2TSAA

Azurin mutant m121a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALAKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutant Met121Ala of Pseudomonas aeruginosa azurin and its azide derivative: crystal structures and spectral properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords AZURIN
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2tsaA00
1N68A 5AZUA 1J9SA 3ZIYA 1NIFA 1KYAA 1SNRA 2YAFA 4CSPA 2HXAA 1FWXA 1NIAA 2IDTA 3T6ZA 1IKOP 5AFAA 3NJHA 1OCZB 4QKTA 1ILUA 4GP4B 4E9VA 1JXDA 1NWPA 1XB6A 3V9EA 2OJ1A 2UX7A 5TK4A 2X88A 3KW7A 2B08A 3JTBA 1OE2A 3PXLA 5EHFA 4Q8BA 4FA7B 1DYZA 5I5JA 2CCWA 5LDUA 2AVFA 4GP8B 4Q89A 3X2QB 2GB2A 1PF3A 3OMIB 3FU8A 2IDUA 1SJMA 2IWKA 3CVDA 3CDZA 5ANHA 3IBOA 1ET5A 3UADA 1ETJA 1QHQA 3FPYA 2AZUA 1OE1A 4G7QB 3X1EA 3T6VA 1WAEA 3OD3A 8PAZA 2FJSA 1CUOA 3WI9A 2UX6A 4L0PB 1RZQA 2XWZA 3FSWA 3OQRA 2RACA 4E9SA 4QLWA 4HCFA 4G7SB 3AG4B 2LLNA 3GDCA 3UACA 3NJFA 4KNTA 2GC7C 1M9WA 3X1GA 2H5UA 2N0MA 3QJTB 3MX0B 3NJMA 3NSYA 3BVDB 3ABMB 1NPNA 3UGEA 2HX9A 3ASOB 4YSAA 2DY2A 2WO2B 5IY5B 4BWUA 3IE9A 6PAZA 3NT0A 2XUWA 3DKHA 3FT0A 2DYRB 1WA0X 1PLAA 2HX7A 2HRGA 1KDJA 3H4HA 3GXUB 4A2DA 4DP2X 2PP8A 2XV2A 4DP9X 1CYXA 3DIVA 2Q9OA 1NWOA 4DP1X 3OM3B 1NTDA 1MG3C 2FT8A 2HX8A 5TK2A 4A2GA 3NJKA 1WA1X 2DV6A 2JFCA 1J9RA 2QT6A 2VMJA 2QPDB 2R7EA 5I5MA 2IDSA 1KBVA 5D4IA 1IBYA 1X9RA 3NJNA 1T5KA 2VM3A 2EIJB 1A4AA 2W8CA 1QNIA 4YSRA 5I6KA 2PPFA 5I5IA 5I6OA 2AANA 2XV3A 2EIKB 1SHWA 1ASOA 1CYWA 1GS7A 1JVOA 3BQVA 1GYCA 1PY0A 1RKRA 1GS8A 1AG0A 4BXSV 1BEXA 1OF0A 1JERA 4JKNA 2YAQA 3FYEB 1IUZA 3TA4D 3ZDWA 1GR7A 2UXTA 3TU6A 1XB8A 2VM4A 5I6MA 2GI0A 2GHZA 3AZUA 3N55A 4KOBA 4E9RA 1AS8A 1KV7A 1OCCB 1L9OA 1J9TA 2YXVA 4G72B 1AS6A 2J56A 1NIBA 3WKPA 2BP0A 1JZEA 2BZ7A 2FT7A 1PZCA 3FQYA 3SBRA 4UF7C 1TEGA 2XX0A 4BDVA 3IN2A 4JHUA 4YSOA 4YSTA 5F7BA 2GC4C 3WG7B 4DP5X 3AY2A 1WS7A 1WS8A 3AG2B 1AG6A 4WTQA 2E86A 1OV8A 1A3ZA 1JZGA 2EIMB 1JZFA 4GYBA 1L9RA 3UAAA 1W6WA 1JXGA 4P5SA 4P5RA 2VW6A 4KO5A 4KNSA 1AAJA 3FU9A 3CG8A 1IBZA 4G7RB 4M3HA 2GIMA 3V9CA 2H47C 1QLEB 4NAJA 4PCYA 3T6XA 2QDWA 3WIAA 3FPXA 4CSZA 2BP0B 2XVBA 4HCIA 3HEIB 1KDIA 2I7OA 1NICA 2FNWA 3CDZB 4PAZA 2YAMA 3AG3B 1NDTA 2ZOOA 1ZDSA 3ASNB 3FU7B 2VN3A 2W88A 3H56A 4N8UA 1PNDA 4F2FA 3EF4A 1BXAA 3S8FB 1OOWA 4DPAX 2IWEA 4E9XA 4HHWA 3TBCA 4M4RB 4RH4A 2CAKA 2UXGA 2QPEB 4A2HA 2X87A 1ASPA 1BXVA 2BO0A 4X4KA 4A66A 5E9NA 2PLTA 3UAEA 5B1KA 2FWLB 2J5WA 2YAPA 5B1AB 1PNCA 1ID2A 3CZUB 6PCYA 4TXVB 4KNUA 3T71A 2DWTA 3MBWB 1WA2X 2YARA 4AI7A 1B3IA 2H3XC 3X1BA 5A7EA 3CVBA 5I6PA 4DP4X 2DYSB 2GSMB 4HIPA 4EF3A 4DPCX 3JT2A 2ZWNA 1CC3A 3PAVA 3NP3A 1MZYA 2CJ3A 4BXVA 1AR1B 3QJSB 1NIEA 5FC9A 4DP7X 1L9TA 2JXMA 4YL4A 3FQ2A 4DP6X 1BYOA 1A8ZA 2J55A 2Y69B 3KW8A 2A3TA 3GYRA 3EH3B 1TKWA 1MDAA 2EILB 3S3CB 3SBPA 1BYPA 1A65A 1ET7A 1E67A 1X9UA 2IAAC 1ET8A 3AW5A 3CVCA 3FU7A 4HCGA 3PLYA 1AZRA 3RYMA 3ZBMA 1E5YA 1GY2A 1NZRA 4E9YA 5I6LA 4ZK8A 4AKQA 1AANA 2XXFA 2YAOA 1A4BA 7PAZA 3NJJA 5I28A 3QJUB 1JOIA 3EHBB 5PCYA 1BAWA 3EH5B 1KBWA 2YXWA 2VSKB 1OE3A 1HAUA 1SF3A 3U25A 4DP8X 2BZCA 5B3SB 3ABGA 1JXFA 1J5DA 3NSFA 3G5WA 2XX1A 1JZJA 2I85A 4UANA 2UXVA 3WNIA 4F2EA 4N4YB 3OMAB 1BQRA 3NJLA 4E9WA 2EINB 2OV0A 2PCYA 7PCYA 1BQKA 1ILSA 3UABA 3FQ1A 5B1BB 4W9ZA 4ENZA 1SHXA 1ZV2A 1TEFA 3ZX1A 2PPDA 2BW4A 1AZCA 5D4JA 5B7MA 1GSKA 4YVUA 3TASA 3T6WA 2DWSA 1AZUA 2ZONA 2YAEA 3NSDA 4NB7A 2PP7A 4HAKA 1PAZA 1ZIAA 2PPEA 1SF5A 2BP8A 1W6LA 1GS6X 1EZLA 1L9QA 4YVNA 4E9QA 1AS7A 1FFTB 2YAHA 4JHVA 4WKXA 4A2FA 3NYKA 2VW4A 2J57A 1JZHA 3WKQA 2XU9A 1PZBA 3D12B 1EHKB 1SFHA 4W1TA 4YSPA 1OCRB 4BWTA 1YLBB 2XLLA 4KO9A 4AZUA 2BHFA 3OMNB 4YSCA 1NPJA 2B3IA 1HFUA 2FQDA 4GP5B 3ABLB 3IEAA 3EH4B 2YQBA 3FYIB 3QPKA 2TSAA 4YSEA 2MTAA 1XB3A 4BWWA 2BP8B 1PCSA 4K9JA 3NJIA 2Q5BA 3SQRA 2BWIA 4YSSA 4F7KA 2WO3B 5B7EA 3FSVA 3FSAA 2MRYA 1W8EA 2IWFA 1JZIA 1PLBA 1L9SA 2JKWA 3FSZA 1L9PA 2PP9A 1SDDA 3S3DB 1DZ0A 5B1JA 5AKRA 2NRDA 4MFHA 2AZAA 2WSDA 2XYBA 2PCFA 3ABKB 4G70B 1XMEB 2R7EB 4YSQA 1SDDB 4HHGA 3X1FA 1RZPA 1MG2C 1F56A 3NSCA 1PZAA 2FQGA 5B1JC 2GBAA 3QJQB 3QQXA 1ADWA 4A68A 3S3BB 1CURA 2P80D 1E65A 4DPBX 1TU2A 4A2EA 9PCYA 4KO6A 3PAUA 3H4FA 3PAZA 1ZPUA 4GY4A 4KOCA 1J5CA 4YSUA 2VSMB 3NJGA 5I6NA 2IH9A 1KCBA 1E5ZA 2CBPA 4KO7A 3NP4A 1FA4A 1AOZA 2FQFA 3X1NA 2PPCA 5F7AA 2ZXWB 3TBBA 1IC0A 2HLEB 1RCYA 2BWDA 2I7SA 1ASQA 1PMYA 2OCCB 3IN0A 2IH8A 3SBQA 1BQ5A 1R1CA 3QJRB 1KCWA 3HB3B 4GXFA 1PLCA 4AKPA 4G71B 1HAWA 1KGYE 3ERXA 3WNJA 2Y1AA 4E9TA 2FQEA 1J9QA 4HALA 3PCYA 1M57B 3FS9A 2UXFA 1MZZA 1AQ8A 1OCOB 4HZ1A 1A4CA 2CUAA 2QDVA 1V10A 4NERA 2BW5A 4AKOA 5PAZA 2FT6A 1AACA 2XXGA 2AFNA 2VW7A 4AX3A 3T9WA 1N70A 2IDQA 5D4HA 2HRHA 5B7FA 2TSBA 1AIZA 1SFDA 3PPSA 3QJVB 1AZNA 4A67A 2XV0A 4YSDA 2IDFA 1URIA 1BXUA 3DTUB 1GW0A 5I26A 3L45A 3C75A 4BK5C 4FAAB 3AG1B 1ZIBA 1ZDQA 1JVLA 4UAHA 2CALA 1V55B 1UATA 4BDVB 4DP0X 1E30A 2P80A 1GY1A 1VLXA 1V54B 3N2JA 2FTAA 3S8GB 1NINA 1M56B 1I53A 2PPAA 1NIDA 2HZHA 1AZBA
chains in the Genus database with same CATH superfamily
