2XJKA

Monomeric human cu,zn superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Folding Catalysis by Transient Coordination of Zn2+ to the Cu Ligands of the Als-Associated Enzyme Cu/Zn Superoxide Dismutase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 36
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2xjkA00
4A7VA 3CE1A 1QUPA 1IBDA 1TO5A 1E9OA 1SRDA 3H2PA 1F1GA 1BZOA 3GZPA 3F7KA 1F18A 3KH3A 3KM2A 3GZOA 1SXCA 2E47A 4A7SA 1IBHA 1OAJA 3QQDB 4L05A 1TO4A 1E9QB 4A7GF 2ZKWA 3HOGA 4FF9A 1XTMA 1EJ8A 1PZSA 1AZVA 5KBMA 1BA9A 5CU9A 1E9PA 2WZ5A 3HFFA 3L9EA 1CBJA 2JLPA 2AQSA 4BCZA 3F7LA 2E46A 1EQWA 3GTVA 1DO5A 1HL5A 1OZUA 2C9SA 4N3TA 4BCYA 2GBUA 2C9VA 1UXMA 1L3NA 1F1AA 1YSOA 3ECVA 4U4IA 1IBFA 1Z9PA 2VR6A 3K91A 2GBVA 2AQTA 3HW7A 1RK7A 1OEZW 3KBEA 4B3EA 5KBKA 2SODB 2WKOA 3LTVA 4A7TA 3KM1A 1JK9B 4A7QA 3SODB 1Z9NA 2WYTA 4BD4A 2Z7UA 1N18A 1PU0A 3RE0A 2LU5A 3MKGA 2V0AA 4OJAA 2AQNA 1CB4A 2C9UA 1SXZA 3PU7A 1MFMA 1S4IA 2WYZA 3KBFA 3MNDA 2AQRA 1P1VA 3QQDA 1HL4A 1OZTG 1E9QA 1E9OB 2K4WA 1SDYA 1SDAB 1U3NA 1UXLA 5KBLA 2WZ6A 2Z7ZA 1ESOA 1SOSA 2GBTA 2WWNA 1SXBA 4MCNA 1SXSA 1F1DA 3GQFA 3KH4A 1SXNA 2AEOA 2VR7A 2WZ0A 1IBBA 1IB5A 2R27A 2WWOA 2AF2A 2APSA 1COBA 3T5WA 1N19A 3S0PA 1YAZA 4A7GA 2Z7WA 4N3UA 1E9PB 2VR8A 3GZQA 2WKOF 2XJKA 1XSOA 1SPDA 3CQPA 2Q2LA 3H2QA 2JCWA 1FUNA 1PTZA 4MCMA 2AQQA 1DSWA 1B4TA 3CQQA 2ZKYA 1JK9A 2NNXA 2AQPA 2XJLA 3ECUA 1Q0EA 2ZKXA 3L9YA 1SXAA 3ECWA 1XTLA 2ZOWA 1YAIA 2Z7YA 4OH2A 1KMGA 3GTTA 4A7UA 1B4LA 1JCVA 1OALA
chains in the Genus database with same CATH superfamily
3VXQB 3L5XH 1LLAA 1FLTX 3IKCB 1LE9A 2WQ8A 3BQUA 1QUNA 1PX3A 1HU8A 5I1KH 1IBZA 1WG3A 4YO0A 3EUDA 3QXTA 1ZLVK 3QJOA 4FQCH 2X4PA 2JMRA 4MJ5A 4QT5B 1WH0A 3RTQB 3VCLB 1KG0B 1OAXH 3QB7C 4F7PB 2E4FA 4UAOB 4Z8FL 1RXLA 2F8IA 2CNZA 3MLRH 4CMHC 1JDAA 1RU9L 2B20A 4Z7WE 1JPFA 4EUPB 2YR3A 1S9WB 4F5CE 4GW1B 1DUZB 3OJVC 3ZTJG 3G6JB 4R7DB 3KEHA 1B0IA 5E9DA 5GSVB 4WWID 3EF7A 3MNMA 1O7SA 1ZY9A 3EKCA 3K0YA 5E03A 3OKNA 3RPKA 1QHQA 3RWFA 1MLBB 4FG6D 3QHZL 4DTGH 1JDDA 1OM9A 3QJTB 3GJFA 3MLXH 4PV8A 1EZVY 5LJYH 5JNYA 3MV9E 1FL6A 4FNSA 2GJPA 2B3RA 3ZYJA 4PMEA 4QHNB 2WXLA 4XODA 4BFFA 3DMMB 3NUKA 3WDIA 5HYJA 4JPIA 4H8VA 2NUTA 1FZMA 1HE7A 2ORBL 5JZ7D 4B9PA 2WINA 4HWEL 5DMGC 3ZTJH 4WO4B 3NIFE 2EVFA 3MV11 4XNQB 4HIIA 3ZZQA 3AXHA 4CMMB 3V4PA 2ZT9C 4KO5A 1RJLA 1OM3H 3NK4A 3SY6A 4OM1L 3HG1D 4JHAL 4JQXA 2Y22A 2F7IA 5CP7A 2CO4A 4XCCH 4MXVF 4W9LC 2R51A 4XXWC 1JWSB 1OAZL 4JO1L 2CSPA 5DQDH 4L9LA 5A1AA 3MJ6A 2OMWA 5DD6B 3S88L 2VR7A 1LP9B 1OSZB 3LZOA 4UT7L 2J7LA 1CI5A 2BWIA 4OCXL 3ARZA 2A5UA 3VYOA 3B43A 3IDIA 1JNNH 3PJSA 3VD4A 3I6LD 4JQXC 3KZ8A 1P7QA 3D4GA 5FDWA 2DTSA 4QHKJ 4RGNC 4L9LC 1MVYA 2EEAA 2OJZL 5TH2A 2CWRA 5MI0C 2R7EB 1KELL 3E38A 3VD2A 1DN0B 1ETZA 3R0NA 1JXGA 1L7TH 4OCWL 2A9NL 2V9UA 2YQ2A 5FGCB 4EZKA 1KMGA 4Z76A 5DK0B 2C5DC 1OTUD 1EFXB 4KRLB 5D1XD 3V6OE 2X2JA 3ZE0B 3FRPB 3GS4A 4G1EB 4FZEL 2CH8A 2DYSB 4FNRA 4JJOA 3ESNA 2B7DT 1NC2B 2IAND 3WLWC 3DDGA 2FJFA 1OAQL 1QLEH 3IGAB 1WAAA 1E4KC 5TTRA 3KM2A 4EI6A 5I1EH 5EEVA 2FEDC 3JV5A 5M95B 1SGKA 4XVJL 4CSPA 3AQXA 1HXYA 1LO2H 1U8OB 4JE4B 5B1CA 3ZE2B 3B4NA 1RZKL 4LCIH 2R8SH 4NO2A 2CR0A 5C7ZA 2VO8A 4R97C 2VLJE 1Q1JL 4N1HB 2FIRT 3OR7B 3VSVA 2GSIA 5GGSA 4NENA 4P23B 4WUUA 5I24A 3EYOB 3QA3A 4XI5C 4TUKH 4U6XB 3OAUL 4F80A 2VJ0A 3BVWA 1HSAA 3X1NA 3HE6D 4PPTA 2RHEA 3RA7L 2YJLA 1ZLVH 1KB5L 3DTUB 1DFBL 1ZHBB 3H4HA 4H25A 2OXHB 3D33A 1NSNL 3EO0B 3IMRA 4LIQE 3VH8B 1L9QA 5KSAA 4RMBA 3LX9A 4E9LA 3OWRA 3UPRA 4FQPA 1VGKA 4WTZG 4UDTA 2VUKA 1W6WA 3RWCA 1OCWH 4YE0A 2HX7A 3MRGB 3EDEA 4IS6B 5DURB 4OLEA 5BW7A 5HYSG 1ZHKA 3IXAA 4IKIA 4R4BA 5ADPL 1T0OA 4RNRA 2VDMH 4P5TB 4I1RA 3IFLL 5CIPB 3ULVC 1EZSA 1ZSDB 1IAIL 1NIFA 1XF3B 5D6CB 3SDDD 4FAAB 4GLRI 1FO0L 5D4HA 3MV7B 3HBQA 4P5RA 4CU7A 3BDBA 3CVHB 3E1F1 3AFLA 4LO9A 4LSUH 4OB5H 2DJ4A 4DN3H 2B5IB 5JR1L 4XP4H 4NJ9H 3AITA 4F37K 1NCCH 1NKOA 5E6UB 5EORL 2JXMA 4UILH 1A7BA 1DLFL 5KBNC 2EJ1A 2JCCE 3WXWL 4HUXA 4QYAA 2A99A 2LR4A 1O6SA 1ZCRA 3KLHC 4CN4A 4WK0B 1W6LA 2HT4D 3P0YH 4PS3A 4FZ8H 5ACZA 2M8XA 1QRND 2H2SC 5G4OA 4CSTA 5DHEA 3GI8H 3F8UB 1WGOA 3PIQB 4A38A 1VFUA 2R39A 5BZWB 5E5RB 1CDJA 5IW1A 5BXFB 4Y9BA 3U7YL 5GZND 2Y07L 1OWRM 2EYRA 2NQ3A 2QT6A 1MW2A 3FQUB 1FBIH 5ACLA 5HI3C 1OSEA 1BVLB 1MVUA 4GP8B 4PWHA 5TPWH 2CHWA 3MXVL 4PRIB 1YNTF 3RFZB 4PJ8A 1I31A 2X87A 3VGHA 3CU1A 3ISWA 1HZLA 5IIEB 2YPLB 2HP4A 3QUXC 2UZIH 3HMWH 5HHPB 2H6UA 5DU7A 3DVGB 3FFDA 4NN5C 3CV5A 1CGVA 1EFQA 3B9VA 3BYYA 2WNKA 4IGBD 3A47A 1T0NB 2DQDH 3C5SB 3KYNA 3Q2WA 5GISL 4J28A 2NCEA 1AACA 1YEIH 1PD6A 1L9MA 4JHBA 1BQKA 4CBPA 3O4LB 1JF1B 2NUPA 5CN1A 2XACC 3H9YA 3JV6B 4NUQA 4PJ8C 1HYSC 2NZ9D 2NY0B 2WZ5A 4LLWA 4TF4A 2ID5A 3GD1C 4A2FA 2Z1PA 4M7LH 1U3HB 4Y5XA 3GDCA 5CWSB 1R24B 3QGVA 5I17A 1NEZG 4EKJA 3ASNB 1CFMA 4UNUA 1YEGL 1BHGA 1J8SA 4JJHA 5F3BA 4F2EA 1DQJB 4DVRH 4U1IB 5L9DL 2ZOUA 3IDGB 1MNNA 3IPFA 3NTCL 2IH9A 4BIKA 1YHPA 3CSFA 1AHKA 1HXKA 4S1RH 4K7PY 1QQDB 3BO8B 1U3YA 1KC5H 1PFOA 4UV7H 4TNWF 3U7WL 3HG1E 2WSDA 3TBYA 4YIQA 1P7BA 4NZUH 2ERJC 1L3WA 2DQCL 