2XA8H

Crystal structure of the fab domain of omalizumab at 2.41a
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNYNPSVKGRITISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords OMALIZUMAB HEAVY CHAIN
publication title Structural and Physical Basis for Anti-Ige Therapy.
pubmed doi rcsb
total genus 44
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xa8H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xa8H01
1BQLL 4YXHL 4YEFA 3VGEA 1R3JA 3F7PC 3QNYB 5EG6C 5E2TH 4MXWL 5HHNA 1KB5H 2NW2B 3FZUD 5AYUL 1U8PB 1YECL 1ZTXH 3LSOA 3K1KC 2FH6A 3OR7A 4LSPL 4QNPE 1LNUA 4PPTA 1FL3B 2P47B 3HG1A 1EMTH 2R4RL 4LLMA 1P7QA 3BVNB 1BQUA 3TO4B 2DQUH 3GMOA 5CJXC 5KS9E 3KG5A 1HK6A 3T0WA 2P4AB 4RFOH 4OSUH 5GZOC 1QBMH 3BKJL 4H26B 3JZ7A 3GBNH 4OGAD 3EOBB 2ZG1A 4L29B 1NAKH 5EU5A 3KPSE 1QD0A 3I6KB 3NABH 4M6OL 2GKIA 1Q72H 5FB8A 2C7UA 1DBAH 4XMPL 5F6IC 4PJ5D 3EO0B 3LDBC 4XP1H 3PF2A 3GGWB 1A1MA 2DLHA 4PRIE 4NWTL 4KDTA 1MHHB 1DBBL 4XVSL 5IB3B 2XV6B 3BJLA 3UTQA 3C6LB 4JFXB 3DSFL 3DETC 1URLA 3JWNC 1UXWB 1T5XA 2KZ1B 2JCCF 4G80A 5AD0B 4NRXB 3D69A 1NJ9B 3QJHB 5C0JB 4WTZG 1OY3B 4ZNEE 1EFXD 1CG9A 3O6MH 3S37L 4KKNA 4YE4H 4UUJA 2PO6B 3BZFB 5BZDA 5I1DA 5CZKA 4MJ5B 3LZFH 4HUKB 4G3YH 4G9DB 2UY6A 4X99B 4Y8DC 1M7IA 5TGBB 5MENE 1IGML 4HEME 3TA3D 4XB7A 3SDCB 4XNUH 1NC2D 1KTDA 1C5CH 3ES6A 1KBGH 1RJYA 2EH7H 1FRGH 3HMXL 1Q9KA 1ZHKB 2BNRE 1J05A 4G6ML 4EN3C 4KTEH 1IC4L 3IXAB 4B7LA 2IANA 2YR3A 1AD0A 2EDEA 1ZT1B 3NH7H 2R0KL 3IJYA 4PJGE 4TRPL 1FL5A 1FZKA 2VJXA 5D72L 4P3DA 1XGTA 3DYPA 4JFQA 1FNSH 2QV2A 3EO1B 1D5BB 3QULA 1Q9OB 1IAOB 3MSPA 1DFBL 1E4JA 4BYHA 2EYSB 3RL2A 5ICYB 1P9MC 4QRRA 4FQPA 4HUVB 3VWKA 1FVEA 3GMRA 3FZUC 5CBEB 1FNLA 1PSKL 4XGZA 4U1NB 4M3JA 4GRWF 3E6FA 3VFGH 3NZHL 5AEAA 2CSPA 3Q5TA 1MCWW 4P5TA 1IILE 5HHVL 2GUOB 2R2HB 5FGCB 4JB9L 4MJIA 3TJHD 1EGJA 1JWSA 1MRDH 1BZ9A 3MOBH 1MIMH 4V1DB 5CILL 1LMKA 4R2GB 4IOIA 3O3BA 1C5DB 3TM6A 4ZAKD 4OGAC 4MQXD 3VXUE 4RNRA 4ZDHB 3QUMB 5EU6A 3REWA 2HFEB 5T1KD 3UJJH 4P23A 3RNQA 4Z7WB 2WV3A 4G8GA 4PRAA 5C0GA 5IMMB 4OLUH 2B0SH 2AQ3A 2JCCB 4KK8D 4ZODA 3P0YH 3LN4A 1BQHG 3G04B 2GQHA 5J0BA 5DURD 4PGCA 1QFUL 3NZ8A 1HH6B 1TNNA 5FV1L 4NPYA 4HBQA 3GZKA 4E5XB 3U7WL 1CD1A 1TQCB 3VXPA 1H9VA 4NFBA 1EVUA 1MJJB 2MCG1 5J89A 1EO8H 1QNZL 4QOKE 4NGHL 4UILH 3QDJE 4I77H 2N1KA 3HMWH 5HVWA 2YD3A 3AS0A 4LKXA 3QCTL 1G7PB 3VXNA 3T0AA 5KW9H 2VLLB 3CSYB 4U6XA 3IDUA 4NUJB 2IMMA 1NDGB 3BGMA 3AS3A 3DGGA 4JFZL 1NFDF 2GFBB 2Z8VC 3F7RA 3PL6B 3TA3C 4XPFL 5E8NA 1EZVX 5IQ7L 3CSBA 1I4FB 1JPGB 1NCBL 2ZG3A 1R3KB 4IRJB 4XXDB 2PF6A 3LIZH 4RGND 5C6TL 4QRTB 5T3ZH 1P5VA 5T33L 1S3KH 5F1NA 1J12A 4S1SH 5JPMB 3CFEA 5CD3B 1I1YB 3P9LA 5GS1C 1WEJH 1FL6A 3V7AE 4XNXH 1L9MA 1UC6A 5HHOB 1BWWA 2BRRH 1ZEAL 3G5ZA 5HYEA 1RHHA 2V2XB 5J1AB 4OD1L 1A9BB 3QH3A 1EAPB 5DQJB 4PUBH 3IRPX 5D1ZA 4Z7NF 1GOFA 1A4KA 3GMNA 5SWSE 3KHQA 4DAGH 4PBXA 1I9RH 3V9FA 3GMLA 1VFAB 5DEZA 4MSWB 4H88L 2GJZA 5HHQA 2AJUL 2Z31D 4PJFF 3UTTD 4Y88A 1GGYA 4X8XA 4MCZA 4Y5XC 2DBJA 4KHTH 2Q3ZA 2AK4A 2M26A 2VZTA 3OAZK 1LO0H 4LCWB 3ZKQD 1IGIH 5IB4A 3RWHB 4OFYD 1GGTA 1NMAH 3AVEA 4MAYB 3TJHC 1HYSD 1PD6A 2ARJQ 3GIZH 4AZ8A 5E9DE 15C8L 2XZCH 1ADQH 1HILB 3UBXB 4ZAKC 2WWKO 4MQXC 1KCSL 1XIWD 1MQ8A 2WUBH 3ZKSD 3QRGH 3Q1SL 3RZWA 3VWJD 5DWUL 4X4YB 1QVOA 3FN9A 4O51B 4ZS6D 4N5ED 4Z78A 3QJFB 5K33A 4KK8C 1I3UA 3IFOA 5A2IH 3C87A 4MNGA 3DYOA 5DK3A 1KLUB 3BRGC 2W60B 3ARBB 2EDXA 1R24A 5LCVL 1RULL 3ULUD 4NM4H 3EZJB 3MA9H 2B5IB 1BX2A 3WDIA 4MQTB 3LHPL 3FOMB 2Y5EA 3NCMA 3MRHA 1EUUA 3SCMA 4JQXA 5EN2B 5IT2H 5JOEA 4ODUB 3QUMH 4NOFA 4U05A 2Y1VA 3RKDD 3TN0A 5DRNB 2A6JB 1QHPA 4LPXA 4ACPA 2P1YA 4RGNC 2Z93A 4E41B 1J1OH 1INEL 3QXTA 4HFUH 1YY8B 3CC5A 5LAXB 4CMHC 3SOBH 1CD0A 1OAUH 3U82B 2A83A 3SKOB 2Q3AA 5HGDA 1S9XB 5BO1L 4PJ7A 3RNKA 2CR6A 1J5OH 1PZ5B 4ZTPH 1T0NB 4KC3B 3KVQA 2O26U 4PP2B 1BJ1H 3MQIA 1FFOB 4PRHD 4PJFB 3UPRA 1ACYH 3TWCH 5CHNB 4XZUA 3OQ3B 3P4MB 3T09A 3Q6FA 1MREL 4G9FA 1U58B 1AE6H 2IADB 3QDGD 1ZA3A 5FHAH 2P8PA 1F3JB 3V79C 2N7BA 3QUZB 1JGVH 2B2XH 1AQDB 3MZGB 3RVWD 2APVA 4X8JA 4JO1H 5C8JA 3M17B 3VD5A 3IT8D 3MNVA 3CIQA 4WUUB 5GS0L 1RUML 2CK0L 5CP7A 4FABL 4Z0BL 3P77B 3V0AC 2ZP0T 2DKSA 2NY1C 3T0EB 3EW3B 4RAUA 1BVZA 3HE7B 4DJMA 3NVQA 3LEVL 3TNNB 1YQVH 1P7KB 4KGLA 1HNFA 2EDDA 1XIWC 2ZOKB 4DCQA 1Q0YH 4J6RL 3AS1A 3SQBA 3VWJC 4BH7B 2EYRB 4U1GB 5CSBA 4NRYB 3Q3GB 3LQAL 4ZS6C 3MRRB 1DSFL 4N5EC 4CU8A 3SO3C 1H3TA 5HVFB 1KEMH 4Y2DD 4OKVB 1A22B 3C60A 3QDME 2JJVA 3ARUA 3V6ZB 2KKQA 1E4XH 2O5YH 5EBLB 1BECA 3P9MB 2X42A 1EJ6A 5GGRB 3WHE0 5FDWB 5HBBA 2GY5A 4ZOAA 1QTYT 1SVCP 2OI9C 3O9WD 1UA6H 3RTQA 3D39B 4GKNA 5GRXG 5JDSB 1P1ZA 5FGRA 4F33A 4QHUB 2B20A 1PW3A 2JB6B 3KLHD 4PJXA 3OAYH 4XBEL 3RKDC 1NSNL 1XH3B 1KG0A 1N59A 1OAQH 5EORH 2AEPH 5D6CB 1H3PL 2BDNL 2D2OA 3FT4B 4U1IB 1UENA 4TNWF 4PYHA 4Y4FA 5C3TA 3U2SA 3VCLB 1C1EH 2W0LA 4JFPB 3NTCH 3CJJA 1OD7A 3LY6A 3U4BL 3KS0H 1KENH 5F3HA 5DSCB 5TE4H 1BBDL 4N0YH 4X7DC 3SJVD 5AZ2H 5SV4A 4O5LH 5IB2B 5T3XL 4HIEB 3WLWD 5SWQB 1G6RL 2LE9A 3X11A 5D7SH 3OXSB 3V5DB 2VIRA 1KT2A 1NLBH 4Y8AA 4LHUG 3ZKXB 1DDHA 5KTEH 1NL0L 2NY4B 2C4XA 