3G5ZA 2VR4A 4XVTL 1BM3H 3D25B 4LCWE 4R4NC 3VFPB 5CGYC 1JXJA 4ZXBD 5E95B 3TJHD 5EC1A 1DLHA 1OCZB 3EJRA 4H8HA 4E41B 2C9UA 2ZXDA 4UZGA 1XB6A 4NYLA 4B3EA 5BOJA 1GHFH 3CC5A 2QBWA 3JTBA 4L9LA 1HHIA 1KCVL 2GTWA 1I8KA 2CDFB 3CSTA 4FA7B 2BNQE 5I71B 2DQTL 2YD4A 4WFFE 4BV1A 4AT6A 3MV8E 3O4LE 1HHGB 3VB9A 3H55A 5TE7L 2EE2A 3LH2H 1AQKH 2ZAIA 4ONFH 3G6JF 2HT4C 1ET5A 3F65A 3EKCA 5GRUL 2HN7A 3QORB 1OM9A 3ARED 3O6FB 1JZ4A 3D4YA 1FNSH 4IS6B 4L48A 2Q7YB 2NNAB 5IHHA 1RLWA 3S35X 2KPNA 1HH9B 3Q1SH 4MNQE 4HVBA 4P2RD 5CFHA 5FO7A 4QY8A 1M9WA 3QYMA 3PP3K 2EYSA 2KQMA 5CGTA 4BA0A 3SDYH 5JMOC 2NY7H 4AEFA 1FBIL 4UM8A 3VWJB 5FUCE 3QIWD 3UGEA 1DJIA 4YSAA 2JCCF 1FH5L 4WJG3 3UIYA 4JB9H 3SE9L 2BIIA 4G9DA 2BSRA 1XH1A 5EU6B 1VFMA 1PZSA 1YNLH 2WBKA 2XZCH 5AOLA 5AAMC 1BBDH 3P40A 2R0ZL 1PLAA 3GZOA 1T1WB 4DVRH 1KDJA 4A2DA 3GIZH 3CIAA 4XPBL 5HGBA 5IVXA 2PP8A 5IKCB 4JL2A 4PRID 5F9WC 1RJLB 3RX7A 1CLVA 1OVZA 1OWRM 3BDBA 3LNGA 4XXWC 1UGNA 1MG3C 2A83B 2KH2B 3VXRA 5LG6A 4N0CD 2EYRB 4JHAL 2RIKA 4JHAH 3MLZL 1Q9WB 2R51A 5D1XB 1FL3A 2PWFA 2W9EH 4KZDL 4JRXD 5TTRA 2XWTA 3IPEA 4PJIE 1SMOA 4S1SH 3CPLA 4X5QA 1QRNE 4LRIC 5K39A 2DMGA 2QTVA 4ZSOE 1KLGB 3X14B 2P4AB 4OZ4B 4P9HL 1MCNA 4XBPA 5FHAH 2HH0L 5H37H 3TPUB 2XETA 2KUTA 1QHPA 1XF4A 1ZLEA 35C8H 1YJDH 5T33H 5HDQH 2VLKD 2ODHA 1BOGA 3QIUC 4TSCH 1GS8A 1DQLH 2YAQA 2JQZA 5IBTH 3SE8L 4PRAB 3KYNB 1SYSA 4F7CA 3RB5A 3MRDB 2AK4E 3TU6A 4ZXBC 1NFDA 3FQNB 1XB8A 3L4UA 4JEGB 4L8BB 1KG0A 2GHZA 4OM0L 5JIKA 4IU2A 4HUVA 5JZ7C 5F9OL 4S1DC 4MXVF 4UU9B 4Z7VF 3VWJC 3OKDA 3GLZA 5LNEA 4G72B 3ZKNC 4IBUA 1PZ5B 3PWNA 1QPPA 2A4ZA 1CF8H 2JKIS 3BFWA 1JZEA 2FT7A 1G9NL 3IU4L 1FORH 4HULB 1Q9LB 3H0TB 4KFZC 3BEWA 1QRNB 3IN2A 5DHVB 3EOBB 5F7BA 2YK1H 3QUZD 5ESVB 2VLJB 1WS7A 3HBQA 3MJWA 4X7CC 1AO7A 4ZQTA 1LHZA 3LH2L 4ERSH 3N40P 3QORC 2EIBA 1C5CH 4OI7A 1CLZL 4BFIA 5CIPH 1SJEB 1PKQB 3PV6A 4EN2A 1JWSA 4IHBA 3FN3A 3SDAA 4NJAL 4X9GA 4JO2L 3T0VA 1A7PL 5I1HL 4PG9A 3NPZB 2BP0B 2G30A 2YD9A 1BSIA 2XZAH 1EFQA 5C0GB 2YA1A 4RAVB 3IETA 2DRUA 3DX9A 4S1RL 4UAOB 2ZXGA 3QDHA 4U1GC 5G4MA 1VACB 2D2CC 2NYKA 5JR1L 2ZOOA 4U6HB 1CD8A 4FQCL 2FL5B 2NUPB 1O7SA 1T7YA 4KK5C 1MRCH 4X6DE 4QHKJ 2X1WL 2YSTA 2XNAA 4AL8L 2FEEI 5DC2A 4GI6A 1LNUA 4EDWH 2DQIH 4WLCA 2H2PD 1U9KA 3T2PA 4XMLL 2GQHA 1JTPA 1M7XA 1FGVH 3D50A 4PJCF 3SD5A 1NC4A 2VLMD 3KJ6H 1USQA 4MA7L 4LSTL 4OCYH 4TUJA 2FECI 2BO0A 1ULVA 5IMMB 1VCBC 1OAKL 5BZDA 1N59B 5HYSA 2VQ1A 5KSUB 3T09A 4FFWD 3EOTL 1ERNA 2AEQL 4WWOA 2OI9C 2QFPA 5F9WB 3MI6A 5FXCH 2CA3A 1JZ2A 1FN4A 3MOBH 3A6BH 4L3AA 3PWJB 1MREH 5GGVH 5EO9A 2FEEL 4Y2DB 4NHUA 1ZVSA 3FT3B 4IBWA 1GZPB 1V7ML 4QYOB 4MX7B 3SGKC 1J8KA 1EAPB 5C0DB 4FF9A 5E08L 4TRPL 3SKMA 4JDTH 4ODTL 4PJ9D 2P28B 1HSAB 4M7LT 4H5SB 1N5YH 2D7PA 3QDGE 4DAGH 1E3XA 2LAGB 3BMVA 3HFML 3VTAA 4BJLA 1U58B 4FNLH 5HYSG 2A99A 4PV8B 1N7MH 1VESA 4DO6A 1QEXA 2A3TA 4HUXB 4LDEB 4IGBB 5L88L 1PGRB 4JDZB 1ND0A 5JMRA 5C0AB 4HV8B 1MAMH 4U1SA 3CLWA 5EBWB 4FYQA 2WWOA 1FO0B 1ET8A 2Y25A 3C8DA 4L5FE 1UD4A 1AZRA 4PW9A 2DIJA 1Q4NX 4HU2A 4Z7UA 4Z7QB 3EIFA 3DA0A 3OGCB 1JF6A 2YAOA 3BKCH 5AVZB 5EC2B 3GJFB 3REVA 1C1EH 5GRVK 2XV6B 4J1UA 5D2LF 3OLEA 3NIFE 4MXWL 5D1XA 1XGRA 1BQHA 3QFDB 3INOA 2CJSA 2VSKB 4ZMAT 1B4LA 3H9SB 1OE3A 4WJ5B 1TMQA 2MHAB 4GQ9H 3B2MA 4PGBB 5KW9H 5D5MB 1T04B 4XHJD 3RUGB 3B8YA 3DIFA 3SJVD 5ISZD 1FZKA 2YRZA 3EYSH 3H1ZA 4QXUH 1JXFA 1F58L 1F18A 2V8MA 4JPSA 3TVMB 2XX1A 4X7EC 4JM4H 2ICEA 2WV3A 3C08H 3LS5L 4GO6B 5AEAA 3IS0X 3T4AC 3SPVB 2YFOA 3DMMC 3WNIA 2IFGA 2X6BA 3QNYA 1RU9H 1T4WA 4B5EA 3EFOB 1U8JB 4HPOH 3LKRA 4AGLA 3E8UH 3VI4F 1J8HB 5D2LA 2J1YA 4HEPA 5KVDE 3UBGA 2EDKA 3UJTH 4RISL 1ZHBB 1S7VA 1TYEB 3RVVC 1CJYA 3NEXA 4F2MB 4G9FD 3HE6A 5HGHB 5F70A 2K4WA 5F71A 3FU5A 3TASA 3TESA 5A2KH 1MNUH 3AM8A 3CFBB 5J3HD 4LSTH 3MODL 2AI0H 2O6CA 2OMYA 4LHUG 5EU4B 1RSFA 2IEPA 5J6SA 4I18A 4NSKB 5CJOL 5D9SA 1QR4A 4G2AA 1N2RB 4KJPD 4LSUH 4ZW6A 3MTXA 1EEYA 4G1EA 3AU1A 4E9QA 5BS0A 3O0LA 3KBFA 3Q5YA 3MMEB 5HDBE 4WKXA 5GGTA 4JZNA 4W4NA 1CFNB 4NQCA 2N7SA 4N9OB 4HIIA 4POZC 3B2VL 4N0CC 3RAJH 1QWHA 3W2DH 5JIMA 4LLAA 4GQPH 3S37L 4D8PA 3RWJA 2FNBA 4CAGA 5LCVH 1ZJAA 2WAHA 3FTZA 1NPJA 4LEXH 3TCLA 1VCAA 1KJ3L 4KXZH 1KXTB 2O5NA 4OGXL 5IROA 2DJMA 2PETA 3DXAB 3O4LB 3RZCB 1CLYH 2P5WE 4Y19D 4AIEA 1HKLL 1DLHB 1FO0A 2DBJA 2MTAA 2HVJB 1XB3A 3VWKA 4MJHA 5AVYB 1PCSA 1SEQL 1CDIA 1HDMA 2D7QA 4JG0H 3WL9B 5JORA 3QIBC 4P07A 3RJDA 3KPSB 3SQRA 1KJ2H 5E8NA 3QIUD 4DQAA 1UM6L 1O9VA 4U6TA 1SXBA 4GKZB 3MKKA 3VRJB 5B38B 2XQYK 3ARVA 2W9DL 2VQTA 2WGNB 4B41A 1DUZB 4N3UA 4RAHA 5D7KE 4K3HA 3UG5A 1IJ9A 3B9KB 1CICB 1RL1A 4OJCA 4Z7WB 4XN4A 3OHXA 3LMJH 5DUMH 5JHAA 1NC4B 5C08E 5CSGA 1M7UA 1GYVA 3I75A 5KJRL 3BQUA 5IMMA 1NCAL 2XZQH 2Q2EB 1QBBA 4WO4A 1N0LB 1MCDA 4Z7VA 4HLZG 4RLDA 4RCAA 4ZUWB 3JTSB 4WNSA 4EKJA 5HHOB 2NR6D 2WQSA 1A6ZB 4PJGE 4TVPD 4U1HB 4GW4A 1IC1A 5LO7A 4IIQA 1JI2A 1BFSA 5D7IB 4JVPA 1NDGB 4BUGA 3B3IA 4UNTA 5IHZB 3RIAF 2X1OA 3ELQA 5F6IC 4ABUA 4D9RE 3U0PA 1RUML 1IC0A 1V3MA 2WYTA 5I5RA 3WENA 1DQDH 2I7SA 3AQYA 2PR4H 3SDXA 3LHAA 4KZDH 4BINA 4YO0B 4TUUA 3EYQD 1MHPH 5ABDE 5BMFH 4PB9L 2PKDA 4NN7B 1CLOH 5T1DL 4A04A 5DJCA 4L4VD 2CR6A 4GAGL 3KJ4C 3QZWB 5IEKB 