1XGTB

Structure for antibody hyhel-63 y33l mutant complexed with hen egg lysozyme
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDLWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtB02
4IRZL 3HLAB 5FYLD 4KMQA 3FQNA 1IGJB 3GRWH 2NY5H 2CRMA 4KPHL 5DJCA 3SDCD 4U6HB 5IB1A 1J7VR 4FQXD 3DTXB 4IMLB 3GIZL 3W2DL 5DUBB 3RVUD 3UDWC 2FIKA 4JY5H 1KENL 1UC6A 3Q0HA 3SGJC 5FF6B 1T04A 1A6TA 1FDLL 2E7HA 4Y4HD 2Y7QB 5HDOA 1AC6A 4XP9L 3FO9B 1JF1A 4OKVB 2GK0A 2XNAB 2BNRE 1UYWH 2R56L 4KY1H 4OI7A 3L3GB 1NCBH 4HLZH 1GGBH 1I1AC 2FECL 3RPIB 1N7ML 3MV7B 3ABZA 2GTZB 5CIPH 5K9QI 3WE6A 1FCGA 3AY4A 4XZUA 4Y8DC 5E8PB 1U2CA 3SE4C 1F8TL 3MOBH 1BZ9A 2DWDA 4P9MH 4F9LA 1UJTA 3R0NA 2J12B 5MENE 3O2DL 5E70A 1ZLSH 1JNNL 1SJXA 3KPRD 4WO4A 4GRWF 3JV4A 2QQLL 2R1XA 2XWBA 2AV1A 2V9QA 2YN3A 4XNQB 3GHEL 4MQ7A 3RU8L 4XCFH 1D5BA 4PJCE 2H1PH 5M7QA 2O93L 4HHAB 3CFJA 1KULA 1DVFB 3FFCD 4BUGA 4D8PA 2OXHA 3BEWA 5BMFL 2WBWB 2WUBH 1T66C 5T3ZE 1BQLH 1RK0A 2ESVD 5HYSG 4PY7B 5LBSL 3ULUD 1KT2A 1KIPA 2CPCA 3VXPA 2WSKA 4KJYB 1JFQL 5E1AA 1T7XA 4XPGH 4U1KA 1P4BH 1Z2KA 4O9HL 2WP3O 3V95A 5AAMA 4MLIA 3MPCA 3D5OF 4P2CG 1HHIB 4Y2DA 5DD6A 5CWSA 3VRJB 5F1OB 4P4KA 1U58A 3QH3A 2AEIT 3V79C 4ODSL 4KZEL 2APWA 4PJ7E 2VUYA 3QG7H 4R0LA 3RWFA 1TETL 4B50A 3NIDF 1VEMA 3MMEA 3KJ6L 2W65B 1HQ4B 1BLNB 1JYVA 3QDJA 4MD4B 2GAZA 43CAB 2ATPB 2JKXA 3TPUA 4I3SL 4RFOL 2DI7A 5DRNB 4DVBB 1K9TA 3U30C 1N8ZA 4F7EA 4JZJC 1LO2H 3EYVA 3IU3A 1T89A 2OR7A 4Y16D 1F2XK 4X80L 3ZE1E 3B83A 4NBYB 2IFFH 1T1XB 3L5HA 4L8SC 3T77A 4ZSOE 5J6GB 1AGDA 1FPTL 5I18L 2V9RA 3MV01 2IAND 4ZFZA 1WGOA 2X70B 1YNKH 1W0VA 1JWSA 4X4XA 4JDTH 5ITBH 1I9IH 5DJDB 1S7TA 3LCYA 1U6AL 4FMFA 2VDQL 2FJFB 5AZEH 4QRPD 3M8OH 4IM8A 4KI1A 3RWCA 5J6HA 1CG9B 3JV6B 5F6HJ 3FO2A 5LXGH 4JHBA 5CCKH 3GBLA 4TSCH 4G8FA 1P9MC 2UY7A 3EYFA 3EYOB 4G8GE 3HFML 5C2UB 4X7SL 4WFED 4JREB 3ETBF 4H8WH 1UACH 2VERN 3BSZL 3FHAA 4LVNB 2HJKB 2QSCH 3ARRA 4QEGA 3GJEA 4YIQB 4UOJA 1GC1L 3BGMB 1WAAF 4WHDA 3DRTB 3ZDZE 1TCMA 4H20L 1A1OB 1DLFH 5CEXB 3V5DA 5GS0C 5EO0A 2VLJD 4MVBD 2X4OA 1I9RH 3O41A 3N85L 1U8KB 1TQCC 1NLBL 5E7FA 4AH2A 4DFIA 1XIWA 3S88H 3W11D 4U7KA 3TBWA 1KNOA 3VFUB 3BZFA 4WW2A 1LEGB 3FCTB 3VFGL 2ED8A 4JFFA 3TVMB 2FB4L 3MLXL 5AEAA 1KJ3L 4WCYL 4KJWC 4N0UE 2UZIL 3G6AA 3A6OA 1KUMA 1FE8L 2JJTA 4WWKD 5DT1H 3MRIB 3REVA 1MFAH 3BPOC 1JHTA 1FYTB 1KCUL 5GSVA 4N8VB 4WUKH 1YN7B 1IM3B 3P0VL 1HEZA 1JP5A 1U3YA 1TJHL 5I8OL 2N1KA 2AI0L 3NAAH 4GKNA 4IIQC 4TVPL 5CFHA 1R0AH 5IWLC 3QUZA 1TDQA 4HKBA 2YBRB 1G9MH 2FECI 4FQCH 4WDIB 4JGJA 4XRCA 4Z5RA 3CH8A 1I7TA 3NH7L 3ZTJH 2BJML 1NCAH 3LS4L 5GZOC 1PLGL 4BH8B 2BCKA 1UZ8A 4KUZL 5L2KE 4I9WD 4P2OC 2CR3A 1L4IA 1BFTA 3GKZA 1UB6B 2YD3A 3WV0A 4Z7OE 2DQDL 4OCWL 4Z7QE 3WBDA 1NFIA 3JXAA 1FLTX 4EJ1C 2HFEB 3CFEB 4PGDB 4HIXL 2EIZB 4UAOC 1WCBB 4P57B 3OR7B 5I1LB 2BVTA 2JLLA 2PN5A 3B2UC 4KK5C 3E8UL 3QCVL 5GGUA 5BS0A 5ABDE 5ESVA 3PP3K 1QRNB 1MRFH 3KVQA 5DYOB 2X4QA 3QQ9C 1UXWB 1FFOA 3C5SA 2XFXB 5J1AA 1AXSB 2A6KB 2AABH 1U8NA 4IOSD 3H9HB 3L3IB 4JM2C 1GZQB 4JO1L 1DJSA 2ZUUA 2NTFB 1NL0L 1A5FH 1RFDL 2Z31B 1WFUA 1PAMA 5DEGA 2WMPA 5A2KH 4HQQH 4ODXB 5DFVD 2VDNH 2MSPA 2Q8AH 3BPCA 4WJ5A 3A6CL 4Z7WE 5SX5H 3SJVE 5CP7B 1PVHA 2QR0A 1L0QA 3TA3A 1TCRA 1X6LA 3ZO0A 4PRIE 2AJZB 5DMKB 4LMQI 4JN1H 3KHQA 1LE5B 4L3EB 1MPAL 4FXKB 4OZIE 3TZVB 4J3XA 5CZVL 5BVPH 3D18A 3WFEL 3TWCL 1MJJA 1P6AB 2MHAA 3S36X 4PG9B 4Q2ZA 1K5NA 1P4IH 2B5IC 1TZGH 3OGCB 4QRQB 4X6DB 5FO8A 4NC0B 4WEUD 2JB6B 3T4YB 3DV6A 5IESH 3MRDA 4ODUB 5MP6H 4XWOC 4FS0A 4R9HA 4M7LH 3BDXA 2HRPH 4EXKA 3VGGA 3VCLA 1OSPH 2HG5A 1WSST 4NCC1 1N2RB 2R0LH 4UTBH 4XPAH 1U3JA 3MLVH 4PJAB 1AR1D 1A1MA 4LSUL 1NGPH 3PHQB 1YEKH 5ICXA 5JW4M 2YS4A 4X6CE 5LG1A 5HHQB 1I1YA 3SDAD 1YY8A 1C5CH 4XMPL 5HGBB 2F53B 2NQCA 4GMTL 4QO1A 5EFIB 2ZOLB 32C2B 4OLXH 12E8H 2G60H 4KROD 3FT3B 5C2BL 5TE7H 1WIPA 4AK1A 2XN9B 5D1ZC 1HDMB 1AP2A 2D7TH 3HS0B 2LABA 4EI6A 1FVDA 2EC8A 5IKCB 1KPRB 2NW3B 1S7VB 1EEYB 4NOFA 5IV2A 4C4KT 4B5EA 3L9RB 1YYML 1PZ5B 1CDIA 2EXYC 5I8KH 4F58L 1UM6H 1PKQB 3C09B 4NSKB 1JVKA 4JRXB 4UUJB 4ELMB 2X4RA 3AREB 1AGBB 3VFSA 3W9EA 1Z9OA 3K3QA 5SX4H 4HWEL 4N0UA 4TQEH 4WRLA 2LVCA 3ZT5A 1BD2E 1U3ZA 3RGHA 1ZVHA 4PRPA 4P48A 4LHJB 5CJXA 3MCLL 1MEXL 4ZAKC 4BK5A 2J6EA 2H26A 3MBEA 1K3ZA 4P2QE 4PRHE 1CE6A 2GQHA 2QLVB 2IPUK 1NEZA 5DHYB 4UNUA 3TN0A 2VDRL 4CAGA 1PBYA 3ULSA 2CIKA 3EOAA 1B4JL 4XXDA 4Z7NF 3BOVA 4OUUB 3QI9C 5C0JA 3CDGA 5HHOB 2HTKD 3D39B 3K4ZA 2ADJA 4RX4A 3VXTB 15C8H 2VNCA 1B6UA 5JORA 1MNUL 2XXCB 3UTTA 5ETUA 5AUMB 3CFBA 4HMDA 5I6XB 1T5WB 2AW2A 4HBQA 5BQ7A 4FABL 1AJ7H 1J9CT 2D4FA 5DD3L 1CWVA 1MF2H 4WTXA 4OZGF 4HWNA 4KHTL 1D5ZB 5FUOL 5IB2B 4WI9A 3K2UH 4WVRA 5EN2A 5FOJA 1UWXK 1UM4L 4OCNC 2VR4A 1FH5H 3ARGD 1SVCP 2G75A 2UVFA 1QRKA 3OJ2C 4XVJH 4K3DL 5CP3A 1T2JA 5FCUL 5C07B 4K9EL 4NT6A 2AV7A 1YMMA 1CGSH 1C5DA 4JPWL 4XWGH 3GSWA 1EMTH 1RU9H 4HZLB 5DS8A 5T1LD 5K9KB 4BELD 3V0VB 5CMAA 3G9VA 3MRQA 3BUYA 2AXFB 5FYLH 3PIQA 4KI5D 5CILL 3DOSA 4JFDE 1CLCA 4P5TD 4YGVA 4NP4L 3ALPA 4Y5YA 4RQQB 4NO5B 3K1KC 3OJMB 1Y18A 2NXZC 3ZDXF 4FTVB 4N8PA 3G5VB 