1XGTB

Structure for antibody hyhel-63 y33l mutant complexed with hen egg lysozyme
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDLWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords antibody kappa light chain
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtB02
1XF1A 2Z9TA 1RURL 4JR9H 1YJDH 3VXOB 4OLXH 5DF0A 1AQKL 1F90L 3QUZC 2DQUH 1JWUB 3LEYL 3GIZL 3K3QA 2R0WL 3IKCA 2QKIA 4OD2B 3ZTJH 4OZFA 3U7YH 1G7JB 5AYUH 4G9FD 1ACYH 5I8OL 4XC1H 4LAJH 4FFVD 2Z35A 5DJ6B 1I9EA 4FQHA 1A0QL 2Y07L 1K6QL 5C3LD 2MTPA 5BW7C 3H7LA 3STLB 2V6HA 4JN2A 5T3XL 4D94A 4ZXBB 3TVMC 2ATPA 2NY0C 2J6EL 1IRAY 3T0WA 1ROWA 3AMKA 5C0AB 1AD0B 2I9LB 3VGEA 1YECL 5JQ6H 4XCCH 1T22B 1I1YA 3LKPB 2QEJA 5I8EB 4LCWD 1NDMA 3VFRA 2DKMA 1MPAH 5I2IB 4OLXL 5C0RH 4RMUA 3T1FB 4D8PB 3UX9B 3VXNA 5DRWB 4IHOA 2F19H 4DOHB 2UY6A 2CJUL 2RGSA 4PRIE 3SDXF 2AABL 1CGYA 4ZTOH 3ESUF 3QXAA 1U8LB 3OAUL 5T3ZE 1R6VA 5EBWA 2MPAH 3F5WA 1ZA6A 2GCYA 3GSNA 3TT1H 5A2KH 3MLWH 4OZFH 4X6CE 3THML 3HR6A 3E3QE 2EC9T 5IBUG 2I5YL 4RMVA 2EH7L 4ACPA 1OARL 4DN4H 1FJ1B 5B3JE 2Z8SA 5ISZA 4MA8L 3ARDC 4ZAKA 2R0LL 5F88A 4KJQD 2EKSA 5AWNL 4DKFH 3KR3H 1A47A 3MYJA 2PETA 3U46B 4M61B 4PP2A 5CEYA 1CT8B 2ITDA 4JY6B 5E9DD 4YLQT 5I1KH 2Y7QB 3QQ4B 1RK0A 2A1WL 1J8HE 4WFFE 3VH8A 1N2RB 2BVYA 1KIUA 5DMKB 4ZNEE 4FQJL 1CVSC 3LMJL 4PGZA 1EV2E 4NBXB 3KS0H 4M43H 1BLNB 1UZ8A 1RJYB 2Z92A 1RI8A 2PW1A 4PRNB 3RY4A 3CSBA 5IF0B 5GSVA 1DUYA 4OJFL 3TBTA 4K8RH 1J12A 1KJ2A 3HS0A 4I18A 1CDYA 2P5EE 2IH3B 4YPGB 3VWJC 1LVEA 1FZMB 5DWUH 1AHWA 3FB7A 3MRJB 1T1WB 4YGAB 4ZNCD 5CIPH 3CK0L 3EYFA 2GITA 5LBSH 3WIHL 1TTUA 3RWIA 2XWBB 4D9QD 1F11B 1QFHA 1ZANH 4F80A 2FIRT 1YMME 3QH3B 1H3XA 5I1AB 4CADA 1CTOA 4FMFA 2XQBL 4GMTH 1S7QA 1HKLH 4E42B 3RUGA 1K85A 4LHUG 4YXLL 3BPOC 4F9PA 4CVXA 5ICYB 4B0MM 4PJ7A 5KVGL 1A5FH 1FIGL 1P2CB 5HGHA 3EYVA 2BFVH 1JV5A 4JRYA 3BPLB 4PB9H 3TCLA 1QBLL 4H20H 1FAIH 1GZQB 3ARZA 5ESQB 4MCZB 2Z31A 2B5IB 4HW6A 4BA8A 1B0WA 1KN4L 2GFBB 2ICWA 4IRJA 4XB7A 3D25B 2UVEA 2BSRA 3M8OH 3QWQB 3DJ9A 1HZHH 3CDGA 3KPMB 3E1F1 2XWJA 3VI3E 2Z31D 2V7HB 2VAAA 5IWLA 3CDCA 1IGIL 3GBML 3VXOA 4PRBB 1E28B 4DQOH 4MNGB 2PYEE 4G9DB 2XTJE 3JV6B 1VFAA 3STZA 3CFKB 4FQXA 4MD5A 5C09B 5TQ2H 1GGUA 1Q9LA 2R29H 4OGZA 1MWAL 4H25B 1UGNA 2LV4A 4QXGH 4DGVL 3HNSL 1RJCA 4L3EB 3GMPB 4M7JH 3O45A 35C8L 4O2CB 2UZYB 3D85A 4ZPVA 4OI9A 3TBYA 2D0HA 5T1LA 3MRBB 3IDIA 1YEEL 4P2OD 1OAXH 1OP5H 3OZ9H 3IFLH 5BXFA 4ZUSB 3ULVH 4ZFFA 4P2RD 3T3ME 1P7HL 1LO4L 12E8H 3BEVA 1G7IA 4Y5YB 5JNYB 5KBNC 4GS7C 4WHTA 1KENL 4U1MA 5D71H 3DUUB 3HMWL 1CT8A 2ITDB 2AK4D 3ZZ1A 1I1RA 3OZ9L 3C8DA 5JXED 5EU4A 4JPIB 1OAXL 4H8WL 3TIEA 4GT7A 3QFJD 2V5TA 4L3ED 4LSRL 2ICEA 3FFCD 1MI5E 3QUXB 1F13A 4GAYB 1MAJA 3UJIH 3NBNA 5E9DA 3HNSH 4RDQG 2FHCA 5D5MB 3UBXB 4JFED 3BN9D 3EO0B 2R29L 4CGTA 4MX7B 1EJOL 2A9NH 1XIWA 4H26A 5TQ2L 1EXUA 3PABA 5KSAC 4GQ9L 5GIRA 4YIQB 3ARQA 4FQLL 1YUHA 1NJ9A 4PLOB 2ZCHH 4UINH 4HPYH 2EDTA 4JZJA 3UBXG 3VRJB 3T0XA 4KK9C 4UT6L 4YHLL 1RHHB 3SE8L 1NFDF 5TE6H 4EIGB 1NCNA 4XH2B 2Y5TB 4AEHL 3MUHL 5JHDA 5F1NB 3QFJB 3QO0A 1QSFB 5J13B 5EU6B 3QISA 1KTRL 3DETD 2H2SD 2GTZA 5AG8A 4U1GC 1NEZB 1TVHB 2IALA 1N5AB 5SX5K 1RMFH 1CR9L 4M1GH 4XPGL 1WLHA 4XVTL 2IBZY 5CSZA 2VDRH 4QRRD 2YUXA 4YPGA 1MJUL 1TETL 1U8PA 5IKCA 4AG4L 1T1XB 4AH2A 5F21B 5GXBB 5F89A 4F37K 4I2XE 1JF1A 5FM4A 1MQKH 1KTLA 2KUTA 1L7IL 4YUEL 3WEXA 3Q5OA 4YDJB 5BOPA 1ONQB 3V8CA 3QIWC 1ZSDB 1G0XA 3DIFA 3VXRA 2HFEB 5DYOA 4AQ1B 4WW1A 3D9AL 5E94B 4MDIB 2EIZA 5DWUL 1X9QA 1XR9A 4JM4L 2GJ6A 1KIQA 4FG6D 1X5LA 3I02A 4QRPE 1ZHBA 2H9GB 2VXVL 4ODSL 1T6VN 4M48L 3RWDB 3VWKC 3IFPB 1EAPA 4FXGA 4OB5H 5KVFH 5FUOL 3SO5A 1PLGH 5I1KL 3ISWA 3MGTA 1HCVA 1EVUA 2FSEB 2ICWB 4IRJB 3LD8C 1DN2A 4PGDB 3CDGB 3OMZA 2Q86A 4JPWH 1DBKH 3KPPB 5F7YC 3OQ3B 1GCFA 5IHLB 1MEXL 2PTVA 4NQXB 1FFOA 1I9IL 4K3DH 3VXNB 1B0RB 4WI8A 5C0DB 4X5XA 1BF8A 1D5IH 1ZT7B 3VFNA 2HLFC 5CD3A 1CIDA 3GKWL 3BQUD 3O2WL 1YNKH 2IMMA 4JY5H 2VLRE 5GJSL 5J1AA 4DFIA 3U7WL 2HJFB 3VDAA 1KEMH 4NWTH 1B90A 4X6BA 4TNVK 5DUPL 1U9KA 1W0VB 3O4LB 4G43A 3VXQA 1YMMB 4GW5B 4MWFB 3RUGE 4Z7OF 4UOW1 1EHLL 4HQQH 4R90L 2A6DA 4HF5L 2ERJC 4BK4A 4MHHI 4MXVF 5GGTH 5I1CL 1UM5L 4MXQC 2DJUA 3EW3B 3PHSA 4WFED 4ZS6D 5C0RL 1ZLVH 4TTDC 3AAZB 3T8XA 3TN0A 1FNGA 2Y5TA 4L4VD 2PTTB 3JV4B 4MAYA 5KVEH 2YR3A 2W59A 2AK1L 4WCYH 3G6AB 2NX5E 2P8PA 4O51A 2NNAB 3DVNB 5FV2A 3BMWA 1UZ8B 4NQDD 5CJOL 2NW3B 4OT1H 3QI9D 1ZLWK 5ICYA 3F7YA 2DIAA 1GGBH 3MNWA 3IJHB 4MNQE 2V7NA 5T3XH 4K94C 3U7WH 4XPTH 4QGYA 1HSBB 1QLRA 3OKDB 4PPTA 1CQYA 3F65A 4PJIE 5EUKA 5DSCB 2X4UB 3QIUC 1IM9B 4PGCA 4PJIB 3T77B 5DQDH 1MAMH 1JGDB 4LBEB 4JFYB 1R5WA 2LAGB 1JPGB 5IFHL 2H26B 2VERN 3FQXB 1INDH 4AZ8A 4Z7UF 1J0JA 1XCQA 3E2HB 3HA0A 2DWDA 2EYSA 4YHMH 2P8MB 3FT4B 4MVBD 3MREB 5C7XL 5JW4M 5IVXE 4IMLA 1B6DA 1VERA 1Q0YH 4E5XB 4OKVB 5ALCH 4H0IA 2BY1A 4FQIL 2EIZB 3K4ZA 4Q2ZA 2NY7H 4WEBL 3L3OB 1GAFL 2JIXB 2X4TB 4D3CL 5FYLH 1FL3B 3W2DL 1NBZB 1IC5L 4QRRB 2DIBA 4NNPL 2VDQH 1ZXQA 3QG6B 4DVBB 2AJ3B 3QNYB 5GS0H 2MKWA 1XIWD 2E7HA 3ORJA 5C3TA 5IV2A 4WEBH 4WDIA 3L7FB 1OF2A 3UJJL 1CS6A 