2W07B 4AQAA 1PG7L 4MXQD 3P77A 4TULL 1O5DT 2Z91B 4HV8B 1JXFA 4MNGA 3OLEA 2D7TH 2W80C 1A1MB 5EN2B 1FQ9C 1QYGH 2Z4TA 4Q4IA 4Z7VE 1F6AA 5E2WL 4MS6A 1CF8H 1ZAGA 2IQAB 3GJFH 4JM4H 4KV5E 3V95A 3MRLB 2YD2A 3WNIA 1IC0A 2Q76B 2Y3AA 3I6LE 3FU8A 3TN0D 3UIYA 5ANMB 5FDYA 3O8XB 5K5YA 1Q9LA 1TIUA 1KCSL 1JYVA 3H9HA 2Y24A 3ASWA 4ODUA 1AFVL 1Z5LB 1C16A 2EC9T 3TVMA 2ZX7A 4U0QB 4D9RE 4OLWH 4IJ3B 1DO6A 1T3FB 2X2UA 4K3JL 4QTFA 3ZHNA 1EJ6A 1GHFL 1SMAA 1ACCA 1TTBA 3I6KA 3MRIB 3Q0HA 4Q4EA 3VRLE 3PQYA 4FTDA 4MMXA 1KGXA 5D1XE 1VIWA 2P24B 2V7HA 4LEBA 5E1QA 2IANE 4TSCH 1BZDA 4WU5A 3WFHB 3AS2A 3BVTA 4KX8A 3WEMA 3N91A 1A3ZA 4OZIF 3HE7B 2V2TA 1WISA 4X6FA 2RCSH 5C0AB 4K9EC 5D2LF 4HXBL 2HJFB 4LOUC 5D1ZA 4JHUA 1ZIBA 3DNKA 1U8IA 3PXLA 5AWNH 3QSKB 5K9KA 2AJ3A 2CHNA 1Y18A 3IDMA 1YC7A 1GZQA 1NAKH 4RMTA 1O7VA 1L9RA 2Q3XA 4IYKA 4Z7NE 5AW4B 3FAWA 1W2KT 5I74C 4QR7A 1T03H 3V0HA 4DFHA 2YUWA 2O6CA 1KY7A 2VDKH 2XWJB 3DV4A 2ZSWA 3B7YA 1I9JH 3IFOA 4ODTH 2MCAA 4WKZA 3D2TA 1AZVA 4Q6IB 4Z7UB 2DEWX 1ZA3B 4YBLC 3GF8A 4JDZA 5I18L 4WSJA 2IDTA 4Q0XH 5T1LA 5ETUB 2J4WH 1KEGL 1AAJA 3QFDB 3L4ZA 3FB6B 4PY8J 1NPUA 1ZIAA 4PP2B 3QQ3B 1DE4A 1JZ5A 1J5HA 3G5ZA 3BW9A 4GEIA 4DUWA 1U9KA 4I2XA 4YXKL 2LVCA 5ADOH 4ORZC 1E4XL 4QTIH 5E2VL 3D18B 1CFSA 1K4DA 3U0WH 1X5MA 3UBGA 3O0RL 4PB9L 2CKBB 1VCAA 3CZUB 4JR9L 3DI3B 1Z9NA 4P2AA 4XBPA 4HPYL 4I5BA 1T04B 4AEIH 2DIJA 4JDTH 1A9BB 2UZYB 1G7PA 3F2LA 5HHMD 4YHPA 2R69A 3AAZB 3B9EA 2YA0A 4XPHL 5F7EL 4ABQA 5JDJA 4KUCD 5C07A 4KK5D 2PF6A 1GOGA 4NN7C 4RZKA 1HOEA 5KBLA 1G7MA 1TKWB 3CSYB 4JQVA 1TUPA 2PXYC 4O58L 5IB2A 1F2QA 2VDRH 1UEYA 3D9AL 3S37L 1I3RA 2WNXA 2R4SL 3ULVH 5D5MF 4YSCA 3VW3L 1TCRA 2UZXB 4QWWD 2DQHH 3QFJB 2QGCA 4IRSA 4DF9A 4L3EA 3OKMA 3HBGA 4GG6F 1MPAL 5DZOA 2ENPA 5CSBA 3FT1A 3SYPA 4QCIB 1QP1A 1GYUA 1IGYB 2P5WA 4EN3A 5K69A 1PKOA 1QFWL 3WU1A 4AIEA 3JV0A 1NGQH 1DBBH 3QHTC 1JP5A 2APFA 2ARJB 5AAWC 4ICWA 3WKMH 4P3DA 4L4TA 3KPRB 1CXHA 4DPCX 1RZFH 3GK8H 4IRZH 1KIRB 2VDPL 2W0FB 3NJLA 3SPCA 4F7MA 4JFEB 3HZ3A 1NANH 5DHMC 3Q8EA 2OR7A 4LLUA 2LLLA 2JKSA 2G3NA 2WWMD 4X8GA 4RAVB 4IRJB 2FBRA 5E5UB 1AE6H 2I85A 1R5WA 3RUGE 1E0OB 3LKOA 2FWSA 2X44D 3HBPA 2QSTA 3L3OB 1Z1WA 3L3GA 4F7TB 2JK5B 4P04A 5JHLH 5HP5A 4ODVL 3KEDA 1W0VB 5E9DD 1D5MA 2NT0A 2YSSA 2XYCA 1U41A 1EZVX 2G60H 1QO3B 3AROA 4PWGA 1LNUB 3K4AA 4OZFG 4QRPE 5J06A 1S7WA 3QULA 1R3JB 2Y7OA 4DEPB 1WD8A 2RJMA 5DMGD 4XTRC 4I1PA 1MCPH 4Z0XA 1I7RA 1ED3B 3QORA 5B1JA 3VXRB 3PXJA 1JXDA 2XXCB 1KEMH 4AT6A 2DYPA 2ZCKH 2XN9A 3EYFB 5DWUH 1OTSD 1CE1H 1SNRA 4JFSA 5HYJD 1WZ1H 3G9AB 2AMGA 3IBOA 3NT0A 4X6CB 2AEWA 4OZHA 4JFWA 3VXUA 1A0QL 2ZJSH 2H0JA 4XO9A 3QORC 4LE8A 3TTSA 5I8OL 4M8VA 2VXVH 3TBVB 3FO2B 1X5ZA 3AJ7A 1BZEA 3GC3A 4KQ4H 5DFWH 4ZQTA 5IOPB 1I1YA 3HB3C 4OZFH 1FH5H 1I3GL 1I9RH 5IFHL 2Z93A 1CDHA 1E9OB 3DRTB 3QUKA 2K3HA 4G5ZL 4BH7A 2YRZA 5ESQB 1GR7A 5ILTH 1T2XA 4RGND 3IWUA 4XMPH 4LVNC 3HJ0A 3SGDH 1NOFA 4HWNA 3QXDA 5J9PA 1VFOA 5I28A 3B1UA 1E30A 5L2JA 5FYKU 1HHHA 2D7OA 2MPVA 3QH3B 2AEOA 4GS7C 4IOIA 4WRLA 3TT3L 1JPST 3HZKB 2FJHA 3IDXL 1FFPA 1VGEL 1ZDSA 3NSYA 1P7QD 3GXFA 5EC2B 2XJKA 4P46A 1NBQA 2V33A 5CGYD 1G9ML 1UT1A 5TK4A 4Q8BA 4AH2A 3MUUA 3DXAA 4HGWA 5DZAA 5FO8B 1UKQA 2YN5A 4PJHF 2FEDD 2VYRE 3CLEL 4TQ8A 1KJ2H 1NL0L 3VNYA 4W9JC 3GSWA 3EF4A 2CIKB 3O4OB 3X1EA 1MCNA 2ICCA 4LNRA 5CJ5A 4XH2B 1OARL 1LE5B 3S3BB 3M88A 1CICA 5FA3B 2KYIA 1TENA 1M05B 3SGKA 2B1OA 3WXVL 3RWHA 1G1OA 1U36A 3D5OF 3H2PA 3HG5A 1RERA 4HMEA 1I1AA 4K9EH 1DQVA 4XI5D 2VT0A 4O2FB 3RPIB 3IAPA 5KAQG 3AUVA 2GEQA 4PG9A 4KHXH 2DBLH 5E0FA 4N2OA 2VSDA 2PUQT 2UXGA 3VI4F 4Z7QB 3BUPA 1GGTA 1CICC 4W68A 3FQWA 5EU3B 1H8OA 2ADJA 4MNQA 5TE6H 1J5IA 2XRAH 1N4XH 4G5AA 2J71A 4APQC 3KNBB 1AZBA 4WUUD 5DR5L 5I6XB 3A67H 2VQ4A 4MRBA 1AGEB 2ATPB 2D7MA 2F74A 2OFQA 4KGJA 4OBSA 9CGTA 4KKBC 4PV1C 3CSTA 2XBDA 3P9MA 1QSZA 1G7LA 1SYSB 4MA7L 1KGUA 1ZPLA 4YXHH 4OZIA 2R1YB 2OR9L 2R0WL 2DL9A 4JZJB 4O2CA 4XNYL 3L5JA 1N6QL 4HYTB 4CDHA 3VD1A 3QO0B 4NKMA 4X98A 5DD0L 1R0AL 5LXGH 3ULUD 3P4MA 1AZZC 2DQTH 5K9QI 4I77H 3ULVD 3BUIA 2E4TA 1XEDA 4ANVA 5I71B 4ZX4A 5KSAD 2FT8A 1R3HA 1K72A 1TMQA 1TG8A 2P9RA 4EE2A 2WLKA 3IEAA 3WNPA 4ELKB 4FQJL 5GGVH 1XCXA 3ZYOA 1JWUB 4M62H 3QIUA 4RGOL 4N0RA 3OPZL 2XWBA 4UTBA 5KVDE 3RB7A 3SYOA 1FRGH 5IGXH 1JRHH 4NQDB 4NZRL 3ATAA 3KLHD 5E6YA 1J88A 3RIKA 1NEPA 3UBFA 1RZ7L 4N0YL 4DJMA 1AKJA 2H2SD 4BFKA 3KWVA 3OKDB 1TQTA 4FQ2L 2R9HC 4DP0X 1BIIA 1R34A 1XZ0B 4M48H 4XVTL 3WUWB 3MJ7A 3NA4A 4W6XB 1ZT4B 4NYLA 3RWGB 3QIUC 3NGBB 2V8MA 5DJ0B 2YQ3A 1D6EA 3B7TA 3QC6X 5J6HB 4YHIB 3BYTA 2R69H 2XDHA 4ABUA 1RPUA 5C0CB 1D5RA 3O3BA 3K2IA 4MCMA 3UZVB 1P6AB 1JAEA 4GEJA 1YJDL 4DH2A 5LNGA 1OVZA 3VXTA 2E59A 5I1HL 3H9SA 1UZ6E 1AHMA 1HWGB 1K6QH 4NSKA 2C9PA 4M43H 2OI9B 3U82B 4JS7A 1B9ZA 1RK1B 4PJ8D 4ZOBA 3MBEB 4NO0A 3T8VA 3U2JA 1XBRA 4PWJA 4PGEB 5D5MA 1NGPH 5E9DE 5E1IA 2OMTB 4Y16D 5A2CA 1NFDA 1AYOA 4ZXBC 4D8PA 1GJUA 3N04A 1CLYH 2C1OB 5ABAA 3V7AE 3BP4A 1UA6L 3UC0L 1QBBA 5BO0D 4GG6A 4FN0A 5C0BA 5B4MC 3O3AA 2NW3A 1NFIA 4Q7DA 2XWXA 5GRJH 4HWBL 4W6YB 1LO0H 2P7TB 5LCVA 3J07A 1X5IA 1N0XL 3F7VA 1QFPA 4U1SB 3GSQA 