2TSAA

Azurin mutant m121a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALAKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Mutant Met121Ala of Pseudomonas aeruginosa azurin and its azide derivative: crystal structures and spectral properties.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2tsaA00
4YL4A 2YAFA 2J5WA 1A4AA 1AZUA 4N4YB 1A8ZA 1BYPA 4E9WA 1J9QA 3CG8A 2PPEA 3FSAA 3MBWB 5B3SB 3PLYA 2BWIA 1N68A 1FA4A 2R7EB 2ZONA 2XV2A 3T6VA 4MFHA 1J5DA 2YXVA 3AG3B 2PPAA 1AIZA 3CDZB 1L9RA 2XXFA 4AKPA 1V55B 5EHFA 3TASA 3X1NA 1T5KA 5AKRA 3UGEA 2BO0A 1SF3A 2AZAA 3G5WA 3WNIA 1ASQA 3WIAA 4FA7B 1J9TA 3FQ1A 2Q9OA 3H4FA 4EF3A 1AR1B 5I6MA 4HHWA 3NJGA 1AZNA 3FU8A 3EF4A 2Y1AA 4HCFA 4QLWA 1ET8A 4HIPA 1CURA 1PNDA 4E9RA 4NB7A 4DP4X 4W1TA 3L45A 1NDTA 1BXVA 2VN3A 1WS8A 1IUZA 4HCIA 2HLEB 3NJKA 3ABLB 3NJHA 4YSDA 4A2GA 1A4BA 2UXFA 5I6KA 3T71A 1AZRA 2PP7A 1MG2C 3C75A 4KOBA 3TU6A 3FYEB 1KCBA 4KNSA 1J9SA 1IBZA 1MZYA 2PCYA 2GSMB 2IDUA 4PCYA 1ETJA 3U25A 1R1CA 1AANA 3T6XA 3UACA 2I7OA 2TSBA 3UABA 1ZDSA 2BP0A 2VW4A 2E86A 5B1AB 2JFCA 4DP0X 1SHWA 2CCWA 3QJSB 1CYXA 1AG0A 4A68A 7PCYA 2XYBA 3S3DB 1W6WA 3NP4A 4YSRA 3TA4D 3PAUA 1M57B 3BQVA 4DP1X 1ASPA 3X2QB 1SHXA 3NSDA 3ASOB 3QPKA 4WTQA 2R7EA 1E67A 3S8GB 3FSWA 4K9JA 2Q5BA 3AW5A 5TK4A 2CBPA 2FJSA 4E9QA 5I6LA 1L9OA 2FWLB 2VMJA 3BVDB 1OE1A 4QKTA 1JXFA 1KBVA 2CAKA 2QDWA 1SNRA 1ZIAA 3ERXA 4DP6X 4YSPA 2FQFA 2VSMB 4RH4A 4YSTA 1PLCA 4AX3A 5PAZA 1ZV2A 3SBRA 5A7EA 3DKHA 1GW0A 2HZHA 1IKOP 4DP9X 1MG3C 4BK5C 4BXVA 5LDUA 2OV0A 4GYBA 1WA1X 1TKWA 2FT8A 1ZIBA 3ZIYA 2YARA 2XXGA 3CVDA 4JKNA 3HB3B 4JHVA 2JXMA 4YSAA 5I5IA 1ASOA 1M9WA 4X4KA 5ANHA 1W8EA 2YAOA 2IWFA 4KO9A 7PAZA 1B3IA 4CSZA 3FSZA 1PLAA 2FTAA 2YQBA 3GDCA 4YVUA 1JVLA 4A2EA 4DP5X 2LLNA 3T6ZA 3H56A 3IE9A 3KW8A 1KYAA 1L9PA 5F7BA 3QJQB 1NIFA 2DY2A 3FPXA 2PPDA 4YSOA 3JTBA 2FQDA 1BAWA 3IBOA 5FC9A 5B1KA 3NJNA 5AZUA 2GHZA 4F2FA 4A2HA 4JHUA 2WO2B 3WI9A 1TU2A 4CSPA 1NWOA 4HAKA 1JZJA 4M4RB 5F7AA 1EHKB 2HRGA 2HX9A 1RCYA 2TSAA 2IWKA 1JZFA 5E9NA 1JZGA 2IH9A 4G7QB 3SBQA 1OE3A 1GY1A 4YSUA 2IDSA 1OV8A 1URIA 3OMAB 1GY2A 4ENZA 3EH5B 1SFHA 2BW5A 2XUWA 4E9YA 3NJLA 2BZCA 3FQYA 3NYKA 5PCYA 4DPAX 3NJMA 2X88A 3RYMA 1DYZA 3FQ2A 2FQGA 5I6PA 2DV6A 2XV3A 3QJRB 3H4HA 4GP8B 3S3CB 3AG2B 3ZDWA 2FT6A 2XVBA 4YVNA 1CC3A 2XX0A 1ET7A 1E5YA 1AS6A 2BP8A 2JKWA 2QPDB 3FSVA 4HALA 2J55A 1L9QA 1OE2A 2P80D 4DP2X 2EIKB 2CJ3A 4Q89A 4BWUA 1BQKA 2YXWA 4G71B 2VM4A 1AZCA 2PP8A 4G72B 1V10A 4A67A 1PZAA 4KO6A 3D12B 3N2JA 4AI7A 3TBBA 2IDTA 1JERA 2H3XC 9PCYA 5D4JA 3IEAA 3PCYA 1MZZA 4P5RA 1AAJA 1ILSA 1L9TA 3S3BB 4UANA 2EINB 4F2EA 2VSKB 1AZBA 4GP4B 2WO3B 1NIBA 1NIEA 3ASNB 1OOWA 1WA2X 3TBCA 3FU7A 2UXGA 1BQ5A 2ZXWB 1F56A 2RACA 2P80A 1X9RA 4FAAB 1SFDA 4BXSV 3GYRA 4E9XA 1NPJA 3ABMB 2CUAA 1CUOA 1BYOA 1JZIA 5I6OA 3S8FB 4DP7X 1NINA 1E30A 2XU9A 1OCCB 1VLXA 6PAZA 5I6NA 3QJVB 2B3IA 2PP9A 2BP8B 1J5CA 1ZPUA 2N0MA 2MTAA 1BEXA 2IWEA 4NERA 2B08A 3WNJA 1NIAA 1L9SA 5I28A 3AG1B 2GIMA 2IH8A 3FS9A 1GSKA 2IDQA 3FYIB 1NPNA 4DPCX 2BW4A 2NRDA 4YSQA 3CVBA 2ZWNA 1E65A 4W9ZA 2HRHA 3NSFA 4Q8BA 5B7EA 1NICA 4TXVB 1A4CA 4ZK8A 4A2DA 4DPBX 1PAZA 3AG4B 1IC0A 1ID2A 2YAEA 1YLBB 3CZUB 3WG7B 1RZPA 1PLBA 5B1BB 1FFTB 1QNIA 2BZ7A 1ET5A 1GS7A 2HXAA 1PNCA 3NSYA 1TEFA 6PCYA 4HCGA 4AKQA 1CYWA 3PAZA 3OMIB 1JZEA 2EIJB 1JXGA 4GY4A 4YSEA 2XX1A 3QQXA 3FU7B 4A66A 1WA0X 1I53A 2EILB 3GXUB 4BDVA 1AS7A 4WKXA 1RKRA 3FU9A 1MDAA 4YSCA 2YAPA 1AOZA 2I7SA 3QJTB 3V9EA 1PF3A 2DYRB 2OJ1A 1WS7A 1ZDQA 4YSSA 8PAZA 2AFNA 1OCRB 1JOIA 2X87A 3OM3B 3UADA 2Y69B 1NWPA 2QDVA 1XB3A 4KO7A 3NP3A 5B1JC 3N55A 2YAHA 3EH3B 3AZUA 3NT0A 1GS6X 4HZ1A 1W6LA 2H47C 1GYCA 4KO5A 1WAEA 3PAVA 3X1FA 1AACA 4KNTA 2XV0A 4AZUA 2UX7A 2YAQA 4F7KA 1NTDA 2J57A 1PZBA 2HX7A 1ADWA 1SDDA 2AZUA 1JXDA 3V9CA 2PPFA 4BWTA 1BXUA 4G70B 3UAEA 1KDJA 4P5SA 2QPEB 1SF5A 2MRYA 1OF0A 2UXTA 2IAAC 3NJIA 5B1JA 4PAZA 2IDFA 3OQRA 5B7FA 1KDIA 1XB6A 4AKOA 4E9SA 1XB8A 5AFAA 5TK2A 1GS8A 1XMEB 4BDVB 3ZX1A 3EH4B 2W8CA 1PCSA 4UF7C 3QJUB 4GXFA 4NAJA 2CALA 1A65A 3SQRA 2ZOOA 2A3TA 4G7SB 4N8UA 1UATA 1BQRA 2FT7A 2J56A 1OCOB 4DP8X 5B7MA 3HEIB 1NIDA 1HFUA 2FNWA 1TEGA 2GI0A 3NJJA 4G7RB 3MX0B 2EIMB 1AQ8A 1JZHA 2PPCA 1QHQA 3X1EA 4KOCA 3KW7A 3X1BA 3IN2A 3WKPA 1N70A 3CVCA 1IBYA 3ABKB 4E9VA 3FT0A 1GR7A 1SDDB 2PCFA 2VW7A 3EHBB 5I26A 2VW6A 2XLLA 3OD3A 1HAUA 3JT2A 1DZ0A 2GBAA 1HAWA 5I5JA 5I5MA 1PZCA 2GC7C 3ABGA 2GC4C 2DYSB 1FWXA 5IY5B 1KGYE 2PLTA 1PY0A 1V54B 1JVOA 3CDZA 3DIVA 2WSDA 2XWZA 1AG6A 4GP5B 1PMYA 2I85A 1SJMA 3NJFA 3NSCA 4E9TA 3X1GA 1M56B 2HX8A 1BXAA 2YAMA 2H5UA 3AY2A 3OMNB 4M3HA 1EZLA 2AVFA 2DWSA 3UAAA 1KCWA 1J9RA 4L0PB 3T9WA 2FQEA 2W88A 5D4HA 3PPSA 4A2FA 3PXLA 1NZRA 2UX6A 3DTUB 2DWTA 1RZQA 5D4IA 1QLEB 4BWWA 3WKQA 1E5ZA 4UAHA 2UXVA 2AANA 2GB2A 2QT6A 1X9UA 3FPYA 3IN0A 3SBPA 2BP0B 2BHFA 2VM3A 4HHGA 1KV7A 1OCZB 1A3ZA 1AS8A 2BWDA 4KNUA 2OCCB 1KBWA 1ILUA 3ZBMA 3T6WA
chains in the Genus database with same CATH superfamily