1E4XH 4M6OL 5M7QA 5CMAB 4ETYA 4YHZL 2EO9A 3M07A 5FIEA 1RUQL 4X8JB 3STZB 5I16A 4AK1A 1W72L 1Q72L 4BZ2H 1Q0YL 3I3BA 1EEQA 5DK0A 1AKJA 4P4RA 4GAFB 4R4BB 2ZUWA 1CE6B 1MCPH 5F9OL 1ZHLA 1U8NA 5EIIA 5D72L 2R1XA 2H6PB 3GRWL 5IB4A 1Y6NR 4ZMAT 4KXZH 1Z0MA 2EDNA 2UUDH 4FXKB 5FF6B 1A14H 5L2KA 1BD2B 1UCBL 3TZVD 4XP9H 1WWBX 4QRTA 1HKFA 5ICZA 4HWEH 1MJJA 3DX6A 4R4FL 5F1KC 1KG0B 1KPRB 4CVZA 4S2SA 1YEIL 2KQNA 1OOAA 4LRIC 3EFDL 5MP6L 5IIEA 2EDOA 1VGEL 1U92B 1V7ML 4N0CD 2NLJB 4W6WB 4FXLA 5ANMA 1T03L 2ZCHL 1FNSL 4E41D 1NMAL 3ULVD 5ACLA 1J1PL 3OKEA 3CVHH 4JQVA 1U3HD 1R3JA 4OF8A 1HWHB 5IJKA 3OR6A 2XTJB 5DJZB 4JFHD 2UUDK 3H3PL 1BFTA 4NUGH 3BIKB 4P23C 4LF3B 3D48R 1D5XA 1T1ZA 4HQQL 3UJIL 1F42A 5DJ2A 3S5LG 4NN6B 4LHUB 4EUPA 2F54A 4NJAL 3QXDA 4XPFH 1KPUA 3TBTB 1LEIA 1TTFA 2HFGL 2NY3C 3BN9C 3MJGX 5EWIH 1FO0L 5D70L 1YNKL 1ZTXL 4M5YL 4OTXL 2QBWA 1KCSL 1T20B 2E5EA 2EYSB 1TJGH 4N5UA 3LEVH 4PJ9D 3AXLA 5EZIL 4OI8A 5L2JA 2OJEB 4OZFG 4LU5L 3EDFA 1CF8L 2DDQL 1H15B 3KJ6H 3UTTB 5IFAH 5GRVL 1BFOB 2OTUB 4ORGB 3NN8A 2XN9A 1QNZH 1P53A 4CU7A 3SDDA 2GK0B 1ADQH 3TGXA 3CU1A 3VGHA 1S7TA 4TUKL 4ELKB 1HHJB 3LV3B 1A1MA 2D9CA 4NZDA 4PRPA 5F89B 2EYTB 4U7SA 1K3IA 3QHFH 4UQ3A 3ULUC 1NCWL 1K8DB 1O0VA 5KVDH 5FCUL 4JHAL 3PIQB 2Z31B 3EAKA 5FYKH 5EOQL 3WE6A 3S36H 3BJ91 3LN5B 3O2DL 4JGMA 4PJHA 5ALBH 1MFAL 1V3JA 3M8OL 3QUYA 1L7IH 2YRLA 4Z7WE 4CADB 4P2OA 1KN4H 5JR1H 1TZGL 3FQUA 3MBXL 5GGRA 4GRMB 1AR1C 1MNUH 3RY6C 2HFFA 3RUGB 4QO1A 1NKRA 1S7UA 4YWGL 2FGWH 2IQ9H 1HSAB 4P5KB 4CW1B 3MJ7A 4J3UA 5DJCA 3QZWG 1DBML 5ESVB 2Y72A 2W91A 4JCMA 4J3TA 4KJPC 3WFBL 5GS1B 4GBXC 1T80A 3MV9B 1NBZA 3QZWA 1LO3H 4RAHA 3IXTB 1GHFH 4JANA 1OGTA 4M5ZL 3T4YB 4XHQA 5I15L 5INDB 1A21A 3NZHH 3WFCH 1I7RA 1I1FA 3MLXH 3CCHA 4Y1AE 4PRPE 4UT9L 4ZFOA 1UM4H 3EGSA 3H9SA 5HD8C 3KLHD 4S1QL 3PL6D 4X7SL 3L7EB 4UT6H 4YHLH 4P57A 3WFDL 5I71C 4PLJD 1KELL 2C3VA 3N85L 1I75A 2CO6B 4GQ9H 3TLRA 1J8HB 1ULVA 1I7ZB 2Z91A 3OXSA 2A83A 5EU3A 1Y0LB 3HPLB 4L4VB 1JPFB 5DSCA 4APQB 5LWYL 5F8QC 4QCIA 1I9RL 3S3SA 1TFHA 1HQ4B 4XPHL 1BQHA 3LPWA 4K94L 4L29A 4A2LA 1VEOA 1SJXA 3ECBA 1UCTA 1INQA 2XPGA 1CICA 1YEGL 3QSKB 3RIAF 2OZ4H 5BZWA 3ROOA 3C60D 5HYJA 4GJTB 1SBSH 1JPSL 4FZ8L 5IW1B 1WBYB 3PHOA 4KRLB 1QSEB 3MLTA 5C0JA 1LO5A 3MACL 4ZUTB 4AEFA 4JE4B 1DLHA 4WUUE 1LE5A 2IPKB 2YS4A 3QRGL 4P0DA 1OAUL 4M1CC 4ZO8A 1A1NB 5M94B 4P9HC 3FMGL 3EO9L 3KWWB 3CXDH 4JHZA 4PREA 4U1GB 1GSMA 1R3HA 1H8SA 2VABB 3QI9C 4K3HA 1BHGA 2L7UA 3FFCE 2IPUK 5GRWA 5FO8A 4CVXB 2GTZB 3PP3K 2WW8A 1FNFA 4EDXB 5HSFA 35C8H 3KDMB 1SYVA 3P4MA 3FO1B 2F19L 2ZPKL 3M1BB 1NL0L 1A9BB 4LCYB 3FO1A 3SQOL 1KEGH 2JB5H 3NA9L 2AEPL 1U93A 3HG1D 1VADB 3F12A 4YX2L 2DQDL 1MPAL 1PDKA 3VI4E 2HVKB 4XVSL 3QPQD 1L9MA 3GMQA 2E9JA 3GJFA 2GIYA 3QXVA 4UIMA 3QI9A 4DEPC 4BH7B 3ZKQD 2J8UE 4F33A 4PJEB 1NFDE 4NQDE 3KPPA 2APBA 2WBWB 1BEYH 4HMCA 2YD5A 5HHOB 3SDXA 5SX4H 4IBLT 4NO3B 1NGPL 2DD8L 2R1XB 4LKXA 4CBPA 1GZPB 2IAMA 2VDOH 3B8YA 3EOAB 5C0BE 5ISZE 5JW3H 2O61A 1CFTB 1DQJA 4H5SA 4U05A 4LLUB 1DN0B 1RZIA 4LLYA 3NN8B 3O81A 1U8KB 3BWAB 3RVXD 1AGBA 4P5TD 3RNQA 4OLWH 1BQSA 2FDBP 3CVIH 4EN3D 1MCHA 2OZ4A 4S1QH 4DW2H 3EJYC 4TNVF 4G7VL 4RNRB 1A2YB 3VXTA 4TOYL 3ZE0E 3HCVA 4Q74A 1HH9A 1M6OB 4ZNEA 3MLXL 1A5FL 3MJ8A 3DXAD 1K4CB 4YHOL 5DHXB 1F90H 4JAMA 1FFPB 1EDQA 3CZFB 4LGSB 2FRGP 1MWAA 3PGDA 4Y5YA 2O5XH 5JNYA 2P5EA 3LDBB 3VGAB 3NCYP 4XNXH 3VWJA 1RZ7L 4JQVC 1TMCB 3QXUA 3VXRB 4HHAA 1E4WL 5DMKA 1HI6B 3IDNB 4E41A 2R8SL 3WSQH 1KFAL 4LF3A 5C9JA 4OCYH 4ZO9A 3VD7A 5CBEB 3HZKA 1Y6KR 4L4VA 4R2GC 4H1LG 5GS2D 5GJTL 1R5VA 2I27N 1RUPL 3LKOB 1DEEA 2NW2A 3IDXL 3L3IA 4J12A 5HHNB 4YBHA 1JGVH 3RZCC 4H1LA 4NPYA 3BD3A 5B38B 2CK0L 4M00A 4D9QE 2XA8H 3JZ7A 3QAZC 2AQ3A 3IXAA 4V1DB 2ZG3A 3O6KL 2IPTH 4U6VH 2DTSA 4ZAKB 3MA7A 3HNVH 3EYUL 4JRYE 3E6HA 4NOFA 3Q48A 4HUXB 3TJHC 1FNEA 3I6KB 4R8WL 3DYPA 1JF6A 2J88H 2P47B 1RHHA 2MQ3A 1ZHNA 4KVNL 4UU9A 2XG5A 1OGAD 4MAYC 3PWJA 5AWNH 4DKFL 4Z7VE 2DLTA 3FB8A 1LEKB 5E08H 1MJ7L 4WJ5A 3C09C 3RWHA 4WJ5B 3VXSB 3THMH 2E8ZA 5T3ZD 4LSUH 4FQ1H 2IALB 5EZOH 1YNLH 4PG9B 4Y16B 2OMNA 2ZOLB 3WNMA 5DTFB 3L95A 3QDJD 5TE4H 4R96A 5LCVL 1NLBL 5HHVL 1ZTXH 4OTXH 5D70H 2ZNWA 3WXWL 4X0KA 2OQJA 5JPMA 5H35A 5D1XC 4PJCE 4Y5VA 4X8JA 4M1DH 3BYYA 3L5XL 3QIUD 4O58L 2BERA 5FKPA 1P4BL 1AO7E 3FQUB 2BVPA 4UUJA 5GGRB 5HHXH 4M9PA 5DZNA 3CC5A 4N8CL 5JQ6L 4XXCA 2H3NB 2YA2A 3UTZB 1OAZL 2XNAB 5CINH 5DQ9B 2YPKA 3QDGE 4JO3L 5FHAH 3GSWA 2DF3A 4PV9A 3RWFB 4NO2A 3GSUB 4OFYA 2NX5D 2FD6L 1EIBA 5B39B 4YDKL 4F58H 4DKEL 1T03H 2XFXB 4NQSA 4LKCB 2Z8WC 5IMMB 2CDGA 1A7PL 2H45A 5IB5B 3BKJL 4QRUB 1JJUA 5D7IE 5IVOA 3FQXA 4M3JA 2VN4A 3QPQC 2ARJA 5LVEA 3O6FD 1I8IB 2ZOKA 5C0AE 4FN0A 2FYYA 1FAKT 2R0WH 5D2NB 4X6FA 3MZTA 3K0WA 4MD5B 5C09A 1YYML 3O3DA 4ELME 1NANH 1WFUA 5CGTA 1DQLH 1FGVL 3MYZA 4P2RE 4FRWA 4OV5B 5C70A 2YA0A 4Q58C 4LVOC 3R06B 2NR6C 3QWRA 4JFDA 1W0WA 3L9RA 4ORZC 3CZJA 4QHKI 5SWZA 4LP4A 3T0EA 2CUIA 5CEXA 2VQUA 4EN3B 3GMMB 4GKNB 1U8JB 43C9A 1ZKAA 2ZSWA 4LAQL 4W6XB 1LILA 5BS0A 2BX5A 5IVXA 1FCCA 3Q1SH 4Z5RB 1NDMB 3VFRB 1VFUA 3UCRA 4G6MH 3P0VH 2Q6WA 15C8H 