB 4I0PB 1KV3A 4HJJL 4R2GB 4OV5A 1CU4H 1QLEL 3VRJB 3TPKA 2Z31A 2CDFB 3BGAA 3RWIA 4FRWA 4EIZC 1VFBB 2WWKT 2ZOLA 3MFFB 1K2DA 4YO0A 3QUYD 3WNPA 4GMSH 1QOKA 4FG6C 4YAQA 3TN0D 4RMSA 2OSLB 2VZOA 3MRRB 4XC3H 4YPGB 1OAZH 2EDTA 3T0DA 1BQLH 1Y6NR 3OR7A 4HIEA 5DR5L 2UY6A 3G9VA 2EICA 1HINL 1F8TL 3MXVH 4WTXA 3SDXA 1MFCL 2ZUVA 5D93B 4BM7A 5BV7C 3VXNB 4OGYL 4AJ0A 4BQ6A 3E2HC 4GMTH 4K3DH 1D5XB 2MCPL 3B2UC 4KTEL 1T2JA 1DVFD 1H3PL 3AB0B 1NDGB 4PRPE 5ICYB 2WNGA 3V95A 4NN6C 4GUPA 2CPCA 1EJ6A 1D5MB 3ZL4H 4WFGD 3S37X 4DEPB 3PV6A 3JTSB 1EA9C 4GXUN 2FJGA 5CP3A 5I71B 5HJ3A 4L9LB 5EB9A 1AD0B 1VSCA 2AJ3B 3SCMD 1YUHA 1X9QA 3ARGD 5JTWA 3MV9B 1P1ZB 1IILE 4O02L 1DBML 1QRNA 1R6VA 3KXFB 5GGTL 1LO3L 3IDIB 4JM2D 5IM7A 2EIBA 3TWCH 4ZSOE 4JHBA 2D0HA 4XAWL 3VG9B 5AYUH 1OAQL 3B2VH 5I73C 4LSSL 1BBDH 2YUWA 3T65A 4MB3A 4L3AA 5IB1B 2DIBA 2ADJB 2R2BA 3RVVC 3GZKA 3EKCA 3OAZH 5JQ6H 2B2XL 5CEZE 5KSAB 1T20A 2UUDK 1A7QH 2EH7L 4XH2B 1B3JA 4YHIB 4R4NC 3QUKA 4M6OL 1FNGB 1ORSA 2F54E 4TRPL 1LHZA 1EAPB 3TO2B 1R5VB 2P5WD 1OVZA 2JELL 5E6ZA 2YUZA 2O93L 3SHSA 1NGWA 1H3GA 3O3UN 5CILL 5JW3H 1JYWA 3ZKXC 1YY8B 2EEBA 2UWEA 5DRWB 1PX4A 1LK3L 1A4JB 3MLYH 1GGCL 5BQ7B 2GUOB 2VIRB 3GJFA 1Q72L 3OL2A 3OZ9L 5DEZA 4DJMA 4ZOAA 4OQ1A 4U1KB 5CSGA 1KTLA 1LEIB 4G6AD 5K9QG 3FFDB 4YUEH 4PJ8D 3ARFD 3ZZ1A 1X5JA 1L7TH 2R1WB 4GBXD 3KYKL 4Y5VC 1XIWB 2ZCHL 2IF7A 5MEQA 1XGTB 5E2WL 4G42A 1H8NA 1KPUB 1JGLH 4E41D 2X5PA 4KPHL 3B6SA 5BS0A 3DRTB 5D7JC 2D9CA 4F7CB 3IFOB 3NZHL 4B41A 4FXLA 3S8WA 1T7YA 2IJ0C 2NYYD 4J3TA 4F8QA 3BI9X 5KAQF 5ERWB 4PBWD 3QHZL 2MQ3A 1X5ZA 2BRRL 5KVGL 3MNZB 1ND0B 3HN3A 1EJOL 3T1FB 3TP4A 1NCBL 4NNPL 1EHLH 1AGCB 3PF2A 3EYSL 2VLLB 4P5MA 4S1RL 4K3JH 2BRQA 1I1FA 3UDWA 3LN9A 5C71A 3FN0H 2X89D 1KJ3H 5JORB 1QEWB 3T77A 4Q9CA 5B8CB 2HJLA 2QR0A 3ARBB 4PJDF 4Y19D 1JZ3A 3C2SA 4X6FB 3O6FA 5GZND 5C0AA 4OT1L 1QLFA 1KCVL 1NGQH 1TZIA 4QHKI 1HHKA 1QVOB 3IETA 3VXSB 4MJIE 2MHAA 4RA0C 1BBJB 1MPAL 1NUDA 3HAEH 3T8XB 4L4JA 1FIGH 5FM8A 3U0PB 2X7LA 3BP6A 4NT6A 3IJYA 3MGTB 5JHDB 4PUBL 3V6ZA 4LHUD 3LV3B 1KENH 2AXGA 4JRXB 4PJ9C 5EUOB 4Y5YA 1CG9A 