2TSAA

Azurin mutant m121a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALAKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AZURIN
publication title Mutant Met121Ala of Pseudomonas aeruginosa azurin and its azide derivative: crystal structures and spectral properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2tsaA00
3NJFA 1ZPUA 4UF7C 5PCYA 3T6XA 1NDTA 2XXFA 2E86A 3IBOA 2XV3A 3TBBA 2DV6A 3WG7B 3AW5A 3UADA 2J55A 4HAKA 4YSTA 1ZV2A 1EHKB 4E9QA 2GIMA 1BAWA 3PPSA 1N70A 3BQVA 3X1GA 4HALA 1V54B 3TBCA 4AZUA 3IE9A 4F2EA 1ETJA 1GS6X 2B08A 3TA4D 3QJQB 1BXAA 4ZK8A 1JVOA 2FQDA 1M9WA 4A2EA 3ABGA 1KCWA 1MG3C 1AACA 1BQ5A 3NJLA 2BW5A 2UXVA 2UXGA 4Q8BA 3L45A 1PF3A 1V10A 3S3DB 1PLAA 2P80A 4KOBA 3FYEB 4NERA 4UANA 4HZ1A 1IUZA 3FQYA 2IH8A 2FT8A 5IY5B 1NIAA 1XB6A 2CBPA 1FFTB 1NWOA 1IC0A 4GP8B 2YQBA 2RACA 2VM4A 1OCCB 2I85A 3T6ZA 4WTQA 2XUWA 1SFHA 1BYOA 3S8GB 1B3IA 4AKQA 1AZUA 3SBPA 1GR7A 2HX7A 4FA7B 1F56A 1TEFA 1OV8A 2QPDB 1AZRA 4DPBX 1JZGA 3NSYA 3NJIA 4A2HA 3SBQA 2DWTA 2HLEB 3FQ1A 5B1KA 5I6OA 2P80D 1W6WA 1JXDA 1QLEB 2YARA 3UACA 1A4AA 2H3XC 4DP4X 3DTUB 1AQ8A 5I5MA 4W1TA 2FNWA 5I6LA 2TSAA 3ERXA 3GYRA 1J9SA 1L9PA 2YAMA 4KNTA 1SF3A 2IDSA 4HCIA 3CZUB 1AZBA 4E9SA 1E5ZA 1WAEA 1RZQA 3SBRA 3MX0B 1AG6A 1YLBB 3PAZA 1SDDB 1FWXA 3EF4A 2YXVA 4KO5A 3OQRA 1AR1B 3C75A 1ZDSA 2BHFA 2XX1A 2CUAA 2XXGA 1PCSA 7PAZA 2VSKB 2OV0A 2ZONA 5I6NA 1JZFA 1IBYA 2XYBA 2GI0A 3ABKB 2IAAC 2IWEA 5F7AA 2PP7A 2VM3A 1N68A 3UABA 2QDWA 2BWIA 1OOWA 3X1NA 1PLCA 1AOZA 2AVFA 1SNRA 1WA1X 2XVBA 3FSAA 1GS7A 4KNSA 3FU8A 3V9CA 2EINB 4A2GA 1JZJA 3GXUB 4BXVA 1NZRA 1AS8A 3N55A 3FPYA 4HIPA 4G71B 4HHGA 3FSWA 1SFDA 3OD3A 1JOIA 4HCGA 3WNJA 4M3HA 4PAZA 1NIDA 1AG0A 4JHVA 4KNUA 1A3ZA 4E9TA 2I7SA 4AI7A 1XB8A 1CC3A 1AZNA 3QPKA 3AG4B 2LLNA 2J56A 2DYSB 1BQKA 3QJTB 1ET5A 2IWKA 5LDUA 2AANA 3U25A 2X87A 3D12B 4E9VA 1M57B 4DPCX 2TSBA 2FT7A 2J57A 3QQXA 2VSMB 4DP1X 1KCBA 1GY2A 3CG8A 1ZDQA 2QPEB 1FA4A 1MG2C 2PPDA 1AZCA 3DKHA 4YSCA 4DP9X 3FYIB 4A67A 5FC9A 3NSDA 2BP8B 1OCZB 1A65A 1PAZA 2IDFA 5B7MA 2H5UA 1PNDA 1KBVA 3NP3A 4GY4A 3UAEA 1ILUA 1ASPA 3EH4B 2WO2B 5I5IA 3WKPA 4F2FA 1W8EA 2R7EB 1ZIBA 3FT0A 2HX9A 1DYZA 2YAFA 4MFHA 2UXTA 4YSDA 2XX0A 1GSKA 4JHUA 4M4RB 1GS8A 2AZAA 2GC4C 2MTAA 2UX7A 3PAUA 3X1FA 2PLTA 1JXGA 5D4HA 1KGYE 5B1AB 1J9TA 1TU2A 4ENZA 1RKRA 1OE3A 2YAEA 2QDVA 2XV0A 4YVNA 1SDDA 1BXUA 2PPCA 4G70B 3T6VA 5B7EA 1NIFA 3ASNB 3NJKA 3T71A 3ZDWA 1PLBA 3OMNB 1A4BA 1AS7A 1X9UA 1TEGA 4RH4A 4E9XA 2JXMA 2PCYA 4YSUA 4N4YB 5I26A 1UATA 3GDCA 2FQEA 3PAVA 5PAZA 1R1CA 3WNIA 4A2FA 4BWUA 1J9RA 1OE2A 1MDAA 2Q5BA 4YSQA 1I53A 3AG1B 3QJRB 5E9NA 4A2DA 2HRHA 4KOCA 4QLWA 1NICA 2BP0B 2PPEA 3AG2B 1A4CA 2YAOA 1HAUA 3NJNA 3V9EA 3N2JA 2YAPA 4KO7A 4YSAA 3PCYA 4AX3A 2FQFA 2JKWA 2OJ1A 3HB3B 3ABLB 8PAZA 3S3CB 2BZ7A 4YVUA 1T5KA 2FQGA 5AZUA 5B1JC 1OCRB 1KV7A 4F7KA 4W9ZA 2VMJA 4G7RB 4YSPA 2EIJB 1AS6A 1ET7A 5AFAA 3G5WA 2BZCA 1XMEB 1ASOA 2Y69B 1ZIAA 1PZBA 5F7BA 1JZHA 1OCOB 3NJGA 4BK5C 3CDZB 2AFNA 6PCYA 1PMYA 5B7FA 2H47C 2IDTA 1E67A 1KDJA 1XB3A 3X1BA 2UXFA 1JZEA 2MRYA 3X1EA 2YAQA 2WO3B 4PCYA 1L9SA 1NPNA 3EH5B 3T6WA 4AKPA 4NB7A 3HEIB 3RYMA 4BDVB 2GB2A 5I6PA 5I6KA 4DP6X 2ZXWB 5TK4A 2PPFA 3ZX1A 2IDQA 2YAHA 4K9JA 1V55B 4G7QB 3SQRA 5D4JA 4E9RA 2BP8A 2IDUA 1AIZA 1JVLA 1SHWA 1TKWA 1WA2X 2W88A 2PCFA 3OMAB 3S8FB 1OE1A 4G72B 3FU7B 3AZUA 2X88A 1CURA 2CCWA 1URIA 2DWSA 2R7EA 2ZWNA 2FT6A 3AY2A 2PPAA 3NP4A 4L0PB 2Q9OA 4KO6A 3TU6A 4YSEA 2A3TA 5ANHA 1RZPA 2I7OA 1WS8A 4AKOA 2EIMB 3ZBMA 2PP8A 1RCYA 1CYXA 4UAHA 1PZAA 1NTDA 3CVDA 3FSZA 2HXAA 4BXSV 1ID2A 1MZYA 2BW4A 3NJMA 4YL4A 4E9WA 1SJMA 3QJUB 3FSVA 2VW4A 1HAWA 2YXWA 7PCYA 1SF5A 3BVDB 1QNIA 4HHWA 3OMIB 1L9RA 3ABMB 1W6LA 4A66A 5B1BB 2N0MA 2ZOOA 2IH9A 3NT0A 3OM3B 4A68A 4P5SA 3S3BB 3X2QB 1GY1A 2EILB 2CJ3A 3WKQA 1DZ0A 4P5RA 1PY0A 3IN2A 2BO0A 3EH3B 1L9OA 4GXFA 2JFCA 3ZIYA 2CAKA 2OCCB 4CSZA 3NSFA 2GC7C 2FTAA 2QT6A 4X4KA 4YSSA 1MZZA 3KW7A 4NAJA 3IN0A 2BP0A 1NIBA 3EHBB 1NIEA 1M56B 4E9YA 1NINA 1E30A 3JTBA 1NPJA 3JT2A 4CSPA 4DP2X 1JXFA 3NYKA 2UX6A 4GP4B 2GBAA 4GYBA 2FWLB 4DP8X 1A8ZA 4YSRA 3PXLA 1WA0X 3NJHA 2HZHA 4G7SB 1EZLA 2W8CA 3AG3B 3MBWB 1ILSA 2GHZA 3PLYA 5I6MA 2AZUA 2IWFA 6PAZA 1ADWA 1PNCA 1KBWA 1AAJA 1JZIA 1JERA 1X9RA 2XV2A 1PZCA 3T9WA 5A7EA 2HX8A 2Y1AA 1J5DA 2VW6A 3IEAA 4N8UA 1AANA 3DIVA 1E65A 2J5WA 3CVCA 4KO9A 4DP7X 3CDZA 3UGEA 4Q89A 3UAAA 5B1JA 1KDIA 1J9QA 1IBZA 3H4FA 1WS7A 4GP5B 4WKXA 3ASOB 1BEXA 1BQRA 1BXVA 5AKRA 5I5JA 1J5CA 2CALA 4BDVA 4EF3A 4BWTA 2GSMB 9PCYA 4FAAB 1CUOA 3H4HA 2WSDA 2NRDA 1OF0A 1NWPA 1HFUA 4HCFA 2VN3A 4QKTA 1CYWA 1L9TA 3CVBA 2VW7A 3FU7A 2BWDA 4JKNA 5D4IA 3H56A 1ASQA 2B3IA 1KYAA 2FJSA 1BYPA 2HRGA 3TASA 1IKOP 5EHFA 1ET8A 3FQ2A 3WI9A 1SHXA 5B3SB 5I28A 2EIKB 1GYCA 2XWZA 4TXVB 1QHQA 2XLLA 4YSOA 5TK2A 1L9QA 3WIAA 1E5YA 4DP5X 3NJJA 2DYRB 2PP9A 4BWWA 3FU9A 2XU9A 3NSCA 3FS9A 1GW0A 3KW8A 4DPAX 4DP0X 3FPXA 1VLXA 3QJVB 3QJSB 2DY2A
chains in the Genus database with same CATH superfamily
