5I19H

Crystal structure of human germline antibody ighv3-23/igkv1-39
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
total genus 44
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i19H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i19H01
5DMGC 3LQZB 2UUDH 1LK3H 2BVEA 2NY2B 4G9DA 1YPZB 1BIIB 1TTGA 5HGGS 3X11B 1ORQA 3ARVA 3OXRA 1B4JL 2VJXA 4X6DB 1EIBA 3EGSB 3RNQA 1MRCH 4N0CD 5EB9A 1NC4D 3QIWA 4MD4B 2OCFD 3UAJC 5TH2B 4PRBB 3BXNB 4EBQL 1BJ8A 3F12A 4HIJB 4J12A 4RAVA 4M6ML 4CVWA 4KKBC 4PJ7A 1E4WL 3V7AE 3HE7C 4UILH 1J12A 3E1F1 4O58H 3H9HA 3CFKB 5F7HA 3SJVD 2J8UF 1DANT 5TE4L 4C54A 3K4AA 2X42A 1D9KA 4ZOEA 2ZSVB 3IGAB 1XAUA 4Q6IB 3ULUE 4EXPX 4OQTL 2R0KL 3CFDA 1WUNT 4HWUA 4Y5VC 5DUML 3TFKC 3FB6B 3QULA 4G8IB 2W38A 2V2XA 1BEYH 4F9PA 2Y5TB 2AJUL 2V2WA 4OIIL 5AZEH 1RZ8B 4PRAB 2O5YH 4P4RA 4HS8L 3TJEL 4K3HA 2XY1A 4GRWH 1KN4L 1DQMH 3K1DA 5ICYA 1AO7A 1WZKA 5JW3L 5L2KA 4OBSA 3KPRA 4HIIB 3EAKA 3TO2B 4ALAL 1MJJB 4KKAC 3RIAK 4FABL 3RVVC 3T2NL 4PG9A 4D2NA 4XBPA 3RVTC 3GK8L 2VO5A 1CLOH 2DJUA 2QQNH 3GSOB 3MJ7A 1F4YL 4PGCA 4NKMB 1DSFL 2B5IB 4FMFA 3FN0L 5HI5C 5ELIA 5B4MC 3PHOB 3PL6C 4XC1H 1NBYA 1CE1L 4K7PX 5T5NF 1KV3A 3GIZH 3B9AA 1K6QL 4LLAA 4HZLB 1KJ2A 3G5XA 5IV2B 4JFOA 4L9LB 3KLHC 2BX5A 4OBRA 1FFOA 4KTDH 4EUPG 4QT5B 5ANMB 5J11B 1CBVL 1Q9WA 3MBEC 2H32A 1ZT7B 5D2LF 4TSAL 2Q7NA 5ESAB 3GSNB 4RGOL 5I1EH 2P5WD 5E94A 2FIKB 3MLZL 2NZ9C 3NPSB 4LHUA 2QSCH 5FGSA 3NPZB 1BD2D 4IIQC 2CGRL 4MAYB 5CJQH 5ENWA 2ADIB 1JGEB 1FO0B 1YA5A 5L2KE 3NZHL 3FRUB 4G8GB 5L8LB 4KI5C 2H2PD 4P48A 5DI8B 5C0DB 3BP6A 1U8IB 5KSUB 4GXVL 3T3ME 1AY1L 1X4YA 3DURA 4WEBH 5TDOA 4H1LB 1H8NA 1YYLH 7FABL 2DYPD 5CGMA 3CUPB 3FQXA 4LKXB 2AI0H 2G9HA 4NO5B 3QISA 1MAJA 4RWYL 4MJ2A 5HYJE 4QRRB 5C92A 3TBWA 5J1TC 2AABH 5B38G 2ICWB 5IB4A 1WCBB 3RX5A 3FT2B 3FQNA 5M94B 4EOWL 4NZJA 4P2CG 3PHQA 3STZB 4MZ2A 4JM2B 5IJKC 3U48A 5EO0A 4HCRA 4CKVX 2V2XB 3FQTA 4PD4J 4I4WB 4RAVB 4X7TA 4I9WE 4HIXH 5DR5L 2CDGA 1D5IH 1MEXL 5D7LA 1S7VB 3QDGA 3S5LB 4X6DE 3SEPA 5J7CC 2FH8A 4OCLC 2I9TB 4UOW1 3VXQB 4YBLC 1ZXQA 4Q9QH 1FORL 2P44B 1AGCB 4U7KA 4NIKB 4X6BB 4JN2A 4Y4HA 1YY8B 4TPRH 4X4ME 3ROOB 3TBTA 2AERT 1BD2E 1T0PB 3AGVA 1CFNA 2A9ML 5IFAH 1INEH 5F9WC 2QL1A 1NUNB 3RWCB 2J8OA 4R90L 4JDTH 3THML 3QIBD 1GHFH 3T04D 3MV01 1BFOA 4YGVA 3W0WD 2DQEL 3D5OF 5LGJB 1TMCB 4AH2B 5BS0B 1OT2A 4HWNA 5AZ2H 3VXSD 4DKFH 4JG1H 1J86A 4JY5L 4MJ6B 3PQYA 4WUUB 3GSRB 3W9EB 4P0DA 2VAJA 4ODSH 1W0WA 5C0GA 4PTUA 3EDFA 4E5XB 5HHOE 4LDLB 3C60B 2Z92B 3S88L 4MJIE 4L3EE 5AYQA 1R0AL 3WO3B 4PLKD 1B0GB 1YPZF 1FJ1B 1QO3A 2NLJA 2RFXB 3SE8H 3WV0A 2P8MB 1LDSA 1GZQB 5D7KE 4ZTPH 1OF2A 4AEHH 2A73B 4HJGB 3EOTL 1EA9C 4G7YL 2P43B 1MCCA 2OR9L 1UWEH 5CEZH 4MB5A 4OZIB 1OAKL 3BWAA 4KROD 4A2LA 4PTTA 3BP7A 5F1KC 3V0WH 3VCLA 3DX9B 5BW7C 3G6DH 4N68A 4PJIE 4A2MA 2VE6B 3QG7L 4Y89A 2ZCKL 2JJSC 2CK0L 3AM8C 3K0WA 1RVFL 3N85H 1I9IL 1LDPL 1TETH 4G8GD 1R3KB 2JELL 1QP1A 5EU6A 2AXGA 1YDPB 2VZOA 4OCWH 2OMBA 3P9MA 2YPLA 3OSKA 4AM0A 1JWUB 1MCOH 5DVKA 1QR1B 4OLYH 3OKYA 4LGSB 4ENED 1PG7X 1OGAB 2EKJA 3BIKB 4TULH 4D9RE 1F4XL 1T1ZA 1A8JH 1F90L 4G3YH 4RSVA 4AEFA 4DCQB 5FA4A 4XP1H 4ZFGL 2J5LC 2HMID 1JWSA 3W0WE 2VQUA 3LB6C 4U1MA 4NP4L 2R69L 1KPVA 1P7QD 4I2XE 1KLGB 4G9FD 3TO4A 3D2UD 1R5VB 3IKCB 4OCMC 4QRPD 1A3LL 5F1IA 1I1AD 2IPTH 4GRWE 1JPSH 2YMXL 2JIXA 1ADQL 3D2UB 3ILQC 3QNXA 4GW1B 3QSKB 5SX5K 4U6YB 1VESA 1W8OA 2BY3A 3ROLB 3SCMA 2B1AL 4R4FL 4X80H 3JV4A 4LLUA 4TSBL 1EGJA 4YHLL 2R56L 3JV4B 4WFHD 3ZDXE 5C0NC 1P53A 4DN4L 1NCNA 1T83A 2UY7A 1U3HB 1HINH 1NCUA 3TWCL 5LJYH 4ELMA 2X4UA 3JWOC 2FHCA 4LPUA 4FFYL 1KCSL 1JNNH 4G8FB 4WU7B 4Z78B 4MCYA 1CR9L 1Q38A 4HUXA 3PF2A 4IOSD 3LS4L 4PJXB 5BRZB 4XMKH 2VLJE 3O3UN 3JVGC 3EHBC 3MXWH 3T0EA 1FVEA 1IRAY 5C0FB 1AP2A 3WDJA 2H2SC 4NRZA 4E0RB 4W68A 5E9DE 1I3GH 3RDTC 5DMKB 3K81A 1JFQL 4NJAL 3ARTA 2AGJL 2HT4C 3GJFA 4NC1C 3BZEA 1NGWA 4DOHB 4N0YH 3DX9A 4TVSa 2DF3A 3Q48A 5HPOA 4AQ1B 4FHBD 4P5TD 4MXWH 4ZUSA 2DQJH 5L6YL 4MMZC 5DEFA 2DQDL 1RUKH 7FABH 2HWZH 1M7DB 1FO0A 3RY6C 4OFPA 1UVQA 1A3RH 3C8KA 5D7LD 1FNEB 4CN4A 1SY6H 2J4WL 1HIMH 4HV8A 3C8HA 5HYSG 1K4CB 3MV7D 2OSLA 1G7HA 4LPVA 5KS9B 3IU3B 1BJMA 3HNTH 1IZKA 5D1ZB 5C9JB 2YC1B 2OSLB 2AJSH 1AR1C 2FWOA 3T2PA 2J6EL 5DJZA 1K85A 3ABZA 1P4LB 2UZYB 3PGCB 3RUGA 1FPTH 3U0TB 5BZDA 4NUJA 4M62L 2YXFA 3D39B 2VR9A 3QUMA 4X4ZA 3UTPD 5FUCC 4OI9A 1UA6H 3QDGB 2APWA 3TJHD 4BSVB 5K9KB 3RRQA 4TUKH 2BNRE 4OJFL 5I66B 5TGBB 4M7ZC 1LEGA 2VSCA 3AS1A 4Z8FL 4MVBD 5LAXA 1EAPA 5BZWA 2AKRA 2ZSWB 4ZFFA 4NO0A 4Z0XB 1UM5L 5FYJL 1JIBA 3K2UL 5KN5A 1E27A 2Z91B 4MX7B 2EO1A 2WP3T 4PRHB 1A9EB 2O5ZH 3WFDH 4FQHB 4KH2A 1RJCA 5EORL 3MXWL 3RWDB 4M6OH 4ZUTB 3V8OA 5ICYB 3CSGA 3LEXA 1FGVL 5I1GH 2Y7QA 4OLVH 4D9QD 4XP5H 4KU1A 1HXYB 1CLZH 1KJ3L 3A0OA 1P7QB 1BZ7B 1S8DA 5B38B 4EUPA 2DMKA 4X4XA 4ELKA 5F7LB 1HILB 4UZGA 3VU2A 2VDPH 2QADB 3I3EA 1P6FA 3ARGD 5JPMA 1YEIH 3FFCB 1HHGA 2EE9A 4X6FA 1IC1A 2EXWC 1RJZB 3DJ9A 5D1XD 1QO3B 3ZKSD 3OAZK 5C0FA 1JN6B 4OCRL 4X4YB 3L9RA 4G6FD 1I9JL 4OLEA 3O81A 2EDRA 3C5ZB 4NRYA 3WS3B 4LLDB 5ADOL 4MZ3A 4QRSB 3MBXH 