3OGCA 1ADQH 3GUTB 3HS0B 3VQ1C 1ZVHA 4Z6AT 2J5LB 3L9RA 1BVOA 1XCQB 4K7PX 3RRQA 5KZCB 4UUJB 3ILPB 5IEKA 1WJ3A 1ZMYA 4JY6B 4EQ2A 3LKPB 3X1FA 2QLVB 4BKTC 2Y25A 5L0QB 5PAZA 4MD5A 3LPPA 4FS0A 5L8KB 2CALA 2I32A 2QVKA 3WBDA 4W9IC 2HG0A 3BIKB 3WJLC 3X12A 1UOVA 2VERN 3BAKA 3LH2H 3MFFA 3UTTB 4PJAA 1Q72H 3CZFB 1XT5A 2XIIA 2BWQA 4QRRE 5DO8A 1YNLL 1TDQA 2CHXA 2ZAHA 4WI4A 4WTQA 4UOW0 3MLUL 4TUJA 3HR6A 4PJDB 5A40E 4OJDH 2NQDA 1NMAH 4R6UA 3L1GA 4H88H 3KPQB 3BT2L 1ITCA 4OD1H 4FQHA 4YUEH 4JRXA 1MFBL 3TLRA 5CO1A 3QDMB 4DZ8A 1NUFA 3L7EB 1ZHNB 1HTYA 2ROYA 3H54A 3S5YA 2ICWA 3F7RA 4JRYD 4ES8A 3SBPA 3TVMD 3SKOA 3UPCA 5JW4N 3PWPB 4WFHE 3ZTNH 4BELD 4X80L 1BD2E 2X12A 1PZCA 2PYFA 4GMTH 2DQGH 2FX8H 1G7HB 3PQYD 3QPXL 3U2IA 2VM3A 3P0VL 4YFDB 2JI2A 4NZFA 5DTFA 2IALB 2WYIA 3BKJH 1O7DC 5I8EB 4HJJL 4MCZA 2X4NA 5AD0B 4TNFA 2OCJA 5JA9A 4UDUB 3DSNA 4HJUA 1G7QB 4JY5H 1F42A 1WAAE 4NZTH 3TH4T 1BYPA 5AENA 1YCSA 1UYWL 1NBYA 2ZOWA 5BUGA 4JGMA 5KYXA 1DLHA 1T7WA 1TJHH 4V1DA 3FW6A 2G9HA 3LB6C 2VAJA 1MAMH 3LVTA 2WN3A 5C97A 3P1VA 2K78A 2F58L 1KFAL 4TRPH 3WN5B 3SZKC 5MP6H 3ZZ1A 2WO2B 1ODAA 4WV1B 2OSYA 4X4XB 3AQDA 4RQQB 3U2SA 4HUVA 5IMLB 4WUUE 2NQCA 2VXTL 3QZWG 1FSKB 4A2MA 4JO3H 2JKXA 3CLWA 3QQDB 3M1CA 5T5FL 2O5YH 1YMMB 3P3TA 3OAZK 4YDJA 1Z7JA 1I8UA 2CO6B 3C60A 1C7SA 4HOZA 1NC4B 3BWZA 1L9PA 1EO5A 3GMQA 4PJCE 4PJHA 4R9HA 3NCJH 5JMRA 1KACB 4HHGA 1E4HA 2FWOA 5AB1A 2FO4A 5T1LD 4D3CH 1BBDH 5C0JA 5CP3A 3C12A 3ULUE 3P9LA 4W9CC 3SCMA 1Z9SB 1GSKA 4UQAA 4ONHB 1I1FA 3ZUNC 4K0OA 3FQYA 2GBUA 4GJTB 1JOIA 1RK0B 3QIWB 1UCBL 5D6DA 3UH8A 2I9LB 1S7XA 1EGJA 2G2RA 1DVQA 1DR9A 2AXGB 5JORB 2AHIA 2DN7A 2PXYD 4LSVH 4ZUUA 4ALAL 3SCMC 1QACA 2AV7A 4G8GE 2IVFC 4TVUA 3M45A 1ZANL 3IB4A 3NIDB 3SOTA 3OKKA 4MX7A 2GFBB 5SWSA 2MRYA 5B38B 1W91A 5D6DC 5C07D 1MCFA 3U46A 2MCPH 1FHNA 1MFMA 3FCTB 3LRKA 1I8MB 2R0KL 1O5PA 4WI6A 5E8NB 2CIIB 3LN5B 3EGDA 3BP6A 4HJSA 1EZUA 2FJGB 5A7EA 2I69A 3JUYA 3P4OA 3D4CA 4EAEA 1QRKA 3LDBC 3WELA 1BFOA 3OJ2C 3OMIB 3FOMB 4IRSD 1NCNA 1JD7A 1P84K 2DH3A 4HT1L 2LQRA 3GNML 4UOZA 5CCKH 2DKUA 5C08B 2L4OA 4AYDC 2YPKB 4TNEA 1N10A 1A8JH 3PL6C 4YDKH 2ALWA 4OLUH 5F8RC 4IDJH 4UTBH 3W39A 1L0QA 4PRPB 2XQYA 2C1PA 1V10A 3QZMA 4NPKA 2XG5A 4L29B 2B59A 5KANI 2Z31C 3GHBH 3JVFC 4L4TD 1OV8A 2BHFA 4NZJA 1QNZH 4KTDH 4G11A 4GUCA 1SVBA 2X28A 1MSPA 5F7LB 4UTAH 1JTOA 1KPUA 3T77A 2YEQA 4IDLA 3N40F 3ME0A 5MENA 5AYUH 3IFPA 4KWUA 4XB8A 4E41D 3LZLA 3QJFA 2CCLA 3DIFB 1NWOA 5FB8B 4NZ8A 2E7LC 1FJ1B 4WHDA 2AFNA 2LW3A 5MEPA 4CNIA 4HD9A 4ZFFA 3FB5A 4X5PA 1SVCP 2OM5A 2ZZUT 5I6NA 1PZ2A 3KL5A 4OGZA 3I3BA 5DMIH 2NDGA 1O9VA 1VF5C 4NQEE 3AB0B 1RJZA 4KJPD 4NPJA 1T5WA 5BVJB 2CM6A 1G94A 4HQQL 4B5EA 4J3OC 2VUOA 1XB6A 3RL2A 3US0A 4P2OA 2MWCA 2BP8B 1FGVH 5DFVC 1FNAA 4RMRA 5I1CL 3QORD 2AKRA 3C6LA 3LNHA 2XN9D 1BQUA 2DQFA 2OPCA 3G6JF 3LH8A 3V6ZA 3ZN6A 1C12B 5HHOA 1X44A 2PO6B 4XNDA 1HXMB 1WUNT 5I2IB 4P2CG 3WGUB 3D3VA 3NPZB 4MNGE 2ED9A 4P2OC 4JM0A 5LCVH 4Y5VB 1NCBH 1A66A 2ESVD 1JNHA 4O51A 3C6LC 4K23H 4MQ7A 3OAZH 1TEYA 3ZW3A 4WJG3 4OGAC 3QG6A 2QVMA 5CJOL 2QADB 4W9EC 2GJ6D 2ADYA 4XHJC 2VL4A 4JQIA 1WP6A 2ENJA 3MXWL 3CN0A 3STLA 4AKOA 4MMYB 2PCFB 4G8EB 2PNDA 2ZCHL 3VFRA 4HGKC 4LCCB 3SYQA 4GXVL 3EG9A 3QNXA 5DJ6B 3EJUA 2WB1A 3ZZLA 4AGNA 4PJBB 2R27A 5FYJH 4OI8A 4ERSL 2ZOLA 4RZCA 4Z77A 2XWTB 4UQCA 3MOBL 3D06A 4ZS7H 4B7IA 3H55A 4W9GC 1D9KB 3DXAD 1TQCB 1CVSC 4D0DA 5A2BA 2NY3C 2YRBA 5CCGE 1PYWB 3ABLB 3CZJA 2BS9A 3VFTA 1LP9F 3T0EC 3D4ZA 3F12B 4F9PA 4QLRA 3HN3A 3GGWB 4DGUA 2XN2A 3WO3B 4AYSA 2YWZA 3GKWH 3L2NA 3CFDB 4GW5A 4U1NA 1HHJA 4DKAA 2ZKXA 1C1EH 4QRTB 1CICD 2X4SB 1FH2A 3HC3L 1WEJH 4WAFA 3U6XS 5DZ9A 1YEKH 1THCA 1I1AD 2AV1A 1XL6A 3BAYA 4KKBD 1QR1B 1DQTA 5IB3B 4ZAKB 1H6FA 2HVKA 1OTTD 1H3UA 3H0TA 2P5EA 2P46B 4OJYA 1KPVA 2F53B 2QLYA 2OMZB 3D34A 3VI3F 5TK2A 3LPOA 5HGAB 1MCSA 3ZE0F 3D0VA 2EDWA 2DH2A 5DD5L 3SGEH 2WBKA 2JFCA 3FN9A 3VYPA 5GS1A 2IG2H 4WUKL 2VAAA 1KENH 1XTMA 5D7HA 3BWAA 4LMQE 3QP3A 1G7JB 4YQXL 1FPTH 4F2MA 1XB8A 1CBVH 4KY1H 4NUGH 3ZE2F 3NH7H 4KVCL 5KJ4A 1E5ZA 1KB9K 1TQUA 4JO4H 5DMKA 3O81A 3MJ9L 4J7RA 1Z9OA 5C09B 3H6AA 4UT6A 3IETA 5KSUB 3SKUD 1JS4A 5GS1C 3NP4A 1KCVH 2MSPA 5I30L 3NJFA 1XCWA 5IFJB 3CK0H 1NM9A 4FHJA 3WE6B 4K2UH 4F7CB 3N85L 3HAEA 4HHAA 4ODBD 5AFAA 1TTUA 3GSXB 1T5XB 1Z3RA 2Y06H 4L8BB 4GKZA 2R9HD 3MRKB 2IOOA 3CVHL 5HI4C 3QCVH 4ATTA 2JKNA 2Y6TE 2Z7UA 4HKBB 4I0PB 3FFCB 3QIUD 5E6SB 1A4JB 4JFHE 2ATKA 2FX7H 3LV3B 2J1XA 5B7FA 1FL3A 1ASPA 1FE8H 4X9BA 1LEKB 4D9LH 2ADFL 3DX4A 1A22B 2MOQA 3GMPB 4L3EE 5E1AB 4AQ1B 2OTPA 2NPLX 5SWZB 2VM9A 1XCTA 4L0ZA 1DEEB 2XA8H 4TNVF 3ZZSA 1X9QA 2P5WE 1UQSA 3RWEB 4EF3A 3MREB 1NCJA 2DWTA 4M1DH 2H32A 5I8KL 3APCA 1LQBC 4LKXA 3JUZA 3FU5A 5IESH 3QWOA 2FECI 4G9FA 4TLTA 5AVUB 4UYQA 1V5JA 3I85A 1A47A 1K4CA 4L4TE 5IVOA 4KJWD 3V0DA 4ZDHB 5HGBB 1JZDC 2JLLA 4Y8DC 1T2QH 1TMCB 5AVYB 1RL1A 1TETH 3H9SD 4P2RE 4XC1H 5EBWB 5IKCB 1KSRA 4B60A 2ED8A 3OL2A 5I76B 1UXSB 4JFQA 5I15L 3FONA 5B4MD 1ND0B 3QCTH 1P5UC 4OCRL 3Q1SL 4TSAL 2LGNA 3GSVB 3MJ8A 3E1ZA 4NO0D 4PGDA 2CZNA 1RZ8B 5BRZA 3DTXB 2JTDA 4RISH 4J3OG 4NPYA 4X2UA 4BV1A 