3AGVA 5GGQL 3BIKA 3FOLB 2CGRH 4UQ2B 4IBLT 2MNUA 4ZFOL 1OT1A 1MAKA 4X8JB 4OZIA 2DMKA 3FN0H 2X1QA 1ZT4B 4O58H 2EH7H 3BZ4A 1OAZH 2NX5B 2HH0L 4RAVB 3VMPA 3FQTA 4NHUA 1EAJA 3BKYL 2DQIH 2X4SB 3C9NA 1CF8L 1V3LA 4Y88A 2BSTA 3MV9B 4WUUE 4PV8B 1GOGA 5IT2L 3DX8A 3MO1A 3V7AE 4OQTL 2JIXD 2AQ2A 1X5LA 3MLUL 3FOMB 2H9GB 4YXHL 5D6CB 1OAKL 4GBXC 1EHAA 2ZSWB 4GKZB 2CJUL 3IAQA 3OF6A 3HB3C 3J8F7 4XVUC 3SCMC 4OCRL 4FFZH 1SJVA 3W39A 2EDDA 5DSCB 4X6CA 3LKSB 5EZLB 2ITCA 5D2LB 3OKEB 1YPZF 2DDQL 4IDJH 1KPUB 3C6LB 5FEBA 4GG8A 3WN5A 1UVQA 3MV8A 3O2WL 4KKBD 4ONGH 4NCC2 4OZHB 4HKZB 1VKXA 3ARDD 3V5KA 1A4JA 3MRLB 5DD5L 3RJQB 2CKBL 2KKQA 4Y0GA 3TCXA 1EXUA 2OTUB 3FL7A 4N0FA 2NYYD 1FG2B 4M6ML 2BSED 1T0NA 3K8KA 2XKNB 1IEBA 1QLEL 2VZ1A 4HCRH 2HJFA 4LIQE 3ULUH 1EFQA 4JFHD 1CXKA 4ZTPL 4RCAA 4LLQA 4D2NA 2P8LA 5IHZA 4HUNB 3U9UA 3KPSE 1E4XH 4JRYD 4HIHB 2YZ8A 4G9FB 3DETC 1HIML 5D70L 3MRCB 5INDA 4EOWL 3LPGA 3SGKC 4U2YA 4O51B 4K23H 2MPAL 3HE6B 2GUOB 3SOBL 4WY7L 1S5HB 1D3CA 4XHJC 4PRHA 4YWGL 4XPFL 4YNYA 3VFPA 1IQDA 3O6FD 5F3HB 1A47A 1R5WA 3K4DA 2VDOL 4WFHE 1QEWA 1T83C 4PJBB 2BDNL 1O5DT 4S1QL 5ICYB 2XA3A 3MJ9A 5BRZA 1G7MB 3H9SA 5GGSY 1QZ1A 4U1JA 2WBJB 3QQ4A 4EUPA 3MNVB 1AHWC 2G9HB 1BQSA 3MJ8A 4LDLB 5DI8B 1SMOA 4MX7B 1TXKA 3L3DB 1IEHA 4NQVB 5LJYH 3FO0L 5EH1A 5IQ9B 1GGIL 3WSQL 1DBKL 5HY9B 3LRSB 5B3JF 4KTEH 1AQKH 4L9DA 2AJSL 4TUKL 1RI8A 2Y5TB 3VW3H 1ULVA 4ZFOB 1EVUA 1P7KA 1EJ6A 5HYEA 1CLOL 1IAIL 1N6VA 1CK0L 2YC1A 4NO3A 1WBZA 2MQ3A 3QIWB 1OM3L 1J0JA 1LO5B 2NR6D 4R4BB 4G6AD 5EIIB 4NO0A 1B0RA 4UILL 4IOFD 3C60C 1HH9A 1CU4H 4HUMB 4MAYA 4MGXA 1YEIH 1A3RL 2Z91A 2FL5B 2XI9A 1MIEH 2AXGB 4W81A 3HLAA 1IGJA 4JG0L 3HUJE 1OLLA 4KHXL 5LWYL 1OAXL 1WWAX 2VR5A 3QUYC 4KH2A 4U6HA 4XC1L 2D03H 3RX5A 8FABB 3IFNL 3DTXA 1F90L 4IMLA 5DUBA 3HZVB 3I9GL 5FF6A 4JFXB 1NBVL 3T2PA 5C1MB 1LO3L 1CICB 2Y7QA 1FAKT 2MMXA 1OLZA 3FO9A 4OKVA 3RTQB 2XNAA 3BRDA 1AY1L 4QRRE 4WHTB 5KSBB 1YY9C 3L3GA 3ME0A 5JXAH 2XRAL 4X4YB 3LKRB 3QEHB 3RPIA 3MV7A 5F7DB 2GTZA 5IVXE 5FYKE 5T33H 3HMXA 1QSZA 1T2QH 4PJGF 5ACLA 3ARFB 1INEH 2Y06H 4RDQF 3CSYB 4WU5B 1FFQA 5F9WC 3MRNB 5E8PA 4QRTB 3RWGB 3O4OC 1GGUA 2YKLH 1WCQA 1JZ7A 4QTIH 3ZKMD 4E41B 5GHWL 2H2SC 5I19H 4XNUH 1G1CA 4XCCH 3IFOB 3OZ9L 4BFBD 4XNQA 4G6FB 4XNZC 4RMVA 3SBWC 3TBYB 1N64L 4HHAA 4MA3A 2J1KA 3BDYL 1DVFA 3VI3E 4O00A 5C0AD 3LPWA 2CKNA 3QZWB 4XPTH 2DM7A 4ZXBC 1CZ8H 3ARYA 5DZNA 1J1XH 4HIEB 3QCTL 4MMZC 1I8IB 4PY7A 5DQJB 3H7BB 4M1CD 5IIEB 4R6UA 1LP9F 4KJYA 4FG6D 1QSEE 1KXVC 4DKFH 4PUBH 5F1KC 1NLDL 4C4KO 2R56H 4O2FB 1HHIA 4J4PC 3VRJA 4LNVA 4XAKD 1N7MH 1FGVH 1KCSL 2YK1H 4PJ9B 4LKXB 3RDTC 3AFLA 3VXOB 3EUUA 2CMRL 1JTOA 1F8TH 2ZUWA 2AK1L 4FP8L 2W65A 1HQ4A 1BLNA 5ADPL 4MD4A 4P9HC 1JNNH 43CAA 1I85A 2ATPA 3H8NA 5DVNA 1PKOA 2FIRT 5DRNA 4DVBA 1SYSB 3FFDB 3RU8H 2NZIA 4GO6B 3V4VL 4NQTA 2W0KA 5C7XL 4R4NC 3SDDD 3ZYIA 3S4SG 1T1XA 4PGBB 1ODAA 3B8YA 4I0PD 4OLZH 5J6GA 4Q9QL 2CRIA 2Z92B 2X70A 4KV5E 2VL5B 4L3EE 4JHZA 4IJ3B 3F62A 5DJDA 1GPOL 5DRZB 2BFVL 4JPVL 4NC1E 1ZHLB 5F72S 5TE4L 1W72L 1K4CB 1DE4B 4CMHC 2FJFA 3VXNB 2MKLC 3UZEA 1CG9A 3JV6A 3UBXG 2XQYG 1KCRH 5GRVK 5C0ND 4I3RL 3MACH 4NKQB 3T0ED 3EYOA 4DGYL 4MS8D 1X5AA 1RJYB 4KDTA 1A6PA 4PREB 4GRLC 2HJKA 1MWAB 4ODSH 4KZEH 3OGOE 3DI3B 3VXMB 2BY1A 3H3PL 3ALXA 4KKNA 4YIQA 5I1AB 4F15B 4MAUL 1TETH 3BGMA 5HYJD 4OZFB 3DRTA 3FB8B 4Q74A 1A1OA 1ADQH 3L7FB 5CEXA 2JCCE 3MCG1 5TPWL 3PL6B 1U3HC 3QDHA 5F8RC 5DVMA 4YQXL 1IAII 4HUUB 1K8IB 5HHMB 1QHPA 1U8KA 5IJVB 4YDIL 3QDMB 2A6JB 5KVFL 1BAFL 1WBXB 4H1LG 2FJGB 4PFEA 3KDMB 4PJXE 3DX9B 4LEOB 3VFUA 4X80H 4ZS7L 1LEGA 3FCTA 1Y0LB 4V1DE 4XMLL 1FPTH 5D9SB 5I18H 3EYSL 3TVMA 4XX1E 5C92A 2BVEA 1DUZB 3BHBB 3IDMB 4JJ5B 4WIQA 5C0IB 3B5TA 4POZD 5B39G 1H3VA 1FIGL 1FYTA 3LQAH 4N8VA 5H35B 1OTTD 3FZUD 1X5GA 1YN7A 4PJIB 3RVWD 1IM3A 4Y4FB 3GSQB 1JZ3A 2ARJQ 1YJDL 4MNHB 3WUZA 1QFWL 1PDKA 3QFJB 4HUKB 2BSSB 3HFMH 5C09D 4X6EB 2YBRA 2WAHA 3B2VL 2W0FB 4WDIA 1VENA 4NRYB 2UWEF 3BSZH 2BVYA 4C56B 5A3IC 4KK9D 3VWJB 3H3BC 2ILLA 1C1EL 3ARUA 1AR2A 4BH8A 2FZ3B 1UB6A 2LAAA 4H20H 4NQDE 1DFBH 5IBLD 4C83B 4UDUB 3GZKA 2HFEA 4WHYH 3CFEA 4PGDA 2MFNA 3MUJA 3CSGA 3BWAB 2EIZA 4AM0B 3N85H 1WCBA 4P57A 3OR7A 3PDOB 4UOW0 5I1LA 5IFHH 4QNPF 3GUTB 2J8OA 3OSKA 3UTSE 1EA9C 2VLKE 3FN3A 2F54E 4RISL 3V6OA 3BDBA 2AP2A 2EH8L 2FSEB 4JM2F 3DI2B 1UZ6E 1I3VA 3VFGH 1QRNA 5DYOA 1Z0NA 5F70A 3RWDB 1UXWA 3DNKA 4EI5C 3H9ZA 2FB4H 3MLXH 3B5GA 2FNBA 2XFXA 5JZ7C 1AXSA 1VESA 2A6KA 4KWUA 3E6FB 4PD4K 3H9HA 1DUYB 1FE8H 3L3IA 1KJVB 1GZQA 2ESVB 5HHVL 1S7XB 1T7VA 2NTFA 2Z31A 3MNZB 1TFHA 35C8L 2YSSB 5I73B 4X5WB 5GPRA 2JJWA 3P0VH 4ODXA 1T1YB 5I8OH 2VN7A 5CP7A 1X5JA 1K85A 2B4CC 1E0OB 4ENEC 1UCTA 2AI0H 5SV3A 5H37H 1BGXL 2AJZA 5DMKA 1LE5A 4GS7B 2EE6A 4M1GH 4FXKA 2AEPL 3TZVA 1T7YA 3CZFB 5MEOB 4R3SB 2HTLC 4RAUB 4YBQD 2BJMH 4JPKL 3LS4H 4I18C 2NX5E 4ZS6C 2B1HL 3QNZA 1PLGH 4PG9A 4KUZH 4NNPH 3OGCA 4QRQA 3AM8A 4X6DA 5ISZD 4JE4B 2JB6A 3T4YA 2FX7L 4ODUA 4C58B 1HNFA 3TO4C 4ZYKB 4PJHE 5IGXH 1YZZA 5JO5B 1KLGB 5C08D 2AAVA 1N2RA 2J2ZA 5HHNB 5DMIH 4PJAA 3O45B 1JGEB 3E8UH 3QCVH 3PHQA 