5I19H

Crystal structure of human germline antibody ighv3-23/igkv1-39
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i19H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i19H01
4L29A 4EUPA 4ORGA 4NYLB 2UWEB 3ZTNL 5JZ7D 2ITDA 1JIBA 1HNFA 3JV4B 4PUBL 4NO0A 1XFPA 2VDQL 3X17A 2P5WD 1JYXA 1TENA 2ARWA 2Y1VA 4OD1H 3RPIB 3HNTH 4C57C 4EZMA 1FFNB 4RA0C 1VFBA 3HC4L 4U1NA 4N5EC 2VL5A 5GHWL 5IB5B 1C5BL 5CGMA 4AIOA 5E2WL 3EAKA 4MS8D 3I02A 4TTGA 3FT4A 3NTCL 3Q2CA 1A7QH 5D1ZA 4FQLL 1JI2A 25C8L 5CD3B 1U8PA 3CX5J 3K8LA 2X7LB 1CXLA 4KMTL 2NXYD 4KZEH 1X7QB 3HG1E 5EFIA 3QDJB 2F74A 3FB6A 3U0TB 2EDLA 1U8NB 4JRWA 4WTZA 5DRWB 8CGTA 4X4YB 2R0ZH 3W9DB 1S7UB 5I76B 2NY2D 4PRNA 3V0WL 1YECH 1CLYH 1QFWL 3G04B 4HWNA 2BY3A 3MOAH 3MSPA 4NN6C 1CR9L 2VISB 3DI3B 3WO3B 3JV6A 3JV0A 1GH7A 1AFVL 2P8MB 5GGVL 4NN6B 4X6DA 1YC7A 1UXWB 3B9KB 1N4XL 4NFCA 5HJ3B 4U6TA 4F7MA 1A1OA 5EU5B 4BK4A 3DO7B 2RFXA 3IJHA 4GQ9H 5CIPB 3ZDXF 2FIKB 3MZGB 4Q58C 2APWA 1T0MB 4OIIL 4RFNB 3QQ4A 3RVTD 2DF3A 1NGQL 3G9AB 5C0RL 2RB8A 4JN1H 2CH8A 5CZVL 4P5TC 4V1DA 2XG5A 5E2TH 4R4FL 1AY1H 5KOVC 3QPXL 1MLBB 3G6JE 4LBEB 3EJZC 1QRNA 4P5KB 4P5TB 1CGSL 4RAUB 2BZDA 1S7XA 4IOSD 4Y7MA 3F6IA 4H8WH 3G08A 4H0GA 5DYOB 1XCQB 1EPFA 2VLLB 2XXCB 2CRZA 3WNMA 2NCMA 3KYKH 3LV3B 2E7MA 1LP9E 1L0YA 1PYWA 2ICWI 4S10A 1J87A 5JMOC 4LCUB 1QFWI 3PL6B 2OM5A 4XPTH 3SGJC 5K9KB 4IOIB 1ZANL 5F7EL 1J18A 2CLZA 2AXGA 1NMAH 2YPVL 1M7IA 1DVFB 3EFFB 3KPNA 4MMXC 1FRGH 2V7NB 4OI9A 3KYAA 2A77H 4ALAL 4I2XE 1NFDE 1QFPA 4M6OH 4ODUB 1DE4A 4YHML 1Q9WB 4PREA 3JWDH 3KLSA 4PJHA 5DZLA 2Q8BH 5HGHB 3MLTB 5KANI 5C08E 5K33A 1MAKA 5KS9F 2CKNA 4G9DB 3W39B 5E9DB 4BQ9A 3HLAA 5E03A 1OWWA 3L5WB 2OR7A 4MAUH 1T5WA 3SDDD 1NC2A 5E8EB 2CLRB 3EYQC 4DN3L 4NBZB 1JPSL 3AS3A 2W0LA 3O3DB 5EOTA 5JDSB 2EECA 5FM5O 1DBJL 1P84J 5HGAB 1KTKE 1YQ2A 5C07A 2Y5EA 2FATH 5TPWL 4X8JA 2BXZA 4G6AC 3TZVC 5E8DH 1J0YA 1S7SB 1AGEB 2DIJA 3PE9A 4XH2A 1CFVH 5DJ0B 1CDUA 3MACH 4LCWA 5I8KL 1C7TA 2ENSA 3TZVB 5DEGA 5HPMA 1TTUA 1MCJA 1F3DJ 4CDGC 2AXFA 4Y4FA 4WFFE 1JGUH 1DBMH 1EO5A 1RZ7H 4MB5A 4R7NA 4Y4FD 3U30C 2GTWA 3ULVE 4OFPA 4RZCB 2I9TA 3QA3A 1TCMA 3K4ZA 4PJCF 3U30B 4HXAL 3WYRA 4A2LA 4RMTA 3J8F7 1J1XL 2ICWB 1X4YA 3ARGB 3C6SB 3BWAA 3X11A 3W2DH 3GIVB 2MNUA 3QULB 2P8LA 3F5WB 2VLME 5JPNB 5E0QA 4K7FA 3N06B 2G75A 1CD9B 4Z95H 5FGSA 3GJEB 2CDGA 4YAQA 2NX5D 1Q9OA 5CIPH 5K93A 3P30L 2SEBB 3H9ZA 5DMKA 4ZUWB 4EI5C 1HXYB 1S9WB 2YUVA 5LAXA 1DEDA 4R3SA 2I26N 3SKMA 2ZUSA 1HSBB 3VE0A 3RDTD 4EI5B 4AIZB 1H3UA 2QHRL 4FFWC 3MGOA 3ARBB 2Y25A 3S35H 2NY1C 4P3DA 4HK3N 4XC1H 4G6ML 4OV5A 3BPNC 4PGZA 1AGFA 4XVSH 5I1DA 1EO8H 3AXLA 3KYOB 5GRJL 2BJML 2NY1B 1ZVSA 3HR5B 3RBGA 2FHFA 5DO2C 1MCKA 4ODXA 1MJUH 3E0GA 3FMGL 3PV6A 3BPNB 2MOVA 2AK4D 3SJVE 1KIQA 5EZOL 3REWA 5EN2B 4PJIF 3MCLH 1D6VH 1EUUA 2YN3A 4B7LA 4BH8B 2VH5L 2YMXL 4WHTB 1UJTA 3SGDH 3OR6B 3MZTA 5EDXA 3OL2A 2QQKL 1UWEH 2HRPH 5GISH 1H8OA 4ZPVB 5B4MC 4Y2DC 3S5LA 1QSEB 2EE6A 2VLKE 5MP6L 3KYNB 4IS6A 4XBPA 4HIJB 1MREL 1C7SA 3OR7A 3SKOB 5LGJA 3GRWH 5DFTA 3IDJB 3DXAE 4N0UE 3WN5A 5D1QD 5FO8A 4PS4H 5EUKA 1G7IA 2D7MA 4FNLL 3BD4A 2VSDA 9CGTA 2AJ3B 2R1YB 1CICD 5LCVL 4UNVA 1RJZA 3C2SA 1I9RL 3FB5A 3ZTNH 3G5ZA 4HAGA 2CK2A 2W0PA 3N1QC 4RNRB 1W8NA 4PUBH 1SJHB 1M05A 4BUHA 1EHXA 1BVLB 2VDQH 4I48A 4XT1C 2XWTA 1WITA 3LKNA 3DX9A 5TGBB 4L3AA 5E24E 1R3JB 3E6FB 5EA0L 5HGBB 4IEFB 4Z7QF 2HG5A 3HC4H 1A9EB 2C3HA 2H1PL 2J12B 4FQCL 5GHWH 1C1EL 3QHFL 5FHAL 2VN4A 4F57L 1UJ3A 1C5BH 1XH3B 1U41A 4BKLA 5E2WH 3DVNB 5C86A 3ULUD 5C0BD 3NTCH 2Z35A 1CK0L 4FQLH 3VRJA 25C8H 3BIAX 2O5ZL 2NY5L 2J8OA 3ALWA 1KPUB 3MRLB 2IAMD 3OKKB 2EICA 3N1FC 4KMTH 4JQXC 3BJ91 4YBQD 1NJ9B 1WBZA 3GGWA 3FFCE 1UZ8B 1HH6B 1K4DA 3RFZC 3V0WH 1D5BA 1HHGA 1QFWH 5BZWB 1CR9H 3T0AA 2E6JA 3ZKNC 4WHYH 1AFVH 4NNXB 2O5YL 5EO9B 4ZS7L 4LF3A 1IGFL 2BHYA 1N4XH 4BQBA 1T1XB 4LSVL 1C5DB 2WBJD 4JY6A 5D2NC 1A64A 2CIKA 1BZ9B 4PJAE 4OIIH 1Z5LA 2ADIB 4UOW0 1HOCA 1NGQH 3IF1A 3QXUA 5IJVA 5E8NA 4Z7WB 5C0RH 3B9VA 1Y6MR 1RHFA 2X4NA 5CZVH 1OTTC 5I8EB 3O8XD 3M07A 1FL5B 4LSPL 1PLGL 1NKOA 4QRPA 4R4FH 3QPXH 1W0WA 1CGSH 3TYFA 3PQYE 3FFDB 5IW1B 4G7YL 5F1SA 3M17A 4RQQA 2LTQC 1KTLA 3ROLB 3T2NL 4ZUVB 4FXKA 5I0ZA 2FHCA 2J8UE 3O41A 2P7TB 3PWNB 1J8KA 1JZ2A 4NQVB 2LTQB 5T33H 4PJ8A 4F15C 3BD5A 3RY4A 2A6DB 1II4E 5HHXL 1ZANH 5F7EH 1KCVL 2X1OA 4MD5B 4NRZA 1AXSB 1Z9SA 2WK2A 4LHJB 2YPVH 4RRPA 4F15B 2IGFH 4YWGL 4P49A 1S78D 1JF1B 4ALAH 2W65A 2C7UB 4OD2B 4DGIL 2NZ9C 4LLDA 4YHMH 1OVZA 4JVWA 3H0TB 4JO1L 2YS4A 4OT1L 2R4SL 2IPTL 3FQNA 3RIFF 3PP3H 4RX4D 3RWDA 3HB3D 3VMPA 1ED3B 2GY5A 4IM8A 1CBVL 3ELAT 3EO1A 3BXNA 3MX0A 4QRRA 3RL1B 3ZHLA 2OR8A 2YC1A 1JPFB 3ZHDA 3IXTB 1LE5B 4MXVE 1SVCP 4XTRC 3VXQB 3MPCA 4W6WB 1JPSH 4Z7VF 4XX1E 3UTTE 4BFIB 1SYSA 4JDVB 3ARFD 5BVPL 1HEZB 1OSZB 1DBJH 1P2CB 2X4TB 5DJXB 3GMQA 3FO9A 3QZWB 2VQTA 5DURB 5TPWH 5EORL 2VLRE 1LO2L 5E8OB 3WFBL 1T80A 3CFBB 2HLFC 4QXWA 3I2CL 5I8KH 4ZPTA 2NQCA 3IDXL 4Z7OE 1F02I 1NCDL 1VADA 2MFNA 3D0VA 4L3CA 1GZPA 1U8KB 1MEXL 2FGZA 4WFHD 2H8PA 4HXAH 3S7GA 1R5WB 2PETA 4UB0L 1G9EA 1UB6B 4HQQL 3D2UB 