2YD3A 1E5AA 3CJJA 4G3YL 4JGJA 3BYYA 3CBJB 2YK1L 4JL1A 1D5BB 1TYRA 3KPQA 4X6CF 1I8MA 2DN7A 3LKNB 4HFUH 4LRNH 5I15L 1UH3A 4TPRH 4AZ8A 4QLRA 2WCSA 1SQMA 3NZUA 1ZV5A 5TJWK 4PP1C 3RAJL 4MWFA 3SGJA 3US1A 4XP6H 4XE0A 2BJML 4OZGB 4BRJA 3D2UB 4L4TD 3APFA 4JE4B 1SFDA 3FTGB 1NBQA 4UM9A 4YSDA 1TTCA 4OZFA 5GGSA 1CQKA 2F0CA 4ZQKB 4DGYH 4PJ8B 2A9CA 2XBZA 1R3LB 1U21A 3L45A 4BK5C 1WZ1L 4NBZB 4G7VL 4WGVB 1PX8A 3SDCB 1EO8H 4F20A 2CGRH 1E28B 4Y1TA 4OIFA 3QFGA 2AEIT 3TN0D 4ZX3A 3GRWH 5J13C 4JG1H 3TVMC 4P4KC 2ICWB 1U8JA 3BUTA 3RVTD 2ZX5A 1AXIB 4CSPA 5F89B 1THAA 2IBGA 1KTDA 4U1IB 2IDTA 3UIZA 3NJHA 1GZQA 1ZA6B 1ZWIB 5SWSD 4AJYV 4WU5B 1ZS8B 2OJ1A 4CU8A 4NO0B 1YYMH 2R2CA 1KIRA 4C4KO 4N1CA 4K23H 4WTQA 2EACA 5CMAB 2HT3C 3P0GB 3NIGF 2DEYX 2ZYSA 3MREA 3LX9A 4Y8DC 5F44A 1EUUA 3UADA 1MQ8A 1ETJA 3T2OA 2EVGA 3S2CA 4HWNA 2P42B 2DQGH 3W0WE 1Z5HA 1WAEA 3M1BB 1QFWM 3FUKA 2HYMA 3K2UL 1S2EA 4O5LL 4GSQA 4TVSa 1P7KB 1QLRB 2DL9A 2R9HC 2MNUA 4M9OA 4OGYL 2BDNL 2XXMB 3CBRA 3FH8A 4H20L 1EZSA 3NABH 4XMKL 3B8SA 4RMRA 1F6AB 3S8WA 1P5UC 1UACH 4DUWA 5KVEE 3MRBA 1OPOA 2KYIA 3BVDB 5E2VL 3C6LC 3PHOA 1OT1A 4OCRL 5I74C 3MUY1 5JTWA 1BD2B 2VITB 3QDAA 4PG2A 5EBLA 2N3JA 4EXKA 4QF1B 3HUJB 4J4PC 4PJIA 2YUZA 5DRZA 4PLNC 1E6JH 3KPNA 4FMKA 5DEFA 2ADFH 3TNNA 2AJYL 5HVHC 1JPSL 4HF5H 4KPHL 3F5WB 1MJ7H 1G4RA 1V7NL 2B2XL 3KS0J 4LLYA 2J88L 3PG2A 3KPMB 4F92B 1EJ8A 5AB9A 1FVCA 4C59B 8FABB 5J3HC 1IQWL 4DO5A 5K59E 5L8KB 1DANT 2DTSA 2OL3H 2ZF9A 5CEZE 1KIQB 1HKLH 1IEHA 4TNVF 2QPDB 3TIEA 4ZMTA 1FVEB 4K55A 4J3WA 1IBYA 2VM3A 5MENE 4L2YA 1SEBA 3QPQD 3W9DB 3OJMB 1I3GL 4ZAKB 4J3OH 4O2EB 3NIFF 2VXVH 2NY3C 2X3CA 3KYKH 3HUJE 5FDWB 1BGXL 1I9IL 1IC5L 2BY0A 3M1OA 4OLUH 2WJ5A 1MF2L 2ZYHA 2P9RA 3TN0C 1ANUA 1BFOA 5FB8A 4X6CA 1CFVL 2J2ZB 2F54B 2VDMB 2MOQA 1SXZA 4MCNA 1E4XL 2HUHA 3QFJB 1OCCB 3NZ8A 3DPBA 4MB3A 3EFDH 5F21B 3RNQA 3B2UC 2DBLL 4UT9L 2ORBL 4X80H 4MKTA 1ZLVK 3T0EC 2R56L 1XGRB 3SBRA 1UOVA 4G1MA 4YBLB 3ZT5A 4NI3A 1CD0A 1EAOA 2WTPA 1GC1L 3A67L 1KBKA 4RQQA 1JK9B 3G5YA 1YRKA 3U0TA 2BRRL 2MKWA 1BV8A 5K1NA 3QR2A 2VABA 3BIAX 4BM7A 4CKQA 5J12B 1LO2L 5C0BE 2WAQA 4IK7A 4LOUD 5BRQA 5LN4A 1LXMA 5FOJA 4WTZG 3N1MC 3HG5A 5DZPA 4JFOB 2BMKA 2DQHH 3TNMA 1YUHB 1Q94B 3V9CA 4PGEA 3FPXA 4ODWA 5GSVB 4CSZA 5E24E 1P1ZA 4C57C 1MRFH 5T5FA 4HZAA 2G3ZA 5DMYA 3GO1H 1D6EB 1WFIA 2NR6C 3MCYA 3V4VL 1UURA 5AYUH 4O2FA 3BJLA 5E9AA 3ROOB 3MBXH 3GS4A 5LNDA 1UT2A 5IB2A 1EFXA 4DJMA 3F8UB 4NRZA 2KZ1B 1JGIA 3SDCA 4LLUB 3T2NL 1JRHL 3V6BR 5I18H 3QJZA 3VGHA 3E38A 3WNPA 1J5IA 5CLWA 3D51A 1EVUA 3MRRB 4NZRH 1MIML 3UFIA 3H85A 4OBRA 1FVDA 1WP6A 4UTBA 3RURA 1X5LA 2HFGH 1TENA 3BGMB 4RH4A 1MIEL 2Y6SC 4I5BB 2X87A 2PYFA 1XSIA 4N22A 2EDEA 4ZW8A 4KVPA 4Q2ZB 2ATPA 2FX8L 3MCLL 4PRPB 4JDTL 3LSOB 3SQOL 3U7WL 1SBBA 1ZA3A 2GBUA 2CPCA 5B1KA 4B7LA 4LHUA 1FAKT 2D03L 1NBVL 1QKZL 3KWWB 2DQJH 2NNCA 4B96A 3TV3H 3DK0A 3LZQA 1W15A 1QBML 3SYCA 3WDIA 4JZJC 3MOBL 3KPRB 2K7QA 3QJHA 1FNSL 3QUXA 3QZOA 5TH2B 1K8IB 4WUKH 2NY1C 4YHZL 4HIXH 3EGXA 4MMYB 5DWUL 5KTEL 4MLIA 4YBLC 4GOSA 1GH7A 1AQDB 1DHKA 4GBXD 3ZQWA 4EF3A 1JWSB 4MZ2A 1CXHA 5DO8A 1DUZA 1IGCH 4PJAE 1CG9B 2IPTH 1OGAD 1Z3GL 4MNGB 5FC9A 4Y16D 2VISB 5HHOE 3ARSA 2BS71 4N25A 1HIMH 5FKPA 1IJNA 2OZ4A 1M53A 1F86A 3RWCA 3DRTA 3O2DL 4NUGH 4ALAC 4B27A 3BZEB 4GT0A 3UPRB 4AUJA 4EJ1C 1FNFA 1NPUA 5E0FA 4F8OA 1MCSA 4R26H 3GC3A 5H35A 2WTRA 3BP5A 4WO4C 4ZS7L 3QB7C 1HNGA 2WXQA 2IAAC 2QPSA 5FECA 3X3GH 2C9RA 3ZBMA 4DKFH 3FQNA 1BOYA 4A6YH 4AKQA 1KN4L 2XXFA 1X5IA 1JOIA 3MRMB 1ZLWK 3TV8A 5C3TA 4FCAA 3UDWA 3DO7A 1Q9LA 1P4LB 2PWGA 3H0TA 3BH9A 2YXWA 4LVHC 4PJIF 4XMPH 4W9EC 1SRDA 2COQA 4U6VH 3RWIA 1WCQA 4NGHL 5F7NC 3WAKA 1R47A 4NQTA 1JHTA 1T0OA 2J4WH 1HC1A 1UVQA 2F58H 15C8L 1OGPA 1II4E 3FU3A 2WUBL 1X5ZA 3OAUH 1OTTC 1P5VB 1FZOB 3B7TA 1L5GA 1XIWD 3BVTA 3HS8A 3ILQD 4F91B 5IJKA 1EFXD 1BM3L 2V2WB 5I74B 2CO6A 4FQXB 4P49A 1BQKA 1IBGL 5A6MA 3D85D 3N43B 4YAQA 3QPXL 5IVXB 1JVKA 4LCIH 3ARDB 4UOW1 1PZ2A 3BVXA 4NN5C 4WKZA 4HUWB 4RBPK 1EXUB 2HKFH 2R2HA 3V5DB 3T6WA 1VACA 1ML0A 3P30H 3RIFK 3MOAL 2NZ9D 1QSFD 1SYVB 2WW8A 4GRLB 3ULUE 3CTTA 2H26A 2VO5A 1SF5A 3K80A 4H26B 4NOFA 1HESA 1VZHA 2Y7QA 1EEQA 2X2YA 4HIJB 1LDSA 3W39A 2X42A 2O5YL 4XMWA 3VRLE 3E2HC 1A6UL 2VR8A 4X8CA 2EDRA 4PJGF 4N26A 3VXOA 1XR9B 2WQUA 4Q56A 2G5BB 2KLRA 3PL6D 3LRSB 3PQYA 4IW4C 4TSBL 4TSBH 3HB3C 1MCPL 2X4UA 3WKYA 2ZKWA 3GK8H 1RPKA 1U8HB 5E4OA 5H37A 3KYNA 3RA7L 4JY6B 4BKLA 4XXCA 4QCIA 3EH4B 4ALAL 3IMUA 3R7QA 3QPKA 3MLRH 4KKBD 1C5BH 1MHCB 2CUMA 2DYPA 3NJIA 1YEIH 1HQ4A 2Y23A 1WICA 4Y7OC 2DQDL 3H6JA 1E4KC 1CICA 3PGFL 4WO4D 4ZZFA 5HPMB 3D34A 5AB0A 2O61B 2WQ8A 4K5NA 3A6BL 5ACZA 2Z1KA 4LVOC 3OV6A 5DK0B 3FSZA 2JCWA 4MX7A 3UPAA 5GZOD 4JS7A 3BQUB 4P23D 5CGBA 3MLSH 4ODSL 4R7DB 3KWUA 3KR3H 3RDTC 2VMEA 1QFUH 4PLKD 2Q8AH 1I8KB 1XAUA 2CDFA 3VXNA 5F88B 1WDAA 2CO4A 4YHIB 4G70B 3MDJA 1I1YB 4ZDHB 4PJHE 3TYFA 2WWMC 3WDJA 3QW9A 2VXSL 4IOSA 5CEZL 4UQ2B 2CLRA 5MHSE 3A22A 5GS0D 1MUJA 4TOYL 4WI2A 5GGTL 1TG8A 3MUHL 1DCEA 1TJMA 5AZ2L 3V6OA 2R1WA 1P1VA 2ZX6A 4GB9A 4F93B 1CE1L 1ACCA 1P5UA 4M62H 1IEAB 1OTTD 4U3SA 4EDWL 2DWYA 