5IUCA 4P2QB 4G6MH 2VDQH 3PWNA 1SM3H 1HHGA 3HNVL 4PG2A 3S96B 1UM4H 4JG1L 4BFGA 4LCWB 4ZYKB 5AW9B 5LVEA 3PYCA 3IT8D 2GUOB 4WNQB 4XB3A 4HKZB 1BQLH 1WC7B 1WQVT 2Y5TB 2RBLA 2WVUA 1R1CA 3LIUA 1QKZH 4JL2A 5EU7C 2XN9E 1VEPA 4YHLL 3ZSTA 3H1ZA 3QYNA 3CDFA 1HN1A 4FMKA 1S9YA 5IJKA 2UY6B 3RX9A 5M94B 3NABL 4OZHE 1G84A 5T1DL 1MN4A 2G3ZA 4AIOA 3VXUE 5HTSA 2DM2A 1Y6KR 4J3OH 1A1NA 5L6YH 3I6GA 4GQPH 5I1AB 4Y4FB 3K71B 3CVIL 4LLMB 5FLVA 1MCCA 2WK2A 4QTHA 2W9LA 3VNZA 3QQ9C 4PJ9B 2PPAA 3CWGA 5IJKC 3NFSL 4ZO9A 4UM8B 3VXQA 3DYPA 3IKCA 1DUYA 4GUPB 5G4MA 5B21A 1KN4H 3BRFA 3GSUB 4ZOCA 2NTFB 1TQBC 4QXUL 1AMYA 4Z3FA 4XBEH 3BH8B 2QELA 5J1AB 1VB9A 2E6JA 4LCYB 2XX1A 4KXCA 4FG4A 2LLNA 2XBZA 4QT5A 3RTQA 4GFXA 1OGTB 4HFUH 4XN2A 3B34A 1KG0A 3VCLA 2AABH 3S6CA 4F7PA 1I85A 2JB5L 2E75C 1OCCB 5J8OA 3BAIA 2JJSC 4EUPA 4XPAH 2BC4B 3E3QC 2KKQA 5GHWH 2VLKB 2XTJB 2CLRB 3LS5H 4GW1A 2CUHA 1DUZA 1YECL 3G6JA 4R7DA 5GSVA 4XO5A 4FA7B 4MXWL 3IU3A 2XKUA 1F58H 4MJ4A 3P3SA 3SD2A 4X5XA 1J0IA 1XGYL 5SX4I 4MA1B 4GQ9H 1XGTA 4WEBL 1Y07A 5DD3L 1A14H 4TV3A 4XOEA 2CDGA 4XNXL 2VIRB 4M5TA 2EC9U 5CN2A 1LO5A 1C5CH 1YEJL 2AGJH 3GBNH 4QHNA 4J27A 3DMMA 4PJIB 4V1DD 3FUIA 5IK3B 2HTLD 2YGQA 4OH2A 3TJEH 2J25A 1M6OB 5FHBH 1F6LL 2R83A 3L3DA 4J6IA 5FF6B 4MZ2A 4WK2B 3VMPA 3I02B 2R2HB 1SF3A 1E28B 1Q0YL 4MNQE 4PRHB 4XNQA 3EFDH 2A6IA 2OCCB 4FKHA 4J8QA 4CMMA 4O9HH 4HCGA 3DMMC 3PP3K 3VXPB 1N8ZB 4NI6A 4RGMB 3QCUH 5K39B 1JZ2A 1XIWA 2XZQL 3PAZA 1JWSA 4OZIE 2LV4A 3W0WB 5BV7L 3C5ZA 2RTTA 3N1QC 4OIIH 2MQ3A 5D2LE 4F27A 1PVHA 4QUOA 3WFCH 4L8CB 2CA4A 4LASL 1OSZA 1A7OH 2IXQB 2YKLH 5IQ9B 3BZFB 4N8VB 3LNEA 2OYMA 4X4MA 2CKBL 2D0HA 4M6ML 1MF2L 4EI5B 3SCMD 2Q7NA 1A7NL 4S0TD 3MJGX 5HPMB 3JVGC 1BYOA 2AQSA 1XIWC 1YYLH 4U6HB 1A7RL 3C5ZC 5DYOA 3ZVVA 4S2SB 1YNKL 4Z7UF 2ZXGA 2R7EA 5F7DA 5C0GA 2ZUTA 4AL8L 1DN0A 5DVNA 1M9SA 4QXGH 5E6ZA 3GSOB 4URTB 1TZOA 4GG8B 5D2NB 3MRMA 3GMNA 2NMSA 5DK0A 5I0YA 2WVSA 1EFXA 3QDGB 4BWUA 2HT2C 1KYFA 2YQBA 3FRPA 3RAJL 3SN6N 3MLWL 4LNVA 3K6FA 4YDVB 5H94B 1NC2A 5SWSD 4JPKH 4Q2ZA 5GS0C 5C3IA 5LKNA 3IGAA 3JYCA 4GRLB 2JWYA 2GKIA 4RFEB 3S2CA 4PWKA 1MHPL 5D1ZI 1GOFA 4GAGH 1U8OA 4D2NA 1JI1A 3WKPA 2M2DA 2BCKB 2ZWNA 4EIBA 1J1XL 32C2B 1EVTC 2DQUL 4JANB 3UAAA 5CD3B 3BAEL 4KI5F 4OFIA 3OR7A 1FLRL 4PHXA 2E9JA 3WFBH 4OQ1A 3NA9H 1LDSA 1YEDB 2CQVA 2Z31D 3TWCL 1JGDB 4AMKL 5FOBB 4P23A 4G7VH 4PN6A 2ICES 4EDWL 4M6AA 1DBJH 2BOBB 1XBDA 3H9SE 4U6XA 5D55A 4YL9A 5LGYA 3FRUB 2N0KA 1MFVA 3FU7B 1WK0A 2B9BA 1A1OB 3GS7A 5TF1H 3UZQB 5JOFB 1GCFA 3AM8A 2UZPA 5JO5B 3V0IA 3ZO9A 3BX7C 4NEHB 2GI0A 5KANG 5TQ2L 2X4RB 4M7LT 4U1GB 2YMTA 1ZHBA 2Y9RT 2DWEB 3VQLA 3SDAB 2OL3A 3KS0H 4X4KA 5D5ME 3TV3H 4P07A 1AOHA 4YPJA 1E8XA 3VH8A 1MRFH 2W65B 1WHOA 2WAHA 3MBXH 4N9GB 3BKYH 1IT9L 4GG6E 5EN3A 3A4EA 3TESA 3BCFA 5C0BE 3AM8C 5LBSL 1OALA 3LZFH 4OF3A 1MRDH 2DLTA 4A7VA 2DQIH 4HULB 5MEND 4Q9QL 3DOIA 4IS6A 4J3OD 3DJZA 1YRKA 3QRBA 4ZOEA 5F9WC 4PJEB 1RFDH 4P4KC 5DFVD 1BZOA 3ETBF 1ZTXH 5CIPA 1Q9KB 3QEQA 1XF3A 5IG7B 5D6CA 3MV7A 5BCAA 3TO2B 4QRQB 1SBSH 2ZUQB 1ZVSA 4GW4B 4TOYH 2WXFA 4ONFH 3DGDA 3PREA 4K3DH 4QJ5B 1T1YB 1OGAB 5T8IA 4JY4B 3SBRA 4AQZA 4P2OD 4U0RC 5AAPA 1E67A 1NEUA 1KXHA 1T6WA 4UV4L 4QRAA 3S34L 3C6LD 3VU2A 4B0MM 1OE1A 4A2DA 2ZUWA 1TVDA 4DPBX 4OGAD 5HHOD 1IEBB 2IWKA 4XMVA 3QZNA 3GIZH 4V11A 3PIQA 4PBWD 5CHNB 5E4EC 2AEQL 2HRLA 3D3VD 5BZWA 3DBXA 5BXFA 1M3JA 3CN3A 4OFYA 1MW0A 3BKMH 3PP3H 3SJVE 3SO3C 3FQUA 1B9KA 1LEGA 5KJRL 2K70A 2J8HA 3L6FA 3Q7JA 4WDIB 1LDPH 1AXSB 1KTCA 2NXZB 2ODHA 4PRIA 4JRXE 2BSRB 4YLQT 1U4FA 3NJJA 3UROR 1J0YA 2VQ1B 3X3GH 1H5BA 1ACZA 3B2PA 4X6CF 3AS0A 5CZVL 5IIEA 2YPLA 4KFZC 4E68A 2XXGA 1WLHA 2ZUSA 5HHPA 3DVGA 5T1MB 1ZTMA 2CK2A 4HPOL 5FW8A 4CVZB 2WUCH 2DZEA 1OZTG 1B0RB 2PPDA 1T0NA 2NY3D 3C5SA 4N2GA 1V7ML 4WWNA 4NNYA 3T0ED 3GXIA 4IU2B 5EEXA 3O45B 3GSNB 1JF1A 2P8PB 1XD0A 1ZKAA 3JV6A 2P44B 3P73A 4J3WA 4M93B 1U4EA 3FULA 1H5BC 4KKLD 2XZCL 2D31A 3BPOC 2FQGA 1U3HA 4H0GA 4YFLF 1R24A 1KPRB 4MD0B 3EHBB 1YEEH 3N2JA 2GT9B 3WYRA 4MJIE 1X7TA 2MNWA 2BY3A 3DUUA 4V1DE 3V7AG 3VFVB 1WWBX 1DQDH 5JXAL 1DQJA 1P69B 1IAII 2C3HA 4U1IA 4TXVB 1CIUA 5B39G 5LB1A 3C9NA 5T3ZH 3IDGA 4XNZB 2OBGA 3FN0H 3AT0A 1S7SA 1T7VA 1U8HA 1XSJA 2XWEA 4ILDA 3G6AB 4PWFA 1QQDA 3BO8A 3U0PB 2E6QA 3L9YA 1PIGA 3PS6A 2XKNB 1MCBA 1PD1A 3DRQB 5GRYA 3T0WA 5B3NA 5EEZA 2W07A 3UTSD 3V9EA 4K71B 1GCYA 2P5ED 2Z91A 1CLZH 4HV8A 1HKLL 1UFGA 4PJHE 5IHUH 4C4BA 5EOQH 5GJTL 3ZR6A 2IGLA 2D03H 3EJCA 3MRLA 2MH4A 4FNLL 2O93L 4W9DC 2Q76A 3BLBA 2ZXAA 4RFOH 2Z1KA 3W5NA 1CT8B 2F1EA 4BSWB 3AWEA 3VG9C 4LSTH 3S36H 3HHRB 2HH0L 1F3JB 3FTGB 3WSQH 1SHWA 5KVEH 1Z5LA 4KTEL 4DP7X 4Z7QF 5HI4D 5AAMA 1T3FA 5D72L 3Q06A 2ICWJ 3A6BL 4DP5X 4FFTA 3VI4E 4NKDA 3IF1B 4X42A 1WFJA 4U4IA 5LWYH 4ZMWA 2GBVA 1NCUA 1P84J 3UBHA 2ZYSA 3CFNA 4OLZH 5DVPA 3ZMEA 3D85B 4JPWL 4V33A 4NCC2 1RIVL 5AAMC 2YO3A 3TYGH 1GS7A 2OYKA 2HJFA 1QFUL 4HD5A 4DK6A 4FTVD 1G1YA 4YMPA 2Z6FA 3GMLB 4G7SB 3ZKXC 2BFVL 3S4SB 1RIUL 6FABH 2YOAA 4OJCA 2QSCH 2X9ZA 1UXWB 4LLVB 3DWTA 5GS0H 3VGAB 1G87A 1SDYA 4JO5A 3CFTA 3F6LA 3HZVB 2VRKA 3C5XA 1JZGA 1VFBB 1UJTA 