1XGTB

Structure for antibody hyhel-63 y33l mutant complexed with hen egg lysozyme
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
210
structure length
210
Chain Sequence
EVQLQESGPSLVKPSQTLSLTCSVTGDSVTSDLWSWIRKFPGNKLEYMGYISYSGSTYYHPSLKSRISITRDTSKNQYYLQLNSVTTEDTATYYCASWGGDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgtB02
4U6YA 4U7SA 3C60A 3FQXA 3RVVD 5I75B 2NY6B 4HUUA 4JZNB 3TA3B 1OL0A 3WCYA 3Q2CA 4F80A 4KK9C 4NT6B 2D03L 3GMQB 2PXYC 1ZLVK 2FJGA 4V2CB 5DRWA 1T5XB 1WZLA 1MFAH 1I1AA 2ERJC 1DL7H 1L7IH 4H0IA 1R5IA 5CWSA 1BGXH 2CDGA 5BXFA 3UTQB 2VDQH 3HZVA 4L5FH 5GS1B 5D9SA 4DVRH 1RK1B 3NCBB 3D0LB 4UTAL 1UG9A 2F8XC 1NCBH 2R2EA 3PHOB 2QKIA 3DJ9A 2AW2A 2GITA 4APQA 1GHFH 2R1YA 3BVNA 3T65B 2IFFL 2IG2L 3TH2T 2HJKB 2YEZA 3HS0B 1CQYA 4OCXL 1BF8A 1MHHB 3P2TA 1F8TH 3TIEA 1XF4B 4MNGB 5F7HA 4QRRA 4ZNCD 2V5RA 4GG6E 4GMTH 4HCRH 2EIBA 5IOPA 1G7JB 3QUYD 5FOJA 5T33L 2EDXA 3TO2A 4JN1H 4OF3A 2MWCA 3DBXA 2B0SH 5E5MA 4KZEH 5J4MA 3VWKC 3FN9A 1J0KA 5E7FA 4N0YH 1T21A 2EYRA 4QXGL 4M9PA 1AKJB 4U4BA 4RCAA 2PYEE 2VLRD 5B21A 2E9WA 2BJMH 3HC0B 2D7NA 5DJAB 4HDIA 3AFLA 3BQUB 3HLAA 1YEDA 4Q9RL 3HMXH 3IF1B 4XPBH 5DUML 2FJHB 2BRRH 4ODSH 4X98B 5A2JH 1K6QH 4UT7H 5K9OA 1QRNB 1AGEA 2DD8H 4X6DA 1MJJA 5DQDL 4PLNC 2BVQA 2P43B 1J0JA 4LNRA 4Y5XC 3V0WL 1F11A 4PJIE 4L8DA 3MJ9H 5C0BA 4LLYA 5E94B 2BXYA 2Z93A 1RMFL 5J56B 2ZSVA 5B4MD 3CFCL 3TBYB 1UVQB 1P84K 3OWEA 4QRSA 1CL7L 4NZUL 5BO1L 4LGPB 4PJ7B 5EBMA 5D1XC 1C08A 3DRTA 3O6LH 4WVRA 3HZKB 3GNMH 2C1PB 4G8IA 4KJWD 4X6CB 1H3XA 1B9ZA 2OTUA 4MJ4A 4F33B 3AXLB 4E42B 1MCPL 5C09B 5BQ7A 3KXFB 3LIZL 1BJMA 3DV4A 2QV2A 1F3RB 3R1GL 4JY4B 3C6LB 2IBZY 4R4FH 1KIRB 5CBEA 5JA8B 5LBSL 1U42A 1KF9B 1FVCA 3GMMB 4JB9L 1UH2A 3DXAE 2YD8A 3DPBA 2VABB 3JWNC 1FNEA 4X9BA 4WW2F 4P46C 5EOCH 1L6XA 1QFUL 1EBAA 3G6DL 4NNPL 2IPUG 1MFNA 2D7PA 3B8SA 5DK0B 5IW1B 1U8KA 3SCMA 1FZJB 1OAXL 3L9RB 5D7JD 3ZZ1A 3BUYA 5JW4R 1W0VA 3LRGA 4OLZL 4XNXH 2JJUA 2OTWB 1J5OL 4UV7H 4R97C 5HHMB 7CGTA 3TVMB 3CSBA 2PF6A 1N8ZA 4NDMB 3U7YL 4OCSH 1FGNH 3MZTA 4R6UA 4OIBA 3M17A 4QRTB 1ONQB 1IMHC 1PG7H 2FEDC 2R2CA 1IEBA 1HHHA 4DW2L 1JWMA 1HH9A 2J8OA 4ODHL 3MCKB 2X5PA 4PGBA 2VXSL 2YPLD 4PJ5B 5EWIH 3O2WL 3QIUD 1WT5A 3P0VH 3PV6A 1AO7A 1FIEA 1G7PB 1PYWB 4G9FB 2HTKD 3FQWB 5GGRA 5TF0A 4JFFA 2ZJSH 5DRZA 5KSAA 4WUUE 1QQDA 4XBGA 4PJHE 2ESVB 3IDIA 2WBKA 4M7JH 4Y8AA 1T2JA 4GG8B 4KDTA 1V3LA 1F90L 5FF6A 3QEQD 1H5BB 1U8IA 4JO1L 5ENWA 4YFEA 2AGJH 1I7RB 4P5TA 5ID0B 3ARFB 1CE1H 5EOTB 3PWVA 1JFQL 3OV6A 3E6HB 4OFVA 4MA8H 5C0AA 4K3JL 4AEHH 4KVCH 5JNYA 3QEUB 5DD1L 4GBXC 4I0PB 3MLZL 3MC0A 2XNAB 5TDOB 4DZBA 3HE7D 2APVA 3PDGA 4C59B 1IZKA 1AGDA 5JA9A 3T08A 1Y6MR 3OJ2C 4M7LH 4PJBE 4CW1A 1M6OB 2DQTL 1UM6L 3RY6A 4F15B 5I1HH 3IFLH 5JXAL 3HG1A 1CLZH 1OAYH 1QBLL 5L8LB 5LAXA 3U30B 3IAQA 2YUZA 4Z7UB 1U3YA 1QYGH 3ES6A 5F7LB 1TZHA 1P7KA 5C8JB 1FO0A 4P2OB 3EYSH 1LP9E 5ECJE 1XGUA 4RGNB 1BOGA 2CIKB 5LGHL 3BIKB 1WFTA 4ENEC 3K2UL 3MNZA 1J0ZA 1ZHLB 4PTTB 1RUAL 1OTUD 4LLAA 5GIRA 2V5SA 4JFDD 2X4SA 3SGKC 3G6JF 3MRCB 3QQ4B 3QBTB 4XWGL 2YKLL 5EZJA 4IHOA 2DQEL 1VGKB 1KB5L 4ZFFB 2A6DB 3S88L 3KLAB 2ATKB 5DD0H 3CLEH 1JZ4A 3JVGA 2YSSB 2DYPA 1QFWL 2GJZB 1DBKH 1I3GL 5IV2A 2KQMA 2OZ4A 4R7DA 4YHIA 5DFVD 2LTQB 4NSKA 4OM0H 2XT1B 5TFSL 3FOLA 3MQIA 4F3FB 3C87A 1A3LH 4NUJB 4MA1B 3DIFA 1R3IH 3UYRL 3BN9C 3K4AA 3V52H 3L3GB 2D7QA 3Q5OA 5A2KH 2AXFA 3I50L 1JUFA 1CDGA 5B8CA 4R96B 3OSKA 1T7WA 4JPWH 3T0XA 3O2DA 1NUGA 2Y6SC 3ARDD 5EC1A 3L3OB 2DDQH 2XFXB 3H9SE 3NPSB 5T1DH 4CJ1A 4NHUB 4RDQG 3FRUB 4KUZL 2AJ3B 4LCCC 3MRHB 3L5WA 5KW9L 1L7IL 4U6HB 2VXQH 1BGXL 1DQJA 1N64H 3N85H 5CUSH 1YJDC 2ICEB 4XXDB 2VDQL 4L5FL 4I18C 4JRYD 4DVRL 4ETQA 4Z7VA 3T09A 3DVNA 4JDTH 1ZE3C 5EU7C 3L1OH 3U7WH 5GGTA 4ZYKA 5MERB 1AHWB 3QULA 3ZYZA 1WWBX 2VAAA 5IGXH 2ADGB 3EJZC 2UWEB 3FQUB 1M4KA 3O11B 1QFOA 4QCIA 3LH2L 1XIWD 3LKNB 2NXZD 3UTTD 2V5TA 1NMCB 3F6IA 3ZKQD 3DX6B 4GMTL 4ZUWA 2VLLB 4OI7A 4UAOC 4EI5D 4JN1L 5J1AB 4QHKI 1URLA 2B0SL 4KZEL 4WFFD 4LAQL 1H8SA 1RHHA 5IEHB 4P9MH 2NY4C 5HDBE 2VZVA 1PAMA 2R29H 5IEKB 4HS6A 1BFOB 5K9QG 2A1WL 3BXNA 2CO6B 5FO9B 4YPGB 4UBDC 1N6UA 3FT3B 2Q3ZA 4YBQC 1I8KB 5LCVL 3JTTB 5K9KA 2J4WL 3V4VL 3AAZB 3FHAA 3T1FB 3WS3A 5I15H 3HMXL 4XPBL 3OKOB 4ODSL 1K6QL 3LKRA 3U79A 4UT7L 3MOAH 3MUJA 1EGJA 2DD8L 1HWGB 1N26A 4OF8A 2DQFA 2P45B 4HH8A 5DMKB 4FFVD 1WBXA 3NOIA 1CLYH 1PY4A 4S1DD 3MJ9L 2IPTH 5HYSG 4HUVA 4B50A 4HS3B 4OD3H 1RJZB 5DTFA 4YAQB 2BVYA 1R3HB 3AC0A 4YO0B 2COQA 1MVUB 2DTMH 1FZKB 4TSBL 2YPKB 3QA3B 1BX2B 1DN0A 3D3VD 4FA8A 3WUWB 3QUXB 4D8PB 4U1JB 2VDMH 1TZGH 5HHQA 4HWZB 2B20A 4R4FL 5GGQL 3TLRA 5JORA 5CJXA 2AEWA 4TULH 3SPVB 3QDMB 43C9B 4MAUH 3F12B 5DSCA 4OZFH 5E2WL 4GJTB 4Y2DB 3VRJB 4XX1E 3QT2A 5EOCL 1TTUA 3OR6A 4PJ9A 4HK0A 5TPWH 3LQMA 3BWUC 1MCDA 4MQ7B 5L9DL 3OZ9H 1ZHBB 4XVSH 1MEXH 4QWWD 2KUTA 3UC0L 1U92A 4RMVA 4LMQI 2WBJA 3U4AA 4XNXL 1J05A 3OAZH 5DRNB 2Z35A 1IAKA 3VXUB 3MRMB 1ZGLB 4NJ9H 1AR2A 3IETB 2B7DT 4BKLB 2YRLA 4OCSL 3KR3H 1CCZA 3VD7A 4MS8C 3I3EA 3MOBL 1PG7L 4WTWA 2B1HL 4M93C 2VWEE 4ESKA 4YHYB 4QHMB 4MAYA 4RWYH 4X5XB 2ICWI 5T1KD 