1XGTB

Structure for antibody hyhel-63 y33l mutant complexed with hen egg lysozyme
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDLWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtB02
1AJ7L 3IDUA 1HHJA 1OSPH 1X6LA 3OKKB 3FQXA 3H3BC 3JWDL 5C07E 1UM6H 1B0GA 2GY7B 4QXGL 3K8KA 1MCOH 2A74B 4YO0B 1QG3A 3ILPB 3SOBH 2DLFH 7CGTA 1YMMB 1HEZB 4GAJL 4HJGB 2YSSB 4U6HA 1FNGB 5JIIA 1FYTD 1FFPB 4HV8B 4GUPA 2BVYA 5ETUA 4LLQA 3TN0B 5DEFB 1PKQA 4H1LH 3I75B 4XCEB 4KQ4L 4Y2OA 4YIQB 3BH8A 2FJFB 1B6DA 4O5LH 5EBLA 5J06A 3VWKA 4GG6E 1JGEB 5DJ6B 1LGVA 4ODXA 1RZ8A 4PJIA 2VZOA 2R23B 4PJ5B 5C1MB 1IEHA 1AP2A 3LIZH 4K3DH 5C0GB 5TPWL 3QULA 3WYRA 1BIIB 3DO7B 3PGDB 4QRUB 3N9GL 5FYLH 1A7OH 1QLFA 3DX7B 5GRWA 3PHQA 2G5BA 5E2VL 5AAMA 1V7NH 3QG6B 1TJGH 2AK4E 1SHMA 2OI9B 1BBJB 2AKRA 3BGFB 4Z0XB 3SHSA 4HWEH 4YLQT 4HJ0D 2JJTA 2EYRA 2CKBB 4JZOB 5AUMB 4AMKH 4RA3A 4F33A 1RIUL 1F58H 3MSPA 4HUUA 3RNQB 1G7JB 4LHUD 3RWJA 1B90A 4IS6B 1KEGH 4JRYD 2DI8A 3KYNA 1RQ5A 3Q5YA 2VIRA 1FNSH 4HDIB 4S2SA 2DLIA 1WITA 2CJUH 4HWZB 4JR9L 5LGHL 3ISWA 1B9ZA 5CIPH 2JF1A 1P4LA 2VLME 2APBA 3VXTB 4GMSL 5I1CH 4MAYD 3MUHL 3UTPE 1S9KC 3Q3GB 4MA3B 5C0CA 5E08H 15C8L 2I07A 3ZDXE 3J8F7 1CGSL 2FRGP 3E6FA 1OGAA 1UEYA 4KQ3L 3LOWA 2DMCA 4KHXL 1R3JA 2IMMA 1PLGH 4QOKA 1OTSC 4JAMA 5KS9A 4GBXA 4IOSD 1DR9A 2Z8RA 3TT1H 4ZO9A 2D9QB 4IDJH 3W5MA 2YPKB 3NGBB 5I1HL 5H35A 4G9DA 4OF3A 1CDBA 1EJOH 2WUBL 2JELL 4TSBL 3EO0A 5E5RB 3T0EE 2FDBP 2X2YA 3BZEB 2NW3B 5K9KB 5DMKA 2HFEA 5MERB 2ZPKH 1ZWIB 1DSFH 1TXKA 1SYSB 1IGFH 1MVFA 4KY1H 1ZV5A 4PV8B 4UT7H 3IFPB 4X8XA 3WDJA 4AQOA 3PGDA 2FBOJ 4FQ1L 4HUVB 3M17B 4I77H 2FHFA 4G3YL 5L2KD 3VFRA 3T1WA 2ZUSA 4PJXE 3MOBH 3ULUL 3FFCE 3QQ9D 4KK5D 1NC4B 1F6AB 1YY9D 4JZOA 1FORL 1EZVX 7FABL 2W60B 1TLKA 1VEMA 4WHDA 1OY3B 3E6HB 3BSZL 2P43B 2FJGA 1PSKH 5DS8B 1O7SA 4NQEB 2XRAL 1S7XB 4RAUA 3GMNA 1RUAH 4F8QA 3HS0B 3TNNA 4ZMAT 1RSFA 4YDLC 3WEXA 2XFXA 2CRIA 5JDJA 2F58H 2EDYA 3FB7B 2Q8AH 1Z9OA 3BEWB 4XVUC 4HC1A 1YEFL 4JPKH 4X9IA 5CD3A 1UXSA 3IXTA 3QAZC 3TBTA 3MGTB 3W39B 4QY8B 1TZGH 4CJ0A 4ENEC 1MCQA 4MHHG 3TH4T 2IG2H 4M9OA 4RISL 2BSTB 4HIXH 3NABL 3FO2B 4DWHA 3F7RA 3WO4C 4RZCB 1YMHB 4YE4H 4ONGH 3EYUL 4QEGA 4JY6A 3FL7A 4KKLC 4YGVA 3L3KB 3LB6D 2X6MA 1S7UB 4XCYB 5KSBF 3CFKB 3MRQA 5HGDB 5CMAB 5CJOL 4HS8H 3VRJB 4P4RA 3D39E 5CSZB 3TPUB 4A6YH 1W72B 1MQKL 3EGSB 1AD0B 3L3OA 3S36H 4BSVB 4NRYB 3M17A 1Q8MA 1CR9L 1KCUL 2J5LB 2YKLL 4LMQE 1I8MA 3BUYB 5E00B 3O9WB 6FABL 2YEZB 5DQJB 1IKNC 4JFEE 2VAAA 1OF2B 1F00I 3I3BA 5JO5B 1Z3GH 4Z77B 1RZFL 4RQQA 5CLWA 1DUYB 3RTQD 4AT6B 1JGVL 4XNQB 3KXFA 3VFPA 5JW5A 5T33L 2NZ9C 4B41A 5KANG 3LD8B 4DKEH 1QHPA 4PJ8B 5K9OB 3WNLA 5GS2D 1NCCL 1U0QA 3UTTB 5KW9H 2GTWB 1Y6MR 3MRPB 4FXGA 1ZT4B 3Q6FA 5EO1B 4OZGF 5T1DH 4ZO6A 1OVZA 1SY6A 5E4IA 3ZYOA 3FB6A 2QQKL 5C0CD 4O2FB 5FUZL 1IE5A 5JOEA 4JPIB 1QSFB 35C8H 1AE6H 1OGAD 4XVTH 3EFDL 4LQFL 2BVOA 3BPNB 4LASL 1T5XA 2CXGA 1ZT1B 2BSSB 2W07A 3MRFB 4PJ9C 3GJFB 4DQOL 4M5YH 1PDKA 2OMBA 3KPSD 2W0FB 2XWJB 2GEEA 3AREA 1FG9C 2WIMA 2A0LD 2QTEA 4L4JA 2YOCA 1MCCA 1M71A 4HK0B 4JRXE 4HSQA 3TT3H 4KPHL 4GAFB 3C2AL 3BD5A 5EBMA 3T77A 5IESH 4OZFH 3CMOH 3BIBX 4DW2L 3SGEI 1T66C 5A2FA 4QYOB 3GSNB 4JZNA 5E70A 5T1KA 5JQHC 2VR4A 4P48A 2WQ8A 1QSEA 3STLB 1BMGA 2CPCA 2AEPL 4NKMB 2PUQT 5LAXB 4KTYA 1CG9B 4XI5D 3GNML 4YDJB 2AK1L 2X4TB 1R3HA 1AXSB 4LSSH 4Y88A 3SGJC 2PYED 3VFNB 2P1YA 1WAAA 3C60C 1JWUA 2DBLL 1D5IH 1GRWA 4ORZC 4YR6B 2DKUA 2EH8L 2ZSVB 5GJTL 4Z9KB 1YUHA 1FNEA 5B22A 5CILL 1Y6NR 4XMPH 5J89A 1NAKH 5DK2A 1LO2L 1NGZB 2NY7H 1P6AB 3HMWL 3QI9B 3ZYJA 3GK8L 3RWEA 3QNYA 4PR5A 2GTWA 5GGUA 3INUH 2H3NA 3SKJL 1ZA3B 4LLWB 1YEKL 2V5YA 3MA7A 2AJZA 2ED9A 1U3HC 5GGVL 4M6AA 3B9VA 5JHDA 1PEZA 4N0YH 1T5WA 2WQRA 2FIRT 12E8L 1AHWA 3BP6A 2WMPA 5EWIH 1MHHB 4WUKH 5GISL 4NQUA 1PY9A 2AAVA 4LOUC 3RX8A 1DVFC 4PJAB 1IILE 3LEVL 1C5CH 2Z91B 5KVMC 2P5WE 1N0XL 1A4KB 5SWSB 4DVBA 1I1AA 4HLZH 4HK0A 4YDIL 4OI9A 5DQDH 4NC1E 4OCWL 1F3RB 3KPOB 4U3HA 3ZT5A 1OLZA 5H37H 3VWJB 4JO4L 1N4XL 3LS5H 3OBAA 4FQIH 5DJ2A 2BNQA 3MLXL 1T20B 1S8DB 2E9IA 2YWZA 4JFYA 4O2EA 3N85L 4HH9B 1N3NA 2LQRA 3JBG7 1JNNL 2VERN 3IS0X 2EDHA 2ZUYA 4NP4L 4OFPA 4M62H 4P3CH 4F7MB 4F3FA 4XVJL 4DK6A 2ICES 2P24A 4L8SC 4S1SH 4QF1B 5ACZB 1UACL 3PWNB 3UJTH 1S5IH 3BP7B 4HGKC 3PIQA 2HFTA 1A1OA 1X4YA 5HVHC 2DQFB 4E0RA 2OX5A 1H0DA 1KLGA 5IB4B 2OSLA 3RWDA 3S36X 4B0MM 2FX7H 1HXMB 2BDNH 2MHAB 3BGAA 5CBAA 4JFDE 4BZYA 4OTXH 4QRQB 5MEOB 1RZGB 4OBRA 4XXDA 3G6AA 1OCWL 2EC9U 2VZTA 3QFJE 1CE1L 4WO4B 5IB3B 2FBJL 3KPRA 4ZG1A 3L3IA 1DQLH 2GJ6D 2AJYH 4LLVB 1WWCA 1KIRB 4TNVK 5GIRA 5I17A 2Z35B 1OAXL 1A64A 4K8RC 3U7YL 3AY4A 4ODBD 4NJ9L 5GGSY 5I66A 3IVKB 1MRFH 3MV11 3BEVA 4WU7A 1D6EA 3S7GA 1FRGL 1K3ZA 4ODHL 3HG1A 4MNQE 2PYFB 2YMXL 3NACL 4NO2A 1F4YL 3S35X 2HT2C 2FEEI 1ZLUH 4WEMB 3WO3B 4LAJH 4PGCA 4UQ2A 4R9HA 1TZHA 2AABH 4WVRA 3X12B 5JQ6H 4LCCB 1Q9KA 3JV4A 3OTTA 3R06A 5J11B 4M7JL 2QBWA 2P5ED 3ARSA 4NN7C 5T1KD 2GSGB 5F3BB 2ATKA 1EVTC 2XXCB 3JSSA 2WK2A 5GGTA 1J0ZA 5HJ3A 1DUZB 5BQ7A 5FK9B 4G8IB 1FZJA 5GRUL 5CWSB 2RAMA 1QKZL 4BH8A 