5I19H

Crystal structure of human germline antibody ighv3-23/igkv1-39
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i19H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i19H01
1AKJB 3NFPB 3G6AA 5H37G 1WZMA 4M43L 1GAFL 3UYOD 4UU9A 1WBYA 3VG9C 3B6SB 3D85D 4UUJA 2CLZA 3NABL 5GRUL 4PP2B 2IBBA 1UCBL 3DRTB 5I1LB 3J7HA 5I16A 3IKCA 2LAAA 4HGKC 1JYVA 3VGBA 1VFBB 5MP6H 3DTXB 3ECBB 1N7MH 3WKMH 4L4VD 3RQ3A 3N85L 3JWDH 15C8L 5C0BE 2VQ1B 1FO0A 2BVOB 2PW2B 2YMXL 3QCUL 4KV5F 1JGVH 3CD4A 4LPUA 1P5UA 1F58H 4MD0B 2A1WH 4HFUL 3B6SA 5I66A 1FGVL 4PP2A 2XI9A 4YXKL 3P30L 4I18C 3DRTA 4WO4B 5I1LA 5BZWB 3A67H 4GRLD 1ZLUH 2VKXA 2NXZC 4GW1A 4JAMA 3TBTA 2ESVA 4CU6A 4JDTL 5LQBL 1IRAY 1RIHH 3RUGE 1IGYA 3VXUD 1F6FB 2B8OT 5JA8B 1C1EH 1ULVA 2W65B 1ODAA 5ERWA 4FQQB 3GMPB 3HMXL 2XQBH 1V7NH 2VQ1A 1KJMB 3QUMH 5C2BH 1BZQK 3EO0B 5HVHB 3LV3B 3ARDD 2QR0A 3LZFH 4OGYH 4U33A 3H9YA 3ZDYF 3WFBL 1QUNA 2IBGA 1IKFH 3LDBB 1A21A 5E8PB 3VXRD 1QSEE 4OCXH 4EDXA 2H8PB 5F7KC 3MSPA 4WO4A 2ICWI 5BZWA 4TTDD 1FZKA 3C09C 4OLWL 1JI2A 2H26B 4KK6D 3P9LA 3KLSA 4ZO8A 3D85A 1DFBH 3EOTL 3LPGA 2YXFA 4P3DB 1WWWX 3HI6L 1P5VA 4NN5B 5F1KC 1DP0A 1MPAL 1WZKA 1CD0A 3EJZC 3I85A 4LRNL 3ULUH 3BN9C 4L4VA 5HHXL 2H8PA 3BH8B 1JGDA 1Q94B 3SE4A 5CP3H 1REIA 1NGPL 2P47B 3ZTJH 1MFCH 3WL9B 1GZPA 1IZKA 1RZ7H 4MXVF 4Y4FB 1EGJH 2VKWA 1ZGLM 4D94A 5CILH 1G7IA 4QXWA 1QFPA 4U1GB 5EO9B 3WDHA 3U7WH 3DYPA 3EJYC 2R39A 1F8TH 3KXFD 3ARWA 2RAMA 3KYMA 4P5KA 1IILE 4PLKD 4TUJA 3L7EA 1A6PA 3VXUA 4WNQB 3TESA 1X6LA 1IL1A 1GYAA 3H9SD 1Q94A 5F7LB 4Q97A 5L6YL 3QA3A 2Q20A 5DO2D 4WI8A 5CEZE 1YC7A 3PL6D 4KRPB 5DD1H 5DUMH 3ARDA 4QRTB 1ZVSA 4M3KB 4W70A 2UY7A 5FF6B 3L1OH 4AG4H 1JL8A 3VXRA 4NQDD 1JNJA 2BY3A 1A4JB 3E3QC 1WBZB 3MRBA 4EBQH 2HJLA 4M7KH 2V7NB 1MRFL 5DUBB 2ADJA 5HDBE 2VDNL 3LS4H 1OY3B 3PJSB 3CLFL 1EO8L 2PN5A 4MSWB 2QLVB 1BFVH 5DRWB 3PIQA 4YGVA 1N6QH 1SJEA 4OFPA 1HWHB 2W0PA 3CZFB 5HHNB 1B6DA 2A83A 5GSVB 4AK1A 5C7XL 2F54D 1OARH 1U8OB 1V3KA 3GSRB 4ZUTA 1NBVL 1V3LA 4OZFB 6FABH 1RZKH 1A4JA 3D3VE 3CVIL 3DXAB 1LO3H 4ELME 2E7MA 3QPXH 3EFDL 3MLWL 4X98B 4EOWH 4OI8A 1XR9B 4I9WD 1UACH 4LCWE 1C7SA 4NKMA 3QCVH 5J12C 4ZQKB 3KXFA 4QHKI 4JGMA 35C8H 5GSVA 1IE5A 1FHGA 1D5MA 1A3RL 2GW5A 5DXWA 1U8OA 4D9RE 3HAEB 4UNTA 1AGFA 3GZKA 3FRPA 4MDJA 5I1DA 3V0WH 4WGWB 3BKCH 4OZFA 5DHVB 2F58H 2YD3A 3WE6B 4DVBB 4MNQB 3JWOH 5KSUB 4TOYL 2LU4A 1BX2A 1JP5A 1WVZA 5CSBA 3VE0B 3U2SB 4UILL 2NY2D 4NQDA 1X5JA 4HXBL 4WHTB 1U41A 1F4WH 3ARED 2CDFA 5TQ2H 3V6OC 1RZKC 5IEKB 2HN7A 2OSLA 4KY1L 3CXHJ 3HAEA 5F1OB 4BK5A 5I8OH 4KI5D 4M48H 1AH1A 1H3GA 3S35X 1XCQA 1DJSA 1I8IB 2ENYA 4G6FB 3RVTD 3CFCL 5ACZB 2ADFH 1G7HA 1KSRA 4PG2C 4F37F 2D3VA 2FB4L 3ZE0F 3GB7A 3D39E 4TVPH 2JJVA 4R6UA 3OPZH 2F54A 3RDTB 3U2SA 1H15B 2IAMB 3P2TA 1AJ7H 1RJCA 1CDIA 1A5FH 1HHHA 3H9HA 4AEHH 5FK9A 2V5SA 3RAJL 2BHYA 3KVQA 2HTLC 1N0LA 1BJMA 1IAIH 3OAUL 3BGMA 1YNLL 5I30H 3BGFC 4MLIA 5DRXA 1I8IA 3GJFH 4PJBA 2YBRB 5ACZA 1CDBA 1BQHG 4YH6A 3MV9B 3ALPA 2DJ4A 3SHSA 5LWYH 1BMGA 1MF2H 4P49A 3QYCA 4HG4J 5CIPB 3CFIC 4NN6B 1OTUD 3MRIB 3PQYB 4Z77B 2WBJC 1X5GA 5JW5B 3MCKB 2GTZB 1EBAA 2IAMA 3U0WL 4KJQC 3P4MB 1JFQL 5HPMB 4KZEL 1QVOB 4WW2C 2FO4A 1CLYH 4JFXA 5JPNB 4ONHB 4GJTB 4DGIH 3IFPB 4I3SH 5ACLA 3HB3D 3O4OB 4OZHE 3BRFA 3KJ4B 4BZ1L 1JYWA 3RL2B 4QTHA 5CZVH 4HXAL 4NRYA 4P23B 3AREA 1M7DA 1T04B 5JW5A 3LPFA 3QQ4A 4C83A 1HXYA 3OHXA 1BBJA 4PJHB 5HYFA 5DURB 2FX7H 2UWEE 4PYHA 1WT5A 5F6HJ 4S11A 1OB1B 2OS7A 4Z7WF 4ZUWA 4JREC 4S1RL 4PRDB 2Z31C 3UTPD 4IIQA 5K59E 5GS2D 4WEBH 1NANH 2BJMH 3ZDXE 5IBUB 5MENE 2Y23A 4K71C 1JHTB 3HS0A 3RWFA 2XKNA 3ZTJG 1G0DA 3TT3L 5T3XL 1FFOB 4Y5XA 1GGCH 3MGTA 2EE9A 1FYTD 4CVWA 3RKPA 1JGUH 1P7KB 4PR5B 3CFDB 4AL8L 2CLRB 3CXDL 4C56B 1EZVX 1ETZA 1N4XL 4EI6A 1AD0B 2W0KA 5DEGB 3FT3A 3UROR 3UZVB 1NC4D 2X1PA 4PRDA 2QEJA 5ABDE 5T1LB 1IQWL 4JN2A 4MAYB 3QIWD 5ELIA 1B4RA 4NNXA 3VGAC 2ICWB 1QQDA 4PGZA 1K8IA 1JHTA 1FFOA 4H20L 4G8IB 5KTEL 1BFOB 2V9RA 1P7KA 3CFDA 1RMFH 4MJ5B 4R7NB 1EZVY 1Z0NA 3EW3B 2CLRA 3IDIA 5HXMA 3LCYA 2QQNL 3X12B 2PO6D 4D9LL 3SBWA 2HFEB 3GJEB 43CAA 1AD0A 2WV3A 5DEGA 2XG5A 3KNBA 4GRMA 4HJ0D 2OLDA 4HDIB 1FYTB 1F4HA 1G7QA 4IRJB 1BHGA 5F72S 2ICWA 3LMJL 2G2RA 3ETBF 1P2CB 4L1DA 3ULSA 3GHEL 4UBDD 3OV6A 1CXKA 4XWGH 1T03H 1TZHB 2XWTA 2VAAA 4TPRH 5DJYA 5A2LH 4L8DA 4TUKH 4JDZA 5EU7E 3RFZC 2W91A 5DRZB 1BWMA 5FA4A 2ZPKH 3OJVC 5B39A 5C09B 4OCMC 4XPGH 4N0CD 4HDIA 4P59L 1FYTA 1AXTL 2DTMH 4EEEA 4NWUH 1A7NH 5ILTL 3WLWC 2BVYA 2BSRB 4W6YB 4KGJA 4ZDHA 5IMOA 1U2HA 1P2CA 3AVEA 4RWHA 2HH0L 3QAZC 3LPWA 1E0OB 1NC4A 4WENB 5JZ7C 2MCPH 1UM4L 1TZHA 3PNWB 1WAAE 3C5JB 3SO3B 4JRWA 3TA3D 5JO5B 3QIWA 4PV9A 3UPAA 1I9JL 3KPLB 2IQ9H 2I24N 4PRBA 4RFEB 3GUTB 1WWAX 4NQUA 1S9XB 3DVIA 1SY6H 4P2QD 43C9B 1MI5D 3FB6A 1AR1D 1VACA 1XGRB 3ARZA 1E27B 4N8CL 4HS3A 4N90E 3P4NB 2PO6A 3BWUC 4NNYA 4CKVX 1TDQA 1XR8B 1S9YA 1PVHA 1R0AL 5BV7B 3F7VB 3K3QA 4UB0H 4YIQA 5I8KL 1T4KA 2MWCA 4BK4A 1SM3L 1I3UA 4AQOA 2F8XC 5K9JH 2H32B 4YBQC 4CMHC 3IDNB 3ZYOA 4QRRB 4U1IB 4ZAKC 4ZFGL 3QHFH 3IGAB 4HUUB 4PJAB 2YRPA 4LHUB 5KAQG 5DD0H 