5C0CA 3ESVF 4P3DB 2VR9A 4HUWA 2QADB 2O61B 4X99A 3O8XB 4O9HH 3QXAA 3P0VL 4J1UB 3B2VH 3TT3H 1IGYA 3QNXB 4Z7WF 4U1SA 2EZ0D 4J3SA 3LPFA 4BH7B 5JOFA 2ZJSL 3IFOB 4Z5RA 4BH8A 3BH9B 5JLZA 3MR9A 1EMTH 4HIXH 4LHUD 5C07E 5I2IA 1CDIA 1PZ5B 4M7JL 4YHKL 1PLGL 1C5BH 5AYQA 2QSTA 4L3EB 2C4FT 3JZ7A 4LOUD 2AGJL 3EZJB 4JN2A 1FNSH 1CE1L 3BZ4B 3UZVB 1S5IH 3W9EB 1R5VB 4XTRC 3BDBA 1OGAB 1XF2B 3JWDC 4M5YH 2GJ6E 3SJVE 2CXGA 1P4IL 2N56A 1S9VB 4AIXA 2VWEC 1FL5B 1IGIH 5HYJE 3JV5A 5DR5H 3VXMA 4LP4A 1YNTB 4G80A 4PUBH 1U3JA 4M7LL 3VWJD 1OOAA 5BS0E 5DS8B 3R06A 1CLZL 4Y4KB 5J9PB 3QH3B 2PO6B 3TO4C 5SWSE 5GZND 4MA7H 1WVZA 4PLKC 1G6VK 4XI5C 1S8DA 2ADIB 3UJIL 1KLUB 1SQ2N 4UOJA 5GHWH 1P6AB 3CFBA 4IOIA 4HKJA 4MDIA 1NUDA 5IMLB 2IBGA 3F6LA 2X10A 4TUJB 3HCVB 2XN9D 1QLFB 4ODBD 3P4NB 5TGBA 2AXGA 3MXWH 1BAFH 2MQCA 4M6NH 1P7QB 2V2XA 4Y1AB 1FCGA 3G6AB 1BVKA 4XNQB 2LU3A 3HPJA 4WV1B 4OFIA 3RWCB 4LSSH 5I16A 2X4NB 5DD0L 3CLEL 1NC2D 2VIRA 3ISWA 2XWJB 2BVOA 3WNOA 3S5LA 1DBKL 2NY6D 4Z7NE 1B0WA 1UZ8B 5ERWB 1G9MC 3BYYA 2NY0B 3TA3D 2X4TB 4MJIA 5GPRA 4G8EA 3L3DB 3U9UB 3REVB 1S7RA 3N1PC 3C2SA 2BNQA 4LLVB 4FMFA 4ZUVB 3OAZK 5T3XD 3S3PA 2VDRH 1A7QH 2BHZA 4QXWA 5E9DA 3CMGA 1D5XB 4LCUB 1J0YA 1R3IL 2FYYB 2FO1A 3V52L 5M94B 4PRBA 1AP2A 4C56E 4Y4HB 2DIJA 3SKMA 2A6KB 3O4LE 4HULB 3VFWB 5DC0A 4LPVA 4JKPH 2LAAA 5HDQH 3C60B 3FQXB 2PXYA 2ATPA 2VDLL 4FQPA 3T3ME 4HUUB 4JPWL 2FB4H 4CU8A 5T1DL 5I17A 2DDQL 1QG3A 3WXWH 3PWPA 5IMOA 2LFGA 5J12C 5KVDL 3B2UD 3A67L 4LSTH 1N64L 3N85L 1KJMB 3BKCH 4UU9A 4JFEE 4KVNH 1I1AB 1ZGLP 4JDTL 5C2BH 2PCPA 5CWSB 3U7WL 2CDGB 3EW3B 2X1QA 5BXFB 2CK0H 3HZVB 5D9SB 2GIYA 5E8OA 5IGXL 3ZDZE 3LS5H 1UACL 4BQ6A 2R2EB 3KWWB 1AKJD 2QKIB 3GO1L 2GITB 3PIQA 4APQB 3VU2A 4JPIA 3NIDE 2CR3A 3WIHA 3BQUD 1HYSC 1N4XH 4QRRB 4AMKL 1EUTA 3GSNA 3SGEH 5FECA 3FO9B 4E0RA 3VWKA 4NQVA 4RRPG 1QRND 1ACYL 5IOPB 3GMRA 4R7NB 5D70H 3TO2B 5CBAA 1IGTA 2R29L 4LLQB 3DBXB 5ADPL 3DECA 4QTIH 1YEIL 3RVTC 4ORZC 3LCYA 4OZ4A 2IADA 4C54A 4ZS6D 2HN7A 5HSFA 1U91A 5I15L 2B2XH 2R0WL 3MREB 2OR7A 3MOAL 4HDIB 5E70A 3HLAB 1YEDB 2Q86A 3QRGH 5GRXG 2EDTA 4BQCA 4ODXA 4FOMA 4JFOA 4KKAC 2DI7A 5K9OB 4Y5XA 5IFAH 1AGEB 1CLYL 4X6DB 4GG6A 1MJJB 5C09D 3KXFD 2IPTL 5ISZE 4NQTA 1BBJA 2VE6A 4OD3L 1QSEE 3C6LD 3OB0H 5D1QC 5GISH 4LNRB 4L8DB 5C0BB 4LLYB 2R9HC 3MO1A 4YK4B 5D1XA 1JHKL 2Z93B 4JFHE 2DTML 4WHTA 4RA0C 1NEUA 4NKQB 4QRSB 2LU4A 2VAJA 1D5MB 2R1XB 1KIUA 2NY1B 5EBMB 5INCA 1C08B 3DRTB 1GZPB 4L4JA 5GRYA 5J1TC 3ARZA 4G8IB 2VDML 1TZGL 2OTUB 2C1OA 5I9QC 5BQ7B 2FATH 4TULL 3SDYL 3UBXG 1U0QA 1WWWX 3DV4B 4X7FC 5CBEB 5HHMD 4ONFH 3K1KC 3WEXA 4MAUL 2HRPH 3TVMD 4BZ2L 5F97E 5DJDA 1JPTH 1FVCB 4P46A 5CGMA 4PJIA 3RWJA 1DQQB 5CP3H 5JW4Q 1OAZH 1OAQH 3D2UB 5TPWL 3C8KB 5IQ7H 2O5YL 3JXAA 4TSCH 1FNEB 3RBSA 4XVSL 5JOPE 1MEXL 4NRXA 1OWWA 4H1LA 2P4AB 3ARPA 4PJ5D 1U8KB 3L3KA 1N2RA 3BW9A 3T4YA 2EICA 3BUYB 4G9FD 1W0VB 1GPOH 1KJ2L 4JO3H 4IRZH 4PBWD 4OTXL 2ESVD 3ARBC 1JZ6A 5F6IB 5A40E 3EYQC 4RWYL 1TJHL 4G42A 4U1HA 1IEBB 4KZDH 2QR0A 1HHHB 3C2AH 3DXAA 3E2HC 1JWMB 3ARFD 3B2VL 3TT3L 1Z2KA 2AEIT 4JREB 4I0PD 4E5XA 3OTTA 3PV6B 5CMAA 1AO7B 1MRCH 1W0WB 1H8NA 5DEFA 2ZPKH 1EMTL 2FX8H 4R4BA 5GGRB 3C5ZC 1C5BL 3QDJE 5DJ2A 4XBGB 1QQDB 2YUXA 3GMOA 2YMXL 5EO1A 2UZIH 3RA7H 1IC4H 1FNSL 2Q8BH 1HHKA 1BLNA 3MRDA 1BZ9A 4N0UE 5FF6B 1U8IB 4GBXA 5F7DA 5ENWB 1S5IL 5MEQA 4P5TB 1MWAB 1FZOA 3PWVB 1MCWW 4HXAH 4P2OD 2I27N 3H3PH 3SOBH 3O3EA 1K2DB 1MOEA 4RGND 5DR5L 3VFRA 4CU7A 4HG4K 3X11A 4DZBB 4PUBL 2DJUA 3OR7B 1WTGT 4D94A 4XCFL 3WFZA 5DK3A 2J6EL 4S1QL 1N7MH 2QHLA 3LRSA 4CW1B 2XQYG 3OB0K 5CGTA 2X89A 3HG1B 4WUUA 3PDDA 1DR9A 5LAXB 5EO0A 5C6PB 4LF3B 3RKDC 3UTSE 3BUTA 2I60H 5I19L 2DKUA 3RNKA 2D3VA 3IFPA 1CS6A 3VD3A 2A74A 2DQHH 3ES6B 1TZHB 1P7KB 2P5EE 3U82B 1FO0B 4JY6B 2BSRA 4QRPA 1XGUB 1BOGB 1ZAGA 4E41A 4U1LA 5SWZA 4WI7A 4Y5YC 1EUUA 4YE4H 1DE4A 4PGJA 3MXWL 1BAFL 3MNZB 3G04B 5DJXA 4M6NL 5FM5M 3SGKA 5ESQB 3WKNA 4WTZA 2LV4A 5HYQA 2UVEA 4WW2C 5IP4A 3O9WC 4RFNB 5EZIH 4K8RH 2W38A 3WFCH 2OI9B 4TTGA 2X4SB 4LSSL 3EJJX 5F93C 4HZAA 3BPOC 3UPRB 2C3GA 5EZJB 4IHOB 4NP4H 2C26A 3A6OA 2XY1A 4LLWA 1BIIA 1U8MA 3WNPA 4MSWB 3TWCH 2QLVB 3EO9H 5FK9A 5E1HB 2DYPB 3STZA 3TGXA 4NZRH 4DAGH 4YZFF 5JUEH 1LP9A 3PL6B 5IV2B 3B9DA 5I6XC 2WP3O 4J4PC 2P8MA 4R7DB 2HMID 4YHIB 2BY1A 4NSKB 1MVFA 1E4WH 5D7LA 2VDRL 3FONA 4XT1C 3KYOA 3NFSH 5IQ9B 3CVHH 3BI9X 3G5VA 3KNBA 5JZ7D 3LDBC 12E8H 5KZCB 1P4BL 4J7RA 3DIFB 8CGTA 4G6MH 1FGVL 3NA9H 1CLOH 2VXUH 4JKPL 4DGIL 1J1PH 1A9EA 1CXKA 3EDEA 2AXFB 4LHQB 5JQHC 1JUFB 2PETA 1ITCA 2FB4L 1RPQA 1MF2H 3ILQD 2YA2A 4U33A 1KXQE 4Z6AT 4LCCA 2XXCB 3ARRA 5EC1B 3UBXI 4LSTL 1LDSA 2Y7QB 4I18A 3BKCL 5HGDB 4KVNL 3L5WB 4LLDB 1YYLL 5C2BL 2CK0L 3MRKA 3G6JE 5DHVA 2R69H 4QOKA 3WFHA 4ETQB 1G84A 3DVNB 1CDUA 4AG4L 3LS5L 1U3HB 2DQUH 1PW3A 3MRQB 1HZHH 1OPGH 2WP3T 4I77H 4QCIB 5CJQH 4GKOA 4PRAA 4EVNA 1A21A 4L3CA 1RIVH 1N4XL 3NCJH 4PJGA 1C12A 5F9OH 1A0QH 4EQ2A 5D70L 1RHHB 4QTIL 2EDNA 2ICWA 1XCQA 5FKAA 2AV1A 5FO7A 3O41A 3UAJD 3BXNB 1R6VA 3B3IA 3GKWH 1H15B 1IQDA 3QSKB 3P73A 3INUL 5EFIA 3I3BA 3QIWC 1KC5H 4NQEE 3CSGA 3L95B 