2TSAA

Azurin mutant m121a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALAKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
molecule tags Electron transport
source organism Pseudomonas aeruginosa
publication title Mutant Met121Ala of Pseudomonas aeruginosa azurin and its azide derivative: crystal structures and spectral properties.
pubmed doi rcsb
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2tsaA00
3PAZA 3FSAA 4HCGA 4E9VA 1NIBA 4W1TA 2YXVA 4A66A 1SFHA 2YAPA 3PAUA 1KV7A 2WO3B 2ZOOA 4Q8BA 3HEIB 1BYOA 4E9RA 3FU9A 3FYEB 4DP9X 2CALA 2JXMA 1ASOA 1V10A 4KNTA 5B7EA 5I6PA 1AANA 4YSSA 2CUAA 4ZK8A 3NJNA 4QKTA 6PCYA 4KO7A 3CDZB 3IE9A 3UADA 1KGYE 4F7KA 2GSMB 1PLCA 2XXGA 3GXUB 5I6MA 2DYRB 5I6LA 1E5YA 2GIMA 3X1BA 4KO6A 4A2GA 5I6OA 1OE2A 1AS6A 3TASA 1JZFA 1GSKA 1AIZA 1KBVA 1T5KA 1XMEB 1JZIA 3IN2A 1JXFA 1RCYA 3CVBA 4A68A 4GYBA 3FSZA 2XV3A 2VM4A 4X4KA 1XB3A 3KW8A 2CBPA 4G70B 3WG7B 2I7OA 4YSPA 4HALA 1BEXA 1AQ8A 4DP4X 1HFUA 3GDCA 5A7EA 1ZDQA 2B08A 2VW6A 2PCYA 4G72B 3FQ1A 2EIKB 1XB8A 2PP7A 2QPEB 3QJTB 4NERA 1ZIAA 2BHFA 2NRDA 4W9ZA 3WI9A 5B7MA 1M9WA 4DPAX 3N2JA 2IDTA 1RZPA 2HLEB 3AG4B 7PAZA 4YSOA 2XU9A 2HX9A 3EH3B 1NPJA 2FNWA 1BXVA 3ABKB 2BP0A 2XX0A 7PCYA 1KCWA 1SF3A 2FJSA 3JT2A 1OF0A 2R7EA 9PCYA 1NZRA 3EH5B 1L9QA 3ERXA 3SBPA 1AZRA 1NICA 1RZQA 2FT6A 1AOZA 1B3IA 5FC9A 2EIJB 1PCSA 4AKOA 2IWFA 3NJMA 2WSDA 1SJMA 4DP1X 1JXGA 2UX7A 3IBOA 3FU8A 3ABLB 2IDQA 3ZIYA 2FT8A 3UACA 2ZWNA 2IDUA 2ZXWB 2FQGA 3PLYA 5B1KA 2XLLA 2XV0A 3NSCA 2FQFA 2AFNA 3H4FA 3NSYA 1KDIA 3L45A 1L9TA 3X1GA 1GS8A 1ZV2A 2GI0A 5AKRA 1FFTB 4JHVA 1TKWA 1AZBA 1QLEB 2I85A 1AR1B 2P80D 1IKOP 5B7FA 3X1EA 3TA4D 1QHQA 5B3SB 4WKXA 1L9PA 2Y69B 4NAJA 1OCCB 2Q9OA 2PCFA 1ID2A 3FQYA 2UXTA 3OMAB 5I5JA 1TEGA 2BO0A 1X9UA 2PP9A 1JZEA 1ZDSA 3OMIB 4YSQA 8PAZA 2YAMA 2QDVA 4A2EA 1A8ZA 5PCYA 3OQRA 1V54B 1MDAA 4GXFA 4G7SB 2HXAA 1BQRA 1KCBA 2HRHA 1JVOA 1MZYA 1KBWA 2PP8A 4NB7A 4GP5B 2UXFA 4QLWA 2AVFA 4TXVB 4DPBX 1NIAA 2H5UA 4BDVB 2X87A 4AKPA 4KNUA 2FQDA 3IN0A 3NJFA 3WIAA 3QJUB 4BXVA 1A4BA 1NPNA 4CSPA 5LDUA 1PZAA 2EILB 3FYIB 1TEFA 3QJSB 3NP4A 1CURA 5B1AB 1PAZA 5B1JA 1NWPA 2IH8A 1SF5A 2IDSA 4MFHA 4G71B 4DPCX 2YAOA 1AZCA 4A67A 1J9SA 1I53A 2MRYA 2PLTA 5I6KA 2P80A 5D4HA 3NYKA 3UGEA 1SHXA 2DY2A 2CCWA 2IWKA 3ZX1A 1M57B 2Y1AA 4A2HA 2QPDB 1PZBA 1URIA 2XUWA 2ZONA 3NJLA 2AZAA 1E67A 2YQBA 1UATA 4BWUA 4HCFA 4M4RB 1WS8A 3AY2A 4YSUA 3CVCA 1A65A 1L9SA 1JERA 3NJKA 2YXWA 3UABA 2BW4A 3S3DB 3SQRA 1ILSA 1ET7A 4GP4B 2E86A 4AZUA 1JZGA 1BAWA 2QDWA 3X1FA 1W6LA 5F7BA 4E9TA 2FWLB 1PLBA 2EIMB 3CG8A 1GS6X 3QJVB 1JOIA 3WNJA 5I28A 2A3TA 1HAWA 3NJJA 2FQEA 2JKWA 3WNIA 4YSCA 4AKQA 2FTAA 3N55A 2HX8A 3ABMB 3NT0A 1ET5A 5ANHA 1WA1X 4ENZA 3UAAA 2BP0B 3PPSA 4BDVA 3NSFA 1OV8A 4YVUA 1PY0A 3DIVA 1GYCA 1WA0X 2I7SA 2J56A 4AX3A 4YSTA 2PPAA 5B1BB 4M3HA 1WAEA 3FPYA 3ABGA 2JFCA 1HAUA 1SDDB 1OOWA 1N68A 3V9EA 3MX0B 2PPDA 1IBZA 1ZIBA 2IDFA 3HB3B 3FQ2A 1OE1A 3CZUB 2MTAA 5F7AA 1J9RA 3NJIA 3OMNB 2BWIA 1KDJA 2OJ1A 1IC0A 1EZLA 4DP5X 1JVLA 4DP0X 3EH4B 1J5CA 1XB6A 4L0PB 4AI7A 1QNIA 2VN3A 3QJRB 3V9CA 3FSVA 5EHFA 1BQKA 1OCRB 1WS7A 1SHWA 2DWSA 3AG3B 1NINA 1GW0A 4E9SA 4DP6X 1E5ZA 2PPEA 1W6WA 2VSKB 1AG6A 1ET8A 2W88A 5IY5B 3QQXA 1GY2A 3PAVA 3X1NA 4YSRA 3ZDWA 3T71A 3QJQB 1BYPA 1DYZA 2XV2A 3FS9A 2X88A 3C75A 1A3ZA 1AS7A 3CDZA 3UAEA 2Q5BA 3CVDA 3ASOB 1GY1A 4UANA 3H4HA 3NSDA 2UXGA 1ASQA 1J9TA 2TSBA 1BQ5A 1PNDA 4HIPA 2IH9A 2UX6A 4PCYA 4DP2X 5TK4A 4F2FA 2CJ3A 3WKPA 1VLXA 4WTQA 5PAZA 1JXDA 3SBRA 1AS8A 2XWZA 2YAQA 2IAAC 4KO9A 2R7EB 2BW5A 4E9XA 3NP3A 5D4JA 4YSAA 4UF7C 1JZHA 1MG3C 1SFDA 2TSAA 2H47C 2LLNA 2H3XC 2YARA 2XXFA 4HHGA 4F2EA 2W8CA 4HAKA 3PXLA 3ZBMA 5E9NA 4BXSV 1A4AA 1R1CA 1DZ0A 2YAFA 4HCIA 1PLAA 3S8FB 1L9RA 2DV6A 4G7RB 4YL4A 1E30A 2N0MA 4JHUA 2XVBA 4FA7B 1GR7A 4YVNA 1AACA 2AANA 4N8UA 3BVDB 1IUZA 5B1JC 1MZZA 1OCOB 3NJGA 4BK5C 1FA4A 1ASPA 2OV0A 3DTUB 3AW5A 4A2DA 4KOBA 3S3BB 2VW7A 1J9QA 2VMJA 1EHKB 1ETJA 5TK2A 3S3CB 3EHBB 4BWTA 2QT6A 2B3IA 3T6XA 3QPKA 1TU2A 2GC7C 3X2QB 1E65A 1NWOA 2XYBA 4Q89A 4E9YA 3OM3B 4GY4A 4P5RA 5I5MA 3FU7A 4BWWA 4KNSA 1J5DA 2DYSB 2RACA 2UXVA 4GP8B 1PNCA 2J55A 4UAHA 1CC3A 1NIFA 2VSMB 1OCZB 2FT7A 3AG2B 4RH4A 4E9QA 5I6NA 1CUOA 1GS7A 3T6VA 1NTDA 4K9JA 4P5SA 4JKNA 1W8EA 1IBYA 1AZUA 1N70A 2WO2B 3S8GB 4YSEA 3D12B 4PAZA 3DKHA 2DWTA 5I5IA 4KOCA 1JZJA 1MG2C 2YAHA 2EINB 4A2FA 2IWEA 1AAJA 3T9WA 3FU7B 2BP8B 3KW7A 1YLBB 1L9OA 2GC4C 2J57A 1ZPUA 2PPCA 1OE3A 2VW4A 3JTBA 1WA2X 3EF4A 2GB2A 2J5WA 2XX1A 2GBAA 5I26A 1CYWA 3FPXA 5D4IA 1ILUA 2HRGA 3TBBA 3NJHA 3TBCA 3H56A 1SDDA 2HX7A 3SBQA 1F56A 3ASNB 1NIDA 2CAKA 3U25A 1SNRA 2PPFA 1V55B 1KYAA 2BZCA 4FAAB 5AZUA 1PF3A 1AG0A 4E9WA 3OD3A 1M56B 3BQVA 4YSDA 4DP7X 3AG1B 1PMYA 1NIEA 1FWXA 3FSWA 3AZUA 4HZ1A 6PAZA 3PCYA 1X9RA 1PZCA 4KO5A 3T6WA 2AZUA 1A4CA 1AZNA 3RYMA 1CYXA 3T6ZA 2OCCB 3WKQA 2VM3A 3MBWB 4DP8X 3IEAA 5AFAA 2BWDA 4EF3A 2BZ7A 2GHZA 2HZHA 3GYRA 4HHWA 2YAEA 1ADWA 4N4YB 4G7QB 1BXAA 4CSZA 3FT0A 1RKRA 1BXUA 1NDTA 3TU6A 2BP8A 3G5WA
chains in the Genus database with same CATH superfamily