3QNZB 4NQEB 2VZOA 4NHCL 4NO0B 2OI9B 5D6CA 1XR8A 3I3BA 4HW6A 3TWCH 5EUKB 4JZJB 1KPUA 4W4NA 3KPSD 2AEPH 5I8EA 2HFGH 5DJ6A 1F02I 3MR9B 1MJ8L 4KV5E 3UPRB 3DUUB 3ARTA 3SO5A 5EU3B 2AKRA 4HJGB 4GH7B 4PBVC 3UAJD 4YNYB 1XEDA 3PWPD 3S97C 3BW9A 3QNZA 4NQEA 1CLZH 3IXAB 1N5AB 2DM7A 3TA3A 1QNZH 4WW1A 4G9FE 4CVZB 3DYOA 3IB4A 2I5YH 5KSAD 4HH9A 2A6IB 4JZJA 4U3HA 2CMRL 5FHBH 4P2QA 1MI5A 3V52L 3B5TA 1I1CA 2HT3C 2OM5A 5F3HA 3DUUA 5L0QB 5FYJL 5EU3A 3Q3GA 4NQCE 2D4DA 4WTWA 5EORH 3MLRL 2ZUYA 4J8RA 2O5XH 1UZ8B 5JLZA 4F9LA 3SDAB 5HJ3B 4CVZA 3C6LD 1T7YA 4IRZL 4WI6A 3SOBH 5HYSA 1BAFL 4ZFOB 4DN3H 1BBDH 3T4AB 3WFDL 4LAQL 2ZKHL 4LNRA 4K3EL 2VSDA 2GSGB 5DEFB 1G7PB 2Y1VA 2NPLX 4U6HB 1ROWA 3EYFB 3KPSA 4NKIH 5C0CB 3WFCL 2W0FB 3SDXA 2C3VB 2HVJA 1GGIH 1TJHL 2JIXD 3KJ6H 4J3XA 5IM7A 3ARYA 4YE4L 4LK4A 2BSTB 4P46B 3NTCL 3P77B 1N5YL 3DO7B 4HHAB 4ZFOA 3PWPA 1OQOA 4LSRL 3GSUB 4YX2L 5INCB 5I18H 3PWVB 3QQ9C 1LNUB 1JWMB 1U92B 5J11B 2DQHL 1CD1A 1QKZH 3EYFA 4E5XB 2D7PA 3GEWB 5C0CA 5DGQA 2P8MA 4JKKA 1MCWM 3QDME 5DJ0B 4AENB 1S3KH 3SPVB 3O3DA 4GG6B 1FNGA 4K3JH 3RVUD 3LKRB 1W72A 3P77A 1L7TH 4KVCL 5I0DA 1NCDH 4BZ2L 3DO7A 3SKOB 4YHMH 4G8GD 3MGOB 1NFDF 1T2QL 4JPKH 1NCWL 3STLA 1KENH 1X4XA 5FYKH 1I8LA 3C6LA 3TO4C 4OCYL 1X4ZA 5L7XL 5HDQL 3LKNB 2RCSL 2OTPA 3LN5B 4I2XB 5DJ0A 1UWXH 4AENA 5D1ZB 5IHZB 5AD0B 5C9JB 3BP7B 3PGFH 2DDQL 4N0UB 1JZ5A 3SKOA 3MBXL 2VJXA 3FO0H 3IU3B 3QXDB 2OL3H 2DQJL 4XHJC 4P2RD 2BNQD 2JIXA 2YPKA 4HPOL 2H6PA 2DQGL 2MHAB 4FQJH 1FPTL 1PGRB 1U8LA 4MNGE 4N9GA 5JHDB 4ODTH 2FHCA 5GHWH 5IMLB 3OSKA 5IMKA 1NGXB 3ALWA 3MYJB 4I2XA 4R96A 4NSKA 2CIKA 2V7HB 5AD0A 5C9JA 4N0UA 2LQRA 3PWJB 5GRVL 1XF2A 4NM8H 3MV8B 3QEUA 5C0DB 4HUNB 1T7ZA 3IU3A 3L5XH 1ZAGA 1X4YA 1KF9B 4XAWH 3MACL 4HPYL 3VFSB 2DAVA 1U8MB 3RIFK 1DSFH 4XNXH 4XNZB 4Q9QH 2L0DA 3X11B 1I75A 3RA7L 3R8BB 4U6YA 4U1SA 1Q38A 1F3DJ 2IPUG 3QDGE 1KLFA 5C0JB 2M26A 2DYPB 2EYRA 3TN0C 4WU7A 3NCMA 1K5NA 1OCWL 2DMBA 2EDJA 1T3FA 3NACH 4QTIL 1MQKL 2E5EA 5L2KD 2NTSP 2ZNXA 4FQLH 5SWSD 1U8PB 3F5WA 4P2RA 5GZNC 3DIFB 2BNQA 1P7QD 1I1YB 2CJUL 3IVKA 1J86A 1E4WH 4G7VL 5ITFA 3NN8A 4UIKL 3ZSSA 4Y19D 2YN5A 1WCBA 1PFCA 2X1QA 3WCYA 4CJ1A 3ARFD 1I4FA 4B53A 4Z7UA 4P4RB 2I26N 3RWCA 1VEOA 3LAFA 4AYFA 2QKIB 3IFNL 2QL1A 1G9NH 2EYTB 1U3HD 1VEMA 2LTQB 5KANG 4HGWB 1DUYB 3QCTH 2CRZA 4OAWA 3V7MA 5CLWA 2Z8WC 1AO7E 4CN1A 4K07A 2HTKC 5SWSB 5D7KE 3HC3H 4KKLC 2FHFA 4LDLB 5DHXB 3S37L 3RY6C 1NMCB 5D2LF 3ROOB 1YJDH 3MUHL 1PLGH 3ULUF 1OAUL 5DZLA 2IPTL 5GIRA 1W8OA 2Z35A 1GAFH 5ADOL 2MKWA 5F3BA 3FOMB 1IGTB 4URTB 2XTLA 5INDA 5MEPB 2ED8A 5C0EB 3QPQD 5F1NB 3WO4B 2FH8A 1DQML 4JG0L 2X1XR 2YPVH 3O2VL 5GISL 3KPMA 4OZIF 3GMQA 3DMMC 4RGNB 4YDVA 4Y8DC 5EFIB 1FO0H 1DUYA 3RPIB 1U8JA 5L2KA 3MODL 3HZVB 2KPNA 2DLTA 1HYSD 4Z7OF 5SWSA 3QXWA 1DBAH 2GYSA 4XVTH 15C8H 4WUUD 3BE1H 5GRJL 4DN4H 2D7NA 1G9NC 1P7QA 2EE3A 4OT1L 3B5HA 2APWA 1U3HB 1INDL 3QCUH 4BKLB 3NCYP 2BNRE 3DVGB 3QB7C 4Y16B 3JBG7 1J8KA 1WGOA 4K55A 5ESQB 1OAKL 4HFUH 2DWDA 4WUKH 1FGVH 4U05A 1H3VA 2J6EH 4X4YB 5EFIA 2AJSL 5ANMB 3R06A 4P2OB 5LQBH 2BOCA 3NZHL 5D70L 4NUJB 2Q7NA 3BHBB 1W0WB 3HZVA 1A6VH 3X13B 4PJ7B 4KDWA 1EHNA 5HYQA 2NW3A 2EC8A 3BMWA 4KXZI 1U3HA 4YHYC 1ND0A 1I3GL 4QY8B 1Z9SA 4NZRH 1E4XL 4ZUUB 4UOJA 3KLDA 2ZJSH 4DQOH 4P9ML 1KJ2L 1PYWA 4WUUB 4PTTA 3IDJB 2NY7L 3IXTB 4N8VG 4UMGA 4P2OA 2X09A 5DGRA 1J10A 4ERSL 1DLFH 1W0WA 1EHLL 4MMXC 3L9RB 1KELH 2A38A 2RIKA 1FNFA 2AK1L 1QO3A 8FABB 3MRNB 1CYGA 3MRFA 3LKPA 2CH8A 3MRJB 3EUUA 4GXVL 1JHLL 5IHUH 1BFSA 4ZUUA 1RZIA 4TUOA 4DTGL 1KNOA 3O6MH 4WUUA 4LLWA 3N1PC 4ESKA 1YYLL 2IGFH 5D9SA 2A74B 2Y36H 3W11C 2PW1A 5J6HA 2AEWA 4WO4C 3S8WA 5I1GH 1LEIB 1F6AB 4O4YH 4Z0XA 1KIRB 4NZDA 3MRNA 1KN4L 1F90L 3LKQA 4V1DD 2GFBA 4O2FA 3T0EB 1KCVL 1QSFE 2F53D 1KCKA 3QUYB 3RWIB 4XNQA 5IV2B 5E94A 5FGCE 2FZ3A 3H3BC 3OJ2C 5HVHC 2ARJB 5C8JB 1CT8B 5FDYA 1OP5H 3O2DA 3O8XB 3IDMB 3GSVA 2NY6D 3EOBA 3G08B 5L6YH 4OV5B 3LDBC 4JANA 1JPTL 3U4EA 3NCFB 3HNSH 3SE4C 1MOEA 3PDOB 5IMMB 4XPHH 4UTBL 2R0KL 4GAGL 3T0VA 1WF5A 4WW2F 5E9DB 4LSPL 4PB0L 1DBJL 1KIRA 4UIMA 4O5LL 1UZ6F 4JHAL 3QFJE 3ZO0A 2R1YB 2X4RB 5ETUA 3T0EA 3MZGB 5JOPE 5F9JB 4GBXD 3W0WD 4NKDB 4JB9H 1UXSA 1YY8B 1IM3A 1MY5A 4UDTB 2OZ4A 5I71C 1EERB 3O8XA 5FAAA 1I8KB 3I50L 1K8DB 3U36A 5D2NA 1CQKA 1YQVL 5C7XH 2F53B 5DHYB 3MOBL 3JXAA 3M1BA 3EZJB 3ARDC 2WUCL 1GSMA 1K4DA 3BX7C 3OAZK 3CVIH 3LEVL 3EFDH 3MLWH 4JG1H 5HHMB 3VDBA 4U1KA 5KVDH 3E8UL 4TTDC 2VXTH 1RK0B 4OQTA 1I8KA 2CUMA 1HCFX 4I0PD 5DRNB 2A6KB 4KK6C 3VRLF 4FZ8H 1K6QL 1UB5B 4RNRB 4OZFH 4V1DA 4TSAL 2F53A 4YEEA 4RRPA 3F65A 4V2CB 2YKLL 1H8NA 1CF8H 4OLVL 4PTUA 4O51B 2EXYD 2OQJB 3O6FB 1FFNB 1VERA 3TZVB 3F8UB 4FQCH 2XWJA 3L3OA 4NKOB 1BIIB 3ET9F 5E2VL 4TOYH 5AEAA 2YC1B 3KLHD 3BKMH 4ZTPL 4KUZL 2CXGA 4M5ZH 4UILH 3TIEA 1T5XA 3HAEH 2FWOB 1FV1B 4G43A 4J12A 6CGTA 3PP4H 4AM0B 2YOCA 4NQXA 5DHVH 4D0DA 5JMRA 3OJDB 5AWNL 1ORSA 3CPLB 1A9BA 4GBXA 3W0WA 2AJVL 4U2YA 1MCLA 4O51A 3U83A 4PLKC 4R3SB 2R69H 1DBBL 5CCKH 2FB4H 3RNKA 3V6ZB 3PXJA 3PWNA 4HFWA 3GSXA 3I6LE 4X80H 5DD5L 4WWKB 5E24E 1JNNH 5DO2C 3T3MF 4C59B 