2YD6A 3G5XB 3BESR 1C16A 5JW4N 3QRGL 3WS3B 1D5ZA 3LKRB 5IFAL 2V9QA 4K3HA 4PFEA 5AZ2H 2DQFB 5F1OB 3QUXD 2CKBH 1LHZA 1WBYA 1WBXB 1TVBA 3BDXA 5GISL 5B4MC 2E9BA 1O7SA 4JO4L 4HUVB 1UJ3C 5DTFB 3QDMD 1OB1A 4JHWL 4PLOB 5BRZE 3V6ZB 2N7BA 2EIZA 3MYZA 5C0ND 4KJWC 4Y2DD 3CPLA 3A6BH 4LU5H 1CGYA 5D7SL 2BSSA 1CIUA 1R3LB 1SJHB 5HDOA 1A4KA 2ZG3A 2ENSA 4OLEA 3TYGH 1OQXA 4LP5A 3IT8D 3MLYH 5IBUB 25C8L 1JIBA 1U58A 4GS7B 4M43H 4KKCD 5HHQB 3VXUD 4Y19E 4ONFL 4U0RB 5JORB 4PRHE 4ZPVA 1JPTL 4JAMB 5HVHB 1X4YA 4HCRA 4LPUA 1TMCB 4XPHH 2XXMB 3HNSH 1OAZL 4EBQH 1OAQL 1WQVT 3MJGX 5IQ7L 1T6VN 3BGAA 4TSCL 3VRIA 3OR6B 4PJ9B 4HK0B 1DP0A 1M7IA 1A8JH 3PP4H 2BFVH 4QNPF 2QADD 1YNLL 3T0WA 1EHLH 3O8XD 1ZLUH 3I75A 3VG9C 1U92B 4XNYL 1MI5E 2B5IB 1FG2B 2WBJB 1GPOL 3P30H 4KKLD 1NAKH 1J05B 1BD2E 1IAKB 2XRAL 5I1AA 4G5ZH 4OAWA 1T5WA 2BVUA 3C9NA 5EZOL 3F62A 5IBLD 2AKRA 3IVKB 4L3ED 3NCEB 1NMAL 2APFA 4KZDL 3QUZB 3V5KB 3C2AL 5IVXF 1MHCA 4AYFA 3MV8B 4MAYB 3SQOH 4G6AC 5IHZB 5C0CB 5JPMA 4FABH 2BOBB 4HUWB 3RRQA 1I7UA 1OGAD 1RZKH 5E00A 3WDHA 2BX5A 1MRCL 2MMXA 4UNTA 2A0LD 2ZPKL 2VLJA 2FX8L 2BNRE 4PJDF 1UEMA 4M02A 5JOFB 4BH8B 4Z5RB 1DBAL 1EO7A 5JLZB 3TNMA 3MR9B 1X6LA 3RA7L 2DWDA 2UZIL 5DHYA 1IC4L 3GSVA 1TJIL 4Y4KD 4GAYB 1JWUB 4X6EA 4JN2B 2PO6D 4PY7A 4OKDA 3T0EE 4HXAL 4UNVA 1OSZA 5A3ID 5ACZA 3SOBL 3W5MA 5E99H 3BP5A 1WAAF 3I9GH 3DYOA 5DLMH 4EUPH 1ZANH 3VXMB 1N7ML 4G80B 4GRWF 3TO4A 4Q9QH 5I8OL 1P7QD 3KAAA 4Y1AD 3R06B 5C07A 3FCTB 3N1FC 2VJXA 4JG1H 2YD4A 1ZT1A 1W72H 1TPXC 1C7SA 3CU7A 4LSDA 2I9TA 2I60L 1I9IH 2JELH 5DO2C 2DQHL 5IF0A 1S8DB 1YN6A 3GSWA 4U6TA 3NIFF 1LEKA 4K2UH 3CFBB 4IOIB 1AGFB 3O4OC 2PW2A 4MDIB 4N8VA 3CUPB 4KY1H 4YE4L 4X6BA 4Z7WE 2NY0D 4ODUA 2GJ6A 3T0EC 1LQSR 4OIAA 1ORQA 4U49A 5TGBB 2AXGB 3CSPA 4NQXA 5HYJA 5CP7B 5EZIL 5CEZH 3KYNA 3I85A 1J7VR 2V2XB 2FL5B 3WFCL 5DT1H 5LXGH 1ORSA 3BJLA 2NXYC 3HPJB 3LKOA 4NP4L 1YEHH 4W4OC 5I16B 4Y4HD 3TWCL 5IW6A 4QEGA 4DVBA 5DFVC 3EO9L 3B5HA 2VIRB 3UYOD 1F00I 3T1WA 3C60D 5I71C 5JUEL 2HFFA 5EIVA 1ZLUK 5FEBA 4MJIB 3RDTB 4G8EB 1E4WL 1S7RB 2LVEA 2W9EH 2BNQB 1NCWH 1EHNA 1SHMA 3NFSL 3CVHL 3I6GA 5MENE 2AK4E 2Q76A 4HGKC 5E9DB 3MUGB 2H9GA 1I1AD 1CLOL 5IB4B 1AP2B 4XAWH 5K33A 1J1PL 4Q58C 2E6JA 5J3HC 3QXTA 3S7GA 3SKMB 2BOCA 2WWMD 4PJEB 2NX5E 1MF2L 2BRQA 3F7QA 3IS0X 2PXYB 4PJ8B 1T1WA 2ATPB 4N9GA 5BV7L 4APQD 4M8VA 1IFHH 1KPVA 3CFEA 5I17B 3NZHH 3OJDA 1JGEB 2P42B 3PWPB 4AK1A 1SVZA 1SBSH 1JYXA 4YFLI 4P23C 2ERJB 3A6CH 4RGMC 3I84A 1U6AH 4QRRD 1YA5A 2R69L 3DX8B 4S11A 2PCPB 2X1PA 4EXKA 1H3TA 2DQUL 5BZDB 1FAKT 5E8OB 4D9QD 1HZHL 4UUJA 1MAMH 1WWAX 3O4LA 5DZNA 2RCSL 4HAFA 4I77L 1U3ZA 4HHAA 3PIQB 1ODAA 5CJQL 1DANU 4OCWH 4K8RC 1OWRM 1M7DA 4JPIB 1RIVL 3SDAC 5FIEA 2P7TB 5C0IA 2R0ZL 1QD0A 4QKXB 1QEWA 2HKFH 4MCYA 3GMNB 1KENH 3GSNB 4NO3A 4E0RB 4NQVB 4Z7OF 3TCXA 3WIIH 4Z0XA 3GMRB 3TPUA 3VDCA 5CBAB 1IGTB 4X7TB 4ZUSA 1PGRB 4TRPH 3GKWL 3QNZA 3QQ3B 2GI7A 3G5YA 5C0BD 4OZ4B 1KC5L 1J10A 2IADB 2X42A 3QCUL 1FVEA 2ARJQ 2HN7B 1ETZA 3TJEH 1LO2H 2N4IA 4JY5H 1U91B 4N5EC 1MFBH 2NY1D 1A7PL 3UYPA 4S1DC 2Q86B 2R4SH 5AZ2L 5I8EA 5B38A 4LHUG 2CKBL 4ODXB 5D1QA 4KAQH 4Y5XB 2ICES 2ZCHH 4GG6B 3P0YH 2ZUWA 1BBJB 2VE6B 1T6WA 4GAJH 3OKLA 4WNQB 3U46A 1F2QA 1NC4A 5E4EB 3A6BL 2YR3A 4L4TE 4LU5L 2BY2A 4WHTB 3D2UD 3NCFB 1NBZA 5J6GB 4MLSA 1XH3A 5I1LA 2VL5A 1RZGA 2PYEB 1I7TB 4ONGL 5INCB 3GI8H 4MNHB 1FFOA 3MLYL 3BWAA 3K8KA 3A0OA 1W8OA 1WGOA 1TENA 4QTHA 2C1OB 4F9LC 2W1NA 5C7XH 4XPHL 2VDNH 1B4JL 3HNSL 4EBQL 3WEXB 1KGCE 1QSEA 5DJDB 1JGDA 4P46B 2X4OA 4QWWC 4PJIB 4ZTPH 3RWJB 4LCIH 4JO2H 4RRPA 1FYTE 4C58B 3S35H 3S36H 2BFVL 1EHLL 3TBSA 1KACB 1Y18A 2EH8H 4LDEB 4NRXB 4LSUL 4WY7H 4H1LB 4NZTL 5F89A 1ZVSA 4KHTH 3P30L 1CDYA 1NAKL 1AO7D 1N2RB 3L3KB 4IMLB 3BW9B 3T4YB 3V6FA 2D7TH 3ARBA 5D6CA 5FA3A 4G5ZL 5L88L 4KHXH 4CUCA 3F7YA 4HBCL 2NZ9C 2Y4SA 4WJ5A 2YOCA 1A6PA 3SQOL 1NDMA 4G42B 4GW5A 4U1HB 5TH2B 2EZ0C 4P5TD 2QR0B 3PXHA 3DXAB 4TN9A 3RUGF 3EDDA 1PZUB 3C5ZA 4E5XB 1BZ7B 4LVEA 5E08L 4ODTH 5CMAB 2EXWD 3WO4C 4ZUUA 1P6FA 4U05A 4XVUC 3RVUC 1ITBB 1OP3H 4LOUC 5C08E 1L7TL 1YMMA 4R4BB 2QEJA 3UROR 3D6GA 5H2BA 1WF5A 5DJ2B 3TCLA 5EO1B 3FKUS 4UI2A 5TQ0L 3HG1D 3TT1H 1BLNB 3MRDB 4GBXB 5F7DB 5MEQB 1LILA 1FZOB 4M6ML 2P24A 2WWKO 5DC4B 3I9GL 3VWJC 3O3EB 4OZFA 1ZANL 2AABH 3VFRB 3X11B 2HVJA 3GSUA 4F8TA 5T5FH 3VFVA 3C08H 3LRSB 4JG1L 4QXTB 1G7HA 1A64A 3L3IA 3QEGH 5TE7L 3OB8A 3QDJA 3VH8B 4YHML 1ZVYA 4WUUB 1I9IL 2JELL 4PJHB 4X9IA 2W92A 3O45A 4ZQKA 4I3SH 5EO0B 4N68A 1JYVA 4K2UL 1ZMYA 3RNKB 4Y5YA 2A74B 4PD4J 4NKOA 4XNUL 3CDGA 4KY1L 3PE9A 3G5ZA 2BSRB 1P4LA 5HTSA 2C4FU 1BWWA 2DYPD 5E7BA 4WW2A 2AJSH 1V3JA 4GRWH 4U1LB 3PL6D 5SWZB 1A6TB 1E4JA 5GRUH 5DJXB 3VGDA 5LXGL 5DT1L 5HYQB 3ZT7A 1RZJH 4JFXA 2MCG1 4PV9A 1RJLA 4OB5H 4OGXH 1J0IA 1SM3H 5HDLA 5KZCD 4PJBB 3I6LD 3IDGA 1RZKC 1YEHL 3MPCA 2CQVA 3DUSA 1R24B 2WWKT 1YNKL 4HWEL 1BIIB 4J4PA 1TNNA 3UTSA 3OKNB 3RIAF 5FK9B 4ZOEA 1GOGA 4NRYB 1X4ZA 4ZOAA 1IKNC 1KLGA 3TZVB 2MKWA 1MUJA 5GRVL 1KCKA 2W9EL 1LP9B 1IARB 4DFIA 1NCWL 2VC2H 5KSBF 2P8MB 2MPAL 4NIKB 5HVFB 3PXJA 2VLME 3ULVF 3FONB 1KV3A 2MCPH 1T0PB 3KYOB 4LVOC 