1U8HA 3U7AA 2WWKO 4MNHA 3CDYA 4HX1A 3PWVB 3QFJA 1T21A 3VDCA 1NBYB 5JPNB 5T1KB 3D5OF 3O8XB 4ZS6C 1HN1A 4FFWD 3SKJH 3KXFB 5FO8B 3V0VA 5C07A 3X11A 1LQSR 4NHUA 2DLFL 2CRMA 4L8SB 5DJXB 1F4YL 3RTQA 1A3QA 1F2XK 5I1LA 5C7XH 2IBZX 2QADB 3MRKB 4W6YB 5HYJB 2IADB 1VACB 2A6KB 4OGYH 1RUKL 5T1LD 4NHCL 4MQXD 1T04A 3PABB 3HE7B 3ZYZA 1MHHB 1FGNL 3E3QC 3VD4A 4LRIA 3K8MA 4EI5A 2IAMC 4HIXL 5CBAB 1VCAA 1MFBH 4MYWB 1UB5A 3RNKA 4M6MH 5I8CB 1PZ5B 3QG7H 5JTWA 4RAUA 1ZVSA 1A6VH 3ZKND 5ADOH 3MRRB 1EGJA 1B0GB 3ZSTA 4EDWL 4G7YL 3S37H 2BVUA 2XFXA 4NQSB 1JPTL 4MNQB 5D1QB 4P2QD 4QRRA 2FJFA 3GKZA 3DWTA 1KJMA 2FJFB 1TNNA 2Z8VC 3L1OL 4MJ5B 3BGFC 1UM5H 2DTMH 3MFFB 1WIUA 3QEQB 4NQTA 4HF5H 1CLYH 5F7KC 4XPAL 4NO3A 5HI4D 2R23B 1RK1A 3L5WA 4UTAL 1JF1B 2QQLL 1L9NA 3T04D 3OJDB 2BHUA 1MIML 1UYWL 5DVMA 5GJSH 1OPGL 3DXAB 1S7XA 3VFMB 1SJHA 4PJXA 5I1DB 4OF0A 3JV6A 2QTEA 1YY9D 1U2HA 4GW4B 1JZ7A 1IBGL 1GRWA 1I7UB 4OM1L 3MLZH 3MNVA 4PP1C 4TSAL 3DO7B 2XICA 2I9TA 4YEFA 2E6JA 4QHKJ 4RZCA 5FM5O 2N7BA 2IQAB 3KYKL 5D2LA 4G43B 3DX6B 1MUJA 3S4SG 1YEDB 4QRTB 5ICZB 1WTGT 4YEEA 1F97A 1QFUH 2ICWI 5CZXD 3WE6B 3RUGF 5BRZA 5TF0A 4C59B 3I85A 3QQNA 3DO3A 2YOCA 1OTTD 2CIKB 4QHNA 2X89D 5L88H 3P4NA 5FGBA 4QXTA 3T2NL 4S10A 2HKFL 2VDKL 4LVHB 4KHTH 4QTIH 1QYGL 2VSDA 1BQLH 3QNZA 4DN3L 4A6YA 3ARWA 3O6FB 3SO3B 2GAZB 1A1OA 4OCXL 4ZD3H 3HUJE 5DZLA 3V2AR 3O2VL 1RJLA 5T3ZH 1HCFX 2OSLA 3LQAC 3R4DA 4Q7DA 4NZRL 5K93A 4U0RC 4LARH 1RIVL 1UENA 4NZUL 5J1AB 5DD6A 3U4AA 5LGJA 2NY6B 5GS2H 3QCTL 5FV1L 3TYFA 1K5NA 3MOAH 4JHBA 1UB6A 4J6RL 2G60L 1L4IA 4HUKB 1KOAA 5BQ7B 1MFDH 4MQSB 4OLYH 4YAQA 4OZIF 1T66D 4V1DE 5SWQB 5CLTA 1EO8L 1ES0B 4XVTH 1KJVA 3VFUB 5SWQA 1KJ3L 4KROD 3RQ3A 3MLTB 3QFDA 5C0JB 4Z78A 5C86A 3JUZA 3IU4L 3GUTA 1W2KT 5EZJB 4HUNB 3TC9A 3VWKB 1F6AB 2B4CH 2NXYB 1BFOA 2OTUA 3EOBB 2FCBA 4ORGA 4WWKD 4UILH 5ADPL 3VD5A 3CLFL 3X12B 1MSPA 3RIFF 4JKWA 4MJID 1X5HA 1NUDA 2FATL 4HZAA 3U9UB 3ELAT 4KV5F 2IG2H 3IRPX 3P9LA 1H3VA 4Z76A 1EO8H 1DBAL 4TNWK 1NCTA 4GG6B 3HPJA 4HPYL 1CU4L 1NGQL 3IRZA 1JI1A 2XZAL 3OG4B 3LKQA 4GG6E 5F71A 2XTJD 4L3AA 2A9NL 1VEPA 4RFEA 4ODXA 2XKNB 3LQZB 1T0NA 3Q6FA 4ZPTA 2IMNA 1BZQK 1CXEA 3AREC 4WTZA 5CGMA 2ENSA 1UJTA 5C0EB 1II4E 4LSRH 4JJHA 2AKRA 3SDXB 2F53E 1NGYA 4TULH 3RGVC 2FECL 3P4OB 5FECA 1NFKA 3GMOA 3NTCH 4JPVL 5DC4B 3FQRA 3PV6B 3D3VB 1X5XA 3QFJE 4OZIB 5E8PB 2X6MA 3SBWA 1JNLL 5HGHB 5IVNA 2A74B 4PJAB 3QUXD 4IIQC 3VXQB 5IFJB 3GDBA 2VIRB 2BDNH 4NQEE 1FPTL 2F9BT 1C5DB 4PJDF 3UYOD 2ZJSL 3RKDC 2R2EB 5I1EL 2ZSVA 3BKYL 3U82B 4DZ8A 3BP5B 1IAKA 1KT2A 2JJUA 1IGCL 1WAAF 2APFA 3KYKH 4XMPH 2YPLE 1YMHA 2XRAL 3GNMH 4PRIA 2YC1A 5E4EC 3PWUB 4KK8C 2Q7YB 4OCMC 5F1IB 4BH8A 4JPKH 4IIQA 2ZUVA 5DDHB 5EO9B 1I8LC 3MLZL 4XMLL 5BVPH 1FFOB 2ORBL 1BIIB 1IBGH 3CH8A 5SWZB 5FCSH 3IS0X 1HHHB 1JTPA 1JRHL 1BQHG 2PW1B 3UC0H 4L9LC 5IK3A 1MCNA 5E2UH 3DYMA 4P9HL 3D0VA 3UYPA 2Y1VA 1Q1JL 1X7QA 3REVB 1EO7A 1FFPA 3REVA 2EC8A 4AT6A 4KJWC 4F7TA 1CBVH 3GRWA 2BVQA 3T3MF 3RVUD 1T2QL 2FH8A 5IMKB 1JRHI 4M03A 4HUWB 2QADD 5ITFA 4U1SA 2DLGA 4Y1AB 5ANMB 1CGWA 3RI5K 4PJBA 4X80H 2QHRH 5CSGA 1CZ8H 1IC4H 1P69B 4BZYA 2Q76B 2V5RA 1OAKH 1NAKH 1MFBL 4FS0A 4ZYKB 3BIKA 3KXFE 1YN7A 3LKSB 1ZANL 1HHIA 4GMSL 1HYSD 2A0LC 5C07B 1AGCA 2CIIB 3VFOB 1JZ5A 1U8MA 2WLZA 3MUZ1 5KS9B 5LGJB 3WIHH 5FUZL 5E2VL 2DQHL 4U6HB 2R2CA 5HI5C 5GS0C 1RUKH 5E56A 2I07A 4GBXA 1VADA 1DJSA 3F12B 1YEJL 2HH0H 1JFQL 3PP4L 7CGTA 1T22A 1FSKB 1KIPB 5D2LE 3UTQA 4K8RL 5EFIB 1CK0H 1AFVH 5B22A 2ATKA 2FWOA 4QT5A 2HKHL 4AMKL 4MJIE 1B4JH 3T4AA 1NGZB 4NZTL 3X13B 3HI5H 4I77L 2DMKA 1Z3GL 2AV7B 4WUKL 3V5DA 5GSRA 1LHZA 2I25N 3PG2A 2UYLB 4MLIA 4GW4A 5I19H 1ZT7A 4FQJH 2EECA 3B9VA 4PBWD 5D7SL 5E8PA 1KV3A 3ILQD 1BD2A 3HUJA 1CGVA 1DLFL 3UEZA 1KXVC 3ZDYF 15C8L 3TO2A 5INCA 2D3VA 5FA3B 1YEDA 4G6ML 2FLBT 4TSCL 3LS4L 1NFIA 1FRGH 2E9WA 4X7EC 2LE9A 4I0PA 4OF5A 4XI5D 5C08B 4A6YH 3AFLA 2I5YH 1FNHA 1VFBB 2DJSA 4WY7L 5HVGB 3RWEB 2B1HL 1NUNB 1WJ3A 4KAQL 3HR5A 3GJEB 2Q8BL 5HD8D 1BVKA 2ESVB 1C5BH 1OGAA 2A77L 5JMOC 3QUKB 4Z6AT 4Z7QF 3RAJH 4M93B 1P4IH 3QJFA 2Q87A 4J3OC 4JPIA 4ZFZB 1QO3A 4Q0XH 4YHPA 4UMGA 2NY2D 2C1PB 2PYEB 5CP7A 1CFQA 2H2SC 3I02B 1EPFA 4KFZC 3MBEB 1PGRB 3D69A 3KPRA 2FX7L 4PRNA 1P4IL 3IDIB 3EO1B 5IMMA 2A77H 1I4FA 3GBLA 4ONFH 1RULL 1YECH 2YD9A 3QPXH 5DEGB 2BXZA 5DGRA 4ZOEA 3IXTA 2X4SB 4DAGH 1TCRA 4UIKL 1K2DA 1AJ7L 2CMRL 3QQ9C 1GYAA 3RP1A 2EZ0C 1JWSB 1DTUA 3OKEB 5I74C 1QA9A 4NKQB 4YHKH 1HWGB 2EDBA 5D93C 5CEYB 1IC1A 1KLUA 3MV7B 3LS4H 4PG2A 3T1FA 2NY1D 1HQRB 1N0XH 5KANI 3MRDA 4ELMF 5IESL 2VOTA 4FFZL 5AYUL 4NN5C 3TWCH 3S5LA 4CMMB 3MRGA 3B2VH 1B3JA 1NBYA 2B20A 1IGFL 2ZZUT 3BGFB 2CGRH 1MHEB 4HIIB 2IFFL 4U6YA 4LQFL 1VKXA 1KCKA 3GSXB 4ZSOB 1MREH 1U8LA 4P3DA 3IJHA 5MEND 3EJZC 3BT2H 2EE9A 1AI1L 2DQUL 5FO9A 1J1XL 3JBG7 4OAWB 4HKJB 1QBBA 3ZT5A 2XI9A 5ABDE 5FOBA 1F02I 1HDMA 1KG0A 1KPRA 4M1DL 1A3RH 4N0YL 1K3ZA 1WZLA 3V7AE 3IAQA 5D6CB 1FBIH 1R3IL 4YE4L 1OSZB 3LN5A 2HWZL 4MJIB 3DX8B 5IQ7L 4P5TA 2DM7A 4XTRC 3LQZA 4BM7A 4XCYB 4HIEB 4F8QA 4P2QE 1XH3B 3W39A 2W0PA 2MHAA 1TDQA 5C0CD 2OXHA 3S35H 4HX1B 4X83A 