4FP8L 2A6KA 1T0NB 4JVUA 1NBYB 4G6JL 4UAOB 4F7CB 5E1AA 3JWOC 3N1MC 2Z31A 1RUQL 4Z7QF 1RJLB 3JVGC 5IB3A 3G08A 5IJVA 2F54E 3MRJA 3D0VB 4JHAH 4UT6H 3PWVA 3FB5B 1I8KA 3REWB 3OF6A 4JQXA 4LEOB 3U0WH 3D9AL 5JHDD 2DYPB 5FO9A 5SWQB 3VXSE 1ZLWK 4KUZH 3NFSH 2N56A 2EZ0D 1V05A 3AC0A 1CD9B 3LKNA 3QUXA 5FYJD 3VFTA 4LLMB 5I1DA 3ZDZE 4M1DL 4IMKA 4R2GB 5BZWA 5IEHA 4PB9H 5J9PB 4UTBH 2LTQC 4V2CB 1FZMB 2QKIB 3MV9B 1LO3L 1K5NA 5CEXA 2VDMH 5FA3A 2OBGA 4K8RH 2DM2A 4BZ1H 1EEQA 2FWOB 4I0PB 5E8OB 3E3QC 2D4DA 4YQXH 3RWGA 3UZEA 5DURB 1ZE3C 4G6AC 3CVHL 2FLRT 5E8DH 3VCLB 4PGBB 4FG6C 1ZA6B 1EO8H 1YEDB 5GS0L 1SJHA 5JZ7D 1BVZA 3K1KC 1JUFA 5HPMB 1MNUL 2G9HA 5EORH 1SBSL 3SE3A 4KXZH 5IVNA 4JY4B 1HH9B 2WIIA 4R3SA 2K9UA 4FQJL 5DDHB 1IBGL 2D7NA 5KVEL 4M5ZL 2VLKA 2YBRB 1H15A 4EI6B 4GAGL 3S34H 4L4VB 3REVA 5L6YL 2VXTL 1BQHA 3LKPA 3AFLA 2Q76A 4TUOB 1OAYL 4Q9RL 4GRWE 4XVSH 4HCRH 1JJUA 3FT2A 3HPLA 3W9EA 1LDPH 3JWOH 4KJQD 5DJXA 1J8HE 3G5YB 1I3VA 5DC4B 3MBEB 3O4OC 4Y19D 2FR4A 3C08H 2J8OA 3IDXH 1BP3B 4LPYA 1LEKA 4FQHB 2FX9L 4HJ0C 2CH8A 3OAYH 3VI3E 2QV2A 1PBYA 1N6QL 4LSTH 4WUUB 4ZNCD 2YK1H 4X5XB 4OFKA 1DANT 4MQXC 3SDCB 1GHFH 4F2MA 4JPWL 2OR8A 4KMQA 4C4KT 3GDBA 4WENB 1A1MB 2W9EL 2OR9H 4HXBH 3WSQL 5TDPA 4HQQL 2I5YL 1FPTH 1Q9WA 4LDOB 3TJEH 5TE7L 5K59F 2XTJE 4GG8B 3BZ4B 3Q5OA 5E6ID 3GGWB 4UV7L 3FT3A 3ARFB 5MEPB 1N26A 4HX1B 5F9AC 1OTUD 1YN7A 5FYKD 1OQXA 1SBBA 5MP6L 2ZOKB 1UXWB 4FQXD 5JA9A 5E9DA 2P49B 4OLZH 4ONFL 5FECA 4XPTH 1BIHA 5E6ZA 1F11A 1K8DA 3V6OE 3B9AA 1CZ8H 3BPCA 4ZS7L 5ICZB 2C3HA 1HWHB 3S5LG 3P9LA 2DQUH 1T2JA 2Y6SD 1C7TA 1HXYB 1WFOA 1KTLB 3KNBA 4XP9L 1F2XK 1N5AA 4PJGB 5MENA 3M45A 3V6FA 2VLRA 3QXWA 4U33A 5L88L 4OV5A 4DKAA 1E6JL 1BX2A 3QQ9C 1YEJH 4KK5C 4WDIA 4LSPL 4NKIH 5INCA 5GGSA 3GSVA 1KJVB 3K2MC 5DQ9A 1D7FA 2BERA 4J3SA 4BQ6A 1N5YL 3QUXD 1CGTA 4KZEH 3GSXA 1YEEH 4TN9A 3FQUB 2APXA 1F45A 4MB5A 4MDIA 2VXQH 3AB0C 1R3LA 1EBPA 3ORJA 1MCWW 2AK4D 5A16A 4IMLB 4OD3H 5D1QA 3MNWA 1V3KA 1INQA 3KWWA 3QXDB 2ICWI 3GMRB 4TPRL 2PW2A 3T0XA 4XZUB 1LO0L 1KG0B 1LK2B 3O6FA 1XR8A 4P5TC 5BRZA 4NZRH 4GQPH 1GGBL 4BFIA 4IRSA 3HE6B 5DWUL 5KN5B 1CT8A 1DQJA 5EFIA 1PY4A 2DLEA 2VOTA 5IT2H 4A2MA 1VPOL 5JORA 4AL8L 1L0QA 1UCBH 3EOAA 1ES0B 3BKYH 4XNMA 2VXSL 3S88H 1D5BA 3WNOA 2VLKD 1U8JA 1UFUA 3S4SA 1LEIB 1A7QL 3DVNB 3KPPB 4WTZG 5DMGC 3WN5B 5GJSH 1FVDB 2IANE 2XA3A 5JPNA 2VN7A 4RMTA 3VWKC 3WFHB 3D1MC 5CJQL 2BSRB 5CZVL 2OTUA 2Y72A 5T3XL 2CLRB 5EPMB 1S7RB 4PJAF 4HHAA 1MRCL 2YPVH 3TGXA 1QO3A 2C3VB 1EH9A 3KPTA 3X3GH 3BKJH 5T3ZE 3FT4A 1TETL 2A6JB 1G6RA 2XYCA 2JJTC 1EHNA 3P4OB 1U93B 1B0RA 1EGJH 3O3AA 4ZNEE 4FQCL 2PO6D 4G6ML 3U6RA 2IH1B 1WIPA 2VO5A 4LFHD 1FGNL 1XMWA 1FYTB 5E6YA 4OM0H 2QR0A 3IJSB 3DRTA 3W9DB 5F7DA 1OAQL 3F8UB 3TO4D 1CD1A 2MPAH 5HI3D 2IBZY 4YXHL 4DZBA 2DQGL 1KIPA 5I74C 5JOPE 1JF6A 5FKAB 1FG2B 2XQBH 3QHTC 1MWAH 3C6LD 5KVFH 1ZGLA 4GBXC 2J8UE 3WN5A 3P0VH 1Y0LA 5E9DD 3OKDB 5CJ5A 4NZTH 4NQVB 4P3WA 4FZEL 3RFZC 2C9AA 5I8CB 4Q97A 1C5BL 4YX2L 1NCDH 5I1KH 1A8JH 2FZ3A 4JRYB 4TYUA 3SKMB 3PQYA 5BJTA 2AJSH 1YDPA 4XMLL 4KJPD 2A9NL 5MEND 1CFSA 3SE8L 3LN9A 4EN3B 3FRUB 2VLRD 4XNYL 2V2TA 3HNTH 2VDQL 1I3UA 2ESVE 4PGDB 4MAYB 4HUXB 4OZHE 1YECH 1MFCH 4L3EA 2Y5TA 1FFNB 1MCNA 4JKWA 3SDYL 4HIHA 2DTML 5ALBH 5JUEL 2HVKB 4RA0C 4U7SA 1XF4B 1S7SA 3DYMA 4WFEE 2GUOB 3TZVA 3NOIA 4LPTA 1K2DB 3L3GA 2DTSA 4NN6B 4K7PL 1KT2A 1RAMA 1CFNB 3TBSA 1KCRH 1P84J 1SJEB 1WBYB 2ZCKL 5FOBB 2HG5B 4JHBA 4M1CD 3DBXB 3V4PH 3LDBB 5GS2H 4BJLA 5EUOB 1MUJA 1RK0A 5BRZD 3QRGH 4WFHD 1XGPB 1ZS8B 1WZLA 5FFLA 2GITB 5L2KB 4KDTA 4NNPL 3MRIA 4I1NB 2J4WH 4OLEA 4ZS6D 3MJ8A 3I6KA 5ANME 4CRPA 2ADFL 3GBNH 5T5FL 3F12A 1TQCC 3CSYA 4HUNB 1NCTA 3OKEA 3LN4B 3WKMH 4Z7NF 3PWLA 4DCQA 4WHTA 2O5ZL 5TQ0L 4PP2A 4RFNB 2A6IA 4RGNB 1NL0L 1A7PH 3CU7A 3WUWA 1UQSB 5FUOL 3BQUB 5TGBB 5EO9B 4O2CA 5F7HA 1VFMA 5EU7C 3I02B 4PUBH 4PGDA 1EDQA 5E94B 4G8FA 2UWEA 1DEEB 5IQ9A 1T21A 4XP1H 4M7LT 1YPZB 4JRXD 3QH3B 1BLNB 3CH8A 3F7PC 5B38A 4XCCH 4WW2B 4L8CB 4WV1B 3EFFA 3EOTL 5IMMB 5JOFA 4FNLH 2FJHB 1OW0A 3DUUA 2EDDA 4Q6YA 2R1YB 2Z92B 2HG5A 2UUDK 4AIZA 1CD0A 4RNRB 1IAII 4OGXL 4HKXB 4FTVD 3EJYD 5C0EA 4YNYB 3NTCL 1U92A 2H32A 1NLBH 1FZOB 3GZKA 1WTLA 4EVNB 1ZHBB 2KPNA 1AD9B 4WU5B 4JHZA 1URLA 3G5XA 4OKDA 5FDWB 1NPUA 3C8DA 1A21A 3QIBA 1F97A 1T6VN 4ORGB 5E8NB 1K8IA 3KPLB 4EUPG 4HC1H 4AENA 3L5XH 4LEXH 1HQRB 2BVTA 1FDLL 3GEWB 3UTSA 1RZ7L 4DAGH 3D18A 1B4JH 1WUNT 1CBVL 1A9EB 4OGYH 2VN4A 5IG7A 2R2BB 4ZFOL 1P2CB 3UBXI 3D0LA 3ULUF 3CVHB 3I50H 3RTQB 5C0ND 2EDFA 1OSZB 1JIBA 3AREC 3CDCA 3DX8A 5TDNB 2X4QB 4POUB 1I7TB 1UQSA 4ZTOH 5I0ZA 2O5YL 4TQEL 4OF8A 1J87A 4XHJD 4MD0A 5GRVK 2IQAB 5IB2B 4OLVH 4I8DA 4OGAD 4Z0BL 3CLFH 1IC1A 4X0KB 3UO1H 1CDGA 4OZGE 3PQYD 5GSRB 2X9XA 3PABB 5HI4C 3TBWA 1LO5A 3X3FL 5JTWA 1Z5LA 4XNXH 5FV2A 1T1YA 5HGAB 4JFFE 1VSCA 3JUZA 3T4AA 1WZ1H 4L3ED 4NZUL 3IGAB 1F8TH 2E7BA 5F89A 3SQOH 4GW5B 3K74B 3L7EA 1TITA 4QCIA 4I2XA 2IADA 4MJIE 5ESQB 4XAKE 3UROR 4YNYA 3TZVD 5DFTA 1MHPL 5IHLB 1HHIB 3I2CL 2DICA 4AH2B 2JLLA 1F4AA 2VNCA 2LVCA 4GKNB 1G7IB 3KPSB 3CSPA 5IBLD 4X98B 4GS7C 2VL5B 