4JPWL 5C86A 3RILA 3ULSB 5L2KD 3V0EA 3T8VA 4JBSA 2ITCB 4D2NA 3F7LA 4U1JA 5TE7H 5T1JA 3MNWA 4Z0XB 2CALA 2RALA 3HKFA 5IFJA 3FN0L 2ENPA 3LQZB 4P57A 3LD8C 2R9HD 1YEHL 3BD3A 1QPKA 3DO4A 1KGYE 4FCAA 3ZKXC 5I6MA 5DHXB 3P0YL 3CPUA 3DGGB 3TZVC 1AH1A 2X7LA 4M03A 2BIQA 3FTUA 5E8PB 3O2VH 1S5HB 5J6GA 5I1EL 1CFVL 4D7BA 1KPRB 4JRYD 1JZIA 2W94A 3GZPA 1QFUL 3D33A 3BWUF 5D2LE 5SX5K 5I0WA 3V5KB 1I3VA 4R8WH 2IALB 4QKXB 3VI3E 3DETD 1LO2H 3T0ED 2PO6C 3WG7B 4DKDC 4PWFA 4JKKA 4P2QA 2HPTA 2VAJA 5C09A 3UTSE 3VXUE 2CLVA 4OV6F 3RJDA 3B2VL 1ZSDA 3E1ZA 2CO4A 1TNMA 3Q2NA 2XVGA 4MCYB 4O9HL 2HTLD 3TBYB 2DQHH 4FYSA 4EN3D 1DSYA 3RVXD 3MVSA 1K4CB 5KANI 3GPSA 4QO1A 3TC9A 4TUJA 2LAAA 1K5WA 5AWNH 3ULUH 5JO5A 4JHWL 3QJTB 2YD8A 1A1OA 2CE6A 5I18H 3N06B 3WV0A 4QRRE 4H20H 4EPSA 2GSGA 1JHTA 3D2UD 4KRMB 1SXSA 2OL3H 2A9NH 1YPZE 1MHHA 2HX9A 1S3KL 3ARZA 2AEQH 4W6WB 2F53B 1T89A 2BJMH 2E9GA 2ZAIA 4YHKL 1W9XA 1XGUB 1XF1A 2R2HB 4OF6A 3VD3A 2Q3XA 3RNKB 5JPNC 4APXB 2ED8A 5ILTL 1B0IA 1SF3A 3P73A 3FN0H 3V0WL 2NY5L 3MOBH 4HPHA 2XWXA 1FNLA 1Y6KR 1JV5A 2EDXA 1KCSH 1RUQH 3DJ9A 3EZ8A 1U4FA 2ZKHL 3D3VE 5DU7A 5IMMA 4ETYA 3K0YA 4Y1AE 4U0RC 2CA4A 1MIEL 2AXFA 2JNZA 2VL4A 4N0UE 3Q8BA 3LKNA 5AB0A 5IHLB 1JGEA 3WKNA 2V5SA 2EH7L 4OT1H 2GK0A 3IBOA 1CFTB 5F7KC 3S36L 3G08A 1Z9PA 1MFDL 3QNYB 3U36A 2EE9A 1IB5A 2GJZA 4G8GB 4UQAA 4WUKH 4ZSOA 2XWCA 4HEPA 3KCPB 1Q9LA 4JFHD 4LU5L 2WKOA 4WDIB 3S35H 1FDLL 1BQLH 3BKCL 4JFFA 3ZKMC 3UAJD 4XNBA 3U4EB 3VCLB 3HG0A 3L1OH 4HT1H 3VSVA 2O5XH 4AC4A 3QZWG 4QRRA 4LCVA 1Z2KA 1NFIA 3P2TA 4UM9D 2D0GA 2E7CA 5JPMB 5I0XA 3IGFA 3MRLB 5DD3H 5B3SB 2HVKA 1U91B 3IJHB 5HPOA 4CN6A 1GHFH 1RY7B 2UXTA 3PABA 2JV6A 3OJMB 3ARBD 1S9WA 4PJBA 4IDJL 3LNIA 1TEGA 2LTQB 5AL8A 3F8UB 4KK5C 4Y19D 3QH3A 4LRIA 25C8H 1KCRH 3OKMA 2F53E 1K5NB 4IMKC 3QI9B 4NCDA 5CINH 4FQLL 1I4FA 4N2DA 1S9WB 2WSPA 2NYYC 4LLWA 5F6IC 1AE6H 5GGVY 3R4DA 4B7IA 1ADQH 1RFDL 2BXZA 1MRCL 1EBPA 4FYRA 4TXVB 4UUJB 3Q9QA 4X8JA 3IAGC 5FLVA 2MQ0A 5I8CB 3E38A 2GJ6D 4LP5A 5ALCH 3NJFA 3QXDA 2CBTA 3WIAA 4PD4K 3GJFB 5AB1A 3UTSB 3P9MA 2XFGB 3RBSA 5FUCC 3MMEB 3JWOL 3APNA 4RESB 3PPEA 4HBCH 4PREA 5KEZA 3M17B 4DUXA 3CPLB 2QKSA 2H8PA 2OMYB 1ML0A 3ARBB 2XTJD 3O3DA 4J7RA 4AENA 4B9FA 2YFNA 4X9HA 4HG4J 1YO4A 5E99H 5KW9H 1BZ7B 2E76C 1ICTA 1KNOB 1OAXL 3MCYA 3WJJA 2OR9L 4Z8FH 4KUCD 5LB1A 4MXWH 1F90L 3CZNA 4K4KA 5SWSD 2AZAA 3SDDC 1YEDB 4IBUA 4HK3J 3MGAA 2R27A 3BZDA 5MEQB 4DSYA 4GT7A 2OULB 4HH9B 1Y0LA 4M7ZB 4LCWA 3W2DH 1ILSA 1UKSA 4KDTC 4P2QD 5SWQB 2RD0A 1ZA6A 1XGUA 2R2HA 4B3EA 2D73A 1A6TB 1YYCA 3HG2A 4U33A 3MLWH 2EIMB 1TVHA 5F7WC 1AR2A 4M5TA 2X5PA 1NM4A 4GMTH 4ZXBB 1PX8A 2XA3A 4I3SH 4PB9L 1M2VB 3RWIA 1AHMA 1BJ1H 3OAWA 3EYQD 1YY9D 3WXVH 5F0JB 1Q94A 4IRSC 4K73A 4XCNB 5F0LB 2B1AL 2BSSB 2HT4D 1BVNP 2HPOA 2F18A 1WA1X 2OTWA 1PYWA 4MWFB 3J7HA 5GS2H 2CKNA 2J8HA 4R3SA 3F6LA 2GITA 4S11A 2VLRA 1M3JA 3NSFA 3ZN6A 4OD3L 5EBLB 5IBTH 2DLTA 4LRNL 1E3FA 4M7LH 4QHUA 1WZAA 2UUDH 4DERA 5IQNA 2PPAA 1K6QL 1WAEA 3CSFA 4P2YA 3ZKND 2R2BA 1N68A 4LEEA 5TPWH 1XSIA 3CVHH 2C4FT 4TLKA 3CFCH 3UZVB 1OE1A 4A6YL 5F9OL 2MTAA 2CO6B 5F7AA 1HKLL 3NJIA 4B97A 2F61A 1T3FA 5EV7A 2AJ3B 4YLBA 4Q4IA 5EU7E 4K23L 3QYNA 5EOTA 3NEEA 3IFNL 3HVDA 1X5HA 1KENL 2VN4A 4NBYB 5BRQA 1HHHA 2WIMA 3LKPB 2J6EH 3V9CA 5L7XH 1ZVNA 2ZYRA 5LCVL 1KJVA 2MJWA 5F3BA 3QQ4B 4Q52A 5IJVB 5JHAA 4D9QE 4UT9H 1MEXH 4YXKL 3FT3A 3IU3B 3ZMNA 5GGRA 2ZT9C 3MNWB 5C0RH 3DOIA 4IEFB 2W38A 2P5WD 5K9JL 4PRHE 4JN2B 4JDTL 4R4BB 3F7VB 5DI8A 3DRTA 3K1KC 2VXTH 7FABH 2AI0H 1OTSC 1AGBA 2FX8L 1RQ5A 2M8XA 3W5MA 3QG6B 1UD3A 1T66D 1CTNA 2ICES 1OLZA 3GS4A 3PL6A 1WFIA 2XTJC 3HC3H 1AGDA 2Z92B 4GAYB 3POCA 5BOJA 4KDVA 4FC3E 2DLFH 1YEHH 4QOKA 1EEYA 1RK0A 5IB5A 1KENH 2DH3A 2HWZH 3T0XA 3CZFB 3KJ4C 2J6EL 3LZQA 4XXWA 4P2AA 4E9XA 5F2FA 3BUIA 5FB8A 3VFOB 3CU1A 1S7TA 2W9EH 1NJ9A 2NNFA 1ROCA 3AREB 5KYYA 1MW0A 3O4LD 4HS8L 5EU6A 1R3IH 3ALXA 2MOGA 1S6NA 3QG7L 4YNYA 3EJZD 4BXSV 2VXQA 4HZLA 4PWEA 3GJEB 4JGUA 1XX9C 5DQDL 3TPUA 1XFPA 2H3NB 2I9TB 3R1GH 4P99A 3FO9B 2D7TL 4HUNB 2AXJA 2BOLA 3JV4A 3HLAA 4M3KB 1QACA 5E9DB 4K8RD 5CJOL 3Q6FA 4FG0A 2ICEB 5BRPA 2HJFB 3SPIA 2FL5A 5CJXA 3OKEA 2I60L 4IM8A 2E7LC 3V4UH 2WY3B 5LBSH 1C5BH 2R0LH 2FD6H 4RMUA 4V2BA 3RGBA 2FJFA 1KCUL 4NX0A 2XG4A 1AKJB 4XVJL 1MCNA 2ID5A 2EXWD 3H9HA 3KPRE 1NMCC 2EVGA 3UG4A 1GIGL 3TYFA 3EYFB 4GKNA 4LOUD 4U1IA 5DURD 3X2QB 3LKRA 3BUDA 5D6CB 3FU7A 4KJWD 3SGJA 4U05A 3V0WH 5ITFA 4R9HA 4BZ1L 4PRHB 3TJEH 1AVAA 1YNKH 2YXMA 1FGNL 1FV1A 4GP8B 5SWSE 3GXMA 4YHKH 4HUXA 3VSQA 5DD0H 1IM9D 5C0GA 1O9WA 3HAEH 3QCVL 5CUSL 1DJZA 4Z3GA 3EO9H 5GJTH 3KNBA 5IEKB 3SDCD 3NEOA 3TEXA 1DQDL 4U3SA 4BHUA 2F2HA 3Q1EA 2XC8A 1LE5B 3BYYA 4PJAF 4KC3B 2LW3A 4ONGH 3WIFB 2Y6SD 3L54A 5I5IA 4JGMA 3CNKA 5TH2B 2OSLA 2VLRD 3X3GL 1MHEA 4PRIE 1ZEAH 5IB3A 2V9TA 4PJHF 5D1QC 4AUUA 3KM1A 1DBKL 1QP1A 2AJSH 2HJFA 2PPCA 1KJ2B 1M2OA 2B59B 4P46D 5E94A 4BK4A 4HGWB 4U1LB 5CBEB 4NZUH 3GNML 3MRFB 5J4MA 1J0IA 2LTQC 3R7RA 1WEJL 2PPFA 3UJIL 4MNQE 4AYEC 3SSGA 1TFPA 5ETUB 4L3AA 1KJMA 4MAYD 2BOBA 1ZCRA 2YRBA 2F19L 1M56B 3CE1A 3DBSA 3LV3B 5HGHA 1V7NH 4I8DA 3V0DA 3ZKXB 1KBKA 3AGVA 1FJ1A 3KVDD 