5DMYA 2PCPB 4WCYL 1FV1A 4JFYB 4WDIB 4MXWH 3MRPA 3RAJH 4F7PB 2AAVA 3OJDA 1HHIA 3FQXA 2O5YL 3BD3A 1IKNA 1J7VR 1Z5LB 3AU1B 4HUMB 1A7PL 3U7AA 3GIZL 5TGBA 5H35A 4L5FL 3C2SA 4I0PA 4CADA 3V6ZA 3AAZB 3SKUD 5E7FA 3LHPL 4LLQA 4Z7VA 3BZEB 2ZG2A 3VFPB 4X4ME 1UB6B 5TDNB 3FCTB 4JFFE 4WFFD 1PBYA 3ARRA 4APQB 5SWZE 1D9KB 2UZYB 3U0WH 3F62A 2HG5B 5E8NB 1JFQH 1S7SB 3UTTD 1GJIA 2ORBH 3G9VA 3BEVA 4OLZH 5EOTA 3IYLW 5T1KB 4ODSH 4JO2L 4P3CL 4HXAH 4MX7A 2ZCLL 1VEPA 5DF0A 2QV2A 1LGVA 2B1HH 4FXGB 4D8PA 4XPFH 4MD5B 3BZEA 1NFDE 1ZHLA 5GRWA 3HPJB 3GMOA 5ITBL 3GSNA 4R2GD 4XVJH 3W39B 2ARJQ 1ZGLP 1KCSH 2VQUA 3BUTA 2HG5A 2AABH 2IAMC 1A3LH 2ICEB 4JPWH 5GGTH 2AGJH 1LE5B 5EOCH 3N50A 3T2OA 2I9TB 5A40E 1TNMA 3SDCD 5EU4B 1YEGH 4YHKH 4YDJB 2R2EB 4ETQB 3DGCR 2CR6A 5T3XH 3UTTB 1JK8A 2NY2C 4JZOB 4LHJB 2VLJD 4LLVA 3E1F1 3QNYB 4AQ1B 3AREC 4RAUA 3W39A 1AE6H 2DOCA 1A9EA 5E6YA 2O26U 3CXDH 5D7IA 4KDTA 1YEFH 3CXHK 1SEBA 1TZGL 1YNTA 4JO1L 1U6AL 2ICEA 4LLUB 4W4OA 2YD1A 1I1AD 5I75C 3WNLA 4MA3B 3KYNA 1WT5C 5FO7B 2NW2B 4S0TD 2I9TA 5EU4A 5CUSH 1MIML 3O4OC 2C1PB 3F12A 1YECH 4IIQC 1N3NB 1C5DA 2GJ6E 3QH3B 4TQEL 3VXMD 4JKWA 4NIKB 3QFDB 3UTTA 5FFLA 5DLML 1NJ9B 4LHQB 4EUPB 1ZHKA 4FRWA 1C16A 4OF5A 4XWOD 4LSVH 4Y5XC 3SDCB 4D9LH 1ACYL 4MJIB 4JEGB 2PF6A 1CFSB 5D7JD 1T21A 4X8JA 1NCBL 4NBYB 3WIIH 1WITA 4RMTA 5FO7A 5J06A 1N6UA 3O45B 4G6ML 2VXUH 2Y4SA 3OQ3B 2XZCL 4RMSA 4RX4D 3QBTB 3G6JA 1OTUC 3WS6A 1WV7T 3RVWC 4OV6F 4PRHB 1K3IA 4ISVB 2Q3ZA 3TT1H 5KVFL 1SEQL 1B2WL 4ZNEE 1KT2A 1I1AB 2ATPB 4NCDA 2W60A 3UTQA 1ERNA 4M7ZC 5F7FA 4Y5YA 3SDCA 2R15A 4XP9L 3HB3C 1CFSA 1IAIM 5HDOA 5F7MC 5K9OB 1S7XA 4JKMA 3EYSL 2G5BA 2DQTH 3FRUA 3SBWC 5EB9A 1WWBX 2VLJA 4J1UA 5DEZA 1F97A 4W6WB 4X9GA 5L8JB 1FZJA 2EIDA 4M6OL 5F93C 3MUGA 3I6GB 1O7VA 5J1SC 2UZXB 4ISVA 4LLYB 5FGRA 2EDFA 1IGCH 1CICB 1I1AA 1EH9A 4OZFG 3QJFB 1UM4H 5CGYD 1NUDA 3FB8B 3O41B 3UMTA 4JO3L 1CGYA 3IT8D 4OTXL 2VDML 1EMTL 1QLRA 1JCKA 3BT2H 5TF0A 4JE4B 4R26L 4N0FA 4N8CH 2VDQH 1HHJB 1DN2A 4H26B 3SE9H 3RZCD 2FX8L 3HAEG 4NDMB 4KK9D 5D7JA 3S36L 3I9GL 3MOQA 2CDGB 2VDRH 3P9MA 4JM2F 3WHXB 4AT6A 5JIKA 5F9AC 3UO1L 3BDBA 4QHLB 3LN9A 5D2LE 4RX4A 3ULVL 1SYVB 1ES0B 3ROLB 1RU9L 3V6FB 3QIWC 3HG1B 3E3QE 3BZFB 3DARA 1J0HA 5FYLH 5BV7H 2IALB 1NKRA 3I6KA 4OIBA 2VQTA 4UNUA 4H26A 4OB5L 4W6XB 1VKXB 5IG7B 2H32H 4JCMA 1UM5L 3TBSA 3L95A 4JR9H 1PG7X 5D8JL 4Z7OE 2PO6C 3OXRB 4JFOA 4HT1L 5CINL 4JFED 1XCTA 1JNLL 4ZD3H 4UT7L 2H41A 2IQAB 2N56A 2NMSA 4HJ0C 3VRJA 1YN7B 2AQ3A 4ETQA 1YMMD 3TIDA 1ES0A 3ROLA 1FAKT 2X4SA 1Q9OA 3V6FA 1QPXA 1FAIH 1FLTX 4QT5B 5FIEA 3BP4A 2W9DH 1HSBA 1T66D 3QIUD 4UBDC 4XCFL 1SBSL 2X9XA 1VKXA 1B6UA 2C3HA 2HWZH 3F6LA 3NFNB 2YXMA 3LQMA 5IFJA 4OZGF 2GITB 4PJGA 2FGWL 4WV1B 3MRLB 2H2PD 2XQYK 2IQAA 4RFOL 5BV7C 1PW3A 1YN7A 1FNEB 2H1PH 4GW5B 4M7JL 2BDNH 4N0CC 3D9AL 5CJQL 1QFUL 1RUML 3MC0A 5FYJH 2AJYH 3S3SA 3RGHA 5EO1B 2IMNA 2XFXA 1CIDA 2MJWA 5GRZA 4BSJA 3G5ZA 1GGUA 5E2TL 4F3FB 3CDCA 5DQ9A 1QEWB 4LLMA 3TA3C 4YBLB 4JO4H 1EJOL 3V6OE 1UA6L 1BAFH 1AGDB 1AGCA 5T1DL 1CTOA 3WFDH 1BZ9A 4JZJC 3IS1X 2ZKHH 3G04B 2VN7A 3QDJD 4XP6L 4GW5A 1UQSA 1AR1C 4K3EH 1PSKL 4MJ6A 2IH1B 4HAGA 3QG6B 5F88A 1DUZA 1ITCA 2VDOH 1DE4B 4JFEA 1QZ1A 1TJHH 3T3PF 2AJZA 2EDRA 5EH1A 1YEDB 4NJAL 4E41B 2FYYA 3Q1SL 4Q6YA 2YWYA 2R29L 2V2XA 5IT2L 1JV5A 4PJAE 1H3WM 5IVXB 3OZ9H 2QADD 4F9LC 3BFOA 3RIAF 1RY7B 4F2MB 1T1XA 3G04A 3QIUA 1X9QA 2R4RL 4RAVB 2DQHH 1VPOL 2D31B 5HGBB 1MCJA 4GKZA 5DA0B 1P69B 2IH1A 1UADC 4P57B 5FKAA 4B5EA 5L0QC 3I02A 3TYGH 3T0WA 5AG9A 4KQ3H 1N64L 2V5TA 4JRYD 5LAXA 3X3FL 4CDHA 1MWAB 3C2AL 1S7TA 5BVPH 4M5YH 3MLZL 4X7FC 1UZ6E 3IKKA 2I27N 4RAVA 1IFHL 2D31A 3MXVH 3PXHA 1MCCA 2YD4A 3H0TB 2X4UA 4ODWA 1UXWA 1MWAL 2RCSH 1Z9LA 5CJXA 1HK6A 4EVNA 4PGEB 4XH2B 1GHFL 3QDJA 3GK8H 3L5IA 4OGZA 1QR4A 4QOKE 3NPSB 4FS0A 5ENWA 2V6HA 1SBBA 3BZ4B 3VJ6A 5I19L 4XCCL 1H3TA 3C6SB 2HVKB 5ICYA 1NGQL 32C2A 3GMLA 4PRPB 4L3EE 5D5MA 2YEZB 2X4TB 1KB5L 4JPIA 3I75A 3IAGC 1X5KA 1I8LC 3AB0C 3C6LC 3D87B 3WEXB 5J4MA 2HJKB 2E3VA 1NFKA 1P4IL 4UV7H 3S4SB 5EBMB 3VXTA 1Q72L 5IQ9B 5KS9B 1BM3L 1JHKH 5GZOD 1FG2B 4HH8A 5D7LB 2J3SA 3T04D 2HVKA 2OXHA 3TO2A 4PGCB 2BRQA 4F7EB 2X10A 1K2DB 4GAYB 3DVNB 1XMWA 3L6FA 2XA8H 4NM4L 3QRFM 4KHTH 2RHEA 3WEXA 1N2RA 2HJKA 4G6AD 4R4FH 4OKVA 2W38A 4IBLT 3S4SA 1R3HA 5EBMA 2VL4A 1A6UL 1QBBA 4FG6D 1DANU 2P5WE 5KS9A 3LN4B 2CKBB 4L29A 1KOAA 1N26A 2AJUL 4GG6E 2DF3A 1MCNA 3FO1B 4XBPB 4LF3A 3FAXA 5BS0B 3MNVB 4DGYH 1JWUA 4L9LA 1LO5B 1K2DA 1TJIL 4ZMAT 4PJXB 4HWBA 4Z0BL 3RVUC 4Z7NF 2P5ED 1DQJB 3NAAL 2CKBL 4OD1L 4MQSB 4KQ4H 4MA1B 1OAXH 4LHUG 1QFOA 3UBXI 1WEJL 4RDQG 5TE4H 2CJUH 3OWEA 5C0GB 4KAQH 5FM5M 3CX5J 1ZHNB 5DJCB 2OTWA 3VI4F 5IKCA 1DQLL 1PQZB 3DX9B 1CFNA 3O9WD 2ZSWB 3GI8L 3X3GL 4LEOA 1YEEL 2APXA 4HJJL 2BOBB 2R0LH 1LO5A 2VH5H 3HMWL 4LLAA 4NZTH 3HZMB 3RVXD 2XN9E 1EFXD 5JW3L 1XH3B 4EQ2A 3STZB 1J1XL 1QRNE 3U0TB 1RUAH 1OF2A 1ZHNA 1GGBL 2A6JA 3S88H 5AG8A 1EEUA 5IEHB 1L7IH 2NNAB 3R0MA 2VRAA 2ZSWA 3QEGL 5GGUA 3S37H 1O5DT 1CZ8H 3MV8E 2R0WL 1AC0A 1ZA6B 1OAUH 3V4VH 3AC0A 1ZVYA 3ARGB 5BXFA 1CI5A 1G7MA 