4BZ2L 4ES9A 1RZJL 3FJTA 3Q3GB 1PD0A 1P7KA 2DMGA 3BUQA 4KWUA 1TZOA 2H0PA 1QYGL 3H2WA 3H53A 1OAYL 3AXLB 1JK8A 5D55A 3VRIB 1SLVA 3IBOA 2R2BA 3MGTA 2FZ3A 4GO8A 5F96H 1N5AB 2BSRB 3PIQA 3GNMH 3C8DA 4N8CL 2QZQA 1S4IA 1BA9A 3MRNA 5B1CA 4NUMA 2IG2H 3U4BL 5INCA 1KXHA 4ZMPA 5FA3A 4XBPB 4Z7VB 4OZHB 3JWDC 1ZV2A 4KZCA 1E6JL 3RFZA 2WD0A 4JVWA 3BYTA 3VXQA 5EU6E 3WS6A 4YBLC 4KK8D 3MXWL 4FKHA 1QABA 4M6OH 4ORGB 1YEIL 1J12A 1OZTG 3WL9A 5IVXF 1J18A 2WK2A 3SDYL 4MJ4A 4ETQB 3O0LA 4P05A 3HBQA 4A2EA 5AOKA 1RJYA 1P7HL 1I8KA 2VRAA 1KY6A 2VT0A 4L8BA 1DDHA 2R2CA 4G9DB 4JQIH 1A6UH 4PB9L 1IAII 4G6JH 5ABZA 4I3SH 3ZR5A 3F00A 4XMVA 5H35B 3L16A 5T8IA 2A4ZA 3QEQD 3T0BA 3KLSA 2HLAB 2YSTA 1F4HA 4MMXA 5C3TA 5C9JB 2EYTB 3IF1B 1S9VB 3RWCA 3QXWA 1QX1A 1NAKL 1NKRA 1D9KA 1OHQA 2LTQB 2PXYD 4O9HH 4GAAA 2FIKB 1KN4H 4I48A 5FYLD 3PQYB 3PDGA 5LBGA 3BUBA 1VGKB 2AERT 1SN2A 3CFBA 4WF7A 1DDHB 5I23A 1BM3H 3MNMA 3P3RA 4F9PC 2ADFH 4LHUB 4WEUD 4OZ4B 4FN0A 2MSPA 5C0BE 1E8WA 3DHPA 5IMKA 1M6OB 3BYYA 5I30L 3UACA 5GRJL 5AKSA 3QHTC 4JKPL 4I3GA 3L3JA 5KYUA 5I6LA 1T03H 1VZHA 1MNUL 5D1XA 3F62A 5E0QA 3TV8A 1U8IA 2IAMC 3V7AE 1DVZA 3EZJB 4G8AC 5JHLL 2EC8A 5D7SH 5J3HD 1LP9A 5JO5A 1IGJB 1IGTB 2FJFA 4QEGA 4Y19A 3VWKA 3HR5B 3V4PH 2YXVA 3OQRA 1TJMA 4KKAD 1PD6A 1E9OA 4RGNB 3LJ3A 4ZMOA 4ZSOB 2QADC 2NW2B 4Q6IA 4M7JH 1DL7L 3L4UA 4ONFH 3F7KA 3QI9D 2ZONA 1G43A 3ABKB 2AI0H 3TBWB 4FTVB 4TSCL 1TTRA 4HISA 4FNLH 4GSQA 3VG0L 2IFGA 2CIIB 4PB0L 4JDZA 5IQ9B 2BWIA 3WTXA 4OV5B 2NXZD 4Y5XA 4JJ5A 3RL2A 2IVFC 1DANT 1YPZB 4XXDB 3T0XA 1OHZA 3MOAH 5D93B 3WKML 2W0FB 4K7FB 3ZY7A 2ITFA 3P9LA 2EEBA 2WAHA 4PJIE 1E9OB 3WN5B 1D5BB 2P48B 1HCVA 4JVPA 3I9PA 4OCNC 1MWAA 2HTLC 1WP6A 1UZ6E 3ZQXA 5BMFL 3IVKA 5E2VH 3S97C 1SRDA 3Q48A 4WQOA 2HA1A 3NA4A 4KNUA 4KDTA 3E8UL 1EXUB 2EC9U 3L3DA 2WVVA 4J3TA 4AI7A 4DOHE 2DD8H 4MJID 2YRBA 3TT1H 3SDXB 1IEBA 4B27A 3Q44A 5A1AA 1UXWA 2WSPA 3ELAT 1MCWW 1MPAH 1ROCA 1UQSB 3HI5H 4HIEA 1WAAE 4K71B 4JR9L 3PWNA 1XFPA 1MI5A 1RUML 4GRWH 4PJ9C 2P8MA 3SCMC 4JDTL 4P9ML 4AVIA 4GRLD 3V5DB 3QQXA 5L8LB 3BZ4A 1WFOA 1KCBA 1AP2A 2WBXA 1ZDQA 3QK0A 3SPHA 2F08A 5L2KE 4TTGA 4P23C 2OXHB 1MDTA 1YEDA 1YEEL 3NEEA 3MV11 3V6ZA 5HI5D 1I1YA 4E0RA 2GBVA 3QUGA 2A1WL 4PJ6A 3IJ8A 3VNYA 3GMOB 1YEGH 2H5UA 4P5TB 5FO9B 4I0PA 3TCLA 1HX0A 4G8GE 5I5MA 2R51A 3VXPA 3WJMA 1D5ZA 1G6VK 4U6VL 4M1CC 1W8EA 5BRPA 1AP2B 8CGTA 3QJHA 2GK2A 4NQXB 2EVJA 1ZHNB 1QRNA 3V6ZB 5T33H 5C07A 5E2UL 1A25A 1NGXB 1MVUB 3AWGA 4LLWA 4NQEE 4QRPB 3PDOA 4K94C 2YMXH 3MA9H 2DIAA 1XGPB 3H9HB 4IBQA 3M88A 2WPGA 5DD3L 4UQ2A 2FX7L 3IT8D 3TCLB 2NT1A 1GKOA 4YFLF 4KKNA 4RWYL 1RKRA 1MCEA 2ZCZA 3ZE1E 1Z5LA 1UEYA 1BQUA 1JGUL 1EUTA 1QFUH 2CXGA 4WDIA 1KPVA 2R1XB 3GJEB 2YD8A 2X05A 4QOKA 1T1XA 5ITBH 2D9QB 5FYKD 3KG5A 2XJKA 1MAJA 5BVPH 3QUYD 3CFDB 5JDSA 2APWA 3CFTA 5BCAA 2A6KA 2EUXA 1FAKT 1ZLSH 3CXFA 1N4XH 5EZPA 2X4TA 3RNKB 4BWUA 4U1KB 3VX0A 4P3CH 1MREL 3MLZH 1I9EA 4M5ZL 4G6KL 5FUOH 5LCVL 4FXKB 2ENPA 1Q8MA 4OR1A 5B4MD 2NYKA 4QLWA 5KSAA 4F2MB 5JXEC 1A4CA 3SO5A 5LGJA 2J2ZA 4NCDA 3FO0H 3EDDA 2APVA 1F11A 4GMSH 1ED3A 3ZGHA 5GS0H 3E7JA 5L4MA 4F57L 3UOAB 3L3GA 4LPXA 5KJ7E 1E40A 4YHNA 2Z34A 4AENB 4IJ3C 3WN6A 3ABLB 2BZ7A 1R4XA 1FFQA 1INQB 1S7VA 2K0RA 2XDHA 1GC1H 35C8H 4J4PD 4JCLA 4PRAA 1QAWA 3C5SB 3RVVD 1TXKA 3EYSH 1N19A 3TO4D 3EG9B 2F15A 4YQXL 1ASOA 5B22A 3T09A 5HGBA 1FO0A 1Q9KA 3U4EA 3OAYK 1G9EA 5SWQB 5KTEH 2AGJL 2WXOA 5L4IA 4P57A 1CICA 2K4WA 4UOQA 4D9LL 5EOCJ 1AQHA 2ARJQ 2OLDA 2A6DB 1C5DA 3EH5B 4MYWB 4AKPA 4MAYB 5I6KA 3KXFD 5JYLA 3EFFA 4O58H 4O4YH 1DCLA 2QKIB 3EXLA 3GBEA 4NQCB 3QHZH 1TETH 3HG3A 2XSKA 2YAHA 1ITCA 3IB4A 5ENWA 2PO6B 4G7QB 15C8H 3MHZA 4PJ8D 4A7TA 4TLTA 4YXKL 1WCQA 1F90L 4X5QA 2Z8WC 3E6HB 4Z0BH 5T1KA 3TN0D 3VB8A 1AQDB 4Z7OF 2QEJA 1BJMA 4KKZA 1W72H 1J8HB 2DQHH 1LMKA 3CVHB 5CZVL 2X4NB 4KZEH 3MGAA 1SOSA 3GSOB 1Y1DA 4FQJL 4L3FA 4GW1A 4Z7UE 4P49A 3B83A 2WANA 4YX2L 3RLSA 4HFWB 1MLCB 1YYCA 1DSYA 3SZKC 1MWAL 4B3EA 2DLEA 2I7OA 4NQQA 3L9YA 3P0YL 1QR1A 3UZQB 5E94B 2FSDA 1RPQA 4A39A 4CNIA 5I1KL 1HYSC 4Y1SA 4K8RD 1MZYA 4HEPA 3NRFA 4LOUD 1T89A 2BK8A 3OG4B 5KYXA 4TPRL 1E4WL 4FQCL 4XAWL 5HVGB 4N0CD 1QNIA 1C5BL 1U3JA 3D48R 4LCIH 3PAYA 4QAMB 2XTSA 2IANE 2LU5A 3KPRB 3MO1B 1VEMA 3BW9A 3CFEB 4L1LA 3BIAX 3VU1A 4UMGA 1DEDA 3RPBA 3LNDA 4Y4FD 2RFXA 3X2QB 1GY1A 4NKDB 4RNRA 4FQHA 4R8WH 4DQOL 1FLRH 2ZKHL 3PDDA 1JPTH 1PZSA 4NLAA 2I07B 3QRGL 5HPOA 2GJ6A 3KPSE 2C9RA 3LDBC 3LPFA 4EIUA 4G6FB 4J3OG 4IRJA 4CSZA 1EFQA 4JRXE 3KWWB 5SV4A 3DBSA 3QIBC 4X4ZA 3TC9A 4G82A 4NZJA 3FQNA 3P11L 4DETA 1H6UA 3L5IA 1ICTA 4GAJL 5CEZD 2NNAA 1NINA 2A9BA 4H2AA 2DEWX 5C6PB 4KGLA 4M8RA 1JMXA 2QGCA 5DQDL 5LBSL 1XIWB 1A8ZA 3US1A 5C0AD 1RI8A 3GBNL 3PXLA 4PTUA 2GFBB 1BOGB 4EI5C 1D7FA 1IX2A 1H5BB 2C3XA 4TULL 5AOJA 1A7PL 1KCUH 4IGBC 4XNAA 5K33A 4Z5RA 2P44B 5JHBA 1AGBB 4XNXL 2FJGA 2XBTA 4EE2A 2BOCA 4XNQA 2OTWB 5C0RH 5DS1A 2J5WA 4OZFG 1M7IA 1JHTA 3H0TB 1R0AH 2HG0A 1J9QA 2WKGA 4PRPA 1T0PB 1CL7I 4EDXB 1UYWL 4WKXA 2VABB 1UUNA 4L8SB 3ASOB 1PKOA 4EDWH 3T65B 1CI3M 4BDVA 4CJ1A 2YMTA 3OHXA 4F5CA 2EXSA 3ARFA 3C6SA 4Z5RB 1AQKL 5DVKA 5LXGH 1L6ZA 5TGBB 3UL4A 3FB8A 2CRMA 5BVJB 1CGUA 3BN9C 3EJZC 1JPST 1T7XA 3GZQA 4LGSB 5F72S 3UAFA 3CC1A 