3CFEB 3ILQC 1BGXH 3EO9L 4H8WH 5I6NA 3I85A 5E1IA 4NQCB 4Z9KB 2JQAA 5C1MB 4XO9A 3TFKC 1FA4A 1E50A 1I9RL 5I82A 5FWRA 4FKEA 5DMGD 5I1EL 4P46C 1NFIB 4HC1A 4QOKB 1F1DA 2LTQB 4NC1C 1ASQA 3NIGE 4XO5A 1G1KA 2FVNA 2Z7ZA 4CMMA 2W60B 5EU6A 3CIQA 2NW2A 3KPPB 3U7AA 2X28A 1INEH 3GSNA 2CNZA 3QG7L 4K8RH 4E0RA 4M5YH 3MV7E 1HAWA 1B0WA 3R19A 4APQA 3AAZB 3IKCB 4DKEH 2HJKB 3HA0A 3L9RA 4P3WA 4MVBD 4N2MA 4ZAKA 4QJ4B 5T1KA 1H3UA 5DD1L 1DZBA 4OCSH 2I27N 5I1LA 2XT1B 2RJMA 4NRYB 1CLZH 4OF8A 2HCZX 1D5ZA 2UZPA 2D7TH 1FFNA 5HHPA 5BV7C 1VEMA 3FO2A 2R69H 3I50L 4I0PB 3UTPD 2FT6A 2VL5A 2P8MB 2VDNH 2DDQH 1IGTA 2BHYA 1ACYH 3VAEA 3W0WA 5ICXA 3OKOA 1Q38A 4A67A 1NKOA 1OALA 2YA0A 5JIPA 2YXMA 1GW0A 4ABVA 4U3XA 3VDBA 1JPEA 2OKMA 4JRXE 4ZOBA 3OVUB 4NO2B 4OKDA 2VLKA 2NY1D 3QDJD 3APNA 1GY1A 1H6UA 4HS6A 4OF7A 5CILL 3JWDC 1YEEL 5A43C 4BUQA 5IOPB 2F61A 2NUTA 5IHUL 1S7XB 5I9QB 5J56B 3FCUB 1Y07A 2AW2A 3OKLB 5FO2A 1U3YA 5I1AA 2XG4A 4GFTB 2HXAA 4JFEE 4Y5VA 2IMNA 1SQ2N 2QFRA 4PJFE 3V0DA 2AERT 1NEZB 1A1NB 4QKTA 4C4BA 3V8CA 3VWKB 2EE3A 4MCZB 1Q72H 4JHBA 1S9KC 4P23A 2B08A 4M48L 5IBUB 5FYLH 5KJ7E 2LR4A 3REVB 2F7QA 1MFUA 2IGLA 3IWUA 1KLUA 1QA9A 1YAZA 5D1QE 4Y16A 3KDMA 3AUWB 2F1BA 3RJOA 5FO8B 4FLRA 3MBXL 5DJCB 4BFIB 1JV2A 2MPVA 2J43A 1M42A 3GT6A 4WUUD 3UO1L 3RUGA 3U7YL 5EEWA 3IBOA 4WW2F 1MCCA 2ICEC 2VXQH 4UMSA 3H42L 3SDAD 2VL4A 2VR5A 2WSKA 4UTAH 4G8GE 1CUOA 2B20A 4YGAB 4DT2A 4OF6A 4KXAA 4QGYA 4A39A 4DGIH 5I1IH 3QNYB 2A9BA 4JFEB 4LHUD 4U2ZA 1F4YH 5B22A 4QLWA 3NGBB 4G7SB 1CFTB 4HT1L 5C0AE 3DI3B 4OGZA 1FAIL 3UC2A 4XO8A 2GAZB 3QJTB 5DMKA 5TE6H 3DX8A 4UV4H 4G8AC 1XGQA 2EEXA 1JGDB 1BAFH 4U1JA 3QEQD 1SM3L 4IBTA 4L18A 3C5JA 2WO2B 1A1OB 4YK4C 2BFGA 4NFBA 3PGFH 2YUVA 1OB0A 1GIGH 1KLFB 3SKUD 5I0YA 3CZGA 3BVVA 3GMQA 3SPCA 3ALWA 1XWVA 1J5OH 2L7UA 1TO5A 3OPZH 5DA4A 3ES6A 1FNGB 2NLJA 5E6YA 3JWDH 1L7TL 5C9JB 2EDYA 1GCFA 1BEYH 5DFWH 1TR7A 4K71C 2X6VA 2XBTA 3B9EA 2BSDA 1AC6A 5IJVB 2DV6A 2JFCA 2GJ6D 1H3VA 5DZLA 4RRPM 4ELME 2V37A 2E46A 4JKWA 3TZVB 3MNVB 4A55A 1QD0A 2EYTA 1KV3A 3LNIA 3MJ8A 4PJDE 3GSWA 4MNGA 3TBVB 4IDJH 3RP1A 2VLRE 3RVXC 1BJMA 1TU2B 4BFFA 3NFSH 2I60L 3K8LA 4UQEA 3UG4A 1HTYA 3NCYP 4FJYA 3NCXA 2J6EH 4KVCH 1EGJL 2XY1A 4Y5XA 4L3EA 4J5VA 2CRYA 4JKNA 1LP9F 3JVFC 1H6TA 5EU5A 3Q8BA 1BZEA 3ISWA 1SY6L 4L1LA 5CZVL 3S36X 1G1CA 2K3HA 3VSUA 2PO6C 2GG1A 3IDIA 3AWGA 4OJAA 2QVKA 1I8IA 4EDXB 2ED8A 3IDNB 3P4OA 4N0UA 4WAFA 4OCNC 3CCHB 1QPKA 1NCAH 1M7IB 1OSYA 1PJWA 4DVBA 3NFNA 1AS6A 2H1PH 3FTXA 4HFWB 4X0NA 3HC0B 2OR9L 4HCRA 1MW3A 2K0RA 2Y7LA 4JJHA 3T65A 4JHUA 4OKVB 2CDEA 4PJEB 5E4AA 2DYPD 1CU4L 1GGIL 1CGUA 1JZDC 4OQTA 1ZE3H 3MRKB 4YDKH 5GZOC 1B2YA 2KBGA 3MACH 1LQBC 1B0GA 2E86A 2XQBL 3FF7A 4NLAA 3HVDA 4PRAA 2B1HL 5C0EA 1AKJA 3VU2A 5IWLC 3CFIC 5DZNA 4XNYH 4YDIH 3ZO0A 2ALWA 4L9LC 4XC1L 4JR9H 2AQRA 1YPZB 3K2UH 2GIMA 2IPUK 3CMOH 4I13B 4MAYB 1OP4A 2FATL 4YDJA 2IWGA 4IKLA 5GSRA 3WS3B 5IJKC 4X42A 4JJ5B 2YZ1A 3PWPD 4HA1A 4XXDA 3OKYA 2IANB 4F7MA 4S1RH 1KDIA 4G6JL 4P5TC 4B9FA 1PLGH 2O4EA 4ODHH 5AW0B 3GBML 2YAMA 3I9AA 1AO7B 4XE5B 3FTSA 3LXUX 2VR7A 4OLXL 1AHWA 1K85A 2G5UA 1I7RB 4RRPA 1ZT1B 1FI8C 3MLUL 3L2NA 5BXFB 1QSFE 4N8UA 3FULA 3WAJA 3US0A 4RESB 2MNJB 3HC4H 2JI2A 1C5DA 2EDXA 1S3RA 2HJFA 4U1GB 4J6RH 1W0WB 2OA9A 4CVZB 4AVKA 1QG3A 1F6AA 4FQHA 3GLDA 2X4QA 2QADB 2HTKC 4JHZA 4QRQB 3O11A 3Q01A 4KK6C 4BCZA 4TNVK 4RAVA 2Y5TA 5K9KA 4FC3E 2UZXA 4H7VA 4KZ0A 3LZRA 2CKBL 4L0ZA 5TE4L 1FHNA 4FZEL 2PLTA 4YHYC 4JO1L 3B7YA 1CXEA 1WZ1H 5TPWH 4JCWA 5F0MB 2NPLX 1YAIA 3SDDB 3CHSA 4HBQA 2XNAB 2PXYA 1FH2A 4MS8C 2DWTA 5I8EA 4GKSA 1JPST 3MBWB 1WA2X 2YARA 4PRHD 3ZL4L 2QVIA 4PBXA 3HR5A 1BXXA 4BRVA 4JDEB 3CVBA 2GSMB 2WBJD 3PWPE 4AMWA 1IAOA 4E68A 2QHLA 4U6XB 2GJZA 4U1NA 4YHPB 5K33A 2V2XB 3TO2A 3T6QC 1NBYA 4EZLA 4BXVA 2E6JA 2Z4QA 3A6OA 1GAFL 4M6NL 3VI4A 5F89A 1QZNA 2OZ4L 3HI6H 3ISYA 3KG5A 1GW6A 4DERA 2AQNA 3DROB 3GYRA 5AWNH 5DUBA 3OKDB 4HXAL 4JPIA 4FP8H 4FTDA 4UQ3A 4APXB 2YD2A 1JNLL 1KLFA 2UZIL 1BFVH 3O8XC 5A16B 4O9HH 3UJJH 2Z35A 2I25N 4MA3B 5HDLA 4QOKE 3MBEB 2VAJA 4K3DH 1UKQA 1JUFA 3BGFC 3FFOA 2R69L 3I50H 4NZFA 3FT9A 3I75B 3P4LA 3VJ6B 1MWAL 4AUYA 2PYED 2VDPB 3O8XA 1ZVYA 3QJUB 4QUOA 3RI5F 4YZFF 3MRHA 5F3HB 4IEFB 3BGMA 3LTVA 3PGDB 5INCA 1OP5K 4DAGL 5DDHA 1LQSR 2AAAA 3VGFA 5A3ID 1LK3L 2UWEA 2P49B 3ESVF 4PI0A 1OQOA 1JYNA 5ICYA 5EEXA 4NQDD 2DLIA 5CZXC 1WK0A 4LOEA 1T2QL 2JK5B 2VH5H 4XCYA 5I8CB 3LKSB 5IMLA 3CSPA 1HNYA 3SDAC 2TRHA 5GS2H 4XPAH 3QE5A 2X4QB 5DXWA 2J21A 3CK0L 1E90A 1DTUA 4KK8D 5IK3A 5DZ9A 3ZKXB 1BQRA 2AXHA 2OCJA 2ZP0T 4U6HA 5I24A 4HD5A 2DKSA 3O3EA 1S6NA 1KPUB 2V0AA 1THCA 3WE1A 1IRAY 1ZSHA 4JR9L 2VQ4A 2N7AA 2QKSA 4QXTA 1JHKL 3QCUL 3RZCD 5GJTH 3K4ZA 5FF6B 4L4VA 2C7UA 4OSUL 4XB7A 2HUEA 4RVBA 3W0WB 3MLWH 5A2BA 1CU4H 1GGIH 2RH0A 1E8YA 3OAZH 5EFIB 2ZUQB 1KJ2L 4J3SA 3CLFH 1FL6B 1G5AA 3F6JA 5CBAB 4CJ1A 4PTTB 2OCFD 5DK2B 1HXKA 3MYJB 3BHBB 4KUCD 1F3JB 4GPVA 1KIUB 4F37K 4KX8A 4R9HA 2NXZB 2Y2WA 3DYMA 1LVEA 4KI1A 5FDWA 2HKHL 5A2LH 4QPEA 2OX5A 4MD4A 3HE6B 5DTFA 1G1OA 1FN4B 5T5FH 4AZUA 4G8GA 3QJFA 3FFDB 5C2BL 3F05A 3CH1B 3IEAA 3R18A 2OSLB 