4JFZL 1MIML 1R3IH 1RZIB 4GXVH 5LWYH 4E0RA 1JCVA 2HRLA 3WHE0 4IOIA 4XCCH 4IMLB 4Q2ZB 3FSAA 3MA7A 1KN2H 4R4FH 1W0WB 1BVLA 3FFCD 3H1ZA 2YUWA 1C1EH 2Q7AA 4FNUA 4PJ7A 5TF1H 3GMRB 1XR9B 2ADJA 2YD2A 4GW5B 4HZLB 5GSVA 1JIBA 3G6JA 5MI0B 3B9KB 3E6FB 3PY9A 3JV6A 4GIPD 4OCSL 5DEZA 5FKPB 4NP4L 3X11B 1MNUH 4PJ6A 2E9JA 1YMHA 4ADJA 4G1EA 4X7DC 4HEPA 4XWGL 3HPJB 5CM1A 5C0BB 1OAUL 4NN7C 4NHUB 5ISZA 3HB3D 3VFUB 2P5WD 4QHUA 5I6MA 5D7JA 4YDIH 1HE8A 1UUNA 3W11C 1N12A 4HIPA 1IGML 1MJ7L 4H4NA 4ZUWA 3BAYA 5F96L 4N85A 1N5AA 1YSOA 4LSRH 2J12B 1HQRA 4OGXH 4ZW7A 3IFOA 1DEEB 1J0JA 2VN3A 5E1AA 4OFPA 5JOPD 3QDHA 4MJ4A 1CTNA 1RIHH 4AQ8A 2K6YA 4U3SA 4PEEA 3NJHA 4QOKB 2GTWB 2HG5A 1UA6H 3C8KB 3SE8L 4JPWH 5D8JH 4G80B 5BV7L 3J27A 1I31A 4MJHA 3GZOA 3FYEB 1ZE3C 4XMTA 2HH0H 1KJMB 5I30H 3LRMA 4CVXB 3GXPA 4CJ1A 1R24A 4YHLL 2ZXQA 4AVHA 3LH8A 4PJ9A 1WF5A 2CCWA 2QFPA 3LD8C 3RILA 5BRQA 3S5LA 2XYBA 3L7FB 1OGSA 2Z4QA 4PTUB 4N0UB 1NBQA 2X40A 5JW4Q 1A1NA 5F9JA 3MMEA 4ZODA 4G6FB 4LCYB 4JFOA 2UUDK 1W0WA 3B9VA 4HKZA 2D7OA 4O58L 1UXSB 4UTAA 2OMWB 3KPPB 2AJUL 3M45A 2J8UA 2GK0A 5ES4B 2FX8L 5KUKA 3WTVA 4GW5A 5TK4A 2EC9U 4JZOB 5KSBA 4Z7UA 4QKTA 3MGAA 1BIIB 2C1PA 4JFEE 3UPAA 5GS1A 3VSUA 3X11A 4OLUL 2CNZA 2B14A 3JWNH 2YPKB 3DMMC 1NSNH 3PGCB 3QGVA 5H8DA 4PSPA 3VFWA 8CGTA 1ZK9A 3KR3H 4DP6X 2R4SL 3BKYL 3WAJA 1ACZA 3GXMA 1PG7L 4KKCD 1OTUC 3ZXAC 2UVEA 4HP5A 5C0BA 1SVBA 3TWYA 3LVTA 4KJPD 4PUBL 2BOBA 3EJQA 5JXEC 5LUMA 5GS3A 5IJVA 4WDIB 4BXVA 3B5TA 1WA1X 4LFHG 1PY9A 3FB5A 1VGEL 4KK5D 2IFFH 4AITA 3ZT5A 5I0YA 1FNHA 4OLYL 4NCC1 3B9AA 3KWWA 5BVPL 4FXTA 1S9VB 4WUKL 2BIIA 3D39D 5C6PB 2CHZA 3B56A 4H13C 3AUVA 2WXQA 3F05A 3NCYS 1B0RA 4L2YA 3SDDD 4W9EC 1UM6H 2WNXA 2J88H 3C8KA 2GBTA 2AK4D 5DZPA 2GUOB 3LEVH 1MCIA 4P06A 4RA3A 2BY3A 3BSZL 5J56B 4R9HA 2R8SL 1G4RA 4O2CA 5J89A 1KJMA 4CVXA 5EO0B 4UM8A 5DZAA 3K4ZA 1IFGA 3LHPL 5EEUA 2YEVB 5IHBA 1JGEB 1I9EA 1XR8B 3AACA 3FCTB 3QHZH 4OAWA 4XNQB 5HHPB 4MCZB 3WDHA 1FLRL 1SJVA 3JUZA 3UC0L 4OGQC 4APQD 5KZCB 5F9AC 3KNBB 3U0TA 5CJXC 4ZPVB 2IH1A 3HAEA 3HOGA 3MGOB 2O5YH 3PGFH 3GSUA 3Q6FA 4X9BA 5BV7B 5I0DA 3WNPA 2WXPA 3F6JA 1P7QD 1D6EA 1OV8A 2FGWL 2WPGA 4Y5VC 1WT5A 2OTWA 2Y6TE 4HXBH 3V0FA 4UT6L 1FJ1B 2DQIL 3Q1EA 4JRXD 3WGVB 4DPAX 2NY3B 3A6CL 4K15A 1EAPB 2CKNA 4KTYA 1SLUA 1A8JH 3KPPA 1QP1A 5I6PA 1U8KB 3RFZC 3MLTA 1NUDA 3D33A 2JLPA 3VQ2C 1CLZL 2XVBA 3HIZA 5LGKA 2X4NB 2HTLC 2CH8A 1DVFB 2JCCF 1YVLA 5EC2A 1TMCB 4A04A 4MHHG 1C5CL 4GBXB 2O26U 1PIGA 2VM4A 4OCWL 4WDIA 2CIKA 5HPMA 1PZAA 4ZS7L 4KO6A 4R4ND 3QIBA 3C6SA 4K7PH 1BWWA 3T0WA 1EFXA 2NNXA 1YEIH 3K6SB 2NTFB 4UAOB 1CGXA 2O5XL 5CO1A 2D7NA 3B9EA 3PCYA 2WLLA 3F58L 1MZZA 1GHFH 1VZGA 3NFSL 4DGVH 4EN3C 1I3UA 4N2CA 4F2EA 1WUNT 5GRXG 4ZZKA 4P9MH 1EBPA 3EYFB 1RPUA 2PTUA 4JG1L 3V2AR 5IFHH 2FUQA 3IJ9A 3P9LB 3D1MC 4MX7A 4N5UA 3K2MC 3SDXB 3D51A 1EXUB 2ZXBA 4OI8A 2HFEA 3MCKB 1HQ4A 3IDJB 1QFUH 1D5IH 1RZ7L 2MOVA 1VSCA 1HYSC 4HPHA 2NY4B 1JGEA 1NOAA 2D9QB 1OPGH 4Y9GA 1H5BC 5HHPA 3IT8D 2YR3A 1CUOA 4DWHA 5CN3A 3Q48A 3QFGA 1OGAE 4L4JA 1ZHLB 3T3ME 3WEXB 5BPPA 5FYLD 6PAZA 5I6NA 2B3IA 2PP9A 3ETBF 4J8RB 1OOAA 2QSCH 2VDNH 5DFTA 7FABH 3PHAA 5I1CH 4JAMB 4UMGA 4KI5D 1RZJL 3FS9A 4B27A 2ENQA 1CTOA 4JVUA 4Y5XA 3GTVA 4XMPH 5JYLA 1E5CA 2FJHA 3VXNB 3EOAA 4PJDE 1AZZC 1NICA 2ICEC 3CIQA 1DBBH 3SPJA 4Z7OB 4XE0A 4DGUA 3STZB 5EA0L 3A6OA 3KPRE 1EMTH 4U4BA 3FT4B 4KBPA 1TTCA 4XBMA 3MV7A 4PW9A 1RZPA 1KGIA 3X14A 1NH6A 1HC1A 4S1DD 3BP6A 5DK3A 1GS7A 5F0PB 3QFJB 3QXWA 4EXPX 1QNZL 2F19L 2BSTB 1J8KA 1DVFA 2EIJB 1I9IH 2Y25A 2L7EA 3TYGH 5I1LA 3AAZB 1BFOB 5C70A 4GBXA 4LU5H 3QQXA 3QUKA 5DS2A 1DEDA 5DWUL 3CN4A 1I1AB 1RKRA 5SWZE 5AZ2H 3K6SA 4DETA 5E4AA 5CBEB 3KJ6H 1HHIA 1AOZA 3R06B 1L3WA 5J1AB 3ZGIA 3QJTB 4DN3H 3QDMD 2G4GA 3MUJA 1DQQB 1WS7A 1FDLL 2WTRB 2OR9L 8PAZA 1NA8A 2LU4A 4PS4L 3V4PL 1JWSA 1K8IB 1K72A 1MW2A 4RSVA 3ZL1A 3L81A 3SHSA 2I9TB 2R29A 1KJ3L 1V3KA 4AYBA 2DIJA 3CN0A 3NIGB 5C0ND 5BO0D 4LHUG 1CICD 1XGTA 1BEYL 2A9CA 4ZMVA 4OUUA 3P9LA 4LXFA 1UM4L 1YEDA 3MUZ1 3GLAA 4H40A 4UQ9A 3U1PA 3EFFA 2KT6A 1NAKH 1MCEA 3MCKA 4XPBH 1NCJA 5I6XB 3IDJA 4TRPH 4IRZA 3WBDA 2YRLA 4TULL 2PXYC 2XV0A 4AZUA 5I1HH 5IVXB 1VKXB 2BMKB 1U42A 1PZBA 1YAIA 2OX5B 1EHLL 2ZKWA 4WJG3 2ZUWA 3AREA 3EJSA 4P9HH 5HDBB 1T3FB 2H3NA 3ILQD 1D9KA 5E4EB 3UAEA 4MCNA 1R4XA 3U83A 2PR4L 1E5UI 3F84A 4UIKH 4XNZB 5HY9A 5JW4N 5I1GL 3BWZA 1PU0A 3QH3A 4OBSA 5E2UH 1DSFH 2ODIA 3BP4A 1CLYL 4G6KH 4X7EC 3PUUA 3KM1A 5IFJB 3HS0B 5DUJA 2H6UA 1KN4L 2IXQB 1IGCH 1PCSA 1IQDA 3GSNL 3TGXA 5ITBH 4ZAKC 1U36A 2G30A 2VWEE 1R3HA 4YC2C 1R0AH 4I7ZC 4KKAD 5F9DC 4KZCA 3QZWA 5DZNA 5E4IA 3W9DA 2H8PA 4E41D 3QFJA 3ET9F 4XPTL 1KXVC 2EIEA 4I18C 4AVIA 1N5YH 1A4JA 3NJJA 3MJ9H 1ADQL 3R18A 2EIMB 3ZQWA 5I1JH 1IO4C 3H53A 4RWYH 4HH8A 2PPCA 2UWEF 4JY5H 3TV3H 5CSBA 1DFXA 2OMXB 3MRJB 3DSFH 4NO3A 5K1JA 4YHZH 1I1AA 3DRQA 3WKPA 2WUCL 5E03A 15C8H 1KENL 1ZY9A 2X0UA 5FUCE 5AVUB 3KPSA 5MI0C 3L13A 4NO2A 1DQQA 2WTRA 4CU8A 4AW4A 3V0GA 4RGMB 4UQ2A 1I8MB 3RWDA 1FGVH 3VXUB 2I24N 4L8SB 3OKKA 5DQJB 5IMOB 2YBRB 4GINA 4YO0B 3OD3A 3FO9B 4PRID 3G5XA 1HK6A 3GK8L 4Q6IC 4I3RH 2JELL 5ABAA 1USZA 3B2MA 1P1VA 3RZCD 1XEUA 2EH7H 4XHJD 5T3XE 1GTFA 1KCLA 2FO4B 3TJEH 1VKXA 3MACH 4FNPA 5K1NA 4MMYB 