4TN9A 4KJWD 1L9MA 4H25B 5HHQA 3KLHC 4UT6L 4Y16B 4JFPB 5HGBA 2P4AB 2F53A 1BQHB 5EFIA 2APFA 2ZOLA 32C2A 4Z78B 1W8NA 4P23C 2X89D 3BAEL 4N8CL 2VLRE 3FT3A 1EX0A 2IANB 3DVNB 1FJ1B 1IFHL 2XN9A 5ALBH 3VFMB 1H3WM 4MJID 1HDMA 1GHFH 1DCLA 1HNGA 4JO1H 3HS0A 4KQ3H 2EDTA 4U6TA 3NPSB 5IKCA 1KPRA 2NW3A 4G9DB 1S7VA 4XBEL 4Z8FL 1EEYA 4JREC 3NGBC 2VDLH 1AKJB 1Z9LA 3L9RA 1PZ5A 4H0GA 5F7FA 3CSBA 1PKQA 3TM6A 4NSKA 4JRXA 2DQJL 1G6RL 1KXQE 4JM4H 4UUJA 4ELMA 2DKUA 3AREA 1AGBA 2W59A 1KSRA 4QWWD 4NBZB 3B9KC 4K3HA 4XXCC 1JRHH 3SDXE 1HSAB 3P30L 4HXBH 4WGWB 5HJ3B 2BMKB 1NFDB 5F89B 1Q9KB 1DL7L 3D85A 2B7DT 3HMWH 2QQNH 5DHYA 2I9TB 1NBZB 2AJUH 4IEFB 1RURL 4GRWB 1DEEB 3DXAB 4PJCF 4OUUA 1ZLUK 1YECL 1QR1B 3BE1L 3KPPB 5HHOA 1QSFE 4HUWB 3D39A 3N9GL 2ZJSL 3VXTA 5JXEC 5EU6E 5C0BB 4GMTH 1XGYL 4RBPH 4RRPG 5EBMB 1INDL 1L7TL 4JO3L 1T5WA 2O5YH 5C2BH 1U8HB 3ZE0E 2P1YA 1SYVB 5D7LE 3QJFB 2A83B 3ZHLA 1KGCE 3AS1A 1D5ZA 5IB2A 5I2IB 5CKAA 3E0GA 3LMJL 2IQ9L 1Z0MA 4D9QE 2LTQC 4CUCA 1KCKA 4HZAA 5GJTH 2YRLA 4R26H 4N9OB 3IJYB 1YYMH 5C07A 3FB7B 4F58H 3TO2B 4GAJL 3IF1B 1QFWI 2X41A 4QGYA 2VXUL 3TYFB 4RGNB 4HZLA 5J0BA 5K9KA 3CPLB 4PLJC 1XR9B 1S7RB 1UFUA 5D1XC 3V0VA 3EOTL 4PJ7F 4Q58C 3V7AG 2AXFA 2APTA 5F7HA 4M4PA 1KB9J 4X4ZA 4PRDB 3MCLH 4GT7A 1S78D 1KLUB 5IB4B 1OGAE 1HWHB 4RQQA 2NY1B 4NO5A 1F4XL 2ZKHL 3O8XD 4GJTB 4MD5B 3FQUB 3N1FC 1FLRH 3BPNC 4FTVA 5KVGL 3G5VA 2VISB 2VDRH 4K8RC 4LNRB 1T20B 1CGVA 1W0YT 3FOLA 4UQ2A 3RNKB 1G9NC 1B4JH 5F96L 4X8JA 5E7BA 5KVEL 2D0FA 2QADB 2VZOA 4FNLL 4MXWH 4DWHA 4LLMB 3T4AB 1ZT4A 3ZE1F 3NA4A 3WJLC 4RAVA 5KSBE 2CRZA 2X4SA 1MNUH 4KGJA 3U4BH 1CD8A 5HD8D 4OM1H 3MV9A 5ALCL 2ORBL 1GIGL 1RIHL 4PV8A 3T2OA 5C0RH 3BEVB 3OB0K 4GH7B 1MAMH 1P4LB 3OPZL 2NY6C 1MFEH 3CFCL 4FABH 1EGJH 5DF0A 5DD3H 3FOMA 2H9GA 2FX8L 3MLYH 4K7PH 5D6CA 4IRSB 4QLRA 2ZSWA 3QIBB 4KHTH 5LGKA 4GKZA 3QDGE 4LSVL 1CBVH 1AC0A 5F7WC 1I8MB 1MFCH 1BZQK 3I2CL 4E41E 4PJFB 5AYUL 4NFDA 5DSCA 3WYRA 3LKSA 5EZLA 5D2LA 3S37X 4K3DH 3LZFL 4NC1C 3OKEA 5GGVY 2CDFA 3D3VE 1N5AB 1KPUA 2KZWA 2R69H 1NDGB 3C6LA 1UADC 4JPWH 3P0YL 1HXYB 2NY3B 4OZHA 5CZXC 4HKZA 2N7AA 1P7QD 3MRLA 4UT7L 1N0LA 3GSOB 2W1NA 4JJHA 2OZ4A 5HGDB 1FSKB 3QO0B 3QIUC 1TITA 2OTUA 5DGRA 1EO7A 3K46A 3IYLW 1FG2A 2XKNA 1UWGH 4Q0XL 4RGOL 4ZOEA 4XMKL 3QNYB 4PGJA 2X40A 5GGQH 3N1MC 5I71C 5TF1H 2PYED 4HIHA 4NBXB 3ZTNH 4G9FA 3MRCA 3W82A 4FFVC 4DKAA 4BFGA 3EFFB 4CN6A 2HH0H 4O51A 2DQGL 1GRWA 3HE6A 5DMGD 2GUOA 2E9JA 4GXUN 2NZ9D 5GRXG 1CF8H 3K1DA 1S5HA 1F6FB 3NVQA 1E4KC 1WJ3A 5E6YA 1MY5A 5DA0B 4OQTH 5F3HA 2APVA 1L7IL 2WNGA 4PJBA 5ICYA 1G7MA 4MJ4A 2RJMA 2NY5C 3LV3B 2X9YA 1RZJH 4YE4L 3MNVA 2VABB 5IJKA 2G9HA 4PJ8D 5DI8A 4MX7A 4OLYL 3K2MC 3L3DA 4NQVA 2WBKA 3O2WH 4ZUUB 2KPNA 2IAMB 5IQ9A 1I3RA 5HY9A 3LRSA 3B9EA 4KKLD 5DD5H 1X9QA 3RIAK 1I8KB 1JYNA 2CKBH 5SWSE 2Y5TA 5GS2D 2CK0L 4ZFOA 4PY8J 3ISWA 4Z7OF 3HC4H 3HRZB 3QIWA 3BN9D 4R4BA 1LO5A 4JN2B 5EIIA 1TLKA 4DW2L 2DKMA 1KFAL 2QJDA 5FYJD 5CGYD 2ZCLH 5D70H 3V52H 2FL5A 4FFYL 1GL4B 4WI5A 2AXGA 4EOWH 3CSPA 2HMIC 1V05A 5F3BB 2WV3A 1XGPB 3Q6FB 3QCUL 1NC2D 4UI2A 8FABA 4HUXB 1S3KL 3VGBA 3BKML 6FABL 1L9NA 2GJZB 3HZVA 1GJIA 4JFXA 2UYLB 1CICA 2VE6B 3HCVB 1AXTL 4APQB 1OW0C 4RZCB 1JJUA 3RTQA 4Z7WF 3BQUD 4WHTA 5KSBA 4YX2L 4X4YA 3LKRA 3QEHA 5GISL 4Y89A 5F7DA 4DN3L 3LDBC 2AQ1A 2WWKO 2BHZA 4L5FH 5B3NA 4OZIF 1GGIH 3ARFA 4N0CD 5E2UL 3CSYA 4WU5A 4Y4KB 3EJYC 3MRNA 3QUMB 4QRTA 3SDYL 3HG1B 3FB6B 3RWGA 4OF5A 4TUKH 1IKNC 1NMCC 5DR5L 5FYLE 5F93C 3WNMA 5DZLA 5FV2A 1CLOH 4QOKB 5BZDB 4P5TB 3IFOA 1IRAY 2YPLD 3NACL 3S34L 3ZKXB 5I1CL 5HSFA 5B8CB 2IWGA 5IROA 5E6IC 4AIZB 1YQVH 4XHJD 4UILH 1S7WB 4LVHB 4ODTL 1PG7X 1YEJL 1I1CA 1RJZB 2WUCH 3QZWA 3GI8H 5I30L 4X6CF 3EHBD 1BVKB 4JG0H 2EDQA 3KJ4B 4HIEA 5GSRA 1I8IA 3WNLA 4XC1H 5DQJA 3H7BA 3IFNH 1FRGL 5HYFA 3F7RA 2OK0L 5IIEA 2P42B 3UZQA 3WLWD 1BOYA 1OP5H 5KANG 4MJ5B 2JIXB 4P5MB 3I9GH 3KPTA 2NY0D 1LO3H 2H41A 4RGMC 1A9BB 1MSPA 4K3EH 1AY1H 3MFGB 5K9OA 4O2FA 1CTOA 4N68A 5B22A 1V3KA 3KPRE 2HFGL 5GGRB 5BJTB 2D31B 4PJ9A 1TTFA 4LKXA 2ZOKB 4IRJC 4NN5B 3D69B 1UH3A 5ACMA 3VXOA 3RVTC 3NABL 1M7IB 1UJ3C 3FFCE 5E2JA 4LQ1A 5EOTB 3HR5B 3V0WL 4LSQL 4UOW1 3ARPA 4YH6A 1H0DB 5E9DB 5FGBA 1NUFA 3V8OA 3JWDL 1EFXB 5KSAD 4H8WC 3M45A 2JE8A 5EIQA 4L29B 2YA0A 3QUXC 1SYSA 3FFDA 3ULUE 1IQWL 1TJIL 1N64H 4ZMAT 1TVHB 1MFBH 3BDYH 4LSDA 4X6BB 4BQ6A 1KTLB 4NZUL 3NCYP 1T0PB 4UV4H 4PGBA 1AE6H 4DKDC 4JQXC 2Z92A 2IPUG 4G3YL 2VL5A 4OAWB 1GVIA 1OB1B 3QCTH 3TFKC 5I1HH 4E0RB 5DHXB 5DRZA 4GG6B 1ZHLA 1FNSL 2WBJC 1K4CA 1DE4A 4MSWB 5ITFB 3OAUL 2RB8A 4PBVC 3VXNA 5EO1B 1QBMH 2A9NL 3DX7B 3WXWL 4OZGB 3V9FA 2B0SH 2MTPA 4NHCH 2GEEA 4HSQA 1NLDH 2WWMC 2NLJB 1HYSC 4K2UH 3V4PH 2MJWA 2HT4C 2XZCL 3NZ8B 1EO8L 5JUEL 4HJJH 3VG9B 1A7PL 4KMTH 5L2JB 1RJYA 2H2SD 4PREA 1MWAA 2H32B 3CAFA 3T0VA 3VXMA 5L8LB 1N6QL 5D7JB 4MCYB 1WTGT 3MUHL 5I1AA 2CMRH 4U1GC 4NUGH 2P47B 4OZFA 3LEYH 5A2IH 4FP8H 3FB8A 4AQ1B 3X17A 3L7FA 5EBGA 1FZKA 5ADPH 2IANE 4CDGC 3PL6A 2YRZA 1G9MC 2HJLB 1K8IA 4HUUA 4OSUH 2DB8A 5IJVA 5HYSB 5C0CB 1MJUL 3QDMA 3L5XL 1IE5A 2A6JA 2Y6SC 3VU2A 1HINL 