4ODHL 3RDTD 3BGMA 3H2PA 1E4XL 4QF1B 3NGBB 3GM0A 2Y7SA 5GQBA 1M2VB 5DQJA 1EVUA 4ZUTB 3ULVL 3SQBA 1JFQH 1N0LB 2Z0UA 3V6OA 4QRAA 3GRWL 2H8PB 2X1OA 1L5GA 3O2VL 1DBJH 3APDA 4UIKL 5GRVK 2VR9A 4BRVA 4U1JA 4URKA 4TXVB 4RZCB 4YSOA 2G9KA 2P5ED 4DFHA 4TLSA 1T0MB 4KXAA 3TVMB 3FXIC 4UM8A 1K5WA 4A63A 2XXCB 4LSUH 3HRZA 4L1TA 4MZ2A 3RX7A 4PY7B 3CLFH 1ZVHA 1RZ8B 2X4PA 4N0FA 4QXVA 4DPAX 1S78C 1T1WA 1VEPA 2HH0L 1BEYL 5FGSA 3ZN6A 4CU6A 2HRPH 2EEAA 3QJSB 5DJXA 4FXGB 5I15L 5FF6A 1C1EL 4L05A 4HU2A 4OLVH 4QI3A 3MFFA 2XXFA 3DPBB 4W70A 3RGVB 2V2TA 1P4BL 1Y07A 4DZ8B 4O00A 5D7IF 5FPIA 4J3SA 4XPBL 3BH9B 4G1MA 4JPKH 5IF0B 3CSGA 1CXEA 1HQ4B 1NDMB 1NGQH 2P5WD 4XN2A 3T0EC 4TUUA 2YKKA 1ZSDA 2MQCA 3CDGA 3N1FC 1RV6X 4BHUA 1UHVA 2P1YA 2PNDA 4H44C 1JV2A 3EYVA 4GKLA 43C9B 5KS9E 2ICEB 4P2OB 3CBJB 2A9NL 4XVSH 2X6VA 4KXBA 3VRJB 2R8SL 1OSZA 1YYLL 1A3LH 3HE6A 2H3NB 5I82A 2YRLA 4DF9A 4Y2OB 2BSBA 3DVFA 1GA2A 4OIFA 3GIVB 1FIGL 3UBFA 1DQIA 1IC4H 2NX5B 4ZOAA 3KPNA 3G5ZB 4GSUA 1I7TB 3TIEB 4KQ3H 3CTTA 3MBWA 3ZT5A 1MG3C 5GSRB 2J8HA 2UY7B 1PSKH 2H1XA 4ZMVA 2NUPA 3CDGB 1D5RA 1S7XB 2SEBB 2XIIA 4MD4A 5JIMA 3C8HA 3FB5B 4N90D 4UAOC 5FO7B 4JFSA 3ILQC 5HDQH 2BS71 4LHJB 1ND0B 1IC0A 4L1SA 4AWJC 4WVRA 5FW8A 1CBVH 3RDJA 5EB9A 2IPKB 3LEYL 3AABA 1OP5H 3T6ZA 3QG7H 1OP4A 3HA0A 3VGHA 4P2QD 5KVMC 4PJBA 4I18B 3TH2T 3GSWB 3QJFA 4TUKL 3V4UH 2VDOH 2CJSA 1GL4B 1F2QA 4OSUH 2JIXD 5BRZB 5I1LB 1WWAX 1S7SA 2LR4A 4KRMB 1FZOA 4MA1C 4QRBA 5DJYB 3S48A 1ZY9A 5CWSB 5SWZE 3KPPB 2WLLB 1DVYA 5E4IA 2GABA 2KLTA 3FQ1A 1TJIL 3TYGH 5D72H 3ARBB 1HHKB 3O11A 3DTUB 3FQUA 3LH2L 4ENED 2X38A 3BUPA 5EU3B 4JHAH 4UDUA 1OK0A 4BCYA 4HGWB 1KBBA 1IKNA 4P0DA 4Y0GA 1YDPA 1AZBA 2H6PA 3NSJA 4H40A 3PWLB 2WV3A 1E7UA 2AJ3A 2IFFL 3MX0B 4IKNA 3QPXH 3JZ7A 1YLBB 4MTMA 1MXGA 3PAZA 4ZS7L 2WW8A 2WC7A 4J3UA 2B0SH 4RFNB 4F1ZA 2EIZA 4JO4H 3QFJD 3QO1A 4B53A 2HP4A 1HHIA 1P9MA 2ZOKB 3IFLH 1SDYA 1JJUA 4KO5A 5E03A 2VC2H 2F53D 4G8FB 4ZTOH 3LQAC 5IW1B 1TMCB 1XR9A 4GKZB 4Z77A 3A4AA 3IU3B 5D7EA 5I6NA 2OZ4A 1OY3B 2IAAC 3D69B 2DRUA 2HFFB 4JKKA 1V3LA 1HSBA 1YEWA 3EBAA 3T0EE 3H54A 1TTBA 4MSWA 4PTTB 4Y7MA 5J13B 2LLLA 1ORSB 2EDBA 3C9NB 4WEMB 5E0FA 3THML 1AOZA 1NM9A 4TQEL 2EUWA 1K85A 2PYEA 2BNQE 3IXAB 1SNRA 1VFUA 4BZ1H 5EEXA 3ESNA 3AAZA 4LBAA 1PEZA 4OY9A 1T20A 1LDPH 4ZYKB 1CFQA 2EABA 4N20A 3WAJA 1NAMH 1C7TA 2XKNB 1BVOA 4LL4A 5JHDA 3VI3F 1F4WH 1SLWA 2QSCL 4LPTA 3K74B 2BOLA 2DMKA 3VXRB 4PH8A 1KLUA 3TT3L 2QVFB 3LNFA 5KUKA 3RVXD 1AZNA 2NDFA 3HHSB 4Q2ZB 4U3HA 3G7TA 4HXBH 3BRDA 1FZJA 3S96B 5IFHL 1NUGA 3GTNA 4HCRH 4X5WB 2VUYA 3N1QC 2F54E 4PPTA 2XZAL 3QUXC 3F64A 3CVIL 2XWTB 1O6TA 3JV4A 4GAGH 3W39B 2H4EA 2Y5TB 2J57A 3F6LA 4LBEB 1DQDH 1MVYA 2YZ8A 3RWIA 1KELH 3RWJA 2WYIA 2ZUQC 1X5XA 5C2UB 2BXZA 2D0HA 2CPUA 3SY0A 3TH4T 12E8H 4NQDB 1KLUB 4JFZH 3VXTB 1U8KB 3FYIB 4Z7VF 4ZMXA 2C9PA 3UTPE 3L1OL 1O7DC 2NY4D 4GOSA 2R15A 5GGRA 3SBWC 4P46C 3DI3B 3JT0A 1TQWA 4H4NA 1URZA 2CKNA 3NIGB 2XRAL 3LXCA 4FNPA 5C97A 4JX0A 1J8SA 2FYVA 3EH4B 4XVUD 1K4DB 3V0WH 2HMIC 5HVWA 5BOZG 4J7RA 4UT6A 1AE6L 2G3MA 1AKJB 1JNLH 4LU5H 4LLYB 4NC0B 3WIHL 1EZVX 3H9SE 4PJHE 5DJ6B 3SGKA 3O4LB 1CZ8L 2Q86A 4C55A 5ERWA 4MXQC 3CH1B 3K91A 1IC1A 1DLFL 3ARGA 43CAB 4FI8A 5HDBB 2DQEL 1Q1JL 1QQDA 3PU7A 3RTQD 3H7BB 1Z0MA 2GUOB 5DO8A 2QGDA 1OE3A 5DURB 2XN9B 3MLRL 5DLML 1M7DA 3T71A 5GGQL 5E5MA 3FBQA 1K4CB 3QORB 1AGDB 4S1DD 2N7AA 2PTUA 1U36A 1TEGA 3FOLA 5HDOA 5KVGE 1XDTT 3I74A 3V55A 3O6MH 2V3FA 5I26A 1EK3A 3TCXA 3AWEA 3ECBB 3G6DL 4UTAL 1LE5A 5EN3A 2IGFH 2NZ1A 3MUHL 1E8YA 5D5MA 4NS0A 4RZKA 3WNPA 2EKJA 3MA7A 5IHHA 3BD3A 2Q5BA 3HVDA 4LIQL 4PCTA 4LNRB 4Q74A 3IS0X 4UT9H 1U3HC 1WBZA 4X7TA 4LFHD 1V7ML 1QACA 1UVQA 4I9XA 4LK4A 1K9TA 2VXQL 1KCKA 1DVXA 1PZ2A 4B9KC 2BP0B 3ES6A 3HE7A 3UROR 3BSGA 3UTOA 4U1NB 3BWAA 4NP4H 5EPMB 4HS6B 4PV8B 5FV1L 4JFEE 1DBKL 2YD1A 3QUKB 5LGHL 3KGTA 1CGTA 3RB7A 3FQRB 5F44A 5AYQA 1DJSA 2E7LA 3HC3L 4Z7WA 3D3VD 4HJ0D 2V2XB 4HKBB 4MQ7B 4DUXA 4PBXA 2R1YB 1DE4A 3BH4A 2P8PB 4PJ5E 4QTIH 1QLRA 1D5IH 4UINH 5I8KH 4BRJA 2YFOA 1ET7A 4JFUA 2W9EH 1NFDB 3KD4A 3QXDB 1E4HA 5AOLA 5E6IC 5FM4A 5I1HH 5F7BA 3B1TA 1OCOB 4XT1C 3IJYA 1PMYA 2A38A 3MCLL 4U1LA 1IBDA 1CXKA 4OJCA 4CC1A 5B7FA 2WWNA 1MEXH 3HNSH 3LKSB 4I4WB 1CFSB 1O7DE 2NLJA 1WBYB 3VI4E 3QC6X 3SPGA 1HJBC 4WJ5A 3J07A 5IK3B 1MCRA 4Z7WB 1JF6A 2FR4B 1IC7L 2Z9TA 2ZF8A 4PGBA 4PJDE 2W9DL 3TH3T 4CU8A 3FTZA 1BFOB 1QBAA 2YPKB 3HLAB 3IRPX 3FT3A 4BSVB 5LNDA 2VWEC 2EVFA 1RK0A 2CG9X 3FO2B 3E9UA 4W68A 5KEZA 1A1NB 5HVHB 3SDXF 4HG4K 1KCLA 2OSLA 1YEJH 3BQUC 3FU7B 5CEYB 1LEKA 1ZANL 3INUH 5D2NB 4HWUA 5IB1A 3OVUB 2XC8A 1J0ZA 3EO0B 3L3IA 3NJXA 3GUTB 1WG3A 1U8CA 1MCLA 3VSTA 2V8MA 2EQDA 2FT6A 4ZNEA 3AU0A 4N9GA 3GF8A 4XN5A 1RZJC 4OT1H 4RIRA 2G30A 5CSGA 1JZ2A 1JF1A 3N0PB 2EDWA 2ADIA 5SWSB 5DEJA 1A2YB 1U91A 4LSTH 2XN2A 4APQD 1ID2A 1L9NA 2QMJA 3BPOC 1R6VA 1MIEH 1XF1A 5AEAA 2NY5H 1E28A 4YFLI 3G3LA 5IMLA 4OJFH 1P5UB 3LKNB 3VXSE 1SXBA 4FFZA 1TVDA 1CGYA 5ECJE 2B2XL 3L9EA 3REVA 1FBIL 4LDCA 2Y06H 3N42B 5DGQA 5BXFA 5FKPB 3FT2A 1KJMB 3FUDA 5KBLA 2ZD0A 4B7LA 2VDQH 5DJAA 4YUEL 4BFIA 4U2YA 5LGKA 3IJSA 