3V4PB 1AG6A 3TYFA 1RHHB 3QUZC 2I85A 5L8LB 2DLEA 3QQ4B 1GYAA 4JDTL 2XWTB 2PCXA 2VXQH 1XD0A 4XOEA 5AAMC 4LOFA 1I3RB 1J8HA 1E27B 3OMNB 2YC1A 2WP3O 5TH2B 1A6UH 2WTPA 3SSGA 4L29B 4XCEA 4TUJB 1NFDA 4MDIA 2LLLA 5IVXF 2X7LB 4IKIA 4XMLH 1FYTE 3I3DA 3KPLB 3MCYA 3IJ7A 3IAQA 2VJ8A 3PXLA 4WI3A 3QUML 1OSEA 1IAOA 2FEJA 4XO4A 5E9DD 4Y5YB 1HHGA 2O6PA 3TFBA 2B4CL 1UJTA 1UASA 4N26A 1BOGB 4WFHE 2Q8AL 3QULB 3I6SA 1SXSA 2GSIB 4WGWB 5D7LE 3WKMH 1WUZA 25C8L 3FH5A 3KLDA 5F1IB 2DBLL 5DJ6B 3TZVD 4M7KH 5I15L 1WEJH 5IEKB 1SYVB 4ZRGA 4AQEB 2OMXA 5B8CC 2Q8BL 4MVBC 1N18A 4ISVB 4JFSA 3RY6C 1XSKA 2JJWA 5I19L 4TVSa 1B3JA 3TWCL 1M05B 2Z9TA 3PP3K 1U30A 3LS4L 2C9RA 2QMJA 2MCG1 2X2UA 2QLVB 3X1NA 2WB7A 4Y1AE 2BO0A 5ICYA 1QHOA 5C0DB 1MJ8H 3WNIA 1YEHH 1MNNA 3CVHA 4BZYA 5FB8B 1J9TA 4LO9A 3H4FA 1KGJA 1I85C 3AS2A 4GQRA 4JE0A 5EC1A 4YXHL 2NUTA 2QZ5A 3FCGA 5KYXB 1PDKB 5CJBA 1QSFB 2B0SL 2PCPA 4HJ1A 2PTTA 4LESA 4ZMOA 1K5NB 3RA7H 4IDJH 4NZUH 4XE5B 4JANA 2Z8SA 1R17A 4QRFA 4CA4A 3EGSB 3BJ91 4MMYA 1BXVA 4NJ9L 4OQTA 5TDOA 5FEBA 3ARBD 3CFCL 2LU5A 3J7HA 4PJIA 4XAWL 1BGXL 1VFMA 1YY9C 3VXTB 1I8AA 1MXGA 3CFKB 3ISRA 3OC5A 5TH2A 3F5WA 1RZKH 3SKNA 2XCMC 4NRYA 5CINL 2IC2A 4KNSA 2NW3A 1SMAA 1J9SA 4LVNB 4JGNA 3GM0A 2GSMB 2X4OB 4QJ3B 4ZOBA 4HLJA 1YDPB 1R1CA 3DPBA 2P5WA 5DZJA 5HGHA 3LSOB 5L4FA 1JN6A 2DW5A 3BH4A 1KWKA 1E9OB 1E9PB 2JFCA 1RVFL 3JVGC 3UXFA 4F24A 5BQ7B 1JYWA 2IANE 4NFBA 3IDXL 5BV7C 4XVTH 4A68A 4NHCL 3D39B 1E8WA 1O6TA 2RIKA 3UG4A 3V6FB 3MR9B 1CL7L 1F3RB 5AVWB 2H4EA 5HDQL 4HISA 3BQVA 4AYDC 1LL1A 4LLUB 3FQRB 1LO5B 3MLXH 3GSXB 1SYVA 3EYSL 4KC3B 5LN4A 5DZ9A 1I7RB 3DROB 1OL0A 3RWHA 1TFHA 2NY3C 3ETBJ 3HZKB 1KZQA 1QO3B 4UMSA 5FGCE 1ZLDA 1SJHB 4TUKH 2FJSA 3CH8A 5DHVB 4WJKB 4U4IA 1HOCB 5ADOL 1QABA 1T22B 5DT1H 1MWOA 3NMEA 4D9RD 1SNRA 1U92A 4NDMB 3O2WH 5HHXL 3C08H 1IJNA 4KROD 5C0DA 3SPHA 3T08A 1YEWA 4X6CB 3BUBA 4LLWA 3PV6B 3EBIA 4F5CA 5CZRA 3MNZA 4XNMA 2I9LA 2XA3A 4L5FE 3RX9A 1PDKA 2OV0A 5FM5O 3SD5A 1TKWA 2V2TB 2FX7L 1QD0A 2BOCB 2XXGA 5TTRA 1W0YT 3O3BB 3CZFB 1TVBA 3VXRE 3NPZB 3FQWA 4PJ5D 4OGYL 4UAOC 4X98A 1MCRA 4E5XB 3QEQD 4LRIA 3ZE1E 1RIUL 3G3LA 3P3UA 1GGBH 4L4TD 2OSLB 1UZ6E 2FTAA 2LOEA 2CLRB 1JVLA 4YHKH 3DX9B 4ILDA 4AM0A 5DJXB 3DBSA 1QKZH 5ACMA 3LPOA 4DQAA 3KPTA 3VX0A 3APNA 3J8F7 2P26A 4JZJA 2RAMA 2ZXGA 3IU4L 4F7PA 3NJNA 2Z7WA 1SXZA 3S35X 4PJBA 1CL7I 3Q5OA 2X4OA 4HCRH 4GAJH 4UT9A 3TONA 2RALA 4PRAB 1UURA 3HNSH 2ENSA 1PBYA 1UD6A 3ESMA 3DJTA 3UG5A 2Z7YA 1RJCA 2Z91B 3EJUA 1AD0A 3P0YL 4NRXB 2H2PD 4Y4FD 3VO0A 5D7IF 2ZICA 3KZ8A 2VERA 2VRQA 5CR8A 3D39A 2EVGA 3K72A 5F2FA 4ZW5A 1XSOA 4XP1H 3HCVA 1QI3A 4UV7H 3PQYD 2ZCKH 3NJMA 2AK4A 2R69A 4FTDA 3DROA 3FQ2A 2WC7A 3OAYK 4EZMA 3HZKA 2EH8L 2DJUA 3D2UD 4AM0Q 4XXWC 1AHMA 1HHHB 5EZPA 5GSRB 1CD8A 2K9UA 2ZX9A 5GISH 4LKXA 3S3CB 1OAZL 4ZMWA 5BW7A 4R2GB 1DSWA 3QB7C 3TFKD 3Q43A 1OT4A 4NRZA 3VU1A 1JK9B 2ESVD 3LKRB 1CLOH 4DHLA 2BSED 1FFNB 4G8EB 5AG9A 2NX5E 1EJOL 2R9HD 4OGZA 1H8SA 1N2RB 1DN0B 3HG1D 4JVPA 5ID1A 1J05A 1P7QA 4U0QB 4Z3EA 1Z9OA 4K9EH 5IW6B 3O3BA 5IP4A 4JRXA 4A7SA 3QAQA 4X6CF 2R1WA 4HJEA 3KD4A 4NX0A 4WU7B 2OLDA 4DGWC 4NO0D 4EBQL 1O9ZA 3BPNB 4K7FB 3KVDD 2F18A 3BN9C 4C55A 2HKAA 4ZUVA 3U7YH 4BJLA 3NCBB 4LOVA 1XWVA 4HT1H 3IAGC 1TJIH 3DX9A 3GFUA 5F70A 2VL5B 2ZXCA 1KXQE 4MA8L 3SYQA 5HDWA 4S2SA 5AB2A 4V2CB 1GAFL 3FO2A 4HIJA 4G6JL 2EXWC 4JFEB 2WLNA 3UTQB 5HYSA 1WGVA 1A7BA 1SPDA 5I6XC 4FFZH 4PRAA 5IR1A 4IRJD 4G7YL 1RZ8A 3SY0B 2H2SD 3HFML 3Q0HA 2UYLA 5GGRB 1SN2A 3JWOH 5C97A 3O6KL 5EU6E 4NRXA 1CN4A 3F58H 4O2EA 1PVHA 4UYPA 5E4EC 4TPRH 2HFFB 5FYKD 5I16B 2BJML 4JO4L 2H0FA 4QYAA 3O6ML 1KTRL 4D0BB 1AHWA 1FORL 2JKNA 3B8SA 3U36A 4HS8L 1ZGLP 2V17L 3LS5L 4MCYA 4GI9A 2VO8A 1NCWH 4W9ZA 2Q2LA 1OAXH 3HVNA 3DPDA 4N2BA 4H88L 3T8XB 3CLEH 1L9NA 1S9YB 3HS0C 4NT6A 4X8JB 2VH5H 2NXYC 3G5YB 4MXWH 4OZ4B 5GSRA 3ZDXE 2AGJL 1AXSB 1MVUB 3P3RA 3PFUA 2DQ6A 3OKNB 1TFPA 3KLQA 1RJZA 5J6SA 5DVOA 4B0MM 4OLXL 3KYNA 1RZJC 3FU5A 3VAEA 1T1ZA 5I24A 3L95A 4OLVH 2BHYA 3IE4A 3DO7A 4J2XA 2A4EA 3OMIB 4RMQA 3FDWA 4NQVA 5E8PB 4N0CC 2VUYA 1QI4A 3P4OB 3RGHA 1UKTA 3A4FA 1IL1B 1WFJA 3KGUA 4BSVA 5GHWL 2NY0C 3MLZL 3OKOA 4MAZA 2VZOA 5E8DL 1E4WH 2WWNA 3H2QA 1M3IA 5I66B 2VXSH 1HU8A 4U1NB 4WU7A 1DQML 5E5RB 4G6AC 4M1CC 5AVRB 3UTSE 4K7FA 2JI1A 1U9KA 5KSAB 5A3IC 5T1JA 2N01B 4KAQL 3IU3A 2O5ZH 3RAJL 5F21B 4G5ZL 4L8SC 3MRPB 1T4KA 5IM7B 3JTTA 1A7NL 2VT0A 1J1PL 1VEOA 3EH3B 1GS6X 1BSIA 3EOTL 3U2IA 1X5ZA 5I73B 1TTRA 2VN5A 5G5DB 3UTQA 1AQHA 3HMXL 1FNEB 4MAYD 3HI5L 2VR8A 4TQEL 4F7KA 2AAAA 4R7LA 2HX7A 2GQHA 2FL5B 1QUNA 4B6ZA 3SY0A 4I5BB 1WRFA 5CKGA 1PYWA 1G7PB 4FKKA 2A38A 2VAAA 2HJLB 1FDLH 1G5GA 3Q9QA 5DMIH 2HFFA 1DTUA 3U2SB 2X9WA 1KMGA 2IDFA 1ETZB 3QDMA 3AITA 4HWEH 2XBDA 3EGXB 5EN2A 4RRPG 5T1KD 4ONHB 3OKEB 3PHQB 4MKMA 4G6ML 5F7FA 1CICA 5IB5A 5M94B 5JQ6L 2P8MB 4WI4A 4IU3B 3V6OE 3WFDL 3G5YA 4OCRH 4Y5YC 4ALAL 4GRWE 1MVUA 1KY7A 1I1YB 4M6OL 3OJVC 3VFRA 3ZZLA 1LWHA 5IOPA 4NXSA 2FT7A 4IJ3C 5F1NB 4HVBA 4PWIA 2FNWA 2TAAA 2GI0A 5JPMA 1AY1H 1CGSH 3S36X 5F88B 2CZNA 2Q0ZX 4KK6C 2OL3L 5EDSA 1OB0A 1MEXL 4AJYV 4EI5D 4YQXL 