1FVDB 2AV7A 5C07A 3APDA 4HS3A 4NQCD 4TKWA 2FK9A 3FZUC 3CDGA 1AQMA 2GTWA 4L3EA 4W9JC 5ADOH 4ADGA 5EBWB 5IQMA 3S3SA 3BKYL 4LESA 2VDPB 4MA3A 1A3LL 1BX2B 4ZMOA 1R3HA 1E50A 3P30H 3OLEA 4E9VA 1X7QB 5BV7C 2GTZB 1JYVA 4BSWA 4JN2A 4JFWA 4R4BA 1CLYL 3MOQA 5T3XL 1OAZH 4XO5A 2LFGA 3IVKB 4MQSB 3WN5B 4Q0XL 2OMZB 1N26A 4NJAH 4AZ8B 4OZFB 2Z7ZA 1S2EA 3BZEB 1KPUB 4KNTA 4NKOB 3VYPA 4LLAA 3I2CH 4OCMC 3PWPB 4FQIL 5C7XH 4FQ2L 1TTGA 4HF5H 1SN2A 3GC3A 4PJHE 3P0YH 3TLRA 4ESKA 2YPLB 4KI1A 4CVWA 5I6LA 4JFFD 3UPCA 3CXHJ 1ZVHA 2V5MA 5DUML 1AHKA 2L4OA 3ALWA 5TFSL 3BRGC 2B4CL 3QQ3B 2DKSA 1YEGH 2X4TA 4K9EL 5KBLA 1HHKA 5HD8C 3NTCL 3QUXB 1P84J 2CKBA 2XPGB 3GD1C 5A40E 3HHMA 5C9KA 3ZLQC 3VRIB 3OZKA 4NP4H 2WLIB 4X4KA 2I7OA 1VSCA 1I9IH 5HY9A 1E28B 5J06A 2P43B 4JR9L 5LJYH 3OKOA 5A6MA 3AB0C 5CJXC 1F3JA 3U2JA 3VGEA 4HOMA 4RLDA 1AQ8A 5K69A 3BFOA 2Q7YB 4L9DA 4YHLH 5IHBA 1GMEA 2WNGA 3GSVB 5INDB 1FZOB 2VIRA 4X7FC 3OXRB 5D71H 1MCWM 1V3MA 5DR5H 1T20B 3VFUA 1N6QL 3GHEH 2C7FA 2XQYA 2EXYC 1N6UA 4EI5D 3H0TB 4G8EA 3EH3B 4PJEF 4WWKA 4J8QA 4Y4FC 2VDNB 4KXBA 4RA3A 1CQKA 1LLAA 3SDXE 3FRPA 2H0EA 7PCYA 1FL5A 1DBJH 4LK4A 4FFWC 1WZ1L 2DB8A 4PGJA 1E5UI 4X7TB 1EZSA 3SQBB 4UTBH 5JDJA 5EEWA 1UZ8A 3EH5B 4FXTA 3L48A 1IM9B 5CZXD 4DCQB 3QRGL 3UC2A 4HAGA 1TFHA 2O5NA 3L5IA 4IOFC 4UT9L 5KOMC 5A16A 1A4JA 2NT1A 4LPTA 4JCMA 4Y2NA 3SODB 3OKKB 2KKQA 2NY3C 2TRHA 4Z7OF 2QQLH 4P2RD 4PW9A 5I15H 2CLZA 1SLUA 1VHPA 3HOGA 2UX7A 4MHHG 1MCOL 5BS0B 1AP2A 3VFWB 2IDQA 5JXEC 3A5VA 3INOA 4PEEA 3TCTA 1UFUA 1Z5HA 3B9KC 3D3VB 1N0LA 1XQ4A 1ECZA 4HQQL 4J2XA 4NNYB 5A16B 1NGYB 3ZE1B 4ETQA 4LOFA 4R2GB 1IAOA 3H4FA 3WEXB 3T1WA 2Y06L 3WL9A 2UWEB 5I1HL 2WWOA 4LLVB 4AIXA 4EQ3A 5AWNL 1KXHA 3H3PL 2VITA 1I1FA 3CVIH 4XCCL 3WD5L 5JHDB 1QBLL 1P7QA 3KBPA 3HJ0A 3B2UD 4GKSB 4CMHB 4UT7L 4F33A 1ZS8B 1ED3A 4G8EB 4ELMA 4GSDH 4WO4C 1A1MA 5E99L 3AWGA 3BEWA 3O0RL 1D5MA 3GLZA 5DRXA 2QV4A 5KSBA 4N90E 1T0PB 4LPYA 4L8CB 4OJEH 3QRGH 4TUOA 3UTTD 1NL0H 4NLAA 1JNNL 4OM1H 1KYDA 4X6CA 1A8ZA 2R9HC 2X9WA 2JTDA 4ZBJA 3BIBX 2C9PA 4L8BB 1XF2B 4AMWA 4G8IA 2JKIS 4XWGH 1OD9A 3U30B 2V9UA 1Z0MA 2O6FA 2QQLL 3QZNA 5D1ZB 4GS7B 4DQOL 3UYPA 3HVNA 1XCWA 1AO7A 1HQRB 4AKPA 2FX9H 3KGSA 4X80L 2ICWA 1O7DC 3Q01A 4N1HB 3T5WA 2O5ZH 5HGDA 5IJDC 4PBWD 4H1LB 5FOJA 1E9OA 2CHNA 4BXVA 5EDSA 2NW3A 3OKDB 3FHEA 1JNJA 3OHMB 4NRYA 5AYQA 3CN4A 3LZLA 4F58H 3R06A 2WZPD 3FN9A 1NA8A 2P5WB 5EIIB 1UJ3C 3T0WA 4AIOA 3QNYA 1MWAB 3IFOB 4Z7NE 1HCFX 1ITCA 3VRLF 4NZFA 1Y0LB 1SHXA 2QADC 5KOVC 3WHXB 2IWKA 1U8LB 2XPZA 1KLFA 4JREB 3SKJL 3A6BL 4KBPA 3WUWB 2QPDB 3AU0A 2NPLX 4HUCA 1F90H 5DD1H 4KVNL 1XL6A 3NJLA 4PSPA 2YRPA 4YDKL 3S2CA 4B9GA 3W0WE 1ZE3H 4HCFA 2P7TB 2OYPA 5HVFB 1GGIH 5GHWL 1TLKA 1IKNC 4Q2ZA 4AENB 1JERA 3BSHA 5EMYA 1BSIA 3BESR 5F89A 3ZDYF 2QSTA 4ZOAA 1OAQH 1ET7A 2W07B 1DVFC 4F8PA 4J1UB 4GP4B 1FZKA 3CD4A 3MJ9L 4UM8B 1JPSL 2Y7QA 2MCAA 4CC1A 3DGDA 3GK8H 1KTRL 4WU5B 4E9TA 5C0CD 1MFMA 3V4PB 3OX8B 3VJ6B 3W5NA 3QFJE 1G6RB 1UOLA 4U6TA 3M1OA 1NC4A 4M8QA 1DQTA 3SPJA 2R56H 1GGBL 3RU8L 2W9LA 2A6IA 3ECBB 5B38B 4XPGH 1HQRA 5AOZA 2FX9L 4X80H 5H37H 2JKXA 5JR1H 2ZD0A 5HYIA 3MA9L 1VRSA 2VERA 2P1YA 2FHFA 3UC0H 2H9GB 1Q9OB 4ONFH 3U6XS 3I75A 4MA1B 4G83A 3VTMA 2OPCA 3OKMB 1HESA 3CZJA 5T5FA 3RUGF 3VB9A 1PZ5B 2V4LA 3CHSA 3DHMA 3LOWA 3NPSB 5EC1B 1DQQA 2Q20A 2UZXB 1WZMA 2F54B 1UENA 3EAKA 4NQDA 5DMIL 1CI3M 4TN9A 1U8PB 2DZEA 5CD3B 1ED3B 3DYOA 2D9CA 2EH7H 2J8UA 2HKAA 2J1KA 2VQ4A 4JKPH 3SGDH 2J6EA 1BQKA 4DGYL 5IV2B 1FORH 2XWJB 1MAML 5BMFH 4LO9A 1L5GA 3B9KA 4EN2A 2X4UA 4LSRL 5E2TL 4AQ1A 5D7JB 3DI2B 3THMH 3BYTA 3G5ZB 3WJMB 4IGBA 4RDQF 4HJEA 5IY5B 4LMQI 2OZ4H 4X9FA 1SJXA 1WRFA 1EEQA 1M3IA 1EX0A 1IC1A 1UHVA 1E9QA 4CW1B 1CR9H 1KLUA 2KYIA 1JGEB 1ND0A 4MAYC 3IJ9A 1XVSA 4W9FC 3H4HA 4ADJA 5K93A 1X5AA 3MRJA 3HC2A 5CLTA 2WQAA 1SQMA 3II3A 1CDCA 2BSEA 2W81C 4WTQA 2ZOKB 4JREC 4X9GA 3GQFA 4WQOA 2EDEA 1I8IA 3UTTA 5DVOA 4XNZB 5DRWA 1MVYA 4YR6B 4XP9H 2E7MA 2QSCL 1WISA 4PGBA 4Y2LA 4F5CA 3M46A 4IBSA 2VUOA 5E56A 4OZIB 4O2FB 4HS8H 1KGWA 4FI8A 3SE8L 2F8VA 3AC0A 4PJDF 4LSUL 1DFBL 1IGYA 1RL1A 1DZ0A 4YDZA 3RGVC 5K59F 5CP3A 5JO5B 3MXVH 3BRDA 2WGNB 4K3JL 4Y5YA 1KXQE 4M6OL 4QTIH 1S9VB 5DZOA 1CPUA 4ZFFA 4HZLB 5I8KL 2EYRA 2YXFA 4NOBA 1TJMA 2WB7A 5FX3A 1E4JA 4AGPA 1C1EL 5ESQA 3MLXH 1WLHA 2Z7WA 3RI5F 2OJZL 3LXCA 1QZ1A 3U30C 5HVGB 1KIQB 4DGUA 2JJWA 4IKLA 2YD7A 3VFTB 4JPVH 3ARDD 2VQUA 2PWGA 3SDXB 4BE6A 2P5EE 1EEYB 2ZE0A 4BWTA 4JO8A 1CDGA 3AROA 4FL4C 4I0PD 1YNTF 1OCWH 3E6HB 5IEHB 3FOMB 5DD6B 4HJIA 3UYRH 1R0AH 1JN6B 1BM3H 4PJBF 1OPOA 2GC7C 1H5BC 1EHXA 4D9LL 1DUYA 2PW2B 5GQBA 1JWMB 1H6FA 2YBRB 3C87A 2RACA 4UTBA 3S9DB 2NXZD 4XBPB 4Q74A 3RRQA 4PBXA 3NCXA 4OCYH 3ILDA 1R3LA 2Z6FA 5E6ZA 5JIPA 4QF1B 3L9BA 5C0CA 1G7MA 3K0WA 4DESA 1TU2B 3MXVL 5C0CB 43C9A 2C7UA 3BXNA 4UZSA 3B9KB 1RZIB 3EOBB 4LARH 4IRSD 1DQVA 4WCYL 5C08E 3AADB 1F5WA 1UM4H 3UCRA 2V37A 4A55A 2IF7A 2YS4A 3KPTA 3P54A 4Y9BA 3PJLA 1F1AA 1BFOA 5GIRB 1MW3A 2WN2A 3ENEA 3E8UH 3P11L 4L9LB 2CJSA 5GRUH 1ZPUA 4M62H 1V3LA 5KS9B 3OAYK 4ANXA 1BMGA 3GMNA 2DWEB 5DYOB 4YX2H 4QHLA 3CDGB 5ALCL 3M88A 5GRVK 1NMAL 2CBQA 