3S96A 2O26U 3KNBB 3RQ3A 2DMBA 4OIIH 5CEZE 4XAWL 3BZFA 3VDAA 2AJXL 5B3NA 2OJEA 5FUZL 1WJ3A 1OGTA 1CFBA 1SYVA 1U3HD 3GIZL 1A9EB 3UJJH 1LMKA 5IB3A 3NZHL 4BSVB 3PGCA 4P2CG 4LCCB 1SBSL 1GH7A 1UH4A 3ZYOA 1OP3K 1U6AL 4I18B 4OZGF 5M95B 1T2XA 3DRQA 3BAEL 2CRIA 4YXLH 4X7CC 1LK3H 1QHPA 4K94H 2F5BH 2PKDA 5DHVB 3WFHB 3O6KH 4GXUM 3DI2B 1MY5A 3KYMA 4MJ2A 1GSMA 5J89A 5DFTA 4U3HA 3KJ6H 4OCWL 3RWIA 1H0DA 2MOVA 2HFGH 4KK5D 2WK2A 4WWKC 4YZFE 4GAGL 3PWJA 4UAOB 2HKFL 4L3CB 3VXQA 1KBGH 1TITA 4GXVH 2NY4B 4PJGB 1C12B 2VLRA 3WIIL 1UWXH 3Q0HA 2AQ3A 4PJXF 4GKNA 5GGUA 4PYGA 2ICWB 3QIWA 1XCQB 3G6JA 1Q72H 4X80L 5E6IC 4M8QA 2AV1B 5FO7B 2HTLC 3B3IB 1IKFH 5T5NG 2C4XA 1IQDB 1MCIA 3P73B 3H7BA 4LRIC 3TJEL 5EFIB 1LO2L 4JY5L 1IL1B 3FOMA 1QACA 1MFBL 1EEZB 4HGWA 1C16B 2HYMA 3DHMA 2R4SL 1D5ZB 1MCSA 3LV3A 1U8JA 1Q9LA 3GSRA 5C3TA 1ADQH 4M7ZB 2ZCHL 1UJ3A 4FZEH 4QYOA 3P0YL 3VXTA 1NAMA 1TVBB 4GAJL 3QHTC 4LPCA 1AC0A 2IC2A 4PTUA 1FAIH 1WC7A 3DO3A 3ABZA 3EYOA 2DKMA 4XP4H 2EIZB 4K23H 4JZJC 1F3DJ 1RK0A 2FEEL 4GQ9L 4QT5B 3CPLB 5FM8A 4N90E 4DKAA 3GI8L 2BSSB 4PJ9D 4NQEA 1UXSB 1A6UH 2QL1A 1A4KB 4TUKH 4J3OC 1WITA 2E8ZA 3P4OA 2WBJD 1CZ8L 2FO4A 1U58B 2GUOB 2JB6A 5C7XL 3KJ4B 5JDSB 1G9NH 1OLLA 5EA0H 2B39A 2VDNL 1JTOA 4F8QA 4ZPVB 5DWUH 4KFZC 3B6SA 4ZTPL 4LCIL 4JO2L 3VA2C 5EUKA 3CZJA 1NGXA 3QUZD 3GGWA 3W2DH 5BVPH 5CJ5A 3MV8D 4MAYD 4LASH 1JZ5A 3VRIB 5C1MB 5GGVH 5C0CD 5CSBA 1M7IB 4WY7L 4U6XA 3SE8H 3I75B 5FDWA 2NW3A 5EULV 5JO5A 1KELL 4KHXL 2N1KA 1H5BC 3WHE0 3QJFA 4OAWB 5GS2H 5I1AB 1T5WB 3C9NB 5AUMA 4OD1H 4Y19A 4I5BA 1X7QA 1ZV5A 2JCCA 5KG9A 2AKRB 5FA4A 2FCBA 4I0PC 3FB8A 1IGFH 1MHCB 3HUJF 4MQSB 3MXVH 4OT1L 1KCLA 5JPMB 1I7UB 1MIEH 4KK8D 4BFBD 2VLJB 4HWBH 2E7LC 1QR1A 2VZ3A 2EC8A 4W6YB 3VXMD 1MI5A 3PWNA 4KJPD 3TNMB 1DBMH 1VHPA 5KOVC 4POUB 3U30C 4X0KA 3GDBA 2DWDB 5DHYB 5ICYA 2BSTA 2CLRA 1CVSC 1JPGA 3TT1L 3NN8A 4P2OC 5F7EL 2FGWH 2IBBA 4C83B 2EXYD 2HT4C 4F57H 1OSZB 3Q5YA 1Z5LB 5ACZB 4QNPE 3MRBA 3BP5B 1TLKA 3VFGH 2Q7NA 1QSFE 1XGQA 3TESA 4XMPH 4Q6YA 3X12B 3EOBA 1MJ8H 4P59H 4HFWB 2WUCH 4PJAA 3QEGL 4CVXA 1F42A 5C07B 3CMOH 1S7XA 1MSPA 1ZT1B 1EBPA 2I9TB 4RNRA 5IVXE 4PLJD 4KUCD 1YN6B 3GSWB 3T0EA 3CK0L 1LEKB 4OLYH 5DUBB 4N8VB 1MCRA 2PW2B 5CJOH 4KGLA 4X6BB 5GRUL 4ODUB 2GJ6B 4MJID 3RDTD 5CZXD 3SJVB 4PJDE 3MRIA 1ORQB 2BNQD 2IH3A 4NQXB 5HYJB 3MSPA 3KYNB 4AENB 3OKMA 4OB5L 4OGXL 1T7YA 1SM3L 4W4OA 1ORSB 3LQZA 4I8DA 5E9DD 2P44B 1OW0C 3D0VA 2EDDA 5BS0B 2LABA 1I1YA 1NFDF 5I8CA 3IDUA 3LKOB 3K80A 4Y89A 3IGAA 4LEOA 5JW3L 3OBAA 2OL3L 5IW6B 5SWSB 2HMIC 4DVBB 4CMMB 2FX9H 4XCNA 1DN2A 1VDGA 2PXYD 2CDFA 1KTLB 4PJ8D 2HFFB 5IB1A 1EXUB 1WAAE 4HV8A 1C8PA 2KZ1B 2R15A 4I2XE 1D6EA 1J8KA 4XCEA 3TV3H 3PWPD 4HLZG 2MCPL 4GRWE 3WUWG 3I6GB 2Q76B 4OIIL 3ARQA 4AZ8A 3E0GA 2H9GB 4KI5C 5KS9A 1UKQA 3Q6FA 3TM6A 4UT6H 5DJ0A 3ARGB 1HSAA 4M6AA 3MLVL 1A3RH 3TBVA 2XWBA 1E6OH 4Y0GA 3NIFE 3X13A 4JRYA 4P23A 1T1WB 4LKXA 4N9GB 5J12B 3QPXH 3OPZH 1KPVB 3ULVH 3CFEB 1LO0H 3OJDB 3MRGA 4R2GC 5ELIA 1EHAA 1I85C 4I48A 3U4EA 4YXLL 3B83A 1EZVY 2F5BL 4DKFH 5MENA 4G8GE 2NLJA 2JB5H 3O6KL 4BZYA 3EO1A 2N7AA 7FABH 3E3QC 2XACC 3KJ6L 5I74C 3EDKA 4C56B 3SDAA 3O4LB 4Q9CA 2HFGL 4HHAB 2NX5A 2H2SC 1RZJC 1HH6A 4Z76A 1M7DB 1GGCH 1KBGL 1YUHA 1CWVA 1MHEA 5C0IB 3RY5A 4GXVL 2NY5C 1U8PA 5DJYA 1YEKH 1QEWB 1DEEA 4MCYB 1U8QA 2DL2A 4YDJA 4HIJA 4X4XA 4LK4A 2IJ0C 4Z0XB 1HKFA 3TPUB 2ED9A 3B5TA 5EU5A 1Q72L 4XP6L 4ZUSB 1U93A 3E1F1 3P9WB 4FQIL 4HH9A 3MLXH 4CN6A 3DV6A 1JV5A 3LQAH 1RU9L 3G5YB 3DARA 3QUKA 5SX4I 3MRJA 1T83C 3QUMH 5KN5A 2V5YA 3ZYJA 1ETZB 4ZOCA 4LL9A 4YHOH 2PYED 4R4NC 1ADQL 5KJRH 3BPCA 1CXFA 2I5YH 2YA1A 3T2QA 4AQ1B 1E6JL 4FZEL 3D18B 5I8EB 5B38B 5D1QB 3IDJA 4PGDA 2Z92A 4XPGH 2A9MH 3PUCA 2F58H 2J8UF 3HI1A 3K1DA 4Y2DC 5H37G 1ES0A 1FAIL 4OCLC 3QG6A 3CX5J 5D71H 3OKLB 5A16A 2G9HB 4ZS7L 4OGAC 3TNNA 5EIIA 1WIOA 2O5XL 1NC4B 4P46D 3W5NA 4NPYA 5C3LD 1J9CT 2VTFA 1Z9OA 5F6HI 2CPCA 5MEOB 1NBZB 1XH3B 5I1LB 2VL5B 2CO7B 1RZGB 4K94C 3P4LA 4WO4C 4HEME 4F9LA 2BK8A 5FXCH 1FFOB 5B3JF 1DUYB 2I24N 1LO4H 4O5LH 1KN4H 2FIKB 3BZDA 3MJ7A 5EA0L 5IHLB 4QTHB 4ZXBC 2VSCA 4Z7OE 2GK0A 3HPLA 3MODH 1K8IA 2ZSWB 4R8WH 5FB8B 5DWUL 4GRMA 4UT9H 2FEDD 3NACL 3RIAK 5ISZB 4NN7C 1QSEB 5HHXH 3VXRE 3W2DL 2X4OB 1CT8A 5GGVL 3DXAD 4L4TA 4HKZA 3TBSB 3SE8L 5F9WC 1AXSA 1WCBA 1MCLA 2VOTA 1XGPA 3VGFA 4Z77A 3ZDXF 3MYJA 5F89B 1ZVSB 2H8PA 4EZMA 3HMWH 3UTPE 2X44D 3K8MA 3V6FB 3ARBB 5K59F 1OSPH 1HKLL 4KRPB 2HAZA 1T4KA 2ARWA 4K3DL 2FBJH 3W9DB 4JEGB 3F7YB 1MJ7H 3JV6B 3DTXA 3RHWF 1IGFL 1K3IA 4WJ5B 2WINA 3MXVL 4GBXD 4GW5B 2OK0H 5F9DC 2F53E 3FFDA 1MIEL 5ANME 3QWRA 1FYTA 3KPPA 4ZFGH 1UM5H 1EAJA 3C5ZB 1JVKA 3OXRB 1TTFA 5GGVY 2D7OA 3OAUH 3SBWC 1A6VL 5DD6B 3W11C 4ZUUB 5IVZB 3QDGE 2WLZA 4URTB 2CLZA 1DBML 1QR4A 2GT9A 3K74B 4K55A 4GT7A 5H2BB 4WHDA 5HPOA 1R5WA 5F96H 3CIQA 3CCHB 5T5NF 4YHLL 3TCLB 2FGWL 2X89D 4XMLL 4EQ3A 1FLRL 4WUUD 1NGQH 3VWJA 2CH8A 1MQKH 3ULSB 3ZT6A 2XPGA 1Z9SA 2P24B 2EE6A 4ENED 3VFGL 1Z9LA 1G9NC 3O2VH 4XMPL 4DN3H 3VG0L 3U0WL 4OZFB 2IQ9H 1D5BB 1UGNA 1MJ8L 1IM9B 4P59L 3VI3F 1HCFX 5SWZD 2WUCL 2HVJB 5I1GH 4YDKH 3GSUB 