4X7DC 5ACZA 3QZWB 1T04B 1CG9A 3WKML 5D2NB 4JFFA 2ZKHH 1F11B 2ZOKA 4UILL 1RUMH 3O3BB 1AD0A 4QLRA 3LDBC 5GS1A 3VG9B 2J7LA 1T0NB 1X5FA 4DZ8A 1BP3B 5IB4B 3WBDA 5F9WB 3FT2A 5IW1B 3FMGL 3IFOB 1T66D 5JHLH 1H3GA 1CZ8H 4NHCH 1A6PA 3VFTA 2XPGB 1EHXA 5DJCA 1SM3H 3MLTA 1MCOL 3QO0B 3FQTB 1E4XH 3QJFB 3FZUD 5ESVA 3UJJL 5DQJA 3PWUB 3BT2H 1UB5B 4UT6H 1LNUB 3OJMB 2P5WB 3RWHB 3KVQA 3QUZA 4ETQB 5BCAA 5F3HA 5TDOB 2M2DA 4HAGA 4LHUG 1FZOA 3MYJA 5CSZB 1KTDB 4U6XB 4N8CL 4YFLF 1R6VA 1IEHA 1ZT1A 3QIUD 4C56B 1CK0H 3AC0A 2Z35A 3DGGA 2F5AL 4PRNB 4S1RL 1MCWW 3HPLA 2WUBL 3BO8B 2B2XL 3TIEB 1L7TH 1UH4A 5AAWA 1B0RB 2DQTL 5CEZL 4JDVA 4JLRA 1JYNA 4F33B 2X4TA 1AJ7L 2Y6SC 4O51B 2X4RA 5JQ6H 5KSBF 3GMOA 4S1SH 5SWSE 4HUWA 1NC4A 5D7SL 5IOPB 1OOAA 2EH7H 1YEGL 3UXFA 5TF0A 4YQXH 4LCIL 3UBXA 2NX5D 1QTYT 2QHRH 5GGQL 1I3VA 5H8DA 2RCSL 3F7RA 4NQEA 1CICA 2EC9T 2AP2A 5C0CE 1VEOA 1M4KA 3SDCC 3V0VB 3WIFA 3BFOA 1BREA 2XQBH 2EDEA 5C0GB 4UNVA 3HC4L 3IDGA 1RMFL 5C0AA 4GS7B 3M8OH 4U0RB 3ROOA 3EYVB 4ZUUA 3H2WA 2H9GB 1E0OB 4WNQA 1QYGL 4KJYB 5EIVA 1T89C 4AIZA 1F6AA 2BNQD 3IXAB 1LK3L 2GITA 2VYRE 3O45A 5CIPA 32C2B 3D39D 3HE6B 4H0GA 2YK1L 2KKQA 3QUZD 3TPUB 5DHVA 4M9OA 4J3WA 3VA6A 4XTRD 2FLBT 1CDYA 1U8NA 2UZXB 4QRSA 3NABL 3HG1E 4PRPA 1XF2A 3ARRA 3CGTA 1I7ZB 1UJ3C 3IXTB 15C8L 2MNUA 4P46C 1NCBH 4JO1H 3TBYB 1OP5K 4X6FB 4WHDA 3TBYA 4WTXA 4POZD 5F96L 4HIHB 3U46A 25C8L 4Z77B 1X3DA 3KHOA 3QUYC 5HDQH 3CFBA 1P9MC 2DB8A 5E03A 1ZLWH 1QPPA 5IVNA 5DS8A 3ESVF 3MRMA 1V7ML 4OCNC 3VRJB 4ETQA 4RNRA 3SDCA 2YPVH 3U4EB 4NNXB 4PBWD 1DUYB 2ZOLB 5J12C 3A67H 3QFJB 1NKRA 4U6XA 3ARDA 4E41B 4HHAB 3O4LD 1BX2B 3NPSC 1A2YB 4H26A 3FHQA 3TA3C 2AXJA 4OI8A 3MRLA 1MAML 1WCQA 1I75A 3FJTA 1L7TL 2VUOA 4S1RH 2EIZB 3E8UH 4PFEA 1QFWI 4JPWH 4MX7A 4YHOL 2HN7A 3EJJX 3F6IA 3G5YB 4C83A 4L3EA 4IHOA 3GSUB 2V7NB 4GSDL 2PYEB 3QZWG 5DFTA 2W0PA 2XNAA 2W59A 2VUYA 2IPKA 1WITA 5F89A 5TE6L 3QXVA 2D7MA 1KLFA 5FHBH 3ARXA 3C9NA 4ZNCD 3N9GL 4MVBC 3MNVA 1WC7A 3QCVH 3O41A 5IMKB 3VH8B 2HFFA 4GW5A 3VXPB 2AEPH 1E27B 2Z91A 3CX2A 5JXAH 1LE5A 2OZ4L 2XWTB 4HZLA 2EIBA 5D4QA 4YPJA 1ZGLP 3O45B 4U1NA 3WLWC 2CKNA 4YPGA 3JZ7A 3REWB 2C3VA 2C1OB 5A2KH 1IILE 4Z7OF 4CJ0A 1KPRA 3KPSD 1CL7I 2DLIA 1RJLA 2WWMC 1AHWB 3OB0K 3D87B 2GITB 5CIPB 4NC1E 1AH1A 3WXVL 1CFQA 3NIGF 4K9EL 3L5JA 5L9DH 4JPKH 3HNTL 4OTXL 5DFVD 5IEHA 3MRBA 4KRNA 4PJ8A 1Q0YH 2X4NB 5J9PA 3C6LC 4S0SD 1ULVA 5A3IC 3VFTB 3G04B 4MQ7A 3OQ3B 4JFDE 3T0EB 4ZMAT 3H8NA 5I1KL 4IJ3C 1YY9D 3FZUC 3MRFB 1CL7L 3MNZB 5JLZA 4UNUA 5JORB 3HB3C 5F3HB 4Y2DB 1AD0B 2A74B 4E42B 5IW3A 3TVMD 5KSAB 4NQDA 1A21A 2NCMA 4KVNL 2EYSA 1XF4B 3JWDL 3DI2B 3O9WB 4L29B 4CJ1A 1WFNA 1VADB 4GRMB 1H8OA 1RZIB 4PRBA 4JPVH 3DV6A 3QDJA 3UZVB 1KUMA 3NH7H 2X1PA 2F74A 3MRKB 2YUZA 3GSWB 1ZLUK 4EBQH 1AGFB 1R3JB 2FJFA 3LKOB 3NFSH 5DJDA 4LLVB 2R39A 1OTTD 2V9QA 4X8JB 3PGCA 3UYPA 1KTDA 2D7TL 1W0VA 4Y4HC 2KH2B 2IFFH 2BZDA 3ULUF 2ZSVA 5CSBA 1P6AB 4JKMA 1FV1A 1M71A 1CYGA 2YD3A 4ZSOB 2ATPA 5KSBB 4EI5C 4NZTH 1H3WM 1NCCL 3P9LB 2XRAL 2IPTL 4EN3A 1WFTA 2NX5A 4PUBL 1RIHH 3KYMB 3QCUH 4NYLB 4PIRF 3ARFA 1DVFB 1MQ8A 3O0RH 3PWPB 3L3KB 5BMFH 1JN6A 3DUUB 2AJ3A 4GAJL 2WIMA 3OAUL 5IVZB 4LLDA 4MCYB 1WZLA 3NA9H 1MRDL 4ZUTA 1UENA 5AG9A 1ZLSH 1H3VA 2BDNL 3GRWA 9CGTA 3Q5OA 5GGQH 1OPGH 3UCRA 5DK3A 4JFYA 3WE6B 3K7UA 3B3IB 1U8KA 2LU3A 1LO5A 4PJDA 2EH7L 2XZCL 2GFBB 2QJDA 3STLB 5FCUH 3OKOB 5GGTH 3KWWA 2FATH 2R0LH 4U1LB 2DTSA 3QPQD 4ELMF 1AJ7H 2AV7A 4H20H 1WTLA 2ZCKH 2APBA 3KR3L 1UM6L 1ZMYA 4UNTA 2A83A 2W0FA 4HZAA 2BSTA 3O6MH 1A3QA 4XGZA 4LCCA 4QHLB 1JF6A 4XPGL 4YHIB 5B22A 1LE9B 4B7IA 4YWGH 3ILPB 4YHIA 3ZE2E 2E7LC 1N0XH 1BFSA 4RMRA 4O9HL 1JGVL 4BKLA 4K7FA 3W5NA 3SDDD 3KS0H 3B8YA 4UI2A 4MA7L 5HI3C 3NIFE 2XWBB 4HV8B 4GXUM 5MI0B 1NDGA 1ZVSA 3WXWH 4K7PY 4QHKJ 1YC8A 3VWKC 1NFIA 2PTUA 4OGXH 3JV6B 4X7CC 3IETA 1JK8B 4B50A 5F7EH 5AZ2L 1WFOA 4DKFL 3MNZA 4R8WL 5EDXA 3L7EB 4ZTOL 1BQHB 1GHFL 4RZCB 2F53B 1ZTXL 3VFUA 4R90H 2K1MA 2NY0C 5CHNB 4H25B 4MDIA 2W92A 1UKTA 2HFFB 2P5WE 3W81A 3OXSA 3VD9A 1TETL 5E2TH 3VFPA 1DBBH 4BSJA 2OTUB 1S7UA 5KANG 3LQAH 5FUZH 4KAQL 4XPFL 3NGBB 5E4IA 3RI5F 2H32H 4YEEA 3HMXL 4OB5H 3LCYA 3DYOA 3QDGD 3U82B 1GC1L 1NEZB 2BHZA 1NAMB 3DI3B 5TFSH 1U36A 4QEGA 5LGJA 4LDEB 3Q6GH 4ZUVA 4HKJA 3T0EC 2BY0A 2MKWA 2YUWA 2NXZB 2C3GA 3RGHA 3PABA 4NPYB 2GSIB 2ZNXA 1MFAL 3WEXA 4FFZH 4ODUB 2Z31D 1IGTB 2D0HA 3IDYB 1UKSA 5D9SA 5DFVC 4KVNH 5T33L 4ETYA 4MJIA 5I0ZA 5J57B 1FG2A 1YYMH 5HHOA 3X12A 5JPNB 3RJDA 2EDHA 3HI6L 1CL7H 2G9HB 4PJAA 3RVXC 1S9VB 2FEEI 3MV7A 4WFED 2E6JA 4JPIB 3HRZB 4Y2DA 2MQ0A 1KJMA 2CQVA 5T3ZL 2FIKA 1RIHL 4UDTA 2VDOL 1R5WA 2RHEA 5KVGL 3C60C 1JNHA 4I0PB 4PRPB 1A6UH 3JV5A 3U2SB 1JPFB 1E4KA 5IHZB 5DURB 2FLRT 3CFBB 1YJDH 3W39A 4DAGH 4QCIA 5E6ID 5IFHH 2DQUL 3B9KA 1BD2A 1G1YA 2I07A 3BGFC 5F6HI 3UPRB 3BZDA 3FB8A 2OR7A 4M4RA 4ENEC 4QRRA 3DTXA 4ZPVB 1EFXA 4DGVL 1ZHBB 2CXKA 3ZKXC 4DUWA 5INCB 4POUB 4KGJA 4H26B 1RZ7H 4P9MH 3LN9A 3QDGE 4K94C 1MSPA 5EZLA 4BJLA 4XC3H 2G75B 1FBIL 4JHWL 1HHIA 4HWBA 1F2QA 3Q6FB 1ORSA 3TT1H 5EBWB 1JMZA 4LL9A 4PRAA 4CN1A 3GI9H 2PYED 2X44D 