4WTZA 3C8KB 3EJSA 3N9GH 4MQXD 4GG6E 2E9GA 4BWWA 3VFUB 4R2GD 5ACZB 5TF0A 3RWIB 3A4AA 1A1MA 4IRSB 4JW3A 5DHYA 3HZYB 1UUNA 4BELD 3U79A 3TCXA 5CP7A 3W1ZA 2VDOB 2QVMA 4KGLA 4Z7OB 1W8EA 3FQXA 5DJ0B 5IHWA 4U1LB 3ZTNL 5LWYL 1L9SA 4L4VE 1CFMA 4UT6L 1YEDB 4IRZH 1SDDA 3KVDD 2PMZA 3SDDC 1DZ0A 4HBCH 2BXZA 4YPJA 2WM0A 4Q0XL 5K9QG 1DJXA 4MA8H 1NGZB 3CLEH 1TLMA 1RK1B 1A7OH 3TEYA 1Q0YL 4LCYB 3QP3A 3N06B 3ZDYE 1EHNA 2ITCA 3DIDA 3UAJD 4NS0A 4D9RD 1F56A 4PGEB 2Y7NA 3RU8L 4DFIA 3OZ9H 5CZXD 4JM2B 4M8UA 3HNSH 1KT2B 4N8CL 3H9SA 3BP4B 1MLCB 4R96B 2FBRA 1I9EA 4IBZA 1MCOH 1MEXH 4IRZA 4IYKA 4KJQD 4XCEB 3H4FA 3H7BA 3W82A 2EDDA 1JCVA 1X5HA 2OYMA 4XP1L 3UBXI 4X6BA 2FR4A 3K4AA 4FLQA 1A64A 2YPVH 1JGUL 1LEIA 2NXYC 2ZXCA 3BVNA 1G6RA 1D9KB 3WJLC 4IHOB 1EJ6A 1IBBA 4XPGH 3IRZA 3KH4A 4NQEE 1S8DB 4C56E 3D52A 4M3KB 3HG2A 1DVSA 2XXCB 2HLEB 1XH3B 3QWQB 5HVFB 1M1XB 2MPAH 4G5AA 5I17A 3T1WA 2J8OA 3VH8B 3L4XA 3ULUD 3CHOA 2V3DA 1MCBA 1UCTA 2Y07L 4A1RA 2HLAB 2YBRA 2BNRA 2HFEA 3HNVH 1I75A 4PY7B 2RCSL 4DUXA 5JXED 3FO2B 3BWAB 1E3ZA 1B88A 5DYOB 3OKKB 3PCYA 2HN7B 1A5FH 2UXFA 4FQQA 4K3EL 5IVNA 3O6FA 1R24A 3UXFA 3F58L 3RKDD 5ITBL 2H2SD 3S88H 5AG8A 1LD9A 4AKOA 4GRWH 1IBGH 2PABA 3G3LA 2XXGA 4JM2F 2XKNA 5K5YA 4D2NA 1JZ6A 1TQBB 4Y9EA 1HXYA 3TEWA 2ZG1A 5JW4M 1KJ2A 1KGCE 2Z6FA 4NUMA 4HG4J 4DK3A 5I1GL 1A21A 5CJXC 1A3LH 2LHAA 5CWSB 1OAYL 5IB4A 2P5WD 3Q2VA 5BOZG 1ZTXH 4MHHI 4H2AA 3KEHA 3ARGC 4WGWB 4L1DA 4F8TA 5JO5A 2QMKA 5IMLB 4LPUA 2BNQA 3QIWC 1J0IA 1E2VA 2H1LM 4XNAA 3MGTA 4ZUSB 2GPZA 4PS4H 4ZMYA 3MLPA 3ZJAA 1ZHLB 2FTAA 2YFNA 2QGCA 3ZDXF 3MRKA 1M7DB 1UH2A 1YYLL 1RJLA 2PPAA 4U49A 1J87A 2ZNWA 4R2GB 1J9SA 3OXRA 1NIFA 2GABA 1DBKL 2B16A 3DRQA 3HVNA 1KYAA 3ECWA 4RZCA 3CXHK 3T6ZA 4WEBH 3ATEA 4NENB 2X7LB 4HDIA 3N5AA 2ZXAA 5L7XH 5F8QC 5IQNA 1BQLH 4XCEA 2PF6A 3Q8AA 4BKTC 1U8IB 5JQIB 4OFIA 2VUOA 4HJ0D 4OLZH 1NCDH 1TPXC 2NYYC 1H19A 3OMIB 2R1YB 4J3TA 1SUJA 4MB5A 4Y9FA 1IFRA 4N2LA 1MCKA 4PJAB 1MNNA 4TVPL 3D9AH 1HZHH 5LGHH 3QEQE 4A37A 1KIUA 1I3UA 2AZUA 1G7LA 1YDPA 3GNML 4AITA 4A2MA 3MRDA 1QUNA 5J1SC 2BOCA 1Z5LB 1FYTD 3KCWA 2YBRB 2HLAA 3FSWA 3N40F 1I9RH 2EEAA 1KFGA 2LV4A 3P11L 4BQBA 3K8MA 3WJJA 1H6FA 3UACA 2LLNA 4M7KH 2PXYD 2GC7C 3STZB 4JUSA 1AQMA 1XVSA 3OKOB 5DR5L 5IZ7A 5DR5H 2O6PA 1DVTA 1YNKH 4KJYA 1T5WB 1QEWB 3FT1A 5BS0D 1ED3A 2X44D 3IRCA 1MFAL 1GGTA 4IRSA 5JDJA 5LGKA 3O2WH 2VN7A 2VJ0A 4OQTH 2VLKB 1KTLB 4PJXA 4C58B 3P4NA 4ISVA 5DURB 2WXHA 1DQMH 3QUZC 4WGKA 4HIJA 2J5LB 4E36A 1Q0XL 4LCVA 1LP9A 1T22B 2APBA 3P0YL 4XR8C 4TUOA 1DJWA 2A0LC 2HTLD 3LNDA 4XB8A 2RD0A 4JFED 1XGYL 4KTEH 4LHUB 1QLEL 4TL5A 1OTUD 1BVNP 2WYIA 3C60A 3LRSA 3PQYB 5C0GA 3T3ME 2ID5A 3VWKD 3RVUD 5KYNA 1X9RA 4J3OG 4ZS6C 1AZZC 3MV9E 3EDKA 2APXA 2P43B 3C5SA 1BJ8A 2XV3A 5JW5A 2EIKB 3ARWA 2KS0A 3TT3H 3SGEH 5MEQB 1AGFA 4CBPA 3FHEA 3G04B 1FV1B 3NDYE 3BQVA 4OLYH 1IEBA 2DI8A 1GKOA 2WIIB 4MD5A 4PJBB 2AQ1A 1AG0A 4RZKA 1CBVH 1FE8H 3D69A 5C0JA 2YN3A 2RB8A 4JAMA 4QXVA 1BQSA 4AGPA 1HEZA 3T0EA 2HG0A 5E8DL 3VXUA 2VDQB 3GZPA 4KVNH 3BZFB 1CB4A 3K6NA 4L8SC 5CNHA 3N55A 1BJ1H 4BK5A 3QQDA 5CINL 3RKPA 3UJTL 4F5CA 2EVHA 5GZNC 1E4HA 2ROYA 2YZ8A 1J48A 4TNFA 1A3LL 2MFNA 2ZX7A 3GMOB 3GXNA 1FG2B 3P69A 4KH9A 4MMXC 4RETB 4ANVA 3ZE2B 5A7BA 4L8BA 1RPUA 4AXWB 2WKOA 2ITEA 4L8CB 3KVQA 5K1JA 4GMTH 3S96A 4B9IA 5GGQH 4LVNB 5L8LB 1R3IL 3L3OC 4YPGB 3C2AH 3TJEL 3QEGH 5DUPL 3ZHDA 1TMCB 4FFWC 1F45A 4N2GA 2B15A 1RZJH 4LLVA 1FE8L 5KUMA 4ODBD 2MTPA 4JJ5A 4WDIB 1CXFA 1WIPA 1P4LA 1JDAA 3A21A 4PSRA 5EZOL 5ITFB 1U8MA 3RUGF 3C60D 5TDPB 2VXUL 3SJVA 4NUJA 1ADQA 4HCRH 2E7LC 1G7MB 4WW1B 5B39G 2XVBA 1HCZA 4WW2B 3PJSB 4BFJA 2AK1H 3QULB 4QWWC 1SLVA 1KIPA 4AIZA 3T8XA 2OR9H 3X13A 1BIIA 2HRPL 3B2PA 1S5HB 5IQ7H 5DLML 5T3XE 3WTUA 5K39B 2VE6A 1W72B 3DURB 3CZNA 5DD3L 3MLUH 1CDCA 1FO0H 1MSPA 2CLVA 3W11D 5A2JH 5LBSL 3TFBA 1BXAA 3MRIB 4MZ3A 4DPAX 3U9PH 4IBSA 3N85L 2VDML 3VDCA 4HMCA 3GSXA 4GRLA 1DVFA 5D1ZB 2CAKA 5DHDA 3BIKA 1OTUC 1DVUA 2K70A 1CFSB 5L7XL 3NMEA 3TPKA 1TETH 1J9CT 3DV6B 3D0LA 4GRWF 4JJOA 5D71L 4NCC1 2J8UA 1DVYA 3WCYA 4PJ7B 5HHXL 4H25B 4FADA 4HWBL 1COBA 1ZMYA 5IEHB 5J7CC 2C9XA 3RI5K 3SJVE 4FP8L 4ZMNA 1DSFH 3J27A 4H88H 4O2EA 5GISH 4X4XB 4Z95H 5LWYH 3QIBA 4OI8A 3MA7B 1L7TH 3X1BA 2WLMA 3LEVH 2RFXA 1TXKA 3F62A 1YG9A 3LV3B 4RAUA 5CP3A 4YUEL 1IBDA 3ESOA 1MWAB 3BE1L 4PBDA 3DROA 3N42F 3D09A 2CJ3A 1KCSL 5C09B 1AR1C 1KTBA 1KXQA 5E7BA 5EF1A 1S5IH 3FT3A 4YFDB 1HI6B 3H2PA 3FQ2A 4W9GC 5EO1A 1MI5A 2OK0L 3PL6B 3KW8A 3UYPA 4LKCB 1R3HA 2X1XR 5IFAH 5TGBA 2ZAHA 2AXWA 4PJ7E 3S35L 1BX2B 3PF2A 1M3IA 2M83A 3BLBA 5FA3A 3LXCA 2X4OB 4ZSOB 1RZ7H 4Z3FA 1BF8A 5ALCL 4B3VA 4F7PB 5I2IA 2W5PA 4H8PA 4FTVA 4FA6A 3C5ZB 3H7BB 5ANME 3U9UB 4GRLD 2VWEC 3ARFD 1S5HA 1KBGL 4POZD 2V2TA 1FZMB 3TXAA 3U2SA 3LKSA 1Q90A 4ZFZA 3GJFH 2JJUA 4J3OC 3VD1A 2G0KA 4PP2B 4JFOA 2UZXB 5ADOL 5EC2A 5T8IA 5T1DH 3CFCH 2VYRE 4AC2A 5EDXA 4ACPA 1J5DA 4HIEB 3S5LA 3HOGA 2CHWA 1K9TA 3VFRB 2B0SH 4DGYL 1ITCA 1WAAF 5D8JL 1O6VA 1A8JH 1NFIA 1S9VA 1VGKB 3W11C 4V2CB 3WNMA 4RGMB 4DCQA 2GVYA 3T77B 1MPAH 4ZBJA 2NTFB 3U36B 2C7UB 3LDBC 2XWCA 4N90E 3NIDF 4H0LC 4OCWH 