4YK4B 1DQLH 2BY1A 3G6JE 5FO8A 5HYJE 3EHBD 2YD3A 4OFDA 1L9MA 4BZ1H 4ODBD 5F9OH 4ZPVA 5I1LA 5I2IB 1N5YH 5JIHA 3ILQC 1FNLA 3H7BA 2FBOJ 1PSKL 1NLBL 2R29H 4JKLA 4N0CD 1XGQB 1HHGA 2O61A 5IMLA 2ADGB 3N50A 4PJAE 2X4SA 4QYOB 3UC0L 1OOAA 2CLZA 2VLKD 4NHUB 2V7NA 3FO0H 3GRWL 3BSZH 4TNVF 2IGFL 3WHXA 4O51A 1JZ5A 5ITBH 3HR5A 4L3CA 3ULVE 1UWEH 3L3IA 2DKUA 3IT8D 4Y2DB 5D7JA 2ATPB 4OSUH 5J3HD 4IM8A 5CEZL 2AXFB 3QPQD 2R4SL 4EJ1C 1BPVA 2MSPA 1Q9OA 4E42B 1CZ8L 4M7JL 4ZTPL 2EH8H 4KK9C 4ELMA 1BLNA 4FQ2H 5A3IC 3S36X 4N1EA 3SQOL 1I3GH 3KPQA 4QOKE 3FQUB 3MUJA 1KGCE 1YPZE 4NZRH 4UUJB 5C6TH 4OD2A 5FGCB 2HH0L 3MOAH 2FSEA 5JMRA 3BRDA 3REWA 1IL1A 5GRWA 3UJTL 3T04D 3U83A 1HHJA 1LP9B 4PRHB 5I66A 3O8XB 4OCYH 1MJJB 1I8IB 1MCOH 3T0WA 4KY1H 2H26A 3MRCB 4TPRL 3NFSH 3DVFA 2DI7A 5TFSH 1H3UA 3JV0A 4X5WB 3G5YB 3TNMB 1U8HA 4AH2B 4NFBA 2ITCA 4U4BA 1QSZA 4PJEB 5F3HA 2BHYA 5HGDB 2NW3B 2G5RA 3GMOB 4LU5H 3ZSSA 4MS8D 4Q6YA 4WU5B 4I13B 3CSGA 3TYGH 5HI3C 5FYKD 5HDQL 1FLRL 4LASH 4X9IA 4PJGB 1I85C 3OX8B 1MCPL 1XF2B 2XA3A 3D25B 2P8MB 1SM3L 3OPZL 2Q7YA 3KJ6L 1TZGH 5E4IA 4NC2B 2D0FA 2WBJB 3IDGA 4MNHA 3EO1B 3ZE2F 3VFPB 1F4XH 4GAJL 1NDMA 3JUYA 4P5KA 1S7SA 2FX9H 3S3JA 4QCIA 4KHXL 1WUNT 2X4UB 2BY3A 4GW1A 2V9QA 5DSCB 1LO2H 1U91B 2EKJA 4HIHA 2W07A 3T0BA 1RUMH 4LCWB 1Q9WA 4NSKA 1L0YA 4P0DA 1X5GA 4OD3H 4MJ6A 2QQLL 2WUBL 3TPUA 5BRZB 5ANMA 1T1WA 1Z0NA 3ZE1F 4LRNH 3AREA 3L6FB 4PJFB 2OK0H 4CJ1A 3F62A 3M17B 5SWZB 1QFOA 3MCLH 2EDOA 1S7VA 4JFHD 2NMSA 4TN9A 2XTJB 3ULUH 1OM3H 4Q7DA 5FKAA 1YN6B 1A3QA 1D3CA 4HT1H 4IRZL 4NQXB 5DRZA 2NCMA 3S34H 1C7SA 4HS8H 2CDEA 4MJ5A 2MPAH 1EFQA 2YD8A 4Z7WF 2HLAA 4J3SA 3CNKA 3T2QA 3GMLB 1ZT4A 4I2XE 5T1LA 3W0WE 3HZKA 1MRCH 1VGKA 4HFUH 2DLGA 1KN2H 2XT1B 2H3NA 3QCUH 2IH3A 4CUCA 3QWOA 3T0EA 1NMBL 1F90L 3QUMB 4WV1B 1CLYL 4U6YB 5CCKH 3Q5YA 3BN3B 5HHOE 1T5XA 2EO1A 1PKQA 2PYEA 4FNLH 4WO4D 1KFAH 2Z91A 3MQIA 4X6DA 4XB7A 5IVOA 3AFLA 2EIEA 2F5AH 4F57H 3LKPA 3ZMRA 4MAYA 2KQMA 3JXAA 1NUGA 4JB9L 5DO2C 1GXEA 3SDDB 1VESA 4UV7L 3ULVL 1WQVT 3HB3C 3R0NA 3LEXB 1GC1H 1RUKH 3DLQR 3B9KD 5GGRA 4AYFA 3C6SB 1YEEL 4FQHA