1AQKL 2K4WA 4HW6A 2AV7B 1AD0A 2HRGA 4WHTA 2BWQA 1EBAA 2PR4H 3I75B 4KUCF 3CWGA 1PD6A 4Q6IB 5JW5B 3FQ4A 3BVNA 2DDQL 1IKFH 3BCFA 4QHUB 5F9JA 4BJLA 1MAJA 4GPVA 3TCLB 2NUPA 4XXDA 1JI1A 2GJRA 4L18A 4JFQA 4KZ0A 3MCKA 3QRBA 2YD2A 4FERA 4X5RA 4Y4KD 2HFEA 3AZUA 3JT0A 5GSVB 1QR1B 2EC8A 1UQSA 4QXUH 4MX7B 1U8MA 1SGKA 1BVKB 2FBRA 3B9KD 1HKLH 3OPZH 4M5YL 2WTPA 3H3KA 3F2LA 2NY6B 4HGWA 4DETA 5HDWA 3VVVA 4L48A 4TQEL 3MBED 1JG9A 2AAVA 1A6UH 2UUDK 1UB5A 3ECUA 3K71B 2KBGA 3F12A 5JDSA 1P6AB 2VR8A 4K3DL 4HCGA 3S3PA 3D0VA 5JTWA 1GPOL 1ZEAL 3BAYA 2DTML 1FDLH 4AITA 2AMUA 1OAZL 3LSOA 1ZLVH 3MNDA 2XQBH 4ORGA 5E7FA 2WWKO 4TV3A 4HUKB 1GJWA 2BOCA 1SDAB 3EHBD 5KJ7E 3A67H 4POYA 2IADA 3BFQG 1KXTB 5HDRA 4X9IA 5LNGA 3N9GH 4QKTA 3QEGL 4TSBH 3PGCB 4XPFH 4F7MA 5ISZA 3LPPA 1WGVA 4MDRA 3VFGL 5BJTB 4F7EA 2GSMB 1D6EA 3VXTB 5BZXA 1D5ZA 3CIQA 1U8CA 3CLWA 4BYHA 3L5JA 3GRWA 3WJJC 4L8SA 4HGMA 1C5CL 3ZY7A 4DN4H 4TNVK 1JZFA 3NJXA 1S7UA 1Q1JL 1XMEB 3FFOA 4FQQB 2FJFB 1E5BA 3QUMB 2WZAA 1WQVT 4AGMA 1A9BB 4ENED 5E4EC 2XV3A 1KUMA 4L5FH 3CFKA 3NZUA 4TVPD 2IBGA 4WHYG 3U1SH 3TH3T 1U92A 5CO1A 2B2XL 3BGAA 1OAQL 1CDUA 1RIVL 3FQWB 2FIKB 2NLJA 3GGWB 5BVJB 3QULB 2FUTA 2IPTL 2P5EB 3JWNH 1E2VA 1UFGA 3B2PA 3LNGA 2EDTA 4MQTB 3DTXB 1NDMA 1XSKA 4FQJH 2DLIA 2PCYA 5CCKH 3TF4A 1FBIL 1C8PA 3B8YA 3VU1A 1Y6MR 4WKZB 2CXKA 2F0CA 5DZVA 3WTSA 4FTVD 4NERA 4XX1G 4I0PA 1S7WB 3SGDI 2DQFA 3C60B 1D5RA 3KPMB 4BZ2H 2DJUA 1P5VB 2HLEB 2R23A 2WBJC 4CC4C 4Y16C 3TYGH 1NPJA 4PBDA 3GBML 3I6KA 3B9EA 4F1ZA 2ZG3A 2IBZY 3DX2A 1P4IH 4MMYB 1P7QB 4B9KC 4NUJB 1MCWW 1G7JA 4XB8A 1I85A 4LDOB 1KCWA 2FD6L 4R7NB 4YGVA 2WB1A 4AVIA 2JJVA 3E3QE 4HA1A 1ZTMA 1FYTA 3BMWA 4A6YB 4HWEH 5HGAB 4OLWH 1BW8A 4X8GA 3W9DA 3FH8A 4FG4A 3ERXA 3SBPA 1SN0A 1RZQA 3RVTC 1HE7A 3LZFH 4XN9A 5DJYA 3FBQA 4LAJH 5DJXA 1VCBC 3RTQB 4KQ3L 3AY4C 3D5OF 4JFUA 1MCHA 2WLLA 1D5BA 1C8QA 4YN3A 3HRZC 5IMLA 2P45B 1KB5B 4FQPA 3TA3B 2ZZUT 4OFQA 3AS2A 2IDUA 3LKSB 1DVFD 1P4BH 1FZMB 2UYLA 3AACA 3LDBB 3NFPA 4NZTH 2WIIA 5DEFB 5HGBB 5T5FL 3T3PE 3T0BA 4EUPB 4HV8B 1T1XB 3HFML 4OCXL 2WTRA 4X7DC 4YBLB 4J3BA 4R26H 3KPOA 3LVTA 3ES6B 3SKNB 1MWAA 1TKWA 4XMKL 1L6XA 3BUPA 4FZEH 1P7HL 3BSZA 3GBDA 1O6SA 3GMLA 3O6FD 3QDMB 2KL6A 3DHUA 4R4FL 1SYVA 4DGVH 1V7ML 2E7DA 1Y18A 3B7SA 3Q48A 3UBHA 3NCBB 1OP3K 2YUVA 4MNQD 3BQUC 3JV5A 4WU7A 3DIFB 3ZHNA 2ZSVB 4JFEB 4GKOA 3RFZA 4QRTA 3J8F7 4R8WL 3HE7A 1LO2L 3CLEH 2QDVA 5J1SC 4YAQA 1I9EA 4JFEA 3RFZB 5FCUH 4ALAC 3V7AG 2Y5TA 4C4UA 3ATBA 3OAUH 2Y07L 2NY5H 4G7SB 1Y18B 3US1A 1FFPB 4APQC 3QDMA 2ICEC 4TNFA 3O2VL 3SY0B 4YXKH 2EKSB 1GJIA 2X1WL 4NKQB 4YAQB 4K5LA 4FG2A 3PV6A 4WW2F 4CGUB 3WAJA 1DCLA 4LCWE 4EI6B 5K9QG 1F4HA 3QUMH 1AQDA 2LOEA 4YFDB 4KXDA 3T4YA 3MACH 3HG1D 5CJ8A 4R97C 4PJCF 4MJIE 3UPRA 2XTLA 4QRPE 3NP4A 5B1AB 5B1JA 4Q0XH 4MZRA 3MV7D 5JHDA 4XRCA 3EDJA 1FG2A 4MFHA 2FYYB 4ODSL 4MA7H 4RGMB 3BHBA 1WT5C 2G5BB 3IKCA 2VDQH 3LEVH 2Y3AA 2B5IC 3F6JA 2MRYA 4FQCL 5I6KA 5D4HA 3HZYB 3U0TA 2FBJH 4HV8A 1B4JH 2Y23A 1QR4A 4KZCA 4R4FH 5E00B 3ULUL 3NIDB 1B0GA 2BVPB 2VLJA 4OIAA 1HC1A 1DE4B 4X5XA 4XN1A 5DLMH 5EZIH 3T3MB 2E27H 2AABL 1MFBL 5I1LB 3RFRA 4DFIA 4GLRH 3LNDA 1BG9A 1HH6B 4PJGA 5I6XC 1D7FA 5G2NA 1S7VB 3TO2B 2ZAGA 4D0BB 3QFDA 1L9SA 5I8OH 3NJKA 1JPTL 4D9LH 3RIFK 3FQTA 2MCPL 3Q1SH 3KPPB 2VKXA 1QBBA 1EJFA 4YHYB 5DJ6B 4MD4B 3IMBA 1EIBA 4QRUB 3SPCA 4RZCB 2CR3A 4CADB 3KS0J 3CDFA 1GS6X 3QUXD 1GGYA 1IM3A 3IETB 1IM9A 4LCCA 5CHNB 3I9GL 5F7FA 1CXKA 2ZXDA 4P2RE 5HGAA 3SYPA 12E8L 1SUHA 2XA8L 1JK9A 3QUML 4RX4A 4G59C 3TJHD 4ENZA 1D5XA 4X8JB 1A1NA 3KEDA 1NSNH 3BVXA 4FCHA 3WTUA 4JRWA 2EKJA 2R0LL 4HJUA 4UDUA 4PY7B 1KGCD 1OAXH 4F7TB 2M1KA 5IIEB 2ORBL 2YGVA 4N68A 3FPYA 1SDDB 4P4RB 2VAAA 1B9KA 1JUFB 3OXRA 4PIBA 4XC3L 1GOFA 2YD5A 4QLRA 2E8ZA 4ZFGH 1INDL 2FECI 7FABL 5B4MD 1JTTA 1E4XI 2V8MA 1N7ML 1NCWL 4L37A 3CVHB 1BMWA 3WIIL 3VWKA 1YEFL 1OWRM 5FM8A 1ZGLB 5IW6A 4FGMA 1HIMH 2B15A 1KCVH 2V7HB 4PJ5A 1BWWA 3EO1A 3ZRFC 5I1DA 4DGYH 5DSCB 2NTFB 4K9EC 3L81A 4G5AA 4HUMB 1IEHA 1JYWA 35C8L 5EUKB 5IBUG 4BQ6A 1HXMB 5AB9A 4IRZL 1C16B 4BCYA 4WRLA 4OQTH 4PTUA 2E56A 4N85A 2GJZB 4G8GA 3BIAX 5GISL 3F7RA 3X13B 5SX5H 2EQDA 1PLGH 4LKXA 2UWEE 4UV7L 1ZWIA 1EZUA 5JYLA 3VD4A 2H1PH 5C0DA 1AXTH 2EC9T 2VDKH 1U8IB 1INEH 1QSVA 3P4MA 3LKNB 2O1AA 4FQHA 2PO6A 5CD5D 4H25B 5D5MA 2XKUA 1H15A 3F58H 5DC0A 5AW8B 2UX6A 4YC2C 5B8CC 5IMMB 4FABL 4QEGA 4DKEL 1JZDC 1VZIA 5DZAA 1OO2A 4ELMF 3TEZA 2R0WL 4AJYV 2R7EB 1XH3B 1F97A 2G60L 1HXYB 4JFED 2YQ3A 5C0NC 5FA4B 4ALAL 2F68X 4D0DA 1YUHB 1AHWA 1X44A 2NNRA 2H3XC 2J5LB 1PSKH 1JV2A 4I0PC 4JJHA 1E8YA 4P9HC 1M71A 4RGNC 4I4WB 1EEZB 1KCKA 3F83A 1G6VK 3QNZA 2EIZB 1GC1H 1KB9K 4LL1A 3TJHC 1TJGL 1FFOA 2DWXA 2JWYA 3VFSB 5I73B 3O8XA 5I1KH 4RBPH 1PZDA 5FA3A 1CLOL 2B14A 4CGTA 5I0VA 3DPBA 3I9IA 1BYNA 4KKAC 4Y1AB 1FBIH 4YL4A 5KSBE 1E30A 4OLVL 3LN9A 4NCC1 3QCUL 3MBEB 4ZQTA 1IV8A 3OPUA 2AXWA 1KYUA 5EPMB 2R29L 5FECB 1IQWL 4H8WC 5DRZB 1UEMA 3ARVA 1KXQA 1BFOB 2MHAB 3UMTA 4A2DA 2XN9A 4WEBH 5T3ZE 3UX9B 3CZFA 2YJLA 5GGVH 1MREL 5E1HB 4RFEB 2YJQA 2BM3A 1MJ8L 3N3EA 4JDTH 2QQNH 4QHLB 2WXLA 4U1GB 5LLIC 3KYAA 4AEIH 