3DVNB 3GHBL 2WP3O 1A4KB 1J1OL 3MJ7B 5AYUH 5KS9E 1KT2A 1PKQB 5HHOD 4P4KA 1QRNA 4FNLH 2GKIA 1A0QL 4W6YB 1X6LA 1P84K 4Y5XB 3GM8A 2ICEB 1BBJB 2OBGA 5EN2B 2PYEA 3ARED 1ZKAA 2OQJA 3AVEA 4ZYKB 1MCBA 3O3EA 4TUJB 2EEBA 3BHBB 1MIEL 5ICXB 4PJ5A 5I1JL 1RY7B 1FDLL 3L95A 4O2CA 4JO3H 2ARWA 3BHBA 3DGCR 4OKDA 3U0PA 4M48L 4PJGA 3VRLE 2X4RB 3VFSA 3QEGL 4XWGL 5GS0H 3S6CA 4PJHE 1DBBL 3X12B 1F02I 5DJXA 3NACH 1ADQH 1H3PH 1UWGH 1DE4A 1JF1B 5CCKH 4KJYA 4HPYL 5GS1C 3B5GA 4RAHA 1IAIL 4XZUA 5I1EL 4DGIH 4UQ2A 5IMLB 3HUJB 1OAUL 2IG2H 1D9KC 4JFFB 3RWIA 5C08D 2C4XA 2CRIA 3BZFB 2B1HL 3S35X 4JDZB 4HQQH 1QSFE 3MV7B 4ZS6C 4WJ5B 1AE6H 1E6OH 2NXYD 4H1LA 2N1KA 1GOFA 4Y5YC 4DQOL 4NQVA 2VDNH 1MHEA 4FXKA 5CBEB 1QSFD 3NAAL 2AK1H 4JRWA 3SE3A 3L1OH 1JNHB 3QUZB 3R1GH 1AR1D 2YN5A 3WJJA 3VRJA 1QBBA 1V7NH 1OLLA 5HYFA 2YK1H 4GRWB 1CLOL 1XCTB 5HDOA 1ACZA 2EC8A 2VLRA 4OUOA 2GI7A 1WVZA 4N8PA 1BFVL 1MI5A 3UPRA 4YHOH 5I1CL 3RL2A 3DXAA 2G2RB 3RKPA 3W0WB 4EZMA 5JW3H 1PGRB 3LN4A 3WD5L 4NSKA 4OF5A 1MJ7L 2GTWB 2X4PA 4K9EC 2IEPA 4PJDF 43C9B 1UZ6F 2J8UA 3WNPA 2N56A 1ZGLB 4FQIL 5IVXB 2R0ZL 4O2EB 1CD0A 4QRQA 4BH8B 5E8OA 4WU5B 5LXGL 1V7MH 5HDLA 3ARBB 1LILA 3LKPA 2HFEA 3C6SA 3TNMB 1EMTL 4CL7A 1INDH 4BH7A 4X98A 3HI5H 3TT3L 5IB1B 3HN3A 2EKSA 3QHZH 1NAMA 2JCCF 1E28A 3PWNB 2B4CL 4HC1L 1FE8L 1TZHB 5AAMA 2JE8A 3LVEA 5HD8C 2N7BA 1SY6A 4NPYA 1AKJD 5HYSB 3ZHDA 1M6OB 5J6HB 4KZDH 3I3DA 3AU1B 3MV8B 1IM9A 2Z31C 4NDMB 5I0DA 1Q9KA 2AV7B 1F8TH 1BFVH 2F19L 5IHUL 4MXQD 3VGBA 4LGPB 5CSGA 5JHDD 4NKIL 1QFWH 1IT9H 3CMOL 4NOBA 4XPHH 2NNAB 3BPCB 1OHQA 3GSNA 3VD3A 1DQQA 1JGDB 2VWEE 3ZE0F 1INQA 2AK1L 4GBXB 5DMGD 2MKLC 2XN9E 3QQ3A 4U3CA 3DX8B 3HRZA 4M5YH 1VFAB 1LO3L 1U6AH 2DI8A 4NKQB 5BO1L 3IDJA 1NMBL 1GYAA 3VGAC 2ITDB 1CFSB 3PWPE 4KKLC 4J3UA 2A1WL 3FOMB 5GJTH 3T09A 4PR5B 4CMMA 2R4RH 4L4TA 2HT3C 3NA4A 5C07B 4U4BA 4NUJB 3MLPA 4FQCL 2YSSB 4LCIH 1RJYB 2WW8A 4ZSOE 1TQCC 3RWHA 1IGJB 3ARDC 4PV8A 2I60H 3RWJB 1EERB 1OM3H 1JNJA 1UWGL 5H2BA 1GGBL 2ZOKB 1A4JA 2VOTA 1Y18B 1T83C 3KJ6H 2HJKA 1FNEA 5JZ7D 2AI0L 3AAZB 1EO7A 2CLRB 4K2UL 3LPFA 4G6AC 4IMKA 1KN2L 3D25A 5FGRA 1WLHA 3CVHB 1BHGA 4U2ZA 2B2XH 2V2WB 1QBAA 3TYFA 3QPXH 4JFEE 4YLQT 3S98A 1HH6A 1AY1H 1KJ3H 4M7KL 3G08A 4LSQH 1DBJL 1IEAA 3QUMB 1Z3GL 4U2YA 1D3CA 2BY2A 3VFVA 5I16B 1D5XA 1QQDB 1I8IA 1K4DA 2HKFH 3DXAE 2YPKA 4D9LL 3KLDA 4X6CB 2AW2A 1K3ZA 1T21A 3CXDL 3B2VL 3KS0J 3V6BR 4U6HA 5BJTB 4YC2C 2EH8H 2NY7L 4PJ5D 3MUGB 5CINH 3DVFA 4KKBD 1MY7A 4I48A 1A6VH 1VA9A 3V8CA 4Z7VA 3UJIH 3UYOD 4IMLB 5A2LH 4F15C 3DVIA 4Y4FB 4CNIB 5MI0C 4UDUB 5LWYL 2NY1D 4DFIA 1MJ8H 4RGND 2NY0B 1AGFA 1R3JA 1OAUH 3HAEG 2AEPL 3TCXA 3CSYB 3LEXB 1MFNA 4MAYD 5GS0D 5HYQA 4U33A 5INDB 3MLYL 2AJ3B 3PWVA 1UGNA 2AK4E 2FEDC 3T0VA 4DAGL 1JWSB 3GRWL 3ZDYE 5I9QB 1A14L 2L7UA 5E24E 4WUKL 1T5XB 4WW2F 2ITDA 4J23A 4MNQE 1I7TA 5E08L 4HMCA 4LAJH 3LRSB 5A16A 3DX8A 2CRZA 3GIVB 2XG4A 5ANME 3JTTA 3IDXL 3OGCB 3CVHL 4LEXH 1T1WB 5EA0H 3W9DA 4QRRD 4UB0L 5K59F 5AZEL 4KRPB 3HRPA 4JQIL 1CDBA 5IBTL 4EI5A 3MUY1 2DD8L 2LFGA 4XP6H 4RFNB 2X4OB 3VCLB 1ITBB 4PV9B 4Z18A 5FK9B 1JHKL 4J4PA 4M1GL 4PJ8D 1TJGH 4GUPA 1XT5A 5E00B 2Q7YA 4MA3B 4JR9L 1JHTA 2XKSA 1FBIH 5IEKA 2QKIB 1CXLA 4W6WB 3SKOA 2IQ9L 4OGYL 3UBXI 5CBAB 5ABDE 3TN0A 4JFQA 4E41D 1FNGA 2YC1A 3GMMB 4LMQE 4KHTH 3F62A 3GUTA 4NNYB 4U3HA 4WU5A 4RGNE 4E41E 2DQIL 1YEDB 3UDWA 3L3JB 3RIFK 4BFIA 4P2RE 2XZQL 3O9WC 1YECH 4YDVA 1CXIA 1TQBB 4NO0B 4OQTA 1PG7L 2WINA 4BUHA 4XNZB 1AQDA 5KOVC 3H9SD 4N0CC 2NPLX 3RGVD 3H3KA 4XWOC 3ARFC 4HLJA 4BQ9A 5E8NB 1DLFH 1HEZB 5JDJA 3ULUD 4PRHD 3VH8A 3IS1X 4HDIA 2X70B 5CWSB 2XQYG 1HSBA 5E5UB 3T0ED 1J8HA 3MACL 3AMKA 1DQJB 5JDSB 4HJ0D 2EZ0C 4HF5H 1TVHB 1DN2A 3D39A 2E27L 2VDQH 3LN5B 5F7MC 4NO2B 3VFVB 2V7NA 5I16A 3NCEB 1JZ8A 1WQVT 3MGOA 3RU8H 3I9GH 1C16A 2CDGB 3O2WH 4KQ3H 4MD0B 3BIAX 4NCC1 4QOKD 2GW5A 3PGDB 1YPZE 2Y06H 5FYLL 5INDA 4BM7A 3GBNL 1N8ZB 3EO0B 4CADB 5C0AD 1I9RH 3RTQA 1VKXB 3BP4A 4UTAL 4O2FA 3A6CH 4NFBA 4S1SL 3ET9F 1YQ2A 1N5AA 3H3PH 3V7AG 3GSVB 4PJ9B 1JNNL 4AENA 1MQKL 4QO1A 4KKLD 5FV2A 4QRPA 4EIGB 4NT6B 3ARWA 4ZO8A 3G6AB 1MOEA 2VXSH 4Z77A 4PLOB 2ZUXA 5HPMA 5LVEA 5KSAC 3H7BA 2HKHH 4I3RH 1MCDA 3MX0A 4UQ3A 4Z95H 5I1HH 4P5KA 1MI5B 5EO9B 3H42H 1TCMA 3MFGB 5DSCB 3P4NA 4K94L 4NQXA 2BSSA 1VFBB 4NQDB 3IJHB 1AIFB 1CN4A 4IEFB 3FB7A 4HIHA 4XXDB 4KDVA 5KVFH 5F1OB 1JWUA 2FYYA 4MS8D 5C07A 5JHLL 1AKJB 4LCWB 2IAMB 4LLMA 5C3LD 5SV3A 1GPOH 1CFTA 4OGXL 4R7DA 5CMAA 2FBJH 5EU4A 3MA7A 3WJJC 5E70A 3CXHK 4OLYL 4ZUWB 5D6CB 4JVWA 3BP7B 2WSKA 4OM1L 3FQNB 4N90D 1PJ9A 2XACC 1D6EB 1U58B 3VXRE 3DBXA 3KYOB 4KTYA 1C5DB 4TVPD 3GBLA 4I0PD 3QWQB 3DO3A 3EOAA 1LK2B 2QSQA 4JEGB 2ZJSL 3RZCD 1EVTC 3VXMA 1NGXB 1FYHB 4KRMB 5ESVB 2YS4A 2A2QT 3JBG7 3ZE0E 4F7EB 5TPWH 4L3CB 1BWWA 3WCYA 3MGAA 3QIWD 4M93B 3VXNA 1CICD 1ETZA 4LARH 5J12B 5CD3A 5HI3D 1KACB 3TO2A 1IFHH 2ENYA 1AHWA 4AEHL 5HSFA 5DRXA 3S37L 1VFOA 5JOPD 2QSTA 4L9LA 2EKSB 3CFCL 2P49B 1XEDA 1B0RA 4HH9B 5D71L 5DO2C 5I76B 1G7PA 1EFXD 1BWMA 1IM9B 5SX4H 4MNHA 3SQOL 4Y16C 4YZFE 3BPOB 1I9RL 4O4YL 5KS9F 4LNVA 4QTHA 1P7KA 2BDNH 3UPAA 5MERB 