3U7WL 1LNUA 4LPWA 4B5EA 1A9BB 3OX8A 4Q0XH 1IEAB 3BGMB 2EZ0C 4NRZA 3HFMH 1QFWM 1CLZH 3NIDE 3MQIA 1LE9B 5CP7A 5E56A 2UZIH 5EG6C 3SJVB 4Z8FL 1WIUA 1SY6H 2NTSP 2AQ3A 3TWCH 4FQLH 1U2CA 2E3VA 4UDTB 3V7MA 4QKXB 2UVEA 5DO2D 1RZJC 4WNQA 5J13C 1IM9A 5IR1A 2H9GB 2YN5A 4PJGF 1I1AC 1XT5A 1XIWD 2PYEB 5EOTA 2OZ4A 1FAIH 5IB2A 4HBCL 4F8TA 4IIQB 1IC7H 1KJ2L 1AGBA 1P9MC 1WCQA 3EIFA 1WC7B 4HFUH 2DJUA 4JQIH 3QJFB 4OJFH 1JGUL 4P9ML 5EU4A 2R4SL 1T7WA 4KUCD 5IBTH 4XPHL 2VDPH 2WBJB 5DK0A 3B9EA 3OKMB 3HR5B 3RRQA 5DMIH 1DQML 3O2WH 1X7QA 5T1LA 1VFOA 3QEHB 4EDWH 5JZ7C 4XBPA 3U30C 3IU4L 4K3JL 4CVZA 2MFNA 1KBGH 3B2VL 5IIEB 3WNNA 3KDMA 2H1PL 2BNRE 4PRAA 4KI5F 2GCYB 3SQBA 1U3ZA 3SBWA 1A7RH 3G5VB 1GPOH 2VLJA 4NYLB 1I3GH 1N2RB 1SYVB 2HKHL 4UU9B 4Z7VE 3PJSB 3OSKA 4L1DA 3LQAL 3IDYB 3X17A 5LXGH 1S78C 4G8GB 2RCSH 2VL5A 1ZSDA 4R97C 2ADJB 4KJQC 5J7CC 2MQCA 1HYSD 5D1XD 1IKFH 1P1ZA 3RVUD 5EU6D 1NLDH 5ICXA 2VDNL 4H0GA 4NRXA 5E2UL 3SDXE 4AEHH 4NUGL 4XRCA 1LO4H 1PYWA 5SX5H 3V7AE 1LP9A 5CJXA 1Q0XH 1T2XA 3QIBD 2O5XL 4HMDA 3QJHA 3GMLB 2NXZC 5E95B 3D2UD 2HT3C 1JNLL 2IJ0C 3TV3H 1BGXL 3VRLE 2Y06L 3WJJA 4YFLI 1ZHKA 5FYJH 1U8MB 1AKJB 3AY4C 3O2VL 2BZDA 4GW1A 2GJZB 1EHLL 3LKRB 1TDQA 2D03H 2JK5B 3C5ZA 3ECBA 4NBZB 1I1YB 4PJDA 3T3PF 1RZJH 2OS7A 4JG1H 5D7SL 1ZGLP 2VTFA 3O4LB 5JR1L 1RUMH 1INDL 2P4AB 5F96H 4BH7B 4DGVH 4E42A 1A6VL 4X4YA 4WTXA 1RULL 5LWYL 1F3DH 1NSNH 4I3SH 4URTB 4WJ5B 4PRHA 1KPUB 3W5NA 3U79A 1XF1A 1AI1L 2EDXA 3U0TB 3T8XA 3QIWA 1VGEH 3O3BB 5IEKA 2GJ6B 5CEYA 1ZT7A 3V5DB 1MI5A 4QNPF 1IGMH 2HWZL 3RAJH 4UU9A 3G9AB 3PDDA 4LP5A 1BD2A 3FKUS 5DR5H 3DSFL 3C2SA 4DOHE 2GK2A 1Y18A 4U1KB 4LGSB 2BOBA 3MLRH 4OLUH 1JPFA 2Z31C 5FCUL 4PJ5E 1NMBH 2NLJA 5CINH 2DWDB 5J57B 4JM2A 2V6HA 4PG9B 4WWKA 2HLFD 4RBPK 3OXSA 3S3JA 5AG8A 5LG1A 4ZOBA 5F8RC 2DKSA 3HE7D 4GKZA 4NJAH 1A4JB 2DQCL 4FXKB 4JQXC 3GMLA 3LKOB 1JGLH 2X4NB 1QRND 5GRJL 4P5KA 5IK3A 3EJZD 1JHKL 2CSPA 2V2WB 3HUJE 3QUXC 4X4ME 3CPLB 1K6QL 3GMMB 4OCSL 2QJDA 1IQDA 4D3CL 1FL5B 2P5EB 3B5HA 3TCXA 2VDKL 4IMKC 5AEAA 3OJDA 1VKXB 2XN9B 2FL5A 1D3CA 5D8JL 3GSQB 5F7NC 5FO8B 1GVIA 4DGYH 5ID1A 2N7BA 5DRXB 3MTRA 3S5LA 1FQ9C 1J1PH 4YC2B 4P46A 5HHOA 2GTZB 4MXQD 1FL3B 3BD3A 5I2IA 5L7XL 1ZAGA 4KZDH 1AY1L 5IOPB 5TH2B 1XZ0B 5EC2A 3SO3B 5EO0B 4D9LL 5D70H 5F8QC 1XGRA 3ES6A 5ENWB 4PGEA 1T0MA 1GGYA 4M4RA 4U6TA 3ARDD 4OT1L 1T22B 4Q2ZA 1EIBA 3TVMD 1AO7A 1FL6A 2G60L 4IEFB 3CK0L 5FYKH 2ARJQ 3O6ML 5ECJE 3B6SA 4PJ7E 2X10A 5HBBA 3MRKB 5FKPB 5GGTH 4PBWD 5JXEA 1HIML 3QDMA 4OLWH 5D7LA 3TYGH 1NBZA 2K1MA 3IRPX 4G43B 4OFYA 2R0ZL 2NW2A 5IB1A 1PZ5B 5EUOF 2WINA 5L2JB 5LGKA 4PRDB 1E28A 3ARGA 4MDJB 1CGYA 2ATPA 1WJ3A 4KVNL 1IL1A 1UM4L 2RHEA 3W0WA 4D0CB 4JFZH 1KN2H 4XGZB 4FFWC 2A73A 4LVHC 1ACZA 1QLRB 1QZ1A 4HWBL 3L1OL 4F7PA 3CPLA 5D2NB 4P2CG 4JVPA 4X6DA 5C2BH 3GSUB 3LCYA 3MRLA 5A3IC 3MJ7A 1J10A 4YHKL 3AXLA 4FXLA 1CL7H 3RL1A 2AXFB 3LRGA 1OAUL 1AQDB 3KYMA 3L95B 4P0DA 4U1SB 4ETYA 2AJXL 4OF7A 4J23A 1P4IH 4S11A 5J1AA 5IFAH 4WTZA 4NFCA 3DXAA 3C5ZD 4LGRB 1KCKA 5I19L 3O3UN 1YPZF 4FFZH 4LP4A 5HI3C 2YPLE 3EYVA 3MBXL 3WHXA 4ZSOA 1QVOA 4WW2F 4Z95H 3MO1B 1F90L 4PY7A 1FHGA 1I85A 4QWWD 3JV5A 4MLIA 4PRHD 4AEIL 3TIEB 3K8LA 3DV4B 3MJGX 1RURL 4GW4B 2XA8H 4Y19B 3QIWD 1MI5D 3KLAB 3QP3A 3MRDB 5D7JD 4G8EB 2YD6A 1NQBA 1IZKA 3BX7C 3FTGA 4F7TA 2FECI 1DLHA 1MJJA 2BX5A 3RVVD 3C8KB 5K59E 4M7LH 3VW3H 2AVGA 4WWKD 4XMKH 1QLRA 2NY5L 4QRSA 5IMLB 2HMIC 1ZHNB 5EIIA 2KDGA 3ULVD 5IQ7H 2J6EL 3SCMA 3VFOB 1FJ1B 4NFBA 3QUMA 2V7HA 5E6IB 4J7RA 3WUZA 1DDHB 3FFDA 1VB9A 2YRLA 1X4XA 5GS1A 1KTRL 2X1PA 1JZ7A 1HSAA 4NO0A 1IGCL 4W81A 4LSUL 3T1FB 3TA3A 4BUGA 4JGJA 4WI6A 4YK4C 5L0QC 4G9FA 5D7KD 4J6RH 4XAWH 4HZAA 1RIVL 4NCC1 3SY0A 4FQXB 5HTSA 1FP5A 1GC1C 2VDLL 4PJHA 1T1WA 4TSAL 1SEQH 5KTEH 4FN0A 3QUZA 3DX9A 2X1QA 2XY2A 1EXUB 4M1CC 5D1QC 2MCPL 4W6XB 3MCKB 4M6ML 4P46D 4RFOH 1HKLL 1XF2B 4N0UA 2XZCH 5B39G 3O6FC 4HPYL 4YWGH 3VMOA 4IRSC 3VXUE 3CXDL 4CW1A 4U3CA 4ZFOB 2GHWB 4FFYH 1U8IA 5DD3L 3ROLB 3HI1B 3KPMA 1VACA 5E5MA 4O51A 3O8XA 5EZJB 4KRLB 5IGXH 1A6ZA 4LLUB 3ESUF 4PS4L 1C5DB 5TE6L 1I8IB 3MGOA 1AO7D 4XC3H 2FD6L 4OQ1A 5LBSL 4IM8A 4RSVA 3NH7H 4GG6B 5DI8B 4Y5XB 3OL2A 2X4SA 3IAGC 1IARB 1D5XA 4HG4K 4GO6B 4I18B 5DLMH 5JXED 2AJUL 5D7LD 3ILQC 1ETZB 2O61B 2DD8H 2ICWA 1R6VA 4D0BB 1WFUA 2AK4B 1JBJA 5K93A 2APTA 4E41A 2Y1VA 3MUGB 2Y36H 1I7UB 3VXQB 2ID5A 1U6AH 1EO5A 2YXMA 2PXYB 3D69B 3BT2H 2ZJSL 3NFNB 3QHZH 4EUPB 5IFJA 3MV8A 1AR2A 3ZHDA 3EUUA 2APFA 2Y7QA 4G80B 3GRWA 2RJMA 3U46B 3MRRB 5E8EA 4ODWA 5BVPL 1ZTXH 5DVMA 4L4TE 4ELKB 4YBQC 3EJYC 3MRHB 4G7VH 1XF2A 1D6VH 4QXTA 5C07A 3UPRB 1KLUA 3QXUA 1GC1H 4YUEH 2C4XA 4XXCA 1DN0B 1T4KA 1LMKA 4X4XB 4PJCB 2WBWB 1JMXA 5ISZA 1ULVA 5IW6A 2VISB 4JPVH 2NY3D 4PJAE 5F7MC 3RL2B 2LE9A 3I6LE 1P7KB 4PJEA 4YHLH 1HZHL 3QEUB 2XY1A 4G7YL 3RPIB 3VD5A 3L5WA 1XR9B 4LLUA 1A0QL 2G75A 2QQNL 1KJ2B 3BZFB 4R96A 4Y16D 3T0EB 3MRCB 4JFQA 4U4BA 2R0WL 2EDLA 2VZ3A 1YYLL 2VKXA 3KJ6H 3BIKB 4I18A 3UDWA 3VFSB 4S1RL 5T1MA 1I7RA 3OHXA 4YHYC 1DFBH 4XHJC 2Z4QA 4UUJB 4NKDB 5D9SA 2PO6B 3DRQB 1AXTL 4PJXB 4X8JA 4Y8DC 