2Q2LA 1P7QD 3BXNB 4V33A 1I8MA 2DL9A 1U9KA 3AQYA 3CFUA 4FE9A 4W70A 4LNVA 4C83B 5HHXH 2CO1A 1AR1C 2X2IA 5I0ZA 1HWWA 5LN4A 1TDQA 2V3DA 2PF6A 5CP7A 2YC1B 1PZ3A 2OTPA 4LPCA 3EH1A 4UAHA 2CSPA 3LCYA 2VSMB 4RH4A 2BHUA 4JFYB 3BH8A 3RY5A 1N10A 1GOHA 1G7MB 2FECL 4BQCA 1KC5H 4QF1A 3ILQC 5CGTA 2WXMA 3PWUA 4HETA 4F9PC 4LDLB 3QCUH 2RTTA 4E2OA 3F7YA 3QPQD 3FT2A 1NMBL 5K9KA 3AS1A 3LS5L 4GAGL 1B4RA 2GK2A 3MO1A 4NUGH 3VRLE 2ALWA 5J6HB 5TE6L 2Q6WA 5I74B 1A47A 3BJ91 4N9GA 2CMRH 1KPVB 1ZMYA 2B0SH 3L3IA 4YUEH 4ABWA 3OKNB 3NJHA 3KEHA 1NLBH 3PFQA 4OJFL 4HIEB 2PWEA 3H56A 4ABUA 1A7OH 4DGIH 3SBQA 5DT1H 3QORB 3C5ZB 1IGYB 5JPNB 2FX8H 2NZ9C 2A9AA 5CMAA 1BM3L 1MXGA 2KDYA 1K8IA 3VFSA 1Z9LA 3UAJA 1QW9A 1B0WA 2YD1A 1MCBA 4R97B 4TL5A 3BEVA 5ESQB 5GRXG 2EIZA 1Q90A 2ZOUA 4BZYA 3BQVA 4UQCA 1K8IB 1CT8B 1LO5A 1GC1C 4MD0B 4EN3A 5E0QA 3REVA 1PMYA 1D2PA 4PGBB 1AHWB 4GH7B 4XWOC 5FLUA 1I8AA 3B56A 2NOYA 2ITDB 1KTJA 4K94L 3KVPA 3VFPA 5B3JE 1I8IB 2O61A 1T83A 1TVDA 5ACLA 4ZTOH 3KLAA 1EO8H 5CF3A 5A6LA 4R2GC 4HFWA 4ONHA 2ZOKA 4N9GB 4O2FA 1LD9A 3IMWA 3VGAC 1ADWA 4NM8H 4ZPTA 2EZ0D 1WG3A 3K6SB 5F7NC 1FCCA 3LS5H 3DIDA 2OL3A 4GO6B 1SVBA 4RVBA 2YXVA 3F7YB 3KYOA 2X3CA 4QRAA 4Y88A 5MEQA 4X83A 1CICC 1A6VH 4OF3A 5TE7L 3DHJA 4B9IA 4E9RA 4WY7L 5FKAB 2G9HA 1OP9A 3MGTB 3LIZL 3ZTNL 1JL8A 3NIGE 2GFBA 1ASOA 1ACXA 2MQCA 1VZGA 2Z4TA 1AGBB 1OP5H 5FDYA 4YSSA 4XP9L 4PCSA 5E6IA 4EDWL 3NZ8A 3O3DB 2JJSC 3MLPA 4ZZKA 1UZ6F 2VR6A 4P9HL 2CHXA 4YBQD 3L5XL 1TLMA 5AW9B 2DYRB 3L3OB 3O11B 3RWFB 4Z6AT 5A2FA 3M8OL 3O6FB 4KO6A 1RUMH 1RAMA 3WJMA 3MV9E 4X4XB 1YYLL 1C5CH 1OE2A 3FRUA 5DFVD 1II4E 4JPKL 5FYKD 4DN4L 4GAAA 2YPVH 2LFEA 3H7BA 1KIPB 4J28A 1GSKA 4W6YB 3H6AA 1T5KA 4XAWL 1RU9L 4LT7A 1WAAA 3HRZB 1N19A 1DQQB 4FQLH 5BPPA 4NC2B 5KJRH 3VFNB 4A68A 4RAUA 3OGCB 1VFAB 2J72A 4PLJC 1G6RL 2VM4A 3LXUX 1RFDH 1XB3A 5AAWC 1GYAA 4KMTL 2DIAA 3WFHB 3VTTA 1AD9B 2EDDA 4R5TA 2F08A 1NH6A 1PD0A 4NQDB 2HJLB 3EYSL 2IMNA 1R34A 3HZMB 3HCVA 4S0SD 4WJ5B 2Y5QA 1CD1A 1MQKL 4AYBA 4UM9B 1VKXB 5J8OA 5DWUL 2G30A 2EIKB 2C1OB 5IG7B 4XVTL 1KXVC 2VABB 4L2LA 4GW5A 3ZOAA 5FO7A 5MHSE 4BKSC 5HTSA 2XWTB 3RDJA 2APXA 5LAPA 3LMJL 1MXDA 3MRKB 4HUUB 4ZFOB 1HINH 4YEEA 1TZOA 1BECA 2NXZC 3K6DA 2COQA 3QDAA 4JQVC 4PRIA 1NBQA 4DK5A 5F9WB 3IBEA 2AKRB 4QPEA 3EXJA 4BFIA 3O2DL 2X4QB 5E8DL 1Q9KA 3N44F 2APWA 3OLIA 2R1YB 2FO1A 2BRRH 4M1DL 1NICA 3ZE0F 4B5EA 4PJGE 5B8CA 1B3IA 3SCMB 1A6TA 3PL6C 4Z7WA 3G6DH 4FXKA 4D8PA 2EIJB 2ZX6A 3DV4B 4PFEA 4Q9CA 5C8JB 4MNHB 4TOYH 1FF5A 3N1QC 3QCTH 3GSUA 4PG2A 3OV6A 3KBHE 3KR3L 4JPKH 1KCLA 4JY4A 2XBDA 1JXGA 4N0FB 5E4EB 3VMOA 3ARGC 5ADPL 3VXRD 4MNHA 1SUJA 5FGRA 3Q8FA 4NQCB 4Z7QB 1AXTL 1Q38A 2CDFA 4JMNA 2VN5A 4FXKB 4UOW1 5B1KA 4OFPA 2EC9U 2QVIA 1MVUB 3HBPA 2WGXA 3QZPA 4HPOL 3S5LA 1ZHNA 5I16A 5J0BA 5KBNC 4NO0B 1HEZA 4DZBA 1UVQB 1GS8A 4IGBD 5G5DB 3KJ6H 4NT6B 5F1SA 1WFJA 3B3BA 1LDPL 1ZOXA 2FCBA 2O72A 3N85H 1AR1B 3MRKA 4WVRA 1KIUB 4HYTB 3HR6A 1EXHA 3FHQA 1EMTL 5DLML 5FM5O 5D6DC 2JCCB 2QL1A 5ELIA 3HG1E 1BIIA 2CLRB 3DXAA 2BO0A 3EW3B 4I87A 3C2AH 3DUSA 2IQ9H 5C08D 8PAZA 1SJHB 2PW1B 3VXSD 2YAMA 2OXGB 5CILH 1BXXA 2Z8WC 3B2MA 4OAWB 2DIEA 2X05A 2OK0L 1XIWA 4F7CB 3HPLB 4U3XA 4QJ3B 3W37A 3BPCA 5D7LD 2ITFA 3O3BA 5DVNA 3MQIA 2CBMA 2UXFA 4LHUA 4LIQL 4BGDA 1NIAA 3AU1B 2H5UA 3G6JA 4KNUA 2FQDA 1TKWB 1A7RH 2PUQT 3QHTC 4G9DB 1ADQL 5C0RL 3QXTA 5DLLA 3EG9B 4UT6A 2XXMB 3Q43A 3NFPB 3LKOB 1ZS8A 4H1LG 3WHE1 4LVHC 2QKIB 3BOVA 1G9MH 2IV8A 2N56A 3DMMC 3QO0B 1ACZA 4PTTA 1NWPA 2BCKB 4QRQA 4F15B 2DTMH 1J8HA 2FO4A 2P8MA 4UIKH 4D9QD 3D2UB 4L23A 4XN7A 5EIIG 2J3SA 5DS2A 1V27A 2C9UA 1IGML 3NYKA 4X7SH 2X2HA 2DY2A 4KHTL 3F3HA 3WL9B 3ARDA 1H6UA 2X10A 5IFAL 3N40F 1ZGLP 4WFGE 3RZCA 3Q8CA 1PPIA 4I48A 4Z1PA 3IXAA 3DDFA 4S0TD 2ITCA 2W0PA 3KH3A 3W9DB 3MKGA 4GUOA 3HZYA 3LNHA 4XB7A 2J8UF 1E6OL 4OIBA 3NAAL 3ULVL 4NKMB 1GA2A 2ZOTA 3P3UA 1JZGA 4P4KD 4HQQH 2QVFB 1D9KB 3QA3B 5JUEL 4A63A 3GWJA 5TQ2H 3WNJA 1R46A 4KK6D 2DMGA 3WMSA 4M43L 1RULL 2D9QB 4XMWA 3VFUB 4LIQE 3KE0A 3WXVL 1SY6L 3ZVVA 4EI6A 3K8LA 5AVYB 4X5LA 1JWUA 1ZVSB 4WWID 3T04D 1T5XB 2KPWA 3D3VD 3R18A 4HXAL 4BZ1A 4AGNA 3T2NL 1ID5I 3DTXA 3SY0A 1OV8A 4OLZH 4PJIB 1TTBA 2D3JA 3QULA 5B38G 3G9AB 4GLRI 1WA0X 3T3MF 3O4OC 4YSTA 1E4KC 2H7WA 2B7DT 3ARTA 4NUGL 2NX5A 2P8PA 3RWDB 4E5XG 2VIRB 1JNNH 1K4CA 2WC7A 1IT9L 5CD5C 4BSVA 4YWGH 4BQBA 2Y7SA 3K2KA 4GIPD 4NQVB 5HHNA 3O3AB 1QSFA 2YMXL 1EZLA 4V1DE 3MRRB 4MAUH 4DP5X 1YJDC 1SYVB 2EUXA 3OKOB 1J5CA 1SZNA 4HSQA 5C0AB 4LPUA 4NM8L 3U2SA 1BQHB 1RZ7L 1D6EB 2CGRH 2IALA 4FRWA 4OCWH 4FLQA 4WTWA 1MCSA 2VLLB 3K6IA 1AFVH 3NESA 4KRPB 3REWB 3DO7B 2XZQL 1E4HA 2VDLL 1NINA 1ZANH 5JW4N 1XGPA 1DVSA 2CGYA 2WIIB 5DEFA 1J8SA 5T5FH 4OJDH 5FGSA 3HFMH 1MVUA 3BZEA 2AI0L 1KTLB 5DJCB 2RCSH 2AQPA 4PLJD 1OHQA 4PLKC 2DYPB 1WTLA 3K4ZA 2K6WA 3T71A 4YHYC 5GS3A 1KSRA 1ES0A 4TVPH 4ZS7L 2BH0A 3LZRA 3ARPA 4I88A 3MUGB 1HJCA 4AT6B 1AS7A 1CF1A 3IAPA 4GO8A 3T09A 5F7LB 1GYUA 1E27A 4GAJH 3U0WH 2IH9A 2QQNL 3ZTEA 3IGLA 1FO0A 2BNQB 4G9FA 5F7EH 3T2NH 4U1JB 4JRXD 1SBBA 2R4RL 1F0LA 3QXAB 4MAYB 2NSMA 1S9XB 4N87A 1R3JB 4IDJH 2A99A 3ESOA 1LP9F 1A14L 