4X0KB 3VFRB 3IJHB 4MD0A 1NGQL 1AI1H 4LGSB 1A6PA 2C4FT 2OTWA 1K3IA 1H5BC 5GS0D 1NUGA 3G9AB 1YUHB 4XMLL 2X4UA 3UJTL 3MREB 2V7NA 1ED3B 2BY0A 4UDUA 4WWKA 5EPMB 4YHKL 4L4VE 1A6UH 2NY2D 3EYQC 1EXUA 1FNGB 4X6DF 4HK0A 3CX5J 5EC1B 1UB5A 4N9OB 5EOTB 1FVDA 2DLGA 1JHKH 3WSQH 3O6KH 4LSSL 4JGUA 1TQBB 2WBJB 5T1DL 2VH5H 1RK0B 2A6IB 4A6YA 1RUPH 3QG6A 3SQOH 2UWEA 5E2VH 4PFEA 4PJEB 2C1PB 3KXFE 5C07B 1CE6B 4ZUSA 3C8KA 2Z91A 2A9NH 1WCQA 2NCMA 4Y2DC 4UAOB 1BHGA 2VAAB 5IF0A 4PY7A 5ALCL 2WNGA 3GJFH 4HPYL 1JWMA 2Q8BH 4KFZC 4B7IA 2XOTA 3O8XD 5J11C 2EYTA 3F7YB 4LARH 4ZSOA 5GGQH 2X09A 3N9GH 4DZ8B 1VADB 3SGDI 3O9WC 3PWJB 5HDBF 3LD8B 1IC5H 1GGIH 1I75A 3BDYL 1FNAA 2HAZA 4ZUWA 4PGEB 3KLHC 4O58L 3K46A 4ESKA 3U0TB 1YN7A 4JVPA 3U7AA 2EEDA 2VKWA 3TYFB 1CGVA 4HS6A 2VSCA 1MFAL 3LN9A 1DLFH 3MRJB 4L4TA 5D7KD 3RZCD 4LSVH 2R8SH 1U8OA 4F3FB 5DA0B 4YWGH 1WZMA 5H94A 2XZQH 3A6BL 3B5TA 2UY7A 2Y7QA 1FFPB 4AT6A 3L3DA 4Y2OA 3MLTB 4J3OC 1T0MB 3SKMA 1P4LA 3IETB 5T3XD 5ICZB 4RQQB 4BELD 4MLSA 2XPGB 4XNZC 1J8HD 4KHXH 2YWYA 2DQHH 3WLWC 4N0FA 1H8NA 1VEPA 5DFTA 5C0CB 4MA1B 2EDFA 4OJFH 5DD1L 4D3CH 5KSVB 2XZAH 5IVZB 5DK2B 3MGOA 3GMPB 5IESH 1G7QA 4CU6A 3R0MA 43C9A 4KXZI 1DTUA 1O5DT 2DM7A 4JQVA 4NQEA 1MHPL 3G5VB 4X6DB 4ZPTA 5I73C 3VRIA 5GS0C 1VFBA 2D4DA 2XN9B 3HZYB 4W6XB 1U0QA 1JHTB 2DI7A 3OJVC 1M71A 4PJCE 2F53A 3S3JA 3WFDH 3WFHB 2ZSWA 2NY2C 3QHZL 4NN7B 4ZFFB 4XTRD 2MHAA 3MV9B 1BFVL 4M3KB 4KU1A 1N8ZB 3GK8H 1S9YB 5BQ7B 1SVZA 1TJIH 3LQAC 5F88A 4F9LA 5EWIL 5INDA 4Y4HB 1IKNC 4FFWD 1E0OB 3UTTE 3ETBF 1HXYB 4J1UB 5BRZB 3EO9H 4PLJD 2WBKA 3LV3B 3L5JA 4BSVB 3RI5K 3WIHH 2XY1A 5F7KC 5E99L 5FUCE 1RIVL 4I3SH 4OUUA 2WQRA 1DQML 1W0WA 3MUZ1 3WN5A 5I74B 3O8XC 1I9JH 3MNWA 1OOAA 2Q76B 2QSTA 3SPVB 5M95B 1CIUA 3GO1H 1LEIB 4TPRL 3F65A 4QHMB 4YHOL 4OCWH 3GBML 3N50A 1I85C 3DX7B 5D5MA 5HVHB 5JOPD 4MD5A 3VH8B 2F54B 4YHYB 1JRHL 2P5EB 3QISA 4QWWD 5IFAL 3A67L 3QAZC 2IC2A 3N1FC 3K4AA 3DXAB 1CGSL 4PJDF 3PXJA 1JMZA 1JL8A 2OQJB 3INUH 4ZFOL 4Z7UE 3OGCB 3O3EA 4NRZB 4ORGA 1R0AH 3K81A 4R7DB 3HNVH 3S88H 5JPNB 3V4VL 3RZCC 2D3VA 2OLDA 5FHBH 5C0IB 4GQ9L 3WNKA 3MJ7B 1ZA6B 3ZDXE 4FZ8H 4ZXBA 3BAEL 1LQSR 5BMFL 3ECBB 4F7EA 3MV11 2P45B 3OKOB 3TFKD 4MA8L 1YPZA 3KS0J 5FV2A 1DN0B 5IJKC 3RWJB 4UB0H 4Y19E 4DKDC 4GUPB 4HZAA 2XIDA 5CGMA 2A6KA 5FA3A 1UH2A 1AO7D 4P4KA 1A6AB 2OYPA 1RIHL 2ZCLH 3IS0X 3LMJL 1LK2B 2DRUA 3MLRH 1D7FA 2W65A 2X41A 3W0WD 3BQUA 1AP2A 1LD9B 4JZJA 1JPTL 1MI5D 1T83C 4Y5VB 1S7RA 1DVFA 3DIFB 4YXLH 3S37X 2QKIA 3DVNB 4F7MA 4WHTB 3STLA 1U8MB 2VZ1A 2DMCA 12E8L 2BP3A 1UEYA 2E27H 4NO0A 4XTRC 5FOBB 1FO0L 2EH8H 1EK3A 3BH9B 2XRAL 5D96C 4LCCA 3PWVB 3CFBB 3JV6A 2IPUG 3BT2H 2WUCL 4POZC 4K3EL 1U8KA 3QDGE 4LF3B 5ACZB 1FHGA 4H20H 4DVRL 4FFZH 5J1SC 4YHIB 5D7JB 3MGTA 4YXKH 5HYSA 1ETZB 5C86A 5HHXH 3B9AA 3IU4L 2DJ4A 4HKBB 4PLJC 3SE8L 4JO3H 1H3WM 3PUCA 2RBLA 4DW2H 3UROR 5I8KH 3GSNL 2X9XA 4JM4H 3QEHB 1AIFB 1D3CA 3VGHA 2EKSA 1Z0MA 4HKZA 3T4AB 1F6AA 2MCPH 3KHOA 1T20B 3F6LA 2NXZB 4QT5B 2VDNH 4QXUH 4P9HH 2DQFB 1UB6A 3NIDE 1OB1A 4I13B 1ZK9A 4QWWC 2PXYB 3EYOB 2VXTH 3L3KA 5GSRA 1OAYH 5GS2H 3FQXB 4JJ5A 3RY4A 4BZ1H 3MZTA 2PW2A 4R8WL 4I9WE 5AUMA 3VRLE 4LNRB 3K2UH 4BSWB 3BI9X 4RFNC 4K23L 5I0ZA 3MRDA 3MRPB 5IJVA 4ODTH 1TJHH 4WI5A 4HJGB 2BY1A 4G7YH 3QO1A 3ARQA 4QTHA 1M05A 2BSRA 4PJGA 2YMXH 3TFKC 2CJUH 1I7TB 4CMMA 1C16B 4C59B 1VHPA 4PJ9D 3THML 5HYFA 5FUOH 4PJHF 1NUDA 3BD4A 1EEYA 5L9DH 5TQ2L 5D2NA 2AV1B 5GISL 1IM9B 2CGRL 4ODXA 1H3UA 5IW1A 1GOHA 1EHLH 1E27A 1R5VA 4PD4J 1VSCA 1KN4L 3PJSB 1MH5B 1RZIB 4P0DA 1JPFB 1MCJA 2VWEC 1JZ8A 1VESA 4UT7L 4AMKL 3RWGB 1U36A 5L7XH 3HNTH 3H3KA 5F7LB 1CFSA 2YZ8A 1NGZB 1A8JH 1A47A 2Q20A 3BN9D 1MCHA 5B39B 5E6IB 3BIKA 3FTGB 1I7UA 4X7EC 4MB4A 3S36L 3OKEB 1YY9D 4OM0H 3I50L 3TV3L 3ARDA 3ZHDA 1RY7B 5F71A 5IMOB 4XAKD 2D31B 5LWYH 4PBVC 3NFSH 4WIQA 2BCKB 1QRND 1B6UA 5DF0A 2C3VB 3QCVL 3B43A 3ROOA 3EYVA 3WCYA 3OB0K 4UV4L 3NGBB 5TE7L 4JO2L 3EBAA 1I8IB 3GFUA 4GSDH 3VXME 3S4SA 1N5AA 1E4WH 1KJ2A 4PJIE 2JJWA 2H3NA 3VFUB 1N0XL 2AQ2A 1FBIL 3B6SB 2PW1B 1GPOL 1ZT7A 3L7FA 2F5AL 3RRQA 3QDJA 1KN2L 1N4XH 2AXFA 2YBRB 3O6FD 3G08B 4L9LB 1T66D 1G7IA 3V52H 1CK0H 4XMKH 2VXUL 1NKRA 4OI7A 2J6EA 4M00A 5BOPA 2XWBB 4JY4B 5B3JE 4X6FB 1HN1A 4GBXA 3HPLB 2VDLH 4JG0H 1SYVA 3D9AH 1MY5A 2VO5A 3NIGE 1RD6A 1QLFA 4OM1L 4YHNB 4W6WB 3GI9H 2HH0L 5DJXB 5CEZH 1FG2B 5I8OL 1VACB 4PJHB 3VJ6A 3W39B 5HVGB 4CKVX 3TBTA 4QXTA 5E70A 4F58H 2I9TA 2HWZL 4NKIL 1G9NL 3QR2A 3SDAB 2AXGB 1I8KB 4ONGL 2D7MA 4AIXA 4Q7DA 2VYRE 3GDBA 4PJ9C 3MBEA 3JWOL 1K4DA 5D71H 3SGKC 5HGAB 1MFDL 4NZUL 3EGSB 3LKPA 2MNUA 1PQZB 2YRPA 4RAHA 1H3VA 4BFIB 3QIBB 1ZT4A 5SWSA 4NO5A 1MJUL 1UYWL 4GW5A 5F9JB 1KIRA 3OKLA 5CLTA 1QSVA 2FX8H 2V2WA 1V5JA 5T3XE 1EUTA 2VN7A 4OF7A 2DM2A 2AKRB 4O2FA 2JLLA 1J8HE 4DFIA 1KYOK 5C1MB 4FQLH 3TYGH 5JW3L 5MEPA 3BN9C 1MUJB 4EIZC 5JHDB 5JXEA 1YY9C 1D5ZB 3WE6B 1OWWA 4FA8A 2ADJB 4H0GA 3VXRB 3EDFA 3LKNA 4LP5A 3FB5B 4J3SA 5I8EA 2M1KA 2X4TB 4M93C 1MQKL 2YPVL 2LVEA 1FZJB 4FQHB 4ZUUA 2ESVD 4KUCD 3TZVC 3LS5H 3V5KB 2XFXA 4L8BA 3V0WH 5EBMB 3OB8A 5ALBL 1J86A 2J7LA 4JM2F 3L3HA 5TQ0H 1NMBL 1L7IH 