5I66A 2UWEE 3ZO0A 3VD3A 2AITA 8FABA 4DKEL 4X99B 1T3FA 4J28A 1EFXD 2CAKA 1CLYL 5C0FB 5JHAA 2FTAA 4R4ND 1L9MA 3ZSTA 5DWUL 4ZUWB 5KVEE 4NRYB 1I9RH 2ZUYA 1TZGH 1YEKL 4YIQB 3EHBB 4KRLB 1A64A 1RIHL 5DD6A 2XKSA 2JI3A 3QFDA 5EOQL 4YHMH 5C8JB 3JBG7 5GJTH 4LCUB 4XMPL 2VLJE 2WLHA 3MREA 5DHMC 5FWQA 3MDJA 5HYJA 2DDQL 4JPSA 5DC4B 1IKFH 3Q1SH 3MXVH 3DUUA 3WMPA 2VDML 2ZX9A 3GXMA 4WWKD 2AZUA 2EO7A 5KWYC 1CD1B 1DFBL 1R19A 1KBWA 3MRQA 4DN4L 4HXAH 1PZCA 3UCQA 1EJ6A 3DX9B 3ZE2F 2HX8A 2Y1AA 4DO6A 3NG5A 2OYPA 1LTXA 2VW6A 2H0JA 5J3HC 1TQSA 5J11B 1NLBH 1AO7D 4LHUG 5FYJD 3VXNA 2F8IA 4IBYA 1KDIA 1NUFA 5GS1C 1OTSD 1QVOA 2EYSA 3FMGL 4KBPA 1ZXKA 2VWEE 4MLSA 4KKAC 4JL1A 1IT9L 3GSNL 1LO4L 3RHWK 1HILA 4LLMA 1GSMA 1GTFA 2WSDA 3T8XA 1FG2A 4JFXA 3FCGA 3SGEH 4X6BA 1MCPL 1OTUD 4QT5B 4HD5A 1X7TA 4ZBJA 5IHZA 1U21A 2VN3A 5DI8A 4L1DA 4QKTA 3VXNB 2YWZA 2CRIA 1E5CA 2D31A 2EYSB 4NO5B 2DH2A 2K3TA 1WIOA 3BVXA 3NIDE 4KTEL 3V5HB 1W80A 5ALCL 3VFTB 5CJBA 1JGVH 5DO2D 5FYLH 2J1WA 4YBQD 2FHCA 3VTTA 3GBLA 1WWCA 4XPAH 3VFNA 4X0KB 2FJUB 3ZHLA 1A1OA 3EO1B 1P84K 2O93L 3WI9A 3SHSA 3H3KA 5F93C 3BKCL 3P4OA 1BMWA 3W0WA 4ZUUB 3MLWH 4X6EA 3WIAA 1SLUA 3MLXL 4TS6A 2JJVA 1U33A 3KYKL 5C0BB 3KYOB 1E6OH 4W4NA 3F7RA 1CFTB 3KYAA 4JQVA 2O5ZH 1TCRA 3DURB 1R17A 4OLXH 2D31B 4JDVB 5ACMA 4IRSA 1A6ZA 4LEOA 2VUOA 3QEQE 3DHJA 4M6MH 1LO5B 3WO4C 1OTTD 4ECNA 2DY2A 3U1SH 1BWWA 3BAXA 1J05B 4KMTH 2WXQA 4GRLC 5F89B 4G6ML 3MV8E 1EO5A 5IVZA 4B50A 3UO1H 2PYFB 2WXPA 3WU1A 1AXTL 3IYLW 1A6AB 4FNSA 4TQPA 5AVWB 3RGHA 3KJ4C 5HI5C 4PRIA 1UKTA 5JDJA 3TPKA 2JQMA 1TVHB 1OAZH 4GEJA 3QUZD 1UB5B 5IOPA 4FLHA 4OJDH 1LO0H 1BAFL 3S4SA 3H6AA 3U0PB 3HG1A 4LKCB 5T3ZH 5HYQB 1NCNA 3V4PA 4F37K 3K6NA 2ORBL 3MRBB 4WV1B 4Y4HC 4QYOA 1G9MH 2UVFA 1C16B 3CN4A 5GRVL 3UZEC 3WE1A 1RH8A 4WHTB 5L2JB 4GBXD 3FRUA 4ZPTB 4OCYH 1JPSH 4FMKA 4MVBD 1NCUA 2D2CC 3LAFA 2DQIH 4Z95H 5T1LA 2FQDA 2ZJSH 2DWYA 5L4JA 1GJIA 5FFOA 5F6IB 1M9WA 1GIGL 2XZCH 2D3NA 3J27A 4ZOEA 1VAHA 4LEXH 3SDCB 3UTSA 1G7QA 4KXCA 2Q10A 2CO6B 3VYPA 4G8IA 4TRPH 4L3EE 2DBJA 1X4YA 3C5ZC 4OZGE 2E47A 3QH3A 3VD2A 3LRSA 3TFKD 4M1DH 5CUSL 4DZBB 3O6FD 4LEBA 4MHHG 5D1QB 4TNFA 1J0KA 3OPZL 3KCWA 5AB1A 1QG3A 4G5ZH 1TTAA 3L5HA 2A0LC 4E41D 5K9JH 3EYUH 2Y3AA 1FL6A 3FFDA 4FA7B 4KHTH 2XACC 4R2GD 4PI2A 3FUJA 3HN5A 4ZI8A 5J1AB 2G2NA 3SDDB 5HD8D 3GSQB 1O5DT 1R24B 4RESB 1NFIA 3D2UB 1R5VA 1YSOA 2DWTA 2X9YA 4HK3N 5DYOB 3WJLA 1BLNA 2E9WA 2KI6A 5B4MC 4M5YL 1BVKA 5AW3B 4R5XA 3ERXA 3OWEA 1TYRA 3NA9L 4L9LC 1KFAH 4MJIE 4H1LH 1TJHL 5E1AA 2IDSA 5B38B 3HLKA 3STZA 3I6GB 1NGZA 4BK5A 4DVRL 4G8GB 1YNKH 2GY5A 5DFVC 3EUUA 4PGDA 3WENA 3ATBA 4MNQA 5DVNA 4QKXB 4Z3FA 1Y6MR 1NANH 4JM0A 1MHEA 5F1IA 1KCVL 1XF4B 5BJTA 4GRWB 1AR1B 3O4OC 3CHPA 3TO4C 2CUAA 2ZXEB 4GSDH 4QY8B 4NQEB 3M86A 3LHAA 2FSEB 4XVJL 1JZFA 4LPVA 1UWGL 4U33A 2IWEA 1TTCA 4ZOBA 5IQLA 3TWYA 1QBLL 2ADGA 3QUMH 5FFLA 5HYSG 2I9TB 2QADB 5LG6A 3OF6D 1U8QA 1H3XA 3RZCB 2Z7ZA 4B97A 3L4WA 1OAUH 5G4OA 2X9WA 2C3HA 3PHSA 1IRAY 5E2TH 4ABWA 2NPLX 3EOYG 1BVLA 3HG4A 1U8MA 4F7CA 3TO2B 5HDLA 4KNSA 1B2WL 1E4JA 4PJ8C 4I77L 4BXVA 1FL3B 4LOEA 3N55A 1RUPL 4DQAA 3DX6B 3BP4B 1SFDA 4YHKH 2CKBH 3PV6B 4D94A 2IPTL 5EORH 2WXRA 2BSSA 5CEXA 4RX4D 1HZKA 4OD2A 5F70A 1MRDL 1XHHA 2YK1L 2XVLA 2EXTA 1MFDL 2IXQB 5L8JB 3X11A 1M42A 2KBGA 1BQKA 4G7VH 2XOTA 4HK3J 5HBBA 3OKEB 4MS6A 1QRKA 2GJPA 4PRNB 4CMHC 4C56A 2CLVB 3B9VA 2X87A 4U6HB 3BMWA 1M57B 4K8RC 2XYCA 3C60D 3IDMB 1CGXA 1WGVA 2VR6A 3GMMA 5D9SA 5J9PA 4NWUH 3Q2NA 4FJYA 4GLRI 5FYKE 1MIMH 1MHHA 3K8MA 4G9FB 1IQDB 4N0CC 5MEOA 2KC0A 4KFZC 4PJ9B 4YFDB 1WFUA 2DBLH 4JG1H 5IJDC 3UJTL 3IMVA 3WMSA 5E5UB 1OCZB 4GUPB 3D9AL 4LRNL 3QDJB 4NRZA 2R0ZL 4AT6B 2RH0A 4Z76B 2A6IB 1G7JB 5D2LA 3WFHB 2Y07L 3G6JA 4AQ8C 1RULH 4FTDA 4HDIA 1GJUA 4DKFH 4EIBA 5C08B 3ZTDC 2LU7A 3Q6FA 1JNHB 2OJZH 4PCSA 1TQTA 3M6DA 1OM3H 3AM8A 4XPHH 5HJ3B 2XPGB 4S1QH 1IFHH 5CSBA 2LE9A 2EZ0D 2E9JA 2E4TA 3K6OA 1D7CA 4XVTH 1TOXA 3GSUB 4RDBA 2MCPH 1KGYE 1LK3L 4ATWA 5HHOD 5I0XA 4ZO8A 1BF2A 1SEBA 2IPUG 2UZIH 5HPMB 3TA3C 1S9WA 5DMGC 3FL7A 32C2B 4ENZA 3KCPB 4PY8I 1EIBA 4HJGA 2DICA 3VX1A 2MMXA 4Z7UB 3OMNB 1WZMA 1W72A 3JXAA 2OSWA 3QIUB 4MMZA 2VN7A 5I0WA 4PYGA 1BGXH 1FVCA 3QNZA 5IW6A 1DTUA 3JQOB 3KXFE 4N4YB 4DCQB 3NACH 2DQUL 5T5NF 2J8UA 4G1EA 4NT6B 2WXHA 2R56H 3FB7B 1OE2A 2ZNXA 3LPOA 3RIAK 2AEQH 3CZJA 3DX2A 3PWPB 3FFCD 2EC9T 3G08B 4NRXA 4UBDD 5SX5K 2HRHA 1FE8H 4FG6D 4MQXC 3U0TA 2IANB 3KBPA 5GZOA 2OSYA 2B4CH 4QCIB 4U0RC 4QRSB 1D6EB 4ODTH 4IOFD 3IGUA 4X7FC 1G7IB 4CADB 1WGOA 2AJZB 2J4WH 3O3EA 1S7TA 1BG1A 4PWGA 3SE9H 3IJEB 3MNWA 1IL1A 3DJ9A 3PFUA 2AXFB 1JGLL 2FQFA 3E9TA 4MJ5A 3RWGB 2ZPKH 3CGTA 3LXBA 5EZJA 3SJVA 3GBDA 2NTFA 3DXAA 3KPSB 3KR3H 3SPVA 2DIBA 2ZX8A 4FP8H 4LE8A 4DWHA 3P0VH 5A6IA 5I0VA 1PPIA 3CMOH 2BCMA 4GG8B 3BAIA 3DRTB 4M62L 3U6XS 3M8OL 4AE1A 2BVUA 2DJ4A 4OM0H 3FTGA 3KPMB 3F5WA 2BDNL 1VFMA 2IDTA 1N12A 2NXYD 3QJZA 5T3XL 4IHOB 1A3RH 2JTDA 2WUBH 5IB5B 3X1EA 1Q9WA 5J6GB 5AOIA 2ZOLB 4NB7A 4P2RA 3U7YL 2IPUK 4B9YA 3JV5A 3ULVC 3RX9A 4JFPA 3L9BA 3IS1X 3QQ9C 4X83A 5D4JA 4YMPA 5DJ0B 5B8CA 1QFWL 1KB9K 4HZLA 