2CD0A 3O8XA 4GMSH 1LE9B 2V5MA 1IC7L 3SOBL 2VZ3A 4JFZL 5EC1B 1CG9A 4PRHA 1ETZA 1SEBB 1HXMB 3DETC 4M6NH 3SEPA 4MS8C 2D03H 3KNBA 4ZXBA 2ICES 5DO2C 2VDPH 1IQWL 3IYLW 3QYCA 4NM4H 1X5AA 3PIQA 4RFOL 1FL3A 3VD3A 3SE9L 1Z5LA 4MD4A 3HNVL 4V1DD 1KNOB 5KS9A 2HAZA 5B21A 1T1WA 1N6QL 5IT2L 1D5MA 3I50H 3KLHC 1ACZA 1BJ8A 3LIZH 1T20A 1A6PA 3JWDL 1WFOA 3BQUB 3L3HB 3V0WL 1REIA 2FLRT 5C71A 4HS3A 3UDWC 3T2QA 1A7OL 1T5WB 3VE0B 3RKPA 4R0LC 3OR7A 4NM8L 2EEDA 4RMWA 1TXKA 5DR5H 1M7DA 3MZGB 1S7SA 4CJ1A 5EBLA 3WJJC 4O2EB 1CFQB 2VSCA 5HDBF 3I9GL 4XVJL 5D6DA 2W9EL 1S7RB 1WZKA 5F93C 4RNRA 3AM8C 4N5ED 1AY1L 1Y0LA 3BIAX 2BXYA 4JDVB 5IR1A 3FN0H 4J1UA 3UPRA 3KPQB 1LP9E 3RZWA 3UJTL 3SN6N 4OGXH 4LCUB 3S88H 3LS5H 5SWZD 1EX0A 3CXHK 4RCAA 4YHNA 3TZVC 1KTKE 2VLME 5GRJL 5IHUL 3FN9A 3IVKA 2VKWA 2HLAB 25C8L 3E8UH 2CIKA 2W92A 1FORH 4TOYH 1NC4A 5MERA 5I75B 3B8SA 2C3HA 4G7VH 3J7HA 2EDXA 4XAWH 2MQCA 4OM0H 3ZYOA 3UBXI 3WNPA 1X5JA 3KGRA 2BCKA 2IAND 3TPKA 5F3BB 1JNJA 3FOMB 3MV11 5JPNA 3MRMB 2CLVA 4QF1A 2FEEI 4KI5E 1ZT4B 5HGDA 1X4YA 5F9DC 5HTSA 2IEPA 5E8EB 2VDOL 4M62L 4GW5A 5D2LB 1QHOA 1BEYL 4YC2B 1HEZA 2DMBA 4NRXA 1U3HC 3D3VE 4PG9A 3VFPA 1OLZA 3K2MC 3ARRA 4L9DA 4F9LA 5T3XE 1WC7B 1LK2B 3MA9L 3DX8A 3RWIB 4Z18A 4NO0A 5GRUH 5D96B 2NX5A 4OFYD 4C56B 1ZS8A 4AIOA 2MHAB 2EDRA 4XH2A 1QP1A 2V5YA 1CU4H 4XMKH 2YBRA 5ETUB 3FO0H 2HG5A 1MLCB 3SO3C 2ZPKH 4EOWL 2OK0L 1JHKL 3VFVA 2X2YA 4NFBA 7FABH 2X70A 5JW4N 1IAMA 1T1YB 4G6JL 3SGDI 2ZCKL 2QKIB 4F9LC 2AEQL 3AU1B 1MIEL 2G5RA 3BZ4B 4RIRB 5ADPH 4UILL 3QCUH 4KPHH 2XOTA 1ZK9A 1OGAE 1I7TA 2BMKA 4NQCE 5DJDB 1AE6L 3F7RA 2UWEA 1EBAA 2AJXH 1EO5A 4K23L 1H3WM 5DS8A 1RZKH 1LD9B 5A3IC 2HVJA 2YA1A 2OI9C 1LD9A 3MLUH 1UFUA 4JFEA 4O4YH 2V2XA 4HKBB 4QYOB 4UNTA 5J6GA 1IKNC 1P6FA 3PNWB 4P9ML 2DQFB 4HUVB 4J6RH 4G9DA 1PY9A 3TV3H 4N90E 3MX0A 4MGXA 3BDBA 2UY7A 3OR7B 4HGKC 5E94A 2VLLB 2DLEA 4ZAKC 2EH8H 5BVJB 1RUMH 3DX7A 1RIVH 4E41B 4PLJC 4LARL 4I3SL 4CN4A 4KK5D 3UTZA 4OCNC 2AW2A 4WWID 9CGTA 1ZMYA 5I1HL 5T3ZL 3O4OB 1J86A 2VITB 3QT2A 4JEGB 5D7JC 1CLOH 3KPNB 2XZQH 2FIKA 5GGTA 1BQLL 1TVDA 4KRMB 2VR9A 4QTIL 2OL3H 1AD0A 1YEFL 5DMGC 3T2NH 5DUML 4CUCA 1HH9B 3KJ4B 4KQ3L 1I1YB 3GMRA 4O9HH 1EFXB 5IOPB 5K9KA 4MXVE 1C5DA 5C09D 3GZKA 3X3GH 3K1KC 1LO3L 2VAAB 4GXVL 5D7IB 43CAB 5D7JA 3IDMB 2O5YH 3VFNB 5F7FA 1KLGB 3CFCH 2J8UB 4GFTB 4P2QA 3ZT7A 3SE4C 3DSFH 4PREB 5D2NC 2V9QA 4TVPE 3PV6A 3B5TA 4DGIH 4TUJA 2SEBA 4L5FL 4OV6F 2R4SH 2SEBB 1HHIB 2V2WB 2F53D 5FAAA 1CLZH 5CWSB 3G6JB 3UP1A 3RL2A 4NWUH 5IHBA 5C92A 3ZE1E 3BVNB 4LSTL 3N06B 4MQ7A 3UBXA 3HC0B 2BC4A 3C2AL 2YD8A 2I07B 1CLYL 1G9NL 3FL7A 4YFLI 3S9DB 3VD9A 1I3VA 1YPZF 4L3CA 3ARDD 4BQ6A 4M02A 4WFEE 2QQKH 5L2JB 3DVGA 2CR3A 2BVQB 4U1MB 2BNRB 4DEPB 2NY1C 1ZA3A 4FFVC 1ZSDA 1BZ9B 2NMSA 4G7YH 3RVTC 5L6YL 1EUTA 1QNZL 1UXSA 3WIHA 4PJ5E 4PJIF 5IF0A 4BZ1L 2OXGA 4GRWE 4PJFA 1NSNL 1CL7I 4OLVL 1BLNA 3NCEB 1XCTB 3QUYD 5GSVB 1QRNE 1S5IH 3DYOA 3WKNA 3O11A 4LU5H 1BQHB 1F45A 3V4VH 5EZIH 1C5CH 1INQB 2BVTA 4XGZB 4ZODA 1D5BB 5C0NC 1BBJB 1NAML 4LCIL 1UJ3A 5TE7L 5IBTL 4HUVA 1U58B 3CFBB 4B41A 1I8IA 4Y5YC 3DUSA 2W9DH 3GO1H 5JW5B 2V17L 4OD1L 3ZE2E 2PO6C 4Z0BH 1PZ5A 4MDIA 4HZLB 4JG1L 1WZ1H 3WL9B 2Y36L 2ZG2A 1ONQA 3LZFH 4LIQL 4MNGA 4P5KA 4RISL 4EBQH 3FZUD 1EMTH 1MFEL 1QBML 2V7NB 2HFFB 4P3CL 3VMPA 4BFIB 4GKZA 4WW2C 1BFSA 1EZVX 4LLYB 5I73B 3OX8B 2UZIL 4I3RH 2R2BA 3R8QA 5DMIH 4YHYC 2A38A 3JWNC 4M3KB 2O5ZH 3W0WA 5MP6H 1BBDL 3NOIA 1I3UA 2BNQD 2ENYA 1HXYA 4X98A 4YK4B 4UIMB 4Y5VB 4S1RH 4GRWH 2FZ3A 2R39A 1KT2B 2W60A 5E8OA 1UVQB 1WCBA 1BPVA 4Y5XA 4R7DA 1XIWC 1IL1A 4J3WA 2RCSH 1J0KA 4XP9L 2L7JA 3U30C 4CMMA 3VFMA 3MLRH 5FYKD 5SX4I 4F7MA 1BVLA 1S7RA 1NQBA 4XBGB 1U41A 1OLLA 3BEWA 3BKMH 3QNXB 3QDGB 1I8MA 3ALPA 1OTUD 2AJ3A 1R5VB 2DQTH 4HUUA 3D0LA 3QEQD 4MVBC 1FVDB 5KOVC 1NCDL 5CZXC 2VL5B 2FX8L 3C08H 2R2HA 4KRPD 2P1YA 2MWCA 2VZVA 5DMYA 1PQZB 2YD2A 4PGDA 4KRNA 1ES0A 2OBGA 4EJ1C 2O5ZL 4KDTA 1KYOK 4NNPH 2BSTA 1A7QH 4Z7UB 4XAKD 1H15A 4HXBL 3RY5A 2X5PA 1CDUA 2AJUH 1UB5B 1QFOA 3EBAA 4YHPB 4KKAD 5TDNB 3P9MB 4BFBD 1UWXK 4CU6A 1Z9LA 3S7GA 4K07A 1T6WA 1WWCA 1V3MA 3HZKB 3RDTA 3H9HA 4DCQA 4EUPG 5EUKB 3V95A 3S96A 3C5SA 1IGJA 4OCSH 3TVMD 5ID0B 4W4NA 1N6VA 1U3YA 4FQPA 1R24B 1NCAH 3G6JA 2WINB 4WHCA 4JO4L 4LLMA 3FO9B 4NGHL 3D25A 5MI0C 4CVUA 3NIFE 2XWTA 3FTGA 5IBTH 5TE7H 3QI9B 2JJTC 4PS4H 1UZ6E 1GOGA 1DP0A 4OCWL 1IAOA 3SGEI 5CSBA 2VDLH 3IDJA 4UOJA 4ODHL 5HHOE 1PY4A 4YO0A 3JV4A 4M6AA 2PW2B 4F33B 3V5DB 1VA9A 2IBBA 5A43C 1S5IL 5CZKA 1FN4A 1BWWA 1ED3B 2NY2C 3NA4A 4LVEA 4HBCH 4Y2DC 1DE4B 3RZCA 4HFUL 4P3DB 1IEAB 1RU9L 5E7FA 3UZEA 3DO7A 4X6DA 2WWMC 1GIGL 3EDEA 3QIBC 3T0EE 3O6ML 4XNYL 3T2OA 2FL5B 4U33A 2P5WA 4FQHB 3RA7L 3S34L 3FB6A 5FA3A 1U8JA 3U9PH 4PJGF 4ODTL 4CVZB 1EVTC 1KJ2H 1RD6A 1DQDL 3O6KH 1ZVHA 3ULVF 4N0FB 4YDIL 3DGGB 3VXPB 5BVJA 4JZOA 4D9RD 1XGPB 5C0CE 2D2OA 2AKRB 5D7JB 4PJ8C 2DL2A 1U0QA 4P3WA 4X5LA 4YXKH 1CFNA 4FFYL 3KVQA 3RL1A 1IM3B 4XNQB 5J9PA 5GJTH 2NY0B 1NKOA 4M8VA 1YEKH 4CMHC 1A4JB 2Z4QA 3FQNA 5F9JA 3B4NA 1ZHBB 2H9GA 3OBAA 4G6KL 1UADC 1C12B 3LQAH 3L6FB 3FB5A 4ONHA 