1BLNA 1BZ8A 3B9AA 4YR6A 1SDYA 4N0FB 4XXDB 1DJHA 2GTZB 4LKXB 3VW3L 1XCXA 1T1ZA 2ARWA 4XMUA 2I5YL 2Y07H 2QHRL 4APQD 4FNSA 1HWHB 5F1NA 1FFRA 4H5SA 4WI6A 4X5WB 3JTSA 4G3YH 4NRYA 1P4IH 3EZJB 4NKDA 1RMFL 4TS6A 3F12B 3BCFA 4NZJA 1WIOA 2Q86B 1A4KA 4I8DA 4JZJA 3GMMB 1TO4A 4F58H 1FFTB 2NXZC 4J3BA 4LDOB 3L3HB 2YAHA 5F7LB 2WXLA 3KWWA 5KSAD 1QSVA 2O6FA 1H8NA 2XU9A 3NAAL 2HLFD 4JQXC 3MR9A 3GSVA 4EIBA 3EYVB 5C0FB 5CIPB 4AQAA 2XWBA 3SGEI 4NQXB 4PVNA 3MCKB 3GUTA 3JV0A 1HSBB 2D4FA 2H9GB 3BO8A 4JE0A 3PJNA 1G9MH 4Y5YC 4WHTB 1A9EB 2F74A 3QC6X 1KB5B 3A0OA 3QWOA 2IDCA 3O3DB 4K5OA 3DRQB 1AR1D 4H40A 4JO5A 4RNRA 3JUZA 5D2NB 3N9GL 3U0WL 1UT1A 3ZY7A 4N0YL 2FX7H 2NY6C 3IDNA 3P4OB 2QVTA 3P30L 2E27H 4HPYH 1KPRB 4Z78A 1SEQH 5JPNB 3QR0A 3IFLL 1IM9D 1VFAB 1W8NA 4GXUN 5JW4Q 1AD0A 2V3FA 1MJJB 2WKGA 2HVKB 1OLLA 1NAML 1QWUA 2VISA 5KEZA 1O75A 5JW4R 2V2TB 3T65B 5D1QC 3V5HA 1NDMB 1VADB 4BZ1L 3N42B 3PWUA 4RX4A 2A9NH 2VB5A 3OJ2C 2DWEB 3CVHL 1JG9A 5ALBL 5FYKE 3T4YA 1JMXA 1LP9E 2AXJA 1Q9WA 4JQVC 4LPTA 5EOQH 5ERWB 2R7EB 3CFKB 2YJQA 1OB1B 3D3VB 4R7NB 5F1OB 5C3LD 5TE4H 1P69B 2FQGA 1R3JA 3KPRD 5CEZH 1VFUA 3QQXA 1X44A 1R5WB 3LN5B 3AADB 2CG9X 1X5XA 1N2RA 5T3XD 1WT5C 3AGWA 3MN8A 3P2BA 4P46A 4X6EA 1AGBA 3B6SA 3LIUA 4DFHA 3GF8A 1J05A 3IFNH 4ANUA 2GTZA 4LKXA 3VI3B 3PAZA 2ICWA 4PRPE 2Y4SA 3GMLA 2XI9A 3O8XB 4DKFL 2IH9A 4Z3IA 2YMXH 2NY0B 4XCFL 2CBPA 1HH6B 1G4MA 4X6CE 4I85A 3CUPB 3KH3A 1A2YB 5H94B 2D9QB 3TVMD 3HCVA 4JFVA 1LP9B 4L4TE 5LB1A 1CDHA 2BNUB 3F12A 3FONB 3I6SA 2AQ3A 4QWWD 3C5JB 4S0SD 3T0EE 2NQDA 3B3IB 1FPTH 3BVWA 3FUNA 3WJJC 1W0WA 2IH8A 4CVZA 1HIML 1HHKB 4ZUTB 4ZX5A 3O4LA 3MRGA 1S5IL 5TDOA 2VIRB 3FTWA 4A63A 2GSIB 3IJSB 3DECA 4GKNA 5FCUH 2B8OT 5CCKL 3MR9B 1DN0A 1KGYE 3S98A 4KDTC 3GINA 3H3BC 4MDJB 4XCNA 2NZIA 4TNWF 1M57B 5IBLC 2WXNA 4F37F 4XAKD 1QI3A 2H26B 2P5WA 4OUUB 5C0ND 5KTEH 1DVXA 4XTRD 1QATA 4AMKL 5KBLA 4Q4EA 2XQBH 1WVZA 1EA9C 1U8OA 4HD9A 3NACL 1SLUA 2WYHA 5C0AD 4J39A 4E9LA 5GGRA 4NZTH 1N70A 2IDQA 4E42A 3IMBA 4YHYB 3T0EB 1AE6L 4KZEH 3QH3B 1XH0A 3G08A 4O2CA 3B7RL 4F9LC 3UYRL 2XFGB 3OJVC 1LK3H 1N7ML 2PWDA 4MWFB 3DTUB 5IR1B 5IFJB 4XWOC 3NIDB 3INUH 5DHXB 4PRNB 1FIGL 3EYSL 5I0WA 4ZW5A 1TQWA 5F9JA 3VFOA 4UAHA 4DP0X 5M95B 3D85B 4UQDA 1AGCB 4F3FB 2K7PA 1G7HA 4WFFD 4QRTB 5D1QD 2F7IA 3MV9D 1SY6H 4MMXA 1U8PA 4PM1A 3ABMB 3QIUA 1FO0L 4J28A 5AZUA 3PDDA 1YQ2A 3CH1A 1G9ML 2WBXA 1AXSB 3U0PB 4E9VA 1ACYL 1NWPA 3EO0A 3C9NB 1S7TB 2L7QA 4X7DC 1U8MB 1TQBC 2WUCL 2K9FB 1SEBB 3QXWA 3F04A 1YMHB 3WO3B 3BZDA 4RGNB 4M93B 2EYSB 5F1IA 2Y36L 3A6CH 2AVFA 4HJJL 5EZJB 4PJBE 3BN9D 3ZYZA 2F53E 3AS3A 4L3CA 4PY7A 1YNTA 4Y8AA 2F8XC 4IRJB 5HHME 2A73B 2E3VA 4GLRH 3K2MC 3FO0L 4HIHB 2O5YH 5FW7A 3ZL4H 4WQOA 3X1EA 5E2TL 1WZLA 3OD3A 8PAZA 1D5IH 4UNVA 4DSYA 1TJIL 3C6LB 6FABL 4KROB 4O02B 3QR1A 1FYTE 3VI3F 2QMJA 2PW2A 2FWUA 4JPWH 4FI7A 43CAA 3EOAB 4C8XA 5IUCA 1KCSH 2FL5A 5TE6L 3U30C 3WKNA 2WINA 3FAWA 4QOKA 4YXHL 3VXRD 2FO1A 1BQUA 1RUAL 5KBKA 2AEQH 2FJGB 2Q1EA 3O3BA 3VTMA 1U8OB 3LRKA 4PJ5D 4TYUA 5EBWA 1V05A 1WA0X 1A25A 4OD3H 3WFDH 4E0RB 1DSFL 5KS9B 3QDJA 3QG6A 4L8DB 2WUBH 4BHUA 4IQHA 4UTAL 5EPMB 4ZW3A 4JFFD 2XV2A 4WNJA 2Y2TA 1FGVL 1W9XA 1UCBL 4NJ9L 5C09E 4DP1X 1BWWA 4GRWB 3QJOA 2HAZA 2X3AA 4JO8A 3C5SB 3QEQA 1YZZA 4APQC 2MOVA 4RZCB 4KXZI 4LOUC 4PS3A 2ATKA 1O0VA 2GSGA 3EJCA 4M43H 2QT6A 4WU7A 4BSVA 2BNRB 2HFEB 2I07B 2ICCA 3EJTA 4QXGL 4XHJC 1INQA 5I5IA 2YS4A 1QFOA 5I6OA 3OKEB 1Y0LB 1DJSA 3NEEA 4Z77A 1OAJA 4NRZB 5EU6E 3S35H 2CLZA 1E9QB 5KSAC 2AJXH 1ZJBA 5HHNA 1F3DJ 4JKPL 3KPOA 4UOW0 5DHVA 1TCRA 4AJ0A 4NZDA 3S5LG 1RKRA 1BEXA 3FB5B 3HG0A 1DQML 3LQAH 1ESOA 4NWTL 2J73A 5F1IB 1DQJB 5J9PA 1FIEA 5DJDB 2EYTB 1AS8A 4BH7B 1L9OA 4JFXB 5KS9F 3VSQA 3CZFB 1JHKH 1IGYB 5BVJA 2BP0A 3OPUA 4NQCE 2BZ7A 2R0WH 4W6YB 4JRWA 5AYUL 1EJFA 2EC8A 4BDVA 2XX0A 5AZ2H 2GKIA 4LL4A 4YSOA 4YLCA 4EI5B 3TIDB 1D6VL 3V4UL 1LDPL 3GXPA 2P8LA 5MEPB 1OGTA 5TDNB 1WS8A 3Q2NA 2M2DA 1K8IA 4OI9A 1PJ9A 3HIZA 4PW3A 2D7TL 3T0BA 1HHJB 2E9BA 1W6WA 4BZ2A 2DWDB 2ZG2A 1T22A 5HGDA 3T04D 4EN3A 3MLSL 4ODSH 3FUEA 3DJSA 5EU6D 3LH8A 3U9PL 4NN7C 3WIAA 1LO5B 3GMRB 5DU7A 2F1EA 3FB6B 4H13C 5JHDE 2VE6B 1T66D 2IFFH 4GAJL 4Z7OE 1FAIH 4PLOB 3LY6A 2Q3XA 3HMWH 4YHKL 3SQBB 2GT9A 2X0WA 2WLYA 4IOIB 5I75C 2VMDA 5IK3B 4DUVA 3PGCB 4X7SH 2X1PA 3EYFA 5F6IB 5CBEB 2VLJE 3S3PA 3RB7A 5I1KH 4HETA 2EUWA 3MLYL 5DLLA 3VGBA 5TQ2L 1I3VA 1S7VB 2V7NB 2Z1PA 4ZD3L 4X50A 2ZTBA 3IF1A 3PFUA 4JG1L 4F5CE 4F2FA 4GQZA 5CJ5A 4GNKB 3SY0B 3ML9A 4ES8A 3S8FB 4HX1A 3WGVB 5CGYD 2IOMA 1G5GA 1NAKL 1WO2A 4JQIA 4Z3JA 3UP1A 2VLME 3N50A 3BPLC 4MGXA 4RMVA 1K2DB 4LOFA 5CBAA 4GQQA 2A4EA 1GAFH 3HTLX 4M6NH 1HSBA 4RA3A 1KB9K 1TCRB 4PCKA 4WK4B 4A66A 2FHCA 2KERA 5CN2A 3L3JA 4UZUA 1W8OA 3E6HB 4Y5YB 2FWLB 3W3BA 2VJXA 3CMGA 5B1AB 3R4DA 1A7RL 1CFNA 2JSFA 3NRQA 4JB9L 3C6EA 1MJUL 3B9KC 4G82A 2IAMA 2R23A 1JJUA 2WC7A 3B83A 1LEKA 2CRMA 2E6PA 2FD6L 2HG5A 4G42A 1TYJA 4M9PA 4AEIL 3LKQA 3FQTA 4JCMA 3BKML 4X6DB 1DBBL 4GW4B 2HT4D 1GMIA 2DQFB 1L7IL 1MRDH 3QHFH 3V4PH 3UBXG 1Z9OA 2CQVA 5AOKA 5DQ9A 1IM3B 4XVTH 5GS0H 2YMXL 1V7NH 2B2XH 5A7EA 4X9FA 3N1PC 