1H0DA 1MQKH 1RUAL 1NBVL 1OLZA 4DH2A 5KVFE 1G9NH 3CFCL 1XH2A 4UQCA 1SHMA 2O6CA 4ZAKA 3GO1L 2V5RA 4RFOL 1X9QA 1HU8A 1C08B 2DWSA 3CNKA 3HI6H 4FQXD 4JM2D 4NKOB 5I74B 3QZNA 1J9CT 1T04B 3HFMH 5LHDA 5F7MC 4OD3L 3N1MC 4QRTA 4JFPB 5C0AE 3OB8A 4ZUSB 3EDKA 7FABL 1UXLA 5B8CB 3P73B 4BXSV 5I8OH 1FFNB 1P4IH 4M7ZC 1ZLWK 4Y2DA 2PW2A 4KXDA 4R97C 2E75C 1BD2B 1P1ZA 5ANME 4B0MM 1HWHB 1M71A 2HSIA 5FM8A 2G60L 2OL3H 4OQTH 1NMCC 5FHBL 5DYFA 1LGVA 5CINH 2WZPA 1JK9A 4N2OA 3U7WH 3LKPB 5JIDA 3RY6A 4AM0A 1Q72H 1AC6A 1KB5B 1GGCL 1G7PB 3L3KB 4WHYH 4BFRA 2MWCA 4OGAD 1T0NA 3P30L 4JMNA 5DQ9A 5IB2A 2X1QA 4PRHD 1WHOA 3ARDA 2VDNH 3R4RA 1T21B 2HVBA 2K1MA 3F7LA 4QHUB 1MCDA 4JFWA 2QT6A 3GLZA 3VH8A 3PHQA 4YSSA 1GJWA 1XCQB 3P3SA 4C8XA 1EEYB 1U95A 4TVPL 3CN2A 3RWHA 4N68A 3T3ME 1I7RA 3DOSB 4Y5YB 4JANA 5AAMA 3W2DL 5I1IL 3FQ4A 4KV5E 3QIBB 4KQ4L 3QHFH 3V6FB 5DQ9B 3UJJL 5FO8B 3L4YA 4AUUA 3JWDH 3BXNB 5D70H 4ENEC 4GQPH 5I6MA 3FN9A 5I1GH 4HLEA 1PEWA 3U0WL 3UYOD 3W3BA 3BT2L 1WLHA 3MCG1 4JFQB 2GCYA 3CK0L 1X9RA 1NC4D 2QVIA 3B9KD 4X4XB 3NCJH 4GKSA 3PRZA 1I3RA 4HSAC 1E65A 4DJMA 3ULVE 4GIAA 3X13B 4Y1AA 3QT2A 3UC2A 3FCUB 5GHWL 5JXAL 3OR6A 2HWZH 4GQ9H 5E6YA 3K1KC 1QSFD 4XP4L 3FZUD 4Q7DA 1ZA3B 4AVJA 1XBRA 3FCTB 3T4AA 4XXCA 1RXLA 5FB8B 3OAWA 3C08H 5F8RC 1AHWC 5EEZA 2WB1A 4YHPA 1RMFL 2P5WE 3D39D 4LLDA 5D5MF 4FADA 2BNUB 3MLYL 2Q76B 4Y2LA 3KYMA 5GXBB 4ZO7A 2X4OB 1GMIA 2H9GA 1YA5A 1FJ1B 1YN6A 4MRCA 3CFIC 1A9BA 3ZDZB 3JYBA 3VXOA 1NFDF 2B3IA 4AC2A 2Z31A 5I0YA 1HEHC 1RK1B 2B20A 2NCMA 4PVMA 4U31A 4AJWA 1PX4A 3U9UB 1DO5A 2ATKA 2HN7B 4Z7WF 3INOA 3LEVL 4HWZA 3FK3A 3FAWA 3I02B 4MCYA 5J1SC 3NJJA 4JVUA 1Y0LA 1VSCA 2PP9A 3FU9A 2XU9A 4TNEA 4A55A 4F91B 1S8DA 3GJFB 1DUYA 5EBWB 3HUJE 3QPQD 1FQ9C 2GY7B 2QQLL 3STBA 4X4YA 5KW9L 2CMRL 4OM1H 5DDHA 2YRPA 1I1FA 2BMKA 1CFNA 3VFVA 4UF7C 1F6FB 4P2QE 5EU7C 1FRGL 2QELA 1B0GB 2E86A 2TAAA 3GK8L 5E1HB 1CR9H 1I9IL 4FCAA 3NTCL 2VDOB 1RQ5A 2DV6A 4AH2A 1P7QA 1KZQA 1QSZA 1RFDL 4RA3A 3PP3H 3WG7B 1CLZL 1ZHBA 1FYTB 4ODSH 2NY6B 3WE6B 4JEGB 1KEML 1DN0B 1KJ2H 3BVNB 4YDVB 5DJZB 3BWSA 5DDHB 2MIZA 1MCSA 3QZBA 5IB3A 4PI0A 3X1GA 3MZTA 2AEPL 1T83A 4ELMA 2X2HA 1BZOA 4J2XA 1NJ9A 4UV4L 1JPGA 2VAAB 2A74B 1HXKA 1ORQA 5F1NA 1TENA 2NYYC 2BNQB 1AJ7L 3NH7L 3N42F 2XT1B 2ZYRA 4Y8DC 1S9YB 4JFFA 3X3GL 4XP9H 4D9RD 4PJGB 3PHOA 3QFJE 1EMTH 1KTBA 1PF3A 3OPUA 1A7OH 2YR3A 4R0LA 3BAJA 4BZ1A 1W0YT 4MA3A 1HTYA 1W0VB 3CHXA 2EVGA 2ED7A 2AEOA 3Q8BA 3LRLA 1I3GL 4V33A 4GP8B 2DQGH 2A9ML 4NKMA 4NPKA 3HG5A 4WTQA 1PKQA 4S1DC 3Q2VA 4MCZA 2OTUB 4WKZB 1B3IA 3MRLA 4HUCA 2F54B 4IIZA 4LRIA 7CGTA 5HYSA 1CTNA 3CIAA 3IXTB 3MRFA 3DX7A 1CD8A 5E1QA 3HR6A 3MJ6A 2DQCH 3CCHA 2A99A 3ZYJA 4L5FE 3D18B 1OV8A 4BYHA 4HCRA 2CDFA 3DJTA 3DV6B 3ULUF 1DBBH 2VXSH 3MBEC 1NAMB 4O2EA 2H3XC 1PZ5B 4AUYA 3PWVB 1GOFA 4QXWA 4DGUA 4NNPL 3BPNC 4WENB 3ARSA 1A0QH 1A7RL 1J1PL 1ZMYA 1X7SA 3EYQD 1QSVA 3S36H 2WTOA 3FB6B 4HH9A 4WO4A 3RWFB 1D9KD 2H0EA 2DQTL 5T1DH 2YC1B 4HPYL 1FWXA 1KBGH 1BZ7B 5CJQH 1KCSH 4OV6F 2WNXA 4K94H 4MJ6A 2V2WB 4W9LC 3U9PL 2GSGA 1SOXA 4Z78B 3O3BA 3OZLA 4PJHB 4E36A 3LZFH 5LQBH 5EU7E 1OWRM 2OR9H 3L5XL 1C12A 1LK2B 1UA6L 5TTRA 4FEIA 4P5MB 1I1RA 4F24A 2A6JA 4QRUB 3B2UD 2UY6B 5D1XD 4OCWH 3UABA 1X5FA 2HKAA 4NZRL 3L3OB 2UZYA 1PS3A 1ZLVK 3CXHK 3KLHD 1FC2D 2Q1EA 2OMBA 1MFUA 4Y19D 3FONA 3VWKD 3FU8A 4PLJC 1ZKAA 1IM3B 1TFHA 1SGKA 2OP4H 4XO5A 1MCHA 1UWEH 2VQTA 3BWZA 4GG6A 2KLRA 2X53A 4MAUH 2WBJA 2IBGA 4P2AA 1UACH 4RBPH 3WTSA 3S88H 2BINA 4A1RA 4JB9L 2HYMA 1H8OA 5JORA 1I9JH 5FW6A 4APXA 5KYYA 1ZA6A 4IBLT 4O2CA 5AAPA 3IFPB 2DWEA 3QPKA 4XC3L 3C8KA 4U6XA 4WUUA 4Q9QH 2XVKA 3V0JA 3QJTB 2LAAA 4AQ1C 3WGVB 2IWKA 2YLHA 4JPWL 2Q2EB 4HWBH 4UT9A 2F58H 1QEWB 3LS4L 4XN7A 4R4FL 5CBAA 4GXUM 1ECYA 4APQC 2VE6A 2GJJA 3N85L 3EYOA 4B9FA 2VSMB 1CQKA 4ISVB 2ITCB 1YECL 1JPEA 4V1DE 1QHOA 5C9KA 4ZW7A 5AENA 2PUQT 2OPCA 4JY6A 3TYFB 3FFOA 1KIRB 5AZ2L 4YSCA 4L3CB 1OGAE 1DLHA 4MB5A 4LOVA 1TKWB 2ZUQB 5JLZA 4X8GA 4FABH 1BQHG 3HC4H 3OKLA 1WO2A 1TZAA 2WQUA 4FYTA 4L8DB 3S37H 4P5TD 4UM9A 1L4IA 3CDCA 1EHLH 1MI5D 4MJHA 5CJXA 2YZ1A 2X4RA 1JRHL 1ZTXH 4P46B 5TF1L 3MROA 1CK0H 4PREB 5C7XH 2VLLB 3GINA 2AK4A 4M7KL 1UXMA 2AZAA 5KVDE 5IESL 2YA0A 1M1SA 2PKDA 3KDPB 2RAMA 2IADA 4ONGL 1IAOB 3D52A 3R1GH 3GLDA 3P4NA 4PGCB 4WWKC 3T6VA 1SDDA 5DCCA 2WXMA 3TZVA 4ELKB 1BJ1J 4NN6B 3MUGA 4FZ8H 1RIVH 3Q0HA 3OLEA 2BNRB 5IT2H 1OSPL 1QOKA 4OZIB 1M4KA 1A1MA 1YEHL 4FLSA 4LVNB 4ZD3H 5I75B 1DHKA 4P4KB 4IU2A 3VE0B 5C07D 4NKQB 1R3IL 3CPLB 4YZWA 3WFEH 1ZXQA 1OTSC 4X9GA 3PAVA 3I6KB 3APMA 1XGZA 3FO9A 3GI9H 4N0UB 4P48A 3O6LL 1QKZH 2CBOA 1SM3H 1CQYA 2QQKH 4OGYH 1VADB 4XP1H 4IS6A 3QNYB 4YDJA 3B34A 4M6NH 3OC5A 4NQSA 1U92A 4N5UA 5JNYA 2Z1KA 2Y0SA 1P2CB 1UT1A 4QOKD 2V17H 5FEBA 4W9HC 1OWWA 1MCIA 1G6RB 4ICWA 1XGUB 4XGZB 4EZMA 1IB5A 1UFUA 3NABH 4GRWF 5TQ0H 1OOAA 3WS3A 3QARA 4EZJA 2UWEB 1CXFA 2ZG1A 4GINA 5IKCB 3HAEG 5B1JC 1JUFB 3HZYB 1CT8B 3QXAB 1FZKA 5DO2C 1CGVA 3MBXH 4M93B 2VMJA 2X44D 3QQ3A 4JZOA 4EJ1C 1UOKA 2AEWA 2ESVA 4JN2B 3B5GA 5HGDA 3VTMA 4C4KO 1KTLA 4N5ED 1MHPH 1GXEA 4WFHD 5KSAD 4RMQA 4S1SH 2P9RA 1B0IA 4N8PA 