2DMBA 4MWFA 4NHUA 1BF2A 4YPGB 5IF0B 2YD5A 4M7ZC 3FO1A 4I9WE 4JCMA 5SWZA 4ZYKA 3LY6A 1AR1C 2XOTA 3TO4B 4J3XA 3MNVB 4LSRH 1GZPB 4NO0D 2B2XH 1F3JA 4PRIA 4XCNB 1RHHA 3BUTA 2B1AH 4KXZI 1N8ZA 4HJJL 4ZD3L 1KJ3H 3B5GA 3TZVC 2CLVB 3C6LB 4EI5A 3VD9A 5C0BA 4CL7A 4ZAKA 1MJ8H 5ESVB 1G6RH 4P2OA 2QSTA 4OIAA 3O6LL 5IBLC 4DFIA 1ITCA 3BISA 3MXWH 3QUZD 3UX9B 3H9HB 2DF3A 3TM6A 4NC2B 3CAFA 5ADOH 3V4VH 4LVNB 3KGRA 1DBBH 1I9JL 4ZPVB 1PG7L 3GSRA 3P11H 2JB5H 4PLKD 2Q8BL 4MCZA 4W68A 3MXVH 5AD0A 2C1OA 2R2HB 1JWSA 3MRMA 5DHYA 4ZTPL 4F58H 4K55A 4R4FH 4U1HA 2EDTA 4KDTC 4J1UA 3QWRD 4LBEB 4IOIB 3PWPE 5EC1B 3RGHA 3ZKMC 4O9HH 3RWCA 2C1PA 4M7KH 2I9LB 3LKSB 4N9GB 4BZ2L 3LMJL 3DRQA 1M4KA 3FFCA 2D31A 3FN3A 5C09A 3BWAA 5JLZB 2YXFA 2IPTL 4JFEB 1KOAA 2E7HA 4CN4A 4JN1L 1WWBX 4TVSa 4PTTB 4LU5H 5E99L 2IGFH 4FFVD 5LQBH 3TFKD 3SGDH 4RWYL 5JW3H 3STZB 1E4XL 2P45B 1EX0A 3VXNB 4M6NL 3TNMA 1MHCA 1JPTH 3S8WA 4DN4L 4OIIL 3GIZH 5IMKA 1JCKA 1KC5L 2CKNA 2ZG1A 1LK3L 4Z7NE 2X09A 2Z9TA 1OW0C 2FH6A 1HI6B 1OAZL 5C0DA 3PP3H 3QXAB 1MFBH 4LPXA 4HS6B 4KTDH 2E5EA 2AGJL 4NKOA 1HYSC 2P8MA 4M1GL 3RI5F 3RVUC 3VXRE 3WL9A 4HT1H 1TNNA 1S7WA 1BFVL 4UTAH 3NAAL 3DROA 3HC0B 3QIBC 4MJID 3RIFF 1CE6A 1DBAL 3D39A 4D94A 1JRHH 3VH8A 4QLRA 4XPGH 1BWWA 3RVXD 1JPST 5I18H 1S9VA 5H94A 2Z8SA 5I8EA 1F4XH 3QUYD 4JRXB 1FV1A 2J88H 2FEDD 1E6OL 2FEEL 5C6TL 5CFHA 3MOQA 4DGIL 4HUMB 4IRJA 1RZKL 1FH5L 4F15B 1ZLWH 3V0VB 4XCFL 1QHOA 2DQHL 3DARA 4QRPA 2R2EA 1D5ZB 1Q9OB 4HH8A 4LL9A 3H7BB 5DUPL 2E6PA 5J3HC 1M6OA 1R5IB 4FTVB 1JTOA 3QDGE 3IAQA 2AS5M 4Y1AE 5GGRB 2PTVA 2DQIL 3VXNA 1S7VA 4TULL 1G0DA 1KCVL 4JO3L 5I1GH 4F7EB 1ZKAA 4L4VE 3OAUL 4XWOD 2LU4A 1NGPL 1NMCC 3FQWB 4TRPH 2EDJA 3ZT6A 3PHOB 3MLUH 5DJDA 5T3ZL 1GIGL 4GRLA 3K4AA 5E2TL 3BP4A 3GBLA 2F53D 3ZKXB 1V3JA 5ADPL 2JCCA 5EA0L 5T5NF 5GQBA 1NCUA 1AQKH 2R1WB 1PX4A 4EI5D 3B3IB 5C0BD 3IDNA 4P2OD 3BMVA 5HYQB 1QQDB 4NQCD 1MCPL 4APQA 4Q9QH 1G7QA 3NZ8B 1QA9A 1IEBA 5JNYB 4P59H 1OM3H 1J05B 3V6ZA 5INDB 4ZFZB 1C12B 5AG9A 3CFEB 4FQQA 1Q94A 5I71B 5IVZA 2IMNA 2H32H 4ZOAA 4JFPA 5ID0A 2P5WB 5F9DC 1YYMH 4UDUA 4KJYA 2ZG2A 4WUUE 4X6CE 5ALCL 4RFEA 1S7QA 3GIVA 5GZOD 5K9JH 3SPVA 1MREL 5EZIH 3VFUB 4XBEL 2H26A 2CIIA 1FSKB 1S7TA 2Z0BA 1Z9MA 1T1XB 4PJFA 3AMKA 2A2QT 3ARBD 4MX7B 1QBLH 4P2QE 1X3DA 4MJ6A 1BVKB 1NFDA 5I8OL 1LQSR 3RIAF 5DJCA 3FONA 4LNRA 5HDOA 3V9FA 1O5DT 3BKML 2I60H 1NUDA 4ZXBD 5I73C 4LCWA 2HRLA 5C09D 3OXRA 2NY6C 1WWAX 1XCQA 4Y4HA 4BFEA 1X5ZA 1S5HA 2DQTH 3D3VE 4HGWB 5TF1L 3PP4H 2NY1D 3V2AR 4ZDHA 4NQSA 2Q3AA 2LFGA 2NTFB 3MA9H 1QSVA 2RIKA 1KN4L 3HZYA 3PV6B 2B20A 1J11A 3PHOA 2Z93B 3GMQB 2A6DB 2OM5A 1IAOA 3PHSA 5HHNA 5A2KH 1EAPA 4KK6C 3C6SB 3SBWC 3F5WA 3K4DA 4JFDB 1V3LA 3QBTB 5FGBA 3CZFB 4PJGE 3IDIB 2A77H 4ODVL 4AIXA 4X6BA 1BOYA 5GSVB 1J5OL 2IH3A 5F7LB 2F74A 1J1XL 5BMFH 1XIWB 1CGVA 4LCYB 3LN5B 2HTKC 1FVEB 5F88A 3LV3A 3DGCR 5DZOA 4OB5H 3FB8A 4YHPA 5C8JB 3HC3H 1H3GA 4H5SB 3I6GB 5CJXC 3V5HB 4DUVA 1CDCA 3HI5L 2VE6A 2IAMB 1F5WA 3QO0B 4OD1L 2CRYA 1N64H 2MJWA 1UJ3B 2LVEA 3TH2T 5GXBB 1FAKT 2NY2D 5FV1L 4HKJB 5I30H 4GG6F 3FOMB 3GMPB 4MNQB 3WJJC 5M95B 3VXMD 3CD4A 3H42L 3MLTA 1A14H 4GMTH 4M43L 2R29L 5HHQB 3C5ZC 1BM3L 1DANU 3MACL 2PETA 1FE8L 1MAMH 4KVCH 5CP3A 3WDHA 4GXVL 4P2YA 1YNTA 3M07A 1OARL 5C0AA 5GRVL 3CFCL 2OZ4H 3H9SD 4QRPD 4ELMA 4WFGD 4NM8H 2CQVA 4EJ1C 5CCKL 5I16B 3OKOA 5FUCC 3DX6B 4M4PA 4YEFA 3CCHA 5DYOB 1CF8H 1D5MB 3ZTNL 1EMTH 4HIEA 5D1XB 5EU6B 4LIQL 1CDUA 2YA1A 4K94L 3QIWC 4JO1H 3QFDA 4FZ8L 3DV6B 5I8KL 3O3EB 3F7YA 1A3RH 1MFDH 2C3XA 3BVNB 2VDOL 4U6VL 4MXWL 3RA7H 25C8L 1MFAL 3D2UB 1GZQB 4TOYH 4PJBE 3QFJA 1AIFB 4JJ5A 3C9NB 1KNOB 3ZDXF 4GRLD 4LVOB 1GOHA 4ZPTA 1UYWL 3GSOB 1RIHH 3ABZA 4PJCF 3RVVC 1XGYL 3BN9C 4ERSL 1Q0YL 2WW8A 1UM5H 3MV7D 4U1JB 4JM2C 3VXSB 3E3QE 3ZMRA 4WWKC 1JFQL 5DJ8B 3CUPA 3A6CH 1ONQB 4X6FB 4PLJD 3ULVC 1YQVH 3I6GA 4A2LA 3AGVA 1OGTA 4APQD 5IMOB 3AS1A 4XP6L 4U1LB 3NCFB 4X7CC 4KTEL 5HYSB 1IGYB 4Y4FA 5EULV 2QHLA 2V7NA 3U83A 5HDQL 2WSKA 1UB5A 3GMPA 2GT9B 3U2SA 2D7TH 3VGHA 4YXLL 4KC3B 3KJ4B 4UQ3A 2W9DL 1JE6A 4HUWB 4WRLA 3L9RA 1J12A 1FYTE 4J3VA 4N0RA 1BQSA 4XWGL 3UYRH 3I84A 4ONHB 4WEUD 4X9HA 1KELH 3MLVL 3PGFH 4CMMA 1PD6A 4PJXF 4Q9BA 3TIDB 5AZEH 5KOVC 3O0RH 1JWMA 3P4MB 5E7BA 2A1WH 4NIKB 5JPMB 3GBML 1KB5L 4NWUL 4P46C 5FYJU 1NAML 3TP4A 2KL6A 2OQJB 1LD9B 2PTUA 2EYTB 2R4RL 3AMLA 4DK3A 2EDKA 1BHGA 4LCWD 1TVBA 1KPRB 4UIMA 3UTQB 4DUXA 1IGJA 1M7DA 3U4EB 2ERJC 3Q1SL 1NC2A 4JO2H 4RIRB 4KK9D 4Z7UE 5HHPA 5BZDB 1CDYA 3OAYK 3WIHH 1B2WL 2EEAA 3FQRA 1A02N 1RJZA 3CLEH 3P4NB 4YDKH 3HE7B 3WNKA 1CU4H 3QO1A 1GJIA 2XQYK 2B4CL 2Q86A 4CMHC 3QIUD 4OQTA 5FYLD 3GHEL 1YN6A 1QRNB 1RU9L 2BJMH 2F54A 4Q7DA 3WFDL 4GRWB 5CEZH 43CAA 3D85A 2YPLD 2DJ4A 3IDGB 4JFHD 4LKCA 3HZKA 4K3EH 2GK0B 1SM3H 3CH1A 4CVWA 2VQUA 3SDAD 1TMCB 4LQ1A 1BZ9A 2N1KA 4ZUSB 4HS3B 5JXEC 2X1WL 2ADGA 4X80H 1YC8A 3G6DL 4JANA 3HZVA 4X7SH 3MJ9A 4TVPD 3TBYB 5LGJA 3LRSA 5E7FA 4FQPA 5IFHH 2NX5A 2B0SL 1A1NB 1CXKA 3DOSA 4LNVA 5D5MA 3VFMB 3T3ME 1KIQB 3ARGC 1U8HB 2AV1A 3HZMB 5B39A 4KRPB 4KHTL 3DGGB 2A9ML 2AXGA 1MIEL 3O3DA 1I1FB 