2OS7A 3LOWA 3QNYA 3QUXC 3BDYL 1RZ7H 4X7FC 1X5YA 3WS3A 2O5XL 2AXHA 2EKSB 2APXA 1OSPL 2HT3C 5TPWH 4D9LH 4I4WB 2H2PD 3KLAB 3BEVB 3DHMA 3KYNB 4OSUH 1FL6B 4I48A 4XC3H 1I1AA 4X6CA 4KI1A 3GIVA 4HDIB 3GUTB 3QUZD 4W70A 3QUMH 2OYPA 4W4OC 5C6PB 4MMXC 1V8HA 2B2XL 3UO1H 4DOHE 3ARXA 4LDLB 5L7XL 1D6VH 2VNCA 5EO0B 1R3JB 3SGJC 5J3HD 4RMRA 4I2XB 3TBWA 5JW3L 1N5AA 5DRXA 3V0VB 5MEPB 3ZTNL 4NN7C 2N4IA 5I1IL 1TVBB 5CSZB 4XNUL 1G7QB 1WICA 5IK3B 3RZCD 1RUAL 4HH9A 3AS2A 3T77A 1CCZA 3V52L 1TETH 1XH3A 1CD1B 3C09B 3W39B 5L9DH 4Y89A 1CIUA 5DLML 5IJVA 3V6OA 4P5TB 1FIEA 1N5YH 3TH3T 1AQDB 4O51B 5D2LF 4K23H 4TVPD 3NIDF 2C4XA 4MAYB 1FZOB 3HE6B 4P5MA 2ARWA 2BCKB 3EYQC 3H42H 1J0IA 1DUZB 4ZUWB 1YY8A 1W0YT 5IEKA 3V6FA 1IARB 3HC3H 4LSQH 3ZMRA 4ZFGL 2AXJA 4PJXF 4DFHA 4ZG1A 4PRPB 2J1KA 5E9DB 2I9TB 3VFWA 4PY8J 4EDXA 1KC5L 1DQQA 1RZJC 4GBXB 4Y19D 4NCC1 2OK0H 1WV7T 4PJHE 1A9BA 2JCCE 3ZKNC 4JRYD 4FZ8H 5DUBA 1KIPA 4BUHA 5I6XB 1U3HA 3N1MC 4FQLH 4PJHB 3JWOH 3OAYH 3G04A 3INUH 5IOPA 3RJQB 3P40A 1UJ3B 3LN4B 3AXLB 4WTZG 2XTJC 2XYCA 1FP5A 2P5ED 1ZHKA 2A6JA 4RGOH 2X1OA 2R0KH 2ZKHH 4WTWA 1WEJL 4X7DC 4UDUA 4BQBA 4YO0B 1QSFD 2IH1A 5EBLB 4OD2A 4XX1E 2HRPL 3ZSSA 3BMVA 1A6TA 5HHOD 4JKKA 3HAEB 3KPRB 2PXYC 1SM3H 1P7QB 3SDDC 2LAAA 1EAPB 1KENH 1AD9A 5CP3H 5EIVA 5IR1B 4G6AD 3WS3B 3LCYA 1MCCA 3FT2B 3TM6A 1FCGA 1J88A 2QSVA 1A6AA 4G8IA 4B7LA 1MCBA 4JFDE 3K8LA 5F7NC 4QYOA 4IOSD 4NQCD 1P4LA 4RFNB 3SY0A 2VLKB 4AENA 4S1SH 4HGMA 3U46A 3WFCL 3U1SL 3MRNA 3QUKA 4P4KA 1LO0L 3WFEL 5HYFA 1YNTA 5GRVK 5F88B 1S9VA 1JI2A 3DX9B 2NLJA 3GK8H 2YEZB 5C1MB 1OL0A 1IL1B 4DGVH 1P7KA 4KROB 4WW1B 2R9HC 1BGXH 5CHNB 2P45B 2X4OA 5J9PB 2EXYC 5C0GB 4JO2L 3HE7D 2V9RA 2GTWA 3GHBH 2VC2L 1UA6H 1B4RA 3QXTA 4L8SA 5DFTA 5C0BD 2FEDC 4LQ1A 1IGIH 3GBMH 1BJMA 4O00A 5FOBB 3WJLA 1G7MA 1TZGH 3MBXH 4D0BA 4JANB 4KK6D 1YQVH 1NJ9B 3BHBB 4JVPA 2UWEF 1I3GL 3WFZA 5J1TC 4BELD 3VA2C 5F7HA 3EKCA 4RFEB 3JWDH 1F11A 5D4QA 4WGVB 4S1DD 1G9ML 4ZS7H 5AUMB 1JGUH 3B9KD 4PB9L 1X4XA 4OIIH 3B9EA 2GAZA 3MRGB 3WL9A 3IAGC 4ZUVA 5E2JA 2WUBH 1BGXL 1FFNA 1U8IA 3ARBA 4LPWA 4FQQA 2K9UA 5J06A 1HQRA 3KLSA 2L0DA 3MBED 3GB7B 3H0TB 5A40E 1HKLL 5TPWL 1OSPH 3IFNL 5JHDE 1TJHL 2VTFA 1H8OA 3L3OA 4LSDA 3ZKMD 1AGDA 2DIJA 4YDVA 1WITA 1U8OA 2Z93B 4UV4L 3RRQA 2YXFA 3V5HB 4D2NA 1G9MC 1QLFB 4KZDH 4GLRH 1MOEA 4MZ2A 1EXUB 3ARFC 4JFQB 2VB5A 2BRRH 3FOLA 4XCEB 4JFEB 3W82A 5FGSA 5FM8A 1F2QA 5F9WB 3H9SD 5CD5D 4JDZB 2G2RA 3O3DB 4JDZA 3VMNA 4PUBH 4IOIB 2X4RA 4NQED 1I85A 3WXVH 1MQ8A 3W5NA 3DLQR 3I2CL 3MLSL 4NRYA 5E2TL 5EU6E 5HJ3B 2ZNXA 1S7WA 2C3GA 5CJXC 4U4BA 4PR5A 4DVRH 1VFAB 1MRCH 2HTLD 4NNYA 1OP9A 3V8OA 1DQDH 5C0BA 5HYSB 3O3BA 3WIIH 4IS6B 1RSFA 2ADFL 2JE8A 3TBYB 5KSAA 3B3IA 5C08A 4QHLA 1FNSH 1GIGH 2YHGA 1CFVL 1LP9F 1WT5A 4M7LH 4N0FA 4P99A 1D5ZB 3MUGA 2VL5A 1MCQA 5DVNA 5HYSG 5C0FA 1Y18A 1RAMA 1BZ7B 1PYWA 2P5EB 5B8CB 4PJEA 3UZQA 4DAGL 4U0RB 2R2EA 2JCCB 5JORB 1XGRA 4PJ8D 1XFPA 2A6JB 2YK1H 3SKUD 4ONGH 4JM2C 3OAUH 1EEYB 1XF5A 4UV7L 4GAGH 3LKRB 3PDOA 4FQXB 2BRQA 5I30H 3O6FC 5CUSL 5KJRL 1HHGB 2Y5EA 3FQWA 3KPSA 3PWNB 1NUFA 3QUZA 4KHXH 4NGHH 4U1JB 5CCKL 3EFFB 4KI5F 4XAKE 4Z7OE 3QULB 5AAWA 4LVNC 4ELMB 1S7VA 1BOGB 2CIIA 1GGCH 1R3KA 2P24B 1CWVA 1JTTA 3SE3C 5IB2A 1IKFH 5D6CA 3T0EB 1J5OL 3LSOA 5DFVC 5IB2B 2VLRB 3RPIA 4ZQKA 3GMMA 4GKNA 3RPKA 1N4XL 5F7MC 4Z7VA 5ID1B 2IPUG 2AQ1A 4G9FB 4M9OA 1YUHB 1JHLH 4HIJA 2N7AA 3W0WE 2OJZL 4LLVB 4LCWE 1N6UA 4TSCH 3NFPB 4L1DA 4WV1A 2JF1A 5AZEL 4WW2B 1VKXB 2MNUA 3QQ9D 3VH8B 3FZUC 5DRXB 5I1AA 3UTTE 2W1NA 4LIQE 5E5UB 4N9GB 1WSST 4PJ5B 2J5LC 1RFDL 4CMHB 1WCQA 3LKOA 4OSUL 4AEIH 1FZMA 4WUKH 4HT1H 1YMMD 5CEXB 3EJYD 1YJDL 3EJJX 2B1AH 2BP3A 4YHIA 3P30L 4PJ7F 1X7QB 2B1AL 1F58H 1ZOXA 4GO6B 1D5BA 3FAWA 5BMFL 5T1DL 2E27H 3NABL 4OQTH 4OD3L 4QRSB 5BZWB 1KJVB 1AGFA 3VFUA 1X3DA 4LSPL 2VXUL 3MMEA 4QRSA 1ZEAL 4G80B 3ULUH 5IM7A 4KQ4L 2HT2D 4G6KH 4P49A 1FG9C 4U1SB 3CLEH 4K3EL 3TH4T 2P8MA 1RIHL 4LPXA 4HS8H 4E5XA 4R26L 1NFDA 4TVPH 1ODAA 3S36X 5LXGH 2XV6B 5FYJE 2F53B 2BVEA 3CU7A 5EC1A 5F7EH 3CH1B 4OT1L 1JYXA 1IC4L 1L6XA 4WEMB 1NGWB 3S35X 4TYUA 5IBUB 1B2WH 1HXMA 4XP1L 3T0BA 1AGBB 2DB8A 2D7MA 3A0OA 4PJAA 5DJDA 5C0AA 2BSRB 1RPQA 1IQDA 3ARYA 4ODTH 5JOFB 2YUZA 3ILQC 1HIML 3G6DH 5F9WC 3K7UA 3RA7H 3WHXB 1I7RB 1G6RH 2F15A 5J12B 1NPUA 5SWSA 3U0WL 5EA0H 2M26A 4LIQH 1I1AD 2BJML 2FX9L 2VH5L 2Y36H 3LZFL 1S3KH 4RISH 4EBQL 3MPCA 4I9WE 3O41A 3TJHD 2DMCA 2VXTL 3TA3D 1FZKA 3R8BB 2HTKC 4JG1H 4WNQA 2CDEB 4PV8B 4Z0BL 5F6IC 1WBXB 4NWTL 2UYLA 1LK3H 2MSPA 4JKPH 2W9DL 3GO1L 1DBBL 2HT4D 1KULA 4U1JA 2AP2A 4P2CG 4C54A 3D85D 3S4SA 4M7KH 1S7TB 5CJQL 4E41E 2MKLC 4OFVA 2J12B 5C2UB 3DBXB 3VFPB 4JN2B 2ZUUA 5BZDA 3WO3B 4NKIL 3M17B 3L3IB 2JK5B 3A6CH 4LP5A 5I0ZA 5I1EH 1BIHA 1VENA 1P4LB 2W9LA 3WLBA 4DKAA 5FOJA 2J8OA 4OCSL 2B0SH 2LVCA 4Z78B 4KMTH 4P46B 4LFHG 2OP4H 3K2UL 1EH9A 4IRJD 4KRPC 2VXVH 4ODSH 3VWKA 1LE5B 3QUMB 4RRPA 4RWYH 1SQ2N 4MA3B 2Z92B 2ID5A 4OLUH 2XN9B 2X4OB 5GISH 4GRWF 3S96B 1J0YA 3S98A 1QFWH 1BMGA 4TULL 4HK3N 5E95B 5CS7A 5KSBA 5C9KA 5DVLA 4C58B 1M71B 5F1OB 5C07E 1UWGL 3BZFB 1JN6A 2WBJB 3W0WD 