2MHAA 4S0HA 4OTXL 5T3ZD 5TF1L 2EXWC 2WYHA 4FQXA 3MZTA 1FYTD 4PRNB 1P4IL 4FFTA 4PN6A 4PS4H 5EBWA 3LHPL 2W0FB 3KPRA 1AQHA 3TH2T 3V5DB 3TN0D 4RISL 3DBXA 1XH1A 5DFTA 3EFFB 5IR1A 4LOEA 3BO8A 2IJ0C 2ZCZA 3SKOA 4ZD3H 3SHSA 3V0IA 3QQNA 5IJKA 1CD1B 1PVHA 3UIYA 1VKXA 1Z3GH 5CGBA 5DWUH 1IAIH 2JKTM 1A7BA 5JR1L 4FA7B 2WBXA 1QVOA 1FNFA 3L7EA 1T0NB 3NA4A 4BELD 1QQDA 5F3HB 4TNEA 3T0EC 3IMRA 3MACL 1BVNT 1L7IL 2ADGB 3UIZA 3C6SB 1HXYA 1J05A 3IYLW 3S5YA 1A2YB 3O41A 1X4ZA 3EJYD 1EHKB 2X09A 4AEHL 2I32A 4HU8A 1G9NL 2OCFD 2RBLA 1KJ2A 4HMEA 1HWGB 1MH5B 1VGKB 1YEJL 4HSAC 4WI7A 2WBJA 3FO1A 4HIHA 4P3WA 4OZFH 3RWJA 4OCSH 1LQSR 5L0QC 3L3KA 5IB4B 1PEZA 3BAKA 1J5DA 2ARJB 4K3EH 3WLWD 5AD0B 1ZWIB 3JZYA 1RP8A 4OM1L 3L95B 4Y16D 5CZKA 4WI2A 4Z95H 3WFCH 5JW4Q 5I19H 2F54E 4AV5A 4P4KB 1GS7A 4FJYA 4TTDC 2OS7A 1T1WA 2FB4H 1MPAL 2W0KA 4JRYE 1CZ8L 4I2XA 3TT3H 3ORJA 2OMUB 4NFBA 1W8EA 2WO2B 5EZPA 4PVMA 2ARJA 4OV5B 1JZJA 4LSTL 1MHCA 3T9WA 1H3WM 2VXSL 2YGPA 3RWJB 3RTQC 4K3JH 5IT2L 3K6SA 4KQ0A 3KPLA 1L9OA 1UZ6E 2J57A 5HJGA 1HSBA 3Q05A 4MMXC 1ITBB 2D31B 4NNXB 4DF9A 2J73A 4ZFGL 1MNUL 4XTRD 3N50A 3K80A 3MLVH 5C0BA 2EEXA 2RIKA 3L2MA 1NKRA 3L2NA 3MV8B 4XP4H 1XF4B 2WD0A 3QUYC 2EDOA 3TBCA 2H32A 2NX5B 1KCSL 1F56A 2ZP0T 4GRMA 1CXEA 2CAKA 5CZVL 2JJTC 2ZXAA 3VXRE 1TQBC 2ZPKL 5L2KE 2BNRB 2BZCA 4UDUB 4K7PL 5SX4I 5AZUA 1AG0A 4PLOB 1AGCB 4R7LA 2O6DA 3VXUA 5I1JL 5SWZE 4JB9H 2CDEA 4X6DE 1MCLA 3IGUA 2R69A 3N1FC 1U42A 2WUCH 1PD1A 1YQVL 4F5CE 3VH8B 3OZLA 2AZUA 4MDIB 3E0GA 3KYNB 2H0PA 3HS8A 3FO0H 5KZCD 5KYYB 3MN8A 2C9XA 2HT4C 2AK1L 4PLNC 1KCVL 4H8HA 3ME0B 2MCPH 4ZOBA 2X4NB 1CGVA 2Q8AL 3KPPA 1R4XA 5K9KB 3FB6B 3ZE2B 1J11A 2VXQL 4LU5H 2EXTA 5IVXF 4B53A 5A2CA 2YAPA 4XP4L 5ICXB 4NN6B 2ZOOA 1JGLL 1N8OE 3CFEB 1T5WB 1DVYA 4W9DC 2I25N 5TE6H 4HUVA 4F58L 43C9B 5IFAH 1CVRA 1DJSA 5GGRB 2DQDL 3VXRA 3O9WC 3EYOA 3V4VH 2AERT 4UIKL 4MNGB 4XO9A 3ZJAA 4PJXA 3P0VH 4KKBC 4KO7A 4AGLA 1BPVA 3QIUC 1UA3A 3V5HB 4N2LA 2WVSA 3DK2A 3C5JB 4OD3H 4NC1C 2YC1A 2DLFL 3RI5K 5CP7B 1NDGB 3GMRB 5BW7C 3GT6A 2XI9A 1BZ9B 4DEWA 1SOXA 4IYKA 1BV8A 1LO0H 2Y1YA 4HHAB 3NABH 3S34L 3W81A 1LDSA 3ZDZB 4WNJA 3ZSSA 2AK1H 5FOBB 4AMKH 3OLDA 1U58B 1F4YL 4E5XA 4Y5YC 2X4OA 3I85A 5KSUA 2NYKA 5T1LA 4M6NL 2J43A 4UQBA 2K3TA 2EKSA 4ZUWA 5T1MA 2WUCL 4F37F 1OSPH 1E6OH 1MFCH 3E6FA 4F92B 1Z9SB 4AVJA 3X3GH 1HL5A 1T3FB 2X4RB 3K2UL 3FQNB 2VLRB 1ZDQA 1U41A 2EYRB 2B08A 2Q7NA 3T2LA 2C34A 3P0VL 4JCWA 2FSEB 4Y89A 2AK4D 3RWDA 4WI5A 4LHUD 4K3DH 4OBSA 3LEVL 3QFJA 1BJMA 2ATKB 3TZVB 4HWZB 4U3HA 5HI4C 2BVEA 4H44C 3H2QA 1RPQA 4QWWC 4XPTH 1U95B 2XX0A 1OGTB 3QK0A 5L6YL 3VWJD 2JB6B 4M5YH 1KBGL 4X5QA 4J4PA 2QSCH 2A9BA 2HCZX 1HEZB 4P8QA 4ADIA 1NM9A 2JIXA 1UT1A 5ENWB 4ZXBA 1F2XK 4MCNA 1L9QA 3B7YA 3MRMB 1CIUA 5EZJB 3F6IA 5C3TA 1AOZA 2FSDA 1VFBB 5AZEL 4W9IC 2WVVA 1ZA6B 2Z35A 4G6JH 5IK3B 2ENYA 2XPYA 1IRAY 4UYQA 3PXJA 4LIQH 4TMPA 3BPOC 1QG3A 2WHVA 5D7LB 4JY4B 1W80A 3BSZL 3JVFC 4Y4HC 3QUXC 5DK2A 1IGFL 1S46A 1E9QB 3GF8A 5C8JA 2XACC 3M17A 1KELL 3UJJH 3BZFB 1HT6A 4MMXA 3VGAB 3MMEA 2FQGA 4TULH 3D85B 5I66A 3ARGD 2OXHB 1FSKC 1GSMA 1JPGB 5C7XL 1OSYA 3P9MB 3TO4D 2D7TH 4JPVL 4DGIL 2P28B 4X8XA 4PRPD 1BF5A 2Y5EA 3ARBA 4L1DA 3WTVA 1GZPA 5AKRA 4YXHL 4M93B 4QRQB 1IFHH 5IJKC 4OKVA 3EJZC 3N43B 2PYFB 1RIUL 2R2CA 3O2DA 2MSPA 3VAEA 3QO0A 3ARFD 2Y9RT 2D7MA 4PRBB 4KY1H 1DQJB 4AYDC 3HE6B 2EO1A 5JOPE 2Q9OA 4NQEE 3U1PA 4EZJA 2DS4A 3EG9A 2GSIA 2DQFB 1UB6B 3C5ZC 4JFZL 3QWRD 2UZXA 4X6FA 3QI9A 4WKZA 4JX0A 1D7BA 5DURB 3ZO9A 1V7NL 4XXWC 5I5RA 1NFDF 3HCVB 1FNAA 4HUWB 2GEEA 2VCOA 3OQRA 4LLDB 3HZVB 1PG7W 3GMOB 3TV3H 1B2YA 2HJLA 4QGYA 4N20A 4WJG3 4LLQB 3SE3A 3FK3A 1DSWA 1NGZB 1JHLL 1WBXA 4XBMA 3RL2A 1QHPA 4NI6A 4PB0L 3GMOA 3WFHA 1U92B 2ZOLB 4TOYL 2AQNA 1CL7H 2Y6SC 3WBDA 4DPBX 1LQBC 5AVZB 4BDVB 5E8EB 1SJHA 5E6YA 2PYFA 2YZ1A 5M95B 4JDVA 4H0LC 1TTFA 1TQUA 4U1HB 3MSPA 1N0XL 4TUKH 4ZW6A 5I75B 1BIIB 5LG6A 3D18A 3UTQA 2CCVA 3ARQA 1CQYA 3G9VA 3KDMA 3V4PA 1PDKB 2OXHA 1F3RB 2P5ED 3BGMA 4OI9A 1NSNL 1EZVX 3QEQB 3ZHFA 1AQKH 4FMFA 3L5XH 2IH8A 4HIXL 2VISA 1QX1A 2Z0UA 3LEXA 1JGVL 4ZFZA 1FN4A 1GCFA 5L9DH 2GQHA 3QISA 4HXBL 2IADB 3S5LB 4GW1A 1M57B 2XN9D 3MA7B 4EOWH 3OAYH 3VM7A 1PZBA 3ZDYE 3FNKA 2R1XA 5C0ND 2F1EA 1DR9A 3B5HA 4ICWA 2QMJA 4U1GC 2VXUL 3FB5A 3QUZB 3QZWA 2OSWA 1RZJL 3TBWB 3UFIA 3PHQA 2WCSA 4KGJA 1W16A 2JIXB 2V2WA 4TUUA 3OPZL 2HFTA 1L0XA 3A4FA 4FTDA 2AJXH 5KUMA 2XWRA 4F93B 4CU7A 3MJ6A 1MFNA 4TQEH 4UQDA 4CRPA 1CE6A 5F7BA 1EEUA 2NR6A 3TT3L 1RVFL 4E36A 5DD5L 1DDTA 5F0PB 1JPFB 2ZQKA 5GS0D 4K94H 4CAGA 4NO5A 1VFMA 2YLHA 3L13A 4BFKA 2XJKA 4KY2A 3V4UL 3NQKA 3N55A 2ZSWA 2J1ZA 3MA9H 5D1XB 1NOFA 1Z1WA 4ODSH 4XPHL 3EJJX 2R8SH 4YHMH 1RJCA 1JK8A 1F58H 3MRCA 3C2SA 5FPIA 4J23A 5F7UA 5J57B 2ATKA 2H41A 3IDJA 2Z4QA 3FFCD 3BISA 4WHCA 4ACTA 4NSKB 2BY3A 3H2WA 4YE4L 3RGHA 4M7KH 2VDRH 4ZO8A 2Z91B 5HY9B 4GQPH 1IC5L 5KSVB 1S7RA 3DVIA 1KCRL 4N9OB 1HEJC 4P05A 1QI3A 4MA1C 5KVGH 1HHKB 3ZDXB 5DRXB 5TJWK 1VACA 1XF5B 1HEHC 2EDMA 2J8OA 4TNVF 5HDBE 3EYUH 4Y5XC 3RVXC 5M94B 3U0PA 3MREA 4PRPE 3GI9L 1WWBX 2C3HA 4Z7OE 4DGVL 4P49A 2YGOA 4I5BA 1RZ8B 5DYFA 