2XJKA

Monomeric human cu,zn superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folding Catalysis by Transient Coordination of Zn2+ to the Cu Ligands of the Als-Associated Enzyme Cu/Zn Superoxide Dismutase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 36
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2xjkA00
2WYZA 2WZ0A 3QQDB 3ECVA 4A7GA 3GTVA 2WKOA 1SRDA 2AQRA 3KM1A 2C9SA 2GBVA 2ZOWA 1OZUA 1PTZA 4U4IA 1EJ8A 2V0AA 2AQPA 4FF9A 1U3NA 5KBKA 1XTMA 5KBLA 4OH2A 1OALA 3H2QA 1OZTG 2Z7YA 3L9YA 3L9EA 1SPDA 2K4WA 1E9OB 3GZQA 5KBMA 2E46A 2VR7A 1AZVA 4L05A 1YSOA 2WYTA 1IBBA 1L3NA 1BZOA 3HFFA 3S0PA 4MCMA 3SODB 1ESOA 4A7UA 1HL4A 1IBFA 3RE0A 1EQWA 1CBJA 3CQPA 3ECUA 3CQQA 1RK7A 1SDYA 2ZKWA 4BD4A 3KBFA 1SXNA 3HOGA 2C9VA 2WWOA 2AQSA 3KH4A 2LU5A 1JK9A 1F1DA 1JCVA 3KBEA 3PU7A 1MFMA 3QQDA 2APSA 3GZOA 1XSOA 1F1AA 2E47A 4BCZA 1IB5A 1SXAA 3HW7A 1XTLA 1E9QB 1Q0EA 1JK9B 1B4LA 2C9UA 1IBDA 1UXLA 3MKGA 2AF2A 2XJKA 4BCYA 2JLPA 3CE1A 2Q2LA 2WWNA 4A7QA 2SODB 1DO5A 2VR8A 2Z7WA 1YAZA 1QUPA 2VR6A 1FUNA 1SXCA 1F18A 1F1GA 4A7TA 3K91A 3ECWA 3MNDA 1COBA 1PU0A 4N3UA 3H2PA 5CU9A 1N19A 1TO4A 2JCWA 2ZKYA 2GBUA 1E9OA 1SDAB 3GQFA 4A7VA 4OJAA 2WZ6A 1TO5A 1SXBA 3F7KA 1BA9A 1HL5A 2Z7ZA 4B3EA 1N18A 1E9QA 2Z7UA 3LTVA 2XJLA 2AEOA 1PZSA 1UXMA 3KH3A 4N3TA 2ZKXA 1KMGA 3T5WA 1OAJA 4A7SA 1DSWA 2WZ5A 2GBTA 1SXSA 2WKOF 1S4IA 1E9PA 2NNXA 4MCNA 1OEZW 1YAIA 3KM2A 4A7GF 1IBHA 1Z9PA 1B4TA 2R27A 1P1VA 3GTTA 2AQNA 1Z9NA 3F7LA 1SXZA 2AQTA 3GZPA 1E9PB 2AQQA 1CB4A 1SOSA
chains in the Genus database with same CATH superfamily
1XGUB 3KYKH 2IAMD 1DBMH 1SRDA 2KERA 4PGJA 2N0KA 1TJMA 3DO3A 4QDGA 2GAZB 3KZ8A 3SJVA 4UIKH 4PIRF 4H26A 4U4BA 5ENWA 5JIKA 2ADJA 3WKPA 3SQBA 3T8XB 3GLDA 4UMSA 1NAMH 4YSCA 1OTTC 4JFDA 1RVFH 1A7RH 1C5BL 1VEMA 2E27H 1I7UB 4FEMA 4OZIA 3QZWA 1CFQA 3GZQA 4QOKB 2RIKA 1GJUA 4XH2B 4BRVA 3FCSA 3N91A 4F58L 4NC1C 2JKXA 5GGRA 1HL9A 4F3FA 2QLYA 1UM6H 4ZUWB 1CGSL 3S98A 4XPBH 4ZFFA 3V5DA 4KQ4L 3VTMA 2JQZA 1QSEA 3INUH 1ECZA 5DRWB 1A7NH 1SXNA 5JLZA 2E9WA 3HMXL 4TTGA 1OTTD 4NQXB 3VMOA 1E4XI 5FLUA 1Q0XH 2DBJA 1L5GA 2Q76B 5FGBA 3BVNB 3AJ7A 3LKPB 3GBDA 1HZHH 3PP4L 4O00A 4GQ9L 3EFFB 4X6DB 3CWGA 4WEMB 5D96C 3IJSA 2VH5L 4JM4L 2ZUVA 4QKXB 4NC2B 1V7NL 4GKSA 1R3IL 4NJAL 4FTVA 4QHLB 3I02A 1F4YH 1KB9J 3T0AA 3ZL4H 1PFOA 3INOA 4OW6A 3VQMA 4NRYA 1TQTA 3OHXC 3QA3B 4OF5A 4A7TA 1E6JH 2Z35B 4G6JL 3H7BB 1TZIA 3WHXB 3PFUA 1MIEL 5HHNA 4YDMA 3PDDA 4GQQA 4HXBH 1DJXA 3BD3A 2YMOA 4FQQB 1AR1B 4HS6B 3B9VA 4MA3A 3QWRA 3N1GC 3O2VH 3CFEA 2DWSA 4HCRA 4KAQL 3DX6B 1Z7JA 5JO5B 3V7AE 4JFHE 2IALA 4M48L 3O9WC 4MZ3A 3T4AC 2FR4B 4WSGA 3N0PB 2JI1A 2P7TA 5KVEL 3MGOB 2YN3A 1P1ZB 1YUKB 4K2UL 3X1BA 2I9LA 2JH2A 4ZS6C 1U8KB 4GSXA 4HUWA 3N2JA 3CZNA 3Q5YA 3RY6C 2PO6A 5SX4I 3VXUD 4XP6H 4M6MH 1NFDB 3CBJB 5C07A 2DIJA 1THAA 4Z7WA 2V3EA 4HJ0D 4KKBC 1R5WA 1LNUB 4PWJA 1D3CA 1G7LA 2CLZA 1TQBB 2CJTA 3QI9B 3FPYA 1ZPUA 3MOQA 3NIDF 4JM2D 4LIQE 5E2JA 1XIWB 3WSQH 1UXWA 3HBGA 5F9JA 5D1QC 4RGMB 1XAUA 3O3UN 4XN5A 3T0DA 1UT9A 4JCMA 2XFXB 4OCXH 5KOMC 1IKNC 1I8IB 1UA7A 1PYWB 3DMMA 5FM4A 4F7TB 1JCKA 3SOBH 3DX7A 5DLLA 2R9HD 3IDUA 5CGYC 4GO6B 1TITA 4G8GE 4QMEA 5I9QC 4UTBA 1Y0LB 3RZCA 1TQUA 1XF4B 1TEFA 4OUUA 3MRRB 2VLKA 2BSDA 4F7MB 4YHOH 3WEMA 5I2IA 1ZSDA 1Z9LA 2R2HB 3G6AB 3PIQB 5F7DA 2GK2A 3OD3A 2ZNWA 1BVKA 5E2UH 1MCLA 2AXJA 2FD6H 1OK8A 2WV3A 3QQDA 4PTTB 1BZ8A 3LXCA 2EDLA 5C09B 5D1QE 3RVUD 3L3GA 3C6LB 1IB5A 2NY0D 1BMGA 1G9HA 1KC5H 3V7MA 3PHQB 2IMMA 1HSBB 1J5OL 2C9UA 2F74A 1B0WA 4RIRB 3PWJA 3KD4A 3EJTA 2E7HA 3KLQA 1H8NA 1TQVA 5DEFB 1N6UA 2C8NA 4WRLA 3CFUA 1WV7T 2GAZA 1XIWA 2MIZA 3ARZA 4I2XE 2VLLB 3JWOL 4LOFA 1UT2A 4IDLA 5GRZA 3PV7A 3HFML 3BW9A 5KVFH 3MRIB 2PYFA 