3X12A 1HCVA 2LTQB 1JNHB 2VRAA 4GAGH 4UOW0 2FX9H 1NC4A 4XVJL 2CUHA 3WD5L 5A1AA 2GW5A 5LGKA 1J9CT 3MRKA 1JHLH 4X6BB 4JRXE 1RFDH 1IBGL 5FIEA 5CJXA 2A1WH 4TSAL 4ZTOL 1L4IA 5EIIB 3RI5F 1O7SA 5FGCE 4YFLI 2H32A 4HX1A 3TH2T 1S7SA 1CDCA 3OJDB 3BDBA 2XYCA 4G8IB 4KAQL 4V1DE 3HZVB 3O6FC 1T66C 1JZ4A 4GAYB 4KQ3L 4M7ZB 3SKJL 3TLRA 1DUZA 5EZJB 4FXKA 1XF1A 5JXAH 1GGCH 4PR5A 4XP6L 1IAIM 3VGGA 3QXDA 2R0WL 2W9DH 3B9DA 3QUKA 4RRPG 3KPOB 3G6JB 4M6NH 3QCUH 1I7ZA 3S5LG 4AG4H 1KSRA 3L3IB 2X6MA 1MEXL 1JGUH 4GRMA 4NO3A 5K9JH 5D7IE 5DRXB 3RU8H 2V2TB 1C8PA 2VDRL 4HUWB 5D70L 4V2BA 3CLEH 3PHOA 3MR9B 3QWOA 5DJAB 2X1QA 1T7XA 2X70A 5TH2A 5F93C 3IDNB 4X6CB 5TDNA 5I17A 1XGUB 1X5FA 2AABH 2VNCA 5JLZB 3OKDB 5E03A 1MFEH 3MRCA 4UDTA 4GS7C 4LEXL 2GJ6E 5KSUA 1F8TL 3B8YA 4YR6B 4EN3A 5J9PA 3GSRB 2FWOA 1WTGT 5SX4I 5SWZD 2V9RA 5HHNB 1F4XL 5KVGH 1F4AA 3OR7B 3IFLH 1D6VH 1DBJL 4X7SL 1LNUB 4KI5E 3DO3A 1CFQB 1AXTL 1AJ7H 2XTJD 4GQPH 3HE6C 4LLMB 1AO7E 1MCFA 4JM2B 3VFWA 3DRQA 3GMOB 3WNLA 1HDMA 2OTPA 5EU3A 3PGCB 5J56B 5E4EB 4KVNH 2YN5A 1P9MA 3QP3A 1A7RH 2EDRA 1CQYA 4POYA 1CL7L 4WEUD 4I0PC 5EU5B 1J0ZA 1QOKA 4WCYH 3GKWH 4LU5L 1V7NL 3QNXA 4JGMA 4PJBA 2D0HA 4WI7A 5DMGC 5KSAD 5FB8B 2C7UB 2OBGA 4L9DA 4FQXD 4LPVA 3P11L 2O5ZH 4JKKA 4AL8H 1EVTC 3W5MA 2R1WA 4KKAD 4LNVA 3UTQB 5DLMH 3DUSB 2EIEA 3BWAB 3ALPA 4PRBA 5EZLB 3AGVA 5D4QA 2C3XA 4FNLL 3QT2A 1T5XB 3IFPA 4WO4B 3D69B 5C08E 3ZDYF 3QPXL 1CG9B 5T1LB 4IDJL 3L95A 4UUJB 2JIXD 1FE8L 4XC1L 4HF5L 4WU5A 1MF2L 5I1CL 4GXVH 4M1DL 4DN3L 5F7WC 4YPGB 1QSFD 2VLJE 5E95B 1OAZH 3BD5A 5GRUH 1KTDB 2V17L 3ES6B 3EYSL 5MP6H 1RJYB 3EJZD 2AQ1A 1Q9KB 1G9NC 4ETQA 1OT2A 1AGBA 2CKNA 1AD0B 1X4XA 2W0FA 3SGEH 3IJYB 4I8DA 1FL5B 4YUEL 1EFXA 3BPLC 3JWOC 3KPPA 4WI6A 1YEIH 5BW7C 4EQ2A 1EA9C 4P3DB 1XGTB 5IVXF 1AD9B 4XPAH 4YBLC 5J57B 4L3CA 3VMPA 1UM4H 4JVUA 3QULB 3TA3A 4YH6A 1ULVA 5C0AE 1NC2A 4XWGL 5D1QD 1F90L 3WDJA 3QIWB 3ZSSA 3PQYD 2ZSVA 3RL2B 3SKNA 3PWPE 4RMWA 4QRRB 3U46A 3IDIA 3VWKB 2FGZA 2I9LA 5GS1A 1ZGLP 3FFDA 1BAFH 4XGZB 4NYLA 1MWAH 3RL1A 3E6FB 2DKUA 1Q9LA 4W4NA 5I19H 5GXBB 4L4VA 2XTJC 5GRJL 4BQ9A 4MJIB 4C83A 1JWSB 1FLRL 1BZ9B 2CQVA 1NANH 1YEHH 5C6WH 4IOIB 3O3BB 5HI4C 3IGAA 5F6HJ 3LVEA 1MLCA 3DX6B 4N8CL 3E2HB 3KYNA 4RNRB 4NQSA 5KZCB 3BKMH 1YYMH 3MLXL 2HRPL 2VZUA 5EU6B 1IL1B 1Z9SA 2NY0B 2QQNH 4G8GB 1FIGL 4Y5XA 3CXHK 1DN2A 5KSAC 5CJOH 1P4BH 4HJJL 2ZPKH 4FQXC 3LN4B 4UV7L 4YK4C 1F6LL 4HQQL 1EBPA 4FQ2H 4PGCB 4C56D 1YEKL 3VFNA 1SJHA 4P2OB 4AEIL 4KKAC 4ELKA 2FGWH 4OZFB 1BREA 4NPYB 5HDOA 1CD1B 4HBCL 2HA1A 3VXPB 1QYGH 3T4YA 4ZAKA 1KPUA 2BNQE 5T1KA 3C5ZD 2GJJA 3DMMD 2XY2A 3PHQB 4KPHL 2EIDA 2EC9T 3CZFA 1KB5L 1T1WA 2DTML 4KMTH 1ZTXL 1S5IH 5KVFH 4G8FA 3BP7A 4EBQH 1VB9A 3X13A 3HC3H 1SMAA 3REVA 5A16A 2DQUL 3L3GA 5E2WL 2LU4A 1VGEH 5F1NB 5EO0A 3I6LE 3CFEB 3GRWH 3P9LB 1FL6B 4RA3A 3VI3F 4WFGE 4FN0A 3GBNL 1X4YA 5EO9A 5I18H 3H9SE 1DQDH 1NAKL 3DJ9A 6FABH 2BSTA 3G5ZB 4M5ZL 3MBXH 1U3ZA 4WW2A 3HMXA 3QZWG 4OZIE 3QH3B 1Q72L 5KVMC 5IMLA 1DBAL 5D1ZB 4LLWA 4XP1L 1A4KB 1CIDA 4PJ7F 1FN4B 3GMNB 1LO2L 4JREC 1KACB 1RQ5A 4BH8B 3GMLB 4HC1L 4I2XE 4MMXC 3QI9B 1UJ3A 4PS4L 5CJBA 1P6AB 1LDPH 5AG9A 1DQQA 2MWCA 4YDIL 1WQVT 1WZLA 2G60H 2X40A 1DQJB 5T1MA 2MJWA 3O6ML 2AGJH 5IB4B 2R69H 1MFBH 2B8OT 3L5WA 3LZFL 2YD7A 4G3YL 4HG4J 3OKKA 4L8SC 5DHXB 1JCKA 4HT1H 5D7LD 3PIQA 3S7GA 1RZKL 2EH7L 1FRGL 2AV7A 4RGMC 4EZMA 1HEZA 3NFNB 5DEGA 4EIGB 3UTTA 4PJ8B 4KTEL 1GL4B 1R3IH 1MVUA 1OT1A 3HRPA 1OAXL 4JFED 2VLKE 4Z78B 1HH9A 1A7QH 3IFOB 4WHYH 4MNGB 4OFYA 3U9PH 1FNSL 3S4SG 2ICWJ 5DI8A 1Q94A 5GGUA 1CGUA 3QEQD 1INQB 1RZGA 3I75A 4LIQH 4IMKC 1KCKA 2VABA 3AMLA 1R24B 1XIWA 4K3HA 4MLIA 1TVBB 2ESVE 3C5ZC 3VWJA 1BBJA 1BX2B 3DMMC 1IAMA 5FA4B 2G75A 1GH7A 4ZYKA 2I24N 1TETH 5E8DL 4Z7OE 3MRHB 3SCMB 1AGEA 2P5WD 2Y6SD 3VFGL 5EOCH 3GHBL 4Z7UA 4PJEE 3T04D 4EOWL 4ZD3H 2E6PA 3NCCB 4WHCA 2R1XA 4ZFGH 1OP3H 5E8EA 1A3RL 4PJAE 5HHMB 4RFEA 2Z93B 3TJEH 1CI5A 3MOBL 1A7OL 3FMGL 1UT9A 2FJHA 2A83B 2DLTA 2W1NA 4JFYA 1UXSA 2Y23A 4PJ7B 2E7LC 5C0RH 4JR9L 4OZFH 1KCLA 1XR9A 3QDHA 5LQBL 3TPUA 2I07A 4Y1AD 1TVHA 3UPRB 4OLUL 1BOGA 2B0SL 2F8OA 4OF5A 4OZHF 1NGPH 4XZUB 5EUOF 3I9GL 2EDJA 5FYJE 4N0UE 4F37K 3Q6FB 3P0YL 5FXCH 2FH8A 4ZUTA 5ILTL 4JPVL 4FFYH 1HI6A 4ZFZA 4WENB 2ICES 4EEEA 1NGYB 3N0PB 5I76A 3EOTH 2B1AH 1FORL 4QXGH 4X8JB 1EO8L 3CFIC 1UGNA 2CDFA 4KVCL 5L6YH 1CGTA 3DO7A 2LV4A 3GIVA 3T0BA 2CRMA 2X44D 4PRHA 5CLWA 5CP7B 3HMWL 5AAMA 4MB5A 3OAUH 1T03L 5KW9L 3X3GH 4C4KT 4R7NA 2DQIL 4RAUB 5T5FL 4KJYA 3QDGA 2R15A 3ESUF 2ARJA 4RDQF 1RUAL 4HLZG 4DCQB 2RR3A 5SWZE 3PG2A 1JRHI 1QEWB 1GCFA 1S3KL 2XNAA 1H5BA 4S1SL 35C8H 1YNLL 5EU4B 5DD0L 3MGAA 4XNXL 3VG0H 4M8VA 3MUJA 1QFWL 1GGBH 4U1LA 3C60B 3MLYH 1IKFL 3MLSL 2J2ZA 1G9EA 4I3RH 3BGAA 4CN6A 1OAKL 5IK3B 2UWEF 3MA7B 2ATPB 4PUBL 2J88H 3KPRD 1NCWH 3ZL4H 4GMTH 3HI1A 4QRPD 4GKNB 1I1CA 1I9RL 1HIML 1KJ3H 1P1ZB 4F33B 5E5UB 4PREA 3VD7A 2Y6SC 3QWRD 4CVWA 4Y2DA 3LEYH 3OB0H 4KHTL 5K9QI 1ZWIB 4L3ED 1TPXB 1LO0L 4JG1H 4XHJD 1IGIL 4Y4FB 3U2SB 1NMAL 2ENSA 5DQDL 2WW8A 2X9WA 1XT5A 3GIZL 4NQXB 4OZHB 5EUOB 3NCEB 3JXAA 3K74B 4W68A 3O9WA 5CJQL 1ZSDA 5F3HB 