4G3YL 1S9WA 4LU5L 4Y5VA 4OF0A 3BJ91 3K2UH 2F9BT 3BAEH 1XH3A 2JJTA 1RZ8A 2DJSA 1BD2D 3U0TA 1RIVH 5E70A 4YHLL 3BKYH 2P8PB 1M1SA 3MODH 4KMTL 1I7RA 5B8CB 1P7HL 3OAYK 3OF6D 1EFXB 2J5LB 4HUVB 1XGPB 2P5EA 3MBEB 2IFFH 4L9DA 5DQDL 4BQ8A 2Z0BA 2FR4A 1PD6A 5IW3A 4Y88A 1C8PA 3CH1B 4OGXH 4WI7A 1CL7L 2MSPA 2VXVH 3ARGA 2DQDL 3SGEI 1S7RB 3PDGA 3W9EB 1S8DB 2CUHA 3WFHA 5CEXA 3THML 3ZE1F 4TSBH 1UJ3B 3O9WA 2NX5B 2EZ0D 4LKXB 3MJGX 1L6XA 3SKNA 4U1LB 3SDYL 4X6BA 2FECL 3LS5L 4UI2A 5C0AD 3S96B 5BW7A 2AVGA 5E5MB 3QRGH 4YHNB 1EFXA 4HUVA 4QO1A 1MFAL 4U3CA 4PLJD 4NRXB 4PBXA 5GS0H 1OD7A 1FCGA 3P9WB 4FTVE 3QHTC 1I3GH 5IOPA 4L8BB 4XNMA 2P8LB 1NMCC 2VLKE 1S8DA 5F7DA 2BSSA 2BFVL 1TNNA 1M6OB 3B9KD 3HE6D 1UJ3A 3OX8A 1LK3L 5DTFB 1BOGB 5C07E 3WXVL 1BEYH 1PKQA 5I15L 4H88L 3T0DA 4RGNC 3N1GC 5I9QC 2VZVA 5E6ZA 5IF0A 5ISZB 1R3JB 5AYUL 1FFPA 5A16A 3GRWA 1BD2A 1QFWI 2EDEA 4GXVH 1JHLH 1KCRL 4L8BA 3IS0X 1U3HC 3MLXL 4ORZC 1OAZL 2VIRB 3TM6A 3BIKA 3ORJA 1BOGA 1MUJA 4ONGH 2GQHA 5EC2A 3VD3A 3L5WA 5GS0C 4KHXL 1L4IA 3JVGC 3I84A 1OSPL 2QHRL 1W72L 3MJ6A 3CUPA 2K1MA 2Y07L 4P2OC 3DETD 5EDXA 5IB2B 4Y4KB 1FC1A 3WKNA 1UJTA 4TYUA 3QQ3B 2VC2H 3O2DH 2ZCHL 3MJ9A 3LKSB 1EO7A 1I7TA 3QPQC 1BVLB 2EIEA 1X5AA 4ZYKA 5JTWA 5ECJE 5C0AA 2GJJA 1RULH 2ENSA 3HNTL 2VIRA 3GM0A 1DN0A 2WSKA 3U9PL 2P4AB 4XP5H 1TVBA 1Z3GH 4FP8L 3OR6A 1JPTH 5E56A 1YDPB 3LEYL 3FFCD 1DBKL 4DEPB 5HHOD 1OT2A 3L3DB 4UTBH 3SJVB 3AXLA 3B9KA 4EQ3A 3HE6A 3IFOA 4IOSD 2OZ4H 3O4LD 1ZOXA 2V17H 2X1OA 4IRSD 2FATL 4X6FA 1A4KA 1RUKH 4MA8H 3ZT6A 1S7UB 4PJBF 1R5WB 1MFEL 1VGKB 3UTSD 3L3IB 4MCZB 3D18B 3S7GA 5IJVA 3DROB 4OBSA 1MRCL 1MSPA 3M8OH 3MOBH 4K2UH 4JRXD 1ZANH 3VWKD 4J4PD 5F7EL 2WUCH 5GGQL 4P9HL 4I48B 4PJFB 3ILPA 5C08E 3VFGL 2EH8L 5SWQB 4LLDB 1JF1B 3HRZB 2WWMC 1VADB 2WIMA 4MB5A 5HHPA 4IMLA 5IUSA 5ID1A 3T0EC 1VGKA 2CLVB 1K6QH 3L3IA 4P99A 4ZO7A 1KG0B 2GEEA 5BRZE 1T1ZA 3PGCB 3O8XC 3N9GH 5EBWA 4PIRF 1J8HD 1RK1A 25C8H 5D2NC 4S10A 4M1GL 2WWKO 5CSGA 4PJEE 4PB9L 5HHQA 3VFMB 1IAOA 3MNZB 3LD8C 4PV8B 4WTXA 1J0IA 4LLDA 4S1QL 3HRZA 2N1KA 1RHHA 1YYML 3FFCA 4YUEH 3MZTA 5HHOA 4ZTPH 5TE6L 1JTOA 3OL2A 2DBLL 1TVHB 3HR5B 4GKNA 3ZE2E 2BVUA 2GK0B 4LVHB 1KG0A 2WWKT 3FONB 4Y4HD 3O4LA 3NZ8A 4IRSA 5BVJB 2FJFB 4UOW1 5CJOH 3P0VL 4BM7A 4U1HB 4X9HA 5DD6A 3VFMA 1U8QB 1JPGB 1T89A 3B5GA 1E4JA 4OSUH 4DKEL 3BPLB 4HIHB 3H42H 3UBXB 1AP2A 3T1FA 5TFSH 5DD5H 2NY6C 1J8HB 1QLEL 2BHZA 1NBYB 1H5BB 1R3KB 4WCYH 3VWKA 1TVHA 4EI5D 1ZTXL 3HR5A 4J4PA 2F74A 4NYLB 1R5VB 3V5HB 2OJZL 2AXGB 4ODHH 3DUSB 3L5JA 3FONA 2AJ3B 1A47A 1T0PB 3B43A 3PHQA 5KVGL 3SQBA 5DMIL 4FQ2L 1EIBA 3T3PE 1MHPL 2FJFA 2O5YH 3R0NA 1G9MH 4G7YL 4NWTL 5DR5L 3QG7L 1A7PH 1J9CT 1IGML 2CRIA 3GIZH 3MRKA 1U8QA 1JPGA 1K4CA 1LVEA 4GUPB 4KKAD 4MJ4A 4GBXC 5I1EH 4QYOA 1HZHH 1KGCD 1R3LA 3LHPH 5B21A 1U8KB 3UBXA 4Y4HB 3PV7A 3O6FC 1BZ7B 3D25A 1J8HA 3TZVC 4QRPD 1MIEH 1NBYA 1WUNT 3KYAA 5CBAA 1UG9A 1R3KA 3STBA 4MJ2A 1PZ5B 1ZLWH 5L8KB 2NZ9D 1NGZA 2HP4A 4NYLA 5JXAH 2AXGA 4DWHA 5EO0B 5ESVB 3U46A 4LSSH 2FIKB 3IJYB 5EZLB 4KROB 3C5SB 1KIQB 3QNXA 1OPGH 4ONFL 4NUGL 5C0BB 2NTFA 5FGSA 4U0RB 2NY5H 5DJAB 4NRZB 4EI5B 2DM3A 2FCBA 4FQIL 4GUPA 2ZCLH 2ZUQC 4RA0C 5I17B 1IKNC 1U8KA 2MTPA 4Y4HA 3QJHA 4A6YB 4ZPTA 1BZ7A 4I0PC 4TULL 2DLFL 5DDHA 1JNHB 4MZ2A 3AGVA 5DJDA 4NT6A 4P5TB 5M94B 1I9RL 3P0YH 2NLJA 1AQDB 4GKOA 3RUGB 2EXYC 5E99H 4A6YL 5C0BA 5CGTA 1IAII 3FN0H 5DJAA 5JQ6L 4EI5A 2OCFD 5I17A 3KLHC 2EIBA 4DVRH 1AD9A 1AR2A 1QSEB 3VXOB 1URLA 4NGHH 2NY5C 4FXKB 5EUOA 3RUGA 2V5MA 4APQC 5F7HA 3MRDA 5GQBA 2ZZUT 2PXYB 3DURB 3EJZD 1HSAB 4QRPA 2EO9A 1I9IL 4PUBH 3CVHA 3BN9D 5CEZD 2XPGA 4YDLB 1A1NB 1KCUH 1XGTB 4ZNCD 2EEBA 1ZLSH 4KXZH 1LMKA 3E2HC 3OXSA 4GKSB 4CJ0A 4X4XA 4NFCA 1P1ZB 5HVGB 4L8SB 4GFTB 2F5BL 4X9IA 1I1FA 5SV3A 3UP1A 1ACYH 5KVMC 2IADB 2PTUA 4YPGB 4G80B 2OK0H 3BO8A 1MHHA 4U7KA 2VXSL 4YHOL 3H7BA 2N7AA 4H8WH 4W4OC 3RGVD 1T80A 4BSWA 4EUPH 4Y2DB 2R56H 1NANI 3MRHB 1T0MA 3JV0A 4QRQB 1B2WH 1T1YB 3FQRA 5DMKA 2XWBB 5DZOA 1DQDH 5KVEH 3D3VD 1NBZB 4X5LA 1CGSH 2OP4L 3ULUD 2YSSA 3CAFA 2ESVE 2IPKA 2IADA 4O58L 4CMMB 2VZSA 1XF5A 4K94L 1MJJB 3MCLH 1TPXC 3OKNB 4Z7NE 4PS4H 3P4OA 1EPFA 5IFAH 1BQHA 1LE9A 1Z0MA 2R8SH 2NY0D 1F4XL 4D9RD 4R2GC 2R1XA 3KPPB 4QRQA 3WS3B 3WS6C 1T1YA 3TNNB 5LXGL 4C57C 1BLNB 3TVMD 1KLGB 4DK6A 3PV6B 4RISH 5B3NA 5IVZA 1A64A 5E08H 3RGVB 3A6CL 4IOIB 2HRPL 2NY4B 4JO3H 5C2UB 5J3HD 2ZNWA 4U1NB 1MJJA 2VDMH 3QUMA 4Y5YC 3SDCC 5BCAA 1AFVH 3VGEA 4XNYL 1OGAD 4MCYA 4HUWB 1EMTH 2DLIA 4LOUD 4R26H 1B3JA 3EGSA 3TBYB 4TNVF 4LCYB 3D3VB 5E95B 4MNHB 3SQOH 4ELMB 5ID0B 2NYYC 1YNKL 4OCWH 3MV01 5DS8B 2J8UE 3TNNA 4L4VE 1YEKL 1VGEL 2FBJH 4LCWB 2FLBT 3SDXF 1SVZA 3O3EB 5TH2A 3REWA 3RGVA 2Y5TB 1I1AC 3VCLA 3QUZB 1JYXA 5E03A 1DEEB 3BRDA 1RU9H 2NY0B 5AZ2H 1IC7L 4WFGD 3L3HA 1LD9B 1YMHB 5E2UH 4F15B 4OCRH 2O93L 3TVMB 4C58B 3DWTA 3D3VA 1A6ZA 3QXAB 4OB5H 4NQSB 5J6GB 5EIIB 5HYJD 2B4CL 2VZ3A 3TPUA 1UM5H 4XWOC 5CP3A 3VXUE 3A6OA 4POZC 2D0GA 5DS8A 2VOTA 2IG2H 4Z95H 1CK0L 1S7VB 5D7JC 1NL0H 4YHZH 1LO2L 2Y5TA 5FB8B 4JCLA 1KBGL 3EOAB 4GXUM 2F19H 4QGTA 4F58L 4N1HB 4F57L 