1WFOA 3GSVA 3Q8CA 4OB5L 3DOSB 1LNUA 1J9RA 1GC1C 1UB5A 3GQFA 1BIIA 3GSOA 2ZUQC 2PABA 1UFUA 5DHXB 2J72A 4OGYH 1SN5A 3G5YA 4NQQA 2WXHA 1GW6A 2R4SL 1A2YB 3BCFA 3G9VA 1IO4C 4AJWA 3MREA 5KVFE 1UD4A 1J8HD 2NZ9C 2OXHB 2P3YA 35C8H 4K94L 4PV8B 5F6IC 3X1NA 3WNMA 4W9DC 2Q8AL 4NPJA 4C56D 3D4YA 3BVWA 3ZE2E 3V0HA 4BFNA 1IGTA 5KYUB 1XIWD 3OJVC 4NUMA 5FO7B 5J0BA 4NWTH 3O3DA 3KR3H 2GBTA 1X7QB 1EGJA 2WWMC 4L4TE 3ULUE 2BNQE 2GIXA 3AY4C 3RKDD 2K6WA 3NJKA 3ZTJH 4ENED 2ZT9C 4LLMA 3K6OA 1JXFA 1Q72H 2A6DB 1YNTA 3MV7E 3ZT7A 2R2BB 1ZWIB 5GHWH 3C5SB 1BM3H 2YJQA 2EUXA 2CRYA 1N2RA 3CXDL 4ACTA 2BNRA 3NPSB 1B0GA 2CRZA 3QDGE 3GSQA 2P8LB 5H94A 2Y24A 2V8LA 4WEBH 1NANI 4YHOL 5EUOA 1F3JB 2ICEB 3NJNA 2WQUA 3QORB 4KY1H 2P43B 1DDTA 4PGDA 5L2KD 4PGCB 1KY7A 4FQPA 4P5RA 4KMLB 1GTFA 1AR1D 4XNUH 1FL3B 1IM3B 4KFMA 2OTPA 4XXDA 1EXHA 3F5WA 3FSVA 3WY2A 1QKZH 2CKBL 2QGDA 2VL4A 3HAEH 2O5NA 4G8FA 4JFZL 1WGOA 1ZVHA 2UZXA 1L4IA 3LNFA 2C3VA 1E0OB 4WI0A 1TJGH 3BSHA 5I17A 1XCTB 5D2NB 3SE3C 2YZ8A 3IXTB 5E94B 2AEPL 2YEZA 3ETBF 3N1PC 4I3RL 1CBVH 2A4CA 4N0UB 1SVCP 1NEPA 2WJ7A 3X14A 4KJWC 4N0YH 3QDMA 4Y9EA 5F1NA 4U1LA 1OSEA 3LQZB 3S34H 1N26A 1Z9MA 3L3OC 4OTXL 1O7DE 2Z91A 3NRFA 1GSMA 1U8MB 3JVFC 2JJSC 4JG0H 2BIHA 3HN3A 4JVPA 3QYNA 3P73A 3TF4A 5C09E 2ZSWA 1IT9H 5BMFL 4EVNB 3OR6A 1XGUA 5IWLC 5ANMB 2Q0ZX 1IEHA 2OCJA 5HHPB 3F64A 5J06A 5CO1A 1PU0A 1JPFB 4YZFF 5ICUA 2OMTA 4TVPH 1SBSH 2IG2H 2F2HA 2DKUA 2MMXA 2IPKA 3V4PA 2ESVB 1WWCA 5ISZA 5TTRA 4FFTA 5D5MB 5TK2A 4EO5A 3RY5A 3QR1A 4G5ZH 5DJ8A 1AXSA 4B3EA 1ITBB 2R9HC 4FG2A 1XBDA 2G2RA 2HB0A 5FYJH 5D6CA 5IVZB 1OP3H 2J8UE 4LKXA 5IVXF 2F1AA 1INDL 4OI7A 5K1NA 1GS7A 3FCBA 3VGDA 4DN4H 3F7VA 4PG9A 2Y5TB 3FQYA 3BAEH 4I7ZC 1ZEAL 4KO9A 4QOKE 5TH2B 1DQQB 1FG2A 2QPUA 3GBEA 5SX5K 2B1AL 1WISA 5FYJE 5J13B 2B2XH 3D85B 3S37H 3UAEA 2IBGA 1JGLL 1NPNA 3KPNB 1M9WA 4JDEB 4OSUH 4Z0XB 4F7EA 2Y2TA 1WO2A 1BAFH 4NQDB 1H6EA 5CJQL 3C6EA 4PAZA 5D5MA 3S36X 1U9KA 1UD6A 1E30A 3L7FA 4ENEC 3WHE0 1PZ5A 3FC8A 4UAOC 2P8PA 4KPHH 3S4SB 4A2GA 1VESA 1MFUA 2Y06L 4G82A 1S7VA 4WENB 3D9AL 5A2LH 2AQRA 3T3PB 4Z7WF 1AP2B 3BN9C 4RAUA 2HG5A 3CZJA 1QASA 5F21B 2F0CA 3TEZA 1Z66A 4MSWB 2P5ED 4P46A 3E6HB 2Y1YA 4Z5RA 5JYLA 5J11C 1KXQA 4FFWC 3T9WA 1CU4L 4QY8A 3E2HC 3OKNB 4YHIA 4J3VA 1JZJA 1KULA 4JZNB 2WYTA 1CGSH 2E6QA 2KHAA 4MJJA 2CE6A 3ZTNH 5F88A 4JL2A 4CSZA 3ECBA 4DZBB 1ESOA 1WUZA 5C2BL 4Z7AA 3TCTA 3QJQB 4AYMC 3MO1B 2V9UA 2WLIB 2XWZA 4JZNA 3LQMA 2Z34A 1RU9H 4OSUL 5FYJD 1KJ2H 3PL6A 5ID0B 1XSIA 2V2XB 3KGTA 5AAMA 1SOQA 4M02A 3OAZK 1A1OB 3UO8B 5IEKB 4JG1L 1DQQA 1FG2B 2YARA 3CG8A 3GEWB 4FFZA 3U2IA 5C3IA 1PIFA 4FFVC 5DXWA 4P23D 2EECA 1JD7A 1Q0EA 3CZLA 4TVPD 4Z7VE 4AEEA 1KIQB 5ITBH 2CK0L 2AF2A 5KUKA 4P05A 2GJJA 3CU1A 4AYEC 5EHFA 2Z8RA 1DLHB 3SE9L 3K4AA 2EIZB 4G5ZL 4XCCH 3CAFA 3L7EB 2BO0A 5KW9L 4GI9A 2RR3A 1N70A 3QQXA 1SFDA 4OQTH 3O0LA 5DJ6A 1IAIL 3EFDL 1WDAA 4BFGA 4FQXB 4Z77B 2WO2B 2GSGA 5AVUB 3H53A 3BAEL 4EN3D 3MJGX 2BINA 4AXWA 4WWOA 4FS0A 3K2IA 3CSBA 4ZUSA 2HMID 1YPZB 2VKXA 2FATL 5D7KD 3RIAF 2NY1B 3QRLA 3GIZH 1YNKH 4XRCA 2FYYA 3X17A 2YXVA 2BVOA 2X5PA 4XP6L 1KG0A 3IDXL 3R19A 5J5EA 3VQ1C 3P0VL 1OSYA 1SYVA 3BQUA 4I0PB 1UEMA 1P7BA 1T89A 4M29A 5DHYA 1TMQA 1UVQA 1K6QL 1XH0A 4ZPVB 1PBYA 2L4OA 3WJMB 1YAIA 3NYKA 1AOZA 3SE9H 2AJZB 1R0AH 1EZLA 2HN7A 2NSMA 3BRGC 1H0DA 3LKSB 3EG9A 1NAKH 2R2HA 3V6FB 1XGTA 4J6RL 5JA8B 2MQCA 5CN1A 3P73B 4IKIA 4EN3A 1NBVH 5ICXB 3K0WA 5I8EB 3NZSA 1ODAA 2EEDA 1WC7B 4A7GA 4I9XA 1FO0H 1EWHA 3BKCH 3QO0A 4ZOEA 2I69A 4X4ME 4GXFA 2X6AA 1TFHA 3F84A 3QDMB 4PP1D 5F71A 2FT8A 4JY4B 3DLQR 3FQWB 5IKCA 3BGMB 2PPFA 3GJFH 4OIBA 1PG7X 1Z6JT 1OOWA 2CA4A 2WBJA 3CFCL 3EOBA 4QRPA 3TBWB 1KTDB 2EH7L 2PTVA 3WUZA 4L05A 5HDQL 