1I8LA 1P5UB 4KROB 2QFPA 1DEDA 1MHPH 2V17H 2DM3A 3US0A 3ES6A 1SVCP 5D1XC 3HRZA 4H4NA 1GW0A 1JGDB 4BFBD 4HEPG 3EJQA 1T2XA 1AG6A 4LVHB 4DUVA 2X7LB 4FQ1L 1WDAA 4UILH 5EA0H 3TO4A 1SLVA 4L8SC 1GY2A 4Q9RH 4JLRA 3JWDL 2LU5A 1Z66A 2CD0A 2FR4B 2XZAL 4LSPL 1HQ4A 2DWYA 4FQJL 4P3DB 1DN0A 2GUYA 3CFJA 2CLZB 2OZNA 5KVDE 2QPSA 2ARWA 3BZ4A 3LIUA 4JFOA 4ANUA 1J9TA 2KUTA 3QEHA 4ERSH 5CLYA 4PJFB 5L4IA 4NUPA 4WF7A 3BQUA 4HS3B 5BUGA 3G5XA 3HAEG 3SQBA 1FVDA 4BD4A 6CGTA 1LYQA 4G6AD 4ODVL 5IBLD 3FTYA 2X6MA 3HBGA 2AQ2A 2ESVD 5HHOD 5BO1L 2E7BA 3PXLA 4WWKB 5FF6A 2DQTL 4NKDB 4ZMAT 4DEPB 3KPMA 2J2ZA 1QWNA 1BJ8A 1R1CA 3FF7A 4W4OC 5LCVA 1ERNA 3P0GB 3ZTDC 2YAFA 3MJ8A 1E4WH 1KC5L 2EO9A 1FL3A 4LGPB 1N18A 3UBGA 1OGAA 1BQLL 3IJYA 4KKLC 2L04A 4MSWB 1UXWA 3BAJA 2CDEB 2EE0A 3EGSB 4ZS6C 5FCSH 3WO4B 2P5EA 4LSQL 2EP6A 4BH7A 1RPKA 5E5MB 2AANA 5ADOL 1QMUA 4N8UA 3AXLA 4UU9B 4KVCH 4OCXH 2RMNA 1YUHA 1E6JL 1TMQA 3L9YA 4TF4A 1LWJA 2WLIA 4B41A 4OM0H 1XH3A 2R0WH 4ODHL 2BFVL 1CF8L 2B1HL 4GUCA 2B3IA 3EOAB 1OARH 1RXLA 3II2A 4I2XB 3SE9H 3UBXI 4F7PA 1C12A 3GBNH 3VI3F 2ZX7A 3QQ3A 1RZKL 2JH2A 4AJVA 4ELDA 4B50A 5D5MB 4MJ2A 2A6JB 4MYPA 1IJNA 1MJJB 5CJQH 1MHCB 3KXFA 4J3VA 4QHKI 1MLBA 3DXAD 1ZLUH 4Z7VB 1CXLA 2KQMA 2ZX9A 3WXWH 4JAMB 4NC0B 1BA9A 5GSRB 2YEQA 4Q7DA 2A6JA 3QXUA 2IXQA 4OQTL 2J25A 4Z78B 1LHZA 1ORQB 1G5AA 3FO1B 3QVAA 5DJ2A 4PS7A 3NIFE 4NWTH 3VU2A 4P5SA 2R29H 4F8QA 2X4UB 4PV1C 4CU6A 5JUEH 4M5ZH 4N2CA 5G4NA 4B5ZA 4QHNB 3D12B 3LTVA 4PAZA 2DWTA 3HE7C 4YX2L 4ONOA 3ULVH 1IAIL 2YAHA 3V55A 1BMZA 3CMGA 2X3BA 1CLOH 3D2TA 4IMKA 2FIRT 3ZIMA 3GM0A 5FFOA 1CB4A 3BKCH 5F3HA 1TJXA 2VDOB 5HHME 3ILPB 1SHMA 1T0NA 2YGQA 5FO9A 2BS8A 3EF4A 3VX0A 2XX1A 1IT9H 1P9MA 1EUUA 2GBAA 2BX5A 2HP4A 3P9WB 1IKNA 3QQ9C 1T04B 4FFZL 4Z7WE 1JUFA 3PWJA 5GXBB 3MJ8B 4XCEA 1RUAH 3RVWC 3V8OA 3SKOB 4AYGA 4XPAL 4AGQA 1QQDB 1FLRL 1BFTA 2J2ZB 1E0OB 4JPSA 2JKNA 4XCYA 5ESVA 1H3UA 1QSZA 3L7EB 3MU3A 5TF0A 4FYQA 4LVOC 3HC3L 2P3YA 1QLRB 3VFRA 4JG1H 1RUQL 3RQ3A 4QXUL 5IB1A 3ZZQA 4M1CC 4KO5A 5DO2D 4C47A 5ACZB 3RYMA 2XRAL 1T1ZA 3T6ZA 5DC4B 1OSEA 4EBQL 2EUZA 5FGBC 1GGCH 3OC5A 1S9YA 2OMVA 4KNQA 4H26B 2BZ7A 4CADA 4I4WA 3ARUA 1F6AB 3TVMD 1EAJA 3HUJA 4G7QB 4FQXB 4N0UA 1E4KA 4N2MA 4XODA 1DDHB 4MRBA 4ZXBD 5D55A 5IQOA 4Y5VB 3FQTB 4BH8A 3PAZA 5F89B 1NIBA 4O2EB 4W1TA 3MUGA 4YUEL 1S7VA 3GXTA 3CXDH 2P7TA 3PAUA 3TO2A 4UCFA 1TSRA 5B39A 1PW3A 5TQ0L 2XOTA 3LH2L 1TTAA 4NUQA 4BA0A 1YNLH 5I1LA 3ARRA 1T7XA 2QV2A 3BQUD 4NNPL 3BWAA 2VLJB 3FT3B 2IXQB 3IU3A 4Z78A 1JNHB 4FQHB 5I6PA 3UC0L 3P4MB 3DECA 3D25A 4AT6A 5BCAA 1WPCA 4NPJA 4DVBB 2EDWA 1INDH 3LHPH 4Z7VA 4N8CH 1NCCH 1INQA 1BQHA 2VWEC 4PRHD 5EZOH 1MJJA 4DKAA 2HFGL 2GVYA 3HE6D 3PYCA 1YMME 1X5ZA 3LHAA 1KBBA 4A04A 1I7UB 3RZCC 4P06A 2NW3B 1IGJB 3OXSB 1C12B 3QZLA 2DIJA 1YJDL 3GXNA 3RKPA 4H1LA 3IN2A 2CO6A 2DQJH 3JVGA 4AEFA 1YEIL 4A37A 2F7RA 2JKRM 3U2SB 1DZBA 4NO2A 2V7HA 4YHML 1OSPL 3KR3H 2W5PA 5D1ZA 2F8XC 3HN3A 3FKUS 1ZGLA 1A0QH 1Z9OA 3AQXA 4Z77B 2CRYA 5KBKA 5HHMD 4OF8A 3UGXA 1K8DA 3GDCA 4H2CA 3MLXL 5L2JB 4L1LA 3BWZA 1TVBB 1TETH 2VM9A 4ZAKB 2UY6A 1UUSA 1DBKH 1OKEA 1Q94B 1JS4A 3WFDH 3MGOB 5AYTA 1GYWA 5EULV 4HDIA 3QDMD 4F57L 3QPXH 4UT6H 2VDQL 2DBJA 1AC6A 2W95A 4BFRA 1AO7E 4MJ5B 3SGJC 3KCWA 3MUZ1 3SO3C 1IC7L 2BP0A 4XC3H 1UWGH 4YHPB 5ABAA 3SKNA 5BQ7B 4X4MA 2VITB 4RAVB 3NIFF 5ANMA 4FA8A 1IE4A 1OF0A 2BVUA 4LCYA 1NGPL 2WXRA 3WO3B 4OZHA 3T65B 3U83A 5DF0A 4YJZL 3UG5A 1WK0A 3EJRA 4MLIA 2FT6A 3PY9A 2HSIA 4DK6A 4QRUA 4LNRA 3T0EA 2JE8A 1QPXA 2IWFA 1PG7H 2WXQA 4KK8C 2WSDA 2DQ6A 1ND0B 1QW8A 4TSAH 4NI3A 4ANVA 1QAWA 2K78A 3C6LC 3CUPB 2NNXA 1P84K 3TBTB 3ABLB 4J8RA 4ODWB 1DUZA 3U6RA 3A24A 5FHBL 4LNRB 4MJ4A 3QW9A 1C5BL 2NY1B 1WBZA 3U79A 1DFXA 5K9JH 2XZAH 3GIVB 4LSPH 3GO1L 3JUZA 3KDMB 5TE4L 5C09E 3UTSA 5JXAL 4QCIA 4V1DA 2HT2D 3GUFA 1OSZA 4W4OA 3NK3A 3IFPA 3BDYH 3QNFA 3QXDB 1QOKA 3SIKA 2XWJA 4LB8A 2HVJA 2VXSH 2OR8A 3NFNB 1TCMA 4NJAL 4IW4C 5D1QE 3KPSE 3MJ7A 2BNRD 1FFRA 1IKOP 4UUJA 5L0QB 2VKWA 3T2QA 4HK0B 4D0CB 4LVOB 5KVEE 4B27A 5FAAA 4AH2B 5CD3A 1W8NA 3RIAK 2HKFL 1BIHA 3ZZSA 1NGZA 4FD0A 1B6DA 3RL2B 5IOPB 3FUNA 1O7VA 1I4FB 2E59A 3EO9L 3GSQB 3Q2VA 5D2LB 1BREA 3EHBC 5GJTL 4WO4D 4FFWD 4FZEL 4PJXF 1YMMB 5EC1A 3TIDB 1JZEA 2VR9A 3NCMA 4JQIH 1EAQA 2XZCH 3FQXB 5HYQB 3CN0A 4J3UA 4X6FB 5DEZA 2Y24A 1HIML 1MDAA 4NC1E 4GXFA 1KYFA 4IJ3C 2GSIB 4FFYL 4XZUB 4PJBE 3K6OA 4CN1A 5F3FA 5E7BA 4BFOA 2GABA 4NP4L 3U1SL 2HVKB 5F7YC 5CEZL 3VRJA 2GITB 1OM3H 3FMGL 1QKZL 1TT6A 2OTUA 4KTDL 3PP3H 3DUUB 5KJRL 4IIZA 3T0DA 4NT6A 4R4NC 1DO6A 5JXED 3WEAA 4OGQC 1QHOA 3NGBB 3QCTL 3CZKA 4KKAD 4PJ8A 2DYPD 3VWKD 3SBWA 5LDUA 2PCFB 4ZUVB 2VYRE 1DBMH 1D5ZB 4UOZA 1RMFL 2FWSA 2Y7QB 5FFGA 3WYRA 3RJOA 5L8LB 3D0LB 3ZHDA 1ZSHA 4D94A 5H94B 3F58L 2DRUA 2XIDA 3VW3H 1J9SA 3G6JF 5FYLD 3C09B 2VC2B 3L2LA 3BPLC 3WHE0 4NO0A 4JVWA 2E0PA 1GGUA 2AJVL 4CKQA 1CFBA 1UKTA 3VNZA 4NOFA 5JOEA 1FLTX 4Z8FL 3TIEB 3CMOL 4KJPC 4HJJL 3LSOB 1UATA 2FJHB 4GW1B 5JHMA 4PS4L 2NY5C 1CMOA 5ENWA 3AY2A 3ZGIA 3PUCA 1PKQE 3H1ZA 3IPFA 4K71C 2VRQA 4Z76B 5J12B 3AWFA 3SGKA 4N2NA 3SQRA 3IFOA 3K71A 4Y4KB 2QHRH 3RY6A 4D8PB 