1CLOL 2VZ1A 3ZE1E 1YMHA 2DLEA 3DBXA 5C0ND 3VXRE 5L2JA 4YC2C 3TVMA 4AEIL 3PWLB 4Z7QF 1FH5H 4RBPK 1WJ3A 3QXAA 4XHQA 1BP3B 1NC2D 3DOSA 3D39B 3KDMB 3MROA 4HWEH 1B0RB 4XX1E 1FRGH 2VXQH 4JFDE 4PRNB 1LP9E 4N0YL 1AXIB 1FIGH 5ALCH 1OGAA 1S7VA 2XNAA 2FBOJ 5HBBA 1GGTA 2AXFA 2Z8VC 2DL2A 1KV3A 3QDAA 5GRVK 3WYRA 1QFUH 3EOAA 1JZ2A 2C7UB 1OP9A 3BP5A 3FB5A 2EYSA 4K8RH 2VMFA 4OKDA 1IAKA 4YR6B 4F33A 2BC4A 3CK0L 3GMRA 1WSST 2Y25A 4KJQD 1FNSL 3BQUB 2JLLA 2R2BA 5CGYC 5ICZA 4JHZA 3T2NL 1UA6H 4TVPD 5T1DH 4LQFL 2AEQH 4LPXA 3KXFE 1GZQA 3V5DA 1NC2B 1QTYT 4G9DA 1WLHA 2AK4D 4M8QA 5HYJA 1B0GA 4OZHB 5K9KA 1RIUH 4AMKL 3VFNB 5FDWA 3ZKMD 3H9SE 3KPRD 4YR6A 4KK9C 2D9CA 3B2UD 4HZLA 4UAOB 2R29H 3BP6B 4NPYB 3FQNA 3KPQB 5FOBA 4M93C 1J11A 3FOLB 1XGUB 3V4UL 2VZTA 5DFTA 2RJMA 1GC1H 4NQDE 2UWEB 1NCCH 4NBXB 1KTKE 4LIQE 3HUJA 4JM4H 2R4RH 5TF1H 1NC2A 3T4YB 5KANI 1FQ9C 3NCJH 4X0KB 2DM2A 4OZHA 2X41A 3VFNA 4ZUVB 4HK3N 4DCQB 5MENB 4ONOA 3MLTB 4YHIA 5EC1B 3ABZA 1HIMH 3HZKB 4ZUSA 1N64H 3CZJA 4GMTH 1EA9C 2F54E 4X7TB 4DKDC 1OD9A 1L9NA 2IPUK 3GNMH 2ADIB 5E0QA 3KWWB 1Y18B 2X4PA 5F70A 2B5IC 4JKPH 4EUPG 4UQ2A 1DDHA 1T66C 4I9WE 1A14H 3QIUC 5IGXL 2FEEL 1HQRB 4PJBE 3MLTA 1GC1C 5F6HI 5CSZA 3LKOA 3T2PA 5D93B 1GHFH 3IFLL 1IAMA 2QHLA 4I77L 3VRIA 3ZZ1A 2H2PC 1V7ML 4PG9B 1S78C 4MLSA 4U7MA 1JZ3A 2ADIA 2AV7A 5FOJA 3KPRA 1Q9KB 5IVNA 4XAKD 4Z8FL 4KRLB 1OSZB 3SDDD 3FHAA 5C0IB 5I73B 1NGYA 1I9EA 5E00A 3S35L 3GJFA 1S5HB 2J2ZA 3LSOA 3IJHA 4RMVA 1G1CA 4LEXL 1HQRA 1ZK9A 2L7UA 3BDYH 3QP3A 3LEXB 3RTQB 4X7CC 2NXYD 4O2EB 5EU6D 1JF6A 3V2AR 4X5WB 2IJ0C 5CJXC 1A1OA 4PG9A 1CU4L 4HSQA 4U31A 2HJFB 2VLMD 4KI5E 2D7TH 1Q72H 4F7TB 2GUOB 3KPOB 3MXWL 1KC5H 4N90D 5EBGA 2HA1A 3HC4L 1E6JH 4CDGC 4L3CB 1M7IA 1S5HA 2AP2A 3O3AA 5GJTL 4S2SB 4KJYB 2DQEH 3NCYS 1AGEA 2G60H 3S6CA 2QQKL 5JZ7D 3DVFA 3V79C 4QHNA 3QHZL 2QADC 3DYMA 4PREB 3TH4T 4BH7A 1FVCB 2HJFA 5DSCB 3F7QA 1T7WA 3BN3B 2AJUH 4CNIB 1R3IL 3SCMB 1GRWA 4XPBL 4JZNB 4XCYA 3EO1B 4CW1B 1KTLA 4S2SA 3NIDF 4TSCL 1P4BL 4QLRA 5JW4Q 1TJIH 4XC1L 4Z0BH 5HGAB 2CKBH 3UYRL 2FJGA 3SDDA 1F5WA 4IDJL 4HK3J 4PREA 4HIXL 1MJ7L 4OD2A 2AJXL 3MRQB 1RZGA 4S1SL 5BZDB 2FGZA 4CNIA 4P5MA 1UKTA 1HYRC 4U6XB 1EJ6A 4HJJH 1UC6A 1QRKA 3GSQB 4DFIA 1HH9B 5FO9A 5T5FL 4XPAH 1I7UA 4XPTH 5GPRA 3HR6A 2OTUA 4L9LC 1U8NB 2HKHH 1IZJA 4EXPX 5LVEA 1TQCB 3BOVA 1IMHC 1NDGB 5HY9A 3UTPE 5BZDA 4LVOC 5I1IL 3T09A 2ICCA 2ITCA 4M4PA 4D0CB 1FDLH 2FJHB 1FVEB 2YPLB 3BD4A 5EULV 2OJEB 1HILA 3QIBB 4JQIH 4UTAL 2UUDK 3ZL4H 1XF3B 2QJDA 2R0WH 3LVEA 3ARQA 4CU7A 4XRCA 1QA9B 5D7LE 4NZUH 4NO5B 4Z5RB 2GCYB 4G9FB 4BFIB 5DVMA 5EWIH 3CLEH 1A6WL 3FQWB 1U58B 4PRID 2R2HB 3HPLB 3WIFB 1A7BA 2OR9L 1XF3A 5LBSL 4GS7C 4NQCB 1CG9B 2J1KA 4YWGL 5J9PB 5TDOA 2Q8BL 5CKAA 1HH6B 4UT6H 4NO2A 3WFEH 4XNUH 2X1WL 2APFA 4PJCE 3BPNB 4FG6C 4Y5VC 5IP4A 1S5IH 5IB5B 2WUBH 2JJTC 3SDYH 1BF2A 5C0FA 4PJIA 4HS8H 4M62L 3HI5L 3M07A 3FQWA 1U58A 4Q58C 4YZFE 1OP3H 3RIAK 3L3KB 3WIFA 5KSBA 3WXWH 4JJ5A 4L4TD 1U91A 2CK0L 2R4SL 4NOFA 3TBVB 2A73B 3TYFB 3RU8L 2BFVH 3MLVH 3CX5K 5I1JH 3DGGB 3NBNA 3ARGC 4JDVB 3WXVH 3LIZL 3VD7A 3LY6A 4GO6B 1NUNB 3RJDA 5I15H 3IRPX 4H88H 1ZHBA 5FA3A 3MMEB 5EIQA 1DL7H 5HI5D 2J4WH 5C6TH 2UZIL 4PJDA 1JN6A 3KPNB 5E1AA 5SX4I 5BW7C 2PYFB 4JM2D 5AYQA 1NEZB 2PYED 3GSOB 3RVXC 1AY1L 2YK1L 3BPOB 1M4KA 2GAZB 3VW3H 3TBVA 2D03L 4J23A 3MLXH 3TH3T 3QDMB 4PRIA 2I60L 4JDVA 2O61A 4FFZL 5CD5D 2JJWA 4P2QE 5F7WC 1ORQA 1MI5E 1UJ3C 3VFVB 2GSIA 4XBGA 2QHRH 2VO5A 1G6RL 4IJ3B 2Y6SD 1A0QH 3MMEA 4KH2A 3F6IA 2Y07H 3KPNA 2XT1B 5EBLA 1FORH 4MS8C 2P42B 4H25B 3MREA 4HKXA 1DVFD 4R4BA 3Q6GH 4YAQB 5JOFA 4UINH 4U6VL 3TBWA 1DQQB 4I3RL 1DEDA 1JJUA 2VITA 4FFYH 5D7SH 5E8OA 4CVXA 1SYSA 1IQDA 4FQHB 4I4WB 3DLQR 3TEUA 4L4TA 4YO0A 1ZLVK 1U9KA 4G6KH 3L7FB 3DECA 5AAWA 3NH7L 4HIIB 2NX5E 4YFEA 4CN6A 1L0YA 3S4SG 1RAMA 4ODVL 1TJGH 1KPVB 5J13B 5F97E 4MNGB 3V0VB 4PJ5D 2DIJA 2ZOLA 5FYKD 2RQ8A 4LPYA 2KDGA 4UDUA 1DQQA 2VE6B 1DCLA 3IU4L 5FHAL 4FQHA 3T0AA 1JRHL 4Z7VF 3KHQA 4JM2A 5A1AA 2PYEA 3NCBB 2B2XL 2JK5A 3PWPE 1WZ1H 4PLJC 1FZOA 3DRQA 5EPMB 2ZSVB 2FD6L 2YRLA 4XB7A 3MV7D 3CDYA 1KPVA 2NQCA 5CZXD 4K7FA 5DFWH 4MNGA 3V0VA 3VFGH 5ADPH 3MUY1 1YPZA 3B9KC 3HE6C 1MELA 4HF5L 4OJFL 5ISZE 5CP7B 1MRDL 2HFFB 3QDGB 2EDKA 2V9TA 4WY7L 5H94A 5L88H 1D6VH 3WLBB 1DVFA 4HQQL 3ESUF 4OLUL 4ORGA 4MWFB 4M1GH 4YFDB 3WIHA 1T1WB 3CNKA 5GZND 3BKJH 5IBTH 4F7CA 1AO7D 2KL6A 3QEQD 4S1QH 1JZ8A 2IC2A 3VDAA 2HFFA 3CU1A 3REVB 5FUOL 2PTTB 2M1KA 4ELKB 4HWBL 1Q0XH 5KW9H 2LFGA 1FFRA 4N8VA 2X40A 3ARBB 1CGVA 4MAUH 1VFUA 1CBVH 3DETC 1D5XA 4PJ5A 1I8MB 4BQBA 5JIHA 4OM0L 5GGSY 5D7IF 5T33H 3S37X 3O11B 2FX9H 1D5ZA 1FG9C 3PGDB 1NLBL 3HE7D 5KG9B 5F8QC 1GPOL 4ZS7L 5F9OL 3EYOB 2HTKD 4ELKA 1IT9H 5E8DL 3LOWA 4LCUA 4RFNB 3MV7A 2OL3A 5I1CH 5H2BB 1IM9D 4FMFA 1AO7B 5DMIH 2JE8A 4M00A 1TXKA 1J1PL 5HGDB 1L0XA 1A1MB 1T22B 5T3ZH 4G7YH 1MQ8A 3RPKA 1QYGL 4IRSC 3KR3L 3TCLB 3ELAT 2OR7A 3HLAB 3DMMD 5J7CC 1U95A 3O11A 1MCKA 2DQUH 2A9ML 3GMMB 4OF3A 4FQXD 2BNUB 2QSVA 5BQ7B 4G8GE 1T89C 4YEFA 5FO8A 5KSVA 3OKOB 4RZCA 1MNUH 3RWDB 2FNBA 1GOHA 4QXUL 5HI3C 