1HOCA 1MHHB 3VFUA 3P9LB 4X9HA 3ZE1B 1KDJA 3UEZA 2OFQA 1T04B 5HVGB 1OGAB 1E4KC 1JPSH 3QXWA 4UQCA 3V0VB 5KEZA 1QBLH 5I8KL 1UACL 5HY9B 4L3ED 2IPUK 1KACB 2HX8A 2W65B 2Q5BA 4H2AA 1FHNA 5L4IA 2N4IA 1HHIA 1PNDA 2J4WL 2QTVA 3KBEA 4DPBX 5MERB 4JFDE 2BIIA 3Q3GA 2VLKB 3FU8A 4H88L 5CJXC 4J6RH 1IIIA 1CG9B 3RPBA 1S9WA 3V0DA 3B9KB 1L9OA 1M2OA 4MCYA 4C4KT 3WLWD 3NGBC 2YPKB 4NEHB 4Y88A 3AXLA 4XVTL 5ETUB 4DCQA 4PVBA 3QORC 1PD6A 4WUKH 1A3ZA 3GUTB 4FZEH 1MCEA 1YYLL 2YGNA 5DJAB 4IHOA 3G6JF 2NMSA 3QUMB 1K3ZA 1YVLA 3FPXA 3RWFA 1YEIH 2EDHA 1RUAL 1VGKA 2XV0A 1N12A 4OFDA 2OW7A 3GXIA 2ITFA 3PE9A 4KV5F 3ZZSA 1OSPH 4MRCA 2F5BH 2JQMA 4K7PY 3MR9B 1OP5H 3WHXA 3D34A 4XX1E 5IEHB 2WB7A 5DU7A 1G0YR 1GOFA 4G1MA 5DRNA 5FW8A 4D8PA 1OAZH 1S9VA 2A73B 5CZKA 1TJIH 2MNJB 2F54D 4YPJA 5BZWB 2JTDA 4A6YL 5KVGH 1OTUD 5EBLB 2ZWNA 2XSKA 3MCKA 3EH3B 4LXFA 3VVWA 2R69A 3AREB 2W1NA 2WIIA 4Z76B 4UZSA 2CGZA 3RWDB 4O2CB 4Y5YA 4YHPB 4MQXD 2YPVH 1IKOP 4PJBE 5GJTH 1RHHA 2WQ8A 3BO8B 3DV4A 4L8DA 3GGWA 4P5MA 4AYFB 3ARDA 5IVXA 1EZVX 5E9DD 2FH8A 2X4NA 1THCA 3DPBA 5AL8A 5TF1H 1U92A 1DSFH 1PY4A 2DQEH 3JWOH 4W6WB 4HQQH 1ZDSA 5A1AA 3FQRB 4XWGH 1B4RA 1I82A 4JO1H 1UZ6F 3FF7A 4G2AA 4BZ1H 1BFVH 4PV9A 5EZOH 1RUMH 2TRHA 4YDLB 4XPHL 3RGVA 2BLFA 1NEZB 4E9VA 3VFRB 2VGLM 1ORSB 3OKKA 2EVJA 4Y1TA 3FRPB 2K0RA 3BWUC 2AK4A 2X4SA 1MQKL 5FXCH 2MH4A 3TO2A 1Z0NA 1FH5H 1QABA 2B5IB 2V9RA 2Z7YA 3L9EA 4A6YH 4M3KB 1QSFD 2O5ZH 5I2IB 3VW3L 3QZLA 1B4JL 5DMGC 3TEXA 3TASA 4WFGE 1JUFB 4YQXL 3EFFA 4X6DA 4F2EA 4QRUA 4TNVK 3BT2L 3FU7A 3FO9B 3QCTL 3LKQB 2CPCA 1NMAH 3U4BH 1H8LA 5ILTL 3U25A 2L7EA 3RX9A 2DRUA 3W11D 5EO1B 3EJRA 3QC6X 5D1ZC 1M71B 1MJ8L 3ZE1E 3LNDA 4ORGB 3DJSA 5DGQA 5L9DL 2R0WL 4P5SA 2IGTA 2XFXA 2Q20A 3IJYB 3MRNA 5J4MA 5D7IB 4XMZA 3FCTA 1AYRA 3LH2H 3M8OL 3NJXA 3MODH 3KGUA 3QZWB 4QOKA 5AOIA 3D39B 1LE5A 2AVFA 4GMSH 1WH0A 3P4OA 1M4KA 1HCVA 1I75A 3BUBA 4G7SB 4OLUH 3AM8A 1RSFA 1EUUA 3WN5A 3FO9A 2IAAC 2G60L 1HCZA 3WS6A 2V5SA 1G7PB 3MRRA 2DWEB 4N3UA 4F2MB 3SIKA 5B8CB 1IFHH 4LLAA 2R23A 4AT6A 3C8KB 3EIFA 3X3GH 2OTUB 1HSAA 3FSWA 1RJYB 3MBXH 3SSGA 4XC1H 1HZKA 1DP0A 4J39A 1QYGH 4W9FC 2BFVH 2WTOA 1MRDH 4KJQC 5HPOA 3ESPA 3X1FA 4GG6B 5L7XL 5FA3A 4HW6A 4QCIB 2X0VA 3AU1A 2I32A 4G8EA 4MNGB 4N2NA 4KX9A 1M53A 5KVDH 1K72A 1FQ9C 4QXUL 4NB7A 4D0CA 2XA8H 2KZWA 2Z4QA 1U3HD 4RZCB 2XQYG 4EN3C 1P7KA 4PJHB 4UV4H 3SKUD 2HRLA 2J73A 5IQ9B 5HHNB 3HNTH 4WTZG 4JQIA 4XCFH 1NJ9A 1TF4A 4DFHA 7CGTA 3DURB 1PD1A 3L13A 5D7KE 4XNMA 3PWVA 1YNLH 1G84A 1N67A 1MQKH 3N1FC 4HKXA 4J4PA 2D31B 4BZYA 3QUMA 2VDLB 3BEVB 4AMXA 4DESA 1F6FB 1CFSB 1OW0C 2KLTA 3VD3A 1ACXA 4J2QA 4H1LH 2Z31B 3DOHA 4LLQA 4P4KC 3CFBB 4PVMA 3IRZA 3B2MA 4K7PX 3HC0A 1JPST 2HRGA 4S1DD 1LO0H 2XTSA 4FGMA 1CXFA 2AI0L 3F7QA 4JG9A 5ILTH 3P30L 2NRDA 3NZ8A 4F2ME 4N1EA 5LKNA 3MRLB 2CHXA 4WJG3 1WAAE 1HYSD 3CFDA 1QSEB 5K59E 3IETA 4NIYE 2BVTA 3O45B 3WLBB 1L9SA 5EPMB 4X5PA 3SODB 4ZQKA 1NSNL 1HL4A 3AS2A 3P11L 2RTTA 5EU6E 3ZKMD 1A6TA 1KPVA 4ZYKB 4NO3A 1J5IA 1ZANH 1BWMA 3QT2A 3SZ6A 3KH4A 5C0NC 1KCWA 3ECBB 4DZBA 4ALAH 3D0VA 4JRXE 4HKJB 2MQGA 4XB8A 5E5MA 3OMZA 5DEZA 4HBCH 2Q3AA 3ARGD 3MRBA 4PJHE 1XTLA 3CZSA 5E95B 1ZGLA 1DE4B 2NW2B 5LNGA 3TURA 3WTSA 3T2NL 4AQ8C 1DVYA 3WHE1 2Y25A 5BQ7A 1X4YA 1BBJB 3IDMA 5CINL 2J4WH 2HVBA 3VXNA 4JFEB 4KTYA 4Z3JA 4PGBB 2WXNA 2LTQB 4UQ2B 1JXGA 1UA6H 3BQVA 3BUIA 3GSRB 3OAUH 2YWZA 4XN4A 2HLAB 1F4WL 3DIFA 3NACL 3W56A 4ANXA 3UABA 3NEEA 3CDCA 5HI4C 3N3EA 1I3VA 2VJ8A 2DMCA 5E03A 3IPBA 3RKDC 2ARJQ 2ENJA 2HRPH 5I8OH 4ZX3A 2H0EA 3ILDA 4OJAA 1G6RA 3U7AA 4NQDA 3BVDB 1A4KB 3RWGA 4ZQTA 1AO7E 1HL5A 1OXYA 2IDQA 1QPPA 2YGVA 4J1UB 3UZEC 5JXAL 3EO1A 5HD8D 2NY1C 4NQVB 5FLVA 4AZ8B 4MLIA 5I5RA 2Y6TE 4X5WB 1OAUL 1IEAB 2YBRA 