3QWQB 3TO4C 1PZ3A 4W4OA 4NXKA 3HE6B 2W94A 4J8RA 3D25B 4Q6IA 4Z7UA 2PN5A 1M3IA 1OGSA 5DA4A 4HETA 5ETUA 3EADA 3GJEA 4U1LB 4KZCA 3ARSA 5CEXB 3QFDA 4PGCB 3FB6A 4PP2A 3QQ3A 3HNSH 4G6KH 1A5FH 2VMFA 3GI9L 1QSFE 3QRLA 5C2BL 1YVLA 3OMNB 4DGIL 4PYGA 7PCYA 4Q58C 3WNNA 4W4OC 3MV8A 3D18A 1U21A 1UWGL 2V3DA 1NIDA 4XCEA 3EH4B 2ZKYA 3IJHB 5ID1B 2F08A 2VM4A 2CKBA 5JIKA 1P4IH 4OBRA 1B0WA 4E2OA 2A6KB 1UJ3A 1V3LA 4RAHA 5CUSL 5B22A 1FYTA 1BWMA 5BRZD 2UZYA 4JW3A 1GSMA 2ALAA 3WO4C 4DAGL 3X14B 4E42B 4QPEA 4FABH 3SDDB 4J4PC 2YUZA 3AAZA 2RH0A 2EDTA 4MZIA 2CRMA 1F4WH 3AREC 2V6HA 5FGSA 4R3SB 3C09C 3JWNC 4XOCA 4NRZB 2R4RL 2QV2A 3RP1A 1DJGA 2Q20A 4ZW3A 5FYLL 2DMBA 4FFZH 5GJSH 4NUJA 1TKWA 4G42B 1UJ3C 3CSYA 1AGBB 5I82A 3M8OH 1T1XB 4B9GA 4Q97A 1AOZA 2OL3H 4EMZA 3MA9H 1BVZA 1TR7A 4ZZKA 1WBZB 1ZV2A 2UZXA 4PCSA 2A1WL 1SN0A 4YSPA 5HHNB 5HHOE 5IZ7A 1A64A 3QFJA 1KBPA 3QQ9D 1QRNB 4TVPH 4KO9A 4ZUSB 3TXAA 1DCLA 5FM8A 4B0MB 2PW2B 4U1JB 3D3VE 4CILA 3E2HC 2KI6A 3PLYA 3S48A 3K5RA 3BMVA 4P0DA 1IGYA 4LDLB 3DHMA 2PWEA 5B8CB 1L0XA 3NDZE 3UCQA 5KOMC 2ICEB 2X3CA 5GIRB 3ARVA 3VXMA 4HJTA 2R29L 4OJFL 2EO9A 2WC7A 2ARJA 4YX2L 3RHWF 3RZCA 1OOAA 1WGVA 1JF6A 3KPRA 4Y16C 3WY1A 3T2NL 1TVBB 1KIRA 3MR9B 4JGJA 2KZKA 4B96A 2W0FA 1IL1B 1BAFL 3I50H 4PY7B 4LVEA 4IGBB 1JHKH 2DIEA 3CH1B 1X4XA 2DEXX 2V0AA 2WXRA 4IRJA 5EULV 1RQ5A 2DPKA 3LNGA 3LPGA 1CB4A 4ZFOL 1AQHA 1YY8B 3RZCC 5GRUH 3L3OA 2QEJA 3VFGH 1DJWA 2Z92B 4ZMVA 2QPSA 1E4XI 4XP9L 3UABA 5DEZA 4P9ML 5H37A 1G43A 3HFML 4FYRA 1A6PA 2V5RA 4IMLB 5LBSA 1DVXA 1W0VA 2VZUA 1H9VA 3PWJB 3FSOA 4TTGA 4L1TA 3O3EB 3TASA 4PJDF 2WIIB 3QEHB 1PBYA 2OXGB 3T71A 5B7MA 2CU9A 1QO3A 3G08B 2J57A 1RZIB 1LNUA 2FATH 1EDHA 2ITDB 2Q8BH 1JNLL 4OLXH 1I8LA 2EE3A 5KSBB 3L3OC 1EA9C 4UMGA 1KCRH 1J8HE 2WAQA 3NCMA 5F9JA 4PJ5D 1YUKB 1ED3A 4HK3N 4MQXC 4RSVA 4A6YH 5I26A 3VWKC 3IJ9A 2O5ZL 4FYQA 4JFVA 3VXRA 2OMYB 2PYEE 1TU2B 2Q2LA 3S3SA 1NCHA 1QW8A 4HIEA 5BS0E 3DMMD 1QBML 3OKOB 4OLVH 4YGAB 2EIEA 1B4TA 4G3YH 5E2TH 1FZKB 1T21B 5LHDA 1EO8L 5D8JH 5FXCH 3X11A 2P5EE 1R19A 1S7RB 1R17A 1KB9J 2H9GA 25C8L 4ANWA 3OX8A 3IMBA 1YEWA 1DJYA 4KZEH 1BM7A 4DW2L 1B4RA 1N7ML 2PKDA 3GIVA 4M6NH 4JKKA 2AJSH 3FO2A 4LGPB 4B9IA 5SX4H 3LKSA 4CU8A 5EEYA 3CAFA 2HLAB 3IPBA 5E24E 4F2ME 1QEWB 1QFWI 3TN0B 3ZBMA 4U4BA 1WA1X 1E9OA 5FM4A 5IT2L 1UTDA 3DRTA 2HG5B 1GW6A 3TV8A 1XIWD 4NO5B 2AJZB 4BZYA 4J3XA 1QLEB 3C5ZD 2FTAA 4JJ5B 5ESQA 5C2UB 3GS0A 1PW3A 4R5VA 1I3VA 5B1KA 1YQVH 4UIKL 1QWUA 5DZVA 2NY7L 3UGXA 3TA3C 4XAKE 3QH3A 5HDLA 2NY5C 5EOTB 2EIZA 4J3UA 3DO7B 3HZKA 1JBJA 2N7SA 3L45A 4CGTA 1E4WH 4DQAA 3BPLC 1JGEB 3KJ6L 3DX8A 1WBYA 5DMJB 5EC2A 5FUOH 3CVCA 4F9LC 3QC5X 1ZSHA 4R0LB 5GS0D 2W9DL 4GMSH 1MCJA 3D4YA 5CILH 1IKNA 5I1GH 1FORL 5F2FA 4G6JL 5HHXL 1PIFA 4UU9B 4FMVA 4KO7A 4KJQD 2E7HA 3I2CL 1EFXD 4H8QA 1FIGH 1ZPUA 4XH2A 1LE5A 3KPSB 1F4XH 2B4CL 1TTCA 1ID5I 1UUNA 5LGHH 2XWDA 1MCQA 4LAQH 4RSYA 2G9KA 1R9FA 4HC1L 1AQKL 2XZAL 2XIBA 3ZL2A 4W9ZA 5LGKA 5DS8A 4HFWB 1N12A 1WS8A 2X40A 1WUZA 1X4ZA 2X6AA 4O2FA 3RPIA 1CFTB 5FYKD 5LBVA 1GYAA 2BINA 2VABA 2NW2B 4G9FE 4S1SL 3IE4A 3OAWA 2VH5L 3RWDB 2VMJA 1MCHA 1GGCL 3NIDF 1VZIA 2VDMB 3MRNA 3MCLL 2YA2A 2FBJH 1AGEA 2ATPA 4I4WB 4QOKB 1J5DA 3FQ2A 3HG2A 1SYSA 4HUKB 2CO7B 2B16A 5CXPA 4JZNB 2C4XA 5DJCA 4L0YA 1Q94B 4JZJA 2FZ3B 3QHZH 4GY4A 3JWNG 5BRZE 2DM3A 3H2QA 2Y7QA 1YZZA 1LO4L 2Q3ZA 3LXBA 2RACA 2Y6SC 3FTWA 2HRPL 2XI9A 5HHMB 3I74A 4JKNA 2HJLB 4H5SB 5HYSB 1YYML 1GH7A 1IQDB 4ELKA 1KWGA 2AQ2A 3QJVB 5DZJA 2A4CA 2CJUH 4K5NA 5ES4B 1UM6H 2Z8RA 3FUDA 5DURD 1IFRA 1JCVA 1JWUA 3P4NB 4PGJA 3Q6GL 1ZGLB 3ZRSA 1E6OH 2BNRD 2BOCB 5IBUB 5E9NA 3MLVL 3VG0H 4C83A 4XE0A 4QO1A 5JPNB 3QEQD 4NQDA 2EQDA 3STBA 1MZZA 4R8WL 3TF4A 3MV7D 4X6BB 4JHAH 1FFRA 4YSTA 5F1OB 3OKDA 3ZQWA 4FLHA 3JWNH 4FERA 1XZ0A 2COVD 4G7RB 1DFXA 4DPRA 1RZJL 2FVNA 7TAAA 1EWHA 3BSZA 3RWGA 2C7UB 4IU3B 2VKXA 3OKLA 2WYHA 1JZ7A 5DJ0A 4UT7H 3GO1H 4YHIA 5I23A 2EDRA 2V8LA 5D7JC 2HKHL 1HEZB 4KKZA 1ID2A 3PAYA 2BHUA 3BZDA 5C0CA 1RIHH 5T5NG 5F9AC 5C7XL 1BVNP 4TNWK 3OZLA 1QHPA 2ED6A 3UZVA 4Y1AB 1GGIL 4YO0B 2OJZH 2X4PB 3THMH 2CXKA 1CURA 4OFYD 4OCWH 2LTQB 3GINA 2E8ZA 3G5VB 5T3XD 4M03A 2ADGA 1NCDL 3U9UA 4DWHA 5FC9A 4GQQA 4X9FA 2VDOL 5EIVA 2A6DB 5IWLA 3A4DA 4CN6A 1RK1A 1JPFB 4QRFA 4A2LA 3MBEA 4I48B 1NIAA 4HUNB 4PM1A 5SWQA 1NCWL 4X0NA 3ROLA 2BVUA 3G6JE 3DETC 4FL4C 2OMTA 2FL5A 2P45B 4XVJH 3M17A 3KCWA 4FG0A 4AKQA 3BRDA 5D7LD 4IK7A 4FHBD 2GBAA 3LPFA 2IF7A 5GZOA 5DXWA 3GT6A 2Q86A 2WOBA 3OF6D 5IWLC 3N1GC 4P2YA 3D87B 1NEZB 2LABA 2NY0D 4QHUA 2CMRL 1DQLL 2I5YL 4XO8A 3N55A 3GJFB 3ILDA 4U1SA 5JNYB 1B90A 3HPJB 2YXFA 4I8DA 4MVBC 2EDBA 1FL6B 1BSIA 3HS0A 3GUTA 5HYJB 4KQ3H 2ZCLH 3QQ4B 3IFNH 3OAUH 1JTTA 1XCQA 4AJYV 1KZYA 4UUJA 3ILPA 1JGUL 1NBVH 3ZDZB 4JY6A 5GZOC 3LKPA 5L8JB 1MNUH 2JCWA 1P0SE 3BGAA 4QD2E 3VX0A 4PJBF 3EAKA 5D96C 1DBMH 5CM1A 3BIKA 5HJBA 3VFWA 3O2WL 4ONOA 3T65B 3UTPD 3NFPB 3UTTA 4OFKA 4ANUA 4RGNB 3RILA 4L9LB 2UYLA 3PFUA 4AYMC 1LP9E 3F00A 5MI0B 3O6ML 4PJDA 2AEIT 4L5FH 3BUYB 4WJKB 1CFQB 4WFFE 4X4ME 3TH2T 3CDCA 2VMDA 3IDIB 3QDAA 1QTSA 1OF2A 2IGFL 2XX0A 4X6DB 4ADGA 