3P73A 5CZVL 3NMEA 3KPRB 1TLKA 1FL5B 1VGEL 3RU8L 2AEQH 3OAUH 1RZGB 1RJLB 4XVSH 3MV8A 1I7UB 5ILTL 5IBTH 2C3VB 4PJAB 3RUGF 1XF2B 5FKAA 3WSQL 1G1CA 4WEBL 3ULVC 4PUBH 2X4QB 5F7WC 3TH3T 3BP5B 1KJMB 4EJ1C 3GMRB 4D0CA 2E9IA 5DFWH 4S1DD 4IOIB 4JPKL 2VQ1A 3R4DA 4F3FB 3BZFA 4JGUA 4XAWH 5IW1A 1BVLB 2W9EH 5LBSH 4QF1A 3AROA 1A14H 4WFFD 4M93C 4XAKD 4BK5A 5DJCB 4QRPB 4QXUH 4CMHB 3BOVA 2DM7A 4TSCL 5GRUH 1EFXB 2ED8A 3BGMB 4U49A 5D5MF 5CEYA 1BF2A 3NFSL 1JE6A 1DEEA 4OZ4B 2P46B 3GKWL 4PREA 4HIXL 3MRIA 1MHCA 1GOHA 3TV3H 2KPNA 2B4CC 1ZGLA 4L9DA 3UEZA 3MRNB 1XR8A 1ZVYA 4NQTA 5TH2A 2E6PA 2E6QA 3ZT6A 3RPKA 1IQDB 4MQXC 5B4MD 5JIPA 1IM3B 3IDMA 1EX0A 1F4WL 3ILQD 3KAAA 3SY0A 5DQ9B 5JXEA 1N7ML 2Z0BA 5IBUG 1QRNB 4M1DL 4B5EA 5DJZB 3ES6A 4XPAH 2VLRB 1A4KA 4S11A 4KMTL 4Z7WA 2A6DA 5AEAA 5EIIB 4JQIH 2OJEA 3KYKH 1FRGL 2Y7QB 5FO7A 4Y5YA 1D7FA 3KLSA 4MNGE 4OCXL 2GT9B 3MBED 1AQDB 3T4YA 5K9JH 1Q72L 1UZ6E 1KGCD 1A7QL 1SJEB 1XMWA 4XNXH 5IUSA 4MXQC 2R2BA 1QSVA 1WCBA 3DHMA 1U8QA 4L5FL 4UT9H 2O5YL 3SKNB 5EOCH 1EPFA 5FECB 2PUQT 2XA8H 1FHGA 1J0KA 1I1CA 3MNWA 2JB6B 4KK8C 3VH8G 4JKPH 4F58L 4ONHA 3RVWC 1IBGH 5IESL 4QRPE 1G7PB 1C1EH 4PJFA 4OKVA 1XIWB 3RHWK 4NQCE 1T1YB 2EXYC 4L4TE 4Z7UB 5D1ZD 1K9TA 4XZUB 2P5EA 2E7MA 3PP4L 1ETZB 3H7LA 2A83B 1J0YA 2YRPA 2GUOB 3IDIA 4JAMA 5EBLB 4JB9H 5ALBL 1F5WA 3PGDA 1U8JB 4N5ED 5ESQA 1FN4B 1JPST 1NGZB 5LWYH 2ADGB 1CBVH 2VZVA 1UFUA 2JIXD 1I7RA 2ATKB 1NBZB 4X7EC 1UCBL 2OZ4H 2V5SA 1A6AB 1KIQA 3HB3D 4R97B 3PWJA 4XP4H 1T5XA 2OK0H 3QWOA 3BW9A 3BKML 2VL4A 1QKZL 2Z4QB 5FDWB 1MLBA 1A7RH 1JZ2A 5DVLA 1MH5A 5JMRA 4P2QD 3BMVA 2QQLH 4FN0A 4NCDA 1BIIA 1Z3GH 4P5TA 4C4KT 4K3JL 3D48R 3MMEB 1ED3B 3INUH 3PV6B 5GIRB 4YUEH 2NTSP 4BA8A 3ZTNL 4Z7NF 4KZDL 4NQXB 4XGZB 5E2VL 2YOCA 3BUYA 4JY6B 4XNZC 4WIQA 2Q8BH 3F5WB 1H0DA 3TJEH 4WI5A 3O3BA 1A02N 1JWMA 2P4AB 4K2UH 4AJ0A 1KGCE 4P2YA 4YK4C 1VEPA 2BVTA 1JRHL 2XWJA 4Q74A 3V4VL 1C8PA 5DLML 1V05A 3FQWB 1LMKA 4DZBA 4GFTB 2A77L 2NY5H 1XH3B 4TNWF 2RCSH 5EU7C 5GSRB 4HGWA 2LVEA 1KTLB 5CIPH 1GZPB 1RZJC 2WLZA 4MJ4A 1S9YB 2R4SL 5CJOL 4Y4KD 4WW2A 3H9SB 4B41A 5JHDA 1ONQB 1K8IB 3QR2A 4XHJD 5EOCJ 3DX7A 2FGWH 1R5VA 1JV5B 4DEPB 3QULB 3DRQB 1UQSB 3DX7B 1H8SA 1HXYA 4I77H 2QSVA 3UDWC 3EW3B 4MJ5B 2VXUH 3VFWB 4O2FB 2CDEA 1NAML 4FZ8H 3TESA 1EXUB 1H15B 2D7PA 3BPLB 3DYMA 3FQRA 5E7FA 3SGEI 1HDMA 2DI7A 3BH8A 4EEEA 3OZ9L 4IMLA 4Z7QE 3RDTB 5IFAL 3D2UA 3QNXB 5B3NA 3BN9D 4MJIB 3QIBA 1FFRA 4J2XA 1QBMH 3ARYA 5H35B 4JZNB 4J3SA 1IM9D 4F15B 1RZKH 3PABB 4OM1H 3OV6A 3BZ4B 2O61A 3HMWH 4HJJH 2VZTA 4FZ8L 4N0UA 3M8OL 4OFYD 3SPVB 5BS0E 2FBJL 3PQYB 1PEWA 1E6OL 3MCG1 4GKOA 2CDFA 2FECI 3Q5TA 3VWJA 2JB6A 5I8EB 1UWXH 4JVPA 1RZFL 3EJZD 4GMSH 3BZEB 3P77A 3EO1B 3UYRL 4JFZH 1NCTA 1NBQA 3PXHA 1KPRB 1PDKA 3PDOB 2H8PA 3MLXL 1BZ9A 1J0JA 4Z7VE 1J5OL 1ROWA 5C09D 3MZGB 1H3PL 2E7HA 2A77H 2MSPA 5I9QC 4PJEA 1UKQA 3C8KB 1OSZB 1J88A 3KPPB 4Z7QF 4UIMB 4JN1L 2Y72A 1DANU 4RFOH 3WFHA 4HFWB 5F44A 4FQLH 4JFQB 1GH7A 4TTDC 3VXME 4DEPC 2X4NA 3RUGB 1FJ1A 2P8MA 2HG5B 5LGHL 4RA3A 4Y4FC 4X0KA 4FQJH 4EI5D 4OD2B 5D1ZA 5C9JA 3MRQB 5TF1L 2QV2A 3B83A 1TJHH 3WLBA 2WV3A 2WINB 3MOAH 2DIJA 3KNBB 1DEEB 2IALB 1N7MH 1QR4A 5I18L 3HZVB 1I1FA 1NFDE 1B3JA 4HJ0C 5MEOA 1T22B 1EEZB 3L1OL 3RVTD 3VGAB 4CVUA 3ZYJA 4JFPA 4ERSL 4YHYC 3HR5A 1LO0H 1YNLH 3F7QA 3P30H 4IBLT 1CD9B 4X7FC 1U8QB 4KV5E 5DJ2B 1UG9A 4ONOA 3SKOB 4JQVC 2CDEB 3NCYP 5IB3B 1RUML 4GQ9H 3QXTA 5C08E 1A7NL 4WGWB 1PAMA 3CMGA 1RUAH 2GHWB 2HFGL 3QUML 2A6DB 1ADQA 2XI9A 4HPYH 5L2JA 2Q8AL 1I4FB 5JZ7C 1BM3L 3G6JE 5IR1B 2PETA 4HS3B 2XZAL 4LBEA 3HR6A 4TQEL 5AG8A 1N4XL 5IESH 1Y6NR 4CVZB 2QQNL 3ETBF 2ATPB 5I1AA 1TQCB 3ORJA 3TN0D 3UC0L 4ZAKC 3CFEB 4ONGH 3D3VE 3MC0A 5JA8B 1KB5B 1ZSDB 1D5BB 4IRZL 2VIRA 1T1WA 4J4PD 5IMKA 1NUGA 3SDYH 5K9JL 3NTCL 1I8MA 4NWTH 3O2DA 4OZFA 4TOYL 2P24B 3V6OC 1OF2B 1L7IH 1RULH 5CP3H 5D72H 4XPAL 4HWBH 1DTUA 1XIWC 2D9CA 4AMKL 1IKNC 1MLBB 4LDOB 4M8QA 3U0WH 5IVOA 1GGCL 4HMDA 4LIQE 3L3HA 1DQLL 2GJJA 1NFKA 4MA1B 4JHAH 1W0WB 1U3ZA 3SQOH 5EU7E 3MV9D 1KIQB 1PLGH 4UQ2B 5FYJH 3SGKA 4DKAA 5ERWB 2BP3A 1CFQB 1JGEA 3BP5A 2Q3AA 2JCCA 4ZS7L 3O2DL 3QDJB 2CUMA 3ARBC 2VABA 2FSEB 4QHUB 1IFHL 2BHUA 4TRPL 4LVNB 4OJFH 2R1XA 1GGIH 5K9OB 1WAAA 3TBSB 1KCRH 4XVUD 3SE4A 3IJYA 5CUSH 4LSVH 1QACA 4WRLA 1RJYA 2RFXA 3L5WA 3PJSB 1C5CL 1A6ZA 2OP4L 3GB7A 4LNRA 5IFHL 1MVUB 5J06A 3PHSA 4R4FH 4P2RA 3RVUC 1H3UA 1ZANH 2YPKB 4JY6A 1FH5H 1BVZA 5ECJE 2J6EH 2J8HA 4YFLI 5E2WL 4JLRB 5HGDB 2JB5H 1IM3A 1TVBB 3GHEL 4LSTH 1HH6B 3HZMB 3VXUA 1OP9A 4AT6B 2MHAB 2R9HD 3LKPB 4I4WA 1RIVL 3TA3A 5GZND 4LRNH 2DKUA 4KGLA 5H94B 4M8VA 2GSGA 4PGCB 1MY5A 3QNZA 3V6ZB 2HJFA 3HC3L 2R2BB 4FQ2L 2BNQE 3QXAB 4V1DA 3MNVB 2ED7A 2ICWA 1A7PL 4JG0L 2YPLD 3QQNA 5BXFA 5EU6D 3AS3A 5BV7H 1L0XA 5SWQB 1K2DA 2IH3A 3QQ9C 1E6JL 2DI9A 4D9LH 4G8IA 5DJXB 3MCLL 3QUZC 2NZ9D 4Y5XC 5DD3L 1ORSB 1JGVH 1ZS8B 5F21B 5FGCB 2X4SB 4IRSD 4KPHH 1S9WA 4FQQA 2XIDA 2V17H 1ZA3A 5CZXC 3TWCH 4MNQA 4YDKL 2CKBB 5EC1A 3VXOA 3ZTJH 4F7MB 3CCHB 5C07D 3RWFA 4M9PA 3AB0B 4C55A 2BERA 2EDDA 2VXSL 3L9RB 3T1WA 2CR6A 3EOTH 4EVNB 1U8MA 2XN9B 