3ZE2E 4J2XA 1JN6B 1F45A 2EDLA 1WBXA 4QRPE 2UV3A 4HF5L 1SY6L 2FJGA 1BWWA 3KDMA 3DX9A 2WIMA 4LEOA 3CXDL 4HLZG 2DAVA 5KBNC 3SO3B 1Y0LA 5D9SA 2R0WL 4OTXH 1DUZA 3BHBA 3HI6L 1IKFL 4CW1B 1LEKB 3IDMA 4JJ5A 5C0IA 4HGKC 3WDIA 4WFEE 4OV5B 2BFVH 2O5ZL 5TE4H 3W0WB 1MCOH 1W72H 4XB8A 3MLZL 3O9WC 3RY6A 5BXFB 2XTLA 1BBJB 1FBIH 5H35A 3C2AL 1NFDE 3F6LA 1HCFX 2FHFA 1VGEL 4PJIA 3FQXB 2MKWA 1FIEA 2C7UB 3U6RB 4Y4FA 3GSQA 4R96B 1X5YA 1D9KD 1RZKL 5IQ7L 2BNUB 1A1NB 5MEPB 4MNHA 2HRLA 3JVGA 3QFJA 4U1MB 2EDJA 2VLJE 1EHXA 2BSSA 1QLFB 4X6EA 3MTRA 5FHBH 2W0FA 1I8LA 4M93B 4C56A 3QHZH 4HH8A 1M71B 4P46D 1EAPB 3QRFM 3VWJA 3PGDB 3QNXB 3H3PH 5DJ8B 4PB9L 2RHEA 2FHCA 4IMKC 4MAUH 2FZ3A 4GXVL 1ZWIB 4NQED 3H3KA 3I50L 2WIIB 5F1SA 1QYGL 5TPWH 4C83A 4UDUA 3N1GC 4RMWA 5EUOE 4AEIL 4AM0A 3BWAA 3PDOA 5TQ0H 3GUTA 4L8BB 4FQ1H 2X6MA 4LCWD 4EN3B 3TYGL 2FSEA 2OL3H 2IQAB 4QHUB 2AK4B 2JJSC 3MYZA 3KPNB 4ALAL 1VEOA 3RWDA 3EFDH 4R4FL 5SV4A 5L6YH 4GFTB 2HT3C 4NPYB 3INUH 2EYRB 3CCHB 3E6FA 1DUYA 1ZVYA 4JFYB 1KJVA 2ESVA 1FO0L 4OCXH 4WTWA 4YBLB 1IAKB 1S7XA 1I3GH 3MNZA 4NJ9L 4UV7L 2YSSA 4X5WA 3T3MF 1A6VH 1RK1B 2ZCKL 1KN4L 3UX9B 4I9WE 1A6ZB 1T1YA 1XT5A 2XT1B 5I0DA 4X7EC 1AFVL 2AJVH 2ZWLT 5DMJB 2DLFH 3GNMH 1CLZL 3S6CA 4FQJL 1OL0A 3HZKB 3SKMB 3B2VH 5DHVB 1S8DB 3CZFA 3T3PF 4R3SA 5MEOA 4RAUA 1UQSB 5HI5C 1JE6A 1ZV5A 1L0XA 3WIIH 2Z93B 5HYIA 4IHOB 3UXFA 3ZYJA 4ZYKA 5IMMB 4QHKJ 2BNQB 4LRNL 5IBTL 3U48A 5BV7H 2VZVA 5JO5A 1KLGA 5DVLA 2PETA 4DGIL 5I1JL 4OF6A 5EA0L 5HHNA 3O45A 4RISH 2GJ6D 3SQOH 3F7YB 2CRYA 2VLLB 4JFEE 4D94A 4N5EC 5FK9B 3VXRD 2VZSA 4ZD3H 4H25A 4MB5A 3SGEI 2KZ1B 4Y16A 5I1GL 4JFPA 5CJ8A 3SDDB 1BQHA 2IH3B 2M26A 2ZUVA 4Z78A 2PNDA 4WTZG 5DQ9B 1YEFH 2H3NB 2J4WL 2IANA 3DVNA 1FC2D 1FJ1A 4LSRH 2W60B 2DJ4A 2GITB 1ES0B 1SVZA 1S9YB 3VFMA 2XTJD 4F7MB 3K4AA 5HHVH 3ARQA 3A6BH 4M5YL 35C8H 1YEGH 3C5ZD 1OAYL 3DHJA 5F8QC 4G9DA 1HKLL 3EJZD 3JV5A 1IAIM 1NCWH 1AKJA 4XNYL 1I1AB 5D7IE 2XZAH 2P8MB 5DTFB 4MNQB 5KS9B 4HX1B 2UUDH 5EB9A 2V2TB 4LSSH 2EE9A 1P5UA 5M94B 5F7NC 1HSAA 3EW3B 3NFNB 2B1HH 4QCIB 4MDIB 5HJ3A 2BMKA 1NFDA 5IK3B 4MLSA 1V7ML 5F89A 2GTWB 2FX7H 5EZOH 3WKML 2EDFA 1Q9KA 2IALB 1F58H 4ZQKB 4K7PX 4DVRL 2I9TA 1NBZA 4UT9L 3MX0A 5GS0L 4K3GA 3UO1L 3VWKD 1LNUB 1DEEA 2BK8A 3DXAA 4ODHL 5C6TH 1QR1A 3KPPA 3OKLB 2RFXB 4V2BA 4HUWA 3RKPA 2EYSB 3VI3F 3C08H 3IFLH 1FO0B 5C0BA 4UT6H 3HTLX 3SDCC 4FQXC 3ZTJG 1MCFA 3BD3A 5I16B 1A21A 5EBMA 3BAEH 4QKXB 3RVUC 1RJCA 1U8HA 4S2SB 4L4TB 1TQBC 1IFHH 1SYVA 2WQ8A 2BC4B 4U3XA 3QJFA 2A83A 4Y4HC 5LGJB 1Z5LB 4ENED 4JY4B 4P3CH 5I2IA 1H3UA 3DECA 3TLRA 5GS2H 4NQCD 3KG5A 4M7KL 1LP9B 1EHLH 1DBJH 1CVRA 5DURD 2I9LB 1ZGLB 4Y1AB 3IJYA 3OHXB 3FB7A 4G7YL 2ADGB 3TO2A 3IF1A 5JQ6L 3IAPA 1G6RH 4U1LB 5HHPB 3TYFA 5EIVA 1NCUA 5DLML 5FYJH 1F97A 3B9DA 4OFVA 1G0DA 3CPLA 1XR9A 3TO4D 1S7RA 1F6LL 2PUQT 3FRPG 3P30H 4M00A 4HGWB 4PRDA 5CAYB 2Z4QB 1KLUA 5IB4A 5BVJB 4ONFL 2VC2H 1SM3L 3V4UL 3U30B 4LVOC 1B2WL 4JZJB 2IJ0C 1AQDB 1FL5B 1DBML 3FQUA 3PWVB 4HD9A 1J0ZA 4MD5A 4UINL 5C0FB 3RZCD 2IFGA 2VISA 3E2HC 1T20A 4LNRA 1KOAA 3RNKA 4L8SB 2FBJH 3FONB 4P23D 3JBG7 3DBXB 4LLMA 3T4AA 4KAQH 4ZUSB 4KC3B 2B2XH 2ZJSH 4GAFB 3KS0J 1QFUL 2GIYA 4DTGL 2F5AH 1CE1L 1WWBX 1XGYH 4PS4L 5ILTL 1BM3L 2F58L 3BEVA 4KV5F 3ULUC 1IAMA 1P4LA 2A77L 2V7NB 4FQLL 5EORL 4J3SA 5E2TH 4P3WA 1G7PB 3PV7A 3QWOB 4IRSA 3WJJA 3QIBA 3MREB 4QXUL 1D7FA 4OGXH 1I8MA 3LMJH 4PJFA 5JPNB 2IQ9H 2WINB 4KI5E 2YD4A 4HJ0D 2P5ED 2A0LD 2VOTA 4N9GB 4QXWA 2Z0BA 3BUTA 1CR9H 3IDUA 3KNBB 1KIQB 1N5AA 3BW9B 3OBAA 1NDGA 3KYNB 3HNSL 3PWPD 3ET9F 1HXYA 3U1SH 2I25N 4AG4L 4PJAF 2K1MA 4LK4A 2FLRT 3GSOA 3WNOA 1XGUB 1UGNA 3EOTH 4HEPG 4ELKB 2KL6A 4W6XB 2R23B 5HGDA 3QO0A 2NMSA 5D6DA 3R1GL 2AVGA 4G5ZL 3CDYA 2AERT 1F3RB 1TQCB 4M8QB 3T1FB 4R7NB 4K71C 1F4XH 4LBEB 3B9AA 3QNYA 5KVGH 1MHHB 3CXHK 4R8WH 4YK4C 3L3HB 1SEQH 4BUHA 5C08B 5ADOH 5A40E 1DBAH 1V7NL 4PJXF 3T2NH 4NRXB 5KJRL 3EFFA 2V2XB 4F57L 3GKWL 1E6JL 1WT5A 3ZZ1A 4OIIL 1A02N 5J3HD 2ORBH 4OI8A 2IBZX 4PP1D 3BPOB 4PYHA 3CFCH 2QHRH 3WO3B 1ADQA 5FUCE 2E7BA 5C0DB 4K7FB 4E9LA 4LSVH 3VD9A 3U7AA 5JW3L 1B6DA 2FHBA 3TEUA 4IIQB 4MA8L 3I2CH 2LV4A 3MRBB 1QSED 3LV3A 3PG2A 4KRPD 2VABA 4LPYA 2EO9A 1HH6B 5L9DL 3FMGH 4Y19D 3QEGL 4JFHE 1R3IL 4ZUUA 1N5YL 4XVTL 2IAMA 2K3TA 4P2OB 2HT2D 3MUZ1 3NCJH 4FRWA 1A0QL 2F9BT 1V3JA 4F33B 4JRYE 4PJDE 1I8KA 3KWWB 4M6NH 2E27H 2UWEB 4TRPH 1VA9A 3ARBC 5HVGB 5IFAH 3MNWB 3OAZH 2R2EB 2ICWI 4UAOB 2Z8VC 3U0PB 4LQFL 1ZE3C 3Q6GL 5I1KL 4Q0XH 5J13C 4GG6E 4P4RB 3NIGF 2YD9A 5JHDB 4TUOB 4XMKH 4I77L 5C9JB 3HRZA 3O3DB 3MGAA 3W11C 4OLUL 4JN2A 3WIFB 1EVTC 2ZG1A 2QSQA 4L4VD 1CS6A 4S1RL 5SWZD 3VI4E 1LEIB 4HPYL 5IHLB 1QFWM 1UZ6F 1U0QA 2DQGH 4LASL 1UG9A 3QXAB 5F3BA 1FNAA 5EOQL 1X6NA 1XGPA 3HE7D 5JW5B 3Q6FA 1J87A 4JM2B 1M05B 4WWKC 2M1KA 4LL9A 3PXHA 4L1DA 4HUXA 3HI5H 1L7IH 2R39A 4F37K 1CDYA 3KXFB 2GJZA 4XCEB 3FT2B 5BZWB 3BXNB 4FN0A 5I66B 2UYLA 4PRBB 2VE6A 3HCVA 4APQA 4O4YL 1Q9WB 4RZCA 3J7HA 5CZXD 3MFFA 4YEFA 5T3ZL 1RUKH 2NXYD 2OL3B 2P49B 4EDWH 4OLYH 1D5MB 4IS6B 3IB4A 3IDNB 2FD6H 2AGJL 1PYWA 4LCIH 1YC8A 2BVQB 1BP3B 