1H3GA 5C08A 1L9NA 3VFVB 4PS4L 3CMOL 3CDFA 2EIDA 2XN9A 1G7HB 3KPQA 5DHXB 3QDJB 3K3QA 4ELMF 2AEPL 2V2TA 3T2PA 2AQ1A 1YPZF 4ZQKB 4FNLH 3W82A 4N0UB 4OLYL 4OD2A 3Q48A 4YDIL 3O6MH 2ICWJ 3CDGB 4WFGD 5CJOL 3RUGE 3VMNA 3V0VA 1F4HA 5EN2A 2G60L 4WW2B 3TZVD 1OP5H 4G6KH 1BFVH 1NC2A 4ZFOL 3SDXF 4LSQL 3BPOB 3BN9D 4YPJA 4JFXB 3WLBA 4WI2A 1RJLB 3ZE0F 5SWQA 3C60C 3GMQA 2DLFL 2YPLE 1ZXQA 3EGSB 3DUSB 4KJYA 4JDZB 1IKNA 2FX9L 2XV6B 3BH8A 4IMKC 1JRHI 4HIEA 3UTSB 3V5DA 5KAQF 2XQBH 2GKIA 3GSQA 1GC1L 1KLGB 2P5EB 1N5AB 4M1GH 3MCG1 3GB7A 3LDBB 3O0RH 3C8HA 1YDPA 3QEQE 4ZDHA 2DL9A 2C3VB 2BERA 5HHVH 2AI0H 2HJKA 4YGAB 4EUPA 3RL1A 4UT6L 5C71A 4JG0H 5GRJH 4TVPH 3BZFB 3HRPA 1Q9WA 5HI4C 4YX2H 1IVLA 2OJEB 1E6OL 3EJZD 2KZWA 4OCMC 1OGTB 1SYVB 3DSFL 1YEGH 3B4NA 1G7JA 2X4PA 1W72A 1G1CA 3QPXL 3ARVA 1LO0L 3H7LA 1HXMB 3PGCB 3NFPA 1AH1A 3UX9B 1XF5A 3FRPG 1RZ8B 4DKFL 3DRQB 4G7VH 2NY4D 2X4UA 2JB5L 2O5ZH 1U8NA 4PP1D 2BXZA 3GK8H 4K7FA 3VA6A 4UBDD 3BPNB 4YBQD 1EEUA 2WQ8A 3MRPA 4XPFH 4X98A 4WWKA 1QRNA 2XTJC 5FGBC 3RWIB 1H0DB 1GGBH 4S1RH 1WLHA 2CK2A 3RWDA 1ZLSH 5KSBE 3PWJB 5KVGH 1YEKL 5E94A 3CX2A 3VXQB 3ULVE 1UVQA 1AQKH 3FB7B 1INQA 1Q38A 3U1SH 4FS0A 5E6IA 1RIHL 4GKNB 1QNZH 1YC8A 5GGUB 3HZKA 3MLXL 3AS0A 4LRIA 3QIWB 3G6JB 5E2VL 1PBYA 4X6CA 2FR4A 4M8QB 4MQTB 4E42A 5CLWA 3U83A 3H7BB 4XPTH 2X05A 2RIKA 3BISA 3GHBH 1K5NB 3V7AG 5IM7A 5E03A 1NQBA 1JYNA 4NWTH 4MVBD 3LV3B 1Q9LB 2J88H 4OZGE 4XPGL 1CGSH 2A9ML 2VN7A 5IG7B 3ZL4H 1PEZA 1UJ3B 2NW2A 4QYOB 2FECL 3VXTB 5FYKH 3FN0H 5D71L 4JZJA 4V2BA 5DK0A 5IW1A 3ULVC 4PTUB 1FZJA 1O0VA 2R0KL 1FE8H 1WC7B 3BRFA 1M71B 1U8LA 3BJ91 1FSKB 1RK0B 5KVFH 3DO7B 1F58H 3OKDA 1VADA 4NQEB 2QSCL 3O6FC 1S9XA 4DN4H 1LO4L 1ONQA 2EEAA 2UVFA 3AM8C 1U8HB 3NTCH 4KKNA 1KN4L 5C70A 2YD3A 4S10A 4ZSOE 4NC0B 1QRKA 3P4OB 3NMEA 3KDMA 3MODL 2Q6WA 2FO4B 1JNHA 1IC7L 2JB6B 4R8WL 4ZD3H 4G43A 4PJXE 4MS8D 3MCKA 2QSQA 3ALWA 5FGSA 2HWZL 1KTDA 5HHXL 3HZYA 3CDYA 1D6VH 3B6SB 1OARH 1S9WA 4LPYA 3FQWA 5EUKB 1NGXB 1WBZA 3GGWB 3UO1H 2VRAA 1JMZA 2ESVA 2P46B 1A22B 4QLRA 3FFCE 4GG8A 3F65A 4YXHL 3RPKA 5GJSH 4HIIB 3HMWL 1H5BA 2MNUA 2YUWA 4CDGC 1IAII 5FDWB 4OUOA 1I7RA 3QPQC 2VLJD 3IJSA 1OSPL 3LQAC 3OL2A 3C6SB 1B2WH 5JO5B 5I1JH 4KMQA 2FBJL 2EYSB 3CDCA 4I0PA 1MCFA 2OJZH 1LNUA 3QJFB 5ALBH 4Y19B 4I5BB 4A2LA 5GXBB 1X7QB 2J5LB 2JCCB 4PRHB 5KG9B 5FA4B 2DQCH 4XTRD 2OK0L 3FB8B 1VGEH 4EDWH 1NANH 4X8JA 3LN5A 4X5LA 4ZFGL 1M6OA 2E7LA 1KJVA 1UM5L 4MX7A 5IHUH 5FHBH 1NGZB 4CNIA 3OAUL 3PQYE 4HT1L 1UYWH 1QR1B 3LKPA 3FN3A 4Z7UA 1IBGH 5C8JA 1MI5B 4UILL 2P1YA 3PWNB 4P2OA 5F96L 1DSFL 3BDYH 3DVGB 2WSKA 4X0KB 1BD2B 5ICYB 2BSTB 4YHNB 2CLRB 1JPGB 4WDIB 4XI5D 2V9TA 5C07D 3NN8B 1NGQL 1ZHLA 4UIMB 1DDHA 1SY6H 4PRDA 4KMTH 5MEPB 4LSPH 3WJJC 3WFEH 4KQ3H 4DN3L 3FQRA 2IQ9L 3MRBB 1HI6A 1ZTXH 1XGQB 1DBBH 3R4DA 1VGKA 4YDKL 2BDNH 1TQCB 2GJ6D 2NR6C 3EOBB 3SJVD 5JQ6L 4RAVB 4NKDA 1NPUA 5C0RH 3ZHKA 4B5EA 5HY9A 4PRNB 4PJAB 1TPXB 4JE4B 5AG9A 5HYJD 1G1YA 2FHFA 1TTGA 3U9PH 3SGDI 3FQNA 2GK2A 4KJQD 1BQHB 5BS0D 3ZDYF 2WMPA 2CGRH 3V4PH 3O4OB 3PL6C 2XZQH 3O6ML 3HUJE 3GKZA 4KRNA 5SWSD 5A1AA 3T0EB 4LVHC 4FQCL 1EPFA 2Q8AH 4GO6B 5JIHA 4G6KL 1BFVL 2VZUA 3QXDA 2OP4L 1QSFA 2NXYB 3MRIB 1OW0A 2IH3B 1CDJA 2W65A 1FBIH 4FQQA 3OKMB 1H8OA 1FG9C 3LQZB 1GGYA 2OXGA 3D0VB 1CN4A 1I1YB 1I9RL 1KLFA 1ERNA 1XR9A 3L3OA 4NHUA 4LEXH 3IGAB 2D03H 3ARGD 4LEOB 1BQSA 3RPIA 3IYLW 4HWNA 5IVXA 4XCNB 1SEBA 4C57C 3LKQB 3N1GC 2CDFB 5IB1B 1AGCA 1MFEH 5CHNA 3O0RL 1WIUA 1D6EB 4XCEB 2ZOLA 4Z7WB 5HHVL 5IBUG 2G75B 3NA4A 2K9UA 3QO1A 4AQOA 1VFBA 4OZHF 1CXIA 1U3HC 1JF5A 3RKPA 3IAGC 1EJOL 3EFFA 1GXEA 1D3CA 4YX2L 4UB0L 2GCYA 5DJ0B 1HSAB 1YEGL 3FJTA 4XC3H 3TBVB 2EO1A 2XWBB 1FZMB 3ZTJH 4C56D 3O4LD 1I85A 4P23B 3QFDA 4LKXB 3KYAA 5T33H 4RGMB 3S8WA 4H8WL 4N1EA 5IEKA 3ULUF 1EVTC 3W0WE 2WM0A 1HYSD 1TXKA 3RL2A 4YPGA 1N5YH 5C0FA 3FT3A 4G7VL 4I2XA 3GM0A 3WFDH 1FH5H 4I48B 4X4YA 1X5FA 2O5ZL 4QXGH 1J1XH 3U4EB 2GEEA 1YQVH 3RHWK 4HF5H 3GK8L 5E24E 5MENB 2AK4B 5FOBA 2NLJB 5T3XL 1NFDE 3EO1B 3RVTD 4XPFL 4KK5C 3OGOE 3ZE2F 5KVMC 2JJTC 3ET9F 3VFNA 3D87B 3FT4A 5DUMH 3GMLB 2BCKA 3SDAB 1GGBL 3KLSA 4S1RL 2NX5B 1KXVC 3TBTA 5DVNA 3BEWA 1ZLSL 5DQDH 1HH6B 4HS3A 4Z76B 1RJZA 4P2RE 5D96C 43CAA 1DEDA 1YUHB 4FP8H 1MHEB 1LK2B 1DLHA 2X09A 1U8PB 3BHBB 5DJYB 1DZBA 1R3HA 4NCDA 4Z0BH 1AQKL 6FABL 1DEEB 2NMSA 1U8QB 4MB3A 1RMFH 2DTSA 1QNZL 1KFAH 2BVPB 5D1QD 5CLTA 4YDJB 3CFCH 4HIJB 5MHSE 1FZKA 2A73A 5CJBA 1T83A 2K3TA 1ED3B 2R9HD 4G8GA 3PP3H 3H6JA 4FN0A 2VDOL 4WGVB 3RZCC 3CVHB 3G9AB 4HH9B 5BW7C 1JV5B 4NQDE 4XPTL 3QUKB 5T3XE 3MRJB 3J7HA 4OLVH 1NC4D 3GJEA 5KN5B 3MUZ1 4GS7C 3HI5H 4HX1A 1NGPL 4NWTL 2DJSA 5DMYA 1W0YT 3F12A 4Y2DA 3VRJA 5JPNB 4P48A 5FYKL 4F7MA 1SJVA 2WANA 3HI1B 2FSEA 4XAKD 3S35X 4XRCB 3S36X 1ES0B 1FE8L 3G6DH 5DURB 5EBLA 4W4NA 3WE6B 5ISZD 1T1ZB 5EIIB 1QSED 4WO4A 2QQLH 3MRMA 5KVFL 1ZGLA 1F58L 4NHCH 2B5IC 1Q1JH 1A02N 5F9JA 4DN4L 4JFHD 5D1ZC 4ZXBA 5A2FA 1NGYA 3MV11 3HE6C 3SY0B 4ZD3L 3SDDC 3MJ7B 3ORJA 4P3DA 3ARBD 4KRPD 3HPLB 1K8IB 3QG7H 3QUZC 3EYQD 4ODHH 5DF0A 3SKUD 1AJ7L 5FYKE 3PWLA 4YH6A 2Y36L 1FLTX 3IFOA 2GW5A 