2DQDL 3QG7L 1Z9OA 2X44D 5ISZA 5GZOC 5C0CA 1IILE 4PRHA 4LAQL 5CKGA 2ZOLB 1FFQA 5IHBA 4QF1B 1OW0C 4Z7UE 1XGTB 3P30H 2VLJE 4JGUA 1T0PB 3HUJE 2VDKL 4DZ8B 3MTRA 5E08L 2H26B 3W5NA 4NHUB 5T1LB 3UDWA 2BNQA 2QHRH 3GSNL 1RZGB 3MC0A 2X4SB 4OUUA 2JJTA 1EIBA 1NLBL 3QUYC 4OLWL 4P99A 3KVQA 1RZ8A 3NH7L 4G6MH 4GRMA 2ATPA 2BCKA 2RAMA 3QUYB 4L8DB 5GRJH 2BJMH 3FN0L 5J89A 1X4XA 4QLRA 3FMGH 4R0LA 5FGBC 2WQ8A 5EC2B 2GYSA 5EZOH 1CDHA 2R4RL 2QKIA 4L4VA 43C9B 3STLB 1EEZA 1I8KB 4U1KA 2VH5H 2QSTA 2YMXH 3QCTL 1G7PA 4LEXL 4Q7DA 4OGAD 4F9PA 4CW1B 1QBBA 4E41B 1H15A 2QQKH 3B4NA 3DBXB 4OSUH 3MREA 3WFEL 5JW3L 4JDZA 1JGDA 2UYLA 5MP6H 3VW3L 4IIQC 2E5EA 4G6KL 5BOZG 2B5IC 1GOHA 3UTSA 1BZ7A 4IIQB 3GBNL 2QR0B 1RK1B 5EOCH 3VFGL 4QOKE 1I7UA 4OKDA 5HVHC 2F54A 3T0DA 3PP4L 1I3GH 3MV9D 4PJ9A 5DR5L 1LE9B 3DOSA 4LDLB 1I9RH 4BFBD 4Y19B 5HHMD 5A2JH 1FZJB 1NH6A 4F7CA 2A0LC 5DJCA 3FO2A 4HUNB 4NGHH 2M26A 1I8IA 5DRXB 1LP9B 2R0LL 1ZLVH 6CGTA 1MI5E 2YUZA 3LRSB 5EA0H 4X6FB 1UADC 2YEZA 3QO0B 3HZVB 4WO4C 2H1PH 4MX7B 1A2YB 5C0AA 3I84A 3QHFH 5FHAH 4F57H 4OLVL 4X4ZA 1R5VA 2EIZB 5F3HB 2G9HB 1CK0H 2PCPA 5SX5H 1CT8B 5CBAA 1NFDB 1A14L 1KPRB 2PW2A 2O5ZH 3WCYA 3SKNA 4XRCB 3NZ8A 5HGDB 4G80B 1WBYA 1HYSC 2F53E 3MYZA 1QR4A 5C08B 3QWOB 2HJLA 5KW9L 2WUCL 1MCHA 3KHOA 3RL2B 3NFNA 3IFPB 3QHZL 4WFGD 4PD4K 4U1JA 3BRGC 1TNMA 2O5YH 1FVEB 4PRDB 1F11B 2DQJL 4ZS7H 1CFBA 5AUMB 5IK3B 1IGFH 5F6HI 5MHSE 2NY3D 1E0OB 3TVMD 4LSVH 4YR6A 3QI9D 3HC0B 2VIRB 3W82A 3F7VA 4LNRA 2VDPH 5DF0A 1GPOL 1D9KA 2BVQA 2LU4A 3NAAL 5I8OL 1WCBB 4HUVA 3IVKA 3TP4A 5H37G 5TQ2L 3ULVC 4LSPH 1XEDA 1NC4A 4F7PB 4B5EA 1YY8A 1YEJL 5IESL 5I1JL 5KVGL 4XXCC 3ZT7A 4YEEA 2APBA 4G7YH 1YN7B 5E6YA 1NLDH 4P4RA 5I16B 5KSBF 5DUPL 1UXSB 3T2NH 3QEUA 4GRLD 1RSFA 4PP1D 2QLVB 4WUUD 5IVZA 1QO3A 3AMKA 2CXKA 2BVYA 5HHXH 1DLHB 4OFYD 1RI8A 3VGDA 1KCVH 5FB8A 3BIKA 1INQA 3TN0A 2YR3A 4YWGH 4MQ7B 1BPVA 2R1WA 3QXVA 3P4NB 1DDHA 4Z8FL 4DGIH 5F89B 2B39A 4YHIB 4IDLA 5FCUL 4KRPC 3CFEB 2HMIC 1ZHLA 4JO1H 2R4SH 5EBMA 2IPTH 1OGAE 4KRPB 4DGVL 3BN9D 3HKFA 1CBVH 3OAYK 1IM9B 1F58L 1MCQA 1SMAA 1OT1A 3KXFE 5K59E 5C0IA 4NQCA 5IM7B 1E6JL 4ZUSB 3TH3T 3SBWC 1U36A 1JUFB 5F9DC 3RTQA 3MRRA 4GW5B 4G8EA 5CZXD 4MDIA 2KZWA 3SPVB 2BOBA 3SHSA 4HJJL 3SJVB 3T1FB 5BVPH 3FRPG 1IGYB 3VWJC 4I4WB 2DS4A 4ZFZB 1WT5A 4QRTA 3GSXA 3MGTB 3QUZD 3ZDYF 2MCG1 5J8OA 2ADGB 3WNLA 3WFBH 3VFWB 2VLKB 3I2CH 3B5HA 3CFIC 3NIFF 2VAAB 3I6GA 3IDXH 2VITA 3HNVL 4LARL 3HZYB 1NCDH 3PNWA 5CJXA 2EDFA 1IRAY 3DXAB 2X10A 1ONQA 2R8SL 2AEPL 4N0UB 1HQ4B 1CVSC 4M3KB 1H8NA 1MEXH 3MBED 3B5GA 4LPUA 4APQA 1FPTL 3QPQD 4UUJA 4HQQH 2DQDH 3QG7H 3CFCL 4G8GD 5SX5K 4RGND 3BGMB 1K8DA 4EN3B 4LAQH 2VUYA 4OZGA 4NDMA 5JIKA 2M1KA 2YD6A 2V5SA 1YNTA 1NDMB 1J8HD 5DMJB 3MV01 5D4QA 4Q9CA 2VDKH 3G6JF 3O4LA 3OXRA 4X99A 5E08H 3HPLA 1IGTA 3GJFB 4ZFOL 2YK1L 3MODL 5IIEB 4XCCL 2IAND 3LSOB 5KSUA 5IKCB 3GMRA 3GSNH 2KKQA 1JE6A 1LP9F 4XNYL 2W91A 5H2BA 1NLBH 4OLWH 1P9MC 5DJ8A 4JY4A 1KIPA 3NH7H 4D0DB 4D9RD 4QY8B 2B20A 4UQ3A 1S7VA 3FN0H 3UO1L 4TNVK 1K5NA 2KH2B 2BDNH 5IMKA 2R4RH 3QUKA 2VERN 4LEXH 3QCTH 3VFPB 4PJGE 1T1YA 4U1MB 3SGEI 5IQ9B 2VXSL 4NQSA 3WFEH 5JW3H 3OHXB 4DJMA 1INEL 1LK2B 2VR4A 3QXWA 1EEYA 1WWWX 3VW3H 1JWSA 3MRQA 4KK9C 2DQTL 2WBKA 4G6KH 4PJAB 3FCTA 4WENB 3JV4A 5ELIA 5EBWB 1YMMA 1S7WB 1KOAA 1CXFA 3DSFL 2E7LA 1FZMB 3GBNH 4NM8L 4L1DA 1D5XA 1IAOA 1X5GA 3VFGH 3X13A 5I30L 4JRXA 1EHNA 3KWWA 3U0PA 3PP4H 2GK2A 5DR5H 2DI9A 4EI6B 3VJ6A 4PJEE 4IHOA 5IB5A 3PQYB 3PIQA 4HH9B 1BQUA 4MQXC 3RWJB 3VFVA 1BF2A 4N5ED 4JG1L 1GHFL 3V6ZA 2R0LH 4EIZC 2X4PA 2J8UB 1XF4B 4Y89A 4WHYG 5JO5B 3MV8A 3UZVB 4IMLB 1MQ8A 4MA7L 3T3ME 4NKDB 2ZOKB 5SWZB 5JIHA 4RMSA 4Q9QL 3QDJD 2VN7A 4Y1AE 2VDML 2VZ1A 4X4YA 2H32B 4OUOA 1X5ZA 1S5IH 4KPHL 3WFHB 1QHPA 2MWCA 2VISA 1X5IA 3HS0B 4LGPB 1A14H 4Y5YC 4GKSA 1CQKA 3MV7A 1PBYA 2AGJL 4JY5H 3L3DB 3B9KA 1EA9C 1V3KA 3MROB 4XAKD 4Y5YB 1EBPA 5KW9H 5F7DB 1NEUA 2WUCH 4HEPG 4PRPE 5D5ME 5HJ3A 2B2XL 3VXME 2ZSVA 3G5YB 3QHZH 1HQRA 1T0MA 4HLZH 2C26A 3MMEA 4R2GC 2H2SC 5J56B 4HKJB 1FGVL 4WEMB 3GKZA 3TBYA 2DQJH 5I1AA 1JN6A 1N6VA 4JFDB 4R2GB 5H94A 4KWUA 2CIIA 3DUHA 3SE8L 1R3KB 4LBEA 4P5TD 4YDLC 4NQTA 5D2LE 4HWBL 5DYOA 1BFOA 3ARXA 1GPOH 3KJ6L 3VFNB 3EDDA 2VLRB 3EO0B 3EJZD 2X70B 3NAAH 4G5ZL 4YDLB 3LV3A 5I8OH 4ZFOB 1J0IA 5TQ2H 4X5LA 3EYFB 1S7RA 3O2VL 1REIA 1YEJH 3PHQB 5JMRA 3PL6A 1LHZA 1Q94B 5T3ZE 5IESH 4IOIA 1IGJB 5I1JH 2XG4A 4S0TD 5DD3L 5KVGH 4NQEE 4L9LA 3MUGA 4O58L 5T5FL 1DVFA 5DUPH 1DVFD 2YXMA 3S37X 4TN9A 2C3WA 3CVIH 4LOUC 2Z31A 3DVGB 4LP5A 5SV4A 4M4PA 1Q9WA 3GRWA 5C0EA 1RHHB 5F1NB 1FNLA 5HPOA 3TT1L 3MLTA 4XI5C 2OBGA 3CUPA 4WW1B 3RP1A 4G42B 4HHAB 4XCEB 3RI5F 1ADQL 1UEYA 3W39A 4Z7UB 1M6OA 5E9DD 1DFBH 2D7TH 1MY7A 5DQJB 4EDWL 3BVNB 3C9NA 5A43C 5FCUH 2E7CA 4Y0GA 1ZV5A 4F37K 2CLRA 3MFGB 4X9HA 3RGHA 4HGKC 4HPOH 4DGVH 3P77B 4LPTA 3EYQD 1F58H 1N5YL 3EOAB 3F58L 3U82B 1E6JH 1YEKL 2CSPA 2DM3A 1JYNA 1XIWA 3DO3A 1ITBB 3SDXE 5CEYA 4HJJH 4G6AD 5AEAA 1X6NA 3TZVD 1ZHNB 4FXGA 5CUSL 1ZLUH 1IT9L 3GK8L 5B3JE 4RZCA 2YHGA 5I74C 2H32H 1KLFA 4PGDB 1JRHL 3H7BA 2YD8A 