4IIQC 3KYKH 4H1LG 4ANXA 1P7QB 3QDMA 3QJQB 5FDWB 1E5YA 4XMZA 1ZHNA 5C0IB 4ZPTA 4YNYB 1NM4A 1QA9A 5DJAB 2OK0L 3B2VL 3PWPA 2Y72A 2WGXA 5EORH 5A2JH 1ETZB 5FGCE 1BECA 2F5AL 2VDKB 3ML9A 2NX5D 2QKIC 3HRZC 1H3PL 4AXWB 1ORQA 4N8UA 4B9FA 3MLTA 2IALA 2NY5H 3ZE0E 2QQNH 2CGZA 3ILQC 2AEPH 4R97B 3MZTA 5I8EA 1NLDL 1FNSL 4AQEB 3LXCA 4XX5A 1G7QA 5IB5A 4O02B 3TBSA 5I73C 3MRCA 1CDCA 1MAJA 3Q8AA 1DBAH 1GIGH 5C9JB 3VD9A 2E9GA 1NINA 3KBEA 3LKQB 5FUZL 1NGYB 3ZE2E 2HJKB 1V05A 5FYKE 2G2NA 5JLZB 3DBSA 3F58L 5DUPL 5F0PB 4NFDA 3DJ9A 3DLQR 2HFGH 1B88A 5KYNA 3WN5A 2ARJQ 3X13A 1SMDA 1AIFA 1JGIA 3OWEA 4WV1A 3BWUF 4X4XA 1SQMA 2GSIB 1EXUA 2BY1A 2K8MA 5GGSB 5IMLA 2C9UA 5DUBA 1VFAB 2ZX6A 3UG5A 1U6AH 5HDOA 2H3KA 2DQEH 3GMRB 3QQDA 2DJMA 3SOBL 3VSQA 5LG6A 1YMMA 4ONGL 2EZ0C 4A39A 1NC4A 4M56A 3JZ7A 4AQ8C 4WV1C 4HLZG 3ZTDC 4M1CD 1LILA 4HCRH 2WQXA 5DJ8A 5KJ7E 2EDQA 5LQBL 1Z3GL 2VDRB 4H25B 4R4FH 1KBBA 1Z9SA 3HHSB 4RRPG 4J4PD 2OW6A 1YAZA 4JDVB 3FT9A 2YA1A 4KXDA 1PNDA 4ZTPH 1GY2A 3GZQA 2EUWA 3MV8D 2K1MA 4HWUA 3QIWA 5IVZA 5E94B 1CDYA 4IIZA 2I9LA 3VTAA 4HBCH 3VSTA 5B3SB 4F57L 1MWOA 3CSPA 1ZHKB 2AXGA 3NTCH 5BVPL 3H56A 5JORA 4EXKA 2VR9A 4H44C 1PSKH 1FYTD 3BDYH 2RMNA 1U2YA 3SDYL 3MV7E 3NRQA 2XG4B 3OHXC 4TKWA 4DOHB 3EOBA 1ZLUK 5JW3H 3TONA 3QIWC 4KXAA 1IILE 1OPGH 1I8MA 2G0KA 3FCTA 3BP7B 1KGWA 4LVHC 4DEUA 2BOLA 5E8NA 1LD9B 2JXMB 1F18A 2YRLA 4HUXB 4UTCA 1O6SB 2ZPKH 1MJ8L 2DBJA 2IIJA 3IJ8A 3IJEB 3VVVA 3T2LA 3QFJD 3RGVC 1EMTH 3FOMA 3VA2C 5FM5M 1BXAA 3QO1B 2A38A 5EOCL 1UB5A 1T5KA 4L37B 4CSSA 4D8OA 3QUXB 1GS6X 2YPKA 4XVSH 5BJTB 4NN5B 4HXAH 1DDTA 1U8JB 3EH3B 1GHFH 2EYRB 3BDXA 4WQOA 5T3XE 5KVGH 3DURA 4PRPA 3VXMD 2IFFL 4PRIE 1UA3A 4L29A 3RZCD 3LOWA 4PJ8B 3GZKA 2MOGA 1I7TA 2YPLE 1T2JA 5KSAC 2VO5A 2GI7A 3GBEA 4HKXB 1A7PH 2K8QA 3LRGA 4ZFGL 4KMTL 2EIBA 2WQUA 1NCTA 4CUCA 3BSZH 3FFDB 1H6TA 3KM1A 1IFGA 3U9WA 5FHAL 3KYNB 3DDFA 4IRJD 1MCRA 3BZ5A 3O4LE 5E6IC 1OO2A 1X6LA 3DIFA 3IMTA 5CCHE 2NZ1A 4LLWB 2B77A 3V4PH 2XY1A 4MQXD 3VWKD 3Q43A 1ES0A 3O6FC 3OPUA 1CR9L 4OZFB 3S5LG 5I17B 2IFGA 3LRHA 1A3RH 4PVLA 3K81A 1XD1A 3RIAK 4B9CA 1N5YL 2ERJB 2DM4A 5BVJA 4GINA 5I18H 3BESR 2WLYA 4OFVA 3NSJA 4L3AA 5K9JH 2BP8A 2B0SH 3DX0A 5FA4B 1AR2A 5AOIA 2JJWA 1KEGH 3Q5YA 3VXRD 1MQKH 2APSA 3RU8L 2TSBA 1Z66A 4YWGH 2PTUA 3UTPE 1C12A 2PO6A 1N5AB 1HXMA 1P5VA 4LBEA 4GIOA 5E2VH 4AQAB 2AQQA 3P77B 1TQVA 3MA7B 4PB9H 4QHLB 1BPLB 5EC1A 4N2NA 2E9BA 5EO9A 5DQ9A 1PGRB 1KJ2B 3ZKNC 1F6AB 1XSKA 1AD9A 35C8H 4AGOA 3DX6B 1XTLA 3EZJB 12E8L 3QXUA 3T09A 2KPNA 3TA3D 3MACL 2C9RA 2XFGB 3IWVA 2M83A 5ANME 4F8OA 4PJIF 2GB2A 2HRGA 5F7EH 5BO1H 3KD4A 3BT0A 3CLFH 3ZOAA 2PP7A 1JZHA 1NJ9B 4OM0L 4G7YL 2I27N 2YD3A 5C0NC 1AY1L 1M71B 3GM0A 4JRYB 1C16B 1SOKA 4JO2H 2VE6A 3IU4H 4L2LA 1GPOL 4XZUA 2J55A 5I16B 5I0WA 2IMNA 3CXDL 2VZOA 3I6KB 4O58H 4WTXA 4PAZA 1FA4A 3PQYB 3VW3H 4N28A 1IC5H 2LT9A 4PBDA 4UCFA 4PJBA 2X4TB 3WEBA 1QLRB 5CBAB 5HYFA 2E86A 3E6FB 5BZZA 4FQIH 5EUOB 5DT1H 5C0AE 1D9KA 5I74B 4X6FB 1CTMA 1PYWA 1QFWH 3ZHKA 3WEXB 2Q8AH 1LK3L 4CC4A 3CBJB 3GRWL 5D7SH 3N42B 1QHOA 1ZLUH 1BJ8A 2KZ1B 4QRSB 3GGWA 4UB0H 4XBMA 5HDRA 4ZODA 2EICA 1U8IB 3K1DA 4EPSA 3CFDA 4ELMA 4YBLB 5T33L 1MXDA 5KSVB 1KGYE 4HS8L 4Q6YA 4QRTA 1EH9A 1GZQB 1ODUA 1Z2KA 5E8DL 3MOAH 4KDWA 4XO3A 3KWWB 1Q8MA 1MOEA 1LM8V 3TH3T 2YXWA 3CFMA 1JD9A 4KZDH 3ARBC 3DO4A 3WGVB 4FCHA 3O41B 2W9EH 3DOSB 1QBLL 4YDIH 1QR1A 4XCYA 1NBZB 4ZAKA 1FCCA 4G8FB 5IB3A 1ROWA 5DA0B 2HPOA 4Z7UE 4AEEA 2F53A 4NT6B 2OMZA 1WV7T 5FCSH 5HGAA 4JGUA 3SQBB 2BHZA 1BAWA 4FYSA 5T1LB 1I4FB 5KWYC 1ONQA 3NDYE 4RMSA 1G7JA 2Y6SD 1JZ8A 3BW9B 3MUY1 3S2AA 4I2XB 1T0PB 4GT7A 3UYPB 4X7FC 3MVSA 3KPOB 4OCSL 4JG9A 3B3IB 5GS2H 4OD3H 5C09A 4NN7B 4KVPA 5KSUA 4G8IB 1DDHB 1ACXA 5CEZH 1FC2D 2PXYB 3ABGA 2XPYA 3MN8A 4ZO6A 4UINL 5TFSH 1G7PB 4KI5E 3D48R 1J8KA 1Q38A 5AB2A 4YHPB 4X9HA 1JZ6A 4F7CA 2D9QB 3VFNB 5AL0A 3Q3GB 3GSXA 2YFOA 1A3QA 1T5XA 1A6VL 1PLGH 2WTPA 5C07B 1DN2A 4L8BA 4U7KA 3KLAB 3PDGA 3NN8A 2IQ9H 3NPSC 4HKBA 4FLOA 4I0PA 3Q01A 1A4JA 4PJ7B 4JHWH 5CLYA 4DP8X 3S3PA 1WFNA 2DWYA 4NQDD 3CE1A 3QFJE 1LEKA 4DVBB 1QTPA 1CS6A 5E1AA 4AQ1A 5A6IA 3Q1EA 4WKXA 5SWZA 3OKMB 3HI5H 1RCYA 3PGFH 1HH9B 3FMGL 4FLQA 3DPBB 5FIEA 3UIZA 4QF1A 2KQNA 1UWXK 2X3BA 3MREA 4O5LL 4PJEF 1JGVH 1E9QB 2CE6A 3LHPL 1J0HA 3APFA 5DWPA 5D1QC 3KPRE 4N0FA 4N0UB 1SJMA 3VGDA 3UZEA 2EACA 2WO4A 4WO0A 3BZ4A 4ZDHA 5HGBA 1C08B 3Q6FB 4JFEE 4EVNB 4MAUL 3LIZL 2DDQH 3B56A 3CLEH 5EBWA 2FX9H 5IKCA 5I76A 3CHPA 3ZL4L 3OQRA 1UXSA 4WCYL 2EH8H 2OMUA 1R5WB 5MEQA 1ND0A 4E41B 4RX4A 3UP1A 1RLBA 2MJWA 2P5PA 2WKOA 3L3GB 4PRNB 1WFMA 1RZ8A 1UADC 1UZ8B 6CGTA 2YPVH 4OY9A 3DTXA 2RD0A 5FKAB 3EYSL 3JWOL 4UBDC 4AY0A 4D7PA 1RZGB 3LPWA 4JN1L 3WXVH 4P2QA 4MVBD 1D5MB 3OMAB 2YSSB 5EFIA 1OSYA 3O6KL 1UB6B 3EXJA 2OSLA 2EDKA 1HWWA 3RURA 2CD0A 4P59H 3VWJA 4LL9A 4LCWA 4ZYKA 1AP2B 3EH1A 1AR1C 2GUOA 4WNQA 5ACMA 3S35L 5GZOD 4HKZA 4EBQH 1T4KB 1WC7A 1AHWA 4ADIA 4RDQG 3NCWA 3VXRE 3QORB 2BMKB 3ESUF 2A4ZA 2Z7ZA 2CLVB 4HF5L 3C2SA 3HB3B 2X89A 2H5UA 4X6CE 2MNUA 2V17L 4KO6A 5KZCD 3VWJC 2OR9H 2HWZL 2R0WH 5E0QA 1BMZA 1MEXL 3PP4L 1XF4B 4XNYH 