3OKMB 3HFMH 5GGVL 2CQVA 3HKFA 1KTDB 2WAHA 1T0NB 1AO7A 2DQFA 3DX6A 3VWKC 1P4LB 4J4PC 3QEQA 2LV4A 4OF7A 2OBGA 5HGDA 2DB8A 4ONFH 1A1MA 4JGUA 1MAML 1CFVL 3VXSD 4QWWD 5CMAA 1RUQH 3D0LA 3MO1B 2BNRB 4M6NL 1V3JA 4ZFZB 3U79A 2JTDA 2YN3A 5FECB 4BH8B 1TZIB 5F89B 3OKOA 4P2RE 2DLFH 2BNQE 1ADQL 3EBAA 1AI1L 2RR3A 4EXKA 5KJRH 1PZUB 4G6JL 1LHZA 1T0NA 5HHVH 3QI9B 3EYVB 4FQPA 1P4LA 2DWEA 3HE7A 4Z76B 5J1AA 1VFMA 1IC4L 1IGFL 4A6YH 1FSKB 3VGDA 5EOQL 2HMID 4Z7UE 3SGKA 1AKJD 2A77L 5ESAB 2D9QB 1G7LB 1RJZB 3PHOB 3U0PA 4ZFZA 1IM9A 3NFSL 3VI3F 2WP3T 4LVNB 4NN7B 2JELL 2P7TA 4QNPF 1XF4B 4TVSa 4Y4HC 3SGEH 2CGRL 5KZCB 3K2MC 4FHBD 4PY7B 4DKFH 3HN3A 1BGXL 5L9DH 3D69B 1O7SA 3EYVA 4FQXA 5I1KL 1TQBB 1M71B 3QWOB 2VL5A 1I9IH 4H5SA 1LO0L 1JGLH 4HAFA 4RWYH 1T5WB 5ESAA 3C87A 1B4JL 2DI8A 1H0DB 3KS0H 5FKPB 1MHCB 4EI5C 4WO4D 1CE6B 5CEYB 1EBPA 3V6BR 2F5BH 1P6AB 4YLQT 2VLLB 3VXSA 4BUGA 3IJSB 1U8IA 4L8CA 3PP3K 5L2KE 4JJHA 5DUPH 3R1GL 1VSCA 4P5TC 1M71A 4KKAC 3QWOA 3TJEH 2CRMA 3AS2A 1UENA 3B2VH 3RNQB 3GM8A 2AERT 3KPTA 1QSFB 4RGOH 2KUTA 4EDWH 1FZMB 3GHBL 1CCZA 1NMAH 2ZCKH 5E2WL 5FGCB 1BECA 1QFWH 2NZ9C 1FL3A 4BFBD 4Y19E 4KI1A 2BXZA 2BRRH 1IGJB 4X6DE 3VG0H 4TN9A 2OP4H 1MFDL 1AKJA 3NFPA 3T1WA 4P2CG 1AQKL 3NIDE 1UEMA 1OTTD 5BJTB 2E8ZA 1HEZB 5MERB 1C12B 4PJGF 1KEML 2QSCH 2WNGA 4XMPL 3MRCB 3FO9B 3QFJB 2A9NL 1VFBA 3B9VA 3DTXA 3ECBA 4LL9A 5CEZH 4D3CL 1XGQB 3W9DB 2J6EA 1A7OL 4YDLC 1A2YB 1GOGA 2BVOA 2B1AH 2PW2A 1HKLL 1B9ZA 4Y4FD 1GIGL 4NP4H 5E5UB 4MD0A 4C55A 3A6CH 1HEZA 5ALBL 4XNYH 3JWDC 3C5ZB 1W0VB 3MRRB 4X6EB 3O6KL 1SJHB 4OIIL 3HHRB 2MNUA 1R6VA 1MCOL 1XGQA 2W65A 1FJ1B 3K8MA 4FQQA 1CE1L 3GMPA 3O0RL 2IH3B 3L3JB 3L5HA 1KJMA 3HI1B 1VGEH 1EX0A 3VXQB 9CGTA 3WJLA 3EO0A 2DN7A 2XZAL 4KRPD 3WNMA 3LV3A 3UC0H 3JZ7A 3C60B 1Q9WB 1YEHL 4PP1D 4JHBA 2V5YA 5E8PA 2Q86B 5EN2B 2DQCL 3FO2B 2X4OB 1J5OH 5I1HH 2IEPA 1KIUA 1SJHA 3UEZA 5A2IH 2H26A 3MRMB 4HCRL 2EEDA 3QWRD 5AZEH 3G5YB 2B4CH 3WJJA 3DSFL 4HUXB 2IH3A 3CDGB 3QZWB 1W0YT 4P3DA 5DWUH 1EEQA 3VXQA 1IC5H 3NGBC 5IR1B 2DI9A 3UBXG 1KFAH 2OMBA 1EVUA 3WBDA 2QQLH 4MD4B 5IVXF 1RUPL 2Q86A 4AH2B 3RGVC 3BH8A 4XT1C 3NOIA 1QHOA 3WL9A 1HNGA 3QDHA 3DXAD 4Y4FA 2V5RA 5C0RH 2JCCE 5FCUH 5JHLH 5IB4B 3U4AA 2W07A 2E6JA 1YEIH 3AM8A 5EO9A 1PDKA 2E9BA 1UH4A 3ULUC 5F1IB 4JFPB 4G8EB 1CVSC 4YXLH 1U8HB 5IR1A 1D5BB 3V4PL 4D0BB 3RWJB 5D2NE 4YJZL 4X5XB 1AHWB 2NCMA 4HC1L 1FYHB 4MD4A 4WNQA 3SE8H 4LCCB 4AH2A 1H9VA 5GS3A 1WISA 1HCVA 3U1SH 5D72L 2NY0C 4MNQD 2VR4A 3CK0H 1Q0YH 1CTNA 3DUHA 4QRTA 4YDKL 1RZJH 3TVMC 4K3DL 5FF6A 5D5MF 3GI9L 2HAZA 1N59B 4JFFB 4QRSB 4G8EA 2JJSA 4OFYD 5EG6C 1WBZA 5SWZB 5BMFH 1J0ZA 5CD3B 2V7NA 3RWJA 1MFBL 5J3HC 2EO1A 5DUBA 4X5XA 5MHSD 4V1DE 3PJSA 3QWRA 4DGVL 4LOUC 4G6FD 1PX3A 4MSWA 1D5IL 1WC7B 5DRWA 1HN1A 5D1XB 5JORB 2VDPL 4K9EH 5E2JA 3CZFA 5HHNA 4LPVA 2W9LA 1CDHA 3RDTD 1NFDB 2IAMD 1HQ4B 3GSRA 1G7JB 4QCIB 1C5BH 4K23L 2CPCA 3DXAA 4K7PL 5LKNA 2J8OA 4X98A 4WGVB 2D7QA 4XGZB 1XR9A 4JLRB 1LO4H 3W0WE 3MV9D 3RKDC 1L0QA 4YPJA 5KS9F 5DI8B 1CGUA 4RMRA 3VG9B 5JORA 1PEZA 4ZQKA 1NAKH 3D0VB 1TETH 5IFHH 1J12A 3PQYD 4YDIH 1MCRA 1OAQH 1HQ4A 4XVSH 1G7JA 1BOYA 3GO1L 5EZIL 1MEXH 5DK2B 4NC0B 3B3IB 5DHVA 4KRNA 4WHYH 5B38B 4NHUB 5FYKU 3WE6A 1BPVA 4DVBA 4MNQA 2EH7H 5KSUA 1PG7H 3OBAA 5D71L 5C0NC 1FGNL 3U7YL 3VE0A 3JTSB 4JLRA 4M7LH 2HKFH 3V7AE 1J88A 3QQNA 1QOKA 2GY7B 4WHTA 4GSDH 2AI0H 4OFYA 4U1JB 4P23D 1NSNH 1WTGT 1TTGA 4OF6A 1ZEAH 4D2NA 5IEKA 2GJ6B 1KXVC 4Z7VE 3SKJH 4I18B 5HGHB 1A6TB 4HV8B 3JWOC 2X2YA 3MRGB 3B8YA 4PJXF 5DURD 4PFEA 5T3XD 4UAOC 1TCMA 3RZWA 4NHUA 5FUZH 4KTYA 1UM6H 2MPAL 3RVWD 3RDTA 4QHMB 2ADGB 1H15A 2NY1B 2GIYA 3EYUL 5F9DC 1EVTC 1JYNA 1OOAA 1QBMH 4AEEA 2GJ6A 3KLAB 3S98A 1A6TA 4HV8A 4U1MB 2DJUA 4I0CC 3C09B 4NJ9H 5LGHL 5T1MB 1CU4H 3BH9B 5LG1A 4C56D 2YBRA 3AS0A 3MV9A 4GQ9H 1S7WB 3MXWH 3HC4H 5GSRB 5CIPA 3R8QA 3MRIA 2XRAL 3PQYA 3VXNB 4Z77A 5MP6L 1N7ML 3ZKMC 3MCKA 5T1LD 3WKML 5LGKA 2L7JA 3C9NB 1YY9D 2GTZA 1M05B 4MAYD 3B2UC 4JKLA 3P4MA 1JGVL 5IB3B 5HPMA 3W5NA 1F58L 1QVOA 5DJ2B 4ZTOH 5JPNA 3B9AA 4ONHA 3QHZH 3UJIL 3IFPA 2A1WL 1ONQB 3UJJL 5M95B 3G9AB 3LB6D 3FN3A 3FT4B 3BH9A 3S36X 5D93C 3RL2A 2HT2D 5D7IE 3A67L 1N0XH 1S7WA 1QR1B 4P23A 5GGTA 1T04A 4KJWD 1RIHL 3GFUA 4K3HA 2H2SC 5DVOA 1C1EL 4IRJD 4OCSL 3C9NA 1U93B 1V7NL 4PJHA 5EZOH 4WFFE 3MLYH 3QUML 4YFLI 1OB1A 3AUVA 2RFXB 3ZKND 1ONQA 1IKFL 3P11H 4HX1B 4PGJA 1FBIH 2C5DC 4OCXL 1Y6MR 2AJXH 3T77B 4RAHA 2LAGB 5D2LB 4R8WH 3IDYC 5C09D 1WWCA 4PR5A 1DFBL 3IDGB 1TENA 4C56A 5CLTA 3G6JE 3K7UA 2B20A 1S9VB 2RFXA 2V2TB 1Y6NR 1NLDH 3ULUL 4X6CE 3MJ7B 5T1LA 4Q7DA 4MAYA 3HZYB 3SDDC 2K7QA 2MCG1 1F45A 1RZ7L 3INUH 1EGJL 2YUZA 1KYOJ 2EDNA 3RI5F 3H3KA 4G8IA 5CILL 1BFOA 3GKWL 4MJ5A 4R7NA 4V2BA 1RZFL 3EKCA 2NXYC 3X12A 1RURL 4DOHE 2CUIA 4MQ7B 2HFEA 3GJEA 4D9QD 4BSVB 5FYLD 4GRWF 1S9VA 2XXMB 2V2TA 1YN6B 3K81A 5J12B 3HC0B 2LVEA 3MJ7A 4IRJA 4XCNB 4LBEB 5MEQB 3WSQH 3HZYA 2YUXA 4QRRD 1I85A 1Q9LB 5DD1L 5DUML 3VXME 3CH8A 3K1KC 4LHUD 5LBSH 4AG4L 3VI3E 4E42B 4NQED 4QNPE 4NO0D 3UZQA 1HINH 4XXDB 2K9UA 4EBQL 5DRZA 4KC3B 4DAGH 5C09A 1HNFA 4R90L 