2ADIA 3VG0H 3KJ6L 4G43A 1Y6KR 5D70H 5GS1B 3WEXB 7CGTA 5MEQB 4CU8A 1SYSA 5CJ8A 2J2ZA 3V95A 4R9HA 4P59H 3H0TB 4YHZL 2ZUSA 1LO2L 1EO8L 1IGMH 3B5TA 3U36B 5I75C 5IW6B 3PE9A 5F9DC 4OF8A 1T7ZA 1ZLSL 1FG2B 4FOMA 3T77A 1HKLH 4X4YA 1YEFH 2FYYB 3NA9L 1MCFA 3NIFF 3V6FA 4O02L 2Q6WA 3S5LG 2FSEA 4U1GB 3PL6B 2EYRA 1S5IH 2Y6SD 2E5EA 5GPRA 2G2RA 3FONA 4PJEF 2B5IC 2CKBL 3W0WA 3QBTB 5FYKU 3Q3GB 3FOLA 4M5YL 1B2WL 4G9DB 4LVNC 4L8SA 1ZHBA 4HHAA 1TZIB 3RWIB 3EYOA 4Q6IC 4L4VA 3H9SE 5EIQA 5EU3A 4M00A 5F97E 2CRMA 1EAPB 3HZMA 4MD4A 5BZWB 1MHHA 1IT9L 4Z0BL 2Q20A 2YPLE 5IHZA 3C5JA 5GS3A 4MA8L 5IQ9B 3BRFA 2X5PA 1TITA 3QYCA 1HKFA 1NL0H 1ZHNA 1AXTH 4JZOB 5CD3B 2HKHL 4AL8L 4NM4H 5E8DH 4MNQD 3ZL4L 3FQXB 4JANB 1T22A 1KCRL 4LNRB 1DQDL 2HLAA 4I77L 5JW5A 3D69A 3LRGA 4RIRB 3EJYC 5HVGB 2IJ0C 1LO4L 4K55A 4LAQL 5EN2A 2LU4A 2N4IA 2LV4A 1QLEL 2HTKD 2XFXB 5KJRH 3WIHH 4N5EC 2IGFL 4M1CD 4X6DF 4J1UA 4J8RA 3VI4E 3FT4B 3U0PB 4QHNB 3WHE0 5C0AB 2AS5M 3O2WL 5IOPA 5DVNA 1XGPB 4AMKH 4M43L 3LY6A 2X4SA 2H9GA 4HUKB 3WUWB 1S7QB 3T1FA 4LRIC 4QY8A 2VLRD 4EN3C 3IXAA 4R2GC 5BVPL 1V5JA 3TPKA 2ADFL 2C7UB 2R2HA 4ZAKD 3G9VA 4OFDA 1A1MB 3ESUF 1W72A 3OX8B 1FL3A 3NN8A 1Z5LA 1BQHG 3MRDA 3IDGB 1QFUL 5ACMA 1RUPH 4HUXB 1FQ9C 5GGVY 5FM5O 1OD7A 1BOGA 1SBBA 2A0LD 3FT3A 2R23B 5HBBA 5C08A 1BGXL 43CAA 4D0DA 5CJXA 3P4MB 4PGBB 1XIWD 3P4LA 1IGFL 3FB8B 2XY2A 3IJYB 4PJCA 4M6NH 5BV7C 3HNVL 5I1DB 1SYVB 1EZVY 4Y8DC 2N7AA 3CJJA 3CU7A 5K59E 1XGTA 2P8PB 2VAAB 3CNKA 2YKLL 1HNFA 1DZBA 2X9WA 2XV6B 3OKKA 3ZT5A 4BQBA 4ZS7H 4MNGB 4LCUB 4LSPL 3QDJD 5CMAB 5CKGA 3W5MA 3PUCA 4PJCF 3DSNA 4DGIL 3NGBC 3VW3L 4UDTB 1TQBC 1O5DT 4XC1L 4AK1A 4NC2B 5HHXH 5GSVA 2ERJC 5FHBL 5J13C 1WWBX 2PN5A 2LVCA 2EEDA 2VKXA 4CW1A 2EZ0D 3IFPA 5F9AC 5DUPL 5D72L 2FX8H 3CFKA 1JGLH 1N59B 2PXYC 3N1QC 3U83A 3DSFL 4P4KD 3RWJA 4PLJD 4ALAH 3KPRD 2NY1C 3EDJA 1GZPA 4JPWL 3WLBB 3P9WB 2F9BT 8CGTA 1AXSA 2XTJC 5FDYA 5JIIA 4FXLA 5GRXG 5EUKB 3CZFA 1M05B 1QFHA 3UTTE 4FQXD 1BEYL 1OQOA 1NBVH 4HK0A 3NBNA 3X3FL 1OARH 5EU6B 5IGXL 3VWKD 5CJQL 3SGJC 1OM3L 5DJ6A 1F4WH 4HPOL 1WAAF 4R4ND 1S7WB 1D5XB 4NBYB 5HDQL 4GRWF 5A2FA 5EOTA 4ODXA 4JHWH 1FL3B 2R4RL 3FCTA 1MWAL 3L3GA 3LPGA 1EHAA 1ZHKA 2CIKB 4KUZH 5D8JH 5KANI 4R96B 3F65A 2YA2A 2PXYB 4I18A 3LKNB 1BOGB 1NC2A 2FRGP 1K6QH 4FFWC 1M6OA 3MUJA 3OR7B 4GLRI 4EUPB 1CD1B 2QHLA 5CLWA 1NLBL 1B4JH 2CDFB 2NX5B 3ZYIA 1KCUH 4PJGE 4X6EB 4DTGH 2J88H 3E2HC 3HS0A 1L6XA 5J6GA 2DQGL 4LASL 4PJ5E 2MTPA 1EFQA 2PW1A 4FTVD 4G80A 4L3AA 1GGUA 3SDCD 2D7QA 4F2MB 4HK3N 2DTML 4Q97A 3PWVB 1IAMA 4M7KH 5FK9A 4EI5B 3LIZL 1AQKL 1N64H 4C58B 1DQML 4WEMB 1J0ZA 1EHLL 4J3XA 2FB4L 3G5VB 5IEKB 5FOJA 4KJPD 5ISZB 1DBAH 1AO7E 2NYYC 1IGIH 1LO5B 2C3XA 4PJDB 5CJBA 4OQTH 2OTWA 5D6DC 4Y2DC 2YUXA 4JCMA 2PR4L 3TLRA 3HNSH 2NY6B 2OI9B 1BFTA 5DMKA 5J3HC 2V5YA 4MMXC 4YHPA 1S7RB 1FFPB 4MD5B 2BSTB 3G5YA 5C0JB 4FG6C 1W72L 5IB2A 3PWLA 3VFUB 1MFAH 3C6LB 1FL6B 3VRIB 2W65A 3GSNH 2I9TA 3EYOB 4F7CB 4R2GB 4PJ9D 4UV4L 4JO1L 1I8KA 3GGWB 2BVOA 4W4NA 4PS4L 5I2IB 2MPAH 3BH8B 3UAJD 3HMXH 3ZTNH 2B39A 3CZFB 1NDGB 4M1CC 5DD5H 1CGSL 4BZ1H 1YEEH 1W0YT 4ZXBC 5KSVB 5FM4A 2PKDA 1KEGH 4NYLA 1OAQH 5T3XE 1DVFA 1QQDA 4NQCD 5BV7B 3BIKA 2BVQB 4GMTL 5IFJB 2GY7B 2AXFA 3QPQC 2VITB 3SJVB 4GKZA 1VENA 4KJWD 1FV1B 3BE1L 2YD2A 1ZTXH 1FO0H 2VXUL 5EUKA 3GMRA 5GGRY 3RZCA 2VRAA 3FO2A 2F54B 1KJ2L 4GBXC 5DRWA 3BKYL 1UXWA 2AXHA 4P46D 5EBMA 4NN7C 1HKLL 1A6WH 4G6KL 3Q0HA 1FLRH 3FT3B 3O6KL 5GGUB 1JYXA 1I7UA 3QIUA 5I74B 1S7WA 1MCEA 1ACYH 4EVNA 5FDWA 5EWIH 4P2QE 5JMOC 1Q9WB 3TIDA 4PJCB 4KK9C 3FO1A 1RZKC 5DGRA 4KQ4H 3VGEA 3VG0L 2H41A 1KB5H 5E94B 1JRHH 2VXQH 3BQUD 1TCRA 4JO3L 2AV1B 1O7SA 4FFVD 1S3KH 2Z92A 5FXCH 2PW2B 1KELH 2V9RA 4LHUD 1VADA 2X10A 4GRMA 3VD7A 4D9RD 1Z2KA 2JKXA 3BW9B 1A1OB 1KENH 1G7QB 5ALCL 3NFPA 2BSRB 1JBJA 4MQSB 5AD0B 3IDJB 4XWOD 3SN6N 2DRUA 1R5IA 4G9FE 5C6PB 5DUPH 4DK3A 2GTZA 3M17B 3QUYB 1B0GA 3RL1A 1HQ4A 1QLFA 5EC2B 1FGNL 2XG5A 4UTAH 4RAUB 5EIIA 3CSBA 2HFEB 3C08H 1FNAA 3TNMA 1FCCA 1QBLH 2OK0L 1NCAH 3QRGL 4R26H 4XB8A 1UJ3B 4ZD3H 1A4JB 5GRVL 3AB0C 3HPJB 2UWEF 1MCSA 1RSFA 4BZYA 2NXYB 2NY4D 4Y1AD 1OCWL 2E9WA 1JPTL 3TH4T 2G60L 5DQ9A 4CVXA 2EIDA 1RZ8A 4KROC 3DBXB 1NC4B 2BOCA 1XR8B 3GI8L 2HVKA 2DQCL 3O0RL 1OGAD 1YEJH 4GLRH 3MACH 3WFEL 1NUFA 1G7IB 4K8RC 4P5MB 5KAQF 1WISA 4KRLB 3F8UB 1HN1A 2CUHA 1YJDL 2L4OA 4YAQB 4W81A 1AFVH 3ES6B 3BSZH 1ZANL 1S78C 4WO4A 4K8RL 3IRZA 2ADGA 3FB5A 3EZJB 4ZFOB 5KVGH 2KBGA 3MOBH 1IGCL 2VDOH 1HIML 1JUFB 3O2VH 3O41B 1SJEA 5DXWA 4NNPH 3WSQH 4QTIL 5D7JA 1QSZA 5F7UA 1EBAA 1IAOB 3W11D 4G42B 1XIWA 1LE5B 4H1LG 1BFOB 1Q9KB 4YGVB 1Z0NA 3VFOA 5HVFB 1U42A 4OGYH 3MLSL 3UPCA 4F8TA 4HD9A 4KRPD 3I75A 1YMME 3L5HA 4XBPB 4R7NB 4I3SH 3HTLX 4M8QB 2WK2A 1KCKA 4Z7OE 4YBQC 1U8LB 3P11H 3MXVH 2FR4A 2IMNA 4DKDC 4F3FA 4NM8H 4ODWB 4GAYB 4X8XA 4DWHA 4Y19D 3MROB 4X99A 2ESVA 4QRUA 1JTOA 3HE6D 1HILA 2PTVA 1R3LA 2BSSB 4NO0D 3ME0A 3QH3B 1XCQB 4NGHH 1IC4L 2ARJB 1VCAA 3QEUA 4WY7H 3QH3A 1OAZH 2YD5A 3O6FC 5DDHA 4Y19E 1MCIA 3R06B 4JJHA 5TFSL 4AIXA 1YMMA 4Y1AE 3WIIL 4LARL 2HH0L 1P5VA 4NQVB 5ESAA 2ID5A 