1AHWC 5I1AA 4LVNB 3SYCA 3K71A 2ESVB 4LLMA 3REVA 3UAJA 4PJ9A 4IK6A 1UWEL 4GS7B 1RURL 1PKQA 1S8DA 3QYCA 4UM8A 5EA0H 2GJ6B 2UXVA 2Z93B 3UTTD 3HI6H 3QUKB 3GSUA 1WS7A 4FQJH 4XMLL 4WNJA 4GI9A 1CE6B 2BP5M 3BH8A 5GGTL 5J1AA 1BIHA 3NACH 1KIUB 1OW0A 3CZSA 1KCUL 5E8PA 2JI1A 4LCYA 2OP4H 3QXDB 5DGRA 4JBSA 4NHCH 2WZPA 1OGTA 3CVBA 1UGNA 3MAWA 4MJJA 1OD7A 4BZ1L 2PPEA 1M1XB 4NZRH 4KAQH 1E6JH 3ILQD 1RZ7H 2X38A 5FECB 4JHVA 2BC4A 3QDMD 5C9KA 2VLKA 4XC3L 1IV8A 4LRNH 2CLRA 3E8VA 3DXAB 2DTML 4ZNCD 2DOCA 3OC8A 3PWPD 4PIBA 4XPFL 2XVKA 3F6JA 4M1GL 1IC4H 3GSWB 1OSPL 3U83A 4HZ1A 2DMHA 4FYTA 2B1AL 5FKPA 3MUJA 4LAJH 2H6PB 1CICB 4OVUA 3KGUA 3FCUB 5E00B 4WI0A 4APQB 5J56B 4ZMPA 5CLTA 4PJIA 4WGKA 3WIHA 1EUTA 5I1HH 3C5JB 4PVNA 4YHKH 3PV7A 1BQHG 5DJYA 3VRLF 4ZX6A 2V5SA 5DRNB 2EZ0D 5KBKA 3B5HA 2PW1B 1HNYA 2X7LB 5GS2D 3KVDD 4Z7QE 3QZWB 5FF6A 2YAEA 3CPLB 2R2HA 4HW6A 4DZBA 4PRHA 5CEZD 4MA8L 5AZ2H 1PU0A 4FQLH 4LPUA 4XBGA 3GLAA 4MZRA 5I0DA 3VXPA 1N8ZA 2NNAB 5K39A 2G2PA 3P9MB 3ECBA 2FIKB 3I9GH 2AQRA 4E9YA 1HL4A 4LFHD 3HZMA 4YPGA 4HWBH 5C6TH 4ATWA 4L8CA 4GUQA 2DF3A 2AI0L 5IHBA 4XE5B 3CZLA 5IQ9A 3BZFA 4N8VA 4BUQA 4GO9A 1E2WA 1A9VA 2F9BT 3F05A 5HPMA 3RG1C 3UGUA 2QSVA 1OAUH 4HIJA 1JF5A 5DEFA 1NH6A 4I18C 1M56B 2YFNA 4M5ZL 4U6HA 3AU0A 5D71H 3GXDA 4S2SA 3QIWD 5I5RA 4A67A 1SY6L 1E9PB 3OXSB 3L5XL 4OF7A 4NDMB 5IBTH 4AIZB 1IAOB 1AANA 2CGRH 5I6PA 3QIUB 3CN2A 3GSOA 2XWRA 4GG8A 5I1KL 3CQQA 5AVXB 4NQDE 2XYBA 3CPUA 1CF1A 4FQCL 1JZ4A 3L17A 4NKIL 2C4FT 2XWZA 4UNTA 4YDVA 2VGLM 3RGVD 2H0PA 1OAXL 1JPSH 3GRWA 5I9QC 4WY7L 1CLCA 1YNLH 3MLRL 5CJ8A 5H35B 4GRLA 4H8WC 4RFEA 3K2UH 4JCWA 4YSQA 2BCKA 3TIEA 1D6EB 3U6XA 4MS8C 4AV0A 5CSGA 3U79A 32C2A 1FYHB 1RUKH 4LOEA 5CD3A 5C0CE 4AYGA 1XX9C 1ZA6B 5AW6B 1MFBH 2IDSA 1XGQA 1JGDA 5FOBA 3QR0A 4UIMB 4TQEH 1WZKA 4PUBH 5D93C 1WCQA 2BOBA 3GB7B 3FRUA 1KCBA 4X80H 4ZXBB 1FFTB 1A1OA 2CO3A 4X5QA 2AANA 2C3GA 5DRWB 3UZQA 5JOFA 3DECA 4PRPD 4R5TA 5JO5A 1HILB 2B15A 1R3LA 2GG1A 4LHUG 2X4RA 4HJJH 1KNOB 4U05A 4NO0B 2DWEA 4JO8A 5E4AA 1J5OH 3SYAA 3MNVA 2V2WB 3ARWA 1UYWH 2W65A 1NFDB 3O6FD 4N9GA 1RK7A 5HVHC 1SLXA 4YSEA 2FHBA 4EQ3A 3CH8A 5HPOA 4LVOC 3F85A 3GTNA 2NW3B 3NFNB 1NFIB 3FQXB 3MUHL 4YGVA 1GGBH 4PWIA 3DYMA 4XCCL 4PJEA 4LEOA 4OKDA 1CXIA 4WFED 4NGHH 1RJYB 5DQDL 1Q9KA 4DGVH 3UBXG 3N0PB 5TGBB 4M7JL 5IG7A 5FYLE 3EW3B 4Y2OB 3F84A 3TO2A 3Q2LA 4E5XG 5T5FH 1P1VA 4GW4A 3VQMA 1VPOH 3FAXA 4EI0A 4YSAA 5IEKB 1JNNL 2VW6A 4XVOA 3F7PC 2QGEA 1T1YA 5MHSD 1SXBA 3BE1H 3ZKND 2FEJA 2FJSA 3DVNA 5DSCA 5J11C 3PUCA 2R2BB 3C8KB 1MCDA 2LFEA 1L7TL 3ZT7A 2GK0A 3UTTE 1IEBA 4KDTA 1KDIA 3L48A 4PJAB 4X7CC 5CHNA 3HG0A 1UT9A 3OTTA 1UCBH 3QPKA 4N4YB 4FKEA 5CJXC 3TU6A 1ZGLP 4N0CC 5KSBF 1CU4H 4PJDE 2YAPA 2WLZA 2CR6A 1QLEL 2NNXA 4G9DB 2WXHA 5I1EL 1A6WH 1AXSA 3FHAA 4X4ZA 3ETTA 2Z34A 4W6WB 3QDME 2VQ1A 4LCIL 4FNUA 3L4TA 2XUWA 2ICWB 3PHAA 1IC7H 3PWPE 4CVZA 2JB6A 1FDLL 3QIBC 3AMLA 4PBXA 3SDXB 4WSGA 4B95C 4IU2A 3O45A 1AYRA 1MJUH 1RUQL 2FSDA 3GSNA 2P8PA 2MTPA 3L2LA 3INUH 4FFWD 4W93A 4TUKL 4BSVB 3GHPA 5HI5C 4JG0H 2X4NB 3EOTH 2VW7A 1HL8A 2Q7YB 4LPWA 3DSNB 2JKIS 2V5TA 2FO1A 4LRIA 4MKMA 5IW3A 3MUZ1 5IQOA 2EIMB 1BEYH 1DBKL 2AC0A 4MD0A 1ZVNA 1N68A 2GT9A 1VAHA 3ARBD 5AVWB 3KXFB 5LO7A 4XXDB 5L88L 2XV2A 1LGVA 3VFVA 1R47A 3HBZA 1FG2B 2JSFA 4JM2C 5JIHA 5G5DB 4I1NB 2ITCB 1HL5A 4MTMA 4NQSB 4JPVH 4LPCA 2X1WL 3ABKB 5DGQA 3U0PA 1DL7L 1OCWL 1M6UA 3EHBC 1OP9A 1ZDQA 1SHXA 4PLKD 3ZKMC 4F8PA 1LEIA 4UM9B 3DRQA 1YMME 3JQOB 3ATDA 2VDML 4PTUB 5HBBA 4YDJB 4ZAKD 1ZLSL 1J1OH 4LDOB 4LP4A 1JYXA 1N18A 1KGCD 4Z5RB 2CXGA 1JG9A 4ESKA 4LSUL 4OB5L 2EXTA 2DM7A 4R84A 4Y9EA 4YZFE 4YSRA 5A16A 4KK8C 4DN3L 5JW5B 4XP4L 4KBPA 4BK4A 4NJ9L 3SCMB 1EAOA 2YD9A 3VM7A 2GCYB 1T7YA 5GGTA 4UILL 1I1FB 4R5XA 4ZSOB 3WIHH 4BSWA 5BMFL 4YFLI 3FTGA 3JT0A 4KRMB 5CLXA 3K1KC 5FR3A 3P0YL 3JBG7 4FZ8L 1S7XB 1KT2B 5C09D 2X2IA 3GI8L 5F88B 4XP5L 4NNXB 3O9WC 5JYLA 4K8RC 2X1XR 3ARPA 1UKTA 2D7QA 2WV3A 3IF1A 1R4XA 3HJEA 4YDLC 3NIDE 3BQVA 3LDBB 3A23A 3OKKB 1FBIL 5KVDL 5SWSB 3P30H 1HWHB 3D85A 3E0GA 1IC1A 4LSRH 4YDZA 5TPWL 1JUFB 1LYQA 4PV9B 4DGYL 3QDHA 1DZ0A 4GXFA 3ECUA 1P7HL 4I0PD 3MTXA 3PL6B 1J9RA 1M7IB 2UZIL 3ZGHA 3GMLA 1T7XA 3HMWL 3AQYA 5BPPA 4KPHH 2EEXA 2DQDL 1SYVB 5D1QD 1YEIL 2Z31B 5SWZD 1RSYA 1UXWA 1FZOA 3G04B 3PNWB 4J6RL 3WNOA 5G55A 1PQZB 1TZ8A 5C08E 3WNJA 3HZVA 4H8WH 5BZDB 2VDQB 4AC2A 1VFBA 5D4QA 1UD2A 4PRPE 2XVGA 3FO1A 4XOBA 3D25A 3KGRA 4WNSA 2XG5B 3F62A 2WLJA 1J48A 2B59B 2ZG2A 5IY5B 4IQHA 4HCIA 3N6YA 5FO7A 2GYSA 5CEXA 4DVRL 1EAJA 4PGCA 1ZJAA 1WSST 4XPBL 4D7BA 2QKSA 4NIYE 3VFMB 4UBDD 5GPRA 3DGCR 4GKLA 4LHUD 3MUGA 1M42A 3O2VH 4FQXC 4DP4X 5IHZB 1PZBA 2UV3A 5F7NC 3IJHA 5ID1A 5MENB 2C9VA 5K9OB 1XZWA 1W72H 2XPGB 4RX4D 3VXOA 1AR1D 4EZMA 2GY5A 2BNQD 4WFEE 1N67A 3GBML 2Z8WC 4LU5H 1FZJB 1JPGB 4E42A 3X14A 2P8MA 2ETWA 1JK9B 2D7TL 3FB5B 1SY6A 4P2QD 3CFCL 3TBWB 2PP8A 4KXBA 3BFWA 1CF8L 4JM4L 1S5IH 4BKLB 4R3SA 1TVHA 4NRZA 5IREA 1WFTA 3ARDA 5BV7C 2VWEE 4PB0H 3VWJD 2LU3A 3RL2B 4G42A 5BQ7B 4ZUTB 3CHQA 4P2OB 5DD5H 1AGBA 1T1XA 4NC1E 3APDA 4YVUA 4X0KA 3C6LB 3QUMH 1WBZA 5HHNA 