4OF3A 5T1MA 4OFYD 1G7HA 3SGDH 1MJJA 4YR6A 4ODHH 1ADQH 1DVFC 2D0HA 2F5BL 4OKVB 4YHKH 3APCA 4UV7H 4Y4HD 3KYKL 1MLCB 2DQIH 1WITA 4FQXC 1TJXA 3HNVL 2R39A 2J1XA 2J1KA 1WFJA 1MCIA 5DJCA 3ZIMA 4WWPA 1KJ2B 4HAFA 5CZXC 3RWDA 4UANA 1YHPA 3MZTA 1GCYA 3QNXB 4M5YL 4PJCA 2JFCA 3TS8A 1CD1B 2OKMA 4WJ5A 2CMRL 3RQ3A 1ZRUA 5AW7B 1CXHA 5GZNC 3X12B 3PV6A 5E7FA 3HI5L 3VXOA 4UTCA 1RUQL 2WVTA 2NQ3A 5EIIA 3DROA 3OWEA 4HV8B 2DQHH 4Y5XA 5TF1L 2YAOA 5CUSH 3F58H 2GB2A 5EFIA 3B2UC 2JE8A 3L48A 1O6SB 3MI6A 3T3PF 12E8H 2BHFA 4K3EL 1P4IH 5J6SA 2W80C 4DEPB 4LFHG 4DOHB 3IPEA 1GGCH 2GIMA 5DHEA 3S35X 4AEHH 1U0QA 5L2KE 5EEWA 4WW1B 1RIHH 3OB0H 4WFFE 4HF5H 3QXDB 3UERA 5LBSH 1TEYA 1HAUA 1MW0A 3CJJA 3D18A 5DJYB 5FWRA 1VACA 4AQAB 1KCRH 4G43B 1FL5B 5BS0A 4S1RH 1HS6A 1JTPA 4OGZA 2JI3A 3CSYB 2J88H 3AVEA 1CD9B 4N6QA 4LB8A 4XZUB 2GITB 2IVFC 3D39E 5F9DC 3BT2H 2CKNA 1RMFL 2NX5D 1UD8A 2R59A 3P77B 2XLLA 1DEDA 1EUTA 1DJZA 2H1PL 1C08A 1DZBA 3J7HA 4KO7A 1X5LA 5E8EB 4Q14A 4FA8A 2OX5A 3HI1B 4HIXL 1JPEA 2R1XA 5T5FA 4YLCA 1OT4A 2EH7H 2IMNA 2WSDA 2A9CA 2O61A 1HILA 4ODXA 3EGDB 3SDXB 1JK8A 2W0FA 4U2YA 3PHSA 5KWYC 2PN5A 1V7ML 2WOBA 3IDJA 4J3OC 5TH2A 2UWEF 1MY5A 1D9KD 4DP5X 5E6YA 2ROYA 2WZAA 4KZEL 1NICA 2XVKA 3U0TA 2UY7B 2IBZY 4PJIF 4TULL 3FO0L 4K94C 2F7OA 1BBDL 3KYOB 3ZTJG 3FULA 3QDJD 3WCYA 1YEKL 4AH2A 3V6OC 2YPVL 3D18B 5T8IA 3MTRA 5LNEA 4YHYC 4LCVA 3BDYL 1DJSA 4OAWA 3BT0A 4BQ6A 4D9RE 5C9JA 3OPZH 2WNXA 4KXBA 5I26A 2EXYC 1X44A 4BQ9A 3AADB 3GTTA 3U2SA 3RWIB 4OGXH 4ZI8A 1TZGL 2VXTL 3QEQD 2NX5B 4EVNA 4Z3EA 2MTPA 2P26A 5E6SB 3KM1A 3Q8BA 3C87A 1M7DA 2ZUYA 1KBPA 3Q2VA 4P2QB 4BQCA 4Y4HC 3C09C 4UB0L 3X14B 1FH5L 1VB9A 3QYCA 5E99H 4MD0B 4YEEA 1D6VL 1E9OB 4W9LC 5I1HL 3MJ6A 5DQ9A 3NIGB 4JE0A 3JYBA 1CLZL 4QYOB 3GKWH 4PRPB 3UYOD 2DMBA 2VR5A 1AS7A 2VDKB 3HS8A 4O9HH 3TOPA 3RJOA 2ZX6A 3CZKA 2FL5B 5ANMA 3VFMB 4JJ5B 3ROOB 1I8KB 1T1ZA 1RMFH 4BD4A 2B16A 4YUEL 3KVPA 1EDHA 1JZHA 5FYKL 5DZAA 5GS2D 4HT1H 3K72A 3SKOA 3SKNB 4NUQA 1EFXB 3GS7A 3U46B 3FQXB 1LE9B 3KNBA 4IRSC 5EUOB 5F7UA 1RZGA 4APQB 3P2BA 3H9HA 3ZKND 1JK9B 1JAEA 3HCVB 1AVAA 2G3XA 2JJSA 4N0UA 5AALA 3V0JA 3HZVB 5ESQB 4AQEA 4B6ZA 3VNYA 4FQCH 4WI2A 3QJHA 2A77H 2ED7A 4YHNA 4ZAKC 2Y7QA 2R7EB 3RFRA 3MLSH 2QVIA 4U3SA 3IMVA 4F37F 2OMYA 4HWUA 5A16A 2VDRB 3VFPA 4PJ8D 1P4LB 2WO4A 4X7CC 3UJJH 3VXPB 3ZDYF 3ZE0F 2LTQC 2O30A 4ZXBD 3V4UH 4RMQA 1IFHL 2XWDA 1FG9C 5D7SL 2Y69B 1S5HB 4V1DE 4WW2B 1J9TA 4KQ3L 5D1XA 5B3JE 3RVVC 5JHMA 4JGUA 3OTTA 4ZD3H 1Q9OB 4XBEL 1RPUA 1KBVA 3WTXA 1TO5A 3QZWG 5CJOL 2FJFA 3LNHA 4KVPA 4XB3A 4KXCA 3NZ8B 4HUCA 3VDCA 3K4DA 2QZ5A 2IDTA 2ICEC 3CBKB 3RPKA 1WAAF 5AFAA 3RFZB 3TNNA 1N2RB 3RX5A 3QIUB 4BZ2H 3GMRB 3BQUD 5DJYA 4H8QA 2J5LB 5IMLB 2Q2EB 4MDIA 3CTTA 4B0MM 3RGHA 2OMZB 2NSXA 3TWCL 4IOIA 3E38A 1BF8A 1JGVL 2C3XA 5EOTB 5TE7L 3CVIL 4LHUB 5FECB 5IHHA 3VSTA 3SQRA 1XF5B 4UQIM 2CWRA 4R8WH 3O3EA 1V8HA 1WZMA 5D2NC 4TNWF 4FG0A 3MRJA 4Y4KC 2ID5A 2WCSA 4F7CA 1IT9L 5BMFH 3HJEA 1B4TA 3Q1SL 3L5WA 2ITCA 3QFGA 2LLNA 4M4PA 1V3KA 4L4VE 2VXUH 4GSDH 1TCRA 3D3VE 3S88H 4LKXB 2YA1A 3QZBA 3OKLB 1JN6B 3HHRB 5LB1A 3BPLB 2VLME 1JWUA 3FONB 3Q9PA 4XP1H 2GT9A 4XR8C 3AG2B 4M7JH 5KBKA 1K2DA 2EDJA 1HSBA 4JPSA 1EDQA 5LWYH 1HZLA 1NKRA 1LK2A 5IJVA 5K39B 1WBZA 5IB4A 1HKLL 1YC7A 2X9ZA 1BFOB 3CN4A 3D3VD 5DUBA 2YXFA 3O6LH 2YUVA 2BY0A 3BJ91 3UZVB 1JYXA 2I7OA 5EDSA 2F54E 1RJYA 4CMHB 1BLNA 3GMPA 1X5MA 3DUHA 4YSAA 4L37B 2HFEA 2XNAA 2W81C 3IU4L 3VRJB 2F19L 4HIHB 4PCTA 4FYRA 2VXVL 4KX7A 4XBGA 4CVZA 5KZCB 1J10A 1IGFL 5KBPA 2GEEA 2YBRB 5T1MB 4GMSL 4N9OB 4ZOAA 3NDYE 5D7HA 1RZ7L 3L16A 3V5KB 1QRNB 4UQ3B 5HYQA 3A6BH 3OV6A 5HYJE 1Y6KR 4M7LT 2BOBB 5J1SC 4P04A 3SGEI 1RIHL 3HLAA 1NEZA 2VT0A 5FO8B 5SWZB 1V3MA 1PYWA 4HJ1A 