3CVIL 1DLFL 2NUPA 5JZ7C 2D03H 5ERWB 1S7WA 2DL2A 1FHNA 3T3MB 1EUUA 1ZANH 2B5IC 2ZUUA 4HLZG 3OAWA 5LGHH 1GCFA 4JJ5A 5I66A 2DMCA 1YJDH 2WN3A 2ZX5A 4EI0A 1HI6B 3OKMA 1FUNA 1TETH 2HKHH 4P2QD 1EEQA 4HK3J 3KBHE 4PJDB 4RFEB 3JT2A 1F1GA 1FV1B 5IESL 1XXFC 4PWJA 3ULUF 5IM7A 4KTGA 1HSBA 3DNKA 3VD5A 1EAJA 1S7RB 4DW2L 2XZQH 5C2BL 4N90E 3GD1C 3LNIA 4POZC 2DYSB 1A4KA 3L1OH 4JQIL 1JPFB 1CFSA 2WXIA 4RGNE 2WSDA 3GRWA 1TCRB 1PQZB 5FPIA 5IEHB 3MYJB 3APCA 3NJFA 4I5BA 3DO4A 2GY5A 3VG9B 4QHKI 2YWZA 3DTDA 4CNIA 5TQ0L 2HJLA 2YAMA 3EADA 3P4MB 4X0KB 2X0VA 3U2SA 1ETZA 2OSWA 2XKNB 3TTSA 5SWZB 1CFVL 3HS8A 3QJXA 3EGXA 5F71A 3VFTA 4KGJA 4NQCD 5T3XL 4JFFE 4WGVB 4O5LL 1KBKA 4MLIA 5F0JB 2ADYA 1PLGH 2VITA 4ONHA 5I82A 5IVOA 2GJ6E 4PRIA 2Z3FA 3K6IA 1F86A 4LVNC 5CLTA 2RR3A 4RMVA 3OV6A 5C9KA 3A3YB 3ZYZA 4EVNA 4PYGA 4ZNEE 1FP5A 3KLLA 3RZCA 4HHGA 3UAJC 3N1PC 3ZDZE 1OCZB 1YEFL 4RBPK 1I1YA 1NGWA 4KNUA 2A9DA 4ETYA 5H37H 5DRZB 3M17B 1OP3K 4N1CA 5KVDH 1DANT 2ZXEB 3I50L 2ZSWB 1CXIA 1S3KL 5F1NA 1I7UB 3QDJD 2V2XB 3G6DL 4HIIB 4XBEL 3WTYA 4B9ZA 4XN9A 5IFAH 2BSRA 3W39B 2VC2L 2ZPKH 4H1LG 1BV8A 4U1IB 5C07B 3LX9A 4G42B 4GKNB 5BZDB 5B3SB 1MI5E 1MRFL 1NCAL 4PM1A 5KS9A 3UTPD 3QO0A 1LTXA 3BH9B 1SGKA 2VERN 1P4LA 3GJEA 4MJJA 1KEGH 2B4CC 4XO3A 1IFRA 3N42B 4N8VG 4M02A 2F74B 3VFVA 4ONFH 4Q7DA 4MJIB 4OD1H 3FRUB 1VZHA 1YC7A 4GQPH 5F9WC 2VAJA 4GW1B 4F2ME 2F58H 2HMIC 4WSJA 3O6FC 5KOMC 5E9DA 2P47B 5A40E 3B5HA 4RFEA 3IGFA 4I3SL 3T3MF 4FA7B 2PN5A 1FV1A 4LHUB 4ZW3A 25C8H 4PB9H 4GJTB 1EIBA 4P4KB 1BM3H 2GUYA 3LAFA 1OGPA 3NH7H 3QNZB 4WV1A 5DK2B 1KLUA 3VXMD 4BFKA 4KFMA 5DR5H 3VNZA 3MLWH 3ISYA 1JPFA 2JJTA 4JS7A 3EBHA 4PJDF 4X80L 4KY1L 2QVIA 4IEFA 4JRYE 3FFDA 1F4XL 2FR4B 1EEYB 3MYJA 5JOFB 1LO3L 2NNRA 4AIZA 5C0RL 1ND0A 2EUVA 3P4MA 5EEZA 2LU7A 1NCNA 4F8TA 2Q76B 4J39A 5JUEH 1HL4A 3S88L 2XKNA 5FYKU 4QO1B 4F37K 1TMQA 3QSKB 2WQRA 4OU3A 5CFAA 2CDGA 2BHZA 3WUWG 5E8EB 1WZMA 3U30B 4YK4B 2YPLD 3QG7H 3VGDA 1X9LA 2I7OA 2JIXB 1BPLB 3WYRA 1ZGLA 2BSSB 1XXDC 4DP0X 5AAWA 1T2QL 2J73A 5DRZA 3MLVL 3EJYD 5CIPA 7PCYA 1DVUA 4LEOB 5GS2D 1LQSR 2V2XA 4GSQA 2E7DA 3ARBA 4YXKH 3TXAA 1UM5L 4D8OA 3NA9L 2E76C 4U1IA 5C07A 4L4TB 3BD5A 4AV4A 1CXKA 3N43F 2I60H 2YHGA 1AMYA 4HSCX 2BS8A 3BH9A 1S78D 3DJ9A 4LRNH 5IIEA 4UQAA 1JJUA 3WFBH 4TOYL 3ZTDC 1E4XI 1AIFA 2V5YA 1YEJL 4HJJH 1LO2L 4HJIA 2CDEB 2CPCA 1QWHA 2OZNA 1VFBA 4MJIA 1KBVA 4HPYL 3HE7B 1FYTB 4GW1A 3VWJD 5DJ8B 1TQSA 2VC2B 2Y24A 4U1SA 2VMEA 4JHZA 4R2GC 2FQFA 1IAMA 3BD4A 3S4SG 3WFHB 1PLCA 5DD0H 4AX3A 1WHOA 2GG1A 2AMUA 1S5HB 3FFCE 5GGSA 2Z35A 3N42F 3B4NA 4DP9X 4JFXA 2QGDA 1IIKA 1WICA 4NM4L 4PHXA 3MJWA 5ICZA 5AW0B 4AY0A 4D8PA 2AK1H 1BD2E 4JDZA 5D7LB 4MTMA 5KYNA 5J6HB 2EVIA 4AMXA 4WHYG 2CRZA 3V0EA 1EEYA 3PREA 3Q2NA 3BPNC 2NNFA 3D18A 5B4MD 3UP6A 3EOBA 4OZFG 1S7XB 1E9QB 4Y1SA 3TBVA 3TEZA 4RIRB 3H56A 2OPCA 1NGZB 2YD8A 3ISWA 3AADB 3LXUX 4L5FL 4NIYE 1LK3H 3RVXD 4OCYH 3QUXB 4B95C 3V4UH 4DKAA 4ZXBC 4HPOL 4JN1L 2G2NA 5HJ3B 3H3PL 2QHLA 3D06A 1F11A 4ZX3A 1ESOA 5DHDA 5E8EA 4Y1AB 2COQA 2CPUA 2X4UB 3WY2A 5JOPE 1KELL 3CHSA 5ACZA 4XXCA 3NZSA 1I9JH 2LW3A 4LSDA 1NGQL 3KH3A 4ODTH 3B7UX 3EJZC 1WWAX 4MQXD 4NFCA 1HCVA 4G9DB 3VWKD 3IDUA 2FCBA 3ZE0E 4PJ5A 4PJFA 1XTMA 2ICCA 3O4LD 1TLKA 2VDOH 4ODHL 1E3FA 1QZNA 4YNYA 1R34A 4QJ4B 4N2GA 2CDFB 2VZSA 4RETB 5TDPB 4ZD3H 3EH5B 3Q2CA 3ARTA 4L4TA 2EO1A 5DFVC 3V52H 4AYFB 4KKBD 5HHME 5BRZD 2P24A 4LOEA 3TEUA 1JGUL 1UVQB 3VQ1C 4Z76B 3TT3L 3L1EA 2ATKA 3ZMEA 1IM9B 3QJRB 3SQOH 4RESB 3F7KA 5DK0A 2IAMC 3T0VA 2PYED 2DQDH 4LLVB 5DJZA 2ZUSA 4KHTH 3GB7A 3AQYA 1ET7A 1AS6A 3RDTD 4FF9A 5T1LB 4HALA 3I2CL 4WHDA 1HKFA 1UCTA 3UIYA 1WZLA 4GT0A 2JV6A 1BYNA 1BQKA 1WFTA 1GZHC 3GMQB 4U49A 4Y4FA 2GJZB 2PP8A 2OJEA 3NVQA 1DBJL 4CJ0A 3KDPB 1T66C 2H3XC 4BZ1L 1TU2B 1KJVB 2IANB 3VE0A 1EHXA 3RGVD 3TP4A 3PQYA 4GFTB 3ULUC 1OW0A 1N6QL 2ZKHL 4AG4L 4Q0XL 5E2WH 3S34L 1ILSA 3ME0A 4PCTA 2J43A 4RZCB 4IHOA 4BZ2H 3ULUH 3T8MA 2B20A 5KSAC 3UFIA 2CR6A 1WBYB 5C0JB 2CO7B 3Q3GA 1JTOA 3OKDA 4UILL 1G9NL 3L9BA 1CBJA 4R8WL 3DIFA 4YDKL 2X6UA 5DJ0B 1A6ZA 3G04B 3RNQB 4ESKA 2Q1EA 4OH2A 1UD5A 5E5MA 2ESVA 1YC8A 4QNPE 2BSEA 3H6AA 3TA3C 2WBJC 2XG5B 2X4UA 4R83A 3MHZA 1HEZA 3HG1A 4G8GD 1Y7VA 5FGSA 2OFQA 5I6OA 3HHRB 1NINA 4GAFB 2JQAA 4G9DA 4LEXH 4M8QA 3QO1B 4JY4A 2G5UA 4TS6A 1IEAB 2P5PA 2XZCH 3WNJA 1N64H 4NI6A 2JB6B 5HI3D 1UFUA 2CDFA 2YRBA 5DYOB 5IV2B 5IQ9B 2NY6B 4GQQA 1E65A 3T2NL 2D7TH 2HRHA 3FOMB 1XF3A 3ZE1B 5CJQL 2VCOA 1UVQA 3SDAC 1JD7A 1MREL 5CGYD 4ZBJA 1C16A 1Y18B 4MJ6B 4YHNA 4YBQD 5JNYB 3OLIA 4QY8B 4HJGA 5KG9B 2WXJA 1P1ZA 5CD5D 3NACL 2YEQA 3L7EA 3DK2A 4GAGH 1OTTC 2YKLL 5CJ8A 4YH6A 4TMPA 2JI3A 2BIMA 4NZRL 1R3LA 3QEGH 4IRJA 5CS7A 3LIZA 5BVJB 1CYWA 5T1LA 4X9HA 4ZTOL 2JWYA 5BMFH 1PX4A 1JZEA 5BZZA 3RRQA 2ZX6A 3E2HB 1FFQA 1T2JA 3BQUB 5CNHA 1UTDA 1NKOA 3ZTJH 2EILB 3SJVE 2HP4A 4WKXA 2JQMA 5IQLA 3L4CA 4JDVB 3MNMA 1G7MB 4GMTH 4X5RA 3IJHA 4N1EA 1XGUA 4BE5A 2OI9B 4HJ0D 5CEZH 4GS7B 3A24A 4HWZB 1OCRB 4O51A 1MRCH 3EBAA 4FZEH 2UZXA 2QDVA 3MX0A 3BC9A 3OJDB 4K3DH 2J2ZB 4JB9H 2KERA 1C8QA 5DJ0A 3G04A 3RNQA 5C0AE 3M07A 3FKUS 3K71A 