3V4UL 1NLDL 1QZ1A 1XCQB 4S11A 3LB6C 3BZFA 1FG2A 2VDML 3ZHKA 4L5FH 4XCEA 4BSVB 3BWUC 4TUOA 5DD5H 2NY6C 4LBEA 1IGYA 2J7LA 1EEZB 4L3CB 4PRHE 3IDYC 4X8XA 3BAEH 3HE7A 4HC1A 3MOBL 3QR2A 3ZE2F 2DI7A 4F7PB 1CGXA 3KYOB 2DYPA 1X5FA 4M1GL 4XPGH 3AU1A 1CR9H 4G9FE 1ZGLM 3UTSE 3BPNB 2NNAA 2EDJA 5CJXA 3N1QC 2ZG1A 3X3GL 4KV5E 2GSGA 1FNLA 5IEHA 3MNWB 3EOAA 5LG1A 4K8RC 4LPYA 5K59E 4KQ3H 3RWHB 3KYMA 2AJVL 1T7VA 3I3EA 2B39A 4LPUA 1IT9H 5DD6B 4F7EA 2CH8A 4H88H 2GT9B 3O9WD 3IU4H 3FRPG 3SE8H 1CLOL 3QEUA 4HV8A 1CFSB 3JV0A 1QEWB 4LHUD 1BAFL 3UPCA 1AHWC 2AXFB 4HV8B 3BUYB 4N68A 3TO4B 4X4XB 3QEHB 2ATKB 3FRPA 4QRPD 4O5LL 4PJDE 5BJTB 3O9WC 4X4XA 2DQEL 2BY3A 2PO6D 2EH8L 3GGWB 1F4XL 5CD5C 1BM3H 1OF2B 2B7DT 4KKBC 1FNAA 3BN3B 1WBXA 3GMOB 3V4PL 1DUZA 4ZUWA 2D31B 4MNQD 4PGEB 5CILL 1PX4A 1U95A 3PP3H 5HVFB 2EC9U 2JELL 3WUZA 2IANE 3WFEH 3TIDA 1E6JH 1MCSA 3ESVF 1EFQA 4PJXE 4ODWA 4TTGA 3R1GL 1KBGH 3O2VH 3IGAA 3GBNL 4F7CA 3NCMA 4ZD3L 4LCIH 3B3IB 5CLWA 5K9KB 3DHJA 3EO1A 5J1SC 2AQ2A 3QCUL 12E8L 4KPHL 2CKBB 3LB6D 3PL6A 3H9SE 3BW9A 5T3XD 4J4PD 4YFEA 4G6JH 3L3GB 2ZOKB 4X6EB 1CDGA 2VISB 5TGBB 4R2GB 5IGXH 1R0AH 1QLEL 5CJBA 3MRNB 1JWSA 2VXQL 4HK3J 5E00A 5KTEH 5EU4B 5E6ZA 2VZSA 2PO6A 5I18H 1T89C 4XMKL 4L8DB 3U2SB 3D39D 3IJYB 4RGOL 5J0BA 3HAEA 4K8RD 1A7RH 1XT5A 3RWGB 3MA9H 1H3GA 2LVEA 5F9AC 1RJZB 1NLDH 2AJZA 2KQMA 4LLQB 1EGJH 1T1ZB 4JJ5B 5HGAA 1TJIH 4Y8AA 3GJFK 1J0ZA 1KB9K 1DQTA 5MHSE 4E9LA 4HUUB 3MRKA 3BPCA 1TQCC 5FB8A 1B6UA 3MO1B 1T1XA 3EZ8A 3OKNB 1CTNA 2DBJA 3BIBX 4X6DE 5F8RC 4LSQL 5FGCB 1JGEA 4RWYL 3WD5L 3KJ4C 3L1OH 3LAFA 2C9AA 2GQHA 3DVGB 4M4PA 1HE7A 2XA3A 3MODH 4OF6A 5DD0H 1BX2B 3FONB 2DQIL 4KUCF 2D7QA 4XBEH 2OSLB 3N9GL 1F4HA 2XACC 2WIMA 1FYTA 1YC7A 4HXAL 3DMMB 2HMID 2A9ML 1T2XA 2VABA 3STLA 3SDDD 3HZVA 5IUSA 4QXUH 2GJJA 3NPSC 4GQPH 1LDPH 1Q0XH 2R2BB 2XN9D 3VXMA 1LEGA 3ZYJA 5C2BL 4Q9RL 3BDXA 2Z35B 4N8PA 3U79A 3SDCA 2WV3A 2HVKA 4KY1H 5I1IH 5HDOA 3WHXA 5JOEA 1FVEB 1KPVA 5E03A 2HP4A 4BH7A 3WJLC 4UQ3B 2ZP0T 4X4YB 2WK2A 4LLMB 2FWOB 4QT5B 3EIFA 4U49A 1IGYB 3B2UD 3BFOA 5IMLA 4AL8L 1E6JL 3K1DA 4KTYA 1A7OH 3DGCR 5D2NA 5EFIA 4J2XA 4H8WC 3O4LE 4NUJB 5DK2A 4WI5A 4Z7QE 5CILH 2QL1A 1NFDB 5CFHA 5CJ8A 4LPCA 1IILE 1FN4B 4D0DA 4LL9A 3ZE0F 5CJ5A 3FFDA 4U1KA 2F53A 2CDGB 2FBJH 4D9LL 1P5VA 4OZHF 4XXDA 5DA4A 1RY7B 1DEEB 2NW2B 5D1XA 5EPMA 5EORH 1U8MB 3FHAA 3NFSL 4UB0H 5EU5B 1LP9A 1PJ9A 3D85B 1I1CA 2EDEA 3OL2A 3PGDB 1H0DB 4WFHE 3NZ8A 1YNTB 1RIHH 1YEKL 1YEHL 5SV3A 5DDHA 1OW0C 5EO9A 5T5FL 2R15A 2JJTA 4E0RB 2DWEA 3S35L 4G42A 3ZKSD 2H3NA 4JM2F 4GBXD 4Y19B 1BVLB 3X3FH 1RIUL 7FABL 3B6SA 2YPLA 2X1WL 2AABH 3QJFB 2VXUH 1XR9B 4MAUH 1QFPA 3CXHJ 5E5MA 4YDIH 4G3YL 3P3YA 3TBSA 4M93C 3F62A 3WHE1 4JM2D 1S9WA 4P46D 2Z8RA 3FQNB 3D0VB 3QHZH 3H2WA 3BO8B 1MJJB 1XF4B 4IDLA 5DTFA 5LGKA 1FVCB 3P4NB 1AKJD 2IFFH 2DLIA 1DBJL 2VLRA 5D7LB 3V5KB 2EIDA 1QHPA 4XCYA 1FNGB 1A7NH 3MGAA 4Y4KA 3TESA 3U4EA 4HFUH 3TJEH 2J6EH 2GUOB 3QIWD 4MA1C 4JZJB 3EYOB 1FHGA 2YBRB 5ETUA 5IQ9A 2EXWC 1FNEB 2XY1A 1K6QH 1E27B 1HHGA 3FQWB 3F6LA 3PWNA 4ODHH 4PJ7B 4TVSa 1JL8A 5EO1A 2HJKA 4XCNA 1Z0NA 1WTLA 1AJ7H 3OG6B 2HJKB 4XCNB 3TPUA 1TVBA 3Q5YA 1MHEA 25C8H 2MOVA 3SCMA 1AO7D 4B50A 3U4BH 2IGFH 4F3FA 4JO4H 3LEYH 4Y2OA 3P73A 1VGKA 1A9EA 4RQQA 4PLKC 3QEUB 4MJIA 4OGAD 43C9B 3HC4L 5D9SB 2FX7H 2OL3A 4GH7B 4OGXL 5I1GL 5BS0B 3RIFK 3I6LE 1BBJA 3FO9A 5KJRH 4R4NC 4WFHD 3C6SA 1B9ZA 2HT4C 4FQ2H 4C57C 5I30L 1NGXB 3ZKXC 1MHCA 2YD7A 2ZUQC 4M7KL 4GAJH 5MHSD 1F6AA 3EOBA 5J6GB 4WO4A 5EN2A 4YZFF 3IKCB 3QP3A 3GSNH 4M7ZB 5D5ME 2V2TA 3ARFB 1A7QL 5ITBH 3T1WA 4RGNC 3F7VA 3RDTB 5C0BB 4MNQA 5CEZE 3K4AA 3TNNA 3L6FA 3PGCA 5H94B 3VXUB 4NRZB 4J1UB 4HWUA 2VUOA 1KIQB 5K9OB 4Z76B 2BHZA 3FT2A 1DANU 2G75A 2YUVA 3LIZL 5L0QB 1UACL 2CKBA 3O0RL 3MFGB 3VXSD 4N0CC 2DQCL 4JFYA 2LQRA 1I8KB 4UDTA 2NY4C 2GK2A 1MRCL 4QOKB 4JLRB 4QRUA 3REWA 1XZ0B 1BP3B 3JWDC 5D8JH 5FK9B 1Z3GH 3UDWA 4TTDD 4F15B 2CKBH 4PUBL 1Q9OB 3V6OC 4YDJA 1MWAB 3O6FA 4IRZH 3O3EB 3QUMA 5L8LB 5CP7B 5JUEL 2ADGB 2D31A 4XHJC 2O93L 3A6BL 2Q8AL 2F5AL 3QDHA 4GOSA 5FGBC 4OZHB 4OBSA 3X11B 4U1KB 3TNMB 4RGMC 5F9JB 2PR4H 5J89A 1C7TA 2DJ4A 4K7PY 3TEUA 5HYEA 4ELMA 5DT1H 2VIRA 5TJWK 3UTPD 1G9EA 3Q6GL 3BVNA 2E27L 3OGCA 1OAKL 4IRSA 6CGTA 1MFNA 2I26N 2FR4B 1L7TH 3CIQA 1Y6MR 4FTVD 3IS1X 3OF6D 5D8JL 3BT2L 3SJVD 3SKNA 2OR8A 5FGRA 3A67H 4L8SC 2AI0L 5F6HI 4OIIL 3TWCL 1AXTH 2CUMA 4HKZB 1T2QH 3IU3B 4Q6IC 4HFWB 4IEFB 5D1ZA 3V9FA 4GS7B 3MBEC 2Y06H 2V17H 3RJDA 1ZV5A 1KXQE 5GGSB 1DUYB 2GK0A 1HDMB 2PTUA 4RA3A 5DRZB 1G1CA 4PYHA 5DO2D 4TRPL 1S78C 1MUJB 2PXYA 3O4LA 5K33A 4LCUA 1KB5B 1JGEB 1WFTA 4I4WA 5C2BH 3GHBL 1RZFH 1KXTB 3JV5A 4JO2H 4C55A 3MXWL 2AV1A 3W9EB 1J8KA 4J4PA 4ZFOL 2ED9A 5GGSY 5JXEC 3K8KA 1OP3H 4DUXA 4HLZH 3S97C 3QEQE 5F7UA 3GNML 3LRSB 3MODL 2RFXB 5IVXF 5F6HJ 1M7DB 3V6BR 1YYLL 3LRHA 4RX4A 5FYLD 2ZUSA 1LO0H 3SGKA 4XWGH 4GAGL 3GSUA 1MCWW 4WWKC 2X4QA 1AGDB 3U4BL 1I3RB 2LTQB 1HINH 5I8KH 2R56H 2W0FA 3MRIB 4MNGE 1FPTH 3CXDL 3QXWA 2B1HH 3ZDZE 3WLWC 3MRRA 4HBQA 5CGYC 1DZBA 2AERT 3PHQB 2X4PB 4NWUL 3KYAA 4WRLA 1R5WB 4QY8A 1CLZL 1JPSH 