5GS1C 3RWJA 1BQHG 2TRYA 4LLYA 1VFAB 3MRHA 4F7TA 5I17B 4O2FA 1AC6A 3DBXA 1BVKB 4G9FE 1E3ZA 1GW0A 3IFOB 3GINA 3HG3A 2ZCHH 4MAYC 1ETA1 5KZCD 1DN0A 1SEQL 5B8CA 3SJVB 3GSNB 1LEKB 4G72B 1JZ2A 3M7OA 3W2DH 2AVGA 4M6NL 1COBA 5LHDA 4AKPA 1U95B 1HYRC 5I6MA 4HJEA 4KU1A 5F96L 4ZMYA 2AXHA 5TQ0H 3SCMA 1LWHA 1WBZB 4Z0BH 5JXAH 1YC8A 2ZKMX 1JZIA 5D4QA 3S36L 4FN0A 2VCOA 3QAQA 4K9EL 1A6ZA 1DJYA 1ZT4B 2GJZB 2PP7A 3C8HA 3EJZD 1JZFA 3C5SA 3ZJAA 2GTWA 1JN6A 1KXQE 2P47B 2VRQA 3PWPA 2F53E 3DHJA 4GQ9H 1F58H 4TTDD 3WKNA 1FRGL 3Q2CA 1T83A 4FI7A 4QLRA 1N8OE 1ORQB 2C7UA 3O6KL 3DGDA 1E65A 1QLRB 1DQTA 2F8XC 3FZUD 3U0PA 5T3XL 1EFQA 1XCQB 4G6AC 4BHUI 5KVGE 2ZCHL 3DRQB 3O4LA 1SEQH 3IWUA 4L8BA 3T0EA 2R2EA 1GY1A 4H1LG 5DI8B 1X5KA 3CZFA 4M43L 4OLYL 4IHOB 4AYBA 3S35H 4Q58C 1FFNB 1U8HB 4M5SA 3RNKB 4K8RL 3PP3K 2XQBL 4FNLH 3L95A 2MKWA 2C9SA 3O81A 3RPIB 3JTTB 3O3BA 3VXTB 4X4XB 1QG3A 4J6IA 1SJEA 3UJIH 4IIQB 2FGWH 4F1ZA 4AIZB 4BUHA 1IKFL 1LL1A 1EAPB 1SVZA 5CU5A 3MRFA 3IJSB 4OH2A 3BGAA 5JO5A 1IGFH 1NIAA 1AO7B 4UOZA 5C6WH 3P3SA 5LN8A 3MRPA 4YDIH 1RERA 2CD0A 2X9XA 3MV01 5KG9B 1DQML 2E9BA 5HVWA 5C71A 3QRFM 5C7ZA 1QLEL 3VXPA 5DHVB 5FUOH 4MA7H 3EF4A 3D2UA 1SDYA 2Y07H 1TSHA 3KBFA 5GRVL 4PJ7B 5E0FA 1J8SA 4UM8A 3I50H 3KLKA 1JFHA 1X5GA 3GBNL 1VGEH 4R97C 1EZVY 1KIPA 4NN6C 5GGTL 3QULB 1F3DH 3R8BB 5D7LE 3SCMB 4IOFC 3GUTA 2J6EH 1BAGA 4PGZA 2E47A 2EEXA 4ZO9A 1EXUB 2IDSA 3JV6A 4TYUA 3WSQL 1XF2B 4G1MB 1EHKB 1RJLA 3ZT5A 3QUYA 5CCKL 1NBQA 3VMNA 5HHOB 1CG9A 1E2WA 2IWGA 3EHBD 3L17A 4MB4A 2VMJA 4WHDA 4HT1L 3O6FC 1XR9B 4BWUA 3NQKA 1JFQH 1FCGA 2AEWA 4IEFB 3Q8FA 1G7MA 3QUYB 3MLWL 4MKTA 5HYEA 1MG3C 4PP1C 2HT2D 5D9SA 2YAMA 3BUPA 2UX6A 1RL1A 2WINB 4MCZB 5MEPB 1CFTA 2PTUA 3WJMA 4GIPD 2FK9A 1IVLA 3B4NA 4Q9BA 4GKOA 5SWSD 1KIPB 1E9OA 3QDME 2R29L 1MSPA 1FGVL 4Q9CA 4LCWA 1H9VA 2IDUA 4GRLD 2GTZB 2FQDA 3HKFA 3MROA 4KKNA 5GGVH 5IV2A 2X40A 3B9KC 3HC3H 2HKFL 3ETSA 2JELH 2EJ1A 4XBGB 4FLRA 4XOAA 1J05A 5DFVD 2XV3A 3WE6A 1H5BB 2YUXA 3VFWA 2OCCB 1QO3A 5DMYA 3CX2A 5HHOD 2AQ1A 1NBVL 4N3TA 4HXBL 4OFQA 3VYNA 3MLYH 3CDZB 1KMGA 3B7UX 5F9AC 1IE4A 1UJTA 3WJJA 4XO5A 2CR0A 4ALAC 3UAJD 4GAYA 1MQ8A 1UOVA 3DV6A 4WWKA 3SPVA 1OP3K 4RISL 5AD0A 4ZODA 2P48B 1DVFB 1ZHNA 4G80B 2WZPD 2MCAA 4HIXH 5F1SA 2G5UA 3NFPA 3CDYA 3E8UH 1QWUA 2BNRD 1NC2A 3CHOA 5F3FA 1Z1WA 2B08A 3B2VH 4OCLC 4S1QL 5I74B 3SD5A 3L3JA 1JWSA 1IFRA 5C0FB 5IBTH 3ULSA 5IFJA 3EJSA 2ATKB 4GQPH 2X10A 4NM4L 2E8YA 4ETQA 1SJHA 4R7NA 2H8PB 2WD0A 4JX0A 1D9KB 1F02I 3P0GB 4BFRA 2GY7B 5AW2B 3LZOA 3TA4D 3QG6B 3LXAA 5ICXA 5C0BE 4HYTB 4WW2A 3EYVA 3L3IB 4FFZH 4H8VA 1MFCH 1JDAA 1VF5C 2DKSA 2PP8A 1B4JH 4WLCA 4DSYA 4EZMA 3VFPB 4G59C 4DVRH 4JKPH 4F20A 4LLWA 5DHVH 5FUZH 5DJ6B 4AENA 4BKTC 2EDWA 1TJGL 2OX5B 4V1DB 2Q7YB 4GPVA 4GB9A 3EYQD 4LLDA 4OD3H 2MPVA 5AW1B 2WWOA 1A4JB 1MJ8H 1XGYL 2GIYA 1UKSA 2ZX7A 3ZTDC 5KYWA 4P2QD 1TPXC 4N9GB 4M5ZH 3H55A 3R06A 3KLHC 3HHSB 4QRRD 2BY1A 4ZZFA 1YPZA 3ZDXF 3L4XA 2AKRA 5AKSA 4BZ2A 2F19H 1A47A 4IRSD 3HS0B 1ETZB 4I87A 5ICYA 5J57B 3MV9E 1QSVA 4G6FB 3HE6B 4GG6E 1XO8A 3L4YA 5D93B 5GRUL 1I7ZB 3MZGB 4DO6A 1MUJB 2FJSA 3EXLA 4LLYB 1EHLH 1AHMA 5JYMA 4UT6A 3PXJA 3VTAA 1AD0A 4QGYA 1Q4NX 3KLDA 3MBXL 4XC1L 5FX3A 4P2QA 3U4AA 4NKOA 2Y5TA 4HK0B 2XHNA 4MNHA 4ZFZA 2DJSA 5D7JA 5I8EA 1GGYA 1B2YA 2XBTA 3VH8B 43C9B 3ZSTA 1C5DA 3V5HA 1TQWA 3PNWB 4M5ZL 4YXKL 3AQXA 2C3WA 1MCJA 1PZSA 4Q0XH 1PEZA 3T6VA 1RXLA 2I24N 4PS8A 1NLBL 1JGVH 4H5SA 1TEGA 2BW5A 1BFOA 4NXSA 1A4AA 3HE7B 3KE0A 2FLMA 5J12B 3S4SA 2CHWA 3P9LA 4K4KA 1JPFA 4U1JA 2WNGA 4OGYL 1KTDA 2HSIA 4MZ2A 1WGVA 2EH8H 4U6HA 2A38A 3H6AA 3RVTC 4P5KA 4RMSA 3JV0A 4KROD 1SY6L 1TXKA 4PJCE 4J3TA 4OLZL 5JHLA 4JKNA 2E6JA 1MF2H 2ZOKB 4KKLC 4F7PB 2V17L 4E36A 1F90L 