4Z7WB 4L5FL 4X6CE 2EUWA 5HYJE 4Y1AD 5AW6B 4MMZC 1SYSA 3NJJA 4KTYA 4E0RA 1YPZA 2B2XH 2G3ZA 3J27A 3BLPX 4BFNA 1KTKE 1MFCL 1QNZL 2AQTA 1BVKA 5MEPB 1FYHB 3GJFK 4MX7A 5AOIA 4KRPC 2NY2D 5C6PB 3I50L 4NHCL 4M5ZL 2EDRA 2NUPB 4XXDB 3TS8A 1OM9A 1FLRH 1U2YA 1LNUB 2K7QA 4NZRH 4WTZG 5HD8D 1WBXB 1NAKH 2ORBH 2J56A 3O8XD 1NCDH 5B1BB 1AD9A 3NIFB 2ZOWA 3ABGA 3LNEA 4QRRD 5T1MB 5IG7A 4R7DA 3MYJA 4UM9A 1OB1A 5ILTH 2IDFA 4RAUB 1F2QA 5GRYA 4JZNB 4XVUD 3P77B 4P23C 1IZJA 4TPRL 2DM4A 3DOSA 4QY8B 5D2LA 3RDTA 3OMNB 2F9BT 3IU4L 1JZ5A 3EH4B 1YCSA 5DHYA 2IDCA 1IARB 4M29A 2IANB 3QZMA 5E8PA 5EBMB 2WTOA 4JRYB 5FWRA 4HHAA 3OAUL 4C55A 4Y7OC 4WEEA 4CMMA 2K6YA 3IJSB 1ODAA 4G1EA 5KJ4A 3WS3B 2QHRL 2XBZA 3D4ZA 3VFNA 2QHLA 2IEPA 2PTUA 1QBMH 4PV8B 3V5HA 3ZUNC 1NCAH 2OJEB 3S88L 3ZE1F 2F6AA 3NH7L 1VPOL 4G9FE 1ZA3B 1NEZG 1GOGA 2RGSA 4L8SB 2X6BA 4X5PA 2GT9B 4XH2A 3KXFE 1JBJA 3L9RB 3PAVA 1EAPB 1BCIA 2G0LA 3MGTA 4XB3A 5A43C 5AOMA 4O9HH 4ES9A 1BYPA 5EC2B 1ZT1B 3C75A 4K3HA 1P5UC 4KROC 3B1TA 5E6IB 3MRHB 4LAQH 3H54A 3UH8A 5D1ZI 2SODB 5H8DA 5CCHE 2JXMB 4TULL 4FLSA 3BN9D 4AL8H 3TEYA 2HRPL 1OTTC 5D6DA 4APQB 2CJ3A 4O2CB 1TOXA 3CK0L 4WAFA 4XWOD 2R69H 1IKFL 2Q0ZX 1X6NA 4K7PH 1RERA 2OMBA 5LGKA 5LAXB 2BW5A 3VFPB 2OL3B 1YA5A 5D4JA 2AP2A 2ALAA 3MOBL 4UTBL 4F15C 3ZO0A 2Y7LA 3V6OE 3VWJA 5CKGA 2YARA 4G6FD 5DQDH 2VDOL 2VRKA 2VC2H 2Y4SA 2HT2C 4F2EA 4C58B 3L1FA 5BZDA 1H8NA 4N8CL 1WFMA 5D96B 4ONHB 2RAMA 1KY7A 5E9DA 2WLNA 1T20A 3AMKA 4ZFFB 1E4WL 2NY0D 3FO9A 3PE9A 4WUUD 4L05A 5F72S 1EO7A 5KSAB 3O6LL 1GGIL 3I6SA 4J3OF 4LCIL 3OHXB 5AVUB 5J13C 2L7EA 4G7RB 3L3IB 3RA7H 3SBWC 5CWSB 3IPBA 2B9AA 3LDBC 1IIIA 3P02A 4NKDA 4XMPL 4YVNA 4YHLL 1NGWB 3EH2A 2Z65C 1S7TB 1V3JA 5AG9A 3S35X 3BAEH 1H6EA 1SVZA 4KQ4H 4N1EA 1TPXC 2OV0A 1CLVA 4YLCA 2VGLM 2OQJB 3N6YA 4ZPVA 3W82A 3ZT6A 6TAAA 4OLEA 5TK2A 2ZYHA 1XGYH 3AVEA 4XOEA 3PWNA 8CGTA 4DO5A 3BT2H 3SE3C 1UA6H 5KS9A 4APQA 2AK4A 3OQ3B 4G80A 3GSXB 4DKFH 4HISA 5AZ2L 3GSOB 1T89C 4NGHL 4E41B 2Q87A 2VUYA 3R19A 4IHOB 1MJ8H 3HG3A 2UXVA 2W65B 1C5DB 4JGJA 3QI9D 5IQ7L 2NY2C 4DQOH 1HQ4B 3WEBA 1Q1JH 2Z1PA 4IEFA 3THML 2X6AA 4Y8DC 5DWPA 2DI7A 1ULVA 3LQAC 4UOJA 2ZP9A 2HT3C 1VEPA 2Y72A 5C0AE 4ZMNA 1MAMH 5BMFL 2HG5B 2AMGA 4GXUN 3KWTA 3RVUD 2HLAB 2VERN 1M05A 3DARA 2GTZA 4G1EB 5AW4B 5GGQL 3GSOA 3ULUE 3TBSB 1OZTG 3EJPA 1FRGH 4WK2B 3V0VB 1UCBL 4IRZA 3EGXB 4RMBA 1PU0A 2CBOA 2H0JA 3LS4H 2Q76A 4PY8I 2XN1A 3A4DA 1TZIB 4HBCL 4BZ2L 3FN3A 3QWOB 1T1ZB 1MELA 1OB1B 2OQJA 4P59H 1S7RB 1XBDA 2R2BB 4KDTA 4CJ1A 1E3ZA 1JYNA 5HI3C 2CNYA 1U8HA 1SNRA 3D69A 1B2WL 4PRPA 2Q3AA 1LK2A 1ETA1 2F7IA 4S1QH 3H8NA 3WEMA 4FI7A 3VI4B 5DS8B 3KBEA 4IU3B 4JRXB 3VDAA 3CDCA 3LPOA 3OJDA 1DL7L 4JRXE 3F7KA 5JW3H 4UWQB 5L9DL 1BGXH 2AK4E 1FWXA 3EO0A 1S9VA 1V5JA 3PWJB 1PZCA 1CDIA 2AEPL 5K33A 5AG8A 2D4FA 1W72B 3LZFL 2F19H 2XV6B 3WKQA 1IU1A 4FDWA 4LBAA 5IMOB 2Q3ZA 3II1A 4KROD 1YECH 5D7IA 4S10A 3GKWL 4OLVH 4CSZA 1RKRA 1C7SA 2E3VA 2Q2EB 4AUYA 1E27B 1R3KB 3C08L 1VB9A 2PO6B 1A6PA 3DLQR 5E2WH 3U9UA 1ZHBB 1DFBH 2DD8H 3BE1L 4AV0A 2XQYK 3KPSD 1HNFA 2KH2B 1BYOA 4PWJA 1E3XA 4XMXA 2OI9C 5FFLA 3PAYA 1I7TA 4N8VG 2MPAH 3TNNA 4MXQD 1U8IA 1XWVA 1I8LC 1LWHA 5DHVH 1OK0A 4Y7MA 4O51B 3LIZH 4X4YA 4QDGA 2VLLA 4G6AC 3REWA 1T6VN 2PCPA 1NUDA 5C71A 1AGFB 3ULVE 5EEYA 3X14A 1FGNH 3X1BA 2FB4L 3BPNB 1G7HB 4ALAH 4YK4C 1NANH 3IMVA 3IXTA 3VD2A 3BP4A 5IOKA 3CLFH 4NQEB 2QZQA 3DX4A 2FJUB 3IRPX 5FHAH 3RZWA 4HC1L 2XTSA 4L3ED 1T80A 3GTVA 5FUZL 5IHHA 3SYCA 5I17B 3EADA 4OD2B 3OAZH 3VXOA 3UYPB 4N26A 1FNGA 1FZJA 4OZGE 4DH2A 2AXGA 5C97A 2BFGA 4D3CL 2KZ1B 2M2DA 3QXVA 2QGBA 2NY3D 4FN0A 3UJJL 3JYBA 1E5CA 35C8H 2BFVH 4KK6C 1CF8H 3I02B 1PZ5A 2MIZA 5C0IB 3RPKA 4LARL 3ETTA 4R7DB 1FL3B 4UILL 5EA0L 4RGNE 1XB8A 1ZHLB 3O6MH 4IRJC 4JY6B 4HFUH 1MWOA 5KVGE 5T1DL 2YN3A 3LRMA 3N2JA 3MTRA 5ISZD 3A4AA 1A1MB 1KN4H 1HZHH 2DIBA 2ZUQB 1WV7T 3M7FB 3HC0A 5H4YA 5JPMA 1FAIL 4Z7VF 3JWOH 1H9DA 3ZDZF 3MJ7B 1QA9B 2DICA 4U6VL 2WYIA 3KLDA 1GGTA 3GMMB 2MPAL 2V8LA 3QIUB 3MJ9A 2MQ3A 4AV4A 4DO4A 1JK9B 4LEBA 4NRZA 4M8QB 4F1SA 2WQ8A 1C08A 2OSYA 3BX7C 3IFPB 3MLTB 5E6RB 3WEXA 1CGYA 1MRDH 4MAYA 5KYXB 3QZOA 1OY3B 2ZUUA 1Q9LB 1HH6A 2ZX5A 2I26N 5BZZA 3EOYG 5INCA 2V7NB 4GG6F 4MD4A 5H35A 4PHXA 4PH8A 4WI6A 2YRLA 2A74A 5E6SB 2HVBA 1E4XH 3V6ZA 4MZ2A 5DC2A 1BBJB 2BNUB 1RLBA 4GXUM 3QFDB 5DTFB 5CINL 1DJWA 5AYUL 3HUJF 1TSHA 4XRCB 3UACA 4HC1H 1C1EH 2I69A 1JMZA 3FU5A 4JZJA 4RFNB 1PJWA 4L4VA 5GGSY 4YK4B 1YYMH 2GJJA 3NSCA 3PV7A 2Q86A 1G87A 5C3LD 2HTKD 3QEQD 1AGEA 1ZV9A 3L9EA 1XGPB 5BV7L 3RGVA 1T7ZA 4JFTA 4XXCA 2ZWZA 1ZKAA 1FG2B 4XNXL 5D2NB 3H9YA 3POHA 2NSQA 3HBQA 2DPKA 3BP6B 1S3KH 3DURA 2P80D 4LVNB 1KG0A 3ZKNC 1E6JH 3H2PA 5DT1L 1RUPH 3H0TA 4FX5A 3FQYA 3IFNH 4GW4B 2VZVA 1KT2B 1GL4B 1UWEL 1XMWA 4NS0A 5F1NB 1A1OB 4NQVA 4Z3JA 2P26A 4MKTA 3QUYB 1XAKA 4QO1B 1MNNA 1ZXKA 2BSBA 1WE5A 4AYMC 4LCIH 3SQOH 2Q7YA 4CVXB 1BZDA 3NBNA 5HHXL 2C3VA 2K7PA 3LRGA 1KCBA 2H6UA 1QTYT 4LSUH 4OLYL 4P2RA 4WUUE 2CLVB 3AT9A 4LHUG 1XF2A 4MASA 4HK3N 4QIRA 1F3DJ 1LJMA 3KLQA 3QQDB 5CAYB 5CU9A 3ZGHA 1HL4A 3MV9B 4L3FA 1F4YH 5D2NA 3D0AA 3T0EE 3KPSA 4Q97A 5FKPA 3K