3LS4L 3FTGB 1U2CA 3K4ZA 3JV5A 2VISB 3HC0A 1HHKB 3BVNB 5DFVD 1BFVL 2BSRA 3VA2C 2FLRT 1XZ0B 3ARVA 3TF7C 4F8TA 4YGAB 2EKJA 2H3NB 1OARL 5E8EB 5BO1H 1FL6B 3PNWA 3C5JA 3CC5B 4ENED 5JO5A 5FYJD 6FABL 3KPLA 3CFEB 2Y06H 1RZKL 4RFEA 4XXDA 3GUTA 3RU8H 1LO3L 1OLZA 3OB8A 3QPXL 1S9XA 4WHYG 43C9A 2B0SL 3UTZB 1A6AB 1UACL 1XGRA 1E27A 3BVNA 3P4NA 1XZ0A 3QCVL 2MOVA 4JY4B 3LRHA 3HCVB 3O2WH 3F7VA 1IGIH 4UV4H 1J1OL 1FL6A 3MPCA 3CC5A 3V0WL 3I2CH 4Q0XH 4IM8A 2Z8RA 3RVVD 2H32A 2YPLE 3SDAD 2F58L 1JWSB 3IDNA 3U9UB 3NIGF 4QRRA 3JWOL 4U1IA 4PJFF 3IGAA 4HUUA 4PJAA 3BD5A 2VR9A 4YQXH 4LHUA 3UTZA 4PJGE 3ZKSD 4WW2B 4NO0A 1BQUA 1F4WL 4OD3H 4JY4A 5TQ2L 5EUKA 4XP4H 5DMJB 1F11B 3X17A 4OM1L 3OR7B 2ZUXA 5C0CD 3WO3B 4M48L 5I8OL 2ADFL 4KTEH 1MH5B 3MR9A 3UPRA 4U6VH 4OUUB 4P46D 1T7VA 4JPVH 1E4XI 4TVPL 3QULB 3ZDYE 3EDEA 1LQSR 5JUEH 4XC3L 4QOKB 4HJGA 3LQAH 3OPZL 3PHSA 4YNYA 5EU5B 5CBEB 1OGTB 1HOCB 4CRPA 5CZKA 4Y0GA 3IXAA 1N5AA 3QEHB 4JREB 3Q6FB 2ED9A 4QRUB 5JR1H 2BVTA 1A5FL 2Z31B 4AEHL 3NH7H 2IANB 5LCVH 2A6IA 4ODVH 5I74C 2EXWC 4K71B 4L3EB 1CN4A 1MVUB 2R23B 5K93A 4JN1H 3C8KB 4JFEE 2RBLA 2YA1A 1MF2L 3QULA 1OAYL 1VESA 1YMME 2CIIB 4QOKA 3D2UB 4AIXA 1HXMB 4QXTB 1JRHH 1OGTA 4Z18A 4NQVB 2C3WA 2C4FU 4QRUA 1UZ8A 3RX7A 4MXVE 3IF1B 3SDAA 5HJ3A 4HKBB 5IK3B 1CLYL 3CFKB 4DGIL 4I3SL 1MCPH 3VGAB 1MVUA 1UWEL 3LQAC 3T4AA 1Q1JL 5D1ZD 5CZVL 4HF5H 3TV3H 1RJLB 4JQXA 3FMGH 2GSGA 5DEFA 1G7PA 3W5MA 4U6HA 1JZ6A 2RGSA 2CXKA 3WIHH 1WIUA 5FXCH 5HI5C 1CR9L 2W0FA 2C3VA 5EIVA 1C7TA 2P5WB 5B4MD 2EDQA 1ZSDB 2QSTA 4JM2C 1KLUB 4OBRA 4QXGH 2BSTA 4P46A 5SX5K 3VFOB 4GQPH 3WNKA 2VDKH 5JHDD 1JPFB 1NDMB 4HHAA 4WEBL 2BJML 3GSUA 5INCA 3PWVA 1LNUA 1JWMA 1U92A 1J0YA 5CD5C 1F3JB 3FFDB 3MV8D 3G5VB 1GGCL 4LSUH 3QXTA 4J7RA 1MREH 2Y6SC 4E5XA 3RWGB 1JGUL 1P9MA 1IEAB 3VD5A 1I7ZB 3GGWB 2X70B 12E8H 3SPVA 4GG6A 1NQBA 2IWGA 1DVFC 3VFOA 2ATKB 1UKQA 3LKRA 2O5ZH 5D5ME 3CSGA 3MGOA 5EUOF 3RUGF 4FQ1H 1NLBH 1HHGB 4ZXBD 2XN9B 3QAZB 1WIPA 4ZS7H 3H3PL 1OM3H 3DX7B 2DYPD 5E8DH 2FSEB 1QRNB 1MLCB 2ZUTA 3LKNA 1E6OH 2F8VA 4AJ0A 5GJSH 1I7ZA 2PR4H 3LN5A 2I25N 5D1ZA 5F6IB 1NAMB 5IHZA 3BP7A 4J2XA 4XI5D 4MZ3A 4KZDL 1J05B 4JRYE 1UCTA 1JIBA 3MNWB 5TPWH 3QXDA 1QLFB 2XN9A 1JZ4A 2QBWA 2MHAA 1NAML 5FM8A 4FTVD 1QRNA 5F7UA 1MLCA 4X99B 3I3EA 1B0WA 5JHDA 1MCFA 2IF7A 1T03L 1U36A 4CMHB 4PGDB 5IMLA 1NGXA 1QBLH 4ZAKB 3FQTB 3MYJA 4ZXBB 2V7HA 4TUKL 5CZXC 1DBML 3VWJB 3PWJA 2ZPKL 4DZBB 2WZPD 3MV8A 4QF1B 1LDPH 5C0DA 2DTML 1A7NL 3VFSA 3ZE0E 1U8MA 1X3DA 2WK2A 4HKJB 4H0HB 1LEKB 3VH8B 3X11A 2P24B 3TPKA 1VDGA 3MLUH 2DQIH 1CD9B 5GGSB 2MCPL 5FV1L 4PGDA 4RFNC 4KKBD 4ZXBA 4IMKA 3CSYB 2IQ9L 5KBNC 1IC4H 5C0JA 3OKYA 2W59A 4YK4B 1AIFB 5EOQH 2DYPA 1SY6L 5IESH 4FTVB 4TRPL 1EEYB 3RWEB 1LK2B 5I6XC 2VLKB 3K0WA 3NFSH 3OGCB 2M8XA 4RGND 2VAJA 3MA9H 1NEZG 1H3PH 5C07B 1WFOA 2BXYA 2BP3A 2XZQH 5GGSA 1A7QH 2G9HB 2ZG1A 1U8PA 5K9JL 3DIFA 1CS6A 4ALAH 4NNPH 1CDCA 5B22A 3QHFL 4Y16D 1I1YA 3HE7C 1QACA 4FTVA 1FNHA 4BQ9A 5DD0L 2EDXA 3SGKC 2VLKA 5GS0D 3G6DL 3BISA 4PGBB 3JV6B 2Q8AH 3C08L 4O2CB 1ZS8B 4P2OD 4P4RA 2WBKA 4M43H 2AEPL 2QKIA 5DQJB 3RX8A 3NABH 1NCNA 1FVDB 5GRUH 1L9MA 2EYTA 4Z7WE 1UCBH 4EN3B 1F2XK 2P5EE 2E6QA 4FQXC 4HGWA 4DKAA 1FSKC 3GIVB 5F7YC 2GTWB 5SX4H 2VABB 1CLZL 3N85H 4KMQA 3MLPA 1QNZL 3VFRB 4M9PA 2YMXH 3RWHB 3ROOA 5I8CB 4NN7C 5FHBL 2Z91B 2A2QT 2Q76B 3FOMA 1IGTA 5DQJA 5MEPA 5C0EA 5F1NA 2KKQA 4YXKH 8CGTA 3P30H 4QWWC 4EN3A 1R5IB 1TQBC 3RPIA 4JDTH 5BRZD 2C1OB 4OFDA 2G75B 1YJDC 1Q8MA 4P0DA 1KJ2B 1OWRM 2GTWA 1C5CL 2O5XL 3EIFA 2Z93B 3HMXH 4LMQE 3CIQA 3RWHA 3GSWB 3MJ8B 4BKLA 1MHEB 5I8CA 5DJZB 3DVGA 4Y16A 4DZ8B 3SOBL 1PKQE 5ESQA 3WFBH 1NKOA 1BBDL 2HMIC 5ALBH 3TO4B 3JVGA 3P73B 2WWMD 5CS7A 1R5IA 3RJQB 4X4YA 4OIIH 5ANMA 4OLWH 3T0ED 1BD2E 3QUYD 5C08B 5D1QD 4NUJA 1KJ2A 3BHBA 3X13A 4PJ7A 1MCOH 2VLRE 1GGIL 1JUFB 3O8XD 4WWID 3O0RH 1MCBA 3EOTH 1INEL 3HI6H 3MJ8A 4PBWD 1MHEA 5DJZA 4QY8A 4OCNC 4BQCA 5BRZB 1MPAH 3IAQA 4LRNH 2GT9B 2OXGA 3SN6N 5E9DD 5HHXH 3FL7A 3P73A 2VR5A 1CDJA 4ZOAA 3IDJA 1NGPH 3IXTA 4GRWE 5JNYB 4PJEB 1EXUB 1ACZA 1FCCA 3HUJF 1QKZL 1BVKB 4KUCD 1DANT 4M02A 3L9RA 5C0AE 4OZHF 1T83A 1S3KL 2APBA 8FABA 2YWZA 4FMKA 3MRJA 4K3JL 4WI2A 3FB7B 2XQYG 1L7TL 2UVFA 5H8DA 5BRZA 5D1QB 4YHML 3H2WA 3WJLC 1RUPH 1KN2L 4JPKL 1ZVHA 3LRSB 2ZUVA 5JNYA 4PJEA 1EXUA 5FYKL 1D7FA 2A74A 5HHMD 1T7XA 4M7LT 2EDDA 1BVKA 2EIZB 4OGAC 1MLBB 4L3AA 2UVEA 1LEIA 1F6AA 3OKDB 3ZDXF 5KAQF 3TN0B 1UVQB 1OTTC 3WJJC 3PGFL 3FB7A 4POYA 1MRFH 2XTJE 3QUYA 5D1QA 2VDNH 3RWIA 4HC1H 5IV2A 2OL3L 3CLFH 4NN5C 1RSFA 4ZOBA 1EO8H 2ARJA 5C8JA 1CT8A 2BMKB 3V9FA 3OAYH 3IDMA 3O6FD 3G08A 3TZVD 4FQJL 4OV5A 4P48A 4MGXA 5D72H 1F3DH 1AXSB 3PDOA 4YDKH 5IMMA 1QFWM 1G0XA 4ODTL 4Y4FC 3E6HB 1MLBA 5E9DA 3OKDA 1NBVH 4U1GC 4W81A 3AM8C 4NM8L 2R1YA 2X4RA 4MHHI 5F9JA 3L5XL 4NKDA 1YY8A 4XAWL 4UDTA 5IJKA 3NVQA 1ZT7B 3CFJB 1K8DA 3NIGE 1DSFL 4XNXL 4B50A 1J0JA 4Q9QL 1S9KC 4WWKD 1A3RH 5DHYA 1ZV5A 2EC9T 3FFCE 3KGRA 4KRPC 5HHOE 4Q2ZB 2GJZB 5IWLA 4PP1C 3N1FC 4K7PH 1FNLA 3O4LE 2JJSC 1E4KA 1OTSC 1RK0A 1ZT7A 5AAMA 5DRNA 2A6KA 4HXBH 3NACL 5J0BA 