1R46A 2W92A 2WQRA 4RCAA 4J23A 1CYGA 5CSZB 3L5WB 4HUNB 4X5WA 3TV8A 4W9HC 4IRZL 4E9LA 2A9NL 3HR5A 1KB5H 1AOHA 5EOCJ 5JHDA 2QQNL 5E8OA 3ULVH 1HKLH 4MA1C 2HYMA 1MCFA 1EAJA 4F1SA 3F8UB 3LB6D 1ZT1A 5DJ8B 2JVUA 1EVTC 4QRQB 5MP6L 2I07B 5DFTA 3BIBX 3UROR 2EIZA 3DYOA 1QLEB 2QLVB 4PIBA 4BDVB 4KKLD 1MCWW 5DEGA 4Q2ZB 1I7ZA 1G87A 3HFFA 1LDPL 2KS0A 4GP4B 5FKAA 1MCPL 1S5IH 2DLHA 5IROC 1JP5A 2WM0A 3EYFB 5I15H 3V79C 3TZVB 1FL3A 3IAQA 2BCKA 1TTGA 4AYDC 4U1SB 2P5EE 3KCWA 5CSZA 1U8CB 2YKLL 4BQBA 4LHQB 5E51A 4PSRA 1YEDB 3LX9A 1QFWL 5CM1A 2P5WE 1QPKA 2AQ2A 1TPXB 4JRYE 1DANU 4HK0A 4HFUL 5DD6A 3LKOB 4KPHL 1LO4H 5GGRY 2BNRB 2CDGA 4D94A 3MUZ1 4IGBC 4WFHD 3O6FD 4EN2A 2ZICA 1BQLL 5MEOA 5KTEH 4PGEA 3I50L 5GSRB 4Z7OB 2AJUL 3GBNH 1WD8A 4XCCL 2ZWLT 4KHXL 3STLB 2VW6A 1RURH 3TN0B 4KKZA 1QYGL 3CHPA 4K3JL 1HHJA 2Y23A 4UOW0 3B7TA 5F7KC 2EDNA 2Y7SA 1SF3A 2FCBA 1QSED 2WSPA 3C2AL 3ARGC 2BVEA 3H2PA 3NIFE 2ZSWB 4KVNL 4P59H 5E2WL 1JJUA 4Y4HB 4MSWA 4IJTA 4I0PC 2BM3A 5T1DL 2XKNA 4G9FD 4ZPTB 5FYLE 2NZ9D 5KYUA 3FB5A 4OU3A 3ULSB 1H6TA 5IFJB 4QRPE 4QAWA 5HGBA 1KJ2L 1E43A 1HQRA 1T7XA 5C3LD 2FX7L 4CW1A 1QSEE 3FB6B 2LABA 2AZAA 1PKOA 5SWSB 2ZONA 4JDEA 5IT2H 3MXWH 3K5RA 1DQDH 4NZUL 2MOGA 1HHGB 4JCWA 4CBPA 1KJ2A 2WIMA 4JMNA 4UQEA 4G1EA 2WZ5A 4PJ8A 1JBJA 2FRGP 2OTWB 2XTLA 3PAZA 5L0QC 1XX9C 1JWMB 3WMPA 1QO3B 3IKCB 2FEEI 4H20L 2Y3AA 3ULVD 4ANKA 5ABDE 3X1EA 1K4DB 3EF7A 5LG1A 4NAJA 1UWYA 4XXWC 3UO1L 3DMMC 1WA2X 5E1QA 2UYLB 1Q94A 4OF7A 1FWXA 2CG9X 1BW8A 1Z5LB 3SGKA 2RH0A 4YFLI 3FO2A 1RZKC 3N42F 4RFNC 1UHVA 3VU2A 1CD1A 1E42A 1HINH 2WQAA 2AAAA 1B2WH 3LEXA 2VDLH 3S36H 3QC5X 4FABH 2HJKA 1MHPH 1OPGL 3QXAB 1XGQA 2WINA 2XIDA 2XZQH 1D5MA 4XVUD 1SY6A 3UIYA 5I1DB 3AFLA 3BPOC 4ZUVA 4XZ4A 4NQEB 1RZ7H 4ZTEA 4C54A 2VR7A 5EIQA 1QLEH 4LLMB 3D85A 3IDYB 5FUOL 3ZTEA 4DO4A 2NUPB 2QADC 3HR5B 3U0TB 4MXVF 4Q52A 4UQ2A 3UJTL 5FCSH 2BX5A 4IRZA 2MPAH 3LQZA 5I66A 4Z7NE 2QL1A 1ORQA 2C7UB 1OCZB 3SKJH 3TVMC 5B38B 3MGAA 1BXVA 2K45A 3KAAA 1YEGL 2FDBP 4FYSA 3D2UD 4YGVB 5F72S 4KHXH 1ILUA 3U30B 1FNGA 3BWZA 5I6PA 1HXYB 1G0DA 5KS9B 3CSGA 4B60A 4ODUA 5PCYA 2D7PA 5IHUH 3O6FB 3WTYA 3GI9L 3IMWA 2EYTA 5I8CA 2KL6A 5IW6A 3MLWH 1FAIL 3CDGA 4AJ0A 1W2KT 3VXQB 4NYLB 1JGUH 4ZNEA 1NKOA 4XN1A 5JOFA 3WUWB 1DQJA 1VZHA 2WKGA 3NAAH 1E27A 5HYSA 5CEZE 2VQ1A 4F80A 1WA0X 1IGCH 3FT4B 4MX7B 3ZGIA 5BS0B 3VFTA 2A83A 2AV1A 4WTXA 3FQ1A 1S7QA 3HZKA 2ZXAA 1A7BA 4S0HA 5SV4A 1BG9A 4PJDB 1R6VA 3IGAB 4APXB 2HA1A 2D03H 4UOW1 1KEGH 1J8HB 1KGXA 1HK6A 1S9XA 5I1JH 2FZ3B 3ZL4L 2BOBA 5KVGL 2R29A 2YXMA 6PCYA 1GL4B 4XI5D 4GRLA 1UASA 4PJ7A 4PJ7E 4JCLA 4MJ5A 5KW9H 1X5HA 1AE6L 3APMA 2G9KA 1MNUH 4TSAH 4JO4H 4XCNA 3FUHA 2ZAIA 4Y7OC 1VJSA 3CVCA 4MDJA 2J12B 2CJ3A 4G8IA 5FM5O 1NWOA 3LRKA 2WQXA 1NC4A 1DDHA 3VXRD 1IUZA 3O3AA 2WXIA 2DQHL 4H0IA 5C6TH 4HGMA 2JKSA 5LGJA 4DGIH 2ATAA 1PCXA 4FHBD 3HB3B 3Q43A 1TETH 3O9WD 3A4FA 3NSYA 5KJ7E 3FQ4A 2VDOL 4WDIA 2YD3A 5CEXA 1FAKT 2YAHA 4WUUE 1VA9A 2BMKA 2NXYC 5C0CD 2I9LB 4LPVA 4RGMC 2P44B 3VXRE 1FFNA 3OZKA 3DOSA 3QZNA 2ZAGA 3Q5OA 4Y5VB 4L5FL 5HI3D 1O7DC 2QQLH 3P2TA 1MFCL 3Q06A 5FO2A 5CBAA 4R7VA 1MVYA 1NLDL 1P7KB 4PJHA 4Q9QH 3V9EA 5CSBA 2ZJSL 3LS4L 4ECNA 4A2EA 2OYLA 1AXTL 1NFAA 3IF1A 4LKCB 1PVHA 4HS8H 4X4ZA 1MAJA 2IWFA 3T09A 1MXGA 4OZGB 2IQAA 4LU5L 4XPAL 2R69H 5K9KA 3HI6L 1AG0A 1C9SA 3OKMA 5D96B 4TSCH 1J1OL 3OWRA 1L0YA 3SYCA 1KV7A 1KNOB 3G5VA 2ARJA 3CSPA 4EIUA 1BXUA 2ICCA 4CKQA 2Y5QA 1QFHA 4H26B 2IALB 4JO1L 5DUMH 3M1CA 3Q3GB 1OAQH 4EZLA 1IGCL 2J56A 2OJZL 2LVCA 1BXAA 4XNBA 3RZCB 3CV5A 4I18C 3VGAC 1CLYH 3WNPA 1N7MH 3VFWB 1S5HA 2CRIA 4CU6A 2QQLL 2KZ1B 2OBGA 4I77H 4U05A 5IJDC 1IC4L 3HC3L 4TOYH 2BS71 3D39A 2JELL 2CBOA 3O2WL 1LK2B 3JWOC 5IJVB 4NCC1 1RIVH 3TO4A 