3KPQA 2IAMC 4OCYL 3ZKND 3OF6A 4MDJA 4PY7B 4IDJL 4AY0A 3SDCB 3SE9L 3FRPA 5D2NA 4HT1H 4HKBB 3SDXF 2JJTA 1KC5H 5ACLA 1A6UL 3V79C 3SGDH 4LPXA 4BSWB 2E8ZA 3L3DB 1U8NB 2GK0B 4KTEL 4KUCD 4PRPD 4NQUA 3E6FB 3IVKB 3MJ6A 3E0GA 1BM3H 5LAXB 2X70A 4HDIB 4XPTL 3EGSA 5GRJH 3RNQB 3ZKXB 1YQVH 4X0KB 4NKOB 1RQ5A 2WBJA 3LV3B 2JJSA 3KYNB 2OJZH 1AGBA 1P9MA 4P99A 4RISH 2C26A 3C6LA 3OKDB 1BBDH 1MUJA 3EFFB 3FB5B 1G7IA 5D6CA 3PGFL 5CHNA 4PJ9C 1FVDA 3DX6A 4ODVH 2DLEA 5DC9B 2DMBA 4X9BA 4M02A 5DMYA 4KJWC 4Y5XA 5TE6H 1G0YR 3HR5B 5KW9L 3SHSA 2XQYK 5DC4B 3VGFA 4PJIA 1QVOA 2E7BA 3S37H 4WTZG 4J6RH 1TJHL 3IFLL 3DMMD 4FFYH 2BY1A 5JPMB 4L8SC 2NZIA 3GMOB 4HUWB 3OKMA 4I9WD 3RI5K 3OBAA 5GGUA 4P4KB 2CKBA 5EC1B 3VXOB 1X5XA 4I13B 4TSBH 1S3KL 3NCYS 4KKCD 4H20L 3VXMD 4X80L 3LDBB 2F5BH 5C70A 2IANA 1EDQA 4L8BB 4NRXA 2HRPH 1VACB 1U8PB 5KZCB 1MPAL 4YXHL 2P7TB 3C5ZC 3A6CL 4PYGA 1NDMB 1ND0B 4OM0H 1KB9J 1KYOJ 4NKMA 1EBPA 3ZZ1A 1V3KA 3IJSB 3GIVA 4OLZL 2M26A 2RR3A 4OLWH 1S5HA 3GJFB 1WEJH 3KDMB 3QRFM 2Y07H 4TNVK 2PO6B 3BQUA 5AD0A 3BKYH 1CDCA 3LOWA 5KVDL 5C6TL 5JUEL 1NCBL 5DEFB 3EO1A 4HF5L 5DRZA 1MCRA 1KLUB 2WIIB 5CSZA 5KTEL 1PEZA 4HUNB 3LSOA 2H1PL 4HIEA 1Q9OB 2JB5L 3NCJL 1YN7A 3AM8A 4HUUB 1NMAH 4MXVE 1I8KB 1J8KA 5EUOB 4YHYB 2BOBA 1JP5A 2X6MA 1KC5L 4TPRL 3MLTB 5T1MB 4XHJC 4PJFE 4L8DB 1JCKA 3H42L 1G9EA 3CPLB 4M03A 1G7LA 4YX2H 4PGDB 1FFPA 3G6DL 4NQED 3S96A 1TVHA 1OAKH 5SX5H 4LP4A 1L0QA 3KPNB 4G7YH 5IR1A 1N59A 2A38A 4LBEB 2YWYA 1X5YA 2B4CH 4HC1H 1FZJA 1IC4H 4LEOA 2GJ6B 1KB9K 4PY8J 4GKSA 3HI5L 3TT3H 3P9LA 2OS7A 5I19H 1ZLVK 2NW2A 1UQSA 5DVOA 2FECL 1DEDA 4U1IB 2NW2B 4PRDA 3L3KA 2FD6H 1MRDH 2R2EA 5FYKD 2YD9A 2VZ1A 4AENB 1TIUA 5L2JB 3MV9E 1VFMA 1XGPA 3X17A 1RPQA 5I6XB 1OD9A 5BMFL 1QSFB 3QNZB 4NRXB 3BJ91 4OD1H 5HHVH 3U9UB 3WN5C 3ZYOA 1X5LA 1Q0YL 5TQ0H 1IQWH 4YUEL 1C08A 3NIDE 5M7QA 5JOFA 3GJEB 1VERA 1FVCB 5D2NE 1B6DA 4NZTL 3ZDXF 2CIKA 2QQLL 4OLUH 4N1EA 1HHHB 4C59B 2FO4B 4ODTH 4M7JH 2PW1B 2YD8A 2Y1VA 5IQ7L 3QXWA 4IDJH 1I7TB 1S9XA 5IB5A 5CGYD 4Q9QL 5DT1H 2XZAH 3QWRD 5D7KD 3S34H 4LCCB 2HH0H 4BFEA 2W60B 4TTDD 1F3RB 3I50L 3O4LE 2UWEE 4BFGA 5GISL 1JZ6A 3HC0A 4Z7NE 3PDOA 1N6QH 5B21A 1IAKA 3W9EA 4EDWL 5IK3B 5E00A 1F42A 1PLGL 5BRZA 3WKMH 5F6HJ 2J5LB 1CGYA 4EOWH 3O6FD 4JKLA 3PP4H 2FJGB 5DJAA 5I8EA 1MFCH 3EOBB 4X9FA 4R4BA 3JV6A 4OCRH 3U0WL 5GS2H 4HFUH 5E8PB 2O26U 3I85A 5I1LB 4PRHE 3LMJL 5EU6E 3MQIA 4BH8A 4YHNB 4NZRL 4PGDA 5DD1L 2W0FB 2WBWB 2VQTA 3CLEL 4JFEA 5FYKE 4F7PA 4FQJL 5D93B 3T8XA 1KCLA 3S97C 2CJUL 2K3TA 1EAJA 5ALCH 1I8IB 3SDYL 2R0WH 3UTTA 4P9HH 4PTTB 2W0LA 1FCGA 1YN7B 4YK4B 1F2XK 4R3SA 1OLZA 1QHPA 4K8RH 2ZCHH 4ZSOA 5DD6A 4R0LA 3LH2L 4I5BB 3WXVH 4XVTH 5GGSB 1NGQL 3PDGA 1BVKA 4FQCH 4N9GA 3HE7D 1NUDA 3ULVL 1OGAA 3CLFL 4CVZA 1WIOA 4S2SA 1CQKA 4G6KH 1YEHH 1K8IA 1ONQA 1IC7L 1I85A 1MFBH 3RNKB 2NY0D 1GSMA 3RDTD 5TQ2L 3EKCA 1X5HA 4CAGA 1UYWH 2OL3A 5MENB 4UV7H 5E6ZA 5HGHA 4RRPG 3BKCL 2VQ1B 5DJ8A 1T03L 1DL7L 3GMNA 1OQXA 1AHWC 1CLYH 1AGDA 4H8WC 3MODH 5I1IH 3SKJH 5E9DB 3CK0L 2V5RA 4DGYL 5IHLB 3QIWC 4Y7MA 3SKMA 3FFDA 2AJSL 4X7SL 5D2LE 3VWJD 3BESR 4G6JH 1AGEA 3D85B 2LAGB 5EUOF 3OZ9H 1QYGH 5GJSH 2IBGA 1A3RL 1JJUA 1XF5B 2IANE 3MRCA 2DDQL 4HGKC 5I15L 2HAZA 2BVYA 3OKKB 1U8JA 3QDMD 3BPCA 4TUJA 4ORZC 1FC1A 2HTLD 2BC4B 3ZDZF 3A67L 4XBGB 2L0DA 3MV9B 4K3GA 2A73A 4P2OC 3L5WB 3PJSA 4HG4K 4QT5A 3ARFD 3G08B 4LQFH 4RWHA 1J1PH 4PJBA 4PJHF 5CBEA 1NCWH 3HZYB 2VN7A 5GSRA 1QLRB 3TBSA 5F88B 4NBZB 5LCVH 1U3YA 4P46A 1E4WH 1RK0A 1R3HA 5F7DA 3OJ2C 4WHYG 5DTFB 2YD6A 4M6MH 1FVDB 1YNKL 2F53E 4RAUA 5HVHC 4NO5A 4Y5YB 2Q3ZA 4FP8H 5GISH 1I1YA 3L3OB 4J3OC 1MJ7H 3EOAB 5J56B 5I8CA 4Y4KA 2X7LB 4TUOA 3BUYB 3EYQC 1VGKB 2W9DH 4NKOA 1T80A 3LV3A 1B6UA 4FQXC 4BQCA 4X7SH 4B53A 4N8CH 4GMTH 2V5TA 3S96B 3AREC 4CRPA 3G9AB 5D1XB 1J05A 3STBA 2AJYH 4QRQB 4APQD 1CLYL 1TXKA 3BT2L 3GB7B 4UT6L 5I30L 3B43A 4QY8B 5EUOE 2OMNA 1PX4A 3QDMB 3AY4A 1WC7B 4KY1L 4HBCH 1AXSB 1H9VA 3DGGB 3SOBH 4D9QE 3O8XA 4KK6C 2R15A 3MR9A 4WENB 1AE6L 2XWTA 4Q58C 3SKNA 2X4PB 2G5BA 4F9LC 3FMGH 4IIQB 1NBZA 4J8RB 3PWNA 4R8WH 1SEBB 1A64A 4IIQA 3K8LA 1MFDL 1CF8H 2C1OA 3PP3K 1ES0B 4KROB 4OLWL 3MBEB 4X7TB 5FB8A 4HEPG 2KQNA 2EIEA 4UT7H 3VFOB 4L3EB 1YNTA 5E4EB 1FYTD 2OXHA 1S7SB 4G43B 2XN9D 3H7BB 2X4QA 3HE6A 5JQ6L 12E8H 4FZEH 3GJFH 4GS7C 1E28B 2R2CA 4WUUE 1N0XL 1SMOA 2XA8L 4MXVF 5I1HL 4TYUA 3PDDA 2DN7A 4ODWA 3NFPB 1R24B 2F53D 3IDNB 5D2LB 3KLHD 1R3LB 3K74B 4QRTB 1CK0L 4G42A 4DUXA 2D31A 2XT1B 3M07A 1KG0B 4JM4L 5DDHB 4WI4A 5DK0B 1EGJL 2X1OA 3H3PL 3FFCA 32C2A 3SDXA 6CGTA 5FGCE 1FNLA 1Z6JT 1FIEA 2J88L 3BD4A 1DFBL 3DECA 5DHVB 2VDLH 3DO7B 3HZYA 3QEHA 1U8LA 5KTEH 3TT1L 4DQOH 4JGJA 4FQ2H 4Y5VB 3K1KC 1FL6A 4D8PB 2FJHA 1BBDL 4NNXA 3TBVB 1UB6A 1T4KA 2MQ3A 4NKDA 1MWAH 4KUZL 5JW4M 3VXTB 1C7SA 3QEUB 1RIVH 3H0TA 2FWOB 3B2UD 5E8NA 4YHML 4H1LH 4YBHA 1HHIB 3I6LD 5JTWA 3TCLB 4M6NL 1LK2A 2RAMA 5F3BB 3Q6FA 3TF7C 3NZ8A 2QKIA 1HYRC 3GHEH 4LSTL 4MB4A 1HI6B 3I6LE 4K3DL 1KTKE 5F93C 2A9MH 5IQ7H 3L7EA 1IBGL 3MR9B 2RIKA 3KYAA 3IFNL 5DTFA 2H6PA 5TGBA 3S35L 2IBZX 4P49A 5JW4Q 2YEZB 4LFHG 2G75A 3KPMB 