2B5IB 3NIFF 3O4LB 1YNLL 1NCNA 4Y4KA 3QUMA 3HG1A 1VHPA 3GO1L 3FB6A 1NBQA 1S9WA 2DQFB 3WFCL 4LSPH 1TTGA 4YXKL 2DN7A 1IILE 1XFPA 1N3NA 4QOKA 2XZQH 5D93C 5BZDA 4GKOA 4P5TA 3NFSL 1U95B 4PJHF 5A2JH 2FO4A 1NCTA 4X7TB 5DMYA 4JKMA 4W6WB 4NNYB 5B8CA 3VH8G 5JHLH 4AIZA 2M2DA 1IT9L 1VFUA 5HGHB 1S7WA 4AEFA 1RJZA 2F8XC 5K9QG 4FFYH 1BVKA 4OFYA 1S9XB 4FQPA 1C08B 5IUSA 4RMTA 5D1ZB 4WO4D 1VPOL 3VGDA 3GJFB 4KTYA 3O0RL 4YDKL 2EKSB 4LHUB 1J8KA 1S3KH 2D7OA 1F3JB 3IS0X 4YHLL 6FABH 4MJ5A 2JIXA 4P5MA 3BIBX 2Y36H 3IDXL 4RFEB 5T5NG 2ATKB 2ID5A 1AXTH 1HKFA 3V8CA 5E2VL 1F2QA 1A9BA 2EECA 5TE6L 1KCVL 2OM5A 3CLEH 3P4OB 4YX2H 4BKLB 3IDYC 4OF3A 3TJEL 5T1DL 5GGRA 4X0KB 5BJTA 2D31A 1IAOB 2BNRB 2C5DC 2ZOKA 2FGWL 1IC1A 3D69A 4ZAKB 5HI3D 1M7IA 1KYOJ 5EOTA 3HR5A 5IR1B 5C0AE 5E9DA 1H0DA 2FYYB 3I02B 5DR5H 2ED7A 5DZOA 2Y5EA 3K8LA 1G7HB 2AJXL 2I60L 1AI1L 1EFXA 4FMKA 1SQ2N 1U8QB 3EBAA 3NACH 2GHWB 2RBLA 3QI9B 3S34H 5MENB 4L29A 1NANH 4P4KD 4CVXB 1AR1C 5I1CH 2VLMD 2VXSH 1MVUB 2XWTB 3SDAC 1TVHA 4X6BA 4LEXH 3EO9L 1ND0B 3GSNH 1KTLA 5GRWA 5DWUH 1YEJH 1Q72L 4PJCB 4KROC 5EZIL 3PQYE 2VZTA 3VXQB 2EYTB 5I1EH 4OAWA 3QDJD 4CBPA 1OB1A 1TPXB 3PUCA 4XAKE 4E0RA 4GG6A 5TH2B 2OK0H 4MSWA 5ITFA 2GY7B 5EO1A 4ZDHB 4QRUB 5E5RB 3DX7A 2HWZL 4OZGA 4YHZH 4MXVE 5D5ME 3DO7B 4NNXB 2NLJA 1ACZA 4WHCA 4X7DC 4QHNB 3NZ8A 2BVPB 1J5OH 4XHQA 5L2JA 3LQAC 5D7KD 2H32A 1T22B 4KJQD 5D7JA 4MCYA 3NABH 3LN4B 2J6EL 3SGDI 1J05B 4XVSH 5ERWB 4LSQH 3QRGL 4WFFE 2NXZB 4PJ7B 1HSBB 1NBYB 3MRRB 5AG9A 3JWDH 1EERB 2HJLA 5FM8A 5HYSA 5C0CA 2IADB 2HLFD 4Q9BA 3BRFA 2HTKC 1IQWH 1JN6A 3LRGA 1TJIH 1FAIH 1XF3B 2A6IB 2ARJB 3SGEH 4OLVH 2FLBT 4NZUH 5IEHB 1ACYL 5KSBF 1N6UA 1F4YL 4B53A 4LRIA 5KS9E 4GBXB 5HI4C 3T0EE 4RA0C 2EDNA 4HXAH 4CW1A 4YAQB 2FATL 1SJEB 1P53A 2EDYA 3CK0L 4ZSOB 4OV5A 3SCMB 1NGZB 5KZCD 2VYRE 1FNSH 3I3DA 3W0WA 5K59E 3BKCL 5BXFA 1XIWD 3ARGC 1BBJA 1QSVA 2A9NH 3FQXA 2C7UA 4HC1A 3U6RA 1K2DB 4R96A 5BCAA 5FIEA 2W9EL 5HYJE 5IOPB 2OQJB 1YEHL 2BNUA 3QPXH 4Q9CA 1A1NA 4BA8A 1FP5A 3EYQD 3GMQB 5MEPA 4JFFD 3N50A 5FM4A 4U1MA 3T0XA 1QLFA 2VN4A 4R90H 3EDDA 2X5PA 3VMNA 1JGUL 4NM8L 1KB5L 1M71A 1EAPA 3PGDA 4KI5C 5JR1L 3QNXA 3OL2A 4G8GB 5CJQH 1EGJA 1MREL 5DJ8A 4XP6H 4M7JL 1ZWIA 3NMEA 4JFQB 3QUXD 4ZTOL 5KTEL 2WIIA 3P9MB 3AMLA 2FEDD 1I9JH 3MLWH 2GT9B 4MA7L 4NIKB 3QUZD 1QO3B 1RPQA 4FQQB 5GS1C 3LH2L 3DMMD 3M17B 1R6VA 4L8BA 3JWOH 1X44A 2AXHA 3GBNH 1SY6H 3DIFB 1D5IL 4EN3A 3DPBA 1KBGL 3UBXB 2IQAA 4QHUA 2X4NB 1G9EA 2AK4A 4WFGD 3KPNA 1ZEAL 3PJSB 2WP3T 1LMKA 3UP1A 4H0IA 4X9FA 4OLEA 3D9AL 4MQTB 1D6VH 3HI6H 4KDVA 1IKFH 4NPYA 3RWEB 5C09E 2Q7YB 4S0TD 2EYRA 3CCHA 1X7QB 1ZHNB 4JFYA 5F9OL 2O5ZH 4G43B 3A67H 1LE9B 1IAKA 5TQ2L 2IH1B 3HNTH 3TJHC 1A7QL 1AHWB 1RK1A 3DYPA 5BS0D 4X4ME 1A6ZA 2ZG3A 2EIEA 3QA3B 2XICA 3STBA 1RZKH 3BI9X 5IQ7H 2CD0A 3OR6B 5FUCC 4KKBC 4FA8A 3MJGX 1NCCH 3O3EB 3ARDC 3HZKA 3LB6D 3SKMA 1Q9OB 5I9QC 5DHVA 5K9JH 1BQUA 1S8DA 1EUUA 1UQSA 4JHAH 2NNAB 4H1LB 3O6LL 4AL8L 2AJ3B 1JK8B 3LEVH 3W81A 2NYYC 4PB9H 2A38A 2VQTA 2Z93A 4LLYA 5TFSH 1M7DB 3O2VH 4GXVH 3ARTA 2Y07L 3I50H 5EUKB 4O2EB 4IHOA 3OJDB 4UU9B 5KOMC 1QYGH 4JKKA 4NUJB 5IMMA 2BNQA 5L2KB 3ULVD 2OP4L 5FDWB 3C60B 4FQ2L 1C5BH 4OD3H 1BEYL 4YHML 5IB3B 4U0RC 2A6DB 3T0AA 1LD9B 2EEDA 1FGNL 3F7YA 2VLLA 4I2XA 4DQOH 5FK9A 2ADFL 4HKXB 3QUYB 3MXWH 2AEQL 1X5KA 3SDDA 4C59B 2IH3A 3OKDB 4ALAH 3O6FC 4LU5L 5DQ9A 4QT5B 2BOBB 2H3NA 1XF4B 4U33A 3UDWA 2W60A 1A8JH 2GITA 3SGJA 3MA9L 1S9YA 4F7MA 1FZOB 1MCCA 5CEZD 4NWTL 1SBSL 3WUWG 4XP1L 1JV5B 1CL7I 4LSTH 4AEHH 5J06A 3ESUF 1KB5B 3PGFL 1YUHB 4LARL 5ISZE 1I1AA 2XKSA 3KAAA 5DTFA 1WBYB 4FQJH 1FHGA 4MNQA 5CGTA 5F9WB 4HX1A 3B6SB 5H2BB 3SJVB 3TT1H 4Z7WB 3KPMB 5C08E 2DTMH 2V2TA 3SE4A 4U1NB 1YEEL 3PP3H 2IGFH 3O4OB 4PRIB 4L3CB 4DCQB 3NFNA 1OAQL 3BFOA 4ZUWB 4X6FB 4QCIA 4MDIA 4HWUA 1OTSD 4GMSL 5IK3A 5LVEA 3GFUA 4L8DB 2GTWA 4ZO8A 2IG2L 3GB7B 1ZOXA 2IALA 2V7HB 4XNZB 1JPFB 4ZQKA 2E6PA 4G6AC 5IBTH 4BZ2L 5F7EL 2A9ML 3QDAA 3UYOD 4IOFC 3B9VA 1UWEH 4L4JA 4LLUB 4EIGB 1LNUA 2XYCA 4MJIE 3OKOB 5EA0H 3IRZA 3JZ7A 5T3XD 3OKLA 4ZXBB 2RFXA 1MCNA 4TUJB 2EYSA 3HI1B 4PRPD 4M03A 1FO0A 3IXAB 4NYLA 4QHLB 3MBED 1OPGL 1FNGB 1CD0A 5I16A 1GOHA 2J4WH 3VD4A 1NFKA 4S2SA 4L4TA 3VDCA 5J89A 5AZ2H 2BC4A 3TN0D 3SKJH 1FORL 5LGJA 1Z5LA 4JY4A 1DANT 3EDEA 4A2MA 5IW3A 1NC4B 1JHKL 2P48B 1P84J 1OAYH 1JTTA 4ETQB 1LP9A 1HKLH 4OB5H 1XCTB 4RX4D 4M93C 4XNYH 2I9LA 3RGVD 1ZGLA 4Y1AA 4F37F 3OHXA 5E8OB 4YFDB 2ADGA 3UTTD 3WS6C 4EZMA 1LO4H 2NY4C 4KFZC 3RDTB 4TTDD 5AWNL 3KHOA 5HHPA 4U1LA 4XPBL 1H9VA 3SE3C 3MBXL 3P4LA 5EC2B 3ZKMC 2A1WL 4HGWA 1NAMH 3RZWA 9CGTA 2Z4QA 4X4MA 5BVJA 5SWSD 1V7MH 1BD2B 4N0YH 3RUGE 1NGQH 3BT2H 3WKMH 5HDQL 3WFBL 5A16B 5T5FL 4JZJA 1AQDA 1FL5A 1YMMD 5C0FA 3PWVA 1JNHB 1O7SA 4P2QB 2R4SL 3ZYZA 3ULUF 1A14H 3UJIL 2DQUL 4L8SA 3FONA 3SHSA 3TPKA 4ODHH 3DBXA 5H37G 2X7LB 1CGYA 4ZUSA 5BW7A 3IAGC 3QFDB 5IW1B 1ZLVK 5E4EC 3LPFA 2D3VA 1MRDH 2BXZA 4YBLC 3Q5TA 3VG0L 3EOYG 4DAGL 1ORQB 1SBBA 1KJ2L 4R2GD 1CDUA 3X13B 4ONHB 4M1CC 4CMHB 2O26U 2V7NA 4NWUL 1YEDB 3EYUL 2ERJC 5I1IL 1G7PA 3FAXA 4FG6C 3QWOA 1DDHB 