1I8IA 2Y7OA 3IDNB 3BKJH 2VM4A 4M6OL 1KC5L 4AW7A 4DKFL 3OBAA 4PJBF 3RA7L 5SX4H 2KPWA 2ZWZA 3H9HB 4JDVA 3GXDA 1Q72L 2I27N 1JRHL 3QDMD 3VE0B 1TTFA 3WIFB 3WKQA 4M7LL 5I1KH 2ZG1A 4X8CA 4Q0XL 3L5HA 1FZMA 3R1GH 3EGXB 3HG1A 1R5WB 3UFIA 3SE3A 1TVBA 1WG3A 1J5HA 4QF1A 4WHTA 3HZ3A 1SOKA 3VXMA 3Q5TA 5G5DB 1KGJA 3HZYA 3TO2B 4YC2C 1QD0A 2EVHA 3AT9A 2OV0A 4O2CA 3POHA 4RX4D 2X53A 1BD2A 1QFUH 3SE4A 3D0LB 3QE5A 4PJXE 4PJFE 5IK3B 4P46C 3L5XL 3FT2A 3ROLB 4GRWH 1TTCA 4OM0H 3QS2A 2DEXX 3WFDL 4I85A 2NY5L 3U0WH 4HJJL 4A2HA 4XI5C 1R24A 3DJTA 3LS4H 2FBJL 4X98A 1TKWB 3BZ4A 5E08L 4Y9BA 4B9PA 3ESOA 1I8MB 4M1CC 3S3BB 5GGVY 4UAOB 1AD9A 5F9OL 2NX5A 1BEYH 4N2EA 4M7LH 4YUEH 2KKQA 4KTEL 2H4EA 1I9RH 2QEJA 4AMKL 5K9JH 5B3NA 3F01A 1LDPH 4EIBA 1OF2B 1P84J 2BMKB 4G7RB 2R7EA 4XMKL 4QHUA 2OR9H 2ZX9A 5E6IB 2VMCA 2VN4A 4GG6A 3CXDH 5IW1B 3MTXA 3QIBB 4GBXD 2X4UB 4PS3A 2ZUTA 4OD1H 4JL1A 3E2HB 3ULUL 3H7LA 4U6VH 2D2OA 4EIGB 5GGQH 5EORL 3M45A 4P3WA 2QHLA 3DRQA 3O4LB 3APDA 4L8BB 5FFOA 3UGXA 5BW7A 5ITBL 3KEHA 3BP4B 3L4UA 2IO5A 5DC4B 3DGGA 4YQXH 4PRAB 4AZUA 4F8NA 3EDJA 4XMTA 2WLJA 3ABKB 1ET5A 4J28A 5FA4A 3EYSL 4OZFG 4A6YB 1EANA 2VWEE 3FKUS 4OZIF 1FZKB 3NCJH 4LVHC 3DUSA 1TZOA 3AITA 1RAMA 3OKEB 4NNXB 3QZMA 5MEOB 4AGMA 3DO7B 5K9QI 5BS0E 3OXSB 2HG0A 3DX1A 3QDJB 5HGDB 3BAWA 3C09B 4L9LA 4WCYL 2ADJB 4ELKA 4Y0GA 1FNAA 1YEFL 4WVRA 3BPNC 1I8AA 2QGBA 1DQLL 4NQEE 3MACL 4OCWL 1YQVH 4HX1A 4LBEB 2C3HA 2Y1AA 5KANG 1L6PA 1ZHBA 3QWRD 3TZVA 4JHWL 4B9YA 2NUPA 3TCLB 4K7FA 4TNFA 1IQDA 3O2DH 1K8DA 3T0VA 3W5NA 3Q2WA 1SY6H 4P06A 2Y06H 2YIHA 5J9PB 2Y3NA 1NDMA 2ZKXA 3U4KA 4X6CA 3ARDC 1DJIA 1ZS2A 5TE6L 4BSVB 4QYOA 1E9PA 1U8LA 1E8ZA 1PSKH 1Y07A 3WEAA 1E5AA 1KF9B 3CQFA 4AVKA 5AYTA 1HXMB 4KJYB 3KL0A 2HH0H 4NN7B 1IAOA 4LNRB 2R1WB 5D5ME 3ULVL 1RSYA 3OAUL 4X8JA 1TU2B 3RL1A 3LSOA 2IOIA 3MUY1 3ECQA 3D52A 1HH6A 3NPSC 3OXRA 1BZ7A 4R97B 5HP5A 1E27B 4P23B 2HJFA 4HIIA 4KKRA 3MNVB 4HCIA 5GGUA 4CU8A 3ILPB 4UBDC 5CP3A 1KXTA 1A7NL 1U3NA 1FBIL 5BV7C 2DWTA 4ZX4A 3MFFA 3N9GH 3QUMH 4L1SA 4N2BA 1AGEB 4NNYA 3VGGA 4OD1L 4JRFA 3RKPA 1GC1H 3UCQA 4Y2DB 4KTDH 4KFZC 4LIQL 5DRZB 4DIXA 4C57C 2IGLA 2NY2D 5BRZE 5A6MA 2IPTL 5IQNA 3SDAA 1ML0A 1OCOB 3II1A 3U82B 3V4LA 2Z92A 2K9FB 1LO4L 3KPMA 5DTFB 5K1JA 3V5HB 3UTPD 1OARH 4PJ5A 5HDRA 1T03H 4AV0A 4CN4A 1G5GA 1ZTXL 4YR6B 2DQUH 2QV4A 3I6LE 1KJVA 3V4VA 2ZAHA 1BF2A 3QWQB 5AKVA 3VD0A 1EH9A 1AQ8A 4N8UA 1I3RB 2XA3A 4DP0X 3AG3B 2H9GA 4H0LC 3L4ZA 2YWYA 3L2NA 1A7OH 2GHWB 5C8JA 1ZE3H 4N8VA 4BSWB 4C4UA 3UJIL 3BSZL 1QVOB 3NP4A 5GS0C 1MCKA 2AXWA 4KK6C 4J3OD 4TLTA 4E41A 1ZLDA 4Y89A 3LEXB 5D4IA 2VDQH 5EO0B 3GIZL 1GGIL 4QRSB 2NSQA 2B4CH 3LIZH 3AWGA 4Q6YA 2JCCB 3ATFA 3IS1X 2GK0A 3E7JA 3QR0A 3ZT6A 3NESA 1MLBA 3W0WA 3NPZB 3NIFB 5JOFB 3TH3T 3T2NH 5L4JA 1LO2H 4MGXA 4Z1PA 2HKFH 1RK1A 3O6KH 5DVPA 5CN3A 5EG6C 3GMMA 3PV6B 4ILDA 5EZIL 3QHTC 4ODXB 2BOCB 4YWGL 3WY3A 1E7VA 2A0LC 3HN8A 1QUNA 4WFGD 1C7TA 1KJMA 1PKQB 3RJQB 4A37A 3TTYA 3BN9D 4A2FA 1UZ6E 1NUGA 4M6OH 4RBPH 5DJCB 4PS7A 4YBLC 5E6ID 1UUNA 3BISA 3JUYA 4FRWA 1FFPB 3VFOB 3T5WA 4C56A 1UD2A 3MRMA 4KH2A 3N43F 3L3IA 4LVEA 1A6UL 5HI5D 1HKFA 1FVEA 1SJVA 5DS8B 2R1YA 4PEEA 5I30L 1JMZA 3NCMA 4HP5A 4IGBB 2ZCZA 4B53A 2HT3C 3A22A 4PG9B 5JHLH 2A74C 4EDXA 2ZQKA 3E6FB 3GMOB 5MHSD 1SLUA 2VYRE 4NM4H 4ZW3A 3TU6A 1HC1A 5ABAA 3GSWB 4LDLB 4KZCA 3GNMH 3M6DA 4TUUA 5KSBA 4M9OA 3EJYD 1HHJB 1BOYA 1CICA 4WY7H 5I71C 4JANB 1P5VB 3VFVA 1QFUL 5CIPH 3S48A 4GS7C 1A22B 1SYVB 1U8PB 1Y7VA 2AANA 2WKLA 3BQUB 3W9DA 5AWNL 4GAYB 2ZP0T 5F1OB 1UB5B 4NENB 4X6EB 1K5WA 4YHMH 3VWKC 4MNQA 1IBBA 3DURA 3KDMB 3CIQA 3PNWA 1W72A 1LQSR 2X70A 4FDWA 4P4RA 4X5QA 2JIXB 1AQKH 4ZUSB 3QJRB 1FO0L 3RAJH 2QELA 4IBTA 4BFIA 3GYRA 2FWUA 2YD4A 3P2DA 