2NY2C 4WWKA 3LEVH 1RURH 5I66A 2DQHH 5D2NC 2AJVH 5EZJB 4MHHG 1SJHA 3LKSA 3PIQA 1HOCA 1ZA6B 4PGZA 3VXNB 4GRLC 4P2RD 4PJBE 1KIRB 1X7QA 3SDAB 1D5MA 2VMFA 5L2KB 1U8HA 5FYLE 3CFJA 4LU5H 4LU5L 1U8OB 3PGFH 4LSDA 1DR9A 1ZV5A 4QRUB 3QCTL 3VMOA 4PGJA 4Q7DA 2OL3B 5D71H 4W4OC 3QNYA 1UM5H 4X5WB 1TPXC 3OR6A 4XC3L 2VDKL 2UWEB 4XCFL 1RZ7L 1W8NA 1F4AA 5ERWA 1KBGH 3O4LB 4YDLB 1FFOB 3GKWH 3I50H 2R1XB 4XBGA 4G5ZL 4H8WH 3CVHH 4LEXL 4NM4L 5E8DL 4R6UA 1KULA 3FFDB 3O2VL 1DBKL 4S1QH 4AEIL 4IRZH 5EO9A 2P5WA 2UZIH 4YDJB 4FG6D 4ZNEA 4RFNC 3BSZL 4WWID 3SO3B 1LD9B 5FIEA 1P2CA 2W9EL 3FN3A 5T5FH 1F3JB 2GJ6D 1JWMB 3OXRB 4K71B 1ZVHA 4X6DA 4K3DH 3KPLB 2DM3A 4ZUSB 1U8KB 1CIDA 3CFIC 3GMQA 3GDBA 3V7MA 4KRPC 1HHKB 3NVQA 4RGOH 1B2WH 4PD4K 4Q6YA 1G7JB 1ZOXA 3KPOA 5L8JB 5E99H 1RUKL 1ZWIB 1IEAB 5LQBH 3TYGL 4YHNA 2WLYA 2E7LA 4Z7UF 1J0HA 2GYSA 1F4XH 4M43H 1VGEH 4P2OB 2MQCA 1I3RB 5JHDB 3HLAA 5CZVH 4HLZH 4HK3J 5HTSA 5IFJA 4PLNC 3QRGH 4UAOC 4HGWB 1T7XA 2X4OA 3RNKA 4V1DB 3D6GA 5D1ZC 3WIHL 1KYOK 2EDWA 1DFBH 3B2VH 1F97A 2HJLA 4PJ8C 3SDDC 5AUMA 2OL3L 2OTUA 5DJ2A 1EGJH 5IT2H 1XGYH 3EO9H 5TF1H 2VIRB 5DHXB 3QG7H 5BOZG 3QQ9D 5C8JB 1NMCC 4KI5F 2COQA 3VMPA 4KI1A 3V0WL 1HH9B 1TJIH 4LGRB 1RURL 2EDXA 1T5WB 3MOBL 4PJFB 5E6YA 4XPFH 3SJVA 3L3JA 2BFVL 4BFIB 5DD3H 3ZKQD 4ZTPL 5E1AB 2ARJQ 1OSPH 4KQ4L 1S8DB 1KPVB 1CTNA 4HWZB 2CIIB 1CVRA 3L3GB 4YO0A 3WFEH 3TZVD 4PJEE 1P1ZB 4JZJA 3C5SB 4TNWK 2O93L 1OGTA 4KJQD 5MEPB 1GZQA 4RISL 3OGOE 3EJYD 2WQ8A 2ZUUA 3BD5A 2V2TB 4N5UA 2IADB 1MJUH 2Y07L 1YEFL 4PJEB 3HMXA 1HYSC 5J6GB 1QSFA 1NMBH 3M45A 3BWUC 1N5YH 5FUCE 1REIA 4XT1C 1AC0A 3RP1A 5C0IB 3HC0B 1CXFA 1N0LA 3WO4B 4N0RA 4U1KB 3FL7A 2AJYL 2E9JA 5DA4A 1Y6MR 3SJVE 1WV7T 4XMPH 4NKIH 1FH5L 5EZIH 3OR7A 1I9IH 5MHSE 1G6RH 3KPLA 2BFVH 2EXYD 4GQPH 5A16B 1IVLA 5SWSB 1AIFA 4PB0H 4PJHA 1FFQA 2BCKB 3L6FB 2HT4D 3OB0H 4MQ7B 2D7TH 5IVXA 5MHSD 3VWKA 3DOSA 5KSAD 2X1QA 1Y0LA 5TDPB 2C4FU 3IB4A 1NEZG 3QA3A 2EDFA 2VXQL 4P2OA 2VKWA 2AEIT 2JLLA 5E5MA 3LN4B 1Y18A 2FATL 4NCC2 2D4DA 3GSNL 3P0VH 3RGVA 3ZO0A 4WGVB 4V1DE 5KW9H 3BEVB 4FQ1L 1H0DB 1VPOH 3LKQB 3F7VA 1X5ZA 3B2UC 1B88A 5HJ3A 5JHDE 4GW4A 3CD4A 1HH9A 3VFWA 1GGCH 4LLWB 5IHBA 4OFVA 2I5YH 3HA0A 4S2SB 5B39A 3NIGE 1BQLH 1F58L 1N6VA 2DLFL 4LVOB 2B0SL 4DN3H 4U1HB 5CKAA 3MLSH 5EO0B 4KUCF 5FUOH 2FJFB 3LKOA 1KIPB 4DVBA 4MD0A 3EJZC 2PO6D 4LK4A 1X4ZA 5GRJL 3FRPG 1W0VB 3QIBB 3VFRA 3V5HA 4L8CB 3TO4B 3AMLA 4OCSH 4KKCC 2QLVB 4OIBA 4EN3D 2XRAH 3U9PH 5CFHA 4G6JL 2X4UB 4R3SB 3NN8B 4AYFA 5FA4B 4L8BA 3GMPB 1J7VR 1H15A 4HT1L 3CC5B 1KLGA 2DQGH 4FQQB 3FN9A 3BDYL 1DL7H 1ZT4A 1LWRA 1QKZH 5FAAA 1YUHA 2R23A 4BZ2H 4RMWA 2BVPA 4F9LA 2DLHA 2C3HA 1QNZL 4PJGB 3TVMA 1XGUA 3KDMA 4XCEA 1HNGA 3DIFA 4GQ9L 3C2AH 1JF5A 4P3CH 4WNQB 2ZUVA 5I1DA 1A22B 1WIUA 5TQ2H 1JPTH 3FKUS 2I25N 4J3VA 1CGUA 2ICEA 1OW0A 3HFMH 5GIRA 4MAUH 3QP3A 4I18B 5LCVL 1EJ6A 4V2CB 3DPBA 1J0IA 2NNAA 2ZP0T 5I73C 6FABH 1NGQH 1CFBA 4HWEH 4OZGB 3FOMA 3L6FA 1NJ9B 4YBLB 1T2XA 3NACL 4GUPB 4JFHD 4JRXD 1MCPH 3GNML 2FX9H 3SCMD 1C5BH 1G9ML 4TVPL 1L0YA 2NLJB 3QWOB 1OP5H 4EIZC 3K8KA 3BWAB 5EOCL 3MMEA 1HI6A 1NPUA 3U79A 4QTIH 2JK5A 3LIZH 5DMIL 1RK1B 4NKDB 5GGRA 1EUUA 1KELL 5FV1L 1TDQA 1ZEAL 1YC7A 2DTMH 4OLVL 2VC2L 4U7SA 3UC0H 3BAEL 2YZ8A 3MFFB 5IMMB 3V6OA 5FM5M 1MAKA 1UZ8B 1JHLH 3GI9L 3S3JA 3IAGC 2VABB 3RAJL 3ALWA 3HZKA 4LF3A 4WI3A 4Q9CA 3GSUA 3BEWB 1YEJL 1CU4L 3QO1B 1FLTX 5IB1A 3MA9H 3UYRH 3V5DB 5DO2D 2YXMA 3VXQA 2FEEL 4OZHB 2P42B 3I84A 1N6QL 3DRQA 1T89A 2GY5A 3MRGA 4GAFB 4W70A 5K93A 3U4EA 1YNLL 3S7GA 1R3IL 5FO7B 1S9YA 1CICB 3WDHA 2JJTC 3HPLB 3M1BB 4JRYB 1IL1B 4KV5F 3OF6D 1IQDA 4PP2A 3QUXA 1FGNH 1ZHLA 1F4YH 3REWA 2E3VA 3CDFA 2A6KB 1RZGA 3MRJA 3UTPE 3QG6B 1XF3A 3RWCA 1VFUA 3ARBD 3A6BL 3B6SA 4QXTA 3I75B 1IARB 5TQ0L 3MRHA 4PGEA 1KN4H 4FMKA 5FO8A 1UWXK 4ZUVB 4GRLA 3C9NB 2MFNA 3CLEH 3DSFH 4WFHE 4ZFOA 1GCFA 1JVKA 4NQEE 1JGLL 3CDGB 5IW6A 5DUMH 1IKFL 1HHGB 3HUJF 4JFOB 2CMRH 5MEQA 3IYLW 2UVEA 2IMMA 5T33H 3AY4C 3MRRA 1INDL 1S9WB 2X89D 1WF5A 5GRWA 5HHMD 3DETD 5DZOA 3QO0A 1U8IA 3GMMA 3HNSL 1YEGH 3WNNA 3P0GB 3MGTA 3FOLB 4FQ1H 1TZGH 3R8QA 5IMLA 1F3JA 3G5ZA 1KJ2H 1PYWA 1R3HB 3PL6A 5F7DB 5L0QB 1CXEA 5D5MA 2DKMA 5EO1B 4P3DB 2HYMA 1F13A 1FO0L 4NN6B 1WBZA 4RNRB 3QDME 1UACH 1GC1H 3TBWB 4D0CB 5HHQA 3DARA 3S34L 1T1XB 3WD5H 1T3FB 4D0BB 4JDVB 1QBML 3P0YH 4RMTA 1J11A 1QA9B 2PCPA 3TA3D 4QHMA 4FXGB 4NN5C 5KVEH 1CGTA 1RD6A 3AXLB 1X5JA 4ODTL 4S10A 3QUKB 5E2TL 4OLUL 2GCYA 4F7TA 4DTGL 3BQUC 3R1GL 3U0TA 1MJJA 5BZDB 4EKXA 3O6FB 4A6YA 2H1PH 4MSWA 1A3LH 5T3ZE 3NAAH 1A9BB 4Y8AA 5ID1B 3UBXB 1N5YL 5FF6A 1BQSA 3V6ZA 1U9KA 1LEIB 4XXCA 2QQKL 3BO8A 3TIEA 3X3GH 2CKBH 1D6VH 5C2BH 4MQXD 4LCWD 1F90H 2WQRA 5DRXB 1LEGB 4O51A 1HOCB 2AQ2A 1TZGL 2IWGA 3PXJA 4LLWA 4N1HB 3LS5L 5IM7A 1XFPA 4LCWE 4H0IA 5JXEC 3FB6A 4XPBH 1NCWL 1IGTA 1JMXA 4YQXL 2JJUA 4PB9H 1A9EA 5IVXF 3TO4D 2ZG1A 2Y25A 2D3VA 2R0ZH 1XGUB 5D70L 5HHME 3DIFB 1M1SA 3RKDC 2DIBA 1AO7B 1LO4H 2H6PB 5ISZE 4NQDE 2IAND 1LEKA 2F5BL 4YR6A 4XBEH 1FDLH 1XGQB 2DLTA 1KB5A 4HCRH 3BP4B 1CT8A 5F7FA 4Z95L 5D1QC 2AV1A 4U6VL 3C09B 5D2LA 