5J12B 4JFXA 2ICEA 3GI9L 1RJYA 3ULVH 5DRZB 2ZCHH 5F6IB 1NFIA 4V1DE 2XIDA 4L9LC 2X1XR 2HVJA 2IBGA 3QDAA 1NCNA 4XH2B 4KKAD 1NGXA 2E8YA 1GOFA 2QHRL 4M6OL 3ARDB 5FB8B 3HHRB 4EIZC 3V7AG 3TVMB 1ZVHA 3KS0J 3RKDD 1OAKL 4MD5A 1QYGL 4YEEA 5LCVL 3B9KA 1JHLL 1CLYL 2DWEA 2NY4D 4PRNB 3V95A 4GJTB 3CX5J 5HY9B 5C0AD 1T6WA 5D96C 4EDXB 1P4BL 5A2IH 1WISA 5FO7B 3P4NA 4DKFH 2JJWA 1LEGB 2HH0L 1BZ7A 32C2A 4UT9L 1I85C 1MY7A 4NC0B 5JA8B 3KYOA 2QSCL 5EN2B 2ORBH 4LF3B 1G84A 4L1HA 2QQLL 3ZE2E 5HHXH 1J8HA 4JKPL 5GHWL 4AEEA 4NQDA 3D87B 4HKZA 4MA1C 3O41B 3WFCL 4BK4A 4MSWA 5FYKU 1ZLVK 2NY0B 1QOKA 5DT1H 4UBDD 1GGCH 3H3PH 4OCXL 1X9QA 3SCMC 1H8OA 5TFSH 3JTTB 5B8CB 3O45B 5GS1C 4XH2A 1BOGA 1N59B 4JZJA 1U8KB 1NGQH 4N1EA 3TA3C 4RGOL 5F7EH 5DVKA 4BQBA 4WEBL 3G5ZA 3DVGB 1PG7X 5HGHB 1BQLH 5CUSH 3SEPA 4PFEA 2FO1A 2AJVL 1HNGA 2BCKB 3OKLA 1PKQE 3R1GH 3QUZC 1UA6H 4MQ7B 4U1GB 5D7JB 5HYJA 3EYFB 4NWTL 2GW5A 1YNLH 1A7NH 5FO7A 1OTSD 2GSIB 4WW1A 5DD5L 4KDWA 4ZQKB 1T7XA 1MAKA 1Q72H 4PLKC 4PJIE 1KCSH 3VA6A 2W65B 3FQTA 1JPSH 2L4OA 1K4CB 5AWNH 3RGVA 3X14A 4QHMB 3GO1L 4WY7L 2HKFH 4YZFE 4HBQA 3MROB 4H8WL 2UUDH 3O8XC 1N7MH 4HIJA 5KG9A 4XC1H 2DL9A 2CGRH 1IT9H 4FHBD 2IANB 5ESAB 3G04B 3P0YH 4OI8A 2BRRL 4AEFA 4M03A 5HDLA 3IETA 4HPOH 4NKQB 4JDTH 4OLXL 4Y2DA 2BFVH 4H0HB 2BOCB 1U8OB 1JYXA 1OP3H 3AROA 4MB3A 3DMMA 5IM7B 1IGTB 3IU3B 3WLWC 1G6VK 1INEH 1X44A 4QRRA 2OLDA 4YHNA 4FFVC 3R0MA 3TO2B 3HTLX 1OQOA 5H2BA 2X89A 4FABL 1XGUA 2F8OA 4GSDL 5C0CE 4ZUWB 2OK0H 4U1IB 3P73B 4GKOA 4P4KA 1N6UA 3QCVL 1OGAE 5MHSD 1GAFH 2AJ3A 4BSWB 1IAIL 3QUMH 1U36A 5D93C 3EZJB 1NUGA 1G7HA 4YHMH 5DVNA 1Z0MA 4NSKA 3KPSE 4N0CD 1TVHA 5FM5O 3LSOA 2J12B 1H5BA 4YDVA 1HCVA 3MC0A 2X7LB 3EOBA 1MCKA 3MYJA 2YD3A 4PTUA 4YBHA 4QHUB 2KUTA 5SV4A 4LCIH 1HE7A 4ZQKA 1I4FA 3CFDB 4G42B 1IM3A 3EO1B 4OAWA 1EPFA 4XXCC 3ZSSA 3QWOB 1WBZA 4UILH 4H1LG 3HAEA 2B5IB 2OJZL 3QG7L 3V0AC 2FO4B 3HRZB 2VXUL 2MSPA 3IJHB 4IJ3C 1KIUA 1TIUA 2I9TB 3GI8L 3RVXC 1J1OL 3CX5K 4WCYL 3NCYP 1TPXB 2EXYC 4YBLB 3ZT7A 3QUKB 2P8LA 3WIIL 2FEDC 4LAQL 4P99A 3BXNA 5AZ2L 3QCTH 4Z18A 2A83B 5DJZB 5EU3B 1MLBA 3SDDB 4TNWF 3MODH 3D25A 1I9IL 3HCVB 4NQDD 1NDMB 3DURB 1E0OB 4KRMB 3UTZA 2ESVB 5F7FA 4OM1H 3BH9A 1FLRH 2NXYB 3DIFA 3P77B 1W0VA 2B1HH 3GKWL 4OZHB 1XAUA 2HJLA 5JMOC 4KUCF 1BJ1J 4PPTA 5EBWB 3QNXA 5F9JB 1OSPL 1CK0H 3MLZH 1UM6L 3KR3H 4ZNEA 1T89A 4R26H 1QR1A 1MCOL 5C6WH 1UVQA 1UWXH 3OGOE 2D7PA 3SOBL 2VSDA 2DLFL 3SKNA 3LQZA 2DIBA 3Q5TA 1JZ4A 1VADA 2NY3B 3VD7A 1UC6A 4O4YH 2P42B 4MZ3A 4ZUTA 5C0FB 3T09A 1HHGB 2GKIA 4Y16B 4EI5C 4ZAKC 5F9OH 4P2OC 4O5LL 3FO9A 3NN8B 1NGWB 3GRWH 4BFBD 4CNIB 3LIZL 4K3DL 4WI8A 4OKVA 5HYJD 5E2WH 4AQ1B 5FYLL 1A7OL 2AEIT 2G2RB 1V7NL 1KXTB 2FX8H 1TJGL 2J8UA 2X4RA 3VFVB 4H25A 2CDGA 2V17H 4GOSA 1YEGH 1NGYA 4HWEL 4R4BB 4GAYA 3CC5A 3WXVH 4AMKL 1UJTA 1F58L 5CAYB 1KEGL 4U1NB 2EDOA 2X4UB 4OFIA 2DM3A 1FNSL 1CL7I 5KSUB 3P9MB 4LPCA 3ME0A 2CJUL 2JIXB 2FGWH 4PRPA 1ZVYA 5CZXD 3RU8H 3ZDZF 4Y2DD 4ZO8A 5I1CL 1KEMH 4P57B 3TBVA 3DUHA 5E08L 5FF6A 2NY1C 3S3SA 4Z78B 3C60D 4M93C 2JKXA 1FYHB 2X4PB 3QA3B 4LKXB 4QRRD 5KSAA 4Q6IB 4P49A 3OR7B 4MAUH 4L8BB 3VG9B 1AC6A 4NN5C 3PV7A 1PLGL 2ITCB 2ZOLA 1X5AA 4U05A 5F1IB 3QZWB 4ZOEA 3TT1L 1HHGA 1NCWH 2BSED 1U3HD 4P4KD 5E1HB 4IDJL 5JW4Q 1R3KA 1F3DJ 3QDGD 1EJOL 5GS3A 5J6HB 2VUOA 3PDGA 4Q9CA 3H7LA 2YRZA 4E5XB 1AGFA 4I13B 2ZPKL 1W0WB 1DSFL 4KY1L 1IGFL 2RFXB 2Y5EA 1AGDA 4UT7L 5BS0D 4K23H 3ARQA 2E7MA 1UZ8A 3RUGB 5C0IB 1DJSA 4JQVA 4LOUD 5DD6A 4I77L 1PW3A 5ANMA 3BFOA 3SKOB 1JK8A 2VH5H 5C08A 1PQZB 3MOBL 1X5GA 2P5EE 3PNWB 2W38A 4HF5H 5K9QG 1JHTB 1OP9A 4GRWF 4MNHA 3KYKH 1OL0A 4MZ2A 4LGPB 3RWFB 2GAZB 1PSKL 1KB5B 4JN2B 1NAMB 3P9MA 1BAFH 1RUAL 2F19H 1WAAE 3NIFE 5C0RH 1CLCA 4JY5H 2HN7A 5CS7A 1MLCB 4NCDA 1QACA 3V0WH 3M1BB 4NT6B 5F7KC 2F58L 4IRJC 3FQNA 2Q8AL 3IFOA 5D71H 4CU6A 1OB1B 3VI3F 3JV6B 4JPKL 4LKXA 1IC4H 5EUKA 1TZGL 4JFFB 4NCC2 1LE5B 3NPSB 3VXOB 2IG2L 5JHDE 1UB6B 5B3NA 5KSBA 1WGOA 4HIXL 3GMOA 4M8QA 1U8QB 4YE4L 4ONGL 1YQ2A 1XCTA 1YJDC 5FYJE 4R4NC 3WHE0 1V7MH 4MS8C 5F1NB 4MJIB 3UJJH 5KJRH 1A2YA 5BOPA 1BFOB 4NQTA 2IFFH 3OPZH 3D3VD 4HS8L 4IOFC 4ETQB 4GRLC 4JB9H 2V5MA 1KJMA 4IRZH 4Y5YA 3T2OA 4NQXB 3U4BH 4LDEB 4A6YL 1MVUB 5I76B 4UNUA 5C0IA 4GRMB 3QUYB 5HHVH 3S36L 1OTTD 4LLAA 4NO5B 5D1ZA 3SKOA 5HYIA 4APQC 1SEBA 2CRMA 1A6TB 5D2NE 2BNQE 4KKBD 4QHNB 4QTHA 1U91A 4RGMB 1TJHH 1AGCB 1EZVY 1Z3GL 4I3RH 3WLBA 1KYOJ 4KGJA 3RWFA 3IJYA 4OZFG 1NUNB 1NEZG 4JDZB 2E27H 3MREA 3L3HA 1RVFH 2PTTB 3IDJA 2HFFB 4PBXA 2C7UA 3C09C 1OD9A 3QEQA 4QTIH 2HJFA 2HJKB 2IPUG 4OZGA 2VLLA 3FOLB 4DKEL 2Q7YA 1JZ6A 5M7QA 2ZUQC 2Y07H 2ZG3A 5KW9L 1O0VA 2LV4A 2EE3A 2F53B 2EE2A 4PRPD 3CDFA 4G5ZH 2O26U 4C58B 1BWMA 4CADA 2WBKA 5T1DL 4Y4HC 1MPAH 1G7PB 4UOJA 4NNYA 1EFQA 4P3DB 4KK9C 3VGDA 5GGQH 3WHE1 2BNRB 3L3JB 4Y19E 3T2PA 5A43C 3KPRE 2XKNA 3BRGC 1JTPA 1I7ZA 4Y4KA 1J0JA 1II4E 1I3RA 1AE6L 35C8L 2ARJA 2IWGA 4XVTL 4D9RD 3HNVH 4Z7VB 3PDOB 1JN6A 4L29A 3BDBA 2D7QA 3ZO0A 5CBEA 2OL3H 3MNZB 1CICD 4M5YL 1JF1B 1EVUA 3SDAC 1YJDH 5BXFB 5I9QB 4MQSB 5DRNA 4OSUH 5FGBC 2K7PA 4DUWA 3TT3L 3LHPH 