4M9OA 3BH9A 3UO1L 1CT8B 4HMCA 4MA3A 3DGGA 4L4TB 2OQJA 4UDUA 4HMDA 1FRGH 1I1FA 2CIIA 3DNKA 1AXSB 1WCBB 1IM3A 1XGPB 4Z77B 3C5ZD 3EKCA 3KS0H 3MYJB 4WFEE 5JOPD 1B2WL 2H8PB 5C0DA 3STBA 4JO1H 5I1JL 2CRYA 2OJZL 4BZ1H 1XF2A 2J8UE 1T4KB 4ODWA 4K3JH 1WV7T 1ADQA 3MMEB 2DQCL 2H41A 1YNTA 1VGEL 4EDWL 2XZAL 2CKBB 4U3XA 5LGJA 1DLFH 1XF3A 4LCWE 3VXRA 5DS8A 5IHUL 3SBWA 4OQTL 1FYTB 3KPPB 2A6IB 4KJPC 1UYWL 2DQTH 4W70A 1UM6H 4PV8A 1FL6A 2K7QA 3VXSA 1BFSA 4G6FB 5B3JE 1IBGL 1IM9D 5ITBH 1KLUA 3BDYL 2CLZB 1A7NH 2GT9B 4HXBH 5KOMC 2JJSC 3PP3K 1R5WB 1B4RA 3HCVA 1T22A 2IGFH 1QLFA 4GAFB 4KMTL 5FM4A 3QDJD 4LSPL 4PJFF 2ITCB 4KQ3L 5K9JL 3V2AR 3G6AA 2ZKHH 1L6ZA 4XNQA 2XPGB 2MHAB 4WTXA 1CVRA 2KL6A 5F1KC 3MLTA 3N1QC 1CD0A 1RURH 2F53A 1DBBL 5ANMA 2BDNL 4JJHA 1CFVL 3ZDXE 2X4NA 9CGTA 5C0RL 1PKQE 2YKLH 1EIBA 2X7LA 2HT3C 3GJFH 1KB5H 5T3ZH 5K59E 3QDGA 3U9PL 4CMHC 2ENYA 1UZ8A 4TYUA 5C08B 4PLJC 5ERWA 5HPMB 1YY9C 2X4TA 4Q6IC 3REVA 3KPQB 5GRZA 5KVEH 1CYGA 1I3GH 2EDHA 2CGRL 2VNCA 4R3SA 2XZQL 2V2TB 3HHRB 3RDTC 5CZXC 2Q8AL 1M05A 4RAHA 1JZ7A 3FAWA 3J8F7 2LVCA 3S4SA 3EYUL 3MJ8B 2FBOJ 4J4PD 4KKBD 3UTSD 4L4VE 5A2LH 3V0VB 1ND0A 5EN2B 2P5ED 2A6KA 2EIEA 4HGMA 4WI4A 3VFWA 1KIPA 3BKMH 1CTOA 3AREC 4F7CA 1LGVA 3I50H 2H32H 3WLBB 1FNFA 4HWBA 5CSGA 5SWQB 4A6YH 2XI9A 4LEXL 3WFBL 2ADFL 2BVTA 4IMKA 4PJ8C 5B39A 2DLEA 4KJYB 1RSFA 3T3PF 5DMGC 4PPTA 1KJMA 4KUZH 5C9JA 3BH8B 4LKCB 3KPRE 2W60A 3V5DB 5KW9H 4HIEB 3NVQA 1MFEL 2D0GA 3GSQB 2VZSA 4CKVX 2X70B 4LVOB 3RUGA 3VI3E 2APWA 3GB7B 2NNAA 1YDPB 3KWWA 4ZDHB 3NAAL 5CZKA 3GMPA 2W0KA 3WL9B 1Y0LA 3UZEA 4JHAH 4EUPB 1AY1H 1NCAH 3RL1B 3LH2H 4OZIF 4ELME 1Q9WB 4XC3L 1LEGA 1YPZE 3FO9A 2J1KA 3QFJA 2X4PB 3NCYP 1W72B 4R7NA 3VGGA 3VCLA 4P4KC 4LLQA 4AH2A 4LAQH 4WHYH 4H1LG 2W0FB 3NFPB 1N5YL 2R2BA 3WFDL 1FH5L 2D31A 1XF5B 3KPMA 1LE9A 1J1XL 4Z7VF 1JPFA 2A1WH 3SDXE 1YQVL 4NYLA 4HF5L 3EBAA 4FQXC 3ZKNC 2X4UB 5LCVH 1U8NB 3ZE0E 3L7EA 3MREA 5TE4H 4JM4H 4K7FB 2J4WH 3V4VH 1MLBA 4JRXE 5FGBA 2SEBA 4GRLC 5AG8A 3QIWD 3MRPB 1G7IA 1CBVL 4O02L 4WWKB 2VQTA 3EOAA 2V2WA 3ULUH 3S37L 4HG4J 1AR1C 4FP8L 3RWDB 4Z0BL 3GJFK 1KFAL 1K8DA 2IPKA 1J87A 1INQB 2Q7YB 5E6IB 4IRSB 1IT9L 1D5MA 1OHQA 2R1XA 4HC1H 4POZD 3N0PB 4LSRL 5E4EC 4TSBH 1GZPA 1A6ZA 3BSZH 4OF7A 3NZ8A 2PTVA 1RV6X 2FR4B 1AD0A 5E8PB 2P8LB 4OLVL 2R0LH 5FYJH 4ORGB 4Q7DA 1FNHA 1UCTA 5DJZB 3IKKA 3RY4A 5GGQH 3HI5L 3SE9H 2P48B 4GW1A 3SEPA 4NQED 5IM7B 4ZUTB 4X7SH 5F88B 3T0VA 1DQQA 3D2UA 2V7NA 1PSKH 3C8KA 5E2WH 3U6RA 3TYFA 5M7QA 1JF6A 2CR6A 2NW2B 4HK3N 3DYPA 4NQCE 2L7JA 3PGFH 4HFUH 5I1DA 3QJHA 2B4CH 3VH8G 4JZJB 4YNYA 5L9DH 5J06A 3FRPA 3UC0H 1GCFA 1E4KC 3DUUB 2QQLL 2J7LA 4DUXA 3O3AA 3SO3B 5I1CH 3O6FA 4IRJC 4NHCL 1U8LB 1Q1JL 1T03H 3AM8A 1NL0L 4JQXC 2X4RB 3OKDB 5F7KC 4DK3A 4EN3C 1VADB 1FDLL 2G5BA 3TEUA 2P47B 5J57B 1S9XB 3F7VA 4F9PC 4TUOA 3MOBH 4WTZG 2B1HH 2HLAA 2FDBP 3TBTB 3KDMB 2Q6WB 3GI9L 4OZGA 1JNHB 2X9WA 3QG7L 5ALCH 4G43B 1UB5B 2ARJA 4FQLL 4OV5A 1S5HA 1NFIA 1DCLA 1KTDB 1W0WA 3FO1B 1A7BA 3HZYB 4P99A 4Y19D 2D0HA 4G6AD 1S9WB 4PRHD 4L8BA 5I1KH 1WBZB 4Z18A 4U6VL 1FRGL 1CICC 1KPUA 4YHKH 1PLGH 3QUMA 2XYCA 2OX5A 3CC5B 1MWAA 4MYWB 3IJSB 4BZ1L 4JM2F 1NMBL 3MROA 1MI5D 4ZSOA 4ZODA 1K2DA 2NY2B 1LNUB 1BD2D 1P4IH 3OR7A 3BT2H 1BEYL 4DQOL 1INDL 1DLFL 1JF1A 5INDA 1RZIA 4X8JB 5T1MA 1WWCA 1LE5A 3LN5B 1BPVA 4LQFH 1A7RL 1KJVB 4MX7B 4CNIB 1Y6KR 2YHGA 5ITBL 4LF3A 1A7NL 3LKPB 4HXBL 2IFGA 2EKJA 1DQMH 1NUNB 4MNQE 4YHPA 2A83A 3UJIH 4JY6A 2AP2A 1QTYT 5E5UB 3WJJA 2IGFL 5DO2D 5GZOC 1G7QB 5D2LF 3G04A 1DDHB 5JHDE 2R56L 4PRDB 5ESQA 2ZKHL 3GHEH 3EO0B 4M62H 1FPTL 4IJ3C 2E8YA 4P2YA 3FQRB 1RURL 3D25A 3T0ED 2RBLA 1N0XH 1EA9C 1HI6B 3UPRA 2Y06L 4FFWC 2L4OA 3V8OA 5HHOE 3PQYA 5IESH 5T3ZL 4MSWA 2NXYD 4NKDB 5HY9B 1XGTB 2XKNB 5FO8A 4MCZA 5KVEL 4WI5A 3MRLB 3FQNB 3PL6A 3SDCC 1JRHL 1LO3H 3MA9L 2VYRE 1KG0B 3TZVC 2BP3A 2ZNWA 5DVKA 5IQ9A 3TJHC 1NH6A 2Z31C 3R8BB 4CDHA 2DQJL 1DANT 1CL7I 5FFLA 2DIAA 3BKML 3QXDB 2X1XR 5TQ2H 3HZMA 1TVHA 1QSFB 5E2TH 1U41A 4U3CA 4NQSB 3RZWA 1LD9A 3MLPA 2W65B 3V6OE 4P5MA 5CSZA 3REWA 4FQQB 2VDLH 4A6YL 5J3HD 5T3ZE 4ZMAT 1OD7A 1XR9B 1UZ6F 2Y7QA 3UZQA 5HGDA 1X5JA 5KVDH 3RPIB 4LLDA 3A67H 4LBEB 5JW5A 5IVXB 1SEBB 1X5YA 3HUJA 4HWUA 5JDJA 4AJ0A 4P23D 5JXED 1OLZA 1AGCB 5FCUH 5CHNB 1A14H 2E7HA 1U3HA 3EJYC 4MJ5B 3OKEB 1CGXA 1ZGLM 4D9RE 1FHGA 3BGMB 2ZOLB 2W59A 1I1RA 3MRQA 2ZCLL 4BFEA 2RHEA 1GGIH 1UACH 3QO1B 4YC2C 4JHAL 1AY1L 1NCAL 3RNQA 1VFBB 3GO1H 4AIOA 4OFDA 4AIZA 2VUYA 3EFFB 5MEND 4JZOB 2AVGA 2AK4D 2GCYB 3ZDYE 2EO9A 3RI5F 1MREL 2A9NH 1SJXA 1BECA 3LSOB 1A1NA 2VQ1A 4LIQL 4F2MA 4FTVE 1BF2A 2HLFC 4K8RD 4RMRA 4AMKH 3NIGF 4R2GB 3SDAD 3EOTL 1ACYH 3QFDB 2NX5D 1HINH 4FQ1H 1EHXA 3WIFA 5BVJB 4PP1C 3RL2B 5ADPH 4RWHA 4RA3A 2KKQA 1YEIH 4J6RH 5HGGS 1H15A 4G8FB 4XB7A 5C0FB 4I2XB 4X4YB 1MAKA 4GRWB 3L95A 2JJTA 1NSNH 2Y25A 1RVFL 4Z7QF 5A2IH 5TE4L 5I74B 4JM4L 3G5XA 5FOBB 4ZOBA 3O2DH 2FWOB 3JWOH 4GUPA 2R0WH 5ESVB 5F7FA 4PBXA 3VFNB 3ULUL 3QXWA 3FT4B 2VN4A 2BCKB 3MRFA 3T0AA 2Z0BA 4N5ED 3WD5H 4XXCC 4OFYD 4UV4L 4XX1G 3BEWB 4M7ZC 4LIQE 4UZGA 4MZ3A 4QF1B 4FHBD 43CAB 4P4RB 3V6ZA 