3QRGL 3RWDA 1IE5A 3ARGD 1WSST 1MCWM 2B7DT 3EYFA 5BS0D 4RWHA 1FYTE 3HPJB 2HJKB 2WIIA 4XPGH 3HI5L 3K4ZA 3X11B 4KKLD 3P4LA 4DFHA 2UV3A 5L2JA 3KNBA 1MCDA 3T3MF 4WRLA 1KT2B 1DDHB 1FCGA 2DAVA 1K2DA 2X89D 3JV0A 4WV1C 2V5MA 1GRWA 3ZE2E 5K59F 4LHUD 4YQXH 3QQ4A 4MD0B 5FK9A 5I66B 5I1AB 2OTWB 2G2RA 4NM4L 2X4UB 4MVBD 3SJVA 2X1PA 3GMQA 1LP9F 2DQTH 2GSIA 2HVKA 4H5SB 1A6VH 1HKLH 4MNQB 5ID1A 2AJVH 5IT2L 3LQMA 4OCNC 1O7VA 1U8LA 4XCNA 3GSWA 1IAII 3QUML 3KLDA 1RZKC 4HK0B 4DUWA 1FVDB 3WEXA 3B3IA 3TT3H 5CEXA 3PQYE 5IMKA 5CCKH 2AJXH 4CJ0A 3MLWH 3QB7C 1I1RA 4A6YB 3QG6B 4NCC2 4HFUL 2UWEB 1UQSA 1WBYB 3SOBL 4JVWA 2O61A 2F19H 1AQKH 4ZUSB 3C6LD 3C8KB 5I71C 1UH3A 1RPQA 4GG6F 1DL7H 2PYFA 3IDMA 4ZTPL 1X44A 4PJIA 1JWMB 2PETA 5FF6A 1VFOA 5F9OH 1ACYL 1I3GH 1T3FA 2DD8H 2EYTB 2GSGA 3KLAA 3TWCL 4DKAA 4ZSOB 4Q9CA 5DR5L 2OZ4L 5DHVB 3WKMH 2BVPA 1HHKB 3EJYD 2DBLH 4LLDA 3SDCD 3L9RB 1IKNA 4UZGA 4U6TA 2VXVH 5IOPA 5DD3H 2HKHL 4ZUWB 2IPTH 3MRNB 4JO1L 1MCRA 1WCBA 3W9EA 3DRTA 3O4LE 1YN7B 4MA7H 1B90A 3MRGB 4XHJC 4HS6B 5EOCJ 5ADPL 5D5MF 1HINH 3O8XA 3PV7A 3T65A 3UYOD 1G7JB 2HJLA 3BZEA 5H94B 2AP2A 4AT6B 3L3DB 2J8UE 3LN5A 1CGWA 1I85A 1YQVL 5F7HA 4H8WH 2LU7A 3MUGA 3SKMB 4PTTB 3HLAA 5JIKA 3NCJH 1Q0YL 3ARGC 2D4FA 4LPTA 4WFFE 4YBHA 1NBYA 5EUKA 4N0FB 5JA9A 2VDML 4KKLC 2PTTA 3MODH 3OJ2C 1LP9B 1KEML 3RZCA 1EH9A 1S7QA 1G7QB 2VLRD 5CD5D 1MRCH 3N85H 5DS8A 3LQZA 2RB8A 4NQEB 3SO5A 5L8LB 3MCG1 1MVFA 4HUXA 3MTRA 4ZPTB 3TO2A 3VRIB 4IS6B 1VFBB 1NPUA 2JF1A 4MVBC 3RPIA 2P42B 4N1EA 4O2EA 3ZT7A 1G6RA 1J8HA 1M71B 1UA6L 2X4OB 3HRZA 5IJKA 1N26A 2ZUUA 4M7LL 3A0OA 2F53B 2JK5A 3K1DA 4ORZC 3V5HA 4ONHB 4HCRH 2BMKA 3ULVE 4BM7A 4Q2ZA 3HTLX 3M1BA 4TQEH 1IEBA 2BJMH 3T2OA 4I48B 4KQ4L 2R2BB 1C1EL 4QNPF 2O5XL 4LQFH 3L5XH 1DQLH 3NTCL 4S1RH 5INDB 1T83A 2OTUA 4FQ1H 5IW6A 1KFAL 1WC7A 2CIIA 5TPWH 2AK1H 5KS9F 1JWUA 2NTFA 4N0YL 3BE1H 2X4PA 2N56A 4O5LL 4OUUB 1W0WB 4HSQA 3WN5B 3DI2B 3RPKA 3MNWB 4G43A 3EFFA 4NKDA 5D7SL 2YD8A 5D7LE 5CJ8A 5FM5M 3EJYC 4DTGH 3L1OH 4I4WB 5D5MB 5JIPA 1N3NA 4MD5B 3SDCC 1FYHB 5KTEL 3HN3A 1G84A 4KKBD 5E56A 4JFEE 4JPWH 3UJIL 2Q7NA 4OAWB 3QHTC 1Z6JT 3QXWA 1N64H 4A6YH 4ORGB 1F4WH 1DEDA 1NUFA 4EUPG 4I0CC 5ERWA 4B0MM 5A40E 1A6UL 1TZIA 4ONFH 3FONA 1F02I 4WUKH 4OGXH 1UH4A 2H1PH 1ZLSH 3QG7L 3WSQL 4FQJH 3O6KL 4ZXBB 3AXLB 4KWUA 5D7IA 2IFFH 4F7EB 4EI5D 4ISVB 2FB4H 3NA4A 3HR6A 5B22A 1YPZB 4OFKA 5SX5K 1UWEL 2XXMB 5DHVH 2IPKA 5E2VL 1IVLA 2P5WE 4PRNB 4UT6L 3S35X 5GRVL 4LDOB 3VRJA 2FJFA 2RCSL 2A9NL 5FA3B 5L8JB 1F3RB 2EEBA 3KR3H 2GJ6A 4KI1A 5CD5C 1UVQB 3I84A 4IBLT 4PJGF 3VU2A 2W65B 3G6DH 3BQUB 1AP2B 1UWXK 4LARL 4F37F 5GGQL 4QHKI 2FO1A 3N9GL 3M8OH 1S7RB 1DVFB 2QKIB 3QXVA 4F7MB 2ZJSH 1VEMA 5D2LA 1IC5L 1WFUA 1KNOA 2CDGB 1GGIL 3RIFK 3SEPA 4Y1AE 3T08A 4LRNH 5LBSH 2P8LA 5KSBE 1AO7A 1OF2A 2YRLA 3JV6B 3W81A 3H2WA 2KUTA 2OL3H 1U8KB 3UDWC 2V5RA 2DS4A 1DLFL 5E8PA 4WY7H 3W0WA 2R8SL 1SBSH 3MGTB 5HYSB 2VQTA 4ZPVA 4LEOB 1MI5A 4JY5H 2XZQL 3HAEB 5HYIA 3KPSB 4PB9L 3BGFB 1RUQH 4NP4H 3ARBD 5FFLA 5ECJE 2BC4B 4P23C 1A7PH 1JZ5A 5E00A 2EKSB 4YNYA 4HKZB 1F6AB 3MRFA 1M1SA 1Q1JH 3CLFH 4OJFL 1KPRA 2R0LL 2YS4A 4D3CL 5D1XD 4Z5RB 5IESL 3HUJE 5FYKL 1UB6B 1OB1B 1FQ9C 5JMRA 4KKBC 3QQNA 3L3KB 4OTXH 5GSRB 1ZHNA 4JJ5B 4NDMA 2B1HH 4X7CC 5HHPA 1W0YT 3KYAA 4Y16C 5GIRB 1I3RA 1YMMD 2PW2B 4NN5B 5AUMB 3WFDL 5MENB 1AY1H 1XF2A 1LEKB 4AQ1B 4TVSa 1K8DA 2IBBA 4LSRH 4NN6B 1ZLVK 4DEPB 1OHQA 1TZHB 1A9EB 3MRDB 3MNZA 5IJVB 2Q6WA 1XGYH 1JGDA 5HPMA 3GK8L 1VEOA 3BIAX 4EI5C 1M05B 1TJIL 2BSRB 4PJGB 4ZFOA 1CU4H 3QUZD 2GCYA 4P2RE 3EO9L 1EEYB 3LRHA 4C4KO 4ODXB 1AXSB 4HWBH 5IW1B 5C0AA 3WIHL 3T1FA 2XWJA 4XCEA 4UQ3A 5BVPH 1K8IA 5EOQH 1R5VB 4WUUD 2H41A 1I9JL 3BO8A 3F7VA 4TULH 5TFSH 3T0ED 3P4NA 5D8JH 4LVEA 3JTTA 2APWA 4OCWL 3G6JE 3HE7D 1CFSB 4NNXA 5BS0E 4PJ9A 4M61A 5D9SA 2F58H 5IHUH 3RIAF 3SGKA 5FYJU 2UZXB 3OKNB 3DV6A 1JBJA 4MQ7A 1CLZL 3HNVL 4NZDA 1OSPH 4X7TB 3VXUB 5FHBL 5D93C 2FHFA 3QIUD 2LVCA 3BZ4A 4G6JH 3ARBC 4RAVA 1T21B 4N8VG 5J8OA 1FO0A 3ROOB 4CVUA 1V7MH 1HSAA 2QADB 3CAFA 4QCIA 1CFNB 2B5IC 1MAJA 4NZRH 1Z9MA 4UB0L 5IQ9B 1KJ2B 3RDTB 2H3NB 3SDXE 5FYKD 3TEUA 3HG1E 5M7QA 5D1XC 3CDFA 5DUMH 3GSVA 2ZCLL 3EKCA 1ZT7B 1R5IB 3QDJB 1QRNA 2AXFB 4Q9RH 3GSNA 4U0RC 3MOAH 3C5SA 5IWLC 2DIJA 3MUY1 3NCYS 3L6FA 1SYVB 1DZBA 1JN6A 1Z5LA 3HAEH 4KDVA 4R96B 5CSZB 5E2UH 2A74A 5EZOH 1QLFB 2ADIA 2EH8L 5KOMC 3T2PA 2Q7YB 3VJ6B 4U6HA 2E8YA 3TBTB 4OF6A 4QXTB 4EXPX 2VLME 2GAZA 4FFZL 3O6FA 2X4SA 4YXKL 1JV5A 5HHXL 1A1NA 3QUZC 2NY4D 2F5BH 4GAJL 3MBEB 4RDQG 4HWEL 1VENA 4JO3L 5CEYA 1JYVA 1K4DB 2CDEA 3UO1L 4YFEA 2ZCHL 4HUUA 4DW2L 4OZIA 5I8KL 4JM4L 1X5HA 4J8RA 4D9QD 5DFWH 5DRWA 3LKPB 3P0VH 5SWSB 1ZT4B 2MCPL 4NO5B 5CWSA 1KIRB 3TIDA 4YGVA 3OKLB 1MFCL 4LSTL 3U4EA 4QXUL 2V2WB 3O2DH 2Y07H 2MPAH 4P9HL 1X5LA 3HE7C 3U30C 1D9KD 5DTFA 4O2FB 2IANE 3MO1A 2VXTL 3CU1A 5MEPB 1OAYL 1RMFH 2NR6D 5GPRA 2R56L 1QSZA 5C07D 2VLRE 3QFJE 3DVFA 3WO4B 1I1FA 5DMKB 3T3PF 5I8EB 4JHAH 3FHAA 5K9OA 3VW3H 4KK9D 1WAAA 4ODTL 3QIUC 2C3HA 1FC2D 1F45A 3K2MC 4OFDA 2XFXB 4L8BB 3K7UA 5CIPA 2WLYA 1MRFH 4QRRE 2VLKA 2Q1EA 3X12B 5C71A 1M7XA 2CJUL 