4NO2A 4HEME 3FQWB 3I75A 3ARGD 4U6HA 3U9PL 3HNVH 5MEOA 4LARH 1RD6A 3F5WA 3CZFB 5I18L 2V5MA 2R8SH 2AEPH 5FKAB 1FVCA 3FOLA 3NN8B 2DMCA 4PRBB 5KBNC 3WJLC 4I77L 3MOQA 1KELL 4NC1E 1FPTH 5E94B 1AC6A 1HXYA 2UV3A 3KGRA 3CH8A 5HHQA 3K0WA 3SGEH 3WE6A 4ODWB 4UQ2B 4HWUA 3QNZA 5AG8A 4EI5D 4RSVA 5FDWA 1OD7A 3ARBA 2EE2A 2FL5B 1MI5B 3U36A 4P2QA 4M1CC 2BSED 3NIGE 2V7HB 1Q1JL 1A22B 4OQ1A 2WV3A 4NT6B 5AG9A 2NY1D 4W70A 2YK1H 3MODH 3RWFB 3EDEA 1JRHI 4BZ1L 3DURA 1ND0B 4G43A 3MRJB 4P2RE 4XNYH 1DTUA 2GJ6E 5CMAB 3T4AA 1ZGLB 4MNQB 5DO2D 5AYQA 1KLUB 1BQHG 3PWUA 4CVZA 2F53B 2DJUA 4KC3B 2MJWA 2X9YA 4XC3L 4MHHI 3E8UL 3DMMA 4L3EA 3UO1H 5GSVB 1QSED 5H8DA 3GJFK 3KYNA 1OL0A 3ZSSA 3CJJA 3SKOA 3B9AA 1R3HB 4LIQE 4DTGL 3CXDL 5J1AB 3U6RA 2VXSH 3UTPD 2BC4A 1INEH 2AJ3A 2PXYA 2R1YA 4PB0L 4W4NA 5T1MA 1GYAA 2DMKA 1M1SA 3MJ7B 4ZUTB 3QZWG 1QZ1A 2VABB 4NUJB 2DQTH 1VERA 4G8FA 2EDXA 5F3BB 2FLBT 3DSFH 2DWEA 1BVLA 2DKUA 4NM8H 1YEDA 5I30H 3SO3C 1XGUB 2JCCB 4K9EL 5ITFA 5KSAC 3L7EB 3IDIA 1PG7W 2FGWH 5MENA 3SO3B 5IHZB 4WI2A 3REVA 3QXDB 4MYWB 1XH3A 1JTPA 5KSAB 3FB7A 2DQCL 2OI9B 4HKXA 4I3RL 4X6CB 3CAFA 4OZFB 3DVNA 2V9TA 4JG1H 1GHFH 3U46A 3CCHA 1V05A 3ISWA 2EE9A 4Y8AA 1IC1A 5E00B 4P0DA 5GS0C 4KDWA 4RIRB 4MA7H 4PBWD 3KLAB 2ZUWA 4NFBA 2BY0A 1I75A 4Q9QH 2VDMH 3BN3B 4OBSA 2ATKA 5GGRY 2X09A 2R2EA 2UZYB 4KPHH 3KPSB 3PWPD 3GSUB 5MI0B 4NQXA 3E1F1 2FH8A 3CDFA 4BQ8A 2AGJH 3IETB 2HVJA 3ZKND 4EXPX 5HXMA 2NTFB 2B2XH 4HG4J 1A5FL 2AV7A 4GG8B 4P3CL 5JOFA 4Q9BA 3T4YA 5BVJB 1KG0B 3KXFB 3WS3A 3WS6A 1BIIB 1F13A 4QTHA 3VFMA 2OLDA 3HUJF 1FGVH 1IC4L 4M7JL 3VH8B 5BW7A 5KVFL 3H9HA 4JM2C 3BPCB 5I8EA 3QRGL 1UZ6E 3WIFB 1A7BA 4JLRA 4JM2B 3SE8H 1OTTD 4YXLL 4TTDC 3AS2A 4HWBH 3K80A 2I24N 3KJ6H 1FSKC 4GRWB 2JTDA 3ET9F 3TNMB 4G5ZH 3V0AC 3QDGE 3HI5L 5IFJB 4MD0B 2ITCB 3I6KA 1A4KB 1FSKB 3PWNA 5CD5C 4JZJA 3O2VH 3ES6B 2R2BA 1UENA 2R23A 1QEWB 1JPGB 2VMFA 1IEBB 5IR1A 4O2FB 4WTXA 5DD3H 1TZGL 1IGCL 2OTUB 1UH3A 5T5FH 2E7BA 1KIUA 4M7LT 3VMOA 1TJIL 4M43L 1QNZL 4RBPK 3RPKA 2F58L 5FOBA 3KPMA 1TPXC 4HKZA 2WP3T 1AHWB 1BJ8A 3WLBA 1U3HB 2R0WL 3TT1H 3H0TA 4IRSC 3MJ6A 2YD4A 1BQHA 2VWEE 1RU9L 2ORBL 1OAQL 4UT9L 4ONHA 2NZ9D 1ADQH 5FM8A 3VA6A 4Z5RB 4UTBL 4IRSB 2AAVA 1NGWB 1XR8A 1YNKL 2CLVB 3JV5A 3LQMA 3DROB 2Y36L 3O3BA 4EDWH 3PWVB 4GKOA 2X4QA 3LB6D 1D5ZA 1ZE3C 3QCUL 3L5IA 3ZYZA 3S9DB 4XTRD 2R69L 5IEKB 4HIEB 1MCRA 1N5YH 4HZLB 3QZWA 1RZJL 3P4LA 3F58H 5F7YC 5DURD 3EGSA 3WDJA 3DTXA 3HZKA 4BH7A 4RFEA 3C6LA 2AP2A 2IPKA 2XN9A 1MVFA 1YEKH 4Y4KC 3L1OL 4FZ8L 1AGCA 5SX4I 1K3IA 2OMNA 5IMLA 5L2JA 3MRKB 4I18B 5CUSH 2HLFD 4PJGB 4S0SD 1IT9H 1RQ5A 2GJZB 3GK8H 3QUXB 1BD2A 1A47A 2QEJA 5GS0H 1FLRL 3UX9B 4LSRL 1CXIA 5IBLC 5ETUA 1AKJB 1JRHH 1R5WA 1PW3A 3MJGX 3QFDB 5IF0B 1GC1C 1UB6A 5EBGA 4Q2ZA 3U9PH 3S8WA 1N5AB 3D2UD 5JXED 4CMMA 4ZAKA 4OLYL 5I18H 3AC0A 3BD3A 3C60C 3DX7B 3BEVB 2VDRL 5LKNA 3VA2C 4PLNC 1X5AA 1T1ZB 2G5BA 4HKBB 3C60B 1ETZB 4I77H 1KELH 5J9PB 2EDYA 1T1WB 4S1DC 5I17B 3VDAA 1ZWIB 1FO0L 5E5UB 3ARYA 4WI4A 4OZHE 5F7WC 4YPGB 1U8JB 4LPVA 1WGOA 4DUWA 5T1LD 5TDPB 1RZGA 3UROR 2ICEB 4PBVC 5FV1L 2X4SA 4ZXBA 4FQJL 4X6DE 2QQQA 4NRXB 2W0FB 3A6CL 2P45B 2PW1B 3BKMH 1Q1JH 5E7FA 5TQ0H 4GRWH 5GGQL 3QUYD 1ZKAA 2XY2A 4Y1AB 3AY4A 5TH2A 3K7UA 2JIXB 5AZ2L 5ICZA 2RHEA 1MHCB 3OJ2C 4XB7A 2LU7A 4N1CA 1L7TL 3QG6A 2EH7L 1XGQB 4V1DE 3SE9L 3ZZ1A 4JRYA 5A2FA 4CNIA 1NEZA 1B2WL 4E41A 1HH9A 4JFFA 4E41D 1F3DH 4XC3H 1QRNE 3E8UH 2XZQL 5D5MB 3L3KB 2EDDA 4I13B 3VXMB 1CXEA 1EHAA 2C1OA 3EYSL 4HIIB 1CGYA 1FP5A 1QD0A 3MLVL 4DTGH 3CXDH 2NY0C 3OB8A 3HA0A 1RK1A 3U4BH 3S35X 4PB0H 2NY0B 1P4LA 3VWKC 3CX5K 3TIEB 2MPAH 3MCKB 5D2LB 1ORQB 2Y5TB 3NCYP 1HSAB 4Y19D 4ZOBA 3VWKB 2C3XA 5CWSB 2J3SA 5K59F 4O51B 5MERA 1CGWA 1W72L 3CSYA 4GXUN 2A0LD 3PGCA 1P7KA 1M7DA 2GHWB 1AQKL 1F4HA 1IC7L 4PJHE 4X6FA 4K9EH 3QO0A 4U7KA 1U92A 2YPKB 4QHLB 3PJSB 4GBXA 3BP4A 5DFWH 2DQCH 1FNEA 4ZFGL 4I3RH 4WO4D 3OGCB 1KJ2L 3O2DL 3TESA 1ZXQA 5EZJA 4CADB 2YZ8A 3JTSB 2A6JA 4KH2A 1GZQA 1CT8A 4PRAA 5FECA 4MVBC 5KVMC 5HVFB 2FJHA 2VZVA 4XRCA 3UPRA 4QGYA 2OL3B 3P11L 1QLFB 5JW4N 3QWOA 2E9IA 3QUML 5C08D 5C9KA 5C07E 3QAZC 4JHAL 3KNBB 5KTEH 4OLUL 4WW2C 3AM8A 4H26A 4K07A 3QAZB 5GGSY 1F00I 4LCWE 4LSQL 5CLWA 1CDYA 1ORSB 4IDJL 1UVQA 1KXVC 2YOCA 4PRDA 1FAKT 2PTTA 3HC3H 2H6PB 4C83B 3CH1B 2K9UA 4XZUB 3L6FA 1A5FH 1EJOL 2YBRB 4P3CH 1JP5A 1T7WA 4JHZA 1DN2A 1FO0B 3KDMA 4XMLL 1VFAB 4TULL 5D9SB 5F88A 3NBNA 4U6YB 3GMOB 1IC4H 4M7JH 4P3WA 3W9EA 5KVFH 1XF1A 3QEHA 5KZCD 4GW1A 3QRGH 1CFSA 1Z6JT 3G5VA 3GSNA 4MJ5B 4F7PA 4X98B 2X41A 2XICA 3V6BR 1T66C 4YXLH 1ZMYA 3ULVD 1IM3A 5C0DB 4MNGE 3LPWA 1FV1B 3C8HA 2NW2B 3HI5H 1UXSA 5GRXG 4HJGB 3BYTA 5L2KA 5E1AA 1NCNA 2BXYA 3HR6A 4JR9L 4K8RL 2XI9A 3MUY1 2VLMD 2QBWA 5DI8A 2J6EL 1DLHA 1N8ZA 1TZGH 1IGCH 4NC1C 4NQUA 5IG7A 5IB3B 3EOBB 5SX4H 5ACZB 2XA8L 1TJIH 1QNZH 2DYPB 4ZYKA 5FF6B 2J88L 1FJ1B 1P84K 2F58H 2FWOB 3EDFA 5DJZA 4KJQC 3SO5A 4ZFFB 3X12B 3HTLX 3MRCA 3QJHB 5EU4A 2AK4E 3RZCC 4MAYC 3S34L 1U91A 4IBLT 1RU9H 3MRMA 4LSUL 2ORBH 1OAQH 4UT9H 2PO6C 2CKBL 3RZCB 4KRPD 1YC8A 4UTBH 3SDAA 2HMID 2CR3A 