3CSFA 3IFNL 1JOIA 5CMAA 1YEIL 1BGXL 3NTCL 4JFPA 4WQOA 4GQRA 4U1KB 4C83B 3FN9A 4IBSA 3GHPA 5C0RH 4O4YL 5IMKA 2X12A 1NGWB 2YEZB 4WK0B 3MKGA 5AVWB 2A77L 2F1EA 2XV2A 4QRQA 2Q86A 3TBSA 3QK0A 1A66A 1RK0B 5M7QA 4U1HB 3KBPA 4ZUTB 5J9PA 1MAML 3WLBA 1Q1JH 4MNQD 4WI9A 4HSAC 3LEYH 1UWXK 4HIIB 3SN6N 2VITA 3JV4B 1NDGA 3ZO9A 1RQ5A 3QUKA 3DHUA 3EO9L 3L3HA 2EE9A 3GRWH 4XOBA 3RVWC 3QPQC 1N19A 5HHOE 1ES0B 2CIIB 3CX5J 2VLKE 3MNWA 3JWNH 1L9TA 2OL3A 2E74C 3LN4B 5EBGA 2IH9A 4Y5XC 3WS6C 4ZO7A 1YYLH 2O61B 5HGDA 2FWOA 3QQ9C 2ZPKL 4MAZA 1FDLL 4X9YA 3POCA 5L8KB 4QPEA 2JCCE 5AVYB 2FNBA 5C07D 3RHWF 4ZW8A 3A23A 2VERN 2VC2H 3BPCB 1NJ9B 1LEGB 2IWKA 1PDKB 4QY8B 5LAXA 1YY8A 4NGHL 3MRPB 1DSWA 4H25B 1F2QA 1CE1L 3UBXA 4AEFA 3BUTA 4WEBL 2H32A 4YXLH 4R6UA 1FYTE 4Q7DA 4U3HA 1DZ0A 5FO7A 1A6PA 1PQZB 3DX2A 4JLRB 1E6OL 4OLZH 3UYRL 2Z93B 1AZRA 2A3TA 3UJJL 4HOWA 4V1DA 1A14H 5IJCC 4IBLT 2MFNA 3SDXE 1IQWH 4M1GL 4PW9A 4KK5C 2B9BA 2ED9A 1HYSC 1QRNE 1MWOA 2CDFB 3DUUB 4YBQC 3WL9B 1KLUA 2SEBB 4LEXH 2DKMA 4NO5B 4K15A 3UL4A 4XXCC 1P69B 4NHUA 3MUUA 5I75C 3OM3B 1IBGH 1MKFA 3L8QA 3N44F 2J20A 4E5XB 4ZMWA 2WXOA 3BVVA 1A9BB 15C8H 2G4GA 4FQ1H 2P5EA 4FZ8H 4JPQA 4U7KA 4CC1A 2NXYB 3SJVE 2A4ZA 4HS3A 3DPBB 4ETQB 5DFAA 2BP5M 1VHPA 3OQ3B 5IQMA 2YFNA 3EKCA 1T5KA 3O11B 5TDPB 5FPIA 5JW4N 4U1NB 3U7YH 2OJEA 4L23A 4XTRC 2P1YA 4PLJD 4GKLA 3LRMA 2D9QB 3ARBC 3B7YA 4HUMB 1L9NA 5CFHA 1D5RA 2BXYA 2KLRA 5FUCC 5B4MC 2EC9T 4NZ8A 5I6KA 3TA3C 1B0IA 1D6VH 4PB9H 5A2AA 1VRSA 3EHBC 1EV2E 5DRNB 4EF3A 2OW6A 4EQ2A 2A9NH 3A24A 2W91A 3TA3B 4GEJA 3QI9D 3GSUB 3EGXA 3HG1B 4JO5A 4YAQA 4HZ1A 2CLRA 2NY6D 4QRRB 5SWSE 1U58A 4DPCX 4OZHF 2WXQA 3Q01A 4P59L 3UTQA 2GJPA 4WWKD 2AK4B 4QAMB 1IAOB 3IJHA 4LNRA 3MLUL 5HGHA 4M7KH 4L4TB 5LAPA 1WEJL 4FI8A 4MHHG 5E24E 1R3JA 2FO4A 1U30A 4KC3B 5D6DC 4KK8C 4F15C 5I1AA 5L7XH 3ZK0A 2W9EL 2FUQA 2CJUH 2CDEA 3MC0A 1AIZA 5E8PB 2E59A 3NVQA 4F7MA 3TA3A 1UXSB 4U2ZA 2IAMB 3V0WH 3S9DB 2W88A 4AL8C 2AAVA 1YN6A 5DD1L 1DBML 1UFGA 3WN5B 4K71B 4O5LH 4W4OC 3T4YB 1IC1A 1Q9LB 1VFOA 3D05A 3I9GL 5C9KA 5ITFA 2BK8A 3FFCA 1AR2A 3RL2A 5I1EH 5ISZE 1OEZW 1N8ZA 1X6LA 4LEXL 4ODUB 1X5AA 2EDQA 2FJGA 5EBLA 4ZFGH 1U8KA 2I7SA 4HUWB 4S0SD 5F7HA 5GGSB 3E80A 2DLFL 4LMQI 3DUSB 2WZ0A 4CN6A 2CBTA 1I9RL 1ZOXA 4AMKH 5DMKA 4EAEA 1CJYA 1NCHA 5K9JL 1SEBB 4PJXB 3FB7B 2HFTA 3A6CL 3Q8EA 1OZUA 1KUMA 2PPDA 4L48A 4QRRA 3NFSH 5EU6D 5HHXH 1ET8A 4BFFA 5D70L 4WIQA 1IKNA 2HZHA 2CNZA 3GMLA 4PJGA 1UADC 3IE4A 2ZWKA 4IIQA 3Q7JA 4QR7A 4JQIL 2A1WL 4MMZA 4N26A 2FX9H 1KLUB 4YZFE 1QOKA 2F18A 1WAPA 3HZMB 3UBXG 3ZDZF 2C9RA 4IW4C 5GGSA 2D3LA 5BXFB 3KPTA 3QIBD 4GBXB 2QGEA 4ORZC 1XCXA 1P6WA 2ZKWA 3FOMB 4MMZB 5B38G 4JHAL 3CFJB 2VM9A 3QNZB 5INDA 1CDIA 2F61A 4QHUB 2G75A 3ATEA 4FFYA 3V8OA 3UTTE 5B1CA 1XL4A 3JTSA 4YMPA 5L8LB 3NACH 4RQQA 1E40A 2MQ0A 3PJNA 5IIEA 3SD2A 3O3AB 2W9DH 3IFLH 4ZFOL 4LOUD 3DETD 3WE6B 4GO9A 1I8MA 4RAVB 4NAQA 3VD7A 2PYEB 4BCYA 3EHBB 2PNDA 3QA3A 1BD2E 3H42L 1FAIH 4L3AA 3CH1A 1DO5A 4YHPA 1RU9L 1VFAA 4M4RB 2UVFA 2XZQL 5C92A 4HD9A 4K2UH 2XZCL 4LOVA 3ARUA 4ZW5A 3M86A 3BGMA 2FQEA 4Y19E 4Z7QE 2YGPA 1V54B 4AYSA 1XV8A 3KPQB 3K6SB 3MCLH 4MBOA 2ZYIA 3T8XA 2VZTA 5I0WA 4D9QE 4HPHA 4S1SL 3QUKB 3REVA 3C75A 2D0GA 4JFTA 4LEEA 2BSTB 1DJHA 3C6LC 4GIAA 4NO0D 5KYXB 2FB4L 2APFA 1V5JA 2H3NA 1I8KA 1E90A 4MVBD 3S3PA 1P7HL 2XIBA 2W65A 3OVUB 2X4TA 3QISA 4BK4A 2BIMA 2KDYA 2DD8L 4PJ6A 1JPTL 4ELMF 1PZUB 2IAMC 2JKNA 4GW1A 1MN4A 3IVKB 4R7DB 1AGCB 1KLGA 3SDYL 3L1OL 1I7UA 2Q8BL 2PCPA 5AG8A 4QT5B 1CGUA 4Z0BL 4JFPB 3TO4B 3GXNA 2CO1A 1S7QB 3HZKB 2LGNA 2OXGA 3M88A 1YN7B 4FQLH 1M7DB 3DO4A 4K3DH 1SOSA 4NUJA 4P2RA 5B38A 4ODHL 5I1LA 1U8CA 1F45A 5GRJL 2WSKA 3MBEC 1P7QB 2ARWA 3VI4F 4TN9A 3P4NA 3T77A 2ZTBA 