2P28B 2ZCLH 3W0WD 4PD4J 1RPQA 3GM8A 1KCSL 1FZOB 1OB1A 1YEEL 4ONOA 2R2HB 1U6AH 4KK9D 5EFIB 4PJXE 4DERA 1GL4B 2NX5B 2RQ8A 3HHSA 1T6WA 4N2KA 5EBLB 3DRTA 1OAYL 5DVKA 2FWSA 3VG9C 1IAII 3WEBA 1FFPB 2UY6A 3NJIA 4X9IA 2RFXB 3IMRA 4PG2C 5F0MB 5IHUL 4BFIB 4NWUH 4DTGH 1H9DA 1CFQA 2EIZB 4X5XA 2F0CA 3U7WH 3B7SA 5IOKA 4GAAA 5TK2A 2B9BA 3FOMA 1X5MA 3EOTH 1BF5A 3ZU8A 2WYZA 4W9FC 2NR6D 2FLMA 2Y7MA 3KCPA 2YO3A 3EUUA 2H1PH 1YN6B 2A6JA 1ZLUH 1S6NA 2BY1A 5KG9A 5SWSE 1CDHA 3MRKA 2A3TA 1ZK5A 3P2DA 3PIQB 3BT2L 2ZAIA 3KWUA 4DGIL 4MAYA 2WIIA 1E3XA 3ZE1F 1HFUA 2K45A 2WYIA 4WTXA 4KQ0A 3CJJA 3EO1B 4GIAA 2R1XA 4WO4B 3BE1H 3D0AA 1CDYA 4IBVA 3BQUA 1KB5L 1N59A 5FYJH 4C83B 3HUJE 1I1FA 1N70A 5LAPA 3KGRA 5EU6B 3ZZSA 3CVCA 2QQNL 3PPEA 1W72A 4ALAC 1WO2A 5T1KA 3WJJA 1VFAA 1RZGB 2I69A 4U1MB 3WOVA 3X13B 3MJ8A 4WY7L 2FRGP 5L2KD 1JPTL 4DZ8A 4OZGA 1PZUB 2O61A 5F9OH 3CFBA 3QUYD 1QFWM 2G75A 1YEKL 3IDNA 2CD0A 3F12A 1T5WB 1BQHG 2J8UF 3OJDA 2J2ZA 4UQ3B 3ARDD 3GS7A 4F20A 4FQ1H 1PZCA 2OL3H 4U1GC 3WMSA 1T1YB 3FAXA 3KLHD 2VWEC 4P4KC 4QHKJ 5IG7B 5DSCB 3EAKA 1Q9OA 4YQXH 2MHAB 4EXKA 3DHJA 5TE6L 4M62L 5B21A 4G7VL 1FZOA 1CI5A 4EI5A 2R2HA 4R0LB 4LDCA 1XDTT 1AGBB 1KIUB 1T5XB 3GPSA 4PMFA 4QF1B 4Z3HA 5GZOC 4E9TA 2HVJA 3SCMC 3US1A 3ZIMA 4Y4KD 4Z7WE 1FFPA 1A7OL 4HYTB 4X4XB 2IQ9H 2JTYA 2RFXA 5C09D 1IM3D 3T9WA 4I0KA 3LQAH 2Y7LA 3CPLB 3RQ3A 3SE6A 1I3GH 3CFDB 3BLKA 4P2QA 3HC4L 3DTUB 1XIWC 3UTSB 5JO5B 4J8QA 5C8JB 4YDJA 2J1WA 3FT3B 3V0VA 4R26H 5JA9A 2R51A 3MZGB 2QT6A 3H6JA 4YK4C 3MRFB 1MCQA 1HINL 2YEZB 3CQFA 5DTFB 1HXYB 5JTWA 2BWDA 5K1VA 1IC7L 3AS1A 3IVKB 3IKCA 3APDA 3ZBMA 3QJOA 1J86A 4ANUA 4ERSH 1S7TB 4Y9FA 5L9DL 1IB5A 2AV7B 4F8QA 1MWAL 3E9UA 2OZ4L 4Y19D 4GUPB 5LCVL 5ITFB 4KUCF 4WO4A 4XCFH 1KIRA 3CWGA 2W9EH 3DX7B 3WO4C 4EUPA 4CMHC 1S9KC 1YYML 1N68A 2R7EB 2CBQA 2ADIA 3LDBB 3DETD 1NUNB 2VLKD 3VGEA 2COVD 2Y06L 4QAMB 3EKCA 4NQCA 4JPVH 1KTLB 4L9DA 3OZ9L 4CVWA 3OB0K 4E41E 4NIKB 1RZGA 4KWUA 4U1MA 2WLYA 4JJHA 4I88A 2YFNA 1UOWA 1THCA 1U95B 5IWLA 1LK2B 2JB5L 2X1WL 1HS6A 3HE7C 5AKRA 2EDWA 4EQ3A 3TVMB 1ASQA 4MWFA 4JCLA 4YHOH 4E42A 5EF2A 4HBCL 1CF8L 1ODUA 3UJTL 5E4OA 1T5WA 1KFGA 1OVZA 4OZHE 1J48A 4UQ3A 4L1LA 4HHWA 1FO0A 5E8OA 1CDUA 3BX7C 3QDJA 4NNYB 2LT9A 4GRWB 5DSCA 1AGCB 2OJZH 3C5SA 2MEJB 4HUUB 4RFOL 3ZL4L 4IBTA 2FE0A 4XWOC 4NGHH 1FN4B 4DP4X 4MDJA 2XI9A 1LNUA 3MCG1 3RWGB 2XN1A 3FT2B 1A64A 2VQ4A 1OTSC 1Z5LA 3QDGE 1IVLA 3VG0L 3ZDXF 3FHAA 1DO5A 3P9WB 4RAVB 3LB6D 4A2GA 4KU1A 3L5WA 4M5ZH 4PPTA 4DJMA 4PP1C 5HGBB 3WTUA 2XWDA 4BCYA 4XVSL 4QLRA 2FVNA 3RE0A 3I6GB 1JDDA 1TZHA 1UCBL 1E4XH 1YMMD 3DDGA 1JYNA 1FL3A 3VD0A 4K8RD 5D93B 2IDUA 1O6SB 5GGVL 4WEUD 3FT3A 4KDTC 4FP8L 3HKZA 4YLCA 3MGTB 4EIZC 1O75A 3RGBA 3WDJA 5EUKB 2ZUXA 4M5TA 3TO2B 3VXMA 4KY1H 1KGUA 2Y5TB 5AB0A 2K70A 1CD1B 1KNOA 5C0RH 4HUMB 1ULVA 1Y6NR 3IXAA 4PQXA 4YGAB 2AV7A 5ANME 4M7JL 2WXOA 5AD0A 3ILPB 5ITFA 4RGNB 3JQOB 1CT8A 4O4YH 3TCLB 3MV01 3BFWA 1G7HB 1XF4B 3H0TB 3RL2B 2Z92B 4WQOA 2R7EA 1OP5K 5DJCB 2C5DC 4ZG1A 1T7WA 4QRPE 4K2UL 2PWFA 2X10A 3V0WH 3GLDA 2ORBH 1ED3A 1MWAB 2DMHA 3DV4A 4JFFB 1U95A 2FEDC 4JO3H 4M4PA 4X6FB 4DOHE 2YPLA 3CX5K 4IOSD 2AQQA 4M7LT 2GJ6B 1SJXA 5CZVL 3D3VD 3OJMB 3S8WA 4AIOA 3VWKB 5DC9B 1GW0A 3HZMB 2QQKL 2CA3A 2F53D 3NSXA 5FLUA 1IEHA 3ZDZB 3CVHL 2KQNA 4V33A 4HUUA 1Z7JA 3GEWB 4ZFGH 5LGJA 4X4ZA 4AGNA 1KACB 3H55A 1G0YR 1Z2KA 4J27A 3UZEA 1LEKA 3RWGA 4U1LA 1JV5B 4YHPB 3VXQB 4S1QL 5IB1B 2WVTA 3VD3A 1KSRA 2OMTA 5DC2A 2DMBA 3O0LA 4HPYH 5FECB 1MCPH 2E4TA 3DECA 3GDCA 2F7IA 4FQCH 4PYHA 2PF6A 2PYEB 1F58L 2D31B 1OD9A 1HXMB 1K3ZA 3VWJA 4BQ9A 5E99L 4F80A 1S9XB 3FPXA 5C08E 4MMXA 4OF8A 4Z6AT 3HC2A 1WBZB 4AE1A 1EJFA 1QBLH 2JKIS 2VISA 4JEGB 4F2MB 4XI5D 5LAXA 3WI9A 2WO2B 3SKJL 1JSYA 3D4CA 4UM9D 1E8XA 4XN2A 1JZJA 2HYMA 1W80A 3HPLB 3FTZA 3MGTA 4FLSA 5EUKA 2JH2A 4PVNA 1JTTA 1RL1A 3SGJC 2A74B 1NEZG 1CE6B 1OGTA 1DQDL 2BVEA 1KG0B 1RUPL 1DFBL 3E8UH 3MLUH 4NJAL 5IBTH 4OLWH 3VW3L 1MFVA 1P7KB 5AW8B 4AQ8C 3BVWA 1RAMA 3F7PC 2J7LA 3BW9A 3ILPA 4H1LB 2EYTA 3TN0D 2EJ1A 4N0RA 4JRYB 3VMNA 1NMAL 3WEMA 2DQTL 2NY6C 2XFXB 4UZSA 2X88A 3L4XA 3TS8A 1G5AA 2H32A 3K3QA 4M29A 2UZPA 3QQ9D 4LCWE 5I0XA 2XXMB 4N8VB 1XSJA 3MRDB 3ARGB 3LZLA 1FZJB 3FH7A 5D1XE 3PFQA 4PCSA 1YECH 4O02L 2JKWA 1IBDA 4PGBB 1KJ2A 3BUQA 1AXTL 2CRMA 2X3CA 4MRCA 1S5IH 3O0RL 1G87A 3VWKA 1R9FA 2IPUG 2EKSB 1U8JB 3KPMA 3E2HC 2GABA 1AZCA 2K7QA 2YRZA 4PLKD 4AGLA 8FABA 3A4DA 3O4LA 5D1ZB 4AL8H 2XN9D 3PWLB 2VL4A 2IADA 2E46A 5EMYA 3VI3B 2FBJH 3TBBA 2IDTA 1BECA 1AGFA 5D4JA 5A2IH 3O8XC 3GSWB 2K7PA 4PJGE 1H15A 2ZJSH 5AW3B 5KYUB 2OI9C 4GS7C 2BRRH 5DF0A 4UTAH 4C47A 5ESQA 5FECA 2YSTA 4MQTB 4GT7A 3SKUD 5BS0D 1U8MB 2PYEA 5LBSL 2D31A 2GT9A 4FFVC 1NOFA 2GKIA 1DCEA 1C5BH 1V3LA 5ENWB 2AXGB 3H54A 3RY4A 1BQLH 3L54A 4DH2A 3HI1B 4U1HA 2O6EA 3WUWB 3CBJB 1F56A 1MFEH 5IF0B 1FCCA 2FJGA 1DBJH 2PR9A 3QEQE 1BA9A 3ESNA 3A6BH 1D6VL 5GGUB 2BX5A 3F2LA 2A74A 5DD6B 2CUMA 4UT9L 4AYID 5HGGS 5JXAH 1NAMB 1U8NB 1WFUA 4LT7A 3RGVA 1G9NC 4DAGL 3K5SA 3RVUC 4QTHA 3T2LA 4EDWH 1BD2B 2EO7A 1QHPA 4LF3B 1M7IB 4LL1A 1OQXA 2BW4A 4K5LA 2ZWSA 5EU7C 