1DP0A 4OLWL 4YQXH 2X89D 4X8XA 1I7ZB 3L5WB 4I3GA 4XXCA 2VMEA 4ZUSA 2OV0A 2XETA 3ARDC 2VN6A 4F33A 1GOHA 2PW2A 2ZAGA 4U1JA 3OXRB 4FA6A 4AL8C 4TNGA 3QS3A 2WCGA 3KH4A 4YSUA 3GEWB 1IGFH 5B8CA 4AJ0A 4TSCL 2J21A 2ICEA 3QK0A 5GIRA 4KROC 1ZLEA 2V37A 3UAJD 5I30H 1I8IB 2W95A 1SHMA 2RCSL 3LAFA 1KJMA 3ES6A 3QG6B 4XXCC 3N85H 5EWIL 1DSWA 2BDNH 4K7PH 1TVBA 2VMCA 3T04D 3ZDZF 3MR9A 3P2TA 1KTBA 3CIAA 4GYBA 1IL1A 1QLFB 5AWNL 1MJ7L 1HX0A 4PY7A 1RZPA 4W9FC 3TF7C 2YAOA 2I7SA 1ADWA 2WLMA 4EJ1C 1NAKL 1EZLA 2NY3B 3CH1A 4I9WE 1QW9A 3P69A 1ZS2A 3T0EB 3VFRB 4HG4K 2CBTA 1T03L 1YY8A 3ARXA 3R0MA 1G4MA 2ZAIA 2Z92A 4PJBE 1I9JL 4ODTL 1CWVA 2EVGA 2VLKD 1BMGA 3GZPA 4PSRA 3FU6A 5A3IC 2RA1A 4GUOA 3MI6A 4W1TA 4Q0XL 2GSMB 4WW2C 2J4WL 3O3EA 3VFTB 5CR1A 3QEHA 2YD8A 2ITDA 1QPXA 4X6DF 2HMIC 1INEH 1CYGA 3UERA 4U1NB 4QHMB 4BQ9A 4QTIL 3VFUB 4F37F 3U0WL 2JKJA 2OMYA 4GIAA 1BZ9B 2DLGA 4IJTA 3OKOA 1HI6B 3AQZA 4QY8B 5EIIG 3SGJA 1FZKA 2NZIA 4AEIL 4JDTL 2W0LA 1T21A 3E8UH 5MERB 3UTSB 2HVKB 1S7RA 2F53E 1CGSH 4OR1A 5DLMH 4F93B 1ROCA 2DD8H 3LXAA 4P5KB 4YXLH 1UOLA 4PRHD 5GS1B 4R4ND 4FNPA 1T6BX 3D0AA 2PWGA 1KXTA 4MBOA 4N8CH 2HLAA 1QEWA 4QI3A 3SGJC 1VEMA 2EE9A 3LMJH 2E0PA 5FOJA 1BWWA 3QEGH 2HG5A 2YGVA 2VDRL 2N56A 4NO5A 2AJZA 3ULUL 3ULVL 5BRPA 5BQDA 5DMKB 1IFHH 2DQHL 2DMKA 3DUSB 5C09E 4BFBD 3KPTA 5E2UH 4AOFA 1YEHL 2P48B 2AJYH 5EOTA 5F6HI 4YHLH 3DO7A 2EO1A 4PR5B 4HHAB 4JUSA 1JGEA 1G0DA 5IQMA 5CINH 2VQTA 2BM3A 1NGQL 4XCFH 1DBBL 4R0LA 4UZGA 1MFDH 3SDCC 1SXNA 1UWFA 4GKZB 3H9ZA 2EYTA 3FBQA 1P6WA 6PCYA 3FFCE 1RZFL 2GTZB 2VNCA 3GK8L 4UU9A 4IRZL 3DJSA 2ATKB 4D0CB 4FTVB 5IVXB 1ACYH 2C7FA 3IRCA 4G71B 2ITEA 4MS8D 3ULVF 4K8RH 3KPSA 1RAMA 4FC3E 5SWZE 3K6NA 1PL3A 3U0TB 2VXUH 3N3EA 3D39A 1AE6L 1ORSA 3F3HA 1BREA 1Q0EA 4GRLD 1Z6JT 1X4YA 1YYCA 2ZTBA 4L48A 5K1JA 5I8CB 3BJLA 2FSEB 4WWKA 1CFTA 4RMQA 5ITFA 3W38A 2JB5H 1WD9A 4PH8A 1GW0A 3V8OA 1JTPA 5CGTA 3RWDA 1P5UB 2WLNA 1K4CB 2G60L 3KLKA 2EEFA 4OVVA 1MRCH 5D7IA 3VSUA 2YBRB 1AJ7H 1YECH 4QOKA 4I4WA 1F00I 2N7AA 3T8XB 4HOMA 1MCPL 4WWKC 1MFAL 2FGWL 1QG3A 1PG7X 4E9RA 2CO7A 1KEML 4JZNA 5LBGA 3EO9H 5DWUL 2ZCKL 3MZGB 4N5EC 1Q94A 1CE1L 3F01A 1WZ1L 2FZ3A 3BGFC 5IB4B 1M9WA 4XZ4A 5AW8B 5KVFH 2A74A 1BA9A 4KH2A 1MCKA 3GMOB 1GZPA 2APVA 5IQ7H 5EZLA 3L3IA 4PGDB 4Z95L 2VJXA 2ZJSL 4WTZA 4P2QE 4BCYA 3QUGA 5HYSA 2W91A 1HHGB 3RB5A 1BAGA 1F8TL 1K3IA 2VXVL 5FYJU 4KQ4L 1X5YA 2KQMA 4LCWE 2P4AB 4AMWA 1FH5L 1T83C 4P9HH 1I9RL 3SE6A 2A74C 4GXUN 3KW8A 5JIQA 3P4NA 1ZGLA 2AMUA 4BFIB 5ILTL 3U4EA 5FPIA 1U30A 3FTXA 2AXWA 5JPNA 2NY1C 1CQKA 3EBGA 4KQ0A 4X6BA 3L3KB 5DHVH 3SZ6A 3ETSA 4IMKA 4DN4H 4JFFD 4HEPG 5JDSB 4CC0A 5BV7H 3AG1B 1TQBB 1GA2A 4WVRA 4N0CD 2C7UA 4IU3A 4IKKA 4LASH 1EEYB 5F0JB 3PHOB 1U8NB 4N2AA 4AYID 1IRAY 2WLIB 1MF2H 1OWWA 2A2QT 4FXTA 4AK2A 3TFKD 1L6ZA 4XP6H 1KJ2L 2JI3A 4X83A 1F90L 1DUYB 2WZ0A 2OCFD 1A7RH 2IC2A 3K6DA 1ZLWK 3W9EB 1QSVA 2N4IA 3MLZH 4Y1AA 1N6VA 1XH3A 3AADB 2VITB 3TZVA 1H6EA 4AL8H 3II2A 4DKTA 2PR4H 2DQJH 1A2YB 1XSOA 2X4OB 5GRZA 1C8QA 1OAYH 4XB7A 3G5VA 3X3FH 5IMMB 1QPPA 5L4MA 3HC4H 4QRUA 5F1KC 4WI7A 4K9EL 2NXZD 1X3DA 2A6DA 1U8KA 5E7FA 1E50A 3WHE0 4KHXL 2DBLL 4I48A 4CKVX 1IO4C 2VLKE 5A2FA 2XTJE 2QQLH 1RKRA 4P57B 3TZVC 4LF3B 1TQSA 2RGSA 2B39A 2VDNH 3IU3B 2LTQC 3FTVA 5TE6L 4CC1A 1N4XL 2FWUA 4X5XB 1WIUA 3A67L 5TDNA 1XGTB 4BRVA 4A04A 1FLRH 4ZO7A 1NEZA 4FQ1L 1MFCH 2CDGB 4PJ5B 4YXHL 2VUYA 3VAEA 1UKSA 1LO5B 2BNUA 2ZXCA 3AY2A 3HPJA 5CF3A 3SY0B 3EHBD 4PJIE 5B39B 3QQ4A 3ZKMD 3T4AA 5C8JB 4BK5C 1CGUA 3V4UH 4TUUA 5LXGL 4IBQA 5DQJB 3S7GA 3BVXA 4I77L 4XXWA 4DKEH 2EE0A 2HSIA 1EXGA 2HXAA 3L3DB 4F8NA 5ICYB 3G5XB 2G75B 4PRHE 3QNYB 4K9JA 3F7QA 4A2HA 2A6IB 4N3TA 3S37X 43C9A 4FA8A 4KK8D 3NSCA 5EUOF 5FUCC 1CPUA 3T4AC 4M62L 3T65A 3X17A 2VC2L 2CO2A 3NFPA 3VFOB 1NLBL 4NCC1 1XIWB 4J1UB 3N42F 1FRGL 1CLOH 5HHVL 3W0WE 4PTTB 1IM3D 1G6RA 1JRHL 3C5ZB 3CDGB 3FHEA 3NQKA 4BXVA 3I9AA 4OUUB 3II3A 5AL8A 4IBTA 2H2PD 3BUYA 1CFQA 3RE0A 2RFXB 5TE7L 3AC0A 4X6DA 2F15A 4K8RD 4XAWH 2VLME 4R7LA 4XMUA 2MTAA 3IBEA 1CGYA 1MCLA 1YEFL 5DYOB 5C0IA 3TURA 4YNYA 2R69L 1E4KA 3BFOA 5DJAA 1JFQH 5F7DB 2Y3NA 5C0GB 1TTAA 3UDWC 1KTDB 3IK2A 4NAQA 2YD0A 5D2NE 1EEZA 3MLYH 5ABDE 4AXWA 3ZX1A 4Q89A 3MRMB 3GMNB 3D69A 3QDGE 3S34H 2DEYX 2HKFH 2ZWLT 5H2BA 1AXTH 1LHZA 1Q9WB 2A83A 2VN4A 1A6ZA 4RCAA 4AQEA 1MI5D 4S11A 5CGMA 4Y88A 1LJMA 1DSYA 3S0PA 4O02A 1XWVA 4Q2ZB 2FQEA 3D85D 2CBOA 3CQPA 5EU6D 5A2LH 5IROC 5C9JA 3LKQA 1NGYA 2AAAA 2AERT 3OVUB 2HJKA 2ZKHL 5JLZA 5KJRH 1NGPL 4Z3GA 4F8TA 1QAWA 4J39A 3TPUA 1F3DH 3ZKSD 5E8OA 1CLYL 1G7IB 3BPCB 3VQ2C 5CZVH 3FQTB 3VXSD 1B4LA 4KRNA 3UO1L 1VFAA 5GRJL 1BFVH 2R59A 4PJFB 3ULAB 3DVFA 3GMRA 4HPOH 4ABWA 1ZWIB 1NMBH 3V0FA 5JQ6H 4PJ7F 1EHLH 1V7MH 5I66B 1OIOA 1ADQL 2YD4A 4LCVA 2XV0A 3TP4A 4AG4H 4Y5YA 4TL5A 1DANT 5DFTA 5DMYA 4Q9BA 3O11B 5F9WB 2XZCH 3RHWK 4P4KB 2OL3B 1EJ8A 5C86A 3LS4H 3WNLA 3HHSA 4EEEA 3WE1A 4MB5A 3A22A 4JDVA 1G9EA 1CXKA 2ZSVA 5HDQH 1NFKA 2O30A 2BERA 5E94A 4FFYA 4Y5YC 3J8F7 3RKDC 1DVFB 1EQWA 4MYPA 1A3LL 3K2MC 3GTVA 3TX4A 4OW6A 4PJEE 1Q72L 3LHAA 4ZD3H 3FT4A 2BNRB 4U0RB 2WKLA 2IAMC 4DP1X