1NC4B 1OP5K 1S7VB 2DQEH 2FSEB 1BZ7B 2Q86A 3HE6A 2NX5D 5B21A 3FAWA 3WJJC 4YHZH 1M4KA 4I0KA 5FUOL 2MFNA 5L9DL 4W81A 3QQ3A 1CXKA 1WFTA 5LXGH 1NQBA 2H32B 4HX1B 2C4FU 4MJIE 1QKZH 4PGDB 1EHLL 1KJMA 1CDBA 2MMXA 2ESVA 4K71C 1KF9B 2R39A 4FS0A 3MYJA 4X83A 3CMOH 3UXFA 5GRYA 4LQ1A 4CRPA 5DVOA 1IGFH 3RTQC 4WI2A 1DUZB 3HNTL 5L7XL 4FXKB 3LKSB 1MOEA 4JDVA 3OMZA 4PR5B 5F1OB 4G8GE 5F6IB 2RFXA 4ETYA 5I2IA 3O3AA 3LDBB 4APQD 2IAMD 5I1EH 3VGAB 4Y89A 4HWZA 4MGXA 2DJSA 3QUKB 5C0CD 1BFOA 4OM0L 3IS1X 1I7ZB 4X9IA 4K8RH 1L7TH 3FO0H 4GRMB 2ZCKL 4NO3B 2QQLH 1KJ2H 3KYOB 1J87A 3NAAH 2D9QB 2DQGL 1FGNH 5LWYL 4OV5A 3PHOB 2UZIL 2NY4C 1GHFH 5F1KC 2YC1A 3QWOB 4P5KB 1HQRA 2AJYH 2X70B 5TH2B 5TDNB 5I17B 1YEFH 1CTNA 5DHYA 1N6QL 2Q87A 3GSUA 2XN9D 2C3GA 5DJ2A 4N0UA 5BV7B 4MNHA 2G9HB 4UDTB 4WU7A 4O2CB 5KSUB 3FRPA 4NHCH 1NEUA 1IGTA 4PIRF 3ZE0E 3EOAA 5J9PB 2WMPA 4GRWE 4AEHH 3W2DL 4JJHA 2DM4A 3OF6D 5IB5A 1D9KC 2N7AA 2P46B 5BW7A 3OGOE 5GS2D 3P73A 1N4XL 2E6JA 5IM7A 2ERJB 1U92A 3V52L 1CK0L 1HZHL 4XMKL 1XGQA 2NR6C 4Y4HD 1U3YA 4RCAA 4WNQA 1QA9A 1SYSA 3VFWB 4BJLA 4JG0L 3DRQB 3CXDH 5BRZD 3UAJD 1HDMB 1ZGLA 1BFTA 5EU3B 5JW4M 4LKCA 4KK9C 2QQKH 4U0QB 3GI9L 2QHRL 5CEZL 1VDGA 5SWZA 1HXMA 4LCUA 1F58H 4DQOH 4F58L 2CH8A 4PJBB 3SGDH 1TMCB 3MJ8A 5E8OA 4MJ6A 4QF1B 2YOCA 3QDMB 2D9CA 2YUVA 2P5ED 2AK4E 3PV6A 2OXHA 2R1WB 5D71L 1A5FL 2J4WL 4M62H 5F7EH 4HUMB 1JF1A 4PRBB 2FD6H 4OGYH 4N68A 5F96H 4P2QD 4UTAH 4IIQB 2D7PA 4PGZA 4XWOD 3GNMH 4LLQB 5L88H 3GJEA 3L95B 1A2YA 1E4KC 3SE9H 3DROA 1NFDE 5KSAA 4WU5B 3BPCA 4FQXA 1FGVH 5AWNL 4APQC 1HHGA 2IAMC 3TYGL 1NGWA 3WIFA 2IH1A 3HNSL 1MHCA 4NQDD 4F7PB 2FBJH 4ETQB 4MA1C 2OMBA 1T2QL 3B5GA 2OR9L 2VXQH 2DDQH 1QACA 4FQIL 3RP1A 4XPBH 4KK5D 4KXZH 1EFXB 1TNMA 4LRIC 3RFZC 4ODSH 1J0HA 1RJZA 2H32H 2JIXA 4WTZA 1X5IA 3V0WL 4LSQL 1FYTA 5TQ0L 2R2EA 3T2QA 4L3CB 1YMME 4Z7NE 3QA3A 5DJ6A 1QSFA 3TT1H 2FX9L 4PB0H 3ARSA 2XG4A 1MJ8L 1NC2B 2WSKA 3KGRA 1TCRB 4WDIB 1JHLL 5E7FA 1RFDL 4LASH 4P9HC 3K8LA 1UCBH 2A1WL 2ZSVB 2E3VA 4HMEA 3VE0B 3U46B 1GZQA 3DUUB 5HDLA 2I9LB 5I1IH 5HHME 4NYLB 5C0ND 3RL1B 3ULSA 3DBXB 5GRWA 3UTZB 3PWNA 4KH2A 3BEWA 1T7YA 5FO8B 1Q9LB 3V4UL 3RX5A 1BF2A 4L4VB 4JO4L 1QFWI 2CO7B 4MDJA 4E0RB 3FQNA 3D6GA 1VA9A 4C83B 5JXAL 1GGCL 3CX5K 5CEZD 1OGTA 3CDGA 1TTGA 1J0KA 3IGAB 3PQYA 1CCZA 5ISZD 2X4QA 3PABB 1NBZB 3RJDA 1XMWA 2W9DL 3MFFA 3UMTA 3KYNB 4PJCF 4G9FE 4NQSB 2JJUA 1ORQA 1SY6H 3QCUL 4FMKA 5J6GB 4AG4L 5BV7H 4E42B 1CDIA 4Y5XB 5K9JL 3RU8L 4GFTB 5CBAA 5JORB 4QGTA 5ID0B 5HVHC 3QEGH 1KIQA 1NEZB 2E7MA 1HE7A 1Y18A 4XCYA 4C54A 2XG5A 4IMLA 3VFNB 3VD3A 2V9TA 1SJHB 2YA2A 4ELKB 1U8QA 2AABL 4L8SA 2D7TH 1MFEL 1ZOXA 4U4BA 2Z8RA 5J06A 1FFRA 5CSGA 5CINH 3DV4A 4FOMA 1UKSA 1NFKA 4XWOC 4KK6D 2LFGA 1T1WB 3CZFB 4G8FB 3KDMA 4K3JL 1TVDA 1A4JA 4C56A 2VR4A 3X13B 1BQHA 4XNYH 1QLEH 4RSVA 3REVB 4H1LA 5FYKE 1X4ZA 4RMSA 3L3GB 5DZNA 1K5NB 4TUJA 3RUGF 5IBTH 4IMKA 5EO0B 3OPZH 3C5ZA 4KK5C 3DMMA 2BXYA 5EO9B 1A7RL 2AXJA 4NZTH 3S9DB 3A6CL 5FM5O 3VD9A 5CUSL 1I7RB 3MX0A 4WCYL 3GKWL 4L5FH 1U8IA 3IU3A 2EDLA 4HXBH 1JGLL 3EJJX 1S5HA 4Y5VC 3MJ9L 5FYLL 2EXYD 3ZDXF 5IMLB 5MI0C 2VDQH 4PJXE 1FZOB 1KPVB 4HZLA 4LLWB 4A2MA 3NA9H 3FQTB 3TF7C 2CO6B 4TSCL 1KELL 2CRIA 4CMHB 5DLML 2XI9A 4HWNA 3ILQD 1PY4A 5C0NC 4ELMA 4EKXA 2E7LA 5JW5A 1DQQB 1U42A 1UADC 1YEEL 4YFLF 5IFHL 1UEMA 1BQSA 5SX5H 5T1MB 5BXFA 1SEQH 2OK0H 1QBLH 5C7XH 3L5WB 4LSUH 4KRNA 4JKLA 5IB1B 2IH3A 5FECB 3OKKB 3DUHA 4XBGA 2IQ9H 1F4YL 2CD0A 1GOGA 5C9JA 1OAZL 1TJGL 5MP6L 3KPNA 3M07A 2VZSA 4M7JL 2AV7B 3WMSA 1MCQA 1UWXH 3WHXA 5DEGB 3UTTB 4URTB 5CZVH 1MVUB 1K4CA 2NQCA 1IGYB 1GIGH 1M6OA 1HH9B 2WZPD 3FL7A 1BVKA 1F97A 4R9HA 1B88A 4GKOA 3D1MC 4ODWB 3CGTA 4XPAL 2NY1B 4XXCC 4D0CB 3MLZL 1UM4L 5J12C 5DI8B 1IQWH 1Q94B 2YHGA 2RQ8A 5GGUB 5D7LA 1RZGB 3VA6A 2VABB 1RZFH 1XIWB 3UTPD 2VC2L 4YXHH 2VUOA 4Q9QH 1BBJB 2FLRT 2DM3A 2WM0A 2G75B 3SE3C 1YEJH 1DUYB 5F72S 4ZYKB 3Q2CA 4JFEA 5BCAA 1JPSH 1QFPA 2CRYA 5AYUH 1MWAL 1AGEB 5BZWB 43CAA 2BNUB 3PXHA 1LO3L 4Z7UB 4QEGA 3ZYIA 5I19L 4QO1A 4S11A 3OAYK 4F9PC 3NIDF 2A0LD 4YHLH 5JNYA 3WV0A 2R1XB 1GVIA 5E8EB 2R4RH 3QEQA 4RFEB 4Y0GA 4Z0XA 2NNAB 4JN1L 4R97B 5GS3A 1AR1D 4NIKB 1YEHL 1PKQE 3D18A 4MX7A 3ZSTA 1KB5A 1XEDA 1UXSB 3BKJH 4BUHA 2O93L 3BKML 3LPWA 5C3LD 5IEHA 4N90D 1KLGA 1QBAA 4OFVA 4WI9A 2WWMD 2P5WA 2QQNL 4FFVD 2I07B 4Y19B 1AFVH 5FYLD 3TPUB 4LLAA 2WAHA 1ZAGA 1TVHB 4RGOL 1W8NA 2ZNWA 1BOGB 2EXYC 4LVOC 3O3UN 3Q0HA 4R6UA 4ZUTB 4FQ2L 4Q6IC 1CT8B 1HI6B 4HLJA 2R9HD 4ZFZB 1ZLVH 3TESA 3CU7A 4NWTH 4TNVF 4XVSH 4L4TE 3ILQC 2DB8A 5I76B 5T5NG 4ODBD 3VXRD 1QSED 2CDFB 3R1GH 4P9ML 3GIVB 4Y1AA 2GK2A 4JHWL 8FABA 3S37H 4MD4A 5KSBA 3VFTA 4R7NB 1S5IL 3EZ8A 5JIHA 3ZHKA 5KANI 4EBQL 1D5XA 5IUSA 4KJYB 3QDGB 4HC1A 1Y6MR 4JFHE 2ARJB 3T77A 3H9YA 5C0FA 3BXNA 3ARDC 3HMXH 4WV1A 3RVUD 2FBOJ 2OJZH 2KL6A 4WTWA 4BK4A 2XNAB 4PY8I 1IC4H 2AEQH 4NQEE 1JYWA 2NY5L 1DR9A 1XZ0B 2R0KH 4CVZA 4D0DA 5I18L 1DQDL 3KYMA 4U6VH 3OXRA 6FABL 3ZDZF 4LLVA 3MBXL 5HYJD 2JB5H 4MA3A 3KYKH 4PV8A 1B2WH 1DEEA 1ZS8A 1T1XA 3MCKB 3BJ91 2I27N 3SHSA 4L1DA 5EO1A 4HV8B 2A38A 4PREB 3ARVA 2XA8H 1LDPL 3NZHH 2M2DA 4Y2DB 