4HIEB 3DVFA 4PI0A 1A1MB 1AGEB 4U7MA 2IPKB 3UZVA 4PJHE 4C4BA 4ZQKA 3GO1L 4DPBX 3KPOA 7CGTA 4N0FB 1J1XL 4NP9A 5AOLA 2K8MA 3OAZK 2BC4A 4TV3A 2AEPH 2CR3A 3MRDA 3SPVA 4ANVA 1NFDF 1KXTB 1FZJA 1ET5A 1T0NA 1CDBA 5SV3A 4ZMXA 4ZTPH 3S4SB 4I3GA 3JUYA 4EI6A 5KSUA 3BP5A 3H7BB 3ZTNL 4JPKL 3FW6A 3A5VA 1X5GA 4XN4A 1KTJA 3HAEH 4HUKB 2VR7A 3QEUB 3VI3A 3ZE0B 2ED6A 3BUIA 4ZDHA 4O02B 1IAIH 2OJ1A 3MREB 3REWA 2JI2A 1H6EA 4NQXB 5FKAA 1XF2B 1IGFH 1AKJB 3NACH 2VLRE 3IFNL 2D7MA 5HHMB 3NPSC 3VNYA 5IHWA 5KBNC 4OZFB 2DQUH 4GMSL 5CLZA 2DEYX 3CXHK 4PHZA 5JW3L 5T8IA 1JV2B 4PRNB 3CPUA 4I1RA 4RAHA 1Z9PA 5ENWA 1X4XA 2AXGA 2VSDA 1BZ9B 2Z6FA 3LVEA 3U2JA 3HI1A 3B5GA 4GSXA 4N2FA 2WXKA 2FX9H 2E8ZA 4Z7VE 4U0RC 5IF0A 2YD1A 4RDQG 5FM5M 5EZOH 4HGWA 3T4YA 1IJ9A 2F6AA 2O6FA 5GGUA 1QTPA 1AVAA 1FSKB 2K9FB 4NENA 4XP4L 1BFSA 2VDML 4HC1A 3I3BA 4FQXD 4H0IA 1AJ7H 5D5MA 1NAMA 3B2VL 1A6VH 2MRYA 3K74B 4FFWC 2IAAC 4M61B 4UZGA 2WBXA 1IZJA 2WZPD 2X9XA 3GBEA 4JDEB 4JJOA 1SDAB 4ODUB 4BSWB 1VESA 4PY8I 1KCVL 2ZOUA 5DEGB 1XB8A 3FN0L 4FLHA 5I9QB 3WIFB 4CC1A 4HIEA 5J8OA 4MRBA 3IS1X 3ARRA 4HG4K 1P7BA 3C60B 1DVTA 1K9TA 4PJIF 3QXDB 2C8NA 2W1NA 1F3DH 3S96B 2K78A 5CCKL 4N0FA 1O7SA 2WSKA 2QPFA 1SN0A 3QAZB 3VXOA 1KXTA 2VLLA 5D9SB 5HHVH 4NS0A 4HUWA 2EZ0D 4HH9B 1NDMB 1UC6A 5ESVB 4PS7A 2P7TB 1AZVA 4OJDH 5JR1L 2DKSA 5EDXA 2WJ7A 3PGDB 4XB7A 1J12A 1Z9SA 2BY2A 1D7BA 2LVCA 3VXSD 4XMKL 5G2NA 4J3TA 3LDBC 3SGDI 4JR9L 1TQVA 3L1GA 3ROOB 4E9VA 1BF8A 4NUGL 1F18A 3CXDL 3VM5A 3H8NA 3M8OH 5B3NA 4ZX5A 4UOJA 3OHXA 2XLLA 4OM1H 1P9MC 2NR6A 2NY7H 5BOJA 5IUSA 2M26A 3VA6A 1HEJC 5IJKA 3NDZE 3OX8B 5MERB 1TIUA 3GMLA 5KVMC 1U8LA 1GKEA 1M3JA 3ZE0F 3TVMC 1K2DB 2A77H 4B53A 5C86A 3CC1A 3P3SA 1JV2A 1U4EA 3V6OC 1ES0B 5FX3A 4QXUH 4P2AA 5IY5B 2Z8RA 2X70A 4I77L 3B7TA 2QHRL 3O2VL 1QTYT 2ISDA 3CDZA 1T89A 1Q0YH 3RVTD 1CBVL 2BP3A 3GI9L 1U4FA 1WAAA 1ZV9A 2VLKB 2C7UB 2IWGA 3GNMH 3SQBA 5TDNB 2JJSA 3SJVB 4L0PB 3INOA 4DK6A 1GMEA 4HU2A 3D0LB 1A0QH 3EOYG 3EZJB 5D6DC 5L2KA 4QRRD 4FJZA 1XZWA 4WI9A 3C5ZB 3QUYA 2DWTA 2XVLA 3MLRL 4ETQB 4MD4A 2R29H 5D4IA 2VDKL 4LVOC 1M7UA 2YGNA 3ARDA 1EV2E 2FYVA 3FPYA 1HH6A 3RURA 1BJ1H 4M9OA 3SPIA 5LDSA 3AY4A 3M1BB 2OCCB 4WVRA 3S2AA 4PGJA 2CRYA 3E8VA 4IRZH 5C0AB 4L8DA 1S7SB 2DQJH 2QKIA 2P7TA 2EDOA 4UDTB 3Q2VA 4RGNC 2XA8L 1QACA 4PJXB 2HKFL 4Y4KA 3FULA 3CTTA 3LJ3A 4IRSD 1LEGA 3SKOA 4ZJ9A 4F9LC 2WQWA 5C09A 2ITCB 4XCYB 5IVZA 5LB1A 1F90H 3V5HB 4ZUTB 3EO9L 1JYVA 3L4UA 3OPZH 1QSVA 3FTVA 4JBSA 1A6WH 5CP7A 3VXPB 2CO3A 1TTAA 3MBEC 3N3EA 5DUPH 1MCNA 1U33A 2DDQL 5DJ2A 1V55B 4UOW0 2X6AA 3QA3B 5FW6A 4WFED 3GHBL 3L1FA 3KLAA 4KTDH 2WQ8A 2C1OB 2Y07H 2HVKA 2QVMA 3PWPD 1BQUA 3FB8B 2HJFB 2DQMA 5DJAB 5H2BA 5IMKB 3L3DB 1EO8H 1OCWL 1PFCA 5E94B 5E2TL 1R5IA 2Y36H 1HYRC 1J8RA 2UZYB 2Y5QA 3RVWD 1BW8A 4QLWA 3H9HB 2EADA 5HI4D 2EP6A 4OLEA 5SWSB 2D0HA 4EUPG 4Y19A 3QIUB 4PN6A 1HDMB 4MYPA 3HG3A 3BVNA 5LLIC 4OJYA 3ELAT 5EWIL 2IPTL 4KY2A 2B1OA 2VLKA 2WWMC 3BXNB 4OIIL 2C7UA 3GRWL 3VD1A 1TZ8A 3P3TA 1GGUA 1TYRA 2UXFA 4JUTA 5CILH 3HUJB 1LE5A 1AH1A 1WYJA 3C5JB 3QQ3A 3R4RA 2QMKA 1Y0LA 3D0LA 4GRLB 4KZEL 1DL7L 1YUHA 5FOJA 3X3GH 3V4LA 4CILA 3V79C 4HIHA 5F7NC 4ETQA 2BVOB 1BZQK 2GBVA 1U2YA 4LE8A 4MLSA 2IGTA 4WFFD 3V6ZB 2RA1A 5GRJL 1ZDSA 2VW4A 4P07A 1P2CB 1WIUA 4TNWK 3QPXL 5K9JH 1MW0A 3SOBH 5FA4A 4ODWA 4YX2L 3S3DB 3FT9A 1F4YH 3K2UL 3DWTA 4JG0L 1UQSA 3PAUA 4AJWA 3GI8L 1RU9H 2J8HA 1SHXA 3RNKA 1D5BB 4L4VD 5BZWB 1UZ8A 4IYKA 5JPNA 4XGZA 3NGBC 4NNPL 1MW3A 4UIMA 3SGEH 5L7XH 3SYAA 3VFMA 3FSWA 1RV6X 3KEHA 5B1CA 4ZX6A 4Q9QH 4Z7WB 3EDEA 1YMMA 4FXKB 2VDLL 2W0FB 4NO5A 3W56A 5E23A 3MRQB 3ARGC 3FN3A 4PJAE 4E2OA 1GC1H 4YDLB 3Q8FA 4IGBB 5FHBL 1UB6A 1CVRA 4FXGC 5FF6A 3VRIB 2YD0A 3QZNA 3GSVA 3QI9B 3L3DA 3OMZA 1BQHB 2BVQA 2MKWA 2CBTA 5E94A 1MG3C 2OYLA 1N8OE 2OCJA 4XOAA 2UZYA 4P23D 4EDXB 3ARSA 4DQOH 1YNKL 1ZIBA 2QBWA 3HZVA 3RTQB 3KWTA 2OP4L 2WLIB 5D1ZC 1WIPA 3DO3A 3QIUA 4E9LA 1A9BB 4I89A 4LOUD 4C4UA 1ZLWK 1JZ5A 2EEXA 2XACC 1R5WB 4ZPTA 4KRPD 5IB4B 4OKVA 3BXNA 7TAAA 1KTDB 1EHAA 4OCNC 2DWXA 4KI5F 5FO7A 5IK3B 1QASA 3TBWB 1A3LL 5IJCC 2OMUA 3EYQC 4P59H 1GZPB 5DZLA 4Y8AA 4P49A 3D3VA 4F2FA 1IQWH 3TEXA 4LAQL 3FRPG 4HAKA 3O3AB 2UUDH 3DARA 3BWAA 1GXEA 4JM4H 2JJUA 4HFUH 2MKLC 2W38A 3FF8A 1P2CA 2C3WA 2FEEI 1ZRUA 2DJSA 4OZHB 2OXHB 2ID5A 2IDSA 2X41A 4U1KB 2F61A 1CFTB 3D2TA 5AOZA 2ZP8A 3BIKB 3Q01A 2AI0H 4OQTH 4DO5A 5BO1L 4F7CB 3BZ4B 4LPXA 3MOBL 3AABA 3NJLA 4X9YA 3GJFK 1OK0A 1KIQB 3MXVH 3SKMA 3QDGB 4ZSOE 3QPQD 5TPWL 3WS3B 5BUAA 3BKJL 1J8SA 2P5EE 1WZ1L 4ELME 4KKLD 5JORA 1XGPA 2NY1D 5T3ZD 2W0FA 3HB3C 2ARJB 4O2FA 1A14H 2OMZA 3EJJX 2FT6A 2VMCA 4OF5A 1MF2L 4QRAA 4UM9A 3ZZQA 5DMYA 1VENA 3S37H 4PVLA 4JNXA 5JHLL 3VVVA 1OARL 1WV7T 2MQGA 4OJFL 5IHHA 1LE9B 1I1RA 4Z7WF 2CJTA 2H9GA 1EEZB 1A7QH 3FCSA 1DUZA 1XAKA 1J87A 1UWFA 3IJEB 4GKZB 5T5FL 1NCBH 1QEWB 5IVNA 2VDLB 1TZIA 4J3OG 2Y7QB 1H19A 1A9BA 3TN0A 1ZTXH 4IOFD 4KXZH 4MMZA 5ANMB 1F4WH 1G84A 1R5WA 1DBKH 4AQAB 1HSAB 5FUOL 1KTDA 1NFIA 2W9DL 4XVUD 4ZUSB 4L37A 4G5AA 1MFBL 5IK3A 3P9MB 4JO2L 1E8YA 3WSQL 3TBWA 4GKSA 2BWQA 3L3OA 4QRPB 4JG5A 2DF3A 3GINA 