4P06A 3RRQA 4JFOA 4NUGL 3OC8A 2FWSA 3LQMA 2UXFA 5IVXE 1B4RA 1OT4A 2WO3B 3TWCL 3U2SB 1TQCB 1WT5A 2Q8BL 4ILDA 5F0LB 1XGTB 4ODWA 4TQHA 5E8OB 2BCKB 3CVHL 4AYGA 2R29L 3QJXA 2WUCH 1R3LB 5IROA 1SOKA 2F7QA 1A7NH 2VDQB 4N6RA 4MAYD 1BX2B 2IDUA 4JO2H 5HHPA 4G43B 2VLRA 1FVEA 2PO6D 5DD0L 3HHRB 2AQRA 3ARWA 4PJEA 4P8QA 1L7IL 5EA0L 4AQEA 1RJLB 5JQ6H 1U93B 3V5KB 5E6ZA 1J8HD 5IIEA 4TSAH 4RRPG 3S34L 2Q9OA 2B1OA 3TU6A 1CICD 1JG9A 3M07A 2YQ3A 2WXIA 4M4RA 2X2YA 2BC4B 3ZVVA 4BHUI 3V7AG 3DOIA 4WHYG 5F88B 1HH6A 3PL6C 2HVJB 3GM8A 4AEFA 4GBXC 4XOAA 1EHAA 3IDJB 3RY5A 1SXAA 4KTYA 5EV7A 3FSVA 3H3BC 5T1KD 3O3AA 1N5YH 2WQVA 5FFGA 3QQ4B 2GITA 1AO7E 4R7LA 5FYJE 3LTVA 1C5CH 2YBRA 3VD0A 3TL5A 2YPVL 1TLMA 5D1ZA 1ZV5A 5C0GB 3RG1C 5TDNA 4KDWA 4MDIB 3ZMRA 4FQLL 1HH6B 1CTMA 4RMSA 5DD1L 2MNUA 4ZFGL 2VH5L 4GIOA 2ICWA 4XNDA 4P5RA 5F3HA 2BO0A 5DJ2B 1G7HB 4QMEA 4ZXBA 4NGHH 1T1YB 1GZHA 1WHPA 2VDRH 4X4KA 3DMMA 3QEQB 2FWOA 3ZTCC 2WNKA 5D2LF 1OGPA 4ODXA 2Z7YA 1ZT7A 4R2GC 2HJLB 1X5JA 1SMAA 3Q2WA 4G8EB 4YWGH 3VXUA 3WIFB 2XTLA 2PXYB 3BHBB 4ZMNA 2GBAA 1A5FL 1DQKA 1KEGL 5C0CA 5HGGS 4J39A 1NOLA 2RHEA 1WIPA 3ILEA 2WVUA 2IWFA 1AZZC 4DEPC 5SX4H 5I9QC 4CN4A 3HNTL 3C09B 3QIWC 2C3VA 1U8OA 1J5DA 4IRJD 4X5PA 4EUPB 2XPYA 3H7LA 4UUJA 4H20H 3IWVA 1WZ1H 1CLOL 4JPIA 2DQDH 3QO0B 5K39B 3UAAA 4JKLA 1OCWH 1UM6L 2O6DA 3ETTA 4HT1L 3CZFB 3FAXA 2WJ5A 3IDIB 2OMVB 1TJXA 2GTZA 2FHFA 2ZUTA 3MJ8B 5EOCL 3F7VA 3HB3D 2J72A 3UTZB 4NZUH 5IR1A 1MFAL 1HINL 1F6LL 4UQ3B 4UNUA 2FO8A 2IALB 2GT9B 1FUNA 2JF1A 1UM4H 3C2SA 5J5EA 1BF8A 1IZJA 3WEAA 4C54A 2CDEA 3QI9B 4JKWA 2FBJH 1LNUB 5EU5A 4M8QB 4KQ0A 2XQYA 3HJ0A 5DUML 1LQSR 1VZIA 1N6UA 2FJSA 5IWLA 1W9XA 2V7NA 3LVTA 4D7BA 1BYPA 4O5LH 4KC3B 1PG7L 4W81A 3BP5A 4W9GC 2NXZB 3U36A 3TBVA 2GTZB 4HJJL 2G5BB 4I2XA 4JREC 3BSZA 1GYCA 3E8VA 5EZIL 3ABZA 5AYTA 1IGML 2ZYHA 3ZUCA 4DN3L 3Q05A 2X6UA 3ARFD 2OYKA 1QUNA 3HS0A 1PFOA 3NZHH 2DYRB 3BKML 4BWWA 3BZFB 3RUGB 5EEYA 1RURH 1MW3A 4YK4B 1RIUL 4QJ3B 2CJUH 4N3UA 3SKOA 2VXTH 3MCKB 4MJIB 2N7SA 2JE8A 3C60C 4HBCL 4UZSA 3QDMB 4O02B 2V7HA 4H0IA 4CN6A 1F1DA 3HNVL 2FBRA 3X3FH 4E41E 2X09A 2VRKA 3LQAH 1JZ3A 4YLCA 5MENB 4ZOCA 1KYFA 2G0KA 4Y4KA 3FC8A 2XFXA 4GRLB 1WRFA 2EXWD 2XWBA 4HHAA 2HT2D 3A6BH 2W5PA 2G4GA 1DP0A 3OXRA 2R69H 2OMZA 3VVWA 2RCSH 4IRZH 1MY7A 1FNGA 3KJ4B 2X1PA 2CLRB 3WSQL 4QHLA 4X8JB 3WCYA 4ERSH 5FCUL 1GPOL 4K3EH 2DLHA 4MAZA 4KKCC 3IE9A 1UJ3B 1THCA 1R5WA 3RWEA 2B08A 4G83A 1GRWA 4TOYL 3WHXA 1UKSA 2CPCA 4H1LB 5ADPL 3EBIA 1OW0C 3QUMA 1KOAA 1XSOA 2E9IA 3VFGL 4PGEA 4BELD 5CZXC 4DIXA 3RL1A 4ZX5A 2NX5D 4OF6A 3RJQB 5AL0A 1BQ5A 4OGZA 2C1OB 2X2JA 4F8PA 5IEHA 2QV4A 3FT4B 3AB0C 4I85A 4HUUA 4XCFH 5LAXA 3AY4C 4LPYA 4Q14A 1CLVA 3FQYA 4WK0B 5LN4A 3TEWA 2R9HD 1RZKH 2QR0B 1G0YR 1FFTB 1NWOA 2Q7YA 3KBEA 3QE5A 1FI8C 4XNUH 4PV9A 1OCCB 2WLIB 5AUMB 4EI0A 3HE6D 4LVOC 2XUWA 4KKQA 4KK6D 4IKJA 3GRGA 4PJFB 2VJ8A 5F0PB 3ML9A 1I7UB 1CI5A 3QEUB 1YYML 2NTSP 2R4RH 3G5YB 3GMQA 4QGTA 1CLCA 1MCFA 3SZ6A 1R3JB 2VDLB 3DTXA 3O8XA 3EKCA 2A73A 3QUYB 6FABH 4S2SA 5I6OA 4F20A 2YARA 4MXVF 1RUQH 2CKBB 3PJSB 2Q7YB 1CU4H 3T77A 1P4LB 3ARBD 2BRQA 4AGOA 5D7KE 1WZKA 3LNGA 4R26L 5CD3A 2Y1VA 4NSKB 4XNZB 2YPLA 1HNFA 4HS8L 1KNOA 3VA2C 4E9SA 4Z7OE 4XMKH 2VIRB 4Y16A 5TFSH 2VLKA 5JPMA 1UD3A 1PDKA 4HWEL 2NY1D 5CHNB 4L9LB 3STLB 3MYZA 1TPXC 4AMKH 1P53A 1MJJB 1N6VA 3O8XB 4XCNB 1MCNA 3MRPA 3P4LA 2PN5A 3QCTH 4F58H 5LGYA 2LV4A 5LNEA 1GH7A 4D2NA 4HIXL 3L7FB 5GGTL 3NRQA 1XT5A 3HMXH 3KLAB 2GAZB 2VM3A 4QXTA 3ZDZF 1KYDA 2JKIS 3TO4B 3E2HB 3OKMB 1QFOA 2NY7L 2H6UA 3EOTH 2FGWL 2X40A 4GI6A 4EEEA 4IMLA 3ETSA 4QWWD 3RA7H 1MCWM 2C9SA 1BQHA 3RBSA 2WQSA 2J88H 1JZDC 2KLSA 3UEZA 4X98A 3ZK0A 1MUJB 1SBSL 1JGDA 3FH8A 5TE7H 3UZVA 3SOBL 3VNZA 2BIQA 4EN2A 3OD3A 1JOIA 2ZXQA 5DZLA 3KXFB 5GGVY 4PAZA 4LCWA 3VXMB 1UASA 1AG0A 3RWDA 1S2EA 2YEQA 3PP4L 4M8UA 5A3ID 5ID1A 2F7IA 3RPIA 5AYUH 1PBYA 3HN3A 1BMGA 4BE5A 3K71A 4JZJA 5EUOA 5K69A 1DQMH 4YR6B 5JR1L 4HV8B 3MRIA 1T22A 3OKDB 3TN0B 5HVFB 5HHOE 3KL0A 5E8NB 5I1CH 1JWMB 4NUPA 1ET5A 2O26U 4AXWA 1FNHA 1SBBA 1G9HA 4UQBA 1SYVA 5BO1L 2PYED 3AROA 4X98B 2VDPB 3MOBL 3QEHA 4X0NA 5TDOB 1QPXA 4FFYA 3R06A 3B9DA 4D8PA 4DP1X 1PAMA 4NDMA 2OX5B 4X6FB 5BZZA 1GW6A 5IMOA 5JHDD 4XP6L 1HYRC 2BSTA 2R2EA 2QHLA 5FECA 4AL8L 3PG2A 4YDLC 2KMWA 3MRIB 3IGAA 2YUXA 2DOCA 2I5YH 4Q0XL 4BD4A 3UGUA 1KN2L 1ZLUH 3ZMEA 3FFCE 4MD0B 3LN9A 4OGAC 2X9XA 4ZUVB 2H26B 1CG9A 3VGAC 4L4VA 1IEAA 4JY5H 3BP6B 3W11D 2EAEA 2ZCHL 2Z64C 3MRGB 4HIIA 2ATPA 4AIZA 5F2FA 5A40E 4HS3A 2NY3B 5IV2B 2BH0A 3OHMB 4M6AA 4Y4FB 2O5YH 1WUZA 4PJGF 1AKJD 1GSKA 5E9DE 3LD8B 5EU6A 2GIXA 1RLWA 4ZQKB 5C6TL 2HG5B 5FECB 1XVSA 3FRPG 1QW8A 2ZX7A 4YDKL 1HOCA 1LEGA 1ZCRA 4ELMF 1T5WA 3HAEA 2A77L 5J12B 5MEQB 1EJOL 5FUZH 3CLEL 2DQFB 3BIKB 3Q01A 2I9LB 4BZ2H 1RZJH 3UTTA 1I75A 1WFJA 1UKQA 1VFBB 4NOFA 5E1GA 5B7EA 3ASNB 1H15B 1KLGB 5KJ4A 1QYGH 4BH7A 4WNSA 1OAYH 2EADA 3BRGC 4KTDL 2WBWB 3V4VB 5C0AB 5AVZB 4BSWB 3T1FA 1PD1A 3RKDD 1GZQB 1R3HB 3VAEA 1HOCB 1T7YA 3GDCA 3TBTA 3U4BH 1INDL 3V95A 3ARGD 5ANMB 4J1UB 5TD4A 1E6JH 4IEFB 4WI4A 3WLBA 1WF5A 5C6WH 2GHWB 1ZOXA 3I75A 