1U8NA 1H3WM 2BVPB 1YC7A 4U0RC 3ARBB 4X9GA 3SDXB 5IESL 1JNJA 3CMOL 4YHIA 2UY7A 1HQ4B 1HHKA 3U9PH 1NCAH 3MRNA 3MFFA 4Y5VB 3MOAH 3QDJD 3Q6GH 4C56A 1UZ6F 4GH7B 5DJ0A 5HXMA 4NHCH 4ZXBB 4OZ4B 3PL6B 1C08B 3OZ9H 5H37G 4EKXA 5C08D 3MJ6A 3AAZB 4NC1C 5FYKE 4LSSL 1C16A 5HGBB 4MCYB 5DJYA 5F72S 4KKAC 1D5IL 1NBVH 2SEBB 5F3HB 1NDGA 5HHMD 1WCBB 1REIA 3LZFH 4GKSA 4W4OA 2QSQA 3P30H 4P23A 4XMPL 1NAKL 2DKMA 4NM4H 1MCLA 1U58B 3F6IA 2NY7L 4PV9B 5DFVC 3C5JA 2BMKB 3INUL 3ROOA 4FG6D 1HOCB 1H3PH 1RZIB 3CFBA 4X83A 2R0KH 2P8PA 1BEYH 2NY4C 3VGAC 1IAKA 1D9KA 1WBXB 1IAMA 4X6EB 1E27B 1GGTA 2BY3A 3MUY1 4RRPG 1S9XA 2H6PA 1BJ8A 1HDMA 4N0YL 1MHEB 2R69H 3UPCA 4CVXB 5EWIL 1TCMA 3E1F1 2EKSB 4WUKL 2VJXA 2YC1B 5ICYA 3ZSTA 1J0YA 4DOHB 1C5CL 4G6KH 2ZSWA 4RAVB 1IQWH 2FECL 3BW9A 3V5KA 5KZCD 4XPBH 4WWID 3P9WB 4XB7A 5DQDL 4HZLB 2NY2B 1MJUH 3IKCB 2ZUWA 3KPQB 4GQ9H 4D0DA 5F1SA 3LS5L 3VXMB 4M3KB 4L3CB 4FQIL 1ORSA 4UBDC 1CTOA 1FO0A 2AEQH 2GFBB 4U1MA 3TF7C 3HUJB 3IF1B 1HH6B 4TVPH 2BRQA 2J8UF 4P2RA 1NJ9B 1MCEA 1ORQB 3EDDA 2DJSA 3N1FC 1VFAB 1GGIH 4M62L 4P3CL 4MQXD 5KANI 3CSGA 3H9SB 4N8VB 4Y4FC 1SJXA 4S1SL 5FHAH 1MCJA 1JV5A 3UJTL 1S5IL 3U1SH 3SGDI 4I5BB 3RZCA 5BVJB 3ZTJH 3QQ4A 4PBVC 1KYOK 2OL3B 5F21B 3BD4A 3OKKA 3QEQD 2E9JA 3S9DB 2VLKE 2FX7L 2BDNL 3V79C 2A74A 5EU5B 4YO0A 1WBXA 3ILPA 4OZHF 3A67H 4PJCE 1YMMA 3WE6B 4OTXL 1HEZA 4AG4H 1IZJA 4HJGA 2YSSA 5C9JB 3QPXH 4V1DD 1FNGA 5JDSB 1FFPA 4HV8A 3UBXB 3VD3A 2Q87A 3ZLQC 3TN0A 5MI0C 2EDWA 5DEFA 5IBUG 1UGNA 1DQLL 4JREC 2AJYL 3I75A 4XCEA 3EHBD 2VC2H 2EDNA 3MV7B 4G6FD 1ROWA 5CP3H 4YIQA 1W8OA 2FSEB 2FJFA 3KPNB 4ISVB 4D2NA 1JGEA 4PJ7B 5DHVB 5DJ6A 4PJ5A 1FVCB 2R23A 1BBDH 4Y4KD 5C0GA 1BIIA 3DO7A 2WP3O 4QRUA 1RUKH 3DX7A 1JRHI 2CUIA 1MRFL 1CFTB 3QG6A 5CHNB 3NIGE 1BBJA 3WNPA 4Z0XA 4GLRI 3T0WA 2Z8VC 4MXVE 2CKBA 1B4RA 4MD4B 1T1ZB 2VITB 5AUMA 5SX4H 2QADB 3DVIA 2CDFB 3RDTB 4JKKA 3BP5B 3RNQA 2AABL 1G7JA 1ORQA 3MCLH 4XNZB 5CGMA 4IS6A 5JQ6L 2H2SD 2C26A 1CQYA 3NA9H 4HDIA 4OCYH 5I1EH 4C56D 4HWZA 1JPGB 5I75B 4U2YA 5FGCE 4H1LB 3S98A 3VXTA 5ILTH 1P5VA 3Q3GA 4MA3A 1EFXD 1QTYT 4EOWH 5GRZA 3A0OA 2YR3A 2EC9T 4P5TD 4PGZA 4N0CC 5E9DE 3QIUB 3BPLB 2ZUVA 2JE8A 2Q6WB 3L7FB 2YPLB 3B9KC 3W11D 2OMNA 2BP3A 4JHAL 4UT6L 4PYGA 2XV6B 1TCRB 2YPKA 1D9KD 3WXWH 3U0WL 5MENE 2CRZA 2LABA 2VLRE 1G9NC 3HPJB 4K71B 4KUZL 3JXAA 3NFSL 3BZEA 2NW3A 5K9KA 4KRNA 3K2UH 4PJ7A 5MERA 1ZWIA 1MQ8A 1SYSA 5EIQA 3MGAA 1CCZA 4PV8A 3IFPA 5DMGD 4HUVA 1P5UA 1CQKA 1UADC 3EO9H 4Z5RB 1X5IA 5CIPB 2XZAH 4PB9L 4UTBL 3VWKD 2OTWB 3T2NH 4EBQH 3IDMB 3RUGF 1NC4A 1F6AA 2R1XB 2VDML 5FGRA 4K8RL 4N8CH 4BZ1L 2W60A 2CDFA 3RDTA 4OQTH 3E6HA 3EYSH 4YQXL 4R0LC 1J9CT 5DS8A 4CKVX 3P4LA 4NPYB 4F80A 4NQEA 3NCJH 5HYFA 4N8PA 3WKNA 1S7XA 5E8DL 1OHQA 1U2HA 1VDGA 3HS0A 43C9B 1ADQA 1EO8L 2VUYA 4S1QH 4ALAH 4HEME 3MJ9H 4P2RD 5BRZE 8FABB 4WFHE 1F4HA 3BE1H 5EORL 3FB7A 3BEWA 5I1JH 2MKWA 5E5UB 3H6JA 2DDQH 4JZJC 3MGTA 3W39A 1IGIH 4QY8A 3JTSB 3K0WA 5GZNC 3NCYS 4LARH 3S34L 2XTJC 2Q7NA 4NGHH 2BSTA 3ZDYE 1MAJA 3FO2A 4PG2C 4RZCA 1YMHA 3IFLH 3UJIH 1RK1B 3L3KA 4HCRL 1L7TH 4XVSL 1S7UA 4XCYA 1LDPL 1YMMD 3JWOL 3CFKA 2GJJA 5HGDA 3UCRA 3VXUB 4PRBB 5CMAA 3VRJA 5CSZA 3S37H 4W70A 4QOKD 3TPUA 3TN0D 4GBXD 3C08L 4HWUA 4WI2A 5KVGH 1W72A 3EGSA 3IDXL 2D7OA 2YS4A 3ALWA 1AD0A 1KXVC 4BSVA 4NRYA 1TENA 3RGVC 2ZKHH 2XZQH 1QFWH 1KSRA 2DL2A 1G9NH 3BUYA 4HXAL 5E00A 3O9WA 3O11B 4LSTL 2YEZA 5DQJA 2R1XA 2YK1L 5KVDH 3DYOA 5E4EC 4X5WB 2V2XB 1OF2A 1I8LC 5JO5A 1GHFL 1ND0B 4Z77A 1DUYA 3L6FB 3VFWB 3NIDF 2W92A 2OR9L 5CZXC 4HXBL 4AT6A 4Y2DC 1FPTL 2CK0H 3TJEL 4XNQA 3UMTA 4FTVE 3DMMC 3THMH 2Y9RT 4K9EC 2BVQB 1NFKA 2EIDA 1NCBH 1DTUA 1N0LA 5DUBB 4UV4H 4LHUG 2CK2A 4PJ8A 5K9OA 2X5PA 1CFBA 2NCMA 3UTTA 3MRPA 5DEGB 1ZT4A 4A6YB 4OCRL 5EO1A 4FQ2H 4P4KC 5TQ2H 4OLZL 4L4TB 4XPTL 3NMEA 1GSMA 1CZ8L 4O2FA 5D7IB 3JUYA 1OP5H 4ODTH 3BPOC 2DQUL 2DLGA 3I9GH 4JPIA 1FNAA 1QSFA 1ED3B 1FGVL 1RMFH 3CX2A 1H5BC 1XGQB 5HVWA 2KZ1B 3LEYH 2D9CA 3FHQA 3VE0B 5TF0A 1ZT1A 2BSSA 3MRFA 4TTGA 3NZHH 3GJFA 3VJ6B 4XBGB 1R5WB 2W0FA 2XWJA 4NZDA 1EEZB 1TZIB 3PQYE 4CGTA 1YEJL 2X4OB 4Z7VF 1XGTB 4NKIL 1P7QB 3X13B 3BKCH 4R90H 4KROC 5KSVB 3U9UB 1KF9B 4DEPC 1IFHH 1HSBB 3K3QA 2DQJH 1U8PB 4N90E 5CD5C 2ZUUA 4QYOA 4KZEL 3GSNA 1FFQA 4L3EE 1YEEL 3L6FA 3SDXF 2VXQL 3STLA 3LKQB 3HMXA 4NKMA 4YDLB 5LAXA 1CG9A 4YDJA 4OD3L 3F7VB 2NPLX 1NC4D 2X4TA 1AXSA 2WUCH 4OD2B 4RDQG 3VFNA 3VRIB 1MCHA 1R24B 5J56B 1J8KA 2BVQA 2C4FT 4YR6A 1XF3B 4TUJB 3QAZB 2ITDB 3VRLF 2ZSVA 4J2XA 3MLYH 4NZRL 4NQED 1NGZA 3QI9A 3BESR 3KXFD 3WO4B 4DN3H 2IALB 4M61B 5DEGA 1ZA3A 4LLWA 4X7TB 1ACYH 1FN4B 4K9EH 1T89C 5IT2L 3LAFA 4LRIA 1MF2H 1UCBL 1QSZA 3V52H 4IHOB 2CIKB 3BKYL 1BQUA 1EEYB 4LCUB 4OZFB 1NEZB 3S88L 3OR6B 3HLAB 1MHHA 4W6YB 2ENSA 2EYSB 2VZSA 3B8SA 1OTTC 1KPVB 4PJAA 3E8UH 4P5MB 1BREA 5GJSL 4Y0GA 4MNGE 2Z91A 1TZIA 4D8PB 1A4KA 5SWSA 1QBAA 4KKBC 3UAJD 5IHZB 4N0FB 3KPOA 1IVLA 2XWTB 1A6AB 4R0LB 1T83A 1EERB 2YPVL 1BJMA 3VWJA 3PWPB 1Q9LB 3X3GL 3BKJL 2CUHA 2UWEE 3UC0H 3ARED 4RAHA 4NNXB 1L0YA 5EBGA 4TSCH 5E8PB 1EHAA 1T20A 5IHUH 1S8DA 2HFGH 2YD1A 