1R3KB 4Y8AA 3MREA 2CDGB 4X5XB 4HK3J 1XGTB 2DBJA 3OAYK 1NCDL 5JPNA 4XI5D 1P9MA 2WINA 4N9GA 3CVHB 3CX5J 3GSNB 4G7YH 3KNBA 1KIQA 3IVKB 3BW9A 1UKSA 2VQ1B 4GRLB 5JQ6H 4RFNC 4AEEA 4JDZB 1F11B 2YRPA 3FT4B 3KYNA 4WI4A 4HS3B 3WD5H 3AU1B 1EEZB 1XGUA 2X9XA 3OF6D 1JGVH 4ELKA 2R23A 5JPMB 1U3HB 4M02A 1SEBB 1WFTA 4ONFH 1SM3H 1A6WH 3KYKH 4M8QA 3T1FA 4R7NA 4AYFA 4LBEA 3NA9H 1B2WH 1I75A 1SMAA 4JFDB 1DBMH 1UWXH 4FFWC 1QTYT 1MHHA 3TT3L 3MV8D 2EDXA 4HFUL 3L3HA 1T4KB 2KQNA 2ITDA 2HKHL 4MQXC 5C08A 5D4QA 3SDDC 3TV3H 3ZE2F 1UEYA 4U6XB 3CVIH 4I0PC 4KQ4L 2Q8BL 4NRXA 4OM0H 2IMMA 1Q0XL 2GW5A 2DM2A 2V2XA 2V17H 5D7SL 1DLHB 4F8QA 4PS4H 1BM3H 4G6ML 3BH8B 2F19L 1FZJB 2DKSA 2GKIA 5C0DA 2FEEL 4WUUB 4K7FA 5CJOL 2VXVL 1BVZA 1J0KA 4YBHA 1NFDF 1UCBH 5C0NC 4IIQA 2ZPKL 4J6RL 3X3GH 3MRBA 5IWLA 1L6ZA 3T0EC 2H2PD 1T1WB 4MS8C 3Q48A 3UTOA 1HH6A 5IVOA 1CXLA 1ORSA 4MWFB 3UYPA 1HZHH 4D0DB 5F44A 2YD6A 4NKIH 2XXMB 3N1QC 5L7XL 4AG4H 2O61B 4P2OA 5IP4A 4F33A 2PYEE 4TTGA 5FFLA 3KWWA 4WGVB 1JYWA 4Q9RL 2HKFL 2UWEA 5BRZD 3H9SD 1J1OL 4OD1L 2ZUTA 3SQBA 4OCYL 4DOHE 3MNWA 3KR3H 4JVPA 2R2EA 4UB0H 3GMMB 3U0PA 5DUPH 4Z77B 2VR9A 4P4RA 4BZ1L 5JHDA 4TUOA 5C9JA 2VAAB 3O3DA 5FYKL 1JHLH 3Q1SL 3WIFA 4MXQD 5HTSA 2C3XA 1KEGH 5GGVH 1KJ2B 3IJHB 1PX3A 1MCPL 2WZPD 1A7OH 3QB7C 3QAZC 1LEIA 4EI5B 5KJRH 1RZ7L 5I75C 4LDEB 1E27B 1RULL 4F57H 3QXAA 3GKWH 3KPSB 3UJTH 5JW5A 4H88H 4OFDA 4OIIH 4JM2A 5KVDL 4POZC 1II4E 1M05A 2E6QA 3G08B 1QKZL 2BERA 2DF3A 4PYGA 4DGVH 1MCJA 1K6QH 1E6OL 3EZ8A 2DBLL 1A7BA 1OTTC 3FZUC 4JY6B 3RVWC 3IDIB 3QHFL 3KXFA 4UBDD 4XCEA 3BIAX 3FT2A 3RHWF 5BZWA 3BXNA 5I66A 5CBAB 4YO0B 3G9AB 1U8PB 2RCSL 2VZ3A 4NO0D 4MAYD 4PRBA 4CVWA 5AAWA 3VGFA 4MA8H 1Q9WA 1G6VK 4NQCB 5F7LB 5LGHL 1MJ7H 5DUML 4F9PC 4XNXL 5L0QC 2VMFA 1D5MA 4IS6A 3LIZH 5F6IC 4I18B 4KK9C 3IDNA 1AD0B 4ISVB 1TNNA 3BD4A 4XVTH 2BVQA 2KH2B 4PB0L 3O4LA 5FYJE 1VACB 2J88L 5HYQB 2C1PB 2DQFA 3AB0C 4J3VA 5D96C 3TO4B 3DURA 1KIRB 4NJAH 5IBLC 4JZOB 2CO6B 4ZNEA 1KIUA 4DN4H 3E3QE 3KYAA 3DUSB 1CLYL 1KELH 3KLDA 1U95A 5I1KH 3EGSB 3WMSA 4X7TA 4I77H 3MV7D 5BW7C 1CYGA 1CGTA 4NNYA 4OLUH 1MCEA 4LPTA 3BZEB 2VKWA 5FM5M 3L5IA 3G5XB 5ESAB 4S1RH 5HGHA 4PJFF 3M07A 4HPYH 4K8RL 4JPIB 4P23B 2QSVA 1G9NL 3LKOB 1S9XA 2E3VA 2X4TA 3UPAA 5J8OA 4LCYB 1C08A 5EOQH 5ANME 4P2YA 5TDPB 1QG3A 4J3WA 3A0OA 5D1ZA 2OTWB 3GJFA 4RIRB 3RNQB 3DSFH 5DK0B 2EKSA 4LHUA 1ZGLM 3HUJB 1F3JA 3L3JB 4OGYH 1XGRB 3NGBB 2C26A 1H8SA 1OF2B 3UPCA 4NZDA 4J8RB 4RFEA 2C4FU 1DVFD 4JB9H 4A6YL 3MLRL 2ATKA 4OCMC 2JB5L 4O4YH 1NDMB 1A9EB 1QUNA 3EKCA 1OD9A 4V2CB 3QISA 3P4OA 4BKLA 5IMLB 4WEBL 2D7NA 4D0BB 4LP4A 3B9KB 3K81A 2YPLE 4X0KA 4YBQC 3ARBD 4YHPB 1IAOA 2BNRA 4QRRB 4Z95L 4ZAKA 3K8MA 4JCMA 3O6ML 2ED9A 3CMOH 5IVXB 3GO1H 4U6VL 5E4IA 4YXLL 1UKQA 3G5ZB 1IL1B 3O3BB 2FYYA 3I02A 4YXKH 3SO5A 3U7WL 4MJ6B 1G7HA 2OSLB 3V6ZB 1CFSB 2E8ZA 2PW2B 3D0VB 3NFSH 1R3JB 1U8QA 4LGPB 1WEJH 2YPVL 2D2OA 3QI9A 5MENA 4K3JH 4CVXA 4JFZL 1MVUA 4IDLA 2XWTA 3QXVA 3MZGB 1AO7E 2AQ3A 1ND0A 1YYLL 3K74B 1J0YA 5IF0B 5F88B 4PJCA 5LKNA 1B90A 3MJ6A 3VXQA 1NMAL 2EYTA 4NDMB 4AIXA 1TTUA 1NAKL 1KLFA 4CMMB 1N0XL 1VPOH 2ZZUT 1KN2L 2R4RH 5TH2A 2R15A 4YHLH 2LTQB 2FEEI 1U9KA 4J1UB 4ZDHA 4QRUA 1JNLL 4MCZB 4O5LL 4QGTA 4Y5XC 1MRCH 4OGZA 2WANA 3WIHL 2W9DL 1TJGL 3QBTB 5KW9L 2BVOB 4BFIB 5E2VH 3DO7A 4NNXA 2UZYB 5FGRA 5TE6H 1KC5L 2J8HA 2YR3A 4EIZC 1QSEB 3ULVH 2AKRB 4QHNA 2BVPA 3MRHB 4XBPB 4QWWC 2C3GA 1F02I 5D1XB 4PJEE 2GI7A 1UH2A 2FGWH 3BGAA 5AYQA 1T22A 5GGTA 1H3PH 3VFNB 4W68A 3LN4A 4JY5L 1J05A 4MZ2A 5ERWA 4JLRB 3THMH 5CD3B 3BPNB 4D3CL 4PJ7A 4M9OA 3SE8H 1HSBA 4KXZH 3MRRA 1RSFA 1AI1H 4OFKA 2P5WD 4M1DL 2MOVA 4BK4A 2BSRB 1IC5H 1UYWL 3IJSB 5CEZH 2IADA 2KDGA 4D0CB 1CDJA 3RIFK 2IBGA 3RL1B 4Z9KB 4TOYH 4U1SB 3SKNB 1XF3A 2ZG2A 2A6IA 3EO9H 2ARJA 4M3JA 3UJJL 4JFED 2OMBA 1Q72H 4BM7A 3ZT7A 2NY6B 5D2NE 5IEHA 5EZIH 1AGFB 3C5JB 3MOBL 4A6YB 5CSZB 4Q6YA 4GBXA 1NAMB 3CFKB 3MLTB 3QXTA 4BYHA 4YAQA 1SJEA 4ZSOA 3SCMA 1NGZA 4JQVC 3ROLB 2E7MA 1CL7H 2BVUA 5EOCH 1ZA6B 2W0LA 4XCFL 3IU4H 2H1PL 1K2DA 4UMGA 5IOPA 2OQJA 4S1DD 5F7KC 2PCPB 4LPWA 3GMQA 3S9DB 4IOIB 4POUB 3L7EB 3GBMH 1BQLL 3OX8B 5I8EB 2H45A 3RWJB 5T3XH 2FR4B 3QIUB 4NOBA 1Q1JL 4G8GA 1FYTD 3P73B 1S78C 1J0HA 2J6EH 5ENWB 1BVLB 4JFQA 4HK0B 3O8XC 3QRGH 4XPGL 3P9MA 1P4BL 3OKYA 4HWBA 2GT9A 1CD1B 3F58H 4MD0B 4O02H 1QO3A 5I71B 5FO7B 4FQQA 5D72H 4KUCD 4M7ZC 2JCCB 1JTPA 3M17A 3OXRB 2OXGA 3SGKA 3CMGA 3TH4T 1CFQB 5E94B 3DIFA 5HD8C 3B4NA 3UBXA 2X4NA 3PJSA 2F15A 3D1MC 2CQVA 2OLDA 4PJXB 4ERSH 5BV7C 1T83A 3RWEA 1JNJA 1JPTH 2FATH 2Q7YA 3KYOB 5GZND 1X7QA 4V1DB 1ZHNA 3FJTA 1I7ZB 4G43A 1P2CB 4XAWL 1LE9A 4UQ3B 2IH1A 4M5ZH 1NKRA 4MQ7B 1AHWA 4Z7NE 1LO2L 5EDXA 2NTSP 4F7TB 5GXBB 4NQEE 1CDBA 3QA3A 5CP3H 1IM9B 1F3DH 1QRND 3BKJH 3OR6A 4OZFG 3BN3B 2V5RA 5B38G 3ZHKA 1CFVL 3O3EA 1U93B 5HGAB 1Q9OA 3ARXA 1BMGA 3CLFL 1JGUH 5ITBL 4JDTL 1IC7H 4PLNC 1CCZA 2OZ4L 1S7SB 2HA1A 3GM0A 3WO4C 2NNAA 4H1LA 1X4YA 2HN7B 2Z31D 4LCWE 2AJ3A 1JK8A 1MREH 3KPQB 4PJDF 4PG2C 3M8OL 4M7JH 3UMTA 1M7DA 5EUKA 5JOEA 1RZIB 5CIPB 5KTEH 3OJDA 4U1KB 2EDRA 4UU9A 1CFNB 