3M8OL 1A6ZA 1HHKB 1YNKH 1IM9D 4D0BB 3UP1A 5F6IB 2AJXL 3QDMA 4PJ7A 4PJEF 3SGKC 2WANA 1GIGL 3EHBC 4GAYA 1G7HB 5K9JL 3SEPA 3FQUA 2PKDA 5D7IA 2HFEB 3SPVA 3U83A 4J1UB 3AS0A 4LHUG 4YGVA 3QCUH 5IOPB 3OX8B 2E9WA 4P4KB 3SJVD 3RX7A 4ZO6A 4P2RB 2R69H 2GJ6B 1IGYA 1HNGA 4I4WA 2GAZB 3QJFA 2WLZA 4ZFZA 5T1DL 1RZJH 1RZFL 3DRQB 4MJ4A 4NC2B 1OARL 3KS0J 3HE7C 2UY7A 3L1OH 4C56A 3CPLB 4FZ8H 3X14B 3KYMA 4WU7A 3TIDA 1N59B 2VLKD 5ANMB 4NKMB 4M6ML 2YPLA 2GSGB 2DKMA 2XRAL 2OL3H 3DXAD 4C58B 4LSDA 1IKFL 1N7ML 3NMEA 4FFYH 1FLRH 5BCAA 4LSRH 1YJDC 4UOW1 1T5XB 2QJDA 1AGDB 1RIUL 1K2DA 3GEWB 2XWBA 3ULUE 4OLYH 5C2BL 3UXFA 5FYJL 4E0RB 3AS1A 2VDRH 3BKJL 3L3IA 4PFEA 4EN3D 1H3PL 4OCRL 4Q0XL 3T0EB 1EHLL 5I1LB 1WIOA 5IV2B 4TUKL 3A6BL 3Q6FB 1FO0H 1XR9A 4P23B 4OCYL 1KJVB 5D2LF 1BBJB 5LBSL 1ACZA 3L5XL 5IIEA 4MXQC 2P8PA 4U1GC 5GRYA 1NUGA 2A9ML 2W1NA 4D9QD 3ARTA 5J6GB 4G6JL 1JYVA 4YHPB 3A6CH 2IH3A 4U1GB 1CGTA 1BX2A 3OKMA 4HWEL 1MCPL 3BI9X 5EBLA 5GGQH 2E8ZA 1ZT7A 3VXPA 5E8PB 3RWCA 3BUYB 2MCPL 5AZ2H 1BOGA 1Q9KB 1HHIA 4KKAC 4R4NC 1L7TH 1J0HA 2EH7H 5C9JA 3WKMH 3SE9H 5DSCB 4CL7A 3WMSA 1B2WH 3KPRA 5IQ9A 3DYPA 3DUUB 4FOMA 5I1IL 2XZQH 1LK2A 1OLLA 4UDUA 5B39A 4J3XA 1U8OA 1W0VA 3EYSH 4IRJA 1MRFH 2XKNB 2NYYC 3MLVH 1E4JA 4KK9D 5DEZA 4AL8L 4LCCC 4FQHB 4ZDHB 1MJJA 3TA3A 2B4CC 1A6TB 4HUWA 3C2AL 2B7DT 2CKBB 4WW2F 1YDPB 1RZIB 1KB9J 1WWCA 3BDBA 5HHVL 5JPMB 4LCCB 3ARDA 4QHNA 2D0FA 3HE6A 3WHXB 4HGWB 3BEWB 3TV3L 4QHUB 5FHBL 4HH9A 3PQYD 3RWJA 5F9WB 1FN4A 3P4OB 5C0JB 3S98A 2NTSP 3QDGB 5FEBA 3FO0L 4OF6A 4JHBA 1W72H 1E28B 4P46A 4MQXD 1AQKH 1IC7H 5JHDA 1VACB 4OFVA 3SDXF 5IVOA 4UIKL 2CO6B 2ERJC 1U93B 1FNGA 2FYYB 1I1AC 1S3KL 2GUOB 2P42B 2GITB 4F2MB 3KHQA 5T3XE 2KBGA 4YHOH 5BQ7B 5SWZD 1OGTB 4KTYA 2ERJB 4ZFGH 15C8L 5B3JF 4YK4C 1I1AB 3BGAA 4IJ3C 3MRBB 1KJ2H 1T04A 1KT2A 4LHUA 1BFSA 1X9QA 4YK4B 2VWEC 1G6RB 4IJ3B 3WDIA 4DZBB 1BOYA 1NBVH 3PWLB 4RGOL 4FXLA 3CFKB 3U4EA 3UJJL 3P11H 2Q6WB 4QRQB 2VE6A 3DSNA 3QUMH 1G9ML 2IBZX 3FKUS 5F7DA 1PX3A 3MLZL 3QH3B 4JHAH 4PJXF 1U8HA 4LLYA 2JJVA 1UB5A 4X7TB 1IC5L 4GW4A 4OLUH 2VR9A 4U6VL 1S9XA 3FTGA 4LSQH 3GDBA 1CE6A 1GGCL 3IDGA 4IDJH 1FL3A 4AJ0A 1KTDB 1CDGA 4JFDD 3DX6A 4R2GD 4KKCC 3FZUC 3MLWL 3RWHB 1EJOH 4G8IB 4DFIA 4NQDB 4L29B 4EUPB 5D6CA 4BSVB 2CDEA 1EAPA 2YUXA 4XMLH 4TULH 3NIGF 2VLRD 2FEDC 5FYJU 4ZFOA 2ITDB 4YXKH 4TVSa 2H45A 5ISZE 1KFAL 2FO4A 4NO0B 5C0CE 1KEML 1RULL 4G7VL 4YLQT 3DPBA 5B38G 5KS9A 3KJ4C 3D39B 2A74B 2V2WA 1UQSA 4NM4L 4UDTA 2D03L 1M7XA 3U9UA 1VFBB 4U1NB 3KJ4B 4MS8C 5GGTH 2VL5B 4LNVA 4Y5VB 4XP6L 4DOHE 5D1ZC 5D72H 1OAYH 2ZJSL 4JR9H 2XWJA 3FT4B 4K8RH 1XGYH 4AEEA 2J6EH 5F1NA 1QYGL 1MCIA 2N56A 4LOUD 5D1ZB 5FKPA 2F9BT 1U8PB 5BZDA 1DSFL 3VU2A 5FYKL 3V6FA 2XA8H 5DHYA 1QSFA 2J88H 3HAEH 4I8DA 5EFIB 2F74B 4N0FA 2VLJD 5DK0A 4O02L 4U7MA 4PRNB 2YD2A 4F80A 4OZFG 3S34H 1X5YA 3C08L 4L4VE 1DP0A 3JV6B 1MIEL 2Y6SD 2Z92A 5GGSB 3V4UL 2CKBH 2DTMH 1O7VA 4XMKL 4X6DB 4PJCA 1J1PL 4IMKA 3BZ4A 4JGJA 3TBWA 1TQCB 4UBDC 2AJXH 2VUOA 5ITBL 3C87A 1A1OB 1JL8A 3KPOB 3TCLA 4F7MB 3DETC 4UT7L 1GIGH 2RFXB 3IJHB 5K9JH 5JIPA 3QBTB 1BP3B 3FONA 3QQ4B 3VFUA 2DLIA 3UTSE 4X6EA 4FQ1H 7CGTA 2JE8A 4HULB 1FIGL 3H8NA 3AREA 5T1DH 4V1DB 2VDLL 4NNYB 3O3UN 4MHHG 1F97A 5J06A 1RZFH 1OARH 2PYFA 3EZJB 4XPBL 2G2RA 1QRNB 4PGDA 3QQNA 1PG7L 1S7XB 3G08B 3IDMA 4ZUUA 4Q74A 4M6MH 2DTSA 3WIIL 4NKIL 5DZNA 2XRAH 5IT2L 2Y06L 1WSST 1NCTA 4X4MA 4AH2A 1IKFH 1N7MH 1PYWB 5F96L 1GJIA 2C4FT 3CU7A 4HH8A 4QOKD 3O3EA 3V5DB 4Z7NE 1MCEA 5C0AE 4KUZL 3O81A 2CLZB 5E94A 2AXGB 4OZIF 4M02A 1M7IB 3KPNB 3CVHA 2BERA 3GM8A 4U1LB 4AEHL 5FYJH 5C2BH 4PJIA 3GI9L 4YDVA 3BKJH 1H3PH 4OCRH 4Q0XH 4ZOCA 1DE4B 3RHWK 4PREB 2W38A 1BAFL 4JFHE 4PJHB 1MI5D 4A2MA 4K3HA 1YQVL 4TUKH 2O93L 3A6BH 4KI5F 5DGQA 2EIEA 2KPNA 4OCYH 3T09A 1BGXL 1NSNL 1SM3L 1VFUA 3SDDC 3HLAB 4M1CD 5LBSH 1FNFA 1EERB 3L5XH 2CR6A 4Q6IB 1T5WB 1NC2B 1TIUA 5TE6L 4G6JH 4MNQD 1U2CA 4Z78A 5CEZL 4HWEH 5EOTB 4W81A 1MCPH 2F53D 1KF9B 4OJFL 5C07B 5GSVA 5HD8C 2MCPH 3SQOL 4X8JB 4H0IA 3LDBB 3LKQA 1T83A 3C09C 1AD0A 4Y4FC 4XH2B 1MIML 5B38A 5IB2B 3JVGA 4UMGA 4LCWB 2YA2A 3BHBA 3H3PL 4OLXL 5DEGB 5HPMB 3C5ZB 3C09B 5DWUL 5B21A 5J1AA 1LO4H 4R7NB 4PJBA 5I1IH 1ADQA 4AENA 1TFHA 5MHSD 2I9TB 1VFMA 3QA3B 4NUJA 4UILL 4HPYL 3THML 5CS7A 2WSKA 3VGHA 1UGNA 3MRGA 3WNNA 3BWAB 3X11B 1N3NA 4AL8H 2P8LB 3LEYL 3K4DA 3C2AH 4K7FB 3RVVC 2JJUA 3WIHL 5EOQL 4NN5C 2JCCA 1A21A 5HHVH 1WZMA 3TV3H 2CDGB 4YAQB 1EJ6A 4NN5B 5FHBH 1Q9OB 5KSAD 4X6CA 3MRDB 1ZA3A 5DMKB 3FO0H 5LXGL 1IJ9A 4KHTL 5LAXB 4R3SB 2IADA 3TBSA 3TCXA 5I75C 4BFEA 4PGBA 4GXUM 4UIKH 3FQRA 5EU6A 3D6GA 4H0HB 2BRRL 4X7SL 3EFDL 1S3KH 4RIRA 1CFTA 1LD9A 3MGOB 5I75B 2MHAA 4JQVA 5GS0D 2KUTA 15C8H 4Y4HA 4P3DB 4GQPH 2AXHA 3NCMA 4NQCE 2UVFA 4OV5B 2X4OA 1AGFB 5I1DB 5HYSA 3AXLB 3KPSD 1ZVSB 4M93C 1ZHKA 5GGUA 4RDQG 1WCQA 4ODXB 3PV6B 1IL1A 2L4OA 4RGOH 1KIQB 3REWB 1IQDA 3UJJH 3D9AL 4XWGL 4NO3A 2D7PA 1NFKA 1G9MH 1MAML 2NTFA 3O45A 3MLZH 2P46B 1KJMB 1IC5H 3OB0K 3KXFD 4U6VH 4TVPE 3S5LB 3A67L 5KAQF 1GGCH 4IS6B 4NPYA 4XBPB 3WN5C 3ILQD 4OZHF 4J7RA 3OR7B 5LGJB 3X3GH 