3LKQA 3HAEH 3U36B 4HAGA 1S3KH 3IXAB 3PP3K 1TJIH 4HH9A 1EGJL 2EC8A 1JZ8A 4F7MA 4O02H 5I0DA 3WIFB 5HI4D 3O6KH 4QF1A 1QSED 5ACZA 3HUJF 4OM0L 3WMSA 1R5VB 1M7IB 3PWNA 3BP7A 3DYPA 2UZYB 1S9WB 4MJ5B 5F7WC 2DQFA 1DQQB 3N06B 4KJWC 5EU6E 2MPAL 4FMKA 4ESKA 5IB4A 4J8RB 5D6DA 5BV7C 1HXMA 2MHAA 1F4WH 5KSAC 1VGKB 2C5DC 1NH6A 2A38A 4QRQA 4PJ8D 5MEOA 1ZMYA 1RZGA 3V8CA 2XQBL 1MWAL 4WO4A 3FMGH 2BXZA 5KVFL 4PJ9B 1CICC 2CO7B 1LWRA 2DQDH 5J6GB 4LLVA 4XP4H 3P0VL 4NZTL 1KXQE 2X9WA 1KIRA 3ARRA 1G7MB 3VXRB 3O2DA 3VGFA 2R39A 1NCDL 4X7EC 3T65B 4QT5B 3HN3A 2K7QA 2Z35A 1QSFD 1WLHA 5GPRA 3AM8A 2AJSL 2B39A 2FLBT 3A6BH 4Z76B 5JIPA 4JQVC 3IVKA 3HNTL 4PJ7F 4JHWH 4ZOCA 2AERT 2PYFA 2P48B 1YECL 1MFCL 4R7NB 1I1AD 4R8WH 5ALBL 5HYEA 3C60B 3PG2A 5AYUH 3X12A 4LCCA 4I48B 2EIBA 1TTFA 1HWGB 5TE4H 2O93L 2BNQD 1OWWA 2GSGA 5ERWB 2UVFA 3RWHB 5F3BA 4MA8H 3FCTB 1R5VA 5IV2B 1DUZA 1KCRL 1U3HB 5FK9A 4JJHA 4G8IA 3H9ZA 4I2XE 4KK8D 5CWSA 3QDGB 4XPFH 4ODUB 4Y1AB 2BNUB 5DTFB 1T0NA 1NBYA 4YXKH 3V4PL 3UEZA 1R0AH 3PGCB 2EO1A 4KAQH 4F7CA 2YUWA 1ZHLB 5F44A 3ZHLA 4EZMA 4MA7H 5DA0B 3QRGL 1PGRB 1RJLA 1S9YB 1DVFB 1QRNE 3OKYA 4LLDB 2D2OA 2JB6B 3D0VA 5IKCB 4H20H 2J4WL 4GXUN 3FB5A 3GB7B 3MLWH 4ODSH 5BV7H 1S78D 3GBNL 3REWA 4LEOA 2VYRE 3WKML 1A6UH 2DYPA 4H26B 3VXRA 5SWQA 1ZEAH 3NVQA 3FAXA 4YHZH 5IWLC 3GUTB 1V8HA 4Y5YC 4WI5A 1TQBC 3KPRD 1A7PL 3LEXB 4LLMA 1QBMH 3DTXB 2RQ8A 2NXZD 3GJEB 2HT3D 1A6WH 2AXJA 5D1ZC 5D6CB 1VFBB 5J9PA 4PUBL 1FZMA 2QKIA 3MV9A 4L8DB 3OJVC 1CGUA 4X6CB 2EXWD 5SWSD 1CFQB 4OZIB 3TJHD 4XP1L 3T4YB 2FWOA 4I0PA 5E8OA 3ALPA 5IBUB 4L8SB 4OBSA 1QEWB 5GGVY 4X7DC 2X70B 3VWJD 1YEHH 4XCCL 3HG1D 2BC4B 3KLHC 4UB0H 5HVHB 4P2QB 3VCLA 4PGBA 4FNLL 3DHMA 3D48R 1ZA6A 4BA8A 1YEDA 1T2QH 5JHLH 2XNAB 4U3XA 5HPMA 4HKBB 1KENH 2VLJE 1Q1JH 4LVEA 3MMEB 4JY4A 3DUSB 3D3VB 1HH9A 1MFNA 1NLBL 4DVRH 5DDHA 3X11B 2YBRA 3ARXA 5CKAA 4EI6A 4L4VA 3G9VA 4C54A 3EHBC 4M9PA 4NDMB 5I15H 4HFWB 4K7FB 4TUOA 5DRWB 5C0JB 4HC1L 3G6JB 3L5XL 4LEXL 5EOCH 5I6XC 1PEWA 2WNGA 2P7TB 3E2HC 4Y4KC 2PN5A 3MUJA 2OJEB 2Z31D 4FRWA 5DUMH 4DAGL 2XG5A 1B4JL 2NZIA 4OGYL 3G5YA 3GHBH 3MBEA 3I50L 4BKLB 1JVKA 4M48H 1B88A 3AUVA 1EJ6A 4FQHA 3OF6D 4ZTOL 3EYQC 2MKLC 2MWCA 4OLVL 4BM7A 5I1LB 3CLFL 3HC4H 4WUUA 2PW1B 4YAQB 2H2SC 3UO1L 3K46A 4X5XA 4AM0B 3SDCA 4NN7B 5B4MC 3BHBB 5CGYD 2W1NA 3WCYA 2LU7A 5MEQB 5IVXB 1Z9LA 3PWJB 1A1MA 4JDVB 2X70A 4XNXL 4PRHE 3CXHJ 4GG8A 3BZ4A 4KGLA 3GGWA 1WZ1L 3TCLB 3RVTC 5MEPA 2M26A 3ARFA 1T03H 4OI7A 1F8TL 4HX1A 1VEOA 3SQOL 2X44D 2IPKB 4EEEA 3H3KA 3UP1A 1MI5E 4W4OC 1ZLVH 4C4KO 4P23C 1GOGA 3PWUB 1RFDH 2UV3A 1U42A 3JZ7A 4ZUUB 2ZOKA 1UXWA 3W11C 4U7MA 2R56H 3FN0H 1MRDH 1U8LB 2YUVA 1D9KC 2WLZA 3C5SB 2VKWA 1UCTA 3H0TB 4J3TA 1KLFA 5ICZA 4Q0XL 3LH2H 2HLAB 1UZ6E 2AV7B 3EZ8A 3HFML 1CLZL 3TYFB 4HIIB 3VG0H 3ULVE 1AC0A 3NFPB 1HXYA 2CDEB 4J4PA 1KTLA 1FLTX 2UZIL 4I4WB 1IRAY 4PJGA 3QDJB 5D7IF 4PJBB 1OPGH 5JXAH 1SY6L 5K33A 3TWCL 4FQLL 2LTQB 2M2DA 2X05A 5D7KE 2JJVA 3FJTA 1X5LA 3RJQB 1ZVSB 2NYYD 5FEBA 2WLYA 1FAIL 1KJVA 1QFUH 2HRPH 1IC7L 4FFWD 4LSVH 5HHMB 4UINL 5ITFB 4HFUL 1MJ7H 4JQIL 2DS4A 4OV6F 4OJFL 4BELD 4R2GD 3FQUA 1WT5A 1KTDB 4WI9A 5F9WC 5HHOE 5A3ID 5IBTL 2VDPL 2ZZUT 5DMIL 1DBJH 3CFJB 3MV9D 3O2WL 2FATH 3IFNH 4IMLA 4EDWL 3EYOB 3SE9H 4L5FH 3HNSH 3OB0H 1KBGL 4I0PD 2BY0A 3QXDA 3GMRA 4E9LA 2NQCA 4XZUA 4U6XB 1KG0A 1LK2A 5AAWA 1A7RL 1GPOL 3RZCC 3HE6A 1FZKB 1I3GL 4OCNC 1J0KA 2NNAB 5KN5A 1MEXH 1AO7E 2EIZB 1T04B 1K4DB 2WWMD 1U8LA 5LXGL 2RCSL 2VZUA 5I1IH 1ES0A 5D7LE 4U6YB 1HINH 4M02A 4Z7UB 5TDOB 1IKFL 2KZWA 1NLDL 3O4OB 4AEHL 3TN0C 1LO4L 3NFPA 2CDEA 1DE4B 3K8MA 4PREB 5D2LB 1LEIA 3KPPA 3DVNA 1Q0XL 5IB5B 1DBKH 4OUOA 2VXVH 3CJJA 1FVDA 4XT1C 2OXGA 5T5NG 4JLRB 1XF5B 2FNBA 3ZYIA 5M94B 3TV3L 4LHUB 4OLYH 3WFHA 1IMHC 2BSRA 5FYJL 2CLRA 5EPMA 4AZ8A 1S7RA 4TUKH 1JNHB 3MBED 2D03L 2VQ1B 5CGTA 2C3VA 1G0XA 2HMID 2OI9C 3BGFC 1H8SA 3KS0H 1RZJL 4JG1L 2A6JA 2COQA 2OP4H 3OGCB 1RUML 3BJLA 3P4OA 4Z7WB 5F96L 1U93A 4DGVL 3CFJA 1OWRM 1ZK9A 2XI9A 4NUJB 1NSNL 2IH1A 4I3SL 4V1DB 3SDCD 4C83B 1FYTA 2DIJA 4NO3B 4UIKH 4XNUH 4JEGB 1QNZH 4X99B 2IF7A 3P0GB 1DQDH 3IJSA 1VGEL 1FO0H 5DD1H 3W9DA 1EHXA 5JIKA 1IGML 2CLZB 4G6FB 2DQEH 3RAJL 2EEBA 1CDIA 5D1QD 1WIOA 1T3FB 3GSWB 1JGDB 4JFOB 3DECA 5DR5L 1GH7A 5A2JH 1T0PB 4ZFFB 1PAMA 1U95B 1A3LH 3O6FD 4I0KA 5FDYA 3RJDA 3CXHK 3MLRL 2ICWJ 4U0QB 3DLQR 4OLUL 5FM8A 5FKAA 3S96B 1FG2A 1NMBL 4IRSD 2ILLA 5CINL 4UOW0 4FA8A 1E4WH 5KBNC 3OKDA 4NJAL 4NQVA 3NGBC 5I1AB 3BAEH 3KLDA 1JGLL 5I8CA 1OD7A 4LHUA 4UNTA 1MFEH 5IW1B 4JRYA 3SKMA 5B3JE 4S0SD 4J12A 1CDJA 5DZNA 3AVEA 3ILQD 5CJ8A 3FRUA 4EN3A 3LS4H 3AB0B 1AGEB 1ERNA 2I25N 3VXPB 3V4UH 2H8PB 4MAYA 4R7DB 5SV3A 4DGYL 4HUXA 1EFXB 4LIQE 1KGCD 1YZZA 1J1PL 1FFNA 2HVKA 4F9PA 3MRBB 4PB0H 3RNKB 1XF4A 4KZDL 4P5TB 4NUJA 3OKNB 1MSPA 2FYYB 2GUOA 4JG0H 1MWAB 1BZQK 3MFGB 5EOQH 1HHJB 1K2DA 1QFOA 2J2ZA 5D70L 2CKBH 3FQXB 4LRNH 1B0GB 4N0UE 1CFNA 4KI5D 5ITBH 1SJEA 1WBYA 5FOBA 1FBIH 3DBXA 3F58H 4U6HB 4YBQD 4OFDA 3S6CA 3HA0A 3M8OH 4GUPB 5FYKL 3RIFK 5ETUB 5EUOA 4LLQB 1PKQB 4HD9A 5GGTL 1XGPA 2ED8A 4UOW1 