4NYLA 1HXYA 3BJ91 4KVPA 3MXWH 2O5XL 1LXMA 1FL5B 3NJVA 4MD5A 1JWUB 1YEIH 1AGFB 3T2NH 1F3JB 3SDYH 1LILA 5EWIL 3ZL2A 3FKUS 3AXIA 3G5XA 2DJMA 4PGZA 1ZGLM 5DUBA 3GHEL 2OL3A 2WYTA 1KCRL 4OQTA 5JIPA 1KACB 5EULV 4OH2A 1SEQL 3DLQR 4UILL 5D7IE 5IBLD 1PX3A 3OJ2C 4PB9H 2QKSA 1E50A 1HZHL 3MACL 3LH9A 4MMYA 2V3EA 4ZFOA 5BV7L 4HPOH 2EEDA 4YSPA 2BIIA 4CKVX 1II4E 3RDTB 3LZRA 1NBZA 1HI6B 2MQGA 3M7FB 1NAKH 4OKDA 3HE7D 1A6VL 2ZUWA 3C6LC 4MXWL 5GS2H 1YMHA 3B3IB 4UCFA 2DWDB 2DKUA 2YD0A 3S5ZA 1ZEAL 2YAQA 1NPNA 5HHXL 3VGFA 3QPQC 1OF2B 5E23A 5A2BA 1MCKA 2Z92B 4XOEA 4NFDA 2P5EB 2WP3O 4PRHE 2OKMA 4TNGA 4TNVK 2WMPA 5I30H 2BP8A 5GRJH 4H26A 4JKPH 3N40F 1F2XK 2YEZA 2ZE0A 5EIIB 1EQWA 4MKTA 1MNUH 2GG1A 3GMPB 2XJLA 4PJIA 3B5HA 4XCEB 3QWOA 1FN4A 4NENA 3IDXL 5JHLH 1OALA 2FO4B 3L4VA 1KGUA 4H0GA 3U1PA 4YSEA 3QQNA 4NPYA 1WS8A 2X2UA 5DRZA 2BHZA 1SXCA 5I1AA 1X44A 2P5WB 1WAAA 4N2BA 1DL7H 1B9ZA 2JKJA 1XH3A 1SJMA 5FWRA 4NQTA 3SGJC 3SYPA 4XP5L 4TSCH 4NENB 3DROA 5KSUB 3VG0H 1H3PL 4PB0H 3OG6B 3VJ6B 3OMIB 4N8VB 1W6LA 3DTDA 5L2KA 1OB1B 4FFYL 1EEUA 5GGSA 3WKMH 3WV0A 1IJ9A 1YN7A 1VGEL 3BWUC 2XZQL 4Z0XB 3S3BB 4CRPA 3O6KH 5EZLB 2WLKA 4RFEA 4PG9A 3CSPA 3KNBA 5GGUB 1ZT1A 4HKXA 1JYVA 1GCYA 4F9PA 1SJEA 3MJ9L 2QGBA 2UZPA 5J8OA 1L9OA 3GMLA 1VA9A 1N8OE 3N06B 3KDMA 1RZIA 3E8UH 3HUJB 1GOGA 4HH8A 3U48A 3IKCB 3W81A 3BZEB 3JSSA 4JGUA 5DEFB 1T80A 1ZHKA 3KPQB 3DJRA 1UCBL 1PJWA 2IAMA 4BKSC 4JR9H 3FULA 3L08A 3PXJA 3JTSA 5D7LA 4E9YA 5DTFA 1RUMH 1WCBB 4XH2A 1ZT1B 1JWSA 1NGYB 4GJTB 2I25N 4DP8X 5B39B 3MLUL 3NDZE 4JDTH 4NHCL 2JIXB 4P9MH 3NJHA 1QO3A 4OZIF 3AT0A 1DUZB 4MMXC 1TIUA 3MRJA 3T0AA 1JZIA 3GJFK 2C8NA 1GGIL 1YEEH 3KPOA 3ULUD 4IK7A 5IB4A 3VI3E 2A1WH 2XI9A 4TLUA 1QI4A 4F7MA 2EH8L 2CZNA 3CDZA 3UGEA 3A67L 1R5IA 2ZG2A 1KJ2A 3DRQA 3DK0A 4YO0B 1IBZA 5IBUB 5E8EB 4D0BB 4XBGB 5DWPA 3W56A 2CU9A 4PRBA 3BD5A 2VR7A 4RGNC 4U6VH 5HYJD 1ZVSB 1U8JA 3SOTA 1S7RB 1A6TB 3OJMB 3Q2LA 3B2UC 1GZPB 3K5RA 5DGRA 4Y9BA 5D1XC 4FI7A 2F53B 1F4AA 5E2UH 4M6OL 3P4MA 4W6YB 5ABDE 4PM1A 3CVBA 4L1HA 1WTGT 4WFGD 3UBHA 3M17B 3K6FA 5DD3H 3ZHNA 1AGEB 3L2LA 2FX7H 1WWBX 4RWYH 4Z7VE 4OZHE 5BS0B 3G6AB 5D93C 1RHHB 2MH4A 3TASA 2R2HA 1JGUH 1UH2A 3WN5C 1BM7A 1TNMA 3FQ2A 4CW1B 1FGNL 4G6JL 3RI5K 3SCMA 3PWUA 4IOIA 4NOBA 4M43H 2YD5A 3TXAA 5BQ7A 1QFPA 2IMMA 2XICA 4P23A 2YA2A 2COQA 1GOHA 3L3HA 4Y5XC 1I31A 3Q2CA 4LZKA 3FS9A 4N25A 3RILA 1FFOA 3CFJB 4OCLC 4C4KT 1W16A 5I17B 4G6KH 5KN5B 4IOSA 3MNVA 5LCVH 1XSKA 2E6JA 1FIEA 3GMRB 5TDPA 4XO9A 3MRKA 4NBZB 1TCMA 3JZYA 4YPGB 4F57H 1PLGL 3D25A 4FNQA 2YUWA 4PQXA 5C1MB 4KJYA 1IAIM 1TTGA 3DGCR 3MPCA 4G3YH 1COBA 1Q94B 4H8HA 4JRYA 4P5TC 4OCRL 1BFTA 1XBDA 2X4QA 4IRSD 5ICYA 1OSYA 3D4CA 3HBZA 4PJEF 5LG1A 3MYJB 4YQXH 3TBCA 1TVBB 2NY4B 1NL0L 1NUDA 4F2EA 4AE0A 2VJXA 1GS6X 4KX8A 2ZYIA 1IC5L 2EDLA 4YNYB 4AEHH 4S0SD 4XR8C 4HOWA 2VITA 2OMXA 3BUYA 3D25B 4D9LH 5I76A 2FX9H 2CDGB 4PRID 1AACA 2H1LM 4Y9FA 1PIGA 5ITFB 3GXTA 1I8AA 5G2NA 4RGMB 2AW2A 1DEEA 3HG1D 3D34A 4UZUA 4MZRA 2X4QB 4RGNE 2V4LA 2FT8A 4ZSOE 5C0JA 5ESQA 4YXKH 2YGPA 3DIFA 3KE0A 2AABL 1F90H 4KKBD 4XNMB 4Z7QF 4KITB 4MNGA 3DVNB 5D1XE 3S2AA 5CZVH 3RTQB 1BYOA 2ODHA 2BJML 3U6XA 4MCMA 5T1LD 5JXEA 3C5JB 4FQJH 4LSPL 5E2VL 5F9JA 3BEVB 4IK6A 3QYCA 1U8LB 5F6HJ 4I1RA 4YX2H 5IEKA 3AGVA 2X70A 2Z1PA 1MWAH 3UTSD 1GHFH 4JRXA 5L8KB 1XSIA 1JDAA 3G04B 4HWBA 5I1KH 1ANUA 1B0WA 3SDDD 3C6EA 4OLYL 3HI5L 4ALAH 1A4AA 3FCSA 3V79C 5DA4A 2NY2D 4N2NA 4ZFFA 4FXKC 4TPRH 1E4WH 5HHNB 4FQCH 2DM2A 4XAWH 3UPCA 5CM1A 4Y9EA 1JYXA 2EKSB 1C5BH 1ZT4B 4PRDB 3M1CA 4HIJB 3SDXE 3GSVA 1CXIA 1RZQA 3SBRA 3KWTA 3TIDB 4KKLC 4EI6A 3MV7A 4JFYA 1GGUA 2JKNA 3BPNB 1D5MA 3EDFA 4AIOA 2FJHB 3DBXB 3GMNB 4DQOH 3UMTA 2ZKHH 3OAUH 3C75A 4X5XA 4PJ7B 4FC3E 2K8MA 4PD4K 2E27L 3OX8B 2QV2A 4GPVA 1HH9A 3VFWB 4DTGL 1WE5A 1YEGL 4ZMYA 3D3VB 1PCSA 3FO1B 4N5EC 1EANA 3WIIL 4F3FB 4HKJB 4R7NA 5I5RA 1IBYA 4V2BA 3WTYA 1O6SA 3ROLA 2EYRB 5E2WL 1PL3A 1QA9A 1XD1A 3P11H 3I50H 1DJZA 4EI6B 2OQJB 3NAAL 4GAJH 3MJGX 2FATL 3RZCD 4L4TA 5EO1B 3DHMA 4MNQD 4MAYC 1WA1X 5HI3D 4FG4A 4HKZB 4TVSa 1GS7A 1MI5E 2HT3D 5DQDH 2QKIC 3V9CA 4YHLL 3IM1A 2YMXL 4YC2B 5I1DA 4G71B 2PO6C 4S10A 2X6MA 1KIUA 5CSZB 1USZA 4MDJA 4TULH 1NCJA 1G1YA 3GSRB 1A7PH 1Z32X 4XNXH 3DK2A 3KVQA 2B14A 2XN1A 3FRPA 4QRPE 3ILPB 1MQ8A 1LHZA 2BVQB 3TPUB 4E5XB 3PNRB 5ITBL 3EFOB 3FN0L 1J7VR 3GSXB 4FFVC 3L4ZA 4L29A 1UYWH 3HCVB 5MEPB 1XCTA 3UJIL 1C7SA 1U8PB 4RMRA 4DPCX 5JW5B 4RLDA 5DRWA 4W9FC 1X5ZA 4N2LA 4JGMA 5CJ8A 2YFNA 5EN2B 3LRGA 4C4BA 4JFDA 2WINB 5SV3A 1MG2C 4GNKB 2B39A 1SJHB 1AZCA 4YXHL 1ETB1 5C07E 1XTMA 1T2XA 2C1PB 1QBBA 4U3SB 5DK0B 3CAFA 3WJJC 3ZE2E 4ODHH 5B7MA 3SYQA 3FO0L 2PCFB 1KXVC 1E4XH 4EQ2A 2R23A 3L5WB 3BAWA 4HMEA 3JWNH 1XF5A 4JRLA 5DS8B 4EI5D 3GRWH 2DMCA 3O2VH 1CE1L 4UIKH 5C3IA 5KS9A 3I6LE 4F2ME 2VGLM 5EIVA 5C08D 2GKIA 1A4JA 3HRPA 4EI5A 4F80A 4GFTB 4X6DB 4GEIA 1LWRA 4NKIH 3LQZB 4IGBA 5GS0D 4FQQB 2AKRB 1X4ZA 1IGYA 4PMEA 5D96B 3WTTA 1EFXB 1HHGA 3I9GL 4LKXA 1BEYH 5KTEL 3B1UA 2HVKA 4EN3B 5BNXD 5JPNB 2EXYC 5I15H 2DM3A 1B88A 1IM9A 1F86A 3QDGB 1C1EH 4ZO6A 1A7BA 1AD9B 1XIWC 2IBZY 