2G60L 2IJ0C 2OMNA 3QXUA 5KBNC 1TXKA 1UACH 2A0LC 1XF5B 2AGJL 3CVIH 2R0ZH 1MFBL 2X5PA 3H42H 5J11B 2BERA 1BP3B 2DLEA 4XNQA 1EZVY 3EYUL 1AR1C 2VDPH 5I1LA 1X5XA 5B3JF 3KPRA 3BEVA 4P2QE 3O9WB 4QRPA 4HT1L 1ZSDB 4WFEE 2YD4A 4OCSH 2VN4A 3RWDB 5IVOA 3NIGF 4X5LA 3HB3D 5C09D 3QWRA 3DECA 3EYFB 5KN5A 4RMTA 1R3IL 4X9BA 1FP5A 2QSCL 4L3EA 4DGIH 2X1OA 5E7BA 3KNBB 1SEBB 4PGBA 1ODAA 4U3XA 5B8CC 3U9PL 3PDGA 4PD4K 1QFUH 1X5AA 2EDOA 2R9HC 3FRPG 1WBZA 4AH2A 1NH6A 3ARTA 1K2DB 5C0BD 2A77L 3U7WH 4JM2D 4LFHG 1UM5H 5DJYA 3QQ4B 5F9DC 2G2RB 3ARGA 2Z35B 2GSIB 4XNZB 2HVKB 2EE9A 3TBYA 5BS0A 5L2KD 1S9KC 3MOQA 4PLKC 1TETL 5ID1B 1U8PA 2OJEA 1RZ8A 1U8LB 4XCNB 4FXGA 3BHBA 2XTLA 3AUVA 4JFZH 4ZD3L 3WEXB 5IQ7H 1FPTH 1CD8A 4XPFH 3B3IB 5CEXB 4UQ2A 5IMKB 3VFOA 1U2HA 3OX8A 1I1AB 4Z9KB 2X89A 3RVUC 4LHUA 3TJEL 3MJ6A 4K9EH 1J88A 5I73B 1UQSB 3BSZH 4FTVE 2O61B 2HKFL 2X4RA 2EO1A 4UIMB 2ZOLA 2AI0H 3EOBA 3VXMB 2NY2B 3D0LA 4L29A 5GHWH 4WO4D 7CGTA 1U8HA 1ZEAH 4PJIB 1MJ7H 4JKPH 5T1LD 5FF6B 3SDXA 5CEZE 1FLTX 2GSGB 1T3FB 3KLAB 3OG4B 2PYEE 4CN4A 3NPZB 5H2BA 1NGPL 1Q9WA 1XR8B 3GUTA 3D2UB 1KULA 5ISZE 1DJSA 4Z76A 3RGVD 2DLFL 4O4YL 1CICD 1A3LL 4IHOB 5IB3A 1W72H 5F7NC 1CDUA 4L8CB 4JHZA 5IOPB 3EOTL 1H8OA 4H88H 3P30H 3SDYH 2MQ0A 1BIIB 1WCBB 5L6YL 3DRTB 1QLRB 1OP5H 4P2YA 4K3DH 3O8XB 3OAUL 3MV8D 3T65B 3X3GL 1INDH 4MJ5A 3BMWA 2HJLB 4NKMB 4G9DA 1MNUH 4XPHH 4W4OC 3L3OB 15C8H 4JZOB 4P59H 3MUGB 3SDCA 4U3CA 4Z7WF 3HLAB 1VKXA 1KCSH 5GGSB 3HB3C 3QAZB 3RA7H 1T22A 3BKCH 3QIWD 4NOBA 5J13C 5IHZA 5SX4H 5EUKB 3RX8A 4M4RA 2RHEA 5FAAA 1IAKA 3CK0H 4MCYA 1UZ8B 2PTTB 3QNZA 4P48A 3VG0L 4TNWK 3RZCB 4XCCH 5D7IF 3MLYL 1YZZA 3LQZB 1D5BA 1DBKH 6CGTA 3UC0H 4JM2C 2VDOH 1IAOA 3WHE1 1GJIA 4HUXB 4MS8D 3TO2B 2J88L 2ICCA 5LCVH 1NCWL 3ZL4L 5E4EC 4GMTL 1G6RB 1J8HB 4M1GL 2EYSA 5INCB 3HRZB 3FQWA 3LHPH 5ICYA 4I18C 1MCOH 3IDYC 5KZCD 2JK5B 4U31A 5EU6D 5CBEA 1PYWA 4U1NA 5EC2A 2L7JA 3V5HB 4MZ2A 5I30H 2NY0D 1E28A 2D03H 3LEYL 5I6XC 2P24A 1SHMA 3RVXD 2VLRA 3QFJA 3MRLA 1IEBB 5LGHL 5D2NE 3V8OA 4JG1L 2GK0A 4AENB 2GUOA 1ROWA 2R2HA 2ZNXA 3IJSA 4KI5F 2NY5C 1INEH 2BY3A 1LILA 2CKBH 4P2OD 5CMAA 4DVBB 5IW6B 1JYXA 1WC7B 3BKYL 1JGEA 3I02A 1JWUB 5BO1H 2NTFB 1A6WH 2FEEI 4G42B 3QUMA 2HFEA 1Q8MA 5D96B 4Z77B 4JRXB 1H0DB 3EDKA 5EU7C 3ARYA 3L3JB 1P2CA 2FYYA 3EFFB 4S1QL 3UDWA 2ATKB 4NKDB 2JCCA 1FAIL 3GB7A 3JV4B 1C5BL 3RGVC 1N3NB 3KJ4C 1CICC 2I25N 3K8KA 2DQJL 4CDGC 4GT7A 2NZ9D 1MJJA 1EO5A 1HWGB 1IJ9A 3CDCA 3FO2A 3STZA 3MRIA 5ESQA 2DQTL 3T0VA 1A6VL 2COQA 1HKLL 2OZ4A 3X14B 5ERWB 4FABH 4Z0BH 3BDXA 5DQ9B 4DOHE 2AJVL 1TZIB 1CLYH 2CMRL 1KXTB 2VLLA 3CSYA 3FONB 2FX7L 4H1LG 4EDWH 1NBQA 4NUJA 1NDGA 4JLRA 5JR1L 2GFBA 2EDKA 4K7FA 3TT3L 5D7IB 5GSVA 3HA0A 3QIWC 3MACH 1YN6A 2APTA 3LQAH 2P7TA 5JPMA 2F19L 5CD3A 1AQKL 2Z4QA 3ULUL 4Y16A 4ZQKA 3QI9D 3AY4C 1DL7L 1NUNB 4PV9B 4KGJA 4RISH 2GJ6B 4RFNB 3VMOA 2VXSH 5FYKU 1UWGL 5F9OL 2DD8L 2MOVA 1OD9A 5J1AA 2EC9U 5DQJA 4MS8C 4EI5A 2ZUVA 2PCPA 2DBLL 1QFHA 1XCTB 5D2LB 1MCPL 1KNOB 3G6AA 4NQCD 4F7TA 2YUZA 5FYLE 5DD3L 1VFAA 4MZ3A 1E6OL 1EAJA 1EEZB 2P8LB 4YIQA 1AO7B 1FC1A 4PJ8D 5IBUB 3RVXC 4XBEH 1NSNH 3OWEA 2PN5A 1HINL 1H3PH 5E8PB 1WJ3A 4LAQL 3MFGB 2BDNH 2A9ML 3RWHA 4DK3A 4ZOEA 4HH9B 4ZPVB 2EE2A 4UNUA 4P2OC 2DI8A 3ISWA 3DI3B 5FCUH 3NN8B 3GEWB 4H8WL 5TDPA 3U4BH 3UBXA 1PVHA 5BOZG 3MV7D 1BBDH 1ZLUK 2ZUTA 5E00B 4X4YA 4YNYB 5T3XH 4OZ4A 3MRFB 1OW0C 4NCDA 2ZWLT 3SCMD 4EI6A 3U0PA 3T0DA 3V8CA 3FFCD 3OG6B 4X4ZA 3N85L 2CR3A 4NQTA 1NL0H 5C08B 5I8CB 3GMMA 2NZ9C 3ARBA 4RMRA 4NDMB 1NFDA 5HHPB 1FVCB 1I3RB 1YYLL 3ZKND 2VLJB 1XF2B 2E7HA 1GAFH 5HYJE 5TDOA 1VFUA 4HCRL 3MNZB 5D1XA 2Q6WB 2V5YA 1JGDB 4TQEL 5TF0A 5HPMB 4LDEB 1BD2D 4D8PA 3HZMB 2BJML 4WFHE 2BOCA 3ILPB 4LSSH 1BMGA 5L8KB 1UZ6E 4XP5L 4N5UA 4ZFOB 3L5XL 4S1RL 5IWLA 4MQSB 1YY8A 4FQ1L 5EDXA 2AS5M 1CVRA 1YMMA 2AK1L 2I5YH 2CLRB 4HDIB 3SDDD 3BE1L 5C0AB 2VUYA 5GJSH 4WW2C 5DJ0B 3ET9F 3T1FB 4B5EA 4JANB 4QGYA 3GI8L 4UQ3B 1K8IB 4PP2A 2Y72A 1AGCB 4PJFA 3PWPB 3BO8B 5E5RB 2BOBA 3JTTB 1U58A 1MCCA 2IADA 3LKOA 4DTGL 3L1OL 4EXKA 1DE4A 4M43H 5C09E 4NNXB 1PDKA 1WLHA 3QUZA 5MEOA 1UJ3C 1U2CA 4PJ9B 1AQDA 3IVKA 1Y0LA 4M61B 5D9SB 3NMEA 4PJ8C 3GJFA 1HQ4A 1N64L 4NHUB 2K9UA 4U1SA 3DV6B 4MQ7B 4WUUA 5EBWB 3TBVA 1JIBA 4ONFL 5C0BE 4RWYL 1RURH 2G5BA 4NUGL 5DD5L 3T0EA 4DWHA 4OGXL 5F97E 3BMVA 4NSKA 3HE7A 3TNNA 2EEAA 4RAVB 1FO0B 2IFFL 4BK5A 1HSAB 2Z31C 2ZOKA 1DLHA 3CCHB 4BH7A 4NM8L 1EV2E 4KRMB 5B38B 1P84J 2C1OB 2I60H 4TOYH 4NC0B 4U2YA 3MRBA 1HYSC 3D5OF 3FRUB 3A6OA 3GSVB 1QQDA 4OKVA 1PKOA 1KTLA 2BNQB 3BUYA 3QIUA 3TZVB 1QRNB 4S1DD 5EBLA 3GSNB 3FO9B 4J3UA 3C5SB 4NZJA 1F00I 4OF8A 2BVTA 1AHWC 3L6FB 2Y36L 4WJ5A 3O2VL 4PJBE 3ZKNC 4Z7QE 3C8HA 2A74B 5HYQB 3WJJA 5EU7E 5JHLH 4LRNL 5LBSL 3MRQA 3BRFA 1ZVHA 2JB6A 2DWDA 1NCNA 4Z7VE 4Z7OF 2OL3L 1SJXA 1XH3A 5HGHB 5JZ7D 3QEUA 1OGAD 2GAZB 4PJEF 4WY7L 2VOTA 3BPNC 2X4SB 4U1IA 1SBSL 2Z0BA 3ULUC 3H9SB 2R1YA 2YD6A 4X98A 3RVVD 1FNFA 4JY5L 1JV5B 5EWIH 2NW3A 2JELH 4PJAF 2NY6D 5DSCA 5CEYB 4OF0A 1NCDL 4OZIB 3SDDC 4J8RB 1JZ6A 2VR5A 4U6YA 5DRWB 3MV8E 1BEYL 4PJ5E 5JTWA 4MHHG 5E1AB 5CWSB 4MNQD 1Q1JL 3CLFL 1Z0NA 