1UB5A 4RNRA 1KACB 3UTSE 4C4KO 3VXPB 1F4YL 3WV0A 4KY1H 4FQLL 4Z78B 1Z9OA 4APQD 3CFCH 4JRXE 1D9KD 3M45A 1EUTA 2OQJA 3O6FA 1FFNA 4M61B 3TZVA 4NKOA 1BIIA 3N06B 1E4WL 3M17B 5D71H 2YS4A 1VFOA 2YD2A 1FGNH 2YC1A 3U7YH 3MA7B 5T1KD 2FWOA 2BX5A 5C3LD 4AM0A 1CFTB 1X7QB 5LGJB 5FUCC 3BSZL 2CSPA 3G6AB 2BVQB 1WBYB 3OAUH 3CPLA 4UUJB 4HIEB 1YNLH 2CLZB 2X5PA 3UXFA 1VCAA 4Z78A 1G9NL 3A0OA 2N4IA 4R3SA 4LKCB 3O3BB 5I16B 3OB0K 3IKCB 3QCTL 4WWKA 4HGMA 4YHYB 2PCPA 4JFYA 4WDIA 3QUKB 1X7QA 5LGJA 4F7PA 4KZEH 2BVQA 5CIPH 4HIEA 5I66B 2DKMA 5LGHH 3I3DA 1UH3A 1Z5LA 3AU1A 2YPVL 4BZ1H 4LKCA 3AAZA 3O3BA 4BZYA 1FO0L 4GW1B 4GG8B 4JAMB 3TBTB 2ESVB 1OHQA 2BERA 3VFPA 1IGYB 2XRAH 4LGSB 1UB6A 5TDNA 3FCTA 1DBAL 4XVTL 5ERWB 3BE1L 5A43C 4DN4L 4APQA 1D9KA 3RDTC 3T0BA 3QUKA 5E8NA 2MFNA 1S7SA 2QR0B 4S1RH 3UJIH 5DZNA 3UJJH 5JW4M 1AGBB 3K8KA 4WUKL 4EDXB 1I1RA 5T1KA 2J6EL 4MJID 2KQNA 1FZKB 4GG8A 3TT3H 4FXGA 1KGCE 4MD5A 3P9LB 5EUOE 5A2KH 1A6VL 1EFQA 3HPJA 2NYYD 4OCSH 3D85B 2BY2A 4PJIF 4QRPE 4AL8H 4NN6C 4NZJA 2DLHA 4PRHD 1WTLA 1N4XH 1NGWB 1X5LA 4JVPA 5C9KA 2NY1C 2EDOA 1KEGL 3B9EA 5KSBF 4NZRL 1LE5A 1AGBA 2ZJSL 4DQOL 2J8UB 4L4VB 1IQWH 3FZUD 1JGDB 4OI7A 4YDJA 1IJ9A 2R2EA 1GZPB 4N9OB 3KJ4C 5TDPB 2Q3AA 3QZWG 1DLFL 4JFDD 4H20H 4NKQB 2COQA 4JZOA 1G7IB 5KTEH 3ZHLA 1UH2A 1B90A 1KELL 3QNYA 3D1MC 1EEZB 2VN4A 4P23C 1PY4A 4POZD 2QQNH 3K4DA 1NGWA 4GRLB 4PJDF 5F9WB 5IHUL 5I71B 4LLUA 1CICD 3KYMB 4P5KB 4RMWA 4MA3A 4TUJB 3L7EB 2NW2A 3VXUB 2J8UA 1IL1B 3O3UN 3O6ML 1BFTA 2WLYA 3QA3B 4HS6B 2C1PA 2IGFL 4AY0A 1N3NA 3QH3A 3LMJH 2Y36L 4LARL 3QFDA 3ARDB 3GHEH 5TDPA 1ZVSB 5I1GL 1NJ9A 4EUPA 3ULVD 3GKWH 1EEZA 1RZFH 4LASL 3VXRB 4O4YL 3MV11 1RURH 4MJIA 3MRBB 4GRLA 2HJLB 2F5AL 4LSTL 2ADJB 4JFDB 4PY8J 1EK3A 3O45A 1LP9B 4P59H 1AXTH 4ACPA 5ILTH 4BFGA 3PIQB 4YGVB 4HS6A 1SJEB 4M6ML 4PRHA 5D4QA 4MAYC 1YY9C 2A83B 3HNSL 3HG1D 2HH0H 4XPHL 2ATPA 4ZUTB 3WNOA 1I9JH 3OMZA 4WHDA 5K9OA 3LB6C 1F13A 4R90H 4JFDA 2HT2C 1LP9A 4JB9L 4LGPB 4KJWC 3BEWB 4NKMB 4LSQL 3KXFB 4IRJC 3I6GA 4XBEL 4LLYA 1R0AH 1KJVB 1KJ3L 1NUFA 1D5MB 1Y0LB 1CICA 5I8KH 2DMCA 1AGFB 1SM3H 3QJFA 1I85C 4MDJB 5I1DB 5TE7L 1MJUL 4RGMB 3H9SB 1RPQA 2OMNA 5EZJB 1KXTB 3ZKNC 3FB8A 3O41A 3ULUE 3WUZA 4K8RD 3PL6B 4ZFGH 4JG1L 1BX2B 2B0SH 5KVDL 2VXTL 4OZIE 1YPZF 3U82B 3R4DA 4NQDB 1HHJA 4NHCH 3BEWA 4FZ8L 3CDFA 4F37K 4NDMA 2CDFB 2P49B 3AMKA 1KJVA 2V2WB 2HN7B 2CDGA 1Y0LA 2OSLB 3WHXA 1J1OH 1XCQB 5B38G 1CF8L 1G7HB 3H9SA 4QHLA 5EZJA 4WI9A 1CL7I 1MJ8H 5IBLD 3ZYZA 4FQCL 1ZMYA 1SYVA 3GB7B 3SO3C 3PL6A 4LIQL 3HG1A 3BZFA 1TFHA 2F54B 3BKML 4M5ZL 1KYOK 1OGAE 2IALA 3PP4L 1HHHB 3H9HB 5FK9B 2FECI 5IG7A 3PF2A 2V2WA 4RCAA 2CMRH 3OXRA 3BGMB 4OM1H 4RA3A 5DRXB 4PJBB 4WTZG 3V52H 2R69L 4E41D 5CCKL 1S78D 2X4NB 4KGLA 4I8DA 4X7EC 4XC3H 3QR2A 4X80L 1JNNL 4QT5A 4U4BA 2DD8L 4DUXA 4WFGE 3MLRH 4LP5A 1P84K 1PY9A 1HDMB 1RD6A 4MXWL 5A3ID 2F8OA 4KK5D 2W92A 2FO4B 3S3JA 4JFXB 3NFNA 4DUWA 5HYJE 2OI9C 4IRZH 4WIQA 2GITA 4WV1A 5GS1B 3MRLA 4QTHB 4LAQH 2NY2B 1FNEA 2VUYA 3FAWA 2X4NA 4NRYB 3AREB 1M7DB 1OAYH 1CVRA 2R0ZL 5DFVC 1X5HA 5EO1A 3WN5B 1LEGB 3QQ4B 3GBNL 4C83B 1HXYB 3OHXB 1BBJB 3WFCH 4R4NC 5I75B 1HDMA 3KHOA 4YE4H 4G8FB 3K4AA 4GLRI 3HUJE 3WFZA 4F3FA 3TCXA 4ZUWB 1QEWA 4ENEC 2AV1B 3NTCH 1TVDA 2ORBL 5IBUG 3ZHDA 1N5YH 4OLZL 4IIQB 1AGDA 1UWEH 3SGDH 5GS1A 3CCHB 4LSRH 4YX2H 5CGMA 1Q1JH 4ODSL 3HS0B 3RWFB 4E0RB 2XKNB 2P1YA 2B1HL 5TQ0L 4XPFL 4Y5XB 3QG6A 3MGTB 3AROA 3WN5A 4OFVA 1LEGA 1CR9H 1DE4A 4XVJL 4X7SL 1KCSL 1OP3K 2M2DA 1YEJL 1YEDA 4E41A 4G8FA 1ETZB 5GXBB 4EI6B 2AABL 4PRPD 1A3LL 2C4XA 3FT3B 2AV1A 4JPWL 5IVXA 2C3GA 4KVCH 3EHBC 5GGTL 2AGJL 3RVVC 4BZ2H 4M1CD 3SDAC 5EOCL 4XMKL 1T2QH 4JN2B 3CCHA 4TVPE 4LAJH 4F2MA 1YEGL 4YHKL 4NNXB 1NCWH 1QQDB 1K8IB 4E0RA 1RQ5A 5HGBA 5MI0B 1X5IA 4M7ZB 4P57A 4OCYH 2AK4E 5L7XH 5HDQH 4JQXC 1FE8L 1JBJA 1AE6L 3SE3A 3IDIB 4HMCA 5D7LD 1YEFL 3KPRE 4ODBD 43CAB 2DDQH 4A2LA 3KNBB 4GRMB 1KB5B 1MWAA 1NCUA 3MBXH 3EDJA 3RI5K 1FNAA 1HWGB 4P46C 1G7QB 1SHMA 2DQJH 4NFDA 5CUSL 4HPOH 5HGGS 4RBPH 2IANE 1YECL 3H3PH 2DQGH 2G2RB 3ULSB 1FPTH 1FIEA 2CRYA 3H0TA 5J11C 4HMEA 2XWTB 1JMZA 2VAAB 1PJ9A 4LSVL 3VRLE 4PGEA 5DJYB 4L8DB 4XH2A 4JFZL 4JDZB 3WDJA 1P9MC 5BS0D 4KZDH 5FA4B 5B39B 1KB5A 3BZ4A 3WIIL 1MVFA 2VXUL 3MACH 3NCEB 3C6SA 4OZ4B 4ZODA 4HPYH 4ZDHB 2NY3D 5IMOB 4KPHL 1NAMH 4PPTA 4PRPA 3TT1L 2VZUA 3RA7H 1NC4B 2YEZA 2X4TA 4KMLB 1X44A 3H7LA 3QIWB 4PV9B 2YUWA 4PRBB 2NZIA 1DBMH 4KK8D 2DQTL 5D1ZC 3FB6B 5IQ9A 1VACB 4XXCA 4WFEE 1FG2A 4HS3B 1OCWH 4OZ4A 5D7LA 5DT1L 1C08B 2PO6B 4NNYB 4XAKE 4PGCA 4QTIH 1S9YB 4F7EA 4PJCB 1IGCL 1MQKH 5B4MC 4YIQB 1T4KB 2NR6C 1CD8A 1OVZA 3DVNA 4GAYA 3T3ME 4KTDL 3ARSA 2X05A 3EDDA 2NY3B 4XTRC 3IDXL 5EU6E 4I1NB 1XGYL 3ARGD 4TRPH 5F6IC 4G7VH 4DJMA 3BT2L 3LN4A 4UIKH 2CKBA 2VLME 2VDQL 4Q74A 1C08A 3FO1A 3QT2A 5D6CB 3SE9L 4XBPA 5F96L 4PJCA 5BS0A 3MNVA 2VDRL 1KPUB 3O81A 4PJXA 5I8EB 4XNZC 3IFNH 5DJ6B 3MBED 4OLXL 1DQJA 4NCC1 3WNPA 2AKRB 4LPWA 5C0GA 4ZXBC 4IMKC 5DJCA 5FYLL 4N1CA 5BV7L 3VWJC 3BW9B 3G6DH 1PQZA 3DX9A 1VA9A 3TA3B 2NX5D 4LRIA 3C08H 4WW1B 1TLKA 2BOBA 4HH9B 4JR9L