1DLHB 3W0WA 4K7PX 3QO0A 2HVKB 1KN2L 2X9YA 1BHGA 1SMAA 2V7HA 1JHKH 4HC1L 4OZHE 3RZCA 4OBSA 3BP7A 5BW7A 1MCEA 3AB0B 2A73B 3BSZL 1A7OH 1R3LA 1SJHA 4G8GB 3RGVB 1RY7B 5AYUH 1NFDA 3NGBC 5DURD 1WZKA 2R0LL 5FYJL 1DVFC 3SKNA 3CFIC 1NCTA 1I8MB 1EAPA 2KH2B 4MVBC 3D85A 3GJEB 3RU8H 3SDYH 3SE9L 4JAMA 3ULUE 3EHBD 4X7SL 3T0BA 3KJ4C 4HX1B 4KRMB 1B88A 3MRRA 4P2RA 1PSKL 4BZ2H 3WJLC 4M3KB 4WWID 5C0JA 3QHZL 5EUOA 3PGFL 4HFUL 2F54E 5D8JH 4F7MB 4LRNL 2B4CL 2AAVA 5ETUA 2O5YH 2FSEB 1EFQA 3QQNA 1G0YR 4F7EB 3LPGA 2IEPA 3ZE2E 3SE4C 1FG2A 5EBLB 5I1CL 1YECH 5D1ZA 1AC6A 3CSYA 4WO4B 1T03L 1T20A 1BJ1H 4OCYH 3HE6A 4FFYH 4NQDA 4ZG1A 2Q3AA 1KJ2H 4N8VG 5FYJE 4LLUA 5F9JB 3SDDA 4FMKA 5GRWA 4L4TD 3I3DA 1QFWI 4OTXH 3IVKA 4ZXBB 4MD0A 4MD4A 1NGYB 5IROC 3IU3A 4KTYA 3QUZA 3V5KA 5DD3H 3MV8A 1TJHH 5ALCL 5EO9B 4D9QE 1MIMH 4LCYA 5IHZA 3L5XH 2BOBA 4ALAH 1G6RH 4NN7B 3LHPL 4H0HB 2NZ9D 1CG9A 3F58H 3IU4H 3MLUH 1E4XI 3D39E 4LGSB 1D7FA 1LEIA 2VMFA 3PWLB 5I1KL 4WFHE 5F9WB 2L7UA 1KGCD 5D7KE 5L2KE 4MA3B 1VPOH 3DGGB 4UDUB 2OQJB 4XVUD 3RVUD 3AU1B 3QWRD 1FYTD 4F7TB 5I0ZA 1I1FB 1JWUA 2CIIB 2YMXH 3LKSB 4GAYA 5LJYH 1IM3B 4YXKL 3FO2A 4G6FD 3BKYL 3KPTA 2X2YA 5C0DB 1D9KC 5DYOA 3LB6C 1Q0YH 4JKKA 4DTGL 2F8OA 3BMWA 2LAGB 3SE3C 2NYYC 4ODWB 4D0CB 1SJEA 2QQNL 4G9DA 3WHE1 3BT2L 2AV7A 3ARYA 4PREB 2DKSA 4CRPA 4XBEL 1P2CB 4B7LA 5LGJB 1CXEA 1QLRB 3O3DA 1RUQL 4JPVH 4XCFH 3FAXA 1O7VA 2J6EH 4LQFL 2DLGA 4KK6D 1XF3B 4S1QH 3EYFA 3UCRA 3VXRB 1RIUH 3Q5TA 3DURA 3QDHA 3FCTA 3IRPX 2ZUVA 4PV8B 1FV1A 1FL6B 3VXSB 1T04A 2AJYL 4M48H 3QXUA 2JJSA 1DQML 3T2NH 3JV4A 5I19H 2D4FA 1AGFA 3CUPA 5C08D 2J8UA 4ZAKC 1VKXB 1T22B 1GIGH 2C9AA 3JBG7 1WEJL 3GHEL 2YN3A 4M62L 2AJVH 5CP7A 1PEWA 2GFBA 2FL5A 4LARH 3VGBA 3HAEH 3UXFA 1N0XL 4O2EA 5TDPB 3D69A 1QZ1A 3MLTB 4YHZH 5ADOH 4HBQA 2F53B 2E6PA 5ANMB 5IESL 1RAMA 4KI1A 4I3RH 4KJQC 1WK0A 4Q6IA 2X7LB 1FORH 1IAIM 4PYHA 5IB2A 3B9EA 3QDGB 4AY0A 1FN4A 1X5GA 1LO3L 3RDTA 4M00A 4HS8L 4FXKA 2WIIB 3BPLC 4YGVA 4R3SB 3MA7B 1M05B 3CFDA 3MUGA 4NUGH 3S4SB 3IS1X 4M1CD 1T3FB 2DB8A 4JFFE 1ZT4A 3BP4A 4BQ8A 3AREA 1B3JA 5IB4A 5IIEA 1P4BH 5TQ2L 3C8DA 4H0GA 4EDXB 1ND0B 2PTTA 5E2TL 1UADC 2YD2A 2VZ1A 1FIGL 1FGVH 4M7LT 1KIPB 4PJEA 1FO0L 5B38G 5H8DA 3TBWA 4DGIH 4OQ1A 1PKQA 4TVSa 4PJ8A 3ARGC 4F7CB 3HFMH 3PV7A 3Q1SL 3L5JA 3IRZA 3STLA 4N9OB 1JGEA 5C0AE 1MFDL 1MFCH 1CD9B 5B39B 5TJWK 4PJFE 3V6BR 2EDFA 2BC4A 4OFPA 1YYML 5C9JB 3DX8A 2W60B 4QHUA 1FNLA 1YYLH 5FCUL 1SY6A 1A14L 1MJUH 1UA6H 5BZDA 4NO5A 3RUGB 4J3WA 2ZUYA 3CZFA 3LS4H 4AG4H 2NNAB 1GGIL 3WHXA 3GMPB 3TFKC 1Y0LB 2A77H 2VLMD 2OZ4L 4MHHG 1K4DB 2P7TA 3F8UB 2A9NL 1MCJA 4ODVL 4P4KA 5HD8D 4PBVC 1P5VA 5CEZD 1LEGB 3GMNA 1JNLH 3QFJB 4WWKD 4YUEL 5SV4A 1XGYH 2QQQA 4W68A 1HINL 4FQ1L 3VCLB 4X7TA 4AH2B 3ZHLA 2FLRT 4N5UA 4FQXA 4J6RL 4NFCA 2R2BB 3QQ3A 2D31B 1V3KA 3KPMB 1LE9B 4CU6A 1JPFB 2IMMA 5TF1H 4QRUA 4NYLB 1NSNL 3IDMA 4GRLA 4YDVA 1QP1A 3INUH 4WUKL 1JP5A 3O2DL 1A2YB 5E6ID 4IRSD 2I9LA 3WBDA 3JWOL 3L7EB 2HTLD 2Q87A 2M8XA 2XTJB 1MLBB 3AGVA 2SEBB 4ELMA 1G7IB 3T3PE 3LZFL 4XZUA 3N06B 3EOAB 3WD5L 1YPZA 4U1GC 2V2WB 4I0KA 5DC9B 4PJGF 4K71C 1RULL 5GGTL 2CD0A 4XP1L 4WNQA 5LG1A 4JO4H 1AI1H 2FH8A 4DCQA 3I2CH 5CD3A 4JHWH 2XZCH 4NO2A 1K8DB 3S6CA 2IPKB 5J6GA 5IFJB 1A7OL 2PYEA 1I7TA 4OZIE 5D7SH 4MNHA 5AYUL 2EKSB 1A6ZB 3OJVC 3VXOA 3NZ8B 5J11B 4S1SH 1AD0B 4JRXA 2JKXA 1DJSA 3RU8L 25C8H 5BCAA 2YC1B 5CFHA 2RQ8A 3W39A 1XF1A 5CCKL 4OZFG 2HKHL 5DQ9A 4FZ8H 4GW1B 4Z7VE 5KSBB 5D8JL 2V7NB 2VKWA 4RDQF 3U6RB 3TYFB 1E4KA 1NBVL 4KH2A 5I1DB 1S3KH 3QJHB 4IRJA 5AWNH 1YNLH 4YNYB 5SV3A 1YECL 4QGYA 1MY7A 4IMLA 4JQXA 4XB8A 4XNYH 4OCYL 2EC9U 4EN3A 4FFYL 3O3AB 5E8DH 3O6FB 5FM5O 4LHJB 4F9PA 3CFJA 2XRAH 1ZA3A 1Y6NR 5EZOH 2G5BB 4KRPC 5DD3L 4N90D 3F7VB 1MIML 4TUOB 3WDIA 3QXVA 3L5XL 5TH2A 8FABA 1NMAH 1G6RL 2HLAB 4ALAL 5I30H 4YDLB 2ED8A 2JJWA 3F58L 3IU4L 3MLUL 4OZGB 2NQCA 5FGCE 2ARJB 3G9VA 4OV5B 1B6UA 4NQCA 3CGTA 2NY2D 1S5HB 1BZ7A 1NFIB 4RISH 4PIRF 1CICA 2Z91B 4L8BB 1ZT7A 4GXUN 5HGBA 1VPOL 3ROLA 1DBAH 2YUVA 2AK1L 2WZPD 1MHPL 1KPUB 1TJIH 3ZMRA 4PP2A 2AJUH 3QUMB 3V5HB 5I0DA 4YEEA 3BN3B 1Q0YL 2GTZA 4CVZA 3ZKMC 3MROB 1S7UA 3HKFA 1OP9A 4FQHB 4ZSOB 2DOCA 5GS3A 3FHQA 2HT4D 4JPVL 4KROC 4MQXD 4JANA 3ARWA 4X5WA 1RIUL 1C5DA 1JF1B 5INDB 4KTDH 5KSVA 1RZIB 3PHQB 1LE5B 5T1MB 4QXTA 2I25N 5I8OH 5F6HJ 4P9HL 1FC1A 3VH8A 4XP9L 4XVJL 4M48L 4PJHA 3FFCB 3T2NL 4YR6A 4MHHI 1K4CA 1KTKE 4DUVA 2ZG2A 1UJTA 4YHPB 2A83B 1GZQA 3RBGA 1L0XA 3LMJH 4UQ3A 4YFDB 3RVXC 1GIGL 4OV6F 1CFQA 1A6TA 1T2QL 1CFSB 2AJVL 4D0BA 4RFOL 4LARL 3CJJA 4OUUA 1ZVHA 1HHJA 3KLDA 4BFIA 4YHZL 5ADOL 3D25B 2VUOA 3VW3H 2R1WA 1B0GA 4PJBA 2ZG1A 4PG9A 4I3RL 3ZKXB 1R24A 3MV01 5FYKU 5HBBA 1FORL 3SDCA 3PQYB 1QSFD 2QSVA 3OKNA 4N1HB 4NRYA 5FO8B 1P69B 4MCZB 3TZVA 1XAUA 1X5XA 4Y5VC 5F3BA 3DHJA 2Z31A 4KKBC 4LVHB 1QOKA 4JVPA 4ELKA 1WTLA 2XZZA 4NUGL 5JHDA 4U1KA 2Y07H 2YD9A 1X5IA 2DM4A 3V4UH 1ZSDB 4F58H 4NGHH 1QBMH 3HZMB 1TVHB 2FIRT 3HFML 4KI5D 1LD9B 4KTEH 5FUOH 2UYLA 5HHOA 4P5MB 5CSZB 3REWB 3MV9E 4BSVA 5BV7H 4CGTA 1MFCL 3RP1A 1VEOA 4PJCF 5GSVB 4QRQA 5D2LE 4OF0A 5H94A 4DJMA 4JM2C 2HT2C 