5F1NB 4NUJA 5L2KA 4MA7H 4GG6F 2CDEB 2VL4A 4KK8D 5JW4N 5FDWA 3C60A 3LH2H 1QACA 4TSCL 4NQDB 5IB3A 3TZVD 2A6DA 1LD9A 4H8WL 2E7CA 5HI4D 5DMGC 1D5IH 3VI4F 1AD9B 1EZVY 1KBGH 1VADB 2NZ9C 4J23A 2QSCL 1TPXC 2I5YL 3UTSB 1BOGB 1D5XB 2VLKB 4HKXA 3QUYA 2F54B 1EUTA 1ZEAH 1H3GA 3H0TB 1ZHBB 2K9UA 3OKDA 1ETZB 4QT5A 2BOBA 4QY8B 1XF4A 8CGTA 1DLFL 2QBWA 2DLEA 1OP3K 1FZOA 2VXTL 1JV5A 2FCBA 1ZTXL 4S1SH 5FV1L 4PJ8C 1KB5A 1YUHA 3MSPA 5EWIL 3S3PA 4NFBA 3LDBB 2F53D 3RRQA 1WBYA 4P3DB 4Z7WA 3B6SA 5H2BA 3LSOB 3SJVA 3KPMA 4KKLC 3QULB 3HAEG 3U7YH 2XN9D 3GSVB 5L88H 5JMOC 4U1NA 2YXMA 4TVPD 3CFIC 1NMCB 4OV6F 4PRIA 4L3CA 4DCQA 2GJ6E 3O6LH 5DT1L 4AL8H 4YHNB 4ZUWA 4X6FA 1MFAL 4M6AA 3GMPB 4JFOB 1JZ6A 3VXRE 4Q6IC 4E42B 2Y07H 4L8DA 4WUKL 1PSKL 3MLPA 3GB7A 5DC4B 2V7HA 1JPFA 3BN9C 3SBWA 2JELH 4JRXD 5E6IB 3WFDL 3NAAL 1NGXB 1YPZE 2OP4H 5CGYC 4FQ2H 4LP5A 2XTJE 3ARED 4LLUA 1BEYH 4YHMH 3OKOA 1G9ML 4PJHB 2V9TA 3B43A 4ZXBA 5LCVL 4TUJA 4Z0XB 4NN7C 4M4RA 3E3QC 3HI1A 1NCAL 1DANU 5DD1H 3ARZA 1U8OB 3IXAA 2F8VA 4QHLA 3ILQD 1OARL 2W91A 1FNGA 3JUYA 3TJHD 3D85D 1PY9A 1VDGA 4TSAL 3DSNA 4XP4L 3U9PH 1OVZA 3ROOA 5JOFB 2CLVB 3MJ9H 1NC4A 2VLRB 4NWTH 1SBSH 4UIMB 4PRNB 4RGMB 5HHOD 3BQUC 4ETQA 2AJYH 3D39D 4Z7VE 1XCTA 4EUPH 2W0PA 3PGFH 4OKDA 4J4PA 5EG6C 4KVCH 4UTAH 7FABH 5E8OA 3MLSH 1K4DB 4JR9H 3RDTA 1MRFL 2EE2A 4N0CC 1JUFB 4IRJB 2VQUA 4KKAD 2CUHA 2M8XA 2VDMH 1UJ3B 1YEEH 2NY2C 4F80A 5IHBA 3GJFK 2G5RA 5EC2A 1JGLH 1GAFH 2X4PB 1S7QA 1OAQH 1JHTB 1A5FL 1DZBA 3OG4B 1ZANL 1BD2A 4PLOB 1PGRB 3WS3B 1WUNT 4ODWB 4XC3H 3SDXB 1QNZH 3ZMRA 3QUXB 2VDNL 4JCLA 2Q8AL 5A16A 5C07D 1ONQB 2Y23A 3WDJA 1BQHG 4HPOL 2YHGA 5E6ZA 1BJMA 2EZ0D 1JNHA 5F7EH 3UTQB 1TIUA 4LAQH 4P2QA 3PWUB 3NTCL 3X14B 5IVNA 4JN1L 1ED3B 1ZS8B 3EHBC 4H5SB 1DSFL 2X7LA 3DMMB 4GSDL 3T0BA 5BVPL 5HPOA 4NQCE 5B3JE 2B1AL 2ZUSA 3QFDA 1S9VB 4OT1H 5IW1A 3U0WH 1P4IL 1ORQA 1QSFB 3ZLQC 3C8KB 3X13A 4ONHA 2X4UB 1ZA3B 3WLWC 4P2RD 5IESL 4POYA 5EU6B 2GSGB 1YEDA 5MP6L 3TH3T 4ZPTB 4FTVD 2EICA 3I6KB 1DDHA 1R3KA 2NY0C 1CXIA 1IARB 2CDGA 2X1PA 3GMNB 4X5XA 1JHKH 4UTBL 1XGTA 4GAYB 2IPKB 5D7LB 3MLVL 4CN4A 2YUVA 3CVHA 4JG1L 3AUVA 3GSNA 3MV9D 5ICZB 2EE3A 3IVKA 1ZLUH 2VQ1A 4GRLA 3HMXH 4JDZA 5IFJB 2JF1A 3FT4A 3LD8C 2DWEB 4OLXL 1QQDB 4ESKA 5E99L 3L95B 2G60L 4U1GB 1QPXA 4HS3A 5TE7L 2DMCA 3AU1A 1EEZA 2QQKH 4B7LA 2J8UB 5J1SC 4QHMB 5JPMA 1U3HA 1NEUA 1JZ8A 4K07A 5DEZA 1SEBA 5KSAC 2RAMA 3M1BB 5DEGB 4YEEA 4RRPA 5T5FH 1BF2A 4JFDA 1MVFA 1UB5B 1A4KB 1UM6L 3C6LD 1OGAB 2R4SH 1T4KA 1C7SA 4CADB 4PJ5E 4D9LL 3P4NB 3RPKA 2CH8A 4U6XA 4PJGE 3NZHH 5GJSL 5L8KB 2P8PB 2VXQL 1DQLH 5GRJL 2E7LC 2P5EE 5HHXL 4Z0BL 4QXTB 1DLHA 4K55A 3VG0H 2Q1EA 4OCSH 5JOPD 5E08L 5KS9F 3O9WB 3BH8A 5HXMA 2PTUA 1FZJA 2EDWA 3PWPE 1JPSH 5EU7E 2QSTA 1JWUB 4WUUA 1B9ZA 2X9WA 5K59F 2DQTH 2NY4D 5D2NC 3LHPH 3UPRB 4G9FD 2I26N 4LPVA 3PHSA 2DLGA 2DD8H 2Q7NA 5C3TA 1T1WA 3QDGB 3NBNA 1R24B 3T08A 4PY8I 4MWFA 4D0DA 4OQ1A 1MWAL 4NO2B 2O61A 1AJ7L 3G04B 2DL9A 1TVDA 1MIMH 3D3VB 2QHLA 3BESR 3G6JE 3HPJB 1NKOA 3LS5L 4K94H 3OB0H 3OKKB 3HRPA 1RVFH 1WICA 4KK6D 5FOBB 3GMMA 1PEZA 1FH5L 2VDKH 4Z77A 2VSDA 1RHHB 4RAHA 4IRZH 3P2TA 3BYYA 3S5LG 1WIUA 2VAAA 1J8HD 3PWJB 2LVEA 4KPHH 3TT3H 3X12B 1KJ2A 3IJHA 2HKHH 3SY0B 2X4RB 1MHEB 4XWGL 1EHNA 3GIZH 4OFIA 1EMTL 1RU9L 4KQ4H 4PGEB 4MA1C 3W2DH 2Q8BH 4AMKL 4EI5A 1KENH 4YC2C 1E27A 1FDLH 3KPSA 1KTRL 3RIFF 4P49A 3KS0H 4XP9H 5ECJE 3PQYD 3G08A 4G6MH 4NQSB 4Y19E 2O5XL 3QIWD 4JY6A 3IDIA 2VWEE 5CJOH 5CBAA 1D9KC 4YO0A 1U8PA 1VB9A 3MODL 2CGRL 3FQRB 2ZPKH 4O58L 4JAMB 3MC0A 2OMNA 3O2DH 4P46C 3RGVB 4I18A 1AD0A 4ISVA 4L1HA 3BGFC 2QQLH 3VXSD 3K0WA 4L4VE 3GHEH 4Z18A 1X5IA 5SWZE 1VACA 5HYQA 3BVNB 4DEPC 2C1PA 3DARA 5F7MC 3TO4A 1CICD 4FFWD 1KIRA 1J1OH 4OD1H 4TPRL 4FQIL 4JZOA 3RTQD 4MQXD 5EO9B 4FFZL 2VZUA 4WFFD 3DUSA 1V5JA 5BMFH 5A2LH 5SWSB 3EGSA 4BZ1H 2DMBA 2DRUA 5J11C 1TZHB 4IDJL 1A7NL 3BZEA 4GAGL 3ARFD 4X9BA 3G5XA 4ONGL 5ESAA 3UTPD 5LBSH 5FKAB 1JFQH 4FXLA 4JPIA 4P23A 4LDOB 4MNGE 3LKOA 1RZ7H 4LCYA 3LRHA 4O9HH 5TDPA 2I07B 3Q3GB 3TBVB 3VXUD 5CD5D 5CGMA 1KF9B 2OTWA 1LK2B 2P24B 4RIRA 3RNQA 5DK0A 4N1HB 2DBLH 3HUJA 3L3JA 3ULUL 1XGRA 3F65A 3STLB 4LLVB 1OF2A 4J8RA 1F4HA 3RAJL 2LQRA 2VRAA 3GI9L 1E4XL 3U36B 1NDMA 1A9EA 3ARVA 5LGHH 4XTRD 2FDBP 1T3FB 5IMLA 4D0BA 3KJ6H 3GSUB 3B9KA 1VFMA 4HEME 3D2UB 4XXCA 2GSIB 4YHPA 4YDVB 4QRRA 4I3SH 4RFOH 2ENSA 5IVXA 3NOIA 3NFPB 3G5ZA 3QXUA 1IL1A 3O3BA 4P5KB 4MJ6A 3DYMA 2OSLA 3V6ZA 5JW4R 1CFSA 4ZO9A 4F7CB 2PW2A 3D0VA 3KPOB 5IB5B 5ID1B 1R5VB 3ARSA 1R3JA 5I17B 3CFDB 5TF0A 3HNVL 4PJ9D 3F7QA 3ZSSA 5JXEA 2YD2A 5FAAA 3SDCB 1U6AH 4PBXA 3FO1B 4JHWL 2IPTL 3MRIA 2ZUQC 2VDQH 4FQXB 5JDJA 5SX4I 3TP4A 1XF2B 5IF0A 4KTEL 1AQKL 5F88A 1UXSB 1C7TA 1RUPL 1TQBB 4XBGB 3JWDC 4NDMA 4UZGA 2XTJC 3LKQB 3QO1B 4Y4HB 4CMMA 4J12A 5GRYA 3C5ZC 2P45B 1JMXA 3EJZC 4X7SH 3S37L 4J1UA 3T8XB 1OGTB 4MCZA 3ZT6A 4JEGB 1MCKA 2BVOA 4BFIA 1YEIL 2VB5A 1GC1H 1UH4A 2YA1A 1MIEL 1QSEA 2AKRA 1EK3A 3MRHA 4XBPA 3R8BB 5A1AA 2OJEB 3RI5F 1Z9SA 5D1XA 1ZLWK 2BRQA 3WLBB 4Z95H 2VLME 3VH8B 4ODVL 3RA7L 3KPRB 1X5ZA 3DV4B 1CGWA 1NLBH 