4IKIA 4ATTA 2Y9RT 3W5NA 3ULSB 5F7WC 4YX2L 3FUFA 3GXTA 4XO4A 2B4CH 2P47B 4W70A 2F53D 3SCMA 4KVNL 3BE1H 5CR8A 3MV8D 5J6HA 5EH1A 1YC7A 3FMGH 4FXKA 2E4FA 5D55A 3MJ7B 4NKQB 3C09C 1A8ZA 5E8OB 3RUGE 5TE7H 1P7QB 3EYUL 3GBNL 4Y4FC 5LHDA 1E9PA 2BCKA 3ZHFA 2NZ9C 3QRLA 4AL8C 1X4ZA 4CN1A 3PHSA 4HSAC 3TVMA 5DRWB 2NDFA 3WIIH 1IE5A 3S4SG 2H32H 4W4OA 4YHML 4AM0B 4OCSL 2R1YA 3L1FA 2C3HA 4O5LH 5EPMA 3QUYB 2AGJL 4PU2A 4N5ED 3SDXE 3ZHLA 1IAOB 1QYGL 3RPKA 2VJ8A 3HKZA 4FD0A 4TTDD 3PREA 4UNUA 4HOZA 2W0FB 4JY6A 5KVGH 1Y18A 1S78C 2PTVA 3EHBD 3QZNA 3IK2A 4Q9RH 4KKNA 2NNFA 3IJHA 3Q2CA 4GG8A 3IFPB 2EKJA 5IP4A 5GRWA 2CK2A 1TTUA 1IIIA 2WNXA 2R69A 5FYKH 2FE0A 2ATPB 3BDXA 1YPZF 3CLFL 3L4YA 4ZUTA 4WNQA 3RDTB 3JXAA 3C5ZC 4XAWH 3NSFA 4N8VB 4Q9CA 2J6EL 4KKBC 4KVCL 3V6ZB 3A4DA 1ZXQA 3UCQA 1JPSH 1RUPL 1UD8A 3MACL 5F1SA 2EVJA 2AQPA 1XH3A 5I73B 2OBGA 3RGVC 3ARTA 3HG1E 3WLWC 1ILSA 1NUGA 1E8WA 3FH5A 3UABA 2XN1A 4LCWA 2QEJA 4U1IA 4ENZA 4JY4B 1YN6A 3B5HA 3CFJB 1QACA 4PPTA 3HAEG 1QTSA 3IDYB 4KMTH 1FGNL 1A6TA 3RPIB 1WE5A 3BRDA 1M4KA 3FQTB 4N24A 1BBJB 5IF0B 2BNRD 1INEL 4H20H 4KGJA 2DWSA 3U1PA 2M1KA 2P7TB 5EBMA 4NB7A 4HAKA 3BD3A 1ZIAA 4XO3A 3OG4B 5E9DA 4ABQA 3T1FB 1AQHA 2WYZA 4OQ1A 1XF5B 1GS6X 3WN5C 5HGBB 2Z92B 3DX2A 1R3IH 3RL1A 2IMMA 3O81A 4V1DD 2MH4A 1R46A 1KPUA 4OCLC 3B2VH 2G3MA 4F7PA 5I2IB 8CGTA 4I87A 3FTGA 2K45A 5I8EB 2FEDD 2YD1A 1DBJH 5TF1L 5HGGS 5G4OA 1CFQB 3G6DH 1A7PH 4HT1H 3OB0K 3MHZA 4M7LL 5C08B 4FFYH 1F2QA 1F4YL 1AD0B 2HT2D 2YQBA 3VMNA 2TSAA 1L6PA 3S5YA 5DRWA 2VXSH 1JDCA 3HRPA 2AI0L 4MA1C 2GCYA 3P9WB 2F5AH 4IOIA 4L9DA 3IGUA 3KLLA 5GS3A 2QL1A 5GRZA 4KI5C 4XNMA 4F7KA 1R5VB 1RZGB 1HL5A 3QAZB 4KK5D 4OLXH 2ED7A 2OXGB 4H8WC 1V27A 3RG1C 1OAUL 1J5OL 3KL0A 1LO3L 1BZ7B 1ODUA 4R4FH 2VZVA 2VDOH 3ASWA 1L9PA 3TO4B 2A9MH 1UJTA 2AVGA 4AENA 2I32A 3GMPA 1PG7X 4QHNA 3AT8A 2WSDA 2RAMA 2L7JA 2BSSB 1PY9A 3RWDA 3CNKA 4N8VA 1GA2A 3PHQA 4NX0A 5DK0A 5ID0A 2BX5A 5AUMB 4HHGA 5EIIG 4XVUD 3ATFA 2OYLA 3SE4A 4AW7A 1GPOL 1J1PH 1MG2C 2WK2A 3O41A 3MC0A 5JPMB 3KVPA 4HZLB 3TA3A 4M56A 4WWID 4HOMA 1S7UB 1K6QH 3SE9H 2P80D 1D5RA 1I1YA 4DPBX 1LLAA 3CUPA 2VXQL 4YXLL 4JFYB 4KOCA 3QI9B 4PGDA 3NJGA 3KPQB 1I8MB 3ZLQC 4I2XB 4KO7A 3Q8FA 3OSVA 4DOHE 3V6OC 1AOZA 1BIHA 2YD5A 1AGDA 3MRBB 1PZUB 4XMKH 1RCYA 2A74B 2BWDA 1B4JH 2OTPA 2DDQL 2WVSA 4QO1A 2PR4L 1T21B 3BUYB 3MV8B 4P2AA 1N0XL 3RY4A 5DMIL 3D87B 4X4ME 6CGTA 1MI5E 1J0JA 4J8QA 3WNKA 2RQEA 2F7PA 1CFBA 1S9VB 3NZHH 4OZHF 1UB5A 1VGEL 2LU4A 3FS9A 3O6KL 3X3GL 4LEOB 2H32B 1LTXA 3DJTA 4GKOA 2VABB 4Z5RA 3LKPB 5D7KD 3RWGB 1TOXA 3AMLA 4IHOA 3V5HB 4NERA 2XPZA 4JFEA 5PAZA 2RHEA 5DFVD 3MLVH 5DJXB 3ULVE 3VDAA 1AP2A 1I31A 2C1OA 2YC1B 1DUYA 1HINL 3M8OH 3ZDXB 4HUUA 2HT2C 4ILDA 4AQOA 1ZA6A 1ZWIA 2OW6A 4I77L 5FOBB 3VTTA 2AHIA 4U6VL 2NY2D 2WMPA 2AJZB 3SEPA 3ZTJG 1IGTB 4CBZA 3C6SB 4ZXBB 2MSPA 1S7SA 4EUPA 4Z7NE 2FX9L 4PSPA 5JA8B 1AR2A 2HVBA 2DOCA 4BDVB 1EO8L 4F1SA 4TM9A 4JNXA 3W81A 3BP7B 1GZPA 1R3HB 1V3KA 3ZYIA 3F7YA 4V1DE 3ESMA 3OHXC 1FG2A 3AWEA 5AFAA 4X5PA 2IBBA 4AV4A 1ILUA 2OMVA 2ALAA 2EXYC 1VFOA 4KKRA 4IRJA 5KJ4A 1WFTA 1JK9A 3G5YB 1JK8A 3O3AA 4G43A 4YGVB 3VXQA 3BVUA 5EC1B 1K4CA 4I2XA 3SD2A 4WFHE 4NM4L 1BDYA 3RGHA 1F4XH 1AY1H 4E9YA 4JZOA 3UO1H 1LMIA 5ANHA 3MV7B 1CD1A 2KZBA 4WO0A 2JKJA 5C86A 3VXSD 4XNYL 3KWVA 4YDIL 4QHMB 2DWEA 3HE7D 3BUYA 4FNQA 5DEFB 3O45A 2X4TA 4AH2B 5DEGA 3VGDA 5KBDA 1HE7A 1PKOA 1HNFA 4FQ1L 4ALAH 1Q72L 1MNUL 1QSED 1UB5B 2A6KB 3DTXA 4N1HB 5DGRA 1DEEB 1WPCA 2BCMA 4M5ZH 2H5UA 4OFPA 2X4NA 4NT6B 3L17A 3QUZA 4J2XA 5IR1A 3FCSA 1JGLH 3P0VH 5I0VA 5G2NA 1CI5A 3LB6D 1P6AB 1T2QH 2GJ6E 3HS9A 4KQ3L 2JQMA 4PJDF 4G80A 2DYRB 3D18A 4K7FA 4R3SB 3TN0B 2I69A 3QIWB 1TZGL 2OMWB 1MI5D 2ZPKL 4OZGF 3TJHC 1NBZA 4JKMA 2HRLA 4I5BA 1I3RA 1Q0XH 3MRFA 3ECVA 2E7MA 1RK7A 2Q9OA 4NRXA 5DFVC 4HGWA 3IDXH 4O4YH 5E8DH 3EBIA 3L81A 4HKJB 1VB9A 1CE6B 1OF2B 1OTSD 5D93B 3CHQA 1Y0LA 4MJ5B 4LCWD 1HZKA 2FSEA 3G9AB 5I5MA 1OZUA 5HVWA 1BLIA 1T5KA 1YNKL 2W65B 4HUNB 5SX4I 4PUBH 2XC8A 1D3CA 2ZT9C 4KKQA 2AANA 3BXNB 5M94B 3KM2A 1RJZA 2YGPA 1SHWA 2DI9A 3CFCL 3UTZB 4EQ3A 1BG1A 3VVVA 5BXFA 2XWTB 4KTDH 1CBJA 1RERA 4LL1A 4NN6B 3FUJA 3RWFB 1OK0A 2VGLM 4XPBH 2WXRA 3LQAL 2CUIA 2L04A 4HWZA 1MWOA 3Q3GA 3VD9A 3NIFB 2AJ3A 3P54A 3MOQA 4MS6A 3MGTB 4ZUSA 5IW6B 4E41D 4O2CB 2FIKA 4D94A 3CVHB 3G5VA 1WC7A 5FEBA 2WB7A 4JLRA 3QNZB 3KBPA 3RIFF 1GXEA 3QXDB 1DBML 4WTXA 2QELA 4WI9A 3EOAA 1KC5H 4KK6D 1WFNA 3FQYA 1UZ8B 2X4TB 3HG3A 3N43F 1D9KC 1MFEH 3GLEA 5KBNC 2KDYA 5D5MA 5EU3A 3AG2B 4ODVL 3MXWH 1MH5B 1H5BB 3OAUL 2D73A 1V3JA 1OV8A 1WT5A 2AK4A 3IJ9A 3QCVL 4HMEA 5BV7H 1DEEA 1ZPLA 3PIQA 2WHVA 4HHAB 5AW3B 4PJEF 1RJCA 4P5SA 1AAJA 3PHOB 4OM1L 4ODXB 1YCSA 3G6JA 1Z9NA 5IMKB 2L3BA 5LGYA 2GITB 1VPOH 1VPOL 4I77H 4K7PY 1TQTA 1D7FA 2P52A 4HCIA 3ARDC 3KJ6L 2FO4B 4AE0A 4F2MA 2V8LA 1MHCA 1KCVH 1XL4A 2E7DA 1KZYA 1G9NH 1S7WA 3IU4H 3VG9C 3V6FA 1O9WA 2X9ZA 1U6AH 4K94L 5D7IA 3L1OL 4UQ3B 5D71H 4R0LA 4JG0L 5MP6H 4APXA 1WWCA 3ASNB 4UBDC 4HKJA 3IJSA 1KENH 5D9SB 1T0MB 2QSVA 2W88A 2PN5A 3MRPA 4PV9A 2FB4L 4AL8H 3NQKA 1U3JA 1QEWA 3TIEB 3L95B 4GT7A 3S88L 