5IJKA 4XNXL 5E2UL 1TJIL 2ZPKH 4LP5A 5DRNA 1LP9B 4NRZB 4IOFD 2NXZC 3INUL 4QYOA 4EUPH 2WZPD 1RU9L 2MMXA 2RB8A 4FNLL 1C7TA 1CS6A 4I18C 1T7VA 2CPCA 4CN6A 4LCWA 1UT9A 2P1YA 2E7CA 3V2AR 4OT1H 1E4XL 4K07A 2EDOA 1BZQK 3ECBB 3BKCH 2YR3A 3C5ZA 4XXCC 1ZLUH 5JPNA 3O3DB 4QNPF 2ESVB 5JUEH 1G7JA 5ID0A 4LRNL 4UQ3B 4PRIA 2GJZA 2JJVA 4ZODA 3MLVL 3F7VB 5EU5A 4OV5A 4GH7B 4HS6B 4O02H 4DZ8B 2FO1A 4JPIA 3VI4F 5DA0B 3ZSSA 1RV6X 3FQUB 1NCDH 3OKLB 5I8KL 5CS7A 2XTJD 2AJXL 1GXEA 3QQ4A 3VDAA 3WJLC 1G7LB 3K46A 3T8XB 4OD2A 4KVCH 4KTEH 3TN0B 1MPAH 3OHXA 3KJ4C 5IGXH 1EVUA 5T5FL 2FL5A 3FTGB 5D1XA 5FHAL 2WNGA 5HI4D 3VWKB 4OI7A 4X8JA 5D6DA 4WWKC 3HG1D 4XAWL 2NR6D 3ILPA 3EFDH 2XZQH 2BVOB 5SWZE 3X11A 5MEOB 1EEUA 2ZSWA 5HYJB 1SY6L 1IGYB 2J4WH 4ESKA 5ISZD 3VFPB 5L88H 1HDMB 4NC0B 2EECA 4PRHA 4QXWA 8FABA 2V17L 3H9ZA 1VB9A 5EFIA 2R8SL 4XP5L 4K7PH 1NGXA 5DR5H 4NZRH 3S4SA 3B9KD 4HX1B 3CU1A 2WM0A 3IFLH 4TVPH 3MGOB 3MJ8B 2VB5A 1U3HC 1HSBB 5C0RH 1G9NC 2PYFB 4FFWD 3TP4A 2NW3B 3I6KA 4G8EA 5BQ7A 1NSNL 4XP9H 2C4FT 2Y4SA 5SX4I 3LN5A 2IGFH 1WWAX 2DL9A 5FA3B 4LVEA 5C0ND 4ODBD 5EBLA 1AXIB 3C5SA 4BUGA 1CDGA 1WTGT 1OGTB 1JGUL 4LSPH 1CD1A 1PVHA 2W1NA 1CGVA 2CIIA 4HUVB 2PXYA 4UB0H 1YMHB 3K4DA 3HNVH 1CGWA 1FFNB 3NTCH 1Z9SA 3V4UH 2YD1A 4A6YL 4F2MA 1KXQE 4R0LC 3CSYA 1AP2B 4K23L 1NL0L 2X1WL 3D85A 3OAYK 5IWLA 1IJ9A 5TDNB 4WO4D 1LD9A 4MCZB 3EIFA 1G9MC 2B1AH 1M7IB 3QEQA 3TVMB 3D3VB 5ID0B 2J12B 1PZUB 2UZIL 4JZNA 5J1AB 1MF2H 3GJEA 1I85C 2VE6A 3MREA 4W6XB 3T65A 4XH2B 5T3ZH 4UUJA 3VFNB 3STLA 3WIIH 4J4PC 1UB6B 1JI1A 2DQDH 3GSRA 5CEXA 5DK2B 1YEKH 4YHMH 5T1MA 4OGZA 1K8DA 3BVNA 3I02B 5ILTH 3U6RA 4KTDL 5FYJE 3NOIA 5F7EL 5C0AE 3VFGL 3GMLB 4R97C 3MV11 1UH3A 3QCTH 3J7HA 3C5ZD 1EJOL 3WXWL 3T3PF 4NWUL 5KJRL 2GJ6E 3CXDH 4NO3A 4WW2B 4MA7H 2UV3A 5EZOH 1GGTA 3RY5A 5JORA 3MOAL 4R0LB 5DZNA 3GM0A 43C9A 2IPUG 3KXFB 4XCCH 4FABH 5SWSA 4JFDD 3MOQA 3OJDB 4XVJH 1A2YA 3FQUA 4PRID 1IC5L 3QFDB 4LSQL 4JRXA 5FCSH 2C1PA 5L88L 1J8HB 3E8UL 3FQRB 2ZG2A 1AXTL 2NY5C 4U6VH 5KG9A 3DV6B 3E2HB 3MRQA 4N8VB 3T4AB 1UM6H 4YX2L 1N2RA 2AJUH 4JFEB 5KSVA 1S7QA 1OT1A 5ITBL 4HBQA 4LLVA 1YY8A 2CRYA 5SWZA 1D5MB 4XNQA 4M7LL 1Q9LB 2XZCH 3BH9A 3NCJH 2KL6A 5F1IB 1LHZA 3CXHJ 2IPUK 3MYZA 1BBJA 4BQ6A 1FFNA 5MEPA 3LKNA 2DQCH 4U1MB 1RHHA 4AIOA 1CF8L 4GOSA 1MJUL 4U1JA 5KVDH 1GPOL 5C07E 2D0FA 4HX1A 1D6VL 4MLIA 4PGBA 2QQKH 4ZD3L 2HVJA 3THMH 3TPUA 1B9ZA 4LHUB 1P69B 2SEBB 3DO7A 1DE4B 1JF1A 3KJ4B 1INQB 4OCWL 4YIQA 4ZAKA 5HY9A 3WUZA 3IAQA 2GUOA 3RWGB 2P5EE 4G8GA 3DUSB 3T0WA 2C7UA 1KEGL 5JIHA 1DJSA 4LPTA 2XKNA 3OPZL 4UAOB 4YDLC 3P0YL 3N06B 2W07A 4D0DB 2ICES 3D25B 3IRPX 3O9WD 2OP4H 2P5ED 3D9AH 3EOBA 3OGCA 1E4JA 1MLCB 1TPXB 4P46B 3DURB 1RHFA 4JY4A 1CFSA 4KK5C 1QSEB 1LP9F 3VXSA 4MDJB 5CP3A 2GCYB 4F7TB 4P5TB 3S9DB 4PV8B 3EO9L 4RBPK 3RVXD 4P23D 5FGBA 4MWFA 1QSED 5ID1A 4LKCB 2DYPB 1X5AA 1QUNA 3HPJA 1DQTA 4NQSA 1T7YA 2BNQB 1T3FA 2FZ3B 4RMQA 4PTUB 3JWDH 5DMJB 3WFBL 5HYJA 3RA7H 4WHYH 3IS0X 4XP6L 2AABL 5E8EB 3AXLA 2NY5L 3LS5H 4WI6A 1A6WL 2HTKC 3TM6A 4O2EA 2VZ3A 4CUCA 4HXBL 1AGBB 5JXED 5GZOC 1J8HE 2WUCH 2E27H 2J8UB 2VDQL 2Y36H 1SJHB 2WBJD 3B9KC 2I26N 2W91A 5IVXE 5C8JA 5F8QC 4TOYH 3FONB 3MLUH 3BYTA 2IPKB 5F89B 1FZOB 1CWVA 5J11C 4IS6B 3M1BA 4OSUH 5GJSL 1MHCB 2HLAB 5I1CH 1LVEA 4OIAA 3L5IA 4ZFZA 4JQXA 1GC1C 2P8LB 2VDRH 4HXAH 5MENA 1QEWB 4PJBF 3QAZC 4F9PC 3MRLB 4TVPE 1KCUL 4OZFG 5IQ9A 3IDMB 1JUFA 5H37H 3CCHA 2HFGH 3QUMH 2K7PA 4WI9A 5GGTA 3WMSA 4LCYA 4A6YH 1UXSA 1UACL 2ITCB 5IM7B 2Y23A 4F37F 3P73B 3ALPA 3T2OA 3HAEB 5JW4R 1XF3B 4YR6B 5D8JL 2YWZA 3QDMA 1MFBL 3DMMB 3CDGA 1JGUH 4X99B 4HUMB 1A6AA 1I3UA 1NFDF 3HUJA 4WO4B 5TJWK 3ULVH 2DBLL 5C0BB 3LKRA 1PZ5B 5F9OL 1J1PL 1PZ5A 1H3XA 5ENWB 3U7WH 4O00A 1S9KC 5D7IE 3KPSA 1XGRB 3FN0H 1YMMB 3MPCA 4IOIA 3ZE1E 3T77B 2APXA 1P7KB 3QNYB 4L4TB 4LPCA 2E9BA 3TNNA 4GSDH 1FSKB 2ARJA 4FXKB 1MHEB 3F12B 4GT7A 1ZA3B 1RFDL 1KG0A 4WO4C 2DYPA 4H88H 4Z76A 1EHLH 1RK1A 2HA1A 1TTFA 1XCTA 1IGCH 4RFOL 5HY9B 3OJVC 5E08H 3T08A 4S1DC 2OYPA 1QRND 1QOKA 2K7QA 4HFUL 3SKJL 4NQSB 2RBLA 3G6JB 1N4XH 4YHKH 2XKNB 2V7HA 1QRNE 4DW2H 3R0NA 5HHXL 4RDQG 4U1GC 1HZHL 3BKMH 4D3CH 4Q2ZA 4PJ7E 1MLCA 4U31A 1JPGA 3VXRA 2KUTA 2NY2D 2HVKB 5F88A 3K2UH 4AT6A 3VXSB 2XXCB 4EDWH 1A6ZB 3DYPA 5HGBB 4Y16D 4ZDHA 4IRSC 2HLFC 4UMGA 3IGAA 4MSWB 4Q6IA 1OB1A 1AO7D 4ZO6A 5EU4B 1Z9LA 1LO0L 2NY4B 3C2AL 4F37K 1EZVX 1LO3H 4Z0XA 5SWZB 5DD0L 3V5HB 3CVIH 5HHQB 4LSRH 2WBKA 4XVTL 1Q0XH 3RZCB 4KHXH 3KYOA 4WHCA 1BGXH 2DQUH 2I9LB 5D7IF 4G9FB 2VR4A 2BOCB 4WV1C 1FPTL 3VXPA 4PRNA 1DN0A 2VDRL 5KZCD 5LBSL 3H9YA 1NGPH 5F3BA 1C5DA 2R29H 3DUUA 5AWNL 1KT2B 5DQDL 4F57H 2C3WA 2P24A 3RIAF 2JJWA 3U9PL 5F7KC 3O3AA 3ARFB 5L2KD 4YNYB 2CLVB 2YBRA 1PSKL 2DM4A 4OD1L 5C0BA 1S7SA 4OZGF 3L3HB 1MAMH 4RMSA 4XBEL 4RX4D 3RTQB 5DUBA 4L4JA 5DJYB 1X6NA 4KMTH 3FCTB 1KB5L 1M71B 3GMPA 5C7XH 2DLFH 5DSCA 1G9MH 3Q5YA 4P2QB 2VLKB 5I17B 3O4OC 4PJXA 4APQC 5DJAB 4PB9L 3B3IA 1ACYL 2PTTB 2UYLA 4XPBL 3VWJB 3OMZA 4IMKC 3WHE1 5J4MA 4Y2DD 3AREB 3VGGA 3QT2A 5I71C 1CG9B 4MAUL 4FTVB 4GMSL 1F11A 25C8H 4WVRA 5DZLA 1AD9B 3GSVA 4FQIH