3TIDB 4YGVB 1HWHB 1KGCD 4I2XB 1T4KA 3RWFA 2EDTA 3U4EB 2R29H 3PDOB 3V5DA 1BFSA 4YHOH 4AY0A 4BUGA 3GBMH 4J7RA 2RJMA 4R4BA 1JRHH 2IBGA 3MO1B 1CYGA 2UZYB 5DC0A 5IFAH 4P49A 3A67H 3VFRA 3WIHA 4OTXL 2MQCA 1CGSH 3H3BC 4IRSD 2RGSA 1JPST 3T2NL 2B1HL 4HG4K 3OTTA 1ED3A 2QTEA 4GS7B 4CW1A 4K7PH 4LSRL 3V4VH 5K9OB 3MMEB 4H8WC 1C12A 4Q6YA 1XGYL 5EOTA 5A2KH 3QBTB 5CIPB 1D9KA 4OLVH 3RVWC 2VLKB 3BAEH 5BMFH 2ITCA 2R23A 1RK0A 2A6IA 3MV01 3O11B 5E4IA 2Q86B 3HE6B 5F8QC 3STBA 4NBYB 5C07A 1MAKA 1AKJB 4KJQD 3QQ3B 5DYOA 4HWBL 1AGDA 2VAAA 1KJMB 1TPXC 3LMJH 5BVPL 2ESVB 1S7WA 4S1DC 4I0PB 5ICXA 3MYJB 4GRLB 4Y5YB 4MXVE 4P3CH 5TFSL 5GGTH 4H25A 4PRDA 4XNMA 4LVNC 4Y4KD 4OLYH 3H7BB 4JDVB 2RFXB 2NX5A 4YDKH 12E8H 2KPNA 3MYZA 4KY1H 4YDVB 1QR4A 1GZPA 4JFFD 2VMFA 3CH1A 4HWZB 5DRZB 2F58L 4PJAB 2XRAH 5IHUL 4AM0B 3DTXB 1BFOB 2WUCH 3DARA 5E1HB 2Y25A 1IC7H 4LHJB 2DN7A 3TYFA 1PKQA 5JZ7C 1U8JA 3CZJA 5IVXE 4KV5E 1OSPL 3C08L 3RVVC 4OV5B 4O9HL 1OPGH 1R3HB 1E4KA 4KJPD 3VFMB 4YDLC 3IU4H 4OUOA 1SJEA 1HQRB 2NY6C 2DMBA 3FB7A 1DANT 3SE8H 1V7ML 4OLZL 4APQA 4TVPL 4M7KH 2IAMA 3GSNH 3O3DB 4N0UB 2XPGA 4NZRL 1A02N 3S96B 1IGTB 2F53D 5C0CA 3EOAB 5HI3D 1YMHA 1G9ML 1KIUA 1IAIH 4RRPA 5IVZA 3GHEH 3OZ9H 4G5ZH 5DUML 3S5LA 3V2AR 3GMPA 5EIVA 4M5YL 1KXQE 4LRIA 3BPLB 1JJUA 3LKQA 3P73B 5IM7B 5F9WB 5A2JH 1U92B 4UTBL 4U2ZA 1XGQB 3MOAL 2K1MA 4EJ1C 3G5VA 4X6DA 2HFFB 4YBLB 3MLPA 5HY9A 4IRSC 3HZKA 1J8KA 3C5JA 4NQUA 4WNQB 1SYSB 3ZE2F 5C0EA 4BQ8A 1ZGLB 5CJ5A 5E2UL 1ZVSA 5FGBC 5F3BA 4LKCB 3WFHA 1MCIA 2HVJB 4K23H 2XKUA 4ZFFA 3ARRA 1I9IH 1A1OA 5SWZB 3B8SA 3SE4C 4N9GA 3NFPA 4RGNE 2RIKA 4OZGE 3MJ8B 5E8OB 2YSSB 3BD3A 1TITA 2XTJB 1T2JA 4U1MA 3TVMD 2F5BL 1HXYA 3PV6B 4J2XA 5BRZA 4KJQC 3LV3A 5TQ2H 1RZJH 2CGRH 1JF1B 1AGFA 3VA2C 5FO9A 3DHJA 1KN4H 3HS0A 4HULB 1QO3B 5DK0A 2FATH 5DUPH 3H3PH 3GJEB 4UT7H 4AMKH 3O2DL 2Y07L 2MPAL 4QHMA 1UG9A 4Y4KC 3DROB 5KSAB 1JK8A 5F89B 1HOCB 3ZTJH 1ND0A 3BPCB 2AJZB 4FQXB 4YK4B 2P5EA 2XQBL 1HHGB 4MDIA 1CDGA 5CIPH 2ZUWA 1RMFL 1NGWB 3WIFB 5DO2D 2BFVH 4OIAA 3B9KD 2IH1B 1MHCB 2BVYA 3CDYA 2YPKA 2J5LC 4P57A 4P2QA 4OQTL 2Q8AL 4HIIA 3HR5A 3U9UA 3VW3L 1QUNA 5TE6L 1N2RB 1KC5L 2J8OA 1IM3A 4KTDL 3FO1A 4MJ2A 4P46B 1RJZB 4KJPC 3ARWA 4U1KB 1A21A 3O45A 4TVPD 1FYTB 1MRFL 4Q0XL 4UOW1 3QA3B 5C6PB 5DJ6B 5TE7H 4JO2H 2J8UF 4DKEH 4NQDA 1CF8L 3AB0C 4Z8FL 2VE6A 4YHZL 3AC0A 5HI3C 4GUPA 1G6VK 3WFZA 1BD2E 1T04B 1GZQB 3TPKA 5LXGL 3O0RH 4FP8H 4ZUVA 3ULSB 5JQ6H 5I15H 4KZDH 3ULUE 4R0LB 3E0GA 3FQNB 3CX2A 4Y5VA 3KPSD 1P69B 3DVNA 3QUXD 5E94A 1T1YB 5DEFA 1C08A 2E9IA 4TSBL 5I1EL 3PQYB 4OM1H 5C2BH 4JREB 3MFFB 3PWVA 4F8TA 3QO0A 1FDLL 5F1SA 5FYJH 5KG9A 1ORQB 4PRID 4HPOL 4K8RL 4FTVA 1L7TL 3BPOC 3FO0L 1V3MA 3IDGB 4CBPA 5ENWA 3ULVF 4NKIH 5E24E 4XPTL 3UBXG 2Y4SA 1ETZA 1FGNL 1Y18B 4ONGH 4XCYB 1D5MA 2DJUA 3TVMC 1GHFL 2APFA 4M9OA 1JP5A 1CWVA 4PG9B 3VXQA 3ZYJA 3O4OC 4OLWH 2AJYL 4PRHE 3D3VD 3JWOH 1U41A 1I8MA 1YEFL 2PYEA 1U8QB 1SM3H 4L8SB 4JFDD 3QEHA 1AIFA 5ISZA 2WP3O 1T1ZA 4YHML 5MEND 4RGMB 4OT1L 1FG9C 3PWUA 1DP0A 1G1YA 3DV4B 4NWUL 3I2CL 4PJDA 2H8PB 4AEHL 3QXAA 2BNRD 2ORBL 1B4RA 4FFWC 4G6KL 4NNYB 4X4ME 3TH4T 2DQFA 1QZ1A 3O4LB 2YUWA 1W0VA 3EDEA 1ONQA 3QRFM 4NQVB 1A4JB 4C56B 2H2PD 5JW3H 5ESVA 1BQHB 4XXCA 5DO2C 3B9KC 1UFUA 4N0CD 3MROB 3FT2A 2ZUSA 3LRSA 1OP3K 2J8UB 3JWDH 4GG8A 2X7LA 2QQKL 4YHPA 4YDJA 3DMMB 3RWEB 2YPVH 3SE3A 2P8MA 3MRPA 1JYNA 2HT3D 2EICA 2NLJA 5F1IB 5DA4A 2FIKA 1S5HB 2ENYA 1WV7T 2IG2L 4EDXB 5I1HL 4F9PA 1S8DA 3D85D 1G9MC 5DMJB 2XZZA 4GJTB 5I1GL 3DX8A 1OWRM 4HZLB 1IBGH 4TSAH 2ADFH 1A6TB 2AV1A 4NJ9L 4U33A 5A2FA 3WNMA 2FD6L 2BHYA 1F5WA 4I3GA 3B2VH 4G6FB 3WFCH 5JW5B 2GYSA 4KAQH 5E08H 1KEGH 4UINL 4UTAL 1MH5A 1RZIA 3VXUD 1RJLA 5BXFB 1O0VA 4KQ3H 1TFHA 2QJDA 2GTZA 5DVMA 3RWGA 1BF8A 3SE9L 3QUXC 4YZFE 1EIBA 2IH3B 3QZWA 4XP6H 4XBGB 4Q6IA 2MSPA 1OP9A 4HUNB 5C9JB 4K8RD 2R0WH 5B39A 1KGCE 2FBJL 3FTGA 2EKJA 5KAQF 3OKEA 3WHXB 3RDTD 1A14L 2VXQL 1MFNA 2DDQL 2EDYA 5IMOA 3OR6A 1CXEA 5CFHA 2AVGA 1M6OB 2L0DA 1X6NA 4QOKD 4UOJA 1BVKB 3VFVB 4ODSL 3QDJD 3SJVE 2PNDA 3FQUA 3PNWB 4UU9A 4PB0L 4JZNA 4LCIH 4YJZL 5D7LB 4LEXH 4NN5C 1F8TH 5JMOC 3S97C 4LASL 3U7YH 3HI6H 3QQ9D 1UCBL 2H45A 1CXIA 4HS3A 1CZ8H 3B6SA 3OJMB 2PW1A 4JFEB 5CGTA 3FQRB 43CAB 3CFJB 2BVQB 4WW1A 2YK1H 2YBRA 1ZLUH 3HUJF 4ZO6A 3S3PA 2H2PC 4L8DB 5EA0L 1AXTH 1N6UA 9CGTA 5JNYB 4JY4A 4N0CC 5MEQA 3S8WA 5KJRL 3QEQB 4GW4A 3HPLA 4Z0XB 2YXFA 4DKFH 3K80A 4ZOBA 4ODHL 2YPLD 3D18B 4UI2A 7FABL 5CGYD 4QYOA 3W9DA 2BSSB 2HT3C 2FL5B 4GKSB 4PJHA 1N6VA 5IEHB 1SY6L 3W39A 5BV7L 2P5WB 2FR4B 1EHAA 2OM5A 2VTFA 1MIEL 3O2WH 3T3ME 3QEGL 1T5WA 3C09C 4BA8A 4JFFE 3S35H 4CVXA 4DGYH 5K59E 3IDXH 3UYPA 3UP1A 1ES0A 4OCXL 4HIXL 1WT5C 3HC0A 5JXED 2D7TL 4RIRA 1B0WA 3EGSA 5E9DD 3RX7A 1PQZA 4JY6B 4FNLH 1GC1H 1HNGA 5CINL 4QRQA 2ID5A 1UKTA 3VG9C 3WS6C 3MJ9A 3P0GB 3U36A 3DVGB 1KJVB 4Y1AB 1JFQH 3AU1B 3QPXH 4JFOA 4MD4B 5KSBB 3ARED 2ICWA 4HGKC 4XC1H 1D6EB 5EZIH 4M6MH 4DN3H 2FZ3A 5B8CA 1CXLA 3G6JF 1EHNA 4K8RC 3T77B 1MUJA 4JRWA 2SEBA 4P99A 5C0FB 3BXNB 3RWIA 2V17H 2A73A 1KCRL 5D7KE 4AJ0A 4WV1B 3RDTC 1BJMA 2QHLA 3VXRA 1QSEA 3OPZL 3FB5A 