1P5VA 3C9NA 1GZPA 4FXLA 1AGDA 2XIDA 1FAIL 4QXWA 1BF2A 2MOGA 5C3IA 1SYSA 3IRCA 4NQTA 5J6GB 5EZLB 3JWDH 1S4IA 3P2BA 4YBHA 3BO8B 5K9KA 3NN8B 1WSST 3GMNA 3BUYB 2HT2D 5C6TL 2FO8A 5CGMA 1PIFA 2OXHA 2QGBA 4FERA 1ZPUA 2MOQA 4LPWA 4WEBH 4OUOA 1SXNA 1R3JB 3LRHA 4L3CA 2HLAB 3KDMA 3OB8A 3DLQR 2OTUB 1GSKA 1FH2A 3BIKA 4PJCE 4M7LL 3T0BA 5CLWA 5FOBB 3CN3A 3P40A 4OSUL 1L6PA 2N3JA 5E56A 3NSFA 5I9QC 4IBZA 1EVUA 5BS0A 3P11L 1MQKH 1HKLL 4OZHF 4HHAA 1LO4H 4U31A 4JZJC 3C60C 3AG4B 1J5OL 4WFGE 4KKCC 1YLBB 5DLML 5EIQA 4BFFA 3KXFD 1L5GA 2WYHA 4AC2A 1B90A 1PLBA 2HT3C 3MLSL 2ARJA 5F1KC 4FADA 5DMKB 4H2AA 3D87B 1M7DB 4OB5H 4WSGA 3MROB 3W2DH 6PCYA 5E1GA 1KB9J 1BFVH 3P1VA 5BRZE 2WXRA 4UQCA 2HT4D 3HI6L 1J5HA 1SY6A 5HJDA 3EDFA 5I71B 4KH9A 3SDDC 3OXSA 3FTGB 1UB5A 2YGQA 1E6OH 2C4XA 2J4WL 3U6RB 1V7NL 4NKMA 5ADPH 3QHFH 4L1TA 2ZUVA 1IC5L 1U8CA 4NYLB 1NCHA 2R69H 2YMXL 5KS9F 1ACYL 4FQJH 5BW7C 5F3BA 1CR9L 4GG6A 1BBJB 4QHMB 3SE9H 4LCWB 2E9WA 4JPIB 4FQIH 4APQC 3AZUA 5CFHA 3ZR6A 2P8PB 4WW1B 2O93L 1WAEA 3DOSA 4OY9A 3JWNG 1XCXA 5D1XB 4TVUA 1EO5A 4ONGL 1FBIH 2QVTA 3L9RA 4BK8A 3VFOB 5EZLA 3C09B 5D2NA 2Y7SA 3BDXA 4PY8J 4LLMB 1X5FA 1FNSL 4J3XA 4BFBD 4LLQB 1TQBB 4HEMA 4AZ8B 3THMH 5KJ7E 3KHQA 1KDIA 4AKOA 4E9SA 1EWHA 1UWGL 4NQED 4WI8A 3RIFF 5C9JB 2XQBH 3SGDH 4PJGB 5SX4I 4UCFA 5JHMA 2Q6WB 5EULV 1XV8A 4G8GE 4KVCL 1YEGL 1ORQB 3C5ZC 1XCTB 3CZJA 5GJSL 1B4JH 3WHXB 4F92B 4CUCA 1LWRA 1FZMA 2NQDA 4XP5H 1UOKA 4DIXA 3RVVC 3JWNE 1G1OA 1AQMA 1KCUL 2B1HL 2J56A 3CSPA 4R4NC 3MROA 5B7MA 1XL4A 3CFJA 2VDMH 3EIFA 3X12B 2BFVL 2GY7B 3QJZA 4W4OA 2CK0H 3IDYB 5GQBA 5HVGB 5HI5D 4QRTA 4UUJB 3U0WH 2WZPA 5FO8B 1B9KA 4MA1B 5MP6L 2WQUA 4KGLA 3FTGA 2FB4L 2IOIA 2BNUA 1U3HD 3QUHA 4YE4H 3IYLW 2G0KA 3EHBB 1IGJA 1X6NA 3UOAB 1JRHL 1JZ7A 5E5LA 4HX1B 4DKFL 4NYLA 4JFDB 4X50A 5DO2C 4QYOA 1SEBB 4X7TA 1QQDA 1EGJL 1NCDH 4PJHB 4Y16B 1RUAL 1NCIA 3IXTA 4XRCA 3P0GB 4PTTA 5GS0D 4FG0A 1JZ3A 4XNXH 4D9LH 1F97A 2V0AA 2BNRE 3C12A 4JPIA 2IIJA 3HNTH 4I0PB 1FFOB 1TZOA 5JDSB 4JGMA 5JR1H 2ZSVB 4QR7A 3AS0A 4QRBA 4DKEH 3LYRA 4P2RE 3WLWD 4KI5C 1FLTX 1B6UA 32C2B 4NZFA 5FYLH 4QRQA 3VFOA 1DJXA 1SMOA 2N7SA 3VXSA 1SJMA 4LLMA 5I1AA 5E00B 3LN5B 1AP2A 5F8QC 3MRMB 2HX8A 1H6UA 4P2CG 3CIAA 5C1MB 4N8PA 5C0CD 3STBA 3L2LA 5FW7A 3OG6B 2YGOA 3ZO0A 2W88A 1BMZA 3GHEH 1KLGA 1ZOXA 4B0MB 4B9FA 2MPAL 3W0WE 3D4ZA 3MRGB 4GRLC 4FQHB 1Q72L 1MFMA 4PV8A 1UXWA 2FGZA 3BUPA 1ORQA 4ODSL 4YUEL 4K3JL 3UBXB 3BRDA 1XCTA 2OMYA 2VLRB 4F3FB 3LTVA 4NN5C 4UAHA 2AANA 2GB2A 1X9UA 5EO9B 1AO7E 2VM3A 5DRWB 1PCXA 3CFMA 5HYEA 1KV7A 4AH2A 4WI0A 1UJ3A 3VFSB 1G9ML 4PJGF 1CJYA 3RWEB 2PWEA 3T6WA 3U0PB 4PP2A 2OQJA 3ZKXC 2OK0L 1BYPA 3X12A 2HFTA 1OSYA 1N7MH 3KG5A 3RLSA 1JRHI 4Z7VB 43CAA 3TJHC 3EYUH 4N25A 1DUYA 4ZFOA 1U41A 4FQ2H 4IDLA 1YNLH 3PLYA 2AEQH 3SYPA 3TC9A 2FD6H 1T1XA 1RD6A 2E6JA 5BQDA 2ZOKA 3SO5A 3MU3A 5C0NC 5J11C 1Q1JL 2Z1PA 4LAJH 2Z31B 4QRRA 4M00A 1IKNA 1NBZB 4FXKC 1P6AB 4IBWA 1E42A 2FDBP 1QUPA 4HUXB 1JK8B 4P5KB 1VPOH 4JCMA 4Y89A 2GITA 4JFDA 1W72L 4YDLC 5J3HC 2APTA 4HUVB 3WXVH 2D2CC 2X1PA 2A6IB 3CZNA 2YOAA 3GJFB 1N4XH 3QI9C 1AR1B 2VZUA 5KVFH 1SLVA 3GMMB 2BK8A 3BRGC 1CURA 2DZEA 3MV9E 3LKPB 2ZSVA 1HL9A 1IGIH 4PJHF 3AWFA 32C2A 1NDTA 1YPZE 3CMOH 4IRSA 1ZD6A 3HNVH 5IROA 4O00A 3LRKA 3QFDA 1M4KA 4M5YH 3LN5A 2KPWA 2DDQH 3MRMA 4YSDA 1I8LA 3NEOA 1Q1PA 3MFFB 3NQKA 5AOIA 3DJSA 4MD5A 3T3PF 3DVGB 1UGNA 2EDYA 3PWPA 2X44D 4PJEE 3MRGA 2PCYA 4DGYL 4PCYA 4XMZA 3UBXA 2HLFC 1OAQL 2F7PA 3O2DL 3T6XA 3T65B 4OZIA 2IEPA 1D5ZB 5EO9A 4BGDA 5LKNA 3X3FH 2ITEA 2Q7YA 1MHCA 1T7VA 5CUSL 2VXUL 4K5OA 3PP3H 3ZZ1A 2ITDA 4K71B 3F7VB 3QORB 3RWEA 2IPTH 3PWUB 3WN6A 3U0PA 4IBYA 4FEMA 4PV9A 5EOTA 3GRWH 4FCHA 1M57B 1ACCA 5KANI 3C2AL 4TNGA 2A83A 5HGAB 4KUZL 1FE8H 5AB9A 2F54E 3FQNA 3DMMD 5KVEE 1ONQB 1HH9A 4F7EB 4ZI8A 3W37A 3QG6B 1OTUD 4BE6A 3ECBB 1E90A 1NCGA 3BPCA 4E9QA 5JXED 1NBZA 2MPVA 4X99B 4Z7VF 3B2DC 1XEDA 4G9FD 1OSZA 4FMKA 5MENE 3WE6B 3EG9B 1ZIAA 1RY7B 1L6ZA 4FC3E 3T09A 4HUVA 1ZS8B 3VGAB 4HKXB 2NNAB 4JL2A 2C9PA 1G6RL 2A6IA 2E9BA 2ICWI 4OCXH 4YX2H 3GJFA 4UQBA 3N6YA 1FH5H 2FSEA 4ELDA 3LQZA 2WINB 1Q4NX 2L04A 3BKMH 3ZIYA 1RUML 2NZ9C 4K3EH 4PREB 3L4VA 4BHUI 1CK0H 3TOPA 1I4FB 4XPAH 3BDBA 2ADGA 1NGYA 4L4VA 4X83A 2ROXA 5FA3B 2N1TE 3HTLX 4HKBB 1FVEA 1R3KB 1PG7X 1VCAA 4HIXH 1UD4A 3FSZA 4HWBL 3GBMH 4MA3B 5DXWA 3TCTA 5CF3A 2FATL 1DQJB 2JSFA 2LLNA 3T6ZA 3V5KB 2ED7A 1X4ZA 5F3HB 3UJJH 3D85D 1CXEA 1ZJBA 4QHLB 1DBML 1L9PA 4RDQF 3N1MC 1LMKA 2D0GA 4EPSA 5FHAH 3SDCB 1DJZA 4XNYH 3L5XH 4H20L 2PPDA 5I8KL 2CKBB 3RKPA 1F5WA 5ID0B 2Y5EA 2IV9A 3WIHL 1ZS2A 2EYSB 4W9KC 3T65A 3O3DB 4DVRH 5I2IA 1CFNB 4N2LA 4P23A 1UWXH 2XIIA 3TZVC 4G59C 3AUWB 4NKDB 3VFNA 4L3FA 1B2YA 2IH9A 1J9CT 4U1JA 2BP5M 4P2OD 1V7MH 4MSWB 1GIGH 3F7VA 3JXAA 4TLTA 5HD8C 5CSZB 4GIOA 3VH8A 1KCRL 3E1F1 3FUMA 4NQDD 4ZOAA 4I2XE 3K80A 5DQ9A 2VLJE 3FT1A 3IM1A 3DX6B 3FQYA 5AYQA 3WGUB 1ZT1A 2J6EL 2Q3AA 4N86A 4UQIM 3WN5A 4C8XA 1QMUA 1ONQA 3CU1A 2FQGA 2ZAGA 2DV6A 3QG6A 3T0AA 4N8CH 2WN2A 3ECBA 3V4VB 3NZHL 4K23H 4IBUA 3WNLA 3HZYB 2JKXA 2EDKA 4LSTH 2WKOF 4MA7H 4YVNA 3FHQA 3WE6A 