1NMCC 3MLWH 3WN5B 4JM2D 4UNUA 5FO8B 3CFJA 1G7IB 1QFOA 1IGIL 4LLQB 1U3ZA 1RJZB 4M61A 1CLZL 2ESVA 3TNMA 2DBJA 3FB5B 4MQSB 3G5ZB 4MD0A 4TTDD 4ZSOE 4PY7A 2GK0A 3UCRA 1U8IB 1MHPL 1M05B 7FABL 4I48B 1KEMH 1EH9A 1RULH 4G7VH 3VI3F 2XWTB 5EWIL 1MNUL 1MWAL 1QEWA 3DX9B 3LKNB 4OZGE 4QEGA 2GTZA 1CDIA 5T1KA 4NM4H 3S3PA 2D03H 2APXA 5CD5D 1UJ3C 2HG5B 2ZG1A 5HYEA 4QO1A 3ULUC 1I9IL 4YGAB 4XP6H 3LY6A 4W6YB 4BKLB 2ZJSH 2FEEL 4Z7VA 1U3HA 1T21A 2B0SL 1AD9B 2Z35B 1NGZA 1U3HD 3QQ9C 5C3TA 3P0GB 3VRJB 5K9QG 4CAGA 3OJDB 3NCYS 4EXKA 1DSFH 3OPZL 5LJYH 5FYKH 1XGRA 4JO3L 4IRSD 1JBJA 2R1XA 5JA9A 1WBZB 3GGWB 1Q0XL 4O02H 3R4DA 3SY0A 1K4DB 3S96A 1TVBA 3VMNA 1RIVL 5E6IA 1MIEH 2PYEA 3V4UH 4XMKH 3KR3L 4LF3B 1J1PH 2YWZA 3ABZA 2IBGA 1ZGLP 4TUJB 4N68A 5ITBH 5IVXB 4UT7H 4JY6B 4L4JA 3AUVA 2CIKB 3O8XC 1F4YL 1Z5LB 1HOCB 3IF1B 5E8NB 5CEXA 1ZA6A 1FIGH 2BVTA 3MRKA 4I18A 5D96C 2VDLH 2FEEI 4JRXE 2VKWA 3QT2A 4QRPB 3P9WB 3QUXD 4MQTB 3BH8B 4XPBH 5D96B 3T65A 3TNNA 1W0WB 3TYFB 2PN5A 1MFCL 1PG7H 1AKJD 1EFQA 5IF0A 5IBLD 1CG9A 3MRHB 1SBBA 4M9PA 4RQQB 3BDXA 1IGML 4NKIH 4PJ8C 5TE4L 2Y06H 3B5TA 5IT2H 4FXKB 1B4RA 5F96H 3O41B 4X9GA 2XTJE 1RVFL 1T1ZA 4HKBA 4PJ8B 3DVIA 3MV8E 1MJ8L 3C60D 3NFSL 5GRVK 2MKWA 4KUZH 4AZ8A 3WHE0 4NRZB 2BNRB 1KB5A 3SE4A 5I17A 1OP9A 3A0OA 4LL9A 1B0RA 4JB9H 1MRDL 3MXVL 2X4UA 1EXUA 3E6HA 5DHVH 4AEHH 4S1DD 3GI9H 2W65B 2BMKB 3F7PC 4P2OA 1CIUA 2NY6C 4LLDB 3IYLW 1BAFH 3MV7E 4GMTL 1YQVH 4XAKE 3HI1A 2W0FA 3FQNB 1VEOA 2NY6B 4QHMA 5FUCE 1OAZL 1BGXH 1SM3H 1MCLA 4JQXA 3AGVA 1LGVA 4QRRB 5GJSL 4Y1AD 2E27L 4UZGA 5D7LA 4FQXA 1A1NA 2JIXA 2YC1B 2JIXD 2AJYL 2RBLA 2YRPA 4X0KA 5DD0L 5TE6H 1H8SA 3H42L 1CGUA 5CEZH 1SYSB 1AO7A 2MQ3A 2XTLA 1FC2D 5DTFA 3GMQB 3FO9B 1F5WA 1TLKA 3SQOH 1DQJA 1UT9A 3VXMD 2Y4SA 1ODAA 4PPTA 1MIMH 3OQ3B 4MXWL 4ZPTB 3H3PH 3OWEA 4OLXH 1N64L 5IFHL 5DWUH 5SV3A 3M45A 3TH4T 3VXRA 1MLCA 2YRZA 1VADB 1I85A 3S3SA 4P9ML 2E6QA 1H3TA 2NY0D 4L3CB 1GZPB 2HKHL 2O26U 5DQ9A 3BZFA 4HPYH 3VRLE 2L7UA 4RGMB 2Y5TA 3THMH 1HSAA 3U79A 1PKQB 5EU3A 3VWKD 4X5XA 5DXWA 4WUKL 1D5MA 5FYLL 2QHLA 4LK4A 4GKZA 3UZEA 3VXUA 3O11A 1JF6A 5DJDA 3LEYH 5ISZB 1TJGL 5EOQH 5C0CB 1CXHA 4PRHB 5I1CL 4ZTOH 4I0KA 2YPKA 1TVHA 3LS4L 2VKXA 2JKXA 3PJSA 3ROOA 2WUBL 5E9DE 4OI8A 5LXGH 1R0AL 4CADA 4KHTH 3UDWC 4DVRL 3LKRA 1V3LA 5IEHA 3BKYL 2JJTC 1T3FA 1G7QA 1I9EA 2BNQB 2BRRH 4X7SH 3EFDH 4ZG1A 4PGEA 3GM0A 2MTPA 4MVBD 4OUUB 4JQIL 2IFGA 1YN6A 5F7HA 1RV6X 1RZ8B 3X3FL 1X5LA 4OAWA 3QDHA 4R0LC 2ATPB 2BCKB 4GT7A 4EVNA 2HLAA 2KL6A 1H9VA 3GFUA 4R0LB 1ORSA 1U8MA 3ULUF 3MJ9L 2QKIB 4L4VB 1EEZB 3D9AH 4XNMB 4XWGH 4C83A 4HK3J 1G7PB 1MAMH 3QQ3A 1BHGA 2P24A 5KSBA 2AXJA 2EYSA 1H15B 4KV5E 1WISA 5DS8A 2XPGA 3MREB 2VNCA 3VFOA 4JDZB 3QWRD 1JGDB 1FVDA 1WLHA 2AQ2A 5CGTA 5D9SA 3A67H 5F21B 1MFDL 3UTSB 3VGFA 3AMLA 4PJ9C 4QRUA 2YUWA 2D9QB 2I60L 5BO1L 1IGIH 4F8QA 2F54B 4PJ9B 2UY6A 1CLZH 4JAMA 2A6IA 3RUGF 4F7CB 3HAEG 5DJCB 4UV7L 1MHPH 3FO2B 3CMOH 7FABH 5KN5A 1JWUA 4TNWK 5EWIH 3D18B 1I8IB 1MNUH 3CFDA 3F7YB 1E4KA 3OBAA 3RJQB 4C54A 3TO4A 1TQBC 3P3YA 4K94C 3UBXI 1NCAL 4E42A 2ED9A 2W9EL 5DLML 4YE4L 1J05A 1HDMA 4P2QE 4PLJC 2AJZA 4M8QA 5ACZA 1TQBB 3LAFA 1I9IH 5C0AB 4S1RL 5ACLA 2DBLL 1RZKL 2DYPD 3OG6B 1HI6A 3FOMA 5CP3H 2HT4C 1T2QL 4O5LL 3L3GA 5GGRA 1R5VB 5FGCB 1F2XK 3TYGL 2PCPB 4ELMF 4KJQD 5CBAB 2FCBA 3GMNA 4GG6F 3OPZH 2GKIA 3SKNB 3NZ8B 1B88A 3RZCD 1WBYB 1U8QA 1G7LA 1FGNL 5E5MA 4JO3H 4XCYA 5JQ6H 2L0DA 3HG1A 2QADB 3IXAA 2HJLB 3JWOC 5KOMC 2EDNA 2BP3A 1Q0XH 3FN3A 4L3EE 1QSEE 2VJXA 3DUSA 4ZNCD 4Q6YA 4HBCL 4CMHB 4QXUL 1G7HA 3NFNB 4U0QB 1RIVH 1DBAL 2X40A 1UM4L 1QA9A 4U1JB 1W72A 4P4KD 2NY3C 1FFOA 3EHBD 4HS8L 4P2RD 3KR3H 2GJ6D 3UTPE 3AFLA 5IHUH 5FO7A 3DRQA 1QR1B 5HYFA 4O00A 1D9KC 1YEGH 4X5WA 4YR6B 1YNLH 2CUMA 3CPLA 4GS7C 3F7VB 1F4YH 4LNRB 1KJ2A 3O2DA 1D9KB 1P4IL 2BVQB 2ZKHL 3LQAC 5ANMA 2GSGA 3WDHA 3TJHC 4GS7B 4HUVB 3IVKB 1A6VH 1NC4B 1YUHA 4Z0XA 1HXMA 3O6KL 1Y6NR 3G6JA 3QUMA 5MENE 3IAQA 1MFCH 1JNLL 3SDYH 1R3IL 1WFTA 2DQIL 5BRZA 2DDQH 2Y9RT 4P4RB 1HKFA 2DQHL 3UBXB 1IGMH 5TE4H 4JO4L 4TSAH 3QEUB 1XGPA 3LKSA 3WL9A 4U7SA 5D71L 4M1DL 3T0EA 3F6LA 3TN0C 1MJ8H 3NFSH 1D6EA 1MCCA 1MCBA 5FB8B 1RUKL 1INQB 1MRDH 1WFOA 3MXVH 4XB8A 4P23D 2R1WB 5C0GB 1A1MB 3UYRL 1DDHB 4PJ5B 3BP7A 5BV7L 4I2XA 2LU3A 1L9MA 1ZHLB 2ZPKL 5EBMB 4CN4A 4MXQD 4MD4A 1SBSL 3FO1A 2CRMA 1OAZH 1FFPB 1P4BL 5GJSH 4OF7A 3H3KA 2E27H 2NLJA 5C0IB 4C4KO 1JZ3A 4LLUA 4NQCB 5C6PB 3RIAK 4WTZG 2IWGA 1B6DA 2AJYH 4KK8C 4Z7WE 4OLZL 1P69B 3BOVA 5DD0H 5DVKA 3V52L 3RTQB 3H42H 3MRRB 4G8EB 4MDIB 3EYOA 4U3XA 2D7OA 2BOBB 3ZKXC 2J6EA 5DGRA 3TBVA 4KKAD 1WTLA 5C71A 3MYJA 4R4ND 1RZKC 4XP5L 4KUCD 4QRTB 4Z76A 1J10A 1FG9C 2BOCA 3MUHL 3GSXB 4CUCA 3P9LA 2OSLA 3HAEA 4ODTL 1QQDA 5HY9B 5GXBB 1HHHB 1KLGA 2Y7QA 1U0QA 5CJXC 2ZNWA 3K2UL 4MXWH 2E8YA 3I6GB 1H3VA 2VITB 1N64H 4N0CD 5IFHH 3SQBA 1ACYH 1JYWA 4P9MH 2CKBA 2NYYD 2A1WL 5FO9A 1ONQB 3VD3A 4APQC 1WVZA 3ARZA 2HKHH 3BGFB 1Q8MA 4KQ3L 4Z6AT 3W11C 5AWNL 3P4OA 4WUKH 5FYLH 4ISVB 3QDGD 4OCLC 2D2OA 1TJGH 1K8DB 1SYVA 4HK0A 5I1CH 2A9NL 4PTUA 3G6DL 2C3VA 3BYYA 3LS4H 2Z91A 