3ZL4H 1ZS8A 1YNKH 4OLWL 1OP3K 3TYGL 4BK5A 3RUGE 2GITA 5L2KA 5C2UB 3BH8B 5F97E 5EBLB 3VWKB 1YY8B 1RZ8B 4ODXB 4PJIB 1SMAA 3LN4A 4KMTH 2YZ1A 1AP2B 2WV3A 3UAJC 3QULB 2CMRH 4JCLA 1MIMH 1QLFB 3IAPA 4JFZL 1KN2L 2G5BB 3PHQB 1QR4A 1C7SA 4YHOH 5ACMA 4BSJA 2AKRB 4WCYH 5ABDE 5C2BL 1F02I 2VDRH 2EYRB 3BQUA 4K2UH 5TGBA 5TJWK 5EO9A 2J5LC 3I02A 1CL7L 3RQ3A 3RPKA 4F33B 4HUUB 1WEJH 3GKZA 5E94A 3RWJB 5DGRA 1DEEA 3KYNB 1ZANH 3CFIC 1YPZA 2VIRB 3KLSA 4S2SB 1P4IL 3QH3A 5F71A 1BLNA 5IFAL 3FO0H 4WW2A 4L8CA 1P4LB 4WV1A 4X6CF 4OZIF 4N90D 1AR1D 5IMMA 1KFAH 4FFZL 2VWEE 3BOVA 5C0CB 2FJHA 1QD0A 2I07B 2XG4A 3LD8C 3VU2A 2R1YA 5I74B 2Z92A 3E6FB 4Z95L 1OGAB 4RNRA 5ISZE 1X5XA 4HKXA 4PJ8C 4XP5L 1R3JB 1YEIH 1FZOA 4QOKB 4LFHG 2XA8L 4JAMB 4EVNA 5KS9B 1ZHBA 4GBXB 1AD9A 2WP3T 4WU5A 4PJEE 1JYVA 1ADQH 4MJ4A 5FDWA 5H35B 4NBXB 4G9DB 3VDCA 1HK6A 3BDYH 1NMAH 3EO0B 5DD0H 4ORGA 3T0BA 5E8NA 3KPLA 5DMKB 1QLEH 4JM4H 2HFEB 3ETBF 1YY8A 1HQRA 3MZGB 1AHWC 1JL8A 5EDXA 1IC5H 1UH2A 2JJSA 1A9EA 5F7UA 4M7LL 2R2BA 3BPNC 1RUPH 3VW3L 1P2CA 5BW7A 4XMKL 3CVHA 3G6JF 3VFRB 1KB9J 3RIAK 3RTQA 5IQ7L 1IJ9A 4Z7OE 1OSZA 2ZNXA 1UWXK 1BJ1H 5TDNA 3ZKMD 2X4QA 1I7TA 2EH7H 3QEGH 1FIGH 1WFNA 2IQAA 3E0GA 3LPWA 4X0KA 5SWZE 2FJGB 4WI4A 1C1EH 1W72H 4J6RL 4XAWL 5GSRA 3PABA 4RAUB 3WD5H 3GMNB 3QPQD 4EN3D 1EAJA 3TNNB 2F53E 2R0LH 5HGAA 5EZOH 4PRIE 3CDGB 3WEXB 2XFXB 1SEQL 5KTEL 4KK8C 1MCIA 1G9MC 3T0VA 2AI0H 4X9BA 3IGAA 4RFOL 5C0BE 5IVXF 5CD3B 1UXSB 4GW5A 3IXTB 3TBTB 4NQCE 2XZCL 2UYLB 3WNMA 4YWGL 5ESQA 3QI9C 1HHIA 4FFYL 4AH2A 5LVEA 3MLSH 1I9RH 3CVIH 1OT1A 4X4ZA 4GKNA 1G7IA 3KPSA 4JY6B 4N5UA 1EUTA 4X98A 4YGVB 1TQCB 4LRIC 1AFVH 5IGXL 1A9BA 3MRQB 3WFBH 2M1KA 4QXUH 1IEAA 3BGMA 4P4RB 4XC3L 1RY7B 2ZCLH 3NH7L 5HI5D 1LE9A 5DK3A 5DLML 3SJVA 3L3OB 4ZFGH 1R3IH 2DD8L 4BQCA 1CFVH 4UDTA 1I8MB 1DL7H 2ICCA 1GGUA 4HK3J 3ARPA 2D7MA 5C09E 2EXWC 3SKUD 2H9GA 2Y36L 3TJHC 3UTSD 1FFOB 2PYEA 4PJBF 4K7PY 5SX4I 2VAAB 1G7LB 4RQQB 4IIQA 1T83C 1U6AL 4RGND 1WC7A 5D72H 3VWJC 4LSQH 3GJFH 2IQ9H 3QJFA 1UWGH 3BT2L 4OCLC 3QHZL 3N1PC 3KXFB 3VFPB 3S4SG 5JW5B 3BQUD 2WBJA 2ARWA 3WFEH 4MVBD 2F5AH 4DTGH 3HR5A 3OKMA 3ZYZA 3CDGA 3QEHA 1W0YT 4WHYH 5J3HD 1GL4B 3OG6B 1ZTXL 3GSNH 5IIEA 1DCLA 3U0PB 4G7VL 1D6VL 3ZE1F 2X42A 2GCYA 4FXGB 2EDRA 3Q6FB 1GC1L 2DIAA 4YUEL 2UYLA 3HMXH 3G5VA 4W6WB 5A2LH 4NYLA 3L5JA 1N2RA 1SYVA 3FB6B 4JPVL 3PJSA 4AIOA 1G9MH 2MQ0A 2FCBA 5D6DC 3QSKB 2EIEA 4G8GA 4YHLL 3GFUA 2ADJA 2R8SH 4B7LA 3W2DH 2BVOB 5C71A 1F2QA 1T5XB 4WO4C 4CU7A 4KI1A 1WFTA 3AREB 2YD9A 3KJ6L 3VXME 2XICA 5JW4R 1L7IH 1M71B 1CGXA 4Z7UF 1DFBL 5JMRA 3QCUH 3QWQB 5EBMB 2KH2B 3T77B 5D2LF 1HCFX 4N1CA 1FFOA 1U8MA 1AKJA 4HAFA 4JZNB 3AM8C 5T1KB 4PD4J 1G7LA 5CGYC 1QSEB 2GJZA 3ET9F 3LKRA 2JK5A 3H9SE 4QRPE 4WFGE 1I1YA 3QHFH 1IM9D 4O58H 1R3HB 3O4LA 3JWDC 3UZVB 4LSRL 5GS0D 5F7YC 4BH7A 4F57H 1JWUB 1KB9K 3IRZA 4XPAH 2B2XL 1ZLSH 4LCCC 3T3MF 1YUHB 2B1AL 1FNEB 4WJ5A 5J11C 5DK2B 1KPUA 1J7VR 5L9DH 2NY6D 1DLFH 1KJ3L 3U0PA 3RWEB 3QNYB 4PR5B 5GGUB 4POZD 3U0TA 1CLOH 4Z7WF 2H3NB 2WZPD 1MJ8L 1G6RL 3O3BA 3S35H 2GJ6A 2AJZB 3MA7B 2JCCE 3V5DA 4GS7B 5T1LD 1CS6A 3MXWL 2OYPA 3SE3C 5JHDB 2UY6A 3MV7E 5ADOL 4HG4J 3H8NA 3V4VL 1T5WB 3DPBA 1DBBL 4UAOC 1AHWB 3BP6B 4U1KA 3P11L 4I0CC 4KK6D 2JB5L 2ADIB 2VLJD 3MXVL 2DWDA 4PG9A 4F58L 3RHWK 4R4FL 1KTKE 5FHBH 3MUZ1 5J13B 5DHXB 3ZKSD 1A4JA 4FXKA 4MQTB 4DVBB 3CSBA 4O9HL 1I1AB 3LKOA 4H88H 2J3SA 2NYYC 2X4NA 1QFWI 4M7KL 2HTKD 1MCSA 2PR4H 2F5BH 2FB4H 2V2WA 3QXVA 4PJFE 2BK8A 4RDQF 3GMMA 2KQNA 2EECA 1FL5A 2P5EA 1VFUA 5DJ2B 2BNQB 4R2GC 3SJVD 1NFDE 5C7XH 1UWEH 1VKXA 2XN9A 4JFYB 3GSQA 3N50A 4O2EB 3O2DH 1N3NB 3VFGH 5FO8A 5DJAB 3ZE2F 4LCWE 4LU5L 3U30B 2IGFL 5LQBL 1A5FH 5DRXA 5JW3L 5BO1H 4F3FB 2P24B 2WWKO 4I0PC 2GTZA 3L3DB 4UNVA 1FL3A 3R4DA 3HI6H 5IOPA 1JPTL 3PIQB 1A1OB 2EE9A 5TH2A 1XZ0A 1AJ7H 3GIZL 5FYLE 3ZKND 4EQ2A 4GXUM 4E0RB 5EO0A 1H0DB 5CLTA 1KLGB 2WBJD 3JWDH 3WUWG 2OSLB 4QXGH 4JFHE 5ENWA 3RWDB 2WWMC 1MFBL 5CBAB 4KTDL 1NKOA 1T22A 4GAJH 4R97B 4XXDB 3G6AB 5CEZD 4J3UA 4TVPE 4HT1L 3KPRB 2IEPA 4UTAL 3MRKA 3L3IB 5FKPA 2ADIA 4KMLB 5B38G 4KQ4H 2NXZB 4G43A 3FAWA 3BIAX 2FIKB 1PZ5A 8CGTA 5GIRB 1BD2D 1JRHL 3ULUC 5L2JA 4XPGL 4PRDA 4G8GD 5I17B 4MDJA 5I18L 5TPWH 3BN9D 1F4XL 3N9GH 4D0CA 4XGZA 1P9MA 4JM2D 2J88L 3BYTA 5E2VH 5I66B 3BEVB 3MBEC 4WU7B 4WTWA 1D6EB 5D2NA 4PJIF 3HG1B 3BJ91 3GSUA 4NO2B 1A47A 4NOFA 1RIUH 2AXFA 4PGCB 4UQ2B 1QRKA 4YZFF 1TZHB 1AQDA 2JTDA 3L95A 5DJAA 1Q9KB 3JV4B 4U1SA 3R06B 3SDCC 1AKJD 1WVZA 5C0AE 3L3DA 4JR9H 2XWBB 5LGHH 2ATKB 4ELME 3TC9A 2YN3A 5HJ3B 5I1GL 4GMSH 4QGYA 5BQ7B 1E4XI 1FZJB 4PD4K 4BH8B 3O4LD 4TRPL 2A6KB 4HGMA 3ARFC 3MLUL 4X5LA 5HHOD 4LDLB 15C8H 2R15A 4S1DD 1CGSH 5HYSG 3TPKA 4GT7A 5E1AB 3FN9A 3MO1A 4KQ3H 2Z31B 4N5ED 4KHXH 1AQKL 3TIEA 1B3JA 3DV4A 3G08B 5IJVB 3OJMB 3AS3A 4GW4A 3MRJB 4Y19A 2E9BA 3PWVB 4Y8AA 4QHLB 4Q9QL 1I8KB 3KLAA 4KV5E 5I1HH 1RD6A 2VR5A 2WUBH 2JELH 3MRDA 4P59L 4TSBH 1OM3L 5FO9B 2FIKA 4G8EA 5KS9F 3L5IA 2MNUA 4MJ2A 3LKNB 5T3XD 3QUXB 3VFTB 1YYML 4J4PC 5DEZA 5I1DB 1F6LL 3I3DA 3Q48A 4FQ1H 3C8KA 5K9JL 3QDMD 5EZIL 5BZWB 4OFYD