2BP8A 3N85H 3WXWH 5AAWC 2C4FU 2LFGA 3CH1B 4HKXA 3Q6GH 1OM3H 4K94L 2WCSA 4J12A 4AC4A 4BWUA 3TURA 3GSOB 1L7IH 5TGBB 4F7MA 2E7LA 4HQQL 4EN3D 2WINA 4YDVB 4U3CA 5CIPH 3JBG7 4NKOB 5KSVA 1ZA6B 4N9GA 5FDWB 3PNWB 5I17A 3O9WB 3Q8EA 3IEAA 1MRDH 2P48B 3GIVB 2WOBA 5AVVB 3TV8A 5EU3B 4HKBA 3HVDA 1G6RB 5I75B 1R3KA 2G60L 3L6FA 4L48A 1IE4A 4DUWA 2AV1B 5L88H 2LU3A 1QZ1A 1HYSD 2F53E 2WKGA 2Y72A 1QBMH 4QHLA 3DX1A 4M43H 4WW2B 3II3A 4RAUA 2CKBA 2D8KA 2ZXWB 4JFYB 3E6HA 4GUOA 4Z95L 2RACA 4OIBA 5DI8A 5EZJB 1EBAA 4K07A 4CVZB 1GYVA 1SFDA 3UYPB 5CEXB 2EYSA 4OZGF 3EFOB 3O3DA 1FL5B 3HE6B 4MNGE 3OAYH 4WLCA 2HFGL 3S8FB 1WCBB 4DZBB 2XU9A 1OCCB 2CSPA 2DTML 3QJVB 4MSWA 1J5CA 4JY6B 5E6ZA 5AYTA 4FFYL 2MTAA 4NERA 4LPCA 1NIAA 1I8KA 3BWUF 2Z0UA 3M7OA 1DJGA 1VRSA 3AVEA 4CADB 1HJCA 2DWEB 4KQ3H 4QTIL 2AABH 1B4RA 2AQ1A 1IKFH 3GMOA 4U6VL 4YJZL 3DI2B 2E75C 9CGTA 4P99A 2CJUL 1G7IB 3V8OA 4O9HH 4KROC 2YAEA 3MV8B 4GAYB 4K3HA 5AVQB 4KJQD 4ZO6A 4PB0H 1CQYA 2X6CA 2JCCE 4GXVL 5LWYL 1PNCA 5K59E 3TIDB 3GS4A 1TEFA 4BH7B 4YGVB 4XCCL 1A6AB 1U8PB 3HMWH 4FI8A 2EECA 1KN2L 4LKCB 4R4FL 1QFHA 2D7PA 1C1EL 5TF1L 3PDOA 4QJ5B 3EFDH 2KUTA 2AVGA 3DX3A 5AVXB 3WTSA 3LZNA 4NQEB 1O9WA 1EO7A 2KI6A 5I1IH 2A73A 4RMUA 5ISZD 5DURB 2Q10A 5EU3A 3EHBC 5D7JD 4NAQA 4G43B 3EYOB 3UP1A 2AV1A 3KXFA 2PXYD 3FB6A 5BOPA 4Y16C 4ZSOB 2AJSH 4YDIL 5DEFB 5SX4H 5JHDD 1INEH 2VDRH 3BHBB 4IKJA 2XN9E 5BXFB 4Z7IA 5EPMA 4KPHH 4OV5A 4Y4HB 1GYCA 4LSRL 2BNQE 4I0PC 4Y4FC 3RP1A 5IGXH 4OGXL 1P5UB 1FC2D 3FRPB 3RDJA 2XYCA 1RIHL 3PABA 3MI6A 4MAUH 1KC5H 3GSRB 5FM8A 1UA6L 2XSKA 1WCBA 4JPWL 5D8JL 1KDJA 1OW0C 3PV7A 1A2YA 4FNLH 4DEPB 3OKLA 1SBSH 4PJ8B 3TL5A 1TF4A 5A7BA 2VQUA 4PJAF 4WNSA 2HH0L 3BYYA 4BGLA 5I30L 1AHKA 1AR2A 4XP6H 3BIAX 4CADA 3WS6A 2DWEA 4OR1A 4RCAA 4WUUD 1KB3A 2GBUA 4FYRA 4C54A 3IKKA 3N44F 2J25A 4LDOB 1A5FH 4LLDB 1G7IA 3SE3A 4P4RB 3MV8A 1RJYB 3NCFB 4R7NA 1GGYA 4PWHA 3MLPA 4F7TB 4U6HB 5ETUA 1XQ4A 2P43B 2OW6A 3WTTA 1BZEA 1FPTH 3MA9H 3IGAA 4I9WD 2H26B 2R0ZH 4XMVA 2EDRA 2FZ3A 3TIDA 3ZHKA 4P46B 3IMVA 1U8PA 4LIQH 5G4MA 4U05A 1U8OA 2XRAH 1TO5A 3UGUA 1D5RA 2WMPB 4FHKA 1D7DA 3OR6A 2ENYA 2X4RB 3B9KD 1QHQA 3TT1H 3C6LB 1IMHC 4G11A 1WITA 3A0OA 5EO1A 3TF7C 4P3DB 2BIQA 4NQEA 4X7FC 3EH1A 4DVBB 1XZ0B 4YHIB 1NSNL 5C0BD 1IFHH 2A9NH 2Z31C 3KR3L 4TUOA 3HR6A 4YFEA 4PJCB 1TYEB 2Z8WC 1SQ2N 5LQBH 3BZEB 4G43A 5L6YH 5JIHA 3BGMB 3VYPA 4Z77A 1LEIB 1U8QB 4S0SD 5FLVA 1QWUA 1JXKA 4CAGA 1PY4A 2IFFL 1GGIH 3O45A 4JRFA 5JW4M 1Q94A 1AR1C 5HVFB 2GC7C 4X6DA 3LRSA 5D72H 2W65A 1OP9A 3CHRA 4NLAA 3VACA 1BIHA 3LIZH 4PVMA 2E7BA 4W9LC 4LP8A 1R75A 4G83A 4QOKD 4OVVA 5I0VA 3I75B 1N3NA 1EUTA 2GCYA 3ILDA 1A02N 4LSSH 2E3VA 5HJGA 1UM6L 5FYKH 3GSRA 3NSCA 2J88L 4ELMF 2Z93B 1VERA 3WIIH 3LEVL 4NN7B 5LNDA 1S8DB 2P52A 4PJ8A 1A6TA 1T83C 5CJOH 4QGTA 1HZKA 5EIIA 3NZ8B 4F1SA 2W0KA 4H5SB 1K4CA 2JK5A 1HIMH 3MUGB 4FEIA 4IIQA 3QHZL 4FFTA 5KYWA 4BWWA 1PZ3A 2YD6A 4PS3A 4CDGC 4HLEA 2XVKA 4LLDA 1WC7B 3ESUF 5GGRY 3QXVA 3WKQA 1M9SA 1RFDH 1RMFH 2ZNXA 5SWQB 2O5YL 2XWXA 2F5BH 4HA1A 3DXAE 3QJHB 2ZOLA 1QPPA 3O3EB 3CSYA 1COBA 4G6FD 4HXBL 5IT2H 2H26A 1KIPA 2UWEE 3PP4H 1MDTA 4P46A 4NFDA 3QORC 2D3JA 1EDQA 4ICWA 3IMWA 3S7GA 3IMSA 1J9QA 1IAKB 2WMPA 1I7ZB 1MW1A 2X4RA 3QCTH 3NFPB 3VYOA 3KPQB 1U91A 3ECWA 3FOLB 2MPAH 4ORGA 5C0CA 3C6LA 2GAZA 4GRMB 5AKSA 3AG3B 1AIZA 2BIHA 3IDGA 3PJSB 1G9MC 1RH8A 1IGTA 4BH8B 4I8DA 3R0MA 3LN9A 1QA9B 2AXFB 2Y2WA 4QI3A 1R19A 1VGKB 3OPUA 1LEIA 1U8QA 4J3OF 4WENB 1Z3RA 3VGAC 1R33A 1VA9A 3KL5A 5TF0A 1TPXC 1RP9A 4H44C 2VJXA 2V3DA 4JFUA 4K7PL 2IQAA 1YEIL 2ATPA 1YY9D 1ET8A 4PJCF 3VRLE 5EB9A 3LN4A 4XXDB 3TBTA 4AVJA 3N9GH 3BP7B 5GRVK 2CNYA 3K1KC 4ZX4A 1GHFL 3N0AA 4DGVL 3JTSB 4P9ML 2OA9A 4AENB 2YA1A 3L3HB 1ITBB 3SO3C 3QHTC 1BXXA 2OMNA 5CCJA 5KTEH 5IFHL 5JMRA 1Y6KR 4RBPH 4GXUM 1A4BA 1G7QA 5AUMB 5I6KA 1TDQA 2IV8A 4LHJB 2DN7A 3ZYJA 4H25A 1MXDA 2CHWA 2I27N 3NZ8A 5DJDA 1X9QA 3CLFL 4HXAH 5J5EA 1QFUL 3R7RA 5KZCD 3ULVH 1D5IL 3UPRA 4YDZA 3SDCC 3TPKA 3U4EB 3QXTA 1OPGL 35C8H 1OALA 1OPOA 5HYJE 5KVGH 1WC7A 4JO1H 2VDQB 4UT7H 3NBNA 3BWUC 3DYPA 4WHTA 4M6NH 5B38B 5LJYH 1RI8A 2QSCL 4TNVF 2M8XA 2VDNL 4RQQB 7FABL 5I1CL 2BNRB 3O3EA 2DWDB 3D0VA 3U9PH 3TO4B 1AG0A 4Y7OC 5H94A 2NY3D 5I0ZA 1PKQE 4XMPL 2WOYA 4TNEA 1K3IA 1NL0H 3HRZC 4R6UA 3WD5H 3ZHDA 3BYTA 4P2RB 5ABZA 4Z7NE 3BLPX 3QPKA 1E6JH 1EMTL 3KPQA 5IB2A 2C3VA 4Z0BH 3FOLA 3FTSA 3NCYP 1BAGA 2AQTA 3AFLA 1HHKA 3OQ3B 5IKCB 1INQB 1BZ7B 5JA8B 2ICWJ 1DVFD 1RHFA 3TBYA 1MLBA 3BVXA 2QDWA 1NC4B 1UADC 4GBXD 4BH8A 5LHDA 5DGRA 1WTLA 4Y5VB 1I9IL 4K5NA 3TYGL 1NLBH 1QA9A 2AXFA 4RH4A 3U1QA 3P77A 4LU5L 5DFWH 4LNRA 3AS3A 2CWRA 4PBXA 4LARH 4GYBA 1AO7B 1JGLH 1UEYA 3H2WA 5AZ2L 3RFZB 3KJ6L 4YR6A 5J9PB 3IPEA 4CN4A 2Y2YA 4Q56A 1MFNA 4QCIB 4RMBA 4W6WB 3VI4E 1N0LA 3CUPB 3QJFB 3WNKA 4L3AA 4OIAA 1YCSA 3O9WC 3DMMA 3POHA 1TITA 2YAOA 4KO9A 5ALBH 1CTMA 2WXFA 1C12B 3JTSA 4LLYB 4L23A 4AEEA 3L3HA 5A16B 3ZHNA 2E9IA 4I4WB 2QADB 3RTLA 4YEEA 4CL7A 1C5DB 1HE7A 4S1SH 5JXEA 3K5RA 1NAKL 3NIDE 4G9FA 2NY4D 4XPBL 5F7BA 1JUFB 4TRPL 1MIEH 1GZQB 3ENEA 2EYRA 3EDKA 3ZDYB 3UL4A 4XC1H 5I1HL 3U4EA 3L