4F2MA 4EQ2A 1QRKA 4H8WC 1YNTB 2WUBH 1VKXA 1QP1A 2ARJA 2HH0L 1I1AD 1RK0A 4HG4K 1R0AH 4ZOAA 4DVRH 3O4LB 3OXRB 3HPLB 1IGTB 3BKYH 1JI1A 1WWAX 5KSUB 3GMRB 3CFKA 1JPTL 3ARQA 4JQIH 5H2BB 1AXIB 5DJ8B 3IJSA 4JY4B 1KIPB 2UZIL 3WV0A 4UQ3B 4X7TA 4YHZL 5DK3A 1S7VB 3ZSTA 5F7UA 3OF6D 3MRPA 1LMKA 1K5NB 2E6PA 4JN2A 3QB7C 1ZVYA 5IMKB 3JWDC 1XF3A 3MJ9H 1MH5A 3QUKB 5FYJD 2P43B 4U33A 4WEUD 1WWBX 3L3HA 1T1YB 1BD2E 1LNUA 5SWQA 4NQDA 3VWJA 2DD8L 4NQSB 4NQDD 4KKCD 4BSVA 3FZUD 2Z9TA 4YZFE 1RMFL 1EEYB 2E7LC 4ZTPL 1JWSB 3MRQB 1CIDA 1F4AA 4XBEL 3FCTB 2UUDH 1MFDH 3GMMA 1YMMB 4NO0D 4WI9A 4X9FA 1D5XB 1IAOB 2APFA 2FEDD 5C3LD 3D39A 3X13B 2A74A 4JRXB 2F5BL 4X4XA 2I60H 3TM6A 3FQXA 2B1HL 3KWWB 5EZLA 5B22A 5BO1H 3U0PB 1XF5A 4BSJA 2JK5A 3VJ6B 4Y5VA 4IHOB 1FL6A 5EUOF 4GAFB 5I1GL 5C6WH 3PIQB 1GGYA 4UV7H 3VFVB 5LVEA 1K85A 5D1XB 3ZDZE 2XTJC 2EIDA 5TE7L 2VXVL 3V6ZB 3VGAC 1OHQA 2X4PB 1QLRA 4S2SA 5D1ZD 2W9EH 5DUMH 3OAZK 2XZAL 4YE4H 1T4KA 2XTJB 3VGAB 3MV8B 5I6XC 5C8JA 4S1RH 1G84A 2DBLH 1RZKH 1JGEA 1T2QH 4TVPH 2EKSA 4O5LH 5I6XB 3W5MA 2M2DA 1BVKA 3TYGH 5AYUL 4KVCL 2HFTA 3UTOA 5DMIL 3B9KC 5F9OL 5GGSA 1LO5A 3EIFA 4GKSB 4JRYE 5FUCC 4MA1C 5M95B 3MV7B 1FGNH 1KCRL 4E41E 4EQ3A 2P5EB 4JFFE 2FX7L 1JJUA 2YN5A 1U3JA 4R7DA 3BO8A 4MA1B 3FFCA 4RFNC 4OIAA 3KPOA 1NGXA 4K7PX 1F42A 4HBCH 1TZIA 2ZSVB 1IQWL 4QXUH 4XGZA 2EH8L 1BJ1H 1HQRB 1RJLA 4GFTB 1UM4H 3MMEB 4UBDD 3DETD 2DM7A 4HS8H 3Q5OA 4S1SL 3TBYB 5I1AB 5HI3C 1JN6B 3PV7A 5IB1A 5H94B 4NNYA 3TF7C 4V1DD 2CIIB 2EC9T 5L7XL 2UZXB 4YFLF 3PDDA 4M4RA 3D25B 4YHKL 1ZEAL 4Y19E 1QRND 2GQHA 1VSCA 1BFOB 4F9LA 3LHPH 3QIUA 3VGEA 5GQBA 1P4IH 2ZKHH 3S5LG 4JFEA 2F19L 1OCWL 4HWZA 4FTVA 3PL6C 2WMPA 1S7RB 2IF7A 5JW5A 5ID1A 1MCOL 3O6KH 4L9LC 4NKOA 1DVFC 3V5DA 4E9LA 3DX8A 1JNLH 2XQBL 3EZ8A 1NQBA 5AAMA 1R3IH 4L9LB 2Z31C 2DQIH 3MUGB 2X9XA 5J6HB 3D85A 2AERT 1IAIM 2DQHH 4JO4H 4U1LA 2OR9L 5FOJA 2Z31B 4WI8A 3QIBA 5ICXA 4UV4H 4HIXH 5D71H 4M1DH 1DQLL 5F7FA 4M5ZL 3CSBA 5C0EB 1UM5L 4NSKA 4ELKA 1B9ZA 1DLFL 1MSPA 1RUKH 3CUPB 1OSPL 4KDTC 1CVRA 2DAVA 3WUWG 1PKOA 3UTQB 1M6OB 3A6OA 3UYRH 4NKQB 4XAWL 2GSIA 4UTAL 4CVXA 3C9NB 2AV1A 3EYVA 3INUL 4Q6IA 1NGYA 5EULV 1NC2D 4R96A 1NDGA 2ZPKH 4PJFA 1WICA 4XVTL 1SBSH 1I8LA 4OZGF 4CN6A 4JFXB 1GVIA 1P4BH 4NZTL 4CU6A 1XIWC 5C07D 3WD5L 1QTYT 3U2SB 1AP2B 3T3PF 1C5CL 3T8XB 4D0CB 1DQDL 5HHPA 4OFKA 1BLNA 2UUDK 3KS0H 4OLZH 3V52H 1XIWB 5KG9A 4FZEL 5HD8D 5IB2A 5HI5C 1UCBL 5CEYB 4LCWD 3UTTA 3C5ZA 3MRFA 5DJAA 3RQ3A 5DQDL 5ILTL 2BY1A 4FXGB 4XP5H 2YD1A 3FL7A 4YJZL 4R90L 3QFJA 4WEBL 3ARGC 1JGVL 12E8L 3NFPA 4W6XB 2X9WA 1A3LL 3H7BB 4ZNEA 3MA9L 2WINA 3QEQA 4NO2B 43CAA 5L2KE 3K2UH 2EZ0C 3I75B 4YNYA 4U6HB 2GCYA 5MEOB 4Y5XA 3TC9A 1A6AA 1KYOJ 3D69A 5F8QC 2VZ3A 2A1WH 5IQ7L 4MSWA 1JNNL 2EEDA 3O3AA 4GKNA 3OV6A 1FVCB 3FOLB 4KQ3H 1R3LA 3RVVD 2K7QA 3V95A 4LP4A 2XXMB 3MRDA 4HBQA 1I3RB 1B90A 4RMQA 5AZEL 5HHQB 2UWEF 3ARBC 3QXAA 4RAVA 3WE6B 1RJYB 2HFFA 2A9NH 3QNZB 3G6DH 3ZE2E 2DQGL 4JGMA 5FDWB 3EYUL 1MY5A 3U36B 4I5BB 4P2QB 2XZZA 2ZUUA 3H3BC 3STZA 2HH0H 5HYJA 3S97C 5J12C 3GHBL 5DDHB 1FNHA 4RRPG 4PJ7E 4AQOA 5D7IE 5J12B 3QRFM 2ILLA 4X7FC 1HINH 5HHOA 4FQQA 3DURB 4LGSB 1JPTH 4G43B 3T4AB 3Q3GA 4GUPB 3V6OA 3DMMC 4FQIL 3PWUB 4YO0A 2YXFA 4CVZB 2UZIH 4LSTH 1JHTA 4R4BA 3K74B 4KRMB 1KJMA 4HUUB 4YHZH 4QT5B 1N2RA 1S7TA 3DMMB 4C56E 4L3EB 3C5JA 1UA6L 3LRHA 5DHVA 3L5JA 2YPLE 2WWKO 4UNTA 4NWTL 2IC2A 3NIDF 2AI0L 1QLEL 2PXYC 1FDLL 2COQA 4KMLB 4N0YL 3U6RB 4U4BA 2DD8H 2BC4B 4ZOEA 4LLQA 2PXYB 5T1MB 1RMFH 2AEWA 1UM6L 1ZAGA 3BUTA 4ZTPH 4G8FB 2EDKA 4XBEH 5ID0B 1PFCA 2YA0A 1VA9A 2EYRA 1U8IA 4QXGL 4XVJL 1J0JA 2DWEB 1I1FA 1VGKA 1MQKL 1YEDB 3O4OC 4P57A 4ONGL 5T5NG 2F5BH 2B1HH 1ES0A 1C08A 3K8KA 5ITFB 3ARPA 3WUWA 2AQ1A 3IDIB 3O4OB 5MENB 2HN7A 5I1GH 3REVB 2VDOL 4U2ZA 5D7SL 5E56A 3FB7B 1QBAA 4HKXB 3U46B 5TE7H 2VO5A 2VXVH 3CCHB 1X5FA 1AD9A 4J23A 4YXHL 3L3OB 1VESA 3DHMA 4D9QE 2CO7B 5CINL 1E4XL 2XZAH 1JMXA 3OJDA 3STBA 2AJSL 1H3WM 2Q8AL 1A7RL 2W9LA 3QQ9D 2W92A 1B0GA 5CILL 3OZ9L 4KXZI 5F71A 4CVUA 2ATKB 2KZ1B 3VRLF 2R2EB 5AYUH 3T2OA 4KVCH 4P5MA 4NQXB 5CFHA 1YY9C 2C5DC 4MDJA 5F9OH 5GGVH 2BSRA 2KQMA 3WIHA 1P7QA 3KPRE 1KCRH 5HBBA 2FX7H 4M03A 2HVJB 1LEGA 4WVRA 4KJPC 5C09A 4TUJA 3WS6C 5IVXA 1F8TL 2AV7B 3B43A 4QCIA 1F6LL 5JOFB 1IQWH 5A40E 3T4YB 5BW7C 4N1HB 2EH8H 3WS3B 4JJ5A 1F3JA 5F7NC 5DHXB 4QTHB 3VFMB 1H3GA 3H9HB 4S1SH 3N50A 2BVOA 2FBJL 1FBIL 2OCFD 3TO2A 4JLRB 2C1PA 1CD1A 4QRPD 3BH8A 4ETYA 4YHKH 1ZEAH 1E4XI 4PGCA 3OGOE 2F19H 1S5HA 5SWSA 4QNPE 3MRHA 1NL0L 1OCWH 2FR4A 4UIMA 3I6KB 1OAXL 3VG9C 5KSVB 2HT2C 4JZJB 4MA3A 1MCOH 2DMBA 2R2BB 2R23B 4QRSA 4PJ8D 5IR1B 3VG9B 2OX5A 1KV3A 4LRIA 3SDCA 2XQBH 3TPKA 5SWZE 2BNRA 4N1EA 4OGYL 2BNRD 4JKLA 1AJ7L 4RMUA 1SY6L 2A6KA 4YFDB 4ZQKA 4KV5F 3IKKA 2AKRA 4JFZL 1HN1A 2OR9H 5FOBB 3KPMB 3ZKSD 2BMKA 4HKZB 3GMPA 3OXSA 1DQLH 4WI3A 4TPRL 3WLBB 4M5ZH 5FA3A 1UM5H 4YFEA 1BQHB 1DLFH 2CRIA 4ONHB 2NY6D 4PYHA 1OSPH 1X5JA 2P47B 5T3XD 2I9LA 1KIRA 1ROWA 4PG9A 1WAAF 1XR8B 3LB6C 4QRRD 2X89A 2AABL 4Z0BL 4XAWH 3O3BB 3T77A 4UTAH 5I19L 4RWHA 3HPJB 1Z0MA 1DL7L 2X4QB 4DN3H 