1ZHKB 4PJCA 2AJSL 4L3EE 2HVJB 1FYHB 4Y4FB 4I5BB 1FLRL 3FOLB 4Y5XB 5DK2B 5DURB 3MLVL 2HTKD 1FZJA 2BY2A 4NJ9H 1F6LL 3CFCL 3GSVB 4OFDA 4HIHA 2W07A 5I19L 3K46A 1MY5A 4PBXA 2VXQH 5F7WC 4LPTA 1B4JL 1R0AL 4LGRB 4C4KT 2OX5A 4DUWA 1GOFA 4NQCB 4F7EB 5DJ6A 1CXKA 4HAFA 1YEJH 4EN3A 3VRLE 4I1NB 1KC5H 2O26U 4X7SH 3FB6B 4J3XA 1H3UA 5EC2A 1BOYA 2FATH 1JZ6A 1BFVH 3K80A 1JK8B 2HN7B 2HLAA 4FQXC 1DVFA 1W72A 4KZDL 2F58H 4PP1D 3QIUA 4UV4H 5T5FH 3SKNB 2AK4E 2Q6WB 4KXZI 3RVTD 4IDJL 1XF5B 1U36A 4RRPG 2P8LB 3QUYB 2BK8A 1JZ4A 1GHFL 4XRCA 5ERWA 3UTTD 5JORA 1EA9C 2CR6A 1EEYA 3L5IA 5IBLD 3CMOL 1NMBL 4Y4HD 5EU7E 5MENB 5HHQB 2R69H 1F4XH 3TV3L 4WHYG 4P9MH 2EO1A 3KPNA 5C0GA 3R06A 4YWGH 3RTQC 1KPUB 1G9MH 1AGCB 1T7XA 4IRJC 3OV6A 4LLAA 1FL5B 3MROB 1YN7B 5D5MA 2XPGB 4XZUA 5DJYA 1PG7L 4GRLC 5DEGA 3WS6A 2PN5A 1X4ZA 1Q1JH 3SJVA 3QAZB 3C8HA 1G7HA 4J8RB 5DEZA 3ARED 1GGTA 2D7NA 1WIPA 4P4KB 2WUCL 4CNIA 4TPRL 5KG9A 3QB7C 4JY4B 1RZ8A 1BZ9A 1INEH 1H3PH 3V7MA 4PY7B 4P57B 1JHKH 4WEUD 2CK2A 3PUCA 3C6LD 3F7VB 4EOWH 3C5ZC 2AJYH 2C3VB 5FDYA 1AIFB 4XMPL 1NEZA 4LMQI 1N8ZB 2IWGA 4BQ9A 2VDMH 2VWEE 4NKOA 5HPOA 3VFTA 1S78D 3BDYH 3N1PC 4G6AC 1NEZG 5D6DC 5B39A 2EEBA 3AREB 3P0YL 1T2JA 1MCOH 5FA4A 3MLVH 4HIEA 1U8PB 3FQTB 1UQSA 1VESA 2H2PC 1ADQA 4NYLA 1G7LB 2WLYA 2X40A 1D5MB 2H41A 3AC0A 5AZ2H 4Q6YA 1WIOA 5C08D 1MVUB 4G8GD 4JFEE 4CAGA 4JFXB 3C5ZB 3I84A 3C6LB 4X9HA 4NJAH 1T0MA 3QH3A 5I16B 4YFLF 3K2UH 3TFKD 1SEBA 4Y4HC 3H7BA 3OKMA 5ESVA 4P4RB 3QJHB 4N0UE 2HA1A 1TJIL 3QUZB 5DI8A 2A74A 2QQNH 4JG0H 4HCRA 2ZKHL 2GJZA 4NQEA 3UROR 4ODUB 2DI8A 3CFEB 3SDXE 4EXPX 3HI1A 4FQCH 4CJ0A 2XZAH 4KDVA 4QNPE 4U6HA 3BHBA 4KKNA 5E6ID 5TDOA 4JVUA 3SDCD 4Y4FD 2GY7B 1KCLA 3MRQB 4PRID 1Y18B 2PF6A 4GRWB 4GXUM 1TCRB 4ODXB 3MNZB 3MXWH 2W9EH 2VRAA 4M6ML 3MRHB 1E4XI 4LEXL 5DC0A 1RZFL 5TH2B 3G5VA 2PYFA 4JQIH 5DZOA 4B53A 1DBBH 2BNQB 4JY6A 2E7BA 3HC3L 3IT8D 3RU8H 4FABL 4NM8H 1FC2D 4U7KA 1FGNH 1NCCL 5TQ0L 2X1PA 1WVZA 3NCYS 5DURD 3CAFA 3MBEA 4HWZA 1UCBH 4L8DA 4GAYA 3FB5B 4ONHB 3TYGL 3QIBB 4ETQB 2BJMH 4OGYL 4APQA 5DJ0A 4RA0C 1PVHA 3GRWH 1DCLA 1FJ1A 1C8PA 5DLMH 1NCBH 5IT2H 1WGOA 3SE9H 5HGAB 3DV6A 1VPOL 1RUAH 1W72H 5JIIA 3QXDB 3BP4B 4M6OH 2BSSB 1I1AB 1VFBA 1TNMA 1FVDA 1WISA 4L4VE 2BSSA 3O2DA 3TP4A 1GJIA 8FABB 1RK0B 3K74B 4I9WD 3RX7A 1G1YA 1GXEA 2AJUL 4WO4B 3UAJC 3U83A 1YMHB 3MUJA 3M45A 4BSJA 3Q6GH 4P46A 4LSVL 4H1LH 2P8PB 3G6AA 4C56E 2ZUQB 3KXFA 3NAAH 3PWPD 4F9PC 3UTSA 4O2FB 3BP6A 4YGVA 1J87A 2J4WL 3OR6B 1D9KA 4DN3H 3HNTH 2OM5A 3OSKA 1OCWH 5DK3A 5HHQA 3J8F7 2YPLD 3QO1A 2G5BB 5JXAH 5IQ7H 1U3JA 4LSPH 5E24E 3ET9F 3KPSD 4PJ5A 1K4DA 4PB0L 2JJSA 3L95B 5T1DH 2ATPB 5BMFH 3GHEH 2JLLA 3P30H 2B5IC 2AGJL 4JCLA 2NPLX 2ADJA 3ARUA 2M1KA 2FZ3B 4FMKA 1Q8MA 1JCKA 2HG5B 4TSAH 5FEBA 2JCCA 3O41B 2XWTB 1JNHA 2ILLA 4DWHA 3O0RH 1FV1B 1ZLSL 1IAOB 3P4OA 1N0XL 2ADGA 4BFIA 3WCYA 4UT7H 4BFEA 1JGLL 5HHMB 4XPTL 1E6OH 4U6YB 1IGJB 4OIBA 5A3ID 5J11B 4Y0GA 5CJOH 1XGQB 2HT3D 3DXAE 4XPAH 1R24A 2DQJL 5HYSA 5DMIL 3GSNL 4OLUL 3ULVE 2WBJD 2OCFD 4PJCB 4I3RL 1HOCA 2FO4B 5IHZA 1JWMB 2VMFA 1TTGA 2GT9A 4GG6A 1ITCA 2H32A 2Z31C 3PHQA 3U9PL 1BD2E 4P59L 2B0SL 3ARBC 1UQSB 2CLRA 4XNYH 5C6TL 4ZO6A 5GGTL 4KHXL 3UTPE 5MERB 3GI9H 1KACB 4IM8A 1S7SB 3IVKB 1M7XA 1KCRH 4NQVB 3HB3D 5B4MC 5C9JB 1KEML 3S8WA 3L5XH 4O58H 3O3EA 1RZGA 3D2UB 2X1XR 4HIXH 1RZGB 4EKXA 3LY6A 3WXWH 3QDGA 1I8MB 4NO2B 1NAMH 1QO3B 4QEGA 4OCWH 5GGQH 2WQ8A 1CD8A 1U8QB 3S6CA 4NHCH 1C12A 3MV8E 4HGWB 4LSUL 4H0HB 2EDWA 5C0IA 4OUOA 1SMOA 1DDHB 3CX5K 1MCLA 4WVRA 1NCAL 4FZEH 4DZBA 2W60B 2VR4A 3TF7C 2YRZA 4IJ3C 1A1OB 3A67L 4JRXE 1CFNB 3HRZA 2NXZB 3IF1B 3OHXB 4R8WH 5J8OA 5FYJL 4LLVA 1CICC 4APQD 3OB0K 5J13C 2AXGA 2A73A 4F15C 3I6GA 3O3AB 2AXGB 4HXBH 5D1ZC 3IU3A 1JFQH 2DQJH 3P0VL 4BSWA 2IC2A 4KZEH 2ZCLH 2CK0H 3CJJA 3MRCB 4NDMA 3TCLB 2JTDA 1IAIH 3P0GB 5SWZE 3O3UN 3WN5B 2C4FT 5DFWH 4JFOB 3NPSB 4FNLL 3KDMA 1HNFA 3FO2A 5J3HC 1R3LA 5H37G 3ILPB 3VGBA 4G5ZL 2EEAA 4Y4FA 3MJ9L 1MELA 2COQA 2FHFA 5D93B 4I13B 4AG4H 1V05A 1U58A 3CFBA 3QDMB 3PWLB 4PJCF 1CZ8L 1T0MB 3H9YA 3NABH 4OQTL 5JO5A 1OT2A 4QTHB 2FEEL 4XP5H 4Q97A 3UTSB 3UYRH 2Q76A 3DX7B 4B5EA 1GC1C 4Y1AD 4EI6B 4PB0H 1NGYB 1CBVL 3LV3A 2XXCB 3LKSA 3TO4D 1MRDH 3WV0A 3LHPL 4HC1L 2J4WH 3D1MC 3BQUA 1Q94B 3KPOA 4RGMB 4K9EC 4LSVH 2FSEA 4NC1C 5KSVB 1S5HA 2R1YA 3QDJA 4MD0B 3UC0L 1QTYT 1EEZA 1V7NL 5TGBA 2UZIH 3GJEA 1S8DB 4GAJL 1UXWA 1X5KA 4NRYB 4ODVH 5HDBE 3B2UC 3RBSA 3U6RB 5EBMB 1MFEH 3EUUA 4Y19A 2C1OA 3GK8L 1LDPL 1Q0XL 1WFNA 3OXRA 5GRYA 5AAMA 3EYSH 2VLRD 1I3RA 1G84A 4LDOB 3HC4H 4X99A 3RGVA 1PKQE 4G8FB 1NCBL 2NY4B 1CLCA 2AEPH 5EU5A 3DRTA 4ENED 3RL2B 1OGTB 3T4YA 4XZUB 3HMWH 2V2WA 4NP4H 3PWPA 5KSUA 1J10A 1UWEL 2P24A 1WK0A 3KAAA 1NCCH 5TQ0H 1LK2A 4Y8DC 5B38G 3VXRD 4ONGL 3ULVL 1MCEA 2KKQA 4HWBH 3TN0C 4PBVC 3L5HA 1EERB 4MNHB 4LEOB 1OAUH 2BY0A 3VCLB 3SHSA 1UH2A 3QRGH 5HY9B 1T4KA 3GJFH 1NSNH 3TT3H 3D2UD 3VCLA 1WBZB 4Y5VC 4Z5RA 5ERWB 1VEMA 4QF1B 5GQBA 4M7LL 1UM6H 1D9KB 1MWAH 1W0VA 2BHYA 1NMCC 3S4SB 3MRCA 1G7MB 5EBGA 3WIIL 4JDTL 3MRMA 1N3NB 3FT3B 5C0ND 3BUTA 1LEGB 1UM6L 4DVRL 2QQNL 