4EIGB 4HKBA 1QUNA 2F74A 5E0QA 4TNWF 5I66A 5JW5B 3QIBB 1VCAA 1MJUL 1UA6L 5DGRA 2M26A 3HUJB 4R2GD 5ICXA 4GSDH 4BJLA 3BZEA 1KSRA 1A1MA 1TJGH 3LS4L 4XPAH 2MQ0A 1S9YA 1YEFL 4XVTH 3UTZA 1IE5A 3BPNC 2A77L 2KQNA 4DKEL 1A47A 4PR5A 2IBZX 2RCSH 3RNQB 1ZLWH 2Z8RA 4AIZB 4NZJA 4YQXL 5BJTA 3GJFA 1E0OB 1KB5A 3BMVA 4HUKB 1JNLL 2R0ZH 3H9SA 1A1NB 2H2SD 2VQ1B 3ILPA 4F2MB 5KBNC 1XGYL 3FTGA 2GHWB 3MCLH 5EIQA 1PD6A 4NNYA 4OGZA 2FLBT 3WIFB 2OCFD 4JQVC 2IAMC 1PFCA 5TF1L 4DGVH 1R3KA 3DX7A 3K7UA 3D9AH 1HILA 1IL1A 4NN6C 3QZWA 3QCUH 1EEZA 1CXHA 1V8HA 2CSPA 3M45A 1UZ6E 4G8GD 4X9GA 4XXCA 2H32A 4GUPB 3RGVD 4RIRA 1A7PH 2XG5A 4P2QE 5I76B 5D96B 5E6ZA 4A6YA 1KXTB 1LO5A 3MRFB 4XBPA 4FTVA 1R0AH 1ZKAA 4R4ND 2VDKL 5AZEL 1RJYA 1AI1L 1SYSA 2R8SL 4POZC 3I2CL 2ADJA 1XT5A 3W0WB 2XZCL 4LVNC 3QO0B 1TZIA 2Y72A 1SMOA 3RFZC 1L0YA 2V7HB 4QT5A 3RZCB 1WFUA 4JDVA 3BP7B 1DVFA 3VFUB 1UXSA 4OGAD 1HSBA 3P9LB 3MNVB 1FSKC 4ONGH 4S1SL 4XWOC 1NFDB 3V7MA 3DVIA 3SKNB 2GUOA 4PGCA 4OLUH 5JDSA 3NIGE 1EAPB 4WO4D 3D85B 2IPUK 3B9KC 3ETBF 3L5IA 3WJLA 4FZ8L 1DQLL 2W91A 3KLHD 1B4JH 1V7NL 5C92A 1F45A 4AM0A 4ZXBD 3MRRB 4P2RB 3L3HA 4BUGA 3S34L 1FFNA 5C0JB 4M4RA 2YWYA 3VGAC 3SE4A 5EUOB 1QHOA 4Z7QE 1S3KL 2ITDA 4S0TD 5AWNL 5ETUB 4OZHA 5DUPH 2C3HA 1BQHG 4NC1E 4LSUH 4X4ZA 4NZTH 4I3GA 3CD4A 5E8DL 3RGHA 5D1ZB 5EBWA 3CSYB 1T20B 3HE6B 5IROA 3QHFL 4NQDB 3TC9A 4F37F 1II4E 5D5MF 3V0AC 3HMXA 2E6QA 5L88H 1RUMH 3Q6GH 4LLUB 3SDDB 2HH0L 3BD3A 2AJZA 4MD0B 4U1MA 4MD4B 3WKMH 4HBCH 3IU3B 5I30L 4Z8FL 1QO3A 3EAKA 1JZ2A 4N0RA 5FKPA 3JV0A 1ZLWK 4LCYB 2J5LC 4V1DE 3MJ9A 1HIMH 1CG9B 4RISL 2F54A 4U7KA 3VXNA 3TF7C 1IRAY 3R0NA 2GAZB 1LEIB 2E5EA 2YK1L 3P40A 5E08H 4HC1A 1X5KA 1ZK9A 3CH8A 1L7TH 3LY6A 4JGJA 2HG5A 3VXRD 4NC1C 3W11D 1D9KA 2XIDA 2AJUL 4CVUA 3OAYH 4P57B 3H2WA 5TQ0H 2YRZA 1ZS8A 3SE3A 3VXSD 4C83A 2KDGA 3FO2B 5L2JB 1JTPA 4NOBA 5DYOB 4GW4B 1Z5LA 1KCUH 4M6MH 4N8CH 3UTPD 3VI4F 4JVWA 1SJEB 4G9DB 5E4IA 3VD5A 3X12A 2AV7B 3BRDA 1K85A 3D39A 1JGUH 4KTDL 4HFWA 3MV7E 4O2CA 4TTDC 3O3DB 2PUQT 3ROOA 3NPZB 4ONHA 5I18H 3EYFB 3X14A 1TQCC 3DURB 3T04D 2BY0A 5L2KA 1C1EH 5TE7H 3VFSB 1FV1B 2F53D 4YHMH 1T04B 4XC1L 3ZYIA 1PVHA 1FFQA 4ZAKA 1V3MA 3JV4B 3SGEI 2IQAA 3LMJL 3KG5A 5DUBA 3QDGD 5F44A 4XNUH 5ABDE 2R23B 2J8UB 4Y16C 3SJVA 1IAOA 4HPYH 1AIFA 2CRMA 1UWEH 2NTSP 4AENA 2GFBB 3VW3L 5GS2D 4XCCH 4O2EB 3D69B 4P0DA 5ICZA 1UENA 4LCWB 4MWFB 5BS0A 3TN0C 3BEVA 2W0LA 4CMHB 3JWDH 1CK0H 4Q6IB 5SWSA 1KCRH 4CMMA 1YNKH 1AXIB 5CJ8A 4HWEH 5IB2B 1FN4B 1KTLA 3P9MB 4PGEA 3U7AA 1EX0A 1EXUA 3UEZA 1Q0XL 4HJJH 3GSXA 4ETYA 3GBML 4FXKB 4ZO7A 4YGVB 2BHYA 1EFXB 3DMMC 15C8H 2P49B 2MPAH 2Y07L 3V4UL 3CFDB 3LEYL 4F58L 4OFKA 2OMBA 1ZT4B 3BP4B 1I4FA 3AREB 3ARGA 4NGHL 5IIEB 3VE0B 1QBML 2DJ4A 4RGOL 1U95A 2AJXH 2PTTB 5FUZH 5FUOL 4KTEL 4OSUH 3TBWB 1GGUA 1PKQB 3GIZH 5BOZG 3LN4A 5HI4D 1JI2A 1J8HE 2VERN 3STLB 2CXKA 1ZA6A 3WLWC 1T7ZA 1EJ6A 1WFNA 5JXEC 1PJ9A 3ZKSD 1T66C 2BC4B 3VRLF 5F7MC 1WZMA 3QFJD 3BAEH 4HUXB 4QHUB 4GSDL 1WISA 4BYHA 1TJGL 1CGUA 1KPRA 3OAYK 4O58L 4XPAL 4NO5B 3B5GA 4L4VB 1OAUH 4QHLA 3OG6B 3KPSE 1G9MH 4XVTL 3CZFB 1S7WA 4C56A 2IWGA 1DBJH 1N0LA 3WHXB 1HEZB 1Q9KA 3HRZA 2NY7L 4GAGH 1T1XA 4QRPE 2RAMA 3NFNA 4O4YL 5C6WH 4P4KB 2XTJD 5IB5A 4E41E 2EEBA 2Q20A 5SWZE 3MCLL 4WI8A 1IGJA 4PJFA 4AT6A 5EU6E 4M5ZH 4JFEA 3IJHA 2Z8WC 3KPRB 4FQXB 4XNZB 4DGVL 3FO0H 4JCLA 3MNWB 3MFGB 3D9AL 4X80H 5DQJA 2F19L 1TDQA 3IFNL 4QRUB 1BBDH 3IDMB 4GRLB 3RWHA 4YDVB 5F70A 3CU1A 4WFGE 1FCCA 2I9LB 1YJDL 1C7TA 4ELMB 3D18A 2VXTH 3H3KA 4QY8B 2NTFA 5JIIA 4XZUB 5LGKA 3HN3A 5GSRA 1R0AL 1YPZB 5D7LE 1KEMH 1NEZB 1HYRC 1F6AA 4UIKH 3WNNA 2WUBH 5BV7C 1X44A 2G9HA 2APBA 2BSED 4P5KA 1KEGH 4DCQB 5CD3B 3Q3GA 3RTQC 3SDXB 4NO2B 3F7RA 2EDJA 3QWQB 5TDNA 5MEOA 5DJCA 1CDBA 3ULVD 4GQ9H 2DWEA 3X3FL 5GRVK 3DX9B 3VXOB 1DUYA 4GMSL 5HI5D 2JLLA 3EHBC 4OLUL 4JRXB 2FIKA 3LD8C 3WSQL 1PG7X 1CZ8H 3QB7C 2ZSWA 3O6FD 5FB8A 3JUZA 4KC3B 5EU7E 3W39B 1KOAA 1QA9A 5DQ9B 5ISZA 1PX4A 4MGXA 4QOKE 1M7XA 1E4XL 2YD1A 5E2JA 1AXTH 3LN9A 4XGZA 4ZTOH 1KJ3L 3BKJH 1S9KC 3MRNA 5DUPL 1JGUL 1CD1A 4IRJB 4LMQE 3EUUA 5KANG 4OZIA 3BX7C 3B9VA 3CXHJ 4UOW0 4EN3B 3VFTA 4JFYA 4PJGE 1KELH 1RUML 3Q6GL 5FYLD 1MCHA 3CFJB 4HJ0C 3W9DA 1U2CA 4H26A 1ZA3B 1NGWA 5D4QA 4AL8H 3QPQD 1MFAL 3WKML 3JV6A 5HJ3A 1DL7L 3N9GH 4NN5C 4AEFA 8FABB 2BVEA 1QLEH 2WNGA 1HIML 4UTBH 4OT1H 1NCBL 4DKDC 2BNUA 5CS7A 4LQ1A 4NQCB 1GHFL 4TNWK 3OXRA 2H2PC 5K93A 3IDXH 3DETC 4O51A 5DD6A 5IVZA 1CICB 1ZT7B 1F8TL 5ESAA 1UQSA 5HGBB 5C86A 3ROLB 3AY4C 3CCHA 4HCRL 5CGYC 4PP2B 1E28A 4HEPG 1Z0MA 3FFCD 3ULSA 2B8OT 5F7EH 5EU3A 2LQRA 4HW6A 1KCUL 2JCCF 2GTZB 4CVZB 2UZXB 2EEDA 4N8CL 4N0YL 1S7UB 4EUPG 4W6XB 2V5MA 4KK6C 2AXHA 3ECBB 1VERA 1D5BA 1IM9A 5CINH 2BJML 4RMSA 5EG6C 4JANB 3SKJH 4X5WB 5I18L 1F6FB 3HNVH 1C5DB 5KSVB 2BRRL 1C1EL 2NR6D 4RX4A 4BFGA 3MGTA 1IC1A 3IKCB 1QFWM 1D5IH 4YR6B 1KJ2A 4N0UA 3PQYD 1K4CB 4JJ5B 3U4BH 2I07B 5F7NC 2G2RA 3CVIH 4L3AA 2QTEA 1GZQB 3CK0H 4UQ3B 3DUHA 5GS0H 5FYJU 4YFLF 4HPYL 1CFQB 4IJ3B 1UWEL 1G6RA 4D0BB 3O6LL 3GNML 2HFEA 4OUUB 4XCCL 3IDYB 2WLYA 1HHJB 3H0TB 5DJ8A 3WV0A 4BFIB 4PJAF