1D5ZB 1OAKL 4JFDE 1MWAA 4XVTH 5BJTA 1KENL 2V2TA 1CS6A 1OGAA 2Q76A 4DAGL 4P9HL 3C6LC 1C12A 4NZTH 2XYCA 3BFOA 3WD5H 1K8IA 1KB9K 1SVZA 3DTXB 3EGSB 3HZKB 3TGXA 4BH7B 4LLWA 4RFEB 1C5CH 3C6LB 2OJZL 5I66B 1DQDH 2IPKB 2XN9B 4HS3A 5CP3A 4GAGL 5F7LB 1GOFA 4FZEH 1AGCB 1UCBH 2NY5C 4DW2L 2ICES 4YBLC 5DQDH 5KS9E 5ILTH 5IMLB 5L2JB 2BSSA 2FIRT 4R90H 1BD2B 4QHKI 4YBLB 1NAMA 4WEBH 1NUDA 4X6BA 5DC4B 12E8H 2EDJA 5JXEC 3Q6GL 5ETUB 1PKQA 3OMZA 1A3LH 3WXWL 3MA9H 4LQFL 4ZAKC 1J1XH 3CSGA 2F8VA 1Q9LA 3PGDA 4Q2ZB 3S4SB 2F5AL 4WDIA 4J2XA 4CMMB 4YDKL 4ZAKB 5DJ6A 5ISZD 4IOFD 1OWRM 2Z93A 1EGJL 5IQ7H 1JNNH 1LVEA 5C0CD 4J3UA 4TUOA 4PRHD 5HI4C 2G5BB 5EC1B 4DVBA 4BFGA 3V8OA 1QSFE 4HMEA 1MF2L 4PRIB 1LEIA 1S9KC 1FNSL 1OAUL 3UBXG 1H5BA 4ZXBC 4BSWA 1EV2E 1OQXA 4LDEB 1I9JL 2DQGH 2BNQD 1FZKA 1AR2A 5ICYA 4ZXBB 1DN0A 4PJCE 1W2KT 5D7JA 4Y16A 5TF1L 2ED7A 4FS0A 3GHBH 4K55A 1S9YB 1NPUA 1B6UA 5TH2B 1T0NB 5GIRB 5ICZB 4L4VD 4XNMA 1OP5H 1L7IL 5D6DC 3QG6B 3WNKA 2HFGL 4MCYA 4JRYB 4FQIH 1K6QL 4CNIB 1IBGL 3BQUA 1NEZB 1HH9B 4JFFB 1XZ0A 1HE7A 4HMDA 4DQOL 5JW4Q 1UA6H 2J1KA 4A6YL 3ALPA 3QIWA 4M00A 1JVKA 3LMJL 1Z9MA 1NCCL 4EKXA 4Y4KA 2C1OB 1MREH 1OT2A 2FB4L 4NWTH 2JJSA 2AI0H 3UTSD 1QLEH 2HP4A 4KXZH 5FA4A 4YHLL 2DN7A 4N0YH 2C4XA 4BQ6A 1MCWM 1D5IL 3MUJA 1A3QA 1EAJA 4FNLH 5CHNA 2F54D 1P4LB 4L8SA 1UM6H 4PJ9D 2Q7YA 5LCVH 5CCKL 3AROA 5EG6C 3M1BA 5J3HC 4QXGH 4XVJH 3VXTA 5FGRA 4MJIA 4UT6L 1QUNA 5MERB 5J7CC 3D18A 1MQKH 4XNUL 3VG0L 3F7YA 1MUJA 1CGXA 3CSYB 4Z7WF 3VD9A 3PGCB 4ONGH 1P7KB 1HKLL 1M7DB 4CJ1A 3BP5A 4B0MM 2BVPA 3CDCA 4GBXC 3T0VA 1JTOA 3PP3K 1U92B 2VXQL 5DEFA 2F8XC 4FQCH 3ARWA 2N7BA 1C1EH 4PJEA 2VDOH 5IB4A 1U3YA 1ZS8A 5C0AD 5D7SH 3CK0L 4GBXB 3BP4B 2A38A 2R39A 5JUEL 1FNEB 4PLJD 4UU9A 4L8BA 3LRGA 3ZE1F 4U1SA 1WF5A 5C0FA 5EZJB 2YWYA 2A6JB 4YXHH 1EEQA 5ENWA 1GZQB 4PRAB 5FECB 5CINH 1BQLL 1E4XH 2HT4D 5FCSH 2FJHB 1KJ3L 2AJSH 4MNQE 2NY5H 2Q8AH 1BMGA 4DCQA 3UPRB 1A7RH 4CU7A 2DI7A 3HFML 4JFHD 1Y0LA 1PQZA 1H0DA 3OZ9H 4JG0L 2QADD 4QKXB 1U8LA 3AM8C 4M8VA 2Z4QA 3EOYG 5BOPA 4H26B 1KN4L 4Z7QE 1UVQB 2VR5A 1YPZB 2PTTB 3D3VA 3HZMA 2BNUB 3W0WA 2FBOJ 4PJBE 3BDYL 1IFHL 1RUPL 1QR1A 3L6FB 4FN0A 4PRPA 4DUVA 1F8TH 4NZJA 3MLSL 3BW9A 5I1KL 5DC0A 2EXYD 1LO3L 1XCTA 2FSEA 3KDMB 5F88B 3W9EB 1D9KD 1WQVT 3QEHB 4GW1B 3LVEA 3IFNL 1CFSB 1FBIH 3FB8B 3G5VB 1PLGH 3GSNB 3EKCA 4LGRB 1NC4D 2JCCE 3TJHD 5ESVA 1JWMB 1F4XL 3EO9L 1IM3B 1F2QA 1CFQB 2JB5L 1TITA 4X6CE 2V6HA 3RGVA 1NL0H 1GOGA 3UBXA 1OAXH 5L2KB 5E1AB 5BS0A 4K3JL 3MBXL 3MJ9A 1PY4A 1YMHA 5A2LH 3SCMA 5EU6E 5D7KE 4LVNB 5DI8B 3IDYC 5E2VL 1N8ZB 1GGBL 2QQLL 1AI1L 5JTWA 5IG7B 4NQEA 4OGYH 4P2CG 1UKQA 3C8DA 3TN0D 1AJ7H 5EH1A 3IDYB 2YD9A 4WFED 4ZYKB 5C0GA 3VFSA 4JFZH 1A1MA 2GEEA 5DJZB 3KPSE 4PJ5A 4PJ5D 4WWKA 4LDOB 3MRCB 5EU4B 4TPRH 2XV6B 1U91B 2AW2A 1OP5K 3SDAC 2XFXA 4OT1H 3G9VA 3MRMB 4NBXB 3PABA 1L9NA 5DUBA 2VDNL 3ECBA 4PV9B 2DLHA 3G5XA 3SDAB 1A6ZB 1FFPA 3O9WA 4U6XA 4H20L 2AABH 4Z0BH 5I19H 2VXUL 3EJYC 4NQCD 3V0VA 3QDMB 3L3JA 4PJ7B 1PZUB 2WWKT 1DL7H 3ME0A 4GAYB 2X2YA 3FQUB 3RTQD 5D7IB 1OAKH 4TNVF 1KENH 1X4ZA 4YGVB 3ZDZF 4P9HH 4KK8D 4I0PA 3QJFB 1FYHB 3BP6A 2VZOA 1Y18B 1CQYA 2L7JA 5EORH 2OJZH 4GRWE 5HY9A 1HHHA 1LO2H 4GAGH 4C56B 3RWEA 3KYMB 4TVPD 4WU7B 3TIDB 1SQ2N 3SDXA 2EC8A 4OKVA 5E95B 4DW2H 2YPLB 2IFFL 3T0BA 1ZLVK 3P2TA 2V2XA 5MEPA 5JNYA 2XKSA 4L8CA 3VXSB 1PY9A 3Q6GH 4HX1B 4LQFH 1UWXH 4APQD 4UB0H 5HSFA 4PR5A 1K2DB 1I7RA 3OG4B 4ISVA 4EN3C 4DUXA 4PV8A 2F5AH 2XWBB 4PJDB 3O6FA 3W11D 2HRLA 4YDKH 1EGJH 1E27A 3L3IB 1O7SA 1P1ZA 4PJXA 2VZSA 3FJTA 1XR9B 1HK6A 1MF2H 1OD9A 3O4LD 1FNSH 1OAUH 5GS1A 3OKDA 4MCZA 2DM2A 3V79C 4AT6A 1I9JH 5JOEA 2P8PB 2PYEE 1NUNB 1PDKA 4MAYA 3LEXA 2OTPA 1CF8L 2IH3B 2E7HA 2PO6A 3IU3B 3O6LL 1BX2B 2HVKA 3OKMB 5IWLA 1AIFB 4XPHL 1OPGL 5EBLB 2XZCL 1ZT7B 3B8SA 2RR3A 3VXPB 4PB9L 3B2VL 1FZOA 4GQ9L 3RWCB 5HDLA 3VXNA 4C55A 2R56L 1BOGB 1MRCL 4DN4L 1HHIB 4X8XA 3DHJA 1L7IH 5C9JB 2HFGH 3S36X 1NFDF 1K6QH 3OKLA 1IBGH 3KPRB 1QBML 2W60B 3B3IA 2D3VA 2EYTA 2NR6C 4IRJC 3V2AR 4DQOH 4PGJA 4UDUB 4B7IA 3LMJH 1MFNA 5B39B 3IS1X 1NCCH 1U8OB 3C8KA 1W0VB 4IRJB 3TA3C 1DQTA 2V17L 2EIBA 4LVHC 4OB5L 1YMMD 4YHLH 3IGAA 3L95A 4LEOA 3ARDC 1NUFA 1MJJB 3TA3B 1D5IH 4HUWB 3MNVA 4LVHB 4JRXD 5CCKH 3ARDB 4QHNB 2W59A 3GB7A 3HE6B 1NMAL 2OXHA 1X3DA 3MJ8A 4UT6H 1FN4B 5B8CA 1MHEA 4KMQA 4HFWA 2FJFA 3ZHKA 5D1XA 4XNUH 3VG0H 3IU4L 1E6OL 2V9RA 4P46B 1HKLH 5JHDB 2MMXA 3HCVA 4GO6B 4J4PA 4J4PD 2XTJD 3IDNA 1FNGB 3MV8D 2FLRT 3PGFL 3CK0H 3ULVF 4OLVH 1KXTB 2BHZA 3R06A 5JUEH 1RPQA 2Q1EA 2DL9A 1LK3L 6FABL 3I3BA 2BFVL 5D7LE 5HYQA 3I6LE 3RVXD 1T04B 1KT2B 1T89A 1F3RB 1J88A 4LHUB 1BQLH 4M7LL 1KJ3H 5KANG 5CJQL 1AO7E 3MV7D 3U4EB 2P5EA 3CC5A 4F37F 1R5IA 4JG0H 2VE6B 4NUGL 3B9KD 1U8HB 4LLYB 3NACL 4DGYL 4MGXA 1UB5B 3B6SA 4AEIL 4GW4B 2P44B 3CVHL 1P7HL 1S9XB 1BJMA 3FTGB 1CFVL 1KN4H 1S8DB 1Z3GL 3MACL 1CE6B 1LDPL 3IDGB 1FL3B 3WLWC 1FYTB 5C70A 4KDVA 3DX6B 3BDYH 1IFHH 1RUPH 4OZIA 5A3IC 1VDGA 3MLSH 3D25A 5HI3D 4JFPB 5I1KH 1UWXK 3ILPA 3L5HA 4HDIB 5IROA 5D6CB 2CDEB 1EAPB 1I7TA 2EDBA 4YHNA 3IFNH 1T20A 3QWQB 