3VFNA 2P7TB 1CQKA 4U6VH 4LVOB 2EDBA 1XZ0B 2OS7A 4JLRA 1ZHKB 4GW5B 5CD3A 2PXYC 5DO2D 3VGAC 3E2HB 3FFCB 3QDJE 3VWKC 3DX6B 2BSRA 3IJSA 4YHOL 2OI9C 1GOFA 1HOCB 4D0CA 5JXAL 1QOKA 4YHIB 1TZIB 3H6JA 1KJ3H 1TMCB 4WCYH 3RL1A 3WJLA 2UZIH 4U1SA 1T2QL 3SKNA 3RQ3A 5IW6B 3VXMD 5T1KD 3T09A 1INEL 1YYLH 2Y06L 5MI0C 1KCUH 4F8TA 5DJ0B 1AGFA 3C5JA 4JKPL 1QFHA 1NMAH 4A6YA 4QTIL 4PGZA 5CSZA 5J9PB 1TJHH 1BPVA 3PL6D 1NAMA 3CFKA 3MLTA 4XNUL 1N0XH 2YEZB 3V6FB 4TVPH 4XCCL 3ROLA 5HVHB 3JWOC 3MGTB 3QDMD 3AS2A 2WWKT 4KRNA 4L3EA 5D7KE 1ZA6A 3NH7H 4NO0B 2W9DH 4HGMA 1TJGH 2R2CA 2PCPA 2ICWJ 4IOIA 3HHRB 3VRLF 4WEMB 4M7LT 2DQDH 1CZ8L 5B21A 3L7EA 4OCWH 4U0QB 3OX8A 1KG0B 5I8EA 4OF7A 3RWJA 1J1XL 3TNMB 2FR4A 3QIUA 4OBSA 1CN4A 4HIXH 4WWID 3P73A 2V6HA 3WL9B 1QR4A 2BHUA 5ENWA 4WI3A 1BVLA 4K71B 4Y4FD 1RZKC 4HK0A 4NQXB 4CRPA 1CVSC 3GMLB 3RZCC 3IS1X 4D3CH 4PLKD 4YK4B 4DKFL 4PUBL 4M1DH 1CD1A 4MD0A 2E6JA 3QFJD 4ZUTB 5FO7A 3DGGB 3IKCB 5EPMB 2E8YA 2JCCA 3CNKA 4YHKL 2Y25A 4I0CC 3OXRA 4C56D 3L5JA 1FGVL 1CFQA 3VWJD 2YK1L 5E94A 3Q5YA 3UJJH 4GW4B 1NL0H 1RFDH 3SEPA 1T03L 3PXJA 1E4KA 4QRPB 4PJXA 3RWIB 4CU8A 4JFFE 2OR9L 3A6CH 3WIHA 3KYOA 4V1DA 4MJ2A 1I7ZA 1P2CA 1EDQA 4UQ3A 2CLZB 2JJUA 1WIOA 2C4XA 2HLAB 3GRWA 1MPAH 5CZVH 4HJ0C 2A0LC 1RD6A 1H8OA 3WFEH 4MA3B 4F7TA 3BWUC 3TWCH 1IM9A 5AG8A 1E4XI 2X10A 5CJBA 5EU7C 4OLZL 4MDJB 1U93A 5HGAA 4G8IB 3R4DA 3ZKND 2L7UA 4QHKI 3ARBB 1S7SA 3RX8A 1Q1JH 2VLJB 2HN7A 2Z8SA 4M48L 3KPQA 3H42L 3PWLB 1R5IB 5J13B 1MCBA 5I8CB 1RZIA 4WFGE 3KYMB 4LSUH 4RMUA 5CIPA 1OTUD 1CFNA 5FGSA 5F1NA 2QQQA 1KCRL 4XMPH 1PG7L 2CDEA 3MACL 4ZPVB 5AUMA 3VA6A 1CT8B 4NQDA 5FYKU 3WHE1 3RKDD 5C0GB 4MHHI 3TBSB 1A2YB 4ZG1A 4Y5VC 3S35L 5EUOB 1LHZA 3C87A 2QKIB 1AD9A 5D1QD 2DJUA 1VADA 4OIAA 1ZT1B 5IG7B 5BS0E 5J3HC 2YUXA 3UTSA 1BOGA 1D5XA 4WWKB 2VLKA 4PP1C 2XACC 2F54A 2H8PB 1ZHBA 3H0TA 3TF7C 5HDBE 1ETZA 4QY8A 3IKKA 1ADQL 1Z6JT 3F6IA 4D9RD 1JGDB 1WWWX 1OW0A 4XAWH 2J8UE 5IMKB 2LU3A 1F13A 4WU7B 4KRPC 4HWEH 5HPMB 3MR9B 3DO3A 2R0KL 3PHOB 4M62L 1G7IB 3QXDB 1MEXH 2HT2C 1CFVH 4P3DA 2VWEC 5FECB 3LSOA 3ULVE 3QPQD 3QULA 2VIRB 3GSVA 3CLFH 1IKNA 2OZ4H 4L9LC 1MCQA 4YHNA 1H5BC 3GMPA 2PR4L 5DJZB 1O7VA 4JFOA 5D93B 3LQAL 4E42A 1IVLA 2P46B 4W4OC 4RNRB 1AKJD 1CGXA 2NX5A 1ROWA 5I74C 2QEJA 5E6IA 4KZDL 1CFTB 1NGXA 3AXLB 2P5WB 5CEZE 3QG6B 4PJHA 4TNWF 3GM8A 3L3KB 1OQOA 1ZXQA 4Z0XA 3HE7C 1FFNB 5FUOH 2I5YH 1U8OA 3W9DB 4KDWA 1UM4H 1WQVT 2DICA 3OTTA 4JFEB 2E9IA 4OI9A 1DFBL 1G0YR 3GMOB 5GRUL 5CHNB 5E95B 5FCUH 3MROB 4K9EH 5JQHC 2VXTH 5JOFA 2CLVA 2VLRA 4UIMA 1BECA 2EC9T 3DXAD 4LKCB 4PRNA 5IFHL 1ZTXH 3HC3L 5MERB 4ORGB 1U8MB 1U8JB 4WI8A 2NXYC 3IDYB 3MOQA 3ZHDA 5C0BD 5EWIH 1A6UL 5CILH 1K4DA 3ZDZF 2H6PB 4NP4H 1JUFA 4IRJA 5J56B 2D7QA 4FZ8L 5D7IB 1PJ9A 1UJ3A 5HBBA 3QUML 3H7LA 4I4WB 1HHKB 2X4PA 5T3XE 4YDJB 3BMVA 3OB8A 4EBQL 5A2FA 4PRPE 4EVNB 1PSKH 2EO1A 3WS3A 3SDXA 4ODWA 3QUXA 1FL6B 3QWRA 2X2YA 4WTZA 3U79A 1ONQA 4CL7A 1A3QA 3BKYH 2ZSVB 3SDAB 3WFDH 5TDOB 3UTQA 3X14A 1IEAB 3PWUA 3AY4C 2VO5A 4RGND 5IT2H 1DN0B 1ED3A 1ZS8A 4M1GL 2Z9TA 2DS4A 4H5SA 5CEYB 3WUWB 3MLUH 4KROB 3F7PC 4YXHH 3DMMA 4JQXA 1OAKH 5LCVH 4F9LC 1AIFB 5BOPA 2CJUH 1S9VA 3DHMA 3Q2CA 4HFWB 4WO4C 2DM4A 4OCRH 4NNPL 1OARH 1QSFA 3C8KA 2NY1D 2WBJA 3UTTE 2X4UA 1ZA3A 3JUZA 4QYOB 5SWQB 3EDFA 2GSGA 2E5EA 5EU6A 4HIIB 4ZPTA 4U7MA 4DKEL 4TSAH 2DDQH 3I6KA 5IGXL 4XP4H 2QV2A 1HQRB 3I75B 2IBBA 3FB5B 3GMNA 1BFSA 4PP2B 5CSGA 2QADD 5I1DB 4GAYA 3RBSA 2IPKA 5D7LA 5B4MD 5DMIL 5KG9B 3MOAL 2XOTA 3BH9B 1I4FB 1T2XA 2W38A 4RDQG 5ICZA 4J3OC 3RBGA 3EJJX 1LDSA 5JDSB 5IFJA 1YMME 4Z7QF 4M6MH 2DWEA 5HI3C 1QQDA 3L95A 2I24N 2APBA 1QLEH 2Z8RA 4PJEF 4IRSD 3QIBD 4ZTPH 5ALBL 2EKJA 2J8UA 4TVSa 1GHFL 4I0KA 4QHMA 4FXGB 2Q3AA 4KQ3L 4R97C 5CLWA 1ZANH 4GQPH 1HIMH 4Y2DC 3M1BA 1E4WL 1H15B 2VDLL 4P4KC 2Q87A 2MPAH 1DN2A 3SOBH 1UB5A 4WY7H 2C3VB 3QR2A 4HPOH 1A4KA 2R1WB 3VD7A 3FAWA 1OGAA 1URLA 4JDVB 4UIKL 3NTCH 1UM5L 3QQNA 2NY3D 4YWGH 4JM4L 4CADA 3P4NA 4R0LC 4XPFH 4KKCD 3QYCA 3WNPA 1DSFH 2VDOH 4GSDH 2P8PA 5FGCE 2B1AH 1JRHL 2BDNH 4S1QH 5HGGS 4YZFE 4HXBL 3WXVL 3QNZB 3FRUB 4QXTA 2FRGP 4CN1A 3BRGC 1JPST 3O9WA 4LOUC 3ARGB 1PEWA 3MRMB 3P40A 3HMWL 1T89C 2QQNL 1JWUA 3SKUD 5ID0B 2AJUL 2N4IA 4QTHB 2A73B 3FO0H 3MXVL 1A3LL 3UPRA 3WSQH 1DBKH 3FRPA 4AY0A 4OD2B 5T1LB 3QDGA 3PABB 2NY2D 2AJSH 4TNVF 2D9QB 4JG1H 3UAJD 3L5WB 2XV6B 1R24A 4E41A 2BHYA 4BH7B 1F6AB 3E1F1 2DOCA 4PPTA 1IAIH 4KJQC 1CK0H 5E99H 4NC2B 3MV8E 4NO2A 2O5YL 4IMKA 3DVGB 3G04A 3D3VA 2NCMA 1OM3H 5CKGA 3HPJA 3PP4L 5DQDL 3OKKA 3TBYA 5KAQG 1WFOA 4OGAD 3DWTA 4JRWA 1A3RH 5FOBA 4S11A 5GS1B 3VDAA 2HLFC 3STZB 1RHHA 4GRMB 2D0GA 4XT1C 5GJTL 4R26L 5EC1B 4KHXH 5LWYH 3PWJA 1MCLA 3X12A 1OAXH 2IAMD 1MFDL 4D9LH 3SY0A 2JJSA 2WLYA 1ZAGA 1MHEA 3G5YB 1F90H 1KXTB 4PGEA 4RMRA 5EOCJ 3ESVF 5GJSH 2FJHB 2RGSA 2VXQH 1AO7D 5GRJH 3V5HB 1NBVH 4DJMA 5HHXH 4Z0BH 5C6PB 2R29L 5E08H 3RX7A 4NQSA 1XIWC 1PZUB 3BP7B 1CDHA 2XRAH 3D85B 1OT2A 1FLRL 1F4WL 3NPZB 4HC1L 4WW2C 5CINL 2MCPL 4X99B 3FQRA 2D7PA 4URTB 5BRZE 3EYQC 2ZNXA 3H9SE 5A43C 4MXWL 4XCYB 3TIDB 5DJXB 1RMFL 3CJJA 3ARDB