4PJFF 1WTLA 1NIFA 4TL5A 1AD0A 1SVBA 4C47A 2H7WA 1PLBA 4K3JL 4HGKC 2P28B 1H5BC 1MAKA 3H3PL 4C57C 4BQ8A 4DGIL 4XPBH 4E9XA 1HQRA 2X2IA 3QZWG 3BGAA 1DQQB 1ETZB 1XGRA 1W91A 1PFCA 2YXMA 2WCGA 5IM7B 4U1HB 5DK2B 1UWXK 1HDMA 4KZEL 4PSRA 1KT2B 3EYFA 5E8PB 1IBGL 1R1CA 3Q9PA 5FAAA 1LE9B 3NFSL 4NQCE 3VMNA 2A9NH 3MLTB 4WW2B 3B6SB 3VDBA 2R8SH 1YYLH 3VQLA 4H8WL 4L8SC 4PS3A 3IDYB 1LD9A 3VDCA 1IV8A 4WU7B 2VL5A 3IK2A 2IH1B 3J7HA 5SWZA 3Q06A 3FUFA 4OB5L 4EUPG 4DKTA 3DO7A 1J8HE 1KLFA 5I8CA 1HAUA 2AK1L 1WD8A 4ANKA 4PBDA 3VW3L 3KPLA 3CN1A 1E8ZA 1P69B 1VZGA 1Z9MA 5DJ8A 4GQRA 4XMUA 5H4YA 3CSTA 1DBML 3NGBC 5EO0A 5DHYA 3KJ6L 1K5NB 1ML0A 5CMAA 2GYSA 1CGSH 5F9WB 1FLRL 4XZUB 1JPTL 3LN5A 1KXTB 3QWRA 3PREA 3ARFC 2VQUA 4IM8A 4NC1C 4TUKH 5HGHB 1M7UA 2YHGA 4MBOA 3KPRE 3QFGA 3MLVH 2HFTA 5CGTA 3UYPB 4E9TA 2EJ1A 5CGYC 5E70A 3DYMA 4BGDA 3ME0B 2CWRA 3SJVD 1TITA 3T0EA 3WEOA 3DXAD 4QHMA 5DHVH 3U6RB 5IVNA 1UC6A 4J3BA 2LW3A 9CGTA 2WIIB 4FXGC 3LH2H 2G75B 4RWHA 5DVOA 4JM4H 1PW3A 1VACB 4L37B 4BJLA 3S8FB 2OMWB 4YOKA 2CLZA 2PTTB 3RGVC 3V6BR 1YNTB 2HT2C 2VAJA 2IFFH 3AY2A 3K81A 4ZS7H 5E6RB 1CGWA 2WTRA 3OTTA 3DYOA 2Z65C 4P2RD 2R0LL 3GT6A 4R6UA 5CILH 1G7LB 1PGRB 1RZ7L 1Z9SB 1N64H 1CYXA 2ICEC 3C87A 3IJHB 3QUZB 5CGMA 1DSFL 5EFIA 5IGXL 5EUOF 2VTFA 2HLFD 1KB5L 4JY4A 1INEH 4N86A 1J1OL 2VW4A 1NDGA 2YXWA 5ICZA 2ZG3A 4NJ9L 1ZRUA 4ZAKD 4GW5A 5CCJA 3THMH 4TQEH 2BX5A 3K0YA 2M2DA 5CP7B 2Z8RA 2DQ6A 3O41B 4XPTL 3IU4L 1F00I 2Z35B 4K4KA 4U1SB 1BIIB 2ENJA 1N2RA 2QSCH 4PJCB 4BFBD 4UNTA 4Y2DD 3ZIYA 2CD0A 3OQ3B 3TBYB 5JIHA 1JFQL 3GS0A 3TT3H 4JFVA 4W9KC 3O6FB 3Q5OA 3AMLA 1FNSL 2MKWA 2CK0H 4GAYA 5IFHH 1O7VA 1SYSA 1QLFA 3H9SA 2WZPD 2Q3ZA 5L6YL 2XZAH 1ZD6A 4E41B 3CVIH 1RZFL 3NYKA 4GYBA 4CC0A 4DPRA 4TUOB 1S9XB 1WA0X 2AQ3A 2DPKA 3VGEA 5I19L 2QQNH 4H13C 2R59A 3ARBC 4QHPA 4F5CE 1FVDA 2J3SA 5DRNA 4NC1E 3LZLA 3ARDD 4KK9D 1E9PB 3IDNA 1AANA 1OAXL 3NPSB 5I8CB 1TO5A 1E5UI 3L1OH 4KO9A 4DP7X 5ACZA 2WTPA 1OP9A 4U3CA 2R69A 1TYJA 4RFNC 3R4DA 3S36X 4NEHB 4HUVA 2OBGA 3PHAA 3MRMB 5I5JA 3ISRA 4EZKA 1AE6H 3MKKA 5DFTA 2OMYA 9PCYA 1CUOA 4P3DA 2AXGB 3KBHE 4KAQL 4F7EB 1GYUA 2EDYA 3MRCA 1M53A 4IKKA 1CZ8H 4WW1A 3L4CA 2MEJB 3FQWA 1J86A 1IKNC 3KH4A 4HCFA 4WFFE 3VCLA 1DLFH 4FG2A 3MJ7B 5KUMA 1F1AA 1ZK9A 1IC4L 1L3NA 2DQEH 2J1KA 5JQHC 1Q1JH 5T5FA 4Y1AD 4JFEA 3TEUA 2ID5A 3S35X 2WOYA 1FCGA 5JIIA 2ROYA 2RD0A 3HMWL 3LKRB 3VWJA 5MI0C 2FEJA 1MJ8H 2H32B 5DD5L 2BM3A 1KPUA 3QUXA 4G59C 4X8CA 4Y5VB 5DLMH 5HY9A 1J88A 5IVOA 1E3XA 5GGQH 5EUKB 4PJ5A 3ML8A 5F7DA 3DNKA 3WNMA 3L95B 1L7TH 3BESR 3LOWA 2NX5E 5IG7B 1TT6A 5I6XB 5AZEL 5KSVB 1TZIB 5DHEA 3NQIA 3WLWD 4UTAH 3G6DH 3JUZA 2OMTA 2P8LB 1G1KA 4U1IA 3ZMNA 2W07A 3O45B 3WDHA 5EC2A 4LIQH 2VDOL 2ZNWA 3Q6GL 3V4UL 2H2SD 1E5BA 4U1GB 3VI4A 4D0DA 3SBWA 2VXQH 2P3YA 3UDWC 1ONQB 2Z31D 1JYNA 4PJDA 4CMMB 4NNXA 3CBRA 2MFNA 1PZ3A 2EDTA 5ETUA 3T04D 2CH8A 3DGGB 4XN9A 1DBKH 2JCCB 1N0XL 3C60B 1R47A 5H94B 5LGHH 2OZNA 1QTYT 3QC5X 1BLIA 3ARUA 2J8OA 4WAFA 4BFEA 3HC3H 3RNQB 5M7QA 1FYTD 1QNZL 1PYWB 4B9PA 4MX7A 3PPSA 3TNMB 1X3DA 2GSIA 3EJPA 1JGEA 4LQFL 3VFSB 3WFCL 2P24A 1V54B 3OZ9L 1MW0A 5GRZA 4AZUA 1HHJB 3PGDB 5JZ7D 1HEZA 4AL8C 5I0ZA 4NN5B 5I2IB 3MCLH 4LCYA 2I26N 3HMXA 5ETUB 3S37X 3SKNB 1KBPA 3F6IA 2FYYB 1S5HB 4UMSA 4PLNC 2DTML 5HHQB 5D6DC 2V9UA 3ABGA 1R3KA 1U4EA 2Z93A 4QRQB 2WWKO 1UADC 1P7QD 2UXGA 3BO8A 2G9HB 1IC7H 2NZ9C 2YMOA 3VXSA 2W9DH 3V4LA 2P80A 1NBYA 5DR5L 5B3JF 3ZJAA 5BO0D 4Q4EA 1JGEB 4KKRA 5IY5B 4IW4C 2W80C 3FHEA 1B0RB 1U3HA 4NIYE 2E59A 3AS0A 5HHOB 4RSVA 4FLQA 1XR8B 4KVCL 5DUPL 1IFRA 1SFHA 1ZANH 3WHE0 3S8GB 2BVOA 4U7MA 3TTSA 3RVUC 1KF9B 3QORC 5DZNA 1ZWIB 2FIRT 2VL4A 1TEFA 2CE6A 2ZWLT 4LPWA 25C8L 3VO0A 2QPDB 1A4KA 1I7ZB 4OI7A 5HYEA 3MRDB 4QTHB 2E56A 5B1KA 5MHSE 4HMDA 2XG5B 4B6ZA 1NCGA 4W1TA 4WI6A 5DJDA 3VB9A 3OAYH 1CDBA 2VLJA 4Z7NF 5LUMA 2A83B 4GAGL 2O61B 3O2DA 5E6IA 1SF3A 2PCPB 3VXRE 4MASA 4G80A 2F19L 1B6UA 5ESVB 4M48L 4ELDA 4ZW5A 5IBLC 2DI9A 1A9EB 3PGCB 3BAYA 3GGWA 12E8L 1A4KB 4OLUL 3RU8L 2UZXB 1F1GA 1KIPB 3HZ3A 3GTVA 5F1KC 4P9HC 3D85A 1JE6A 2B59A 4DKEH 1YUHB 2LFEA 3LMJL 2BFGA 1CLYH 3RIKA 4NQDE 4X7EC 5CJOL 5DWUH 5HHMD 3U46A 4A7GA 4BUGA 5EOTB 3WKNA 5KVGL 3BQUA 1DN2A 1YCSA 1YEKH 4GKOA 4WO4D 3WUWG 5GRWA 2WAQA 5EOQH 3ZE0B 3QA3A 5TH2A 4XMPH 4N2IA 4D3CL 1DDTA 1ZGLA 2RJMA 1DQJB 2GBTA 2NXYB 4BZ2A 2DDQH 4EMZA 3UBXA 3BPLB 2JJSC 4DERA 3DVGB 2EIEA 2VDMH 3DX3A 4NQVB 4D0CB 1I85C 5ALBL 1IM3D 1UOLA 4DN4H 5AD0B 5HVHC 3AU1A 5K9KB 1I8IA 1ULVA 2M83A 3GKWL 4WNQB 3VGGA 3RAJL 2R1WB 3L9RA 3NCYS 3O4LE 5D2NC 3EW3B 1O6VA 5J4MA 1S7QA 2Y7QB 3FMGH 1DZBA 5L7XL 1IT9H 3GSNH 4HUXB 3W38A 4FQXB 1LO4H 5EIIG 3UBXB 1I4FB 2B1AL 3FNKA 2AV7A 4JM2B 3ULSB 2BVPA 1ETA1 4POZC 3JWOC 1LEIA 2IGFL 4HQQL 3CG8A 5LBVA 3RVTC 5C0EA 1MHCA 5D7IB 2WBJD 3VMOA 1V3MA 3JVFC 3QZWA 1MCPH 1KPRA 3MV8A 3SGEI 1P5UC 3F04A 3CZKA 1A02N 2BIMA 4OTXL 3TNNA 1IILE 2PABA 2IOMA 5D1ZI 3UPRA 2E9GA 2VISB 3NPZB 3DX4A 3ZDYF 1SXZA 3DX8A 4KTEH 4WUUD 5ALCH 2Y6SD 5TPWL 4M9OA 4YGVB 3B7UX 1FNFA 5I18L 3MGOA 3MRRA 5CLYA 4FGMA 3EH2A 2X10A 3FT0A 5BZWB 2WKLA 1CD0A 2YQ2A 4QTIL 2UXTA 3W9EA <