4ENEC 1TZHA 2FO4B 2YZ1A 8FABA 5GRWA 5KS9B 2JB6B 4ESKA 1G0XA 3PL6D 1F4XH 3EO9H 3H9SA 2V2WB 1UQSB 4UDTB 2BHUA 2NW3A 4F33A 2O5XL 5J6HA 3U9UB 4N8VG 2JB5H 3OJVC 1MJ7L 1ZHBA 1A6WL 3OKNA 4G8GB 2I25N 2Z31D 4EJ1C 5A2KH 4K3JH 3MBXH 2XWJB 4NO5B 2EEBA 1I3UA 4L4TA 4KTDL 5E2VH 3VXOB 5FKPB 1CWVA 1GGBH 5TF0A 2QQLH 1AI1H 5BZDB 4I9WE 3WJJA 3RBSA 3V6FB 5DHYB 1CDJA 1QSFB 4XC1L 3UTQA 1M71A 4WI6A 4Z8FH 4N0FB 5B3NA 4N9OB 5DK0B 2Y6SC 2MSPA 3LCYA 3UTZA 5EZIL 4J6RL 2Z92B 2VDNH 2D31A 3DGGB 4JFXA 4PJCB 2OTWA 5ALBL 3IJYB 3BZ4B 3U2SA 3TBWB 1AP2A 1MCFA 2VXUH 3B9EA 5F9JA 3T8XA 3TCLB 3U1SL 4D0CA 1HILA 2BVEA 4WHDA 4OCWL 1XIWD 3FONB 4ONFL 3AREC 3VFUB 4X6EB 4MJ6B 4AYFA 1QG3A 1EZVX 3F8UB 3AREB 1UKSA 5HI5D 4F7TA 4UI2A 1K4CA 2PYFB 2AJVL 2G2RB 2VL4A 3SE3A 2D4FA 1CLCA 4NCDA 3BRFA 3IDMB 4ZUUB 5INDA 1DQQB 2IFFH 2P5WA 4KTEL 4O2CA 4AH2B 3JTTA 3H6JA 2EZ0D 3IS0X 1KULA 4WV1A 5DK2B 3GSRA 4TSBL 5HDOA 3O3EB 1U95A 1EO7A 2Q86A 5I15L 1CL7L 1I3RA 3SGDI 3CFCH 3CVHB 1T6VN 4PJAF 4PJIB 1RJYA 5IJKA 4YDVB 4WCYL 5IVNA 1YEIL 3MNZB 1UKTA 4R26L 2AK1L 4MMZC 4DFHA 3ZDYE 3ARBD 2N4IA 5DJ2B 4I5BA 4JKPL 4P2QD 1G6VK 4MA8L 1JV5A 3NIFE 5DDHA 1B4JL 4OZHA 5JORA 2X6MA 3ZO0A 4HUXA 4WI7A 4XCCH 1FHGA 4QNPF 2KDGA 4YDJA 4J3TA 1CF8H 3D5OF 4GUPA 2J8UF 3BT2L 1NAKL 2IBZY 1ZLWH 4Z78B 3O6LH 4QYOA 3MO1A 1T7ZA 4XPHH 1OPGH 1HWHB 4HUUA 2XZCH 1T83C 4QT5A 2CXGA 2DLFL 3B2VH 4PB9H 3CLFL 1EK3A 3DMMD 1ZT4A 3OAUL 4L3ED 1WC7A 3JVGC 2R56H 3LKQB 5ANME 1MRCH 4DN4H 1AD0B 4LKXB 1MHHA 1CL7I 2HAZA 5B38B 2FECL 3BHBB 1FORL 4JZOB 1QBMH 2W0KA 3T2QA 4PJBB 1L0QA 1HWGB 3DRTA 3MLYL 4N8VA 4MLSA 4AENB 2PXYD 3RKDD 3TT3L 2WNGA 5BRZE 2AS5M 5ID0A 3KPLB 3AVEA 2V17H 1TTFA 1GSMA 3N0PB 4AEFA 4OB5H 3MRGB 1J0KA 5L9DL 1Q72L 4JANA 1N3NB 2IH1A 3T0EE 4MXVF 1VHPA 5T33L 5I2IA 1KPVA 3RY6A 4OI7A 4OCNC 1NGPL 2OI9C 5MEND 1SHMA 4NFDA 2IGFL 3V5KA 5H37H 4U0RC 1ZA3B 1KCUL 4RCAA 4OCSL 1Q0YL 1QHOA 3PXJA 3IU4H 4ODSL 1E6OH 1KTRL 2LABA 3L3OA 3S4SG 1K3ZA 2IADB 3TBSB 1URLA 4U0RB 5KVDL 4PGBB 4JQVC 3CXHJ 1MPAL 3FQRB 1FAIL 5EU6B 3B83A 2IBBA 1A7NL 4AK1A 4Y4HC 2IQAA 1CFTB 1LD9B 2F15A 4Z7OF 2Z8VC 3QO1A 3PGFH 2FECI 2MHAB 1F4WL 5MI0C 4Y4HB 1LK3H 1OF2A 6FABH 2BFVH 1L0XA 4PLOB 3HRZA 2X4OB 5HYSB 3SDDA 4M7LH 5GGUB 1ZHKB 3ARSA 1IL1B 4LPXA 3VCLA 2RCSL 4K2UL 4XBGB 4EDXA 5CJQH 4M7KL 1IQDB 1ZLUK 1F6FB 2CD0A 1YY9D 2X42A 4NO3B 1A02N 4NUGH 2ZZUT 3I50L 1MVUA 4NZUL 3VGBA 3O45B 4LMQI 4MWFA 1CTNA 2OJEB 3QP3A 4FMKA 1KB5L 3NACH 4DGYH 1NANI 1I4FA 3ILQC 4AEIH 5FM4A 4KJPD 3CVHH 2LQRA 4Z7UF 4LASL 1T22A 1Z3GH 2EE3A 1LDPH 4NPYB 3P73A 3WEXA 3P40A 5ALCL 1ZSDA 3GSQA 3LKPA 3CFJB 2LE9A 1NEZG 1BFVL 5TFSL 1FFRA 1GGIL 2EKJA 1U58A 4I1NB 1CE1L 1ZT1A 2ESVB 4M61B 2WWMC 4MNHA 5K9OA 4NOBA 4PY7B 2GK0B 3R0NA 5DFVC 5MEQA 2Y23A 5KSVA 1DEEA 1T7XA 3BZEA 4D8PB 1AR1D 3ZLQC 1SEBA 2GTZB 3GSOA 5T1KB 2N1KA 2HTKC 3VFRA 2NX5A 2HT2D 2X1WL 4U1IA 2O5XH 3T0WA 4O58H 4MNGA 4LRNL 1MJ7H 4BZ2L 1AHWC 4WU5A 1A6WH 5IP4A 1U3HC 1V5JA 2NY7L 1I7ZA 2IPUK 2ZSWA 3RDTA 4Z7VB 3ETBF 5CJ5A 3KPTA 3LIZL 3D0LA 1T21B 4ZO8A 1NGZB 4KTDH 4ERSL 5C0NC 3E3QE 1ZLWK 4AY0A 4YQXL 3ARUA 1XGRB 3BH9A 4BZYA 4HS6A 4JVUA 2R1XB 1QVOA 2Y72A 3OKEA 5E6IC 3SY0B 4M6NL 3S96B 5JOPE 1QFWM 2AK4A 3HPJA 1TVBB 5FYJE 2ZUXA 4K9EC 5EZIH 1A7PL 5E6IB 4J6RH 2PYEB 4AM0A 4HV8B 3EW3B 1OTSC 5ALBH 2EO9A 3FRUB 4NQDE 4OSUL 5DRZA 3U4AA 2ADJA 5I66A 5J13C 3U1SH 3R0MA 3C6LD 3GSVA 2XN9D 1AE6L 4UOJA 4OCWH 3OJMB 3TBTA 4ZD3L 4ONFH 4Y2DB 4I18C 5IW3A 5FFLA 5J13B 3QUXC 4LQ1A 1WBXA 3DV6B 5CEXB 4U05A 4TRPL 1ZA6B 2QSCL 5D1QA 5EOCL 3D39E 4CU8A 4HFUL 1BD2D 1I3GL 1CICA 2AJVH 3T65B 4G9FB 3TNNB 1C16A 3I3EA 2HJFA 1LEKA 5IW6A 3S4SA 3B2UD 5GSRA 1CG9B 2H9GA 4KTEH 1YYML 3OKOA 2LFGA 4NGHL 4RMRA 4ZAKD 4RA3A 4LKCB 3OKYA 2DQFA 4TSBH 3SE4C 3ORJA 4F8TA 5EC1A 1UH4A 2GFBA 4PJBF 2YSSA 5HI4D 1KB5B 1CL7H 5I15H 2PUQT 3DWTA 1MFAL 1DBBL 1B0RB 4B53A 4PRIA 3JXAA 2X4UB 4PRID 4P2OC 5C0BA 1EXUB 3E6HB 5A16A 2HWZL 4WCYH 1YEIH 1KUMA 4P2OB 4R26H 2AK1H 3ZKQD 2IAMA 4YC2C 4ZXBD 2DICA 3HI1B 4JKPH 1IVLA 4MA8H 4NOFA 2Q87A 2CQVA 2JCCF 4QHMB 2Q3ZA 4FQXC 5INCA 1OB1A 4PG2A 5C6TL 1B4JH 4YC2B 2X05A 1S9YA 1QOKA 1OQOA 3PWPB 5EB9A 1T0NA 1HYRC 5GIRA 5D7LB 2OQJA 1A1NB 2H3NA 4FQXB 3LKOA 3UZQA 4PBXA 4X6CF 4BZ1H 5AD0A 3P4MA 4X0KB 1Z0NA 1SJVA 3BT2H 5A1AA 1NAKH 1AO7B 4JRYD 5IBTL 3P0YL 1PSKL 3MNWB 4JFFD 5DTFB 3RUGA 3HMWL 2WBJA 2DLFH 3CLFH 1SY6A 3OAUH 2CUHA 2I07A 2IALA 2VDPL 4OZ4A 1DQJB 3H2WA 5FK9A 3BJLA 3DIFA 4JFEE 5GRUL 5D2NB 3EBAA 3O8XA 1J0ZA 1EMTL 1I85C 4FTVE 1JHKL 4PP2A 4F3FA 1FORH 3RNKA 4XP4L 5CBEA 3VXRB 1MLCB 3HN3A 2I27N 4JM4L 3MLYH 1QPPA 2PTVA 3TT3H 5E2JA 5DQ9B 3BZFB 3FT2A 4FG6D 4ODVL 1NLDL 5EU3B 4ELMA 4X5XB 1D5MB 1WK0A 5L9DH 4GG6A 1Q72H 3F65A 4GKZB 3V4PL 3VXUB 2XACC 3O11B 4FABL 5J3HD 1CFNA 5DJDB 1NANH 1RZJC 4U1HA 4KKBC 1RURL 1R24A 1NGPH 5CAYB 4JM2F 4WJ5A 4XPAL 1TVHB 5TJWK 3ROOB 4M9OA 3KPPA 3D48R 4GBXD 3JUZA 3C5SA 4GH7B 1KCUH 4OCSH 1Q0YH 5I8CA 4ODSH 4GRWF 1PD6A 5DD6A 3LKRB 1FNAA 4I0CC 3EDKA 4HLZG 4KJYA 2XNAA 5IEHB 5KVDH 1T03L 1T3FB 1MPAH 1F6AA 1FAIH 2AJUL 2CDFA 1A7NH 1G7QB 2DLTA 4PJFE 3U7AA 1U9KA 4PGEB 4RX4A 4Q9RL