4GKLA 5CR1A 5HDRA 1MELA 1EXGA 1ZTXE 2VMFA 3N1GC 1IZKA 2D7NA 2FATH 1TFHA 1EAJA 1NM9A 4V33A 5F88A 2H7WA 4IU3B 3TBCA 3UGXA 3E9TA 1MIEH 5T1LD 5DT1H 4K73A 4EZJA 3LH9A 5D5ME 2QPEB 5DFTA 3N41B 2ED9A 4L37A 2IPTL 4UQAA 1R9FA 3UTSB 1N6UA 3UAEA 5B1CA 1MAKA 5HBBA 5KJRH 3NH7L 1U3HD 3HC0A 3QH3A 3MV11 1ID2A 3NA4A 2NMSA 3WIHL 5GS0C 1RULL 3TGXA 3VXOB 3U6XA 4TLTA 5HHXH 5JW4N 4DH2A 3CVHA 1U41A 4M02A 5EF0A 2ZCKH 5JW3H 3P2DA 1C7SA 2LU3A 5DS1A 3EJUA 2A1WL 2XPYA 3GSXB 2DYSB 3DUUB 4KKAD 1ICTA 3MJ9A 4I1RA 1QTYT 5ABZA 4L29A 4KZCA 2ZWNA 5IGXH 2VDMH 3UOAB 1FJ1A 2FX8H 3MCLH 1QASA 3SQOH 3JV4B 2ZJSH 1KB9J 3DTXB 1IAII 5F6HI 1KFAH 3GMRA 2MQ0A 5TD4A 1TSRA 3H7LA 3X12B 4AUUA 5I76A 4QYOA 3MRJB 2VLLB 5CSZA 3SGKA 1D9KD 2P5PA 4YOKA 1CIUA 1RHHB 2EILB 4P3DA 2D3NA 2GY5A 2LW3A 1PX4A 2NTSP 1IQDA 3ZE1E 4DOHB 1WCBB 4AT6B 4PRIE 1I1FA 2WXFA 2ZAGA 5C07A 4LOVA 1IAMA 1EK3A 1GZQB 3QUYD 4OH2A 4IIQB 4XPGL 3DVGA 4Z7QF 5IHZA 3FCGA 3EOYG 1IGYA 5EZOH 3C8KA 3IDGA 1R5WA 4IS6A 4P2OB 2W9EL 1U95A 2EXTA 3L5XH 5BRZB 2XN9A 4TL4A 1FL5B 3BLPX 4LKCA 3L3JB 5EG6C 3FRPB 3ABGA 4WV1A 5KYYB 1DP0A 3MRCB 4YDZA 1JPGA 5GGQL 4HWEL 3G5WA 3O6LH 5DD0L 2ZUTA 4DTGH 5C97A 4NPYB 1X4YA 4OZIA 1ORSB 3D2TA 4FQCH 1H8LA 2BRRH 4EUPG 3CFJA 4R7VA 1IAKB 4J3OF 4QR7A 4F2EA 1CGYA 4K0OA 2XY2A 1FZKB 1SGKA 5FM4A 1TQVA 3ZYJA 2EINB 5AW5B 1P2CA 1URLA 3ZDXE 5GXBB 4AGNA 1UJ3C 4ANWA 4XH2B 1J11A 5GHWL 5G5DB 3RQ3A 3IU3A 2F53B 3IGFA 5DK3A 1NFAA 5LXGL 3FQUA 2GFBA 3I9GL 4FXTA 4PP2A 3EFDL 1YEKL 2A83A 4GQ9L 4Z7NB 5DZAA 4HMDA 1KXVA 3AABA 3KAAA 4BKLB 4PG2C 1U42A 3MLWL 1LDPH 4Z7WF 3V7AE 3S36H 4B0MB 2BP8A 3UAJC 3AB0B 5F3BA 4Y88A 5DJZA 2IQ9H 1N8ZB 3CFBA 3TV3L 5FUZH 4A2FA 1MH5A 4Q9QL 1G87A 5HSFA 4TSAL 5K69A 4JHWL 3ZE2E 2A6IA 4KKAC 4NZUH 5DVMA 1K3ZA 5FGBA 2JTDA 5BS0B 1MQKL 2XFXA 2PTTA 4GSDL 3VFSA 4YSCA 2B3IA 4W9CC 2VN6A 5FUCC 1ZT7A 5F3HA 4QRFA 1EMTH 2ZYIA 5DWPA 3WMSA 3UTPE 1KG0B 4AV0A 3MKGA 5CXPA 4B7IA 2WXGA 3OJDA 4HPYL 4WJKB 4K9JA 4UU9A 3DYPA 3FFDA 4WFGE 3TO4D 4X6DA 2K8MA 2BSRB 4LLQA 3B2XA 1RUQL 1WLHA 2OSLA 1MXDA 4OGAD 2QKIB 4XAKE 3PP4L 2JK5A 4W9DC 1NCJA 1QRNA 1PIGA 1KYOJ 5FUZL 1I8LC 1U92B 2E4TA 4M62L 2Q7NA 4JM0A 5HJ3A 3WO4C 3FUHA 1PDKB 3ARRA 3GTVA 3NAAH 1OARH 3THML 1CMOA 4K3DL 5C9KA 3DX7A 2YD8A 1VSCA 2MCPH 3BWUF 3S3DB 3QWOB 2DH2A 3E1F1 1I9JH 4GRMA 1QBAA 4HZLA 2JJTC 4ORGB 5AKRA 5DEJA 5F96L 4YL9A 1NGXB 3VYPA 1XBDA 3L6FB 1BECA 3DHPA 2I9LB 3PWPB 4W6XB 7TAAA 3RHWK 3G6AA 4JFHD 2B9BA 4XMPL 5AVSB 5B1JC 4PJFF 1KCUH 3GSRA 3UTTE 4BYHA 1UD6A 4WEEA 3IJ7A 2X4NB 4NT6A 3MJ9H 4XH2A 1U8QB 4XNXH 4V1DB 2VR9A 1LJMA 5LAXB 1L7IH 1CDUA 1MRDL 2JH2A 3LIZH 1HXMA 4JPVH 2VSMB 1DDHA 4P2QE 3KHOA 5DC0A 2DJ4A 3AUVA 4XODA 3AQDA 3VXMB 2C4XA 3TBSA 4AQ8C 5F3FA 3CCHA 1E4XH 4TVUA 3Q6GH 4D0BB 2OCCB 3IN0A 1J8SA 2MMXA 3Q0HA 4XP6L 1F3DH 3MO1A 5FYKD 3J07A 3TM6A 3VG0H 3EGSB 4JFFE 1R1CA 5DD6B 4MSWA 5JLZB 2WBJB 1OAXH 2R15A 1N64L 3GSOA 1ZAGA 5CSZB 3Q8CA 1OHZA 3ERXA 3QRFM 5C6WH 4AYID 5HYSB 5J1AB 2IXQB 2WP3T 5C9JA 1WYJA 4HJ0C 4JO4H 2YHGA 2ZG3A 1XZ0B 4KTDL 4H4NA 3G5XB 3KLQA 2V5RA 4I3SL 4XP4H 4Z7UF 4MKMA 3VMPA 2BXYA 3VD4A 1A4CA 2YPLA 2ERJC 1TZHB 3GMMA 1AACA 3EAKA 3PUCA 4F7EA 2HA1A 4Q2ZA 3TLRA 5E5UB 1HHKA 1MFVA 5B7FA 5AOZA 1A6WL 3RWHA 4KKLD 2IFFL 1M9SA 2VLRD 5BRZA 4QRAA 4NQXA 5HYJA 4XPTH 3GPSA 3CDGA 4JFFB 3HS0C 4G6JH 1U92A 5DUJA 4P5TD 2IAMC 3OKNA 3SYPA 3ZE0F 1UJ3B 1FIGH 3VGGA 4P4KA 3PNRB 4JO1H 4N2OA 5TPWL 4UOQA 3BGAA 5H8DA 2NW3A 4DGVL 1FL3B 4Y2OA 3FB7B 3ULVH 5I15H 3PWVA 43C9A 3KLKA 4ACTA 2CJTA 1YEHL 4HS3B 5DJDA 2H3NA 1J1XH 1NCWL 1I53A 3U46B 4Y5XC 5C0BD 1GYAA 2ZCZA 2D0HA 4OZ4A 1KXTA 1SNRA 4TUKH 3OR6B 4NDMA 1AD9A 2ADIB 4CRPA 1ZT4A 4Z7UB 4PY8J 32C2A 3HN8A 4NNPL 4KK9D 4P2OC 4D0CA 2OXHA 3GO1L 2Z64C 1SYSB 4F7CB 1CD1B 3EW3B 4LIQH 5EHFA 4F57H 4F33B 1RFDH 1IT9L 4NP9A 4XBGA 4ZFGL 2DKUA 4FDWA 3DPDA 2EO7A 1RK0A 4ZFOB 3VI4E 1NCIA 3QYCA 1FV1A 1CYGA 3HNSL 1ZGLP 3V10A 4W4OC 3QUYC 4AJWA 4AYMC 1LO2H 3RY6C 2X09A 4ZS7H 4AYFA 4BSWA 4P9HC 4G7QB 2BY2A 4PD4K 1LO5A 1T0MA 4UNIA 5CUSL 5CUSH 1BD2D 3PAYA 4LSQL 5EUOA 4BQ8A 2FLRT 3VQLA 5B4MC 3V9FA 1U3HA 4J3UA 1F2XK 3OQRA 2P5EB 4Q0XH 3VFWB 4N2BA 4PR5B 4LEXL 3RY6A 5BJTB 5FA4B 1IGJA 3RZWA 2GBTA 4M43L 4B0MM 2YIHA 3LVTA 4N87A 3CBKB 3NOIA 3LKOB 2JE8A 5JHLL 5HI3C 3ASOB 4Z7QE 4PVMA 2JIXA 2YOCA 4CL7A 1BQHG 1DSYA 1BBJA 4G7YL 4OFKA 4D3CH 4F15C 4S0TD 5I9QC 2BVOB 4H0IA 2W9DH 2SEBB 1QNZL 1QNZH 1RY7B 3WFDL 1OM3L 3TONA 3U4EB 2CPUA 4ONOA 4G59C 2HFTA 4S1QH 5DVPA 4M1GL 1INDH 3JWDL 4N8PA 3ZKSD 2Z9TA 1T6BX 3LVEA 3RILA 3VD3A 2KL6A 3OKNB 5FO7B 2P5EE 1OIOA 1P4BH 3GEFA 5IQMA 4PY8I 3OBAA 3NFPB 3QDME 4IBYA 3KS0H 1HINH 4AYEC 1BVNT 1SM3H 2HMIC 4XXWA 3BPLB 2DQFA 4JPKH 4XPTL 4IDJL 3P4MA 4GAYB 2XA8L 2DL2A 3BKMH 2CZNA 5D7JD 4HC1H 2VCOA 1CYWA 4F2ME 1T89A 5AQ0A 3ZQXA 2NQCA 5EZPA 5E8NB 1E4KA 1HWGB 1UWGH 3ZKMD 4HEME 3GHEL 3OR7A 1HHIB 2GTWB 2W94A 3ZDWA 3QEQB 2FBJH 3TFKD 5IGXL 4Q74A 2W95A 1XX9C 4ZI8A 1U8KA 1UZ8A 4OD1L 4NKIL 3VXMD 4B9PA 1DQDL 2AQQA 2NCEA 4PWJA 3MJ6A 2XZZA 3KLSA 4HKBB 1J9TA 1MOEA 3RZCC 2PYEE 3F01A 3L3KA 3DXAD 3MRLB 2JIXD 4OTXH 1CF8L 4X5LA 1RZFH 1PZCA 4UCFA 4AY0A 3F3HA 3WY1A 1RP9A 2KT6A