4JG0L 1YA5A 5FB8B 1T0PB 5I18L 3FB7B 2XA8L 1UEMA 5KTEL 3VGAC 3ROOB 4Y4KB 5E2WH 5IJVB 3WNKA 5IGXL 1HZHL 5I9QC 5JHDD 1AC0A 4Y1AA 3W9DA 1P1ZB 4HUWA 5TFSH 3TA3C 3ZLQC 4MCYB 4H20L 4JFFA 4XNMA 1KFAH 5E6IA 3MGOB 4U1LA 3U2SA 1UM4L 3CSGA 1JHTB 4U1HA 3P0YH 1WZMA 1WUNT 3ARSA 4UT9H 3ARGB 1KBGL 5HHPB 1MCFA 2OMBA 2OR7A 5HHPA 1IAII 4N5EC 5EORL 5H94A 3VXUA 2XQBH 4OZGE 5KSBB 4GG8B 4NSKA 5BRZD 1CFBA 2AJYL 2IFGA 4YHOH 4XNUH 2RB8A 5DUMH 4N1CA 5JIPA 2DL9A 3MV9D 4LKCA 3MRQA 2OL3L 4OUUA 1LWRA 4JB9L 4AH2B 5JA9A 2IANA 2IQ9L 2D7OA 4POUB 4DW2L 2APVA 3CVIL 1BAFH 4TPRH 3DGGA 3W11C 2BVPB 1D6VL 5L7XH 5JR1L 3OPZH 1EHXA 1I3GH 2WWMD 1EUUA 1QYGH 3FFDB 4HWZB 2EIEA 5C0CB 1ZVSB 4M7LT 4KY1L 3B5HA 3D39E 1CGTA 2FL5A 2LU4A 1JWMA 3G9AB 4NQUA 1NCWH 1ZA6B 2GCYB 1QSEE 4RFOH 3LDBC 3H6JA 4HXAH 4WU5B 5GRXG 5LAXA 3T0VA 2JB6B 3SGJA 5AEAA 1CVRA 3MSPA 1W72B 4I0PB 4XBEL 1RZKL 3VXPA 3BAEL 2NXYD 3E6FA 1NL0H 4EVNB 4I0PC 2R0LH 1H3TA 3E6FB 3MJ9H 4HAGA 1IC7H 2DM2A 1KLGA 4NO5B 2AK4B 3BKCH 3BESR 3V4UH 4QHNB 4S1SL 1MIEH 1OHQA 1NC4B 4CN1A 1CE6A 4QRRE 2MPAL 1Q9OA 3WHE0 3DX9A 4QHUA 1BFVL 5DI8B 1TZIB 2ICEB 1T83C 2EE6A 1FYTB 2MQ0A 1I7UA 3TVMA 4OGAC 1GC1H 2ZWLT 2Y6SD 1QRKA 3MACH 4PD4J 3FO0L 2CLVB 5ID0A 2HFGH 3ABZA 4N0YH 1JP5A 1SBSL 5HVWA 2CLZA 3O4OC 4X6BB 2YKLH 4ZXBD 3CUPB 2RBLA 5MEPA 4HMEA 1JN6B 2WBJA 4H1LB 4NPYB 1JZ2A 4JZNA 2YRPA 1K2DB 3GMLA 4GW1A 1ZLUH 2R1WB 3H3PH 1QSEA 2R0KL 4LOUC 5B8CA 4RSVA 3B2VL 4HDIA 3QFDB 4MMZC 3MLYL 4KU1A 1XEDA 1D6EA 3VXRE 3JWOL 4PY8I 3N85H 5EOCJ 4YHKL 3KYOA 4HKXA 3LPGA 1A3LH 1WWWX 5KSBE 5FM5M 3ZYIA 4LVOB 5BOZG 1AGEA 1UWEH 3EFDH 4PS4L 2DI9A 2K1MA 4Y19E 3V6ZA 4NP4L 1FORL 3GBNH 1HINL 4HWNA 2NZ9D 5I8KL 3G5ZA 1JPFA 4KJPD 4YBQD 3TA3B 2HYMA 2FJGA 2G75B 3N50A 4LDEB 4L1HA 1VGKB 2PXYB 2Y25A 2XY2A 4MQ7B 2JELH 5H2BA 3VFWB 4M5ZH 1F4YH 3EYSL 1FE8H 2FX9H 2VH5H 1T04B 3AY4A 1TENA 3ILPA 3PWPE 1G6RL 3OKKB 2DYPD 1WCBB 3DROB 4NKMB 4ODVL 1C5BL 3WEXB 4M7ZC 4KVCH 5D96C 2CRIA 3RBGA 4MZ3A 4Z7WF 2DAVA 4QTHA 1B2WL 4XP1H 1YDPB 5DQJB 2NTSP 3WUWB 3U48A 4YDLB 4TRPH 32C2B 5IW6B 5JW4R 1MFAH 4HCRH 2IQAA 3HZVB 4XBGA 1E6OL 1JGLH 3LHPH 3MJ7B 4HC1H 1NAMA 4NNXB 1BOGA 4HS8L 1SYVB 3P4MB 2Y06L 3FCTA 3S36L 2AXFA 1XF4A 1IC5H 4QXWA 3W2DH 3M17A 4X9IA 5KVDL 5BV7L 4OFPA 2F8OA 1N6QH 2GSIB 1AXTL 5HI5D 4LLWA 1GAFH 2DKSA 4R7DB 5HDQL 4LEOA 2AK4A 2BVOB 5DEFB 1X5ZA 1AO7A 2BOCB 3OJDA 3CVHA 3VG9B 4P5TC 2X1QA 3GHEL 3GIVB 4K71C 4WNQB 5TDPA 3L3KA 5EO0A 1B0RA 3PP4H 2X42A 3KJ6L 4Z9KB 4AM0A 1HYSC 2BOBB 1RFDH 3DTXB 2PR4L 3LKNA 4HS6B 4YJZL 4NFDA 1OCWL 4L9LB 1TITA 5E8DL 2ZUYA 1IAIL 5E2VH 5ESAB 1BBDH 2J3SA 1TJGL 3EO0A 4KTDH 5E6YA 3A6BH 3NAAL 2ED8A 4L4JA 1JNNH 1IQDB 3HPLA 5JOFA 3SDAC 4UAOB 3MYJB 3ZTJG 1BD2D 2WBKA 3L3JB 4XPFL 2YZ1A 3OKNA 4NC0B 4XI5C 1GGBL 4FQXD 3X14B 3RFZC 5KAQF 2KZWA 1B88A 2BNRA 4JY4A 4K2UH 4RAVA 4J7RA 3VGGA 4R0LB 4KMTL 4PG2C 3BRDA 4JO3H 1MCRA 4BQ8A 1MREL 3QCVL 3HR5B 2X9WA 5GZOD 1T66C 5EZJA 5J57B 4E0RA 4OZ4B 2VXSL 3ZDXF 1E4KC 2BSTB 4FZEL 3X12A 5SWSD 3NFPA 4WV1B 5T33H 1J1PH 2KBGA 1LNUA 2X41A 4WUUB 5I1CH 1HHHA 2GW5A 5K9QG 5I1LB 5DJYB 1H5BC 5CUSH 3QNXA 5DC9B 3U36B 2QSTA 5HHVH 1FYTE 5GGQL 4K9EL 5ESQA 3SGKC 5F96H 1C5CL 3SDCB 4YBLB 1MRFH 1I1AC 3LSOB 2YK1L 1A9EB 1CYGA 5EULV 4PRAA 4JRWA 4JQIL 3GJFB 4JY5L 4JZNB 4JKPL 4NO0B 4HWEL 3QEHA 3UTQB 5IG7B 5F96L 4K9EH 3LKPA 1A22B 3VI4F 5E08L 4GLRI 2NY3B 3G04B 4XMLH 5BVPL 3T4AB 3X13A 3N0PB 1P1ZA 4J3VA 4MHHG 3C6LA 3GI9L 4KRPB 1CFVH 3B9KC 4KVNH 3R0MA 2YZ8A 4NN6C 4ENEC 5D1ZB 1OD9A 3P77A 4XHJD 5HHOA 2VUYA 2VZTA 4HG4J 3EYUH 2ZJSH 2VKXA 3BX7C 2VXSH 4OZHA 5FUOH 4ZYKA 3QCVH 1NBQA 3AREA 1C08B 2BDNL 2VLJB 3DRQB 5ICXA 4HKJA 3MLSH 3OJVC 4I0CC 4BJLA 4NKOB 5DHVH 5GS3A 1ZAGA 1U91A 2EDDA 5E4EB 2RHEA 1FRGL 3VI3F 2VQ1B 1QR1A 1GL4B 1JNNL 3KS0J 4DJMA 3D9AH 3RGHA 3DVFA 4K3EH 4KTDL 1SY6L 4QOKA 1AKJB 4OF3A 3PXJA 3ZL4L 3WIFB 1QPPA 1E4WH 3RDTC 4FQIH 4LFHD 2YPLB 5DHVB 2DQTL 3HN3A 2YSSB 3DI2B 1FFRA 3NPZB 5C08E 3WYRA 2AEWA 2IBGA 5J12C 5JA8B 2W0FB 3MRIA 4GKOA 4XWOC 3LEXA 3C5JB 3VW3L 4WV1C 2CXGA 3K81A 5CIPB 4G3YH 1DVFD 3HB3C 2P4AB 3BXNA 5HDQH 5C0FB 1NEUA 2EDFA 3NCFB 3CD4A 4U3CA 4UDTB 1I4FB 2R1WA 4X4ME 5HYQA 3G08B 2FNBA 3QA3B 5AZEH 4BSVA 3JVGA 4OLWL 2OR9H 5ILTL 3QIWA 3L5JA 4LVHC 4WGWB 5I1HH 1Q9KB 3C5ZD 2FYYB 3MRFB 4AT6B 5CEZL 3D18A 4QHMA 3PV7A 3NIGE 2VISA 5GZOC 4HCRL 3PDDA 5MENA 4JFHE 3MGOA 3H9ZA 4M61A 4U1LB 1A4KA 1CDCA 5E00B 4KKLC 5CKGA 3KPSE 2FB4L 5LJYH 1ND0B 4ZUVB 4A2MA 3NFSH 4UB0L 3HZMB 5ACZA 1TZIA 2RQ8A 1QVOA 4KVCL 3OKDA 4MSWA 4KTEH 4MA3A 3BOVA 5EBWB 5IMOA 4PJDB 2R69L 4OFKA 5I71B 5IVZA 1FLTX 4P3CH 2QHLA 1CICD 4NDMB 4Y5XC 3MV7E 5CGYD 1QBMH 4R7NA 1CDHA 1WWAX 1OSZA 2AJXL 3I75A 1UH3A 1FE8L 2GFBA 3F6IA 3JTSB 4G9FA 1U8OB 2Z93A 4C83A 2VZOA 2ZSWB 3TN0B 5BO1H 4Z7VB 1J11A 5D9SA 3AS3A 5T1MA 1AQDA 4H8WH 1J1OH 3TFKC 3RU8L 4K55A 3WFHA 5BRZE 3PWLA 2F58L 4G6FD 2WZPD 1NGZA 4HUXA 1VDGA 2I60H 4Z7VF 5JPMB 4YPJA 5EZLB 5C8JA 5F72S 5FYJD 2NYYD 2ORBH 1G0YR 3LH2H 3CFJA 1I9IH 3IETB 4WWKB 3V4VL 3BPOB 5DJAB 2FJHA 1BX2A 3U9UA 5ENWA 4QXUL 1VFOA 4Z7WB 5B39G 5FDWA 4BZ1H 1IEHA 3G5ZB 3FQTA 2BNQE 5F70A 3UXFA 3IDGB