4OD3H 3HCVA 2FHCA 2X4TA 3ARFD 1X7QA 4CVZB 4D0DB 2E8ZA 2CK2A 4X6CF 4NZTL 3KYMB 4UMGA 4JDZA 3OXRB 2XWTB 2V7HA 3PP3H 5K9KA 4LLVB 4HXBL 3RY6C 4MA3B 1DEEB 1IFHH 3NCYP 5CP3H 2LU3A 3HUJB 1F90H 5J6HA 3NA9L 3ULVH 5EIIA 5EO1B 3U79A 5DUBA 3S34L 2H6PA 3SDXF 5I71B 4ALAL 3OJDA 1A7NH 4G8IA 4CADA 3X3FH 2D7NA 4X9FA 3NACH 3NIFF 1SEQL 5HYJA 1QBLL 5GRJH 4LSUL 4XNQB 1FLRH 4WGVB 3BEVB 1FV1B 5CGYC 1S9VA 1MWAA 1N7MH 2C26A 4N8CH 2CXKA 3CVHL 4PTUA 5CZVL 2IQAA 1XCQA 1WBXA 3EFDH 4P2RB 5KN5B 1G7MA 5F44A 2CLVB 4QHKJ 3FT3B 3GSXB 1XF4B 5LGJA 3IB4A 4HQQH 4JGJA 4M1CD 5FKAA 1WBZB 4AH2B 1YEKH 4W4OA 1XAUA 1IQWL 2NXYD 2AEWA 4YX2L 5JLZA 5DJYB 1JMXA 5F7FA 3BW9A 4YR6A 4LFHD 3ARGB 2HT4D 4Q9QL 3B2UD 1CLOL 5JOPE 2DL2A 5C09A 3GSRA 1YEJL 3NBNA 3TBYB 5BS0B 2K3TA 4KPHH 4TVPE 4B41A 3AREC 1JPSL 4X4XA 1OM3L 2DTMH 2OJEB 3D25B 1B4JH 3IF1A 1RZ8B 2QSVA 3PWLB 3ZYOA 4FXGB 4K7PY 3BHBB 1YNKL 1CFQA 4YHLL 4UQ2B 3VFOB 3OX8B 3MXVH 5C0BA 2KZWA 3QDMD 3RBSA 4LHUB 4B50A 4JM2A 5GQBA 1EPFA 5E2WH 4ZMAT 5EH1A 1R3JB 4OGZA 3PGCA 2X4RB 5JUEH 3ARFC 1U93A 2ZOLB 5L2KA 1ZE3C 4I18A 3LSOB 2ZG2A 1KCVL 3D0LB 4LK4A 5D2LE 1NAML 2ITDA 1AFVL 1U8HB 4M5ZH 1J1XH 5F7YC 3SDXB 3HG1B 5H2BB 1Q9WB 4PBWD 3GUTB 1P7QB 4Z76B 3GRWA 1LO2H 2XACC 3VGAC 1S7XA 3WFBL 3W0WE 4ERSH 3DUSA 4HC1H 3BWAA 5EZLA 1MI5E 2VWEE 4PS4H 3E8UH 3WIIL 3R1GL 4YDIH 1LEGA 4WO4A 5HTSA 3QSKB 3HC4H 3VH8G 4Z18A 5T1LA 5HDQL 3D3VE 1GGUA 3C9NA 4XVUD 3RY5A 2VDKL 3F8UB 4Z7VA 4JFDE 3IFNH 3KJ6H 1A1MB 4KUZL 4YPGA 3RGVA 3VXSD 2F15A 1ZMYA 5BV7C 1CICA 3WUWA 3DVIA 1VKXB 4LPCA 1RZKH 1T22B 2OJZL 5M94B 4RMVA 5IHZB 1EBAA 3FB6A 4G80B 1BM3H 1OAXH 1IAKB 2AEQL 4OIBA 4PRPD 4JQIL 1YJDL 4MCYB 4ZG1A 1MLBA 5BZDB 5I1DB 3QNZB 4KKCD 4U6VL 2ERJC 3MV8A 4M1CC 4DUVA 5I75C 1AD9A 4PJ5A 2P43B 1M7IB 4L4VD 5C92A 2JB5L 4NC1C 2NXYC 3KYKL 1ACZA 1B2WL 2J8HA 2PR4H 4QLRA 1J05B 2BVOA 1HHHA 2IGFH 3T8XA 3SGJC 2HT4C 3B2UC 3QIWA 3H7LA 2IANB 3FQWB 2CLZA 3OL2A 4QRSA 1PGRB 3ZE0F 5E8DH 1FZKB 5GGRY 1PYWB 5EC2B 2XA8L 1E28B 1U91A 3AY4A 3KXFD 4JFQB 3GHBH 2P24B 4ZS7L 4OLXH 2VLRB 3QFJB 4EOWH 3MRLB 1NBVH 1UACL 3CVIL 2GK0B 2W07A 1RIUH 1FNEA 2R0ZL 2Y06L 3H42L 3JBG7 1A3RH 5DJZA 3IJSB 4RA0C 4G7VH 1NCCL 2VDPL 1G0DA 1A7OH 3FMGH 5IGXH 5CMAB 2P44B 1JGEB 1FVEB 3GMRB 3DX9A 2HN7A 3DX6A 3I02B 2YD2A 3DSNA 4LBEA 4OCSL 1Z3GH 4JR9H 4GLRI 1PLGH 4IIQC 1IL1A 5E6YA 5LQBH 2ZKHL 5FO7A 1FSKB 4P5TB 1P2CB 1JTPA 2FYYB 4DGIL 3I9GH 3U4AA 3GB7B 5EBGA 1PG7L 1HHJA 5ILTH 3IAPA 3MUHL 4JPVH 1ZGLM 2OR8A 4CAGA 4P2OA 3N06B 5I1JL 3BP5A 4OZFA 3FOLA 3RQ3A 1UM5L 3REWB 3ALXA 1FORH 3FO2B 4HH8A 3STZB 4P23B 3MRIB 5ESQB 4KVCH 3RNQB 5FM8A 5C0GB 4PRAB 3DURA 3PHQA 3QUYD 3O6LL 4I1NB 1IMHC 4XVUC 1OW0A 4AYFA 1T03H 3LKRA 1PAMA 3UYRL 1SMOA 4JDTH 2DQIH 3NZ8B 4JLRB 5T5FH 4QKXB 3VGFA 1FPTL 1QP1A 4K7FB 5HSFA 4XAKE 1CXHA 5IVXA 1RUAH 4XX1G 4HHAA 5GSVB 2EDBA 4K9EL 2K7PA 4KROB 1YN6B 2MTPA 3BSZL 1QRNE 2P7TB 1IQDA 2RAMA 2Z4QB 4Y16B 1U3HD 4ZQKB 5E2TL 4XP9H 3U0WH 2YZ1A 1YNLH 5IEKA 2AI0L 2XQYK 4LKXB 5DD0H 3VXNB 4KKCC 4U6XB 3HFMH 5GHWL 1QFWH 1HCFX 3BGMB 4EUPA 3DGGB 1IKFH 3MLSH 1MJ7L 4JKPL 5E8NB 5LJYH 2DWEA 3CFCH 1OAKH 4GRWB 2YPLE 1EMTL 3EJZC 4HK3N 4FHBD 3C2AH 4EI5B 2PCPB 1FN4A 1RU9H 3TCXA 4RFOL 1LE9A 4U49A 1N0LA 3H8NA 1U6AH 4OSUL 3G6AB 4F7TB 4BH8A 1W72L 4JPKH 1QBML 1HIMH 3P30L 3QI9A 4YIQB 3SDYL 1EHXA 1NDMA 3RWCA 2EXWD 1DQJA 3NABL 4K3DL 1RHHB 3VFPA 5D1QC 2IF7A 1INDL 5JW4N 5DQDH 1MNUL 2NY1D 4KRLB 4XPHL 4NBXB 5B39G 4CNIA 4P59L 5TDPB 5CJQH 4NQCA 4OZGA 1JF5A 4XRCA 2GJZB 5HHQB 3I6GA 1K9TA 3RA7L 3BKCL 1H8SA 3NFNA 4MCZB 3SN6N 4PJ8A 4OZ4B 4YC2C 3B9VA 2AK4B 2GT9A 4PGJA 4R4ND 3CK0L 4YE4L 3HI5H 1CGYA 1MCBA 4EI6B 3U0PB 1J0IA 3E6HA 4XCCL 1IZJA 1CBVH 4J4PD 4LL9A 5D93B 3TBWA 2B4CH 1DBKL 3UC0L 4XNUL 3GMMB 1C5CL 2VDOL 1KBGL 5IV2A 3B4NA 1INQA 1WAAE 3MV7A 1NFDB 2Z31A 1TVBA 1QVOB 1NCAH 5FA4A 3QUYC 5L0QC 3NH7L 1MCOL 2EECA 2DTSA 5TDOB 5I30L 1OL0A 1MCKA 4Y19D 5D1XB 2D03L 3MJGX 2LQRA 3FFCA 3TCLA 4D8PB 4QTIH 2BOCB 3MCLH 2QBWA 1PX4A 4U0RB 1P53A 1V3KA 1YJDC 4LVHB 3MC0A 2CKBL 1EGJH 3GM8A 3GSOA 5I9QB 1AHWA 1U3HC 1YMMB 1EO7A 3WNOA 4WI3A 1UM6H 1A6WL 3CPLA 4OCYH 1RUKH 5KAQG 1NFIA 5GGVH 3TN0B 1X3DA 1BD2A 2CXGA 2ICEA 5DR5H 2OZ4H 2BOBB 1MRDL 5JQHC 3F12A 3V6FA 3K0WA 3LKOB 1A0QH 3CC5B 3N1MC 1MIML 3L7EA 1GXEA 2ADGA 4OKDA 1DE4B 5HGDB 4PJXF 5MEOB 1NGYA 4CU7A 3IVKB 1Y0LB 2HKHH 4X80H 3RNKB 3GJFB 1HQ4B 3UJJL 3HKFA 3SDDA 3T3PE 2YD1A 4U1SB 2EXWC 4NFDA 5ADPH 5FUCC 5HJ3A 3VMNA 3TBVB 1F11A 4P2CG 2OXGA 4NC1E 1CLYL 4G9FB 2G5BB 3EYQD 1OTTD 1ZA3B 4EDWL 2P8PB 4WVRA 3FAXA 4NSKB 3U30B 2C3WA 5IW3A 1M7DA 1DLHB 4GRWH 2DYPD 5C8JB 2ZUYA 4F15C 3MACL 1IGCH 1QEWA 2G5RA 4CL7A 4UILL 1LGVA 3MNVB 3Q6GH 1FCCA 4R4NC 4I77L 2VDMH 4JRYD 3UEZA 3MRBB 5EU4A 4F7CA 4FXLA 4RISL 1QQDB 5DJ8A 3UZVB 4J4PC 2VXSL 4I9WD 1KTLB 1ZKAA 3BUYB 1NGXA 1LWRA 3QIUB 3EUUA 1JUFA 5IK3A 1NLDH 3VXTA 3MA7A 3U1SH 4R97C 2ATPA 1FFNA 2NMSA 3LEXA 3LIZL 4X4MA 5T3ZL 1KV3A 4N8VA 1EEUA 2NY3B 4WJ5B 1WEJL 4M7LH 3NPSB 2R2CA 3DGCR 2XTJE 3ZT5A 4OD2A 3MRQB 2BRRL 2DWDB 1LO4H 1ZWIA 5IHLB 4K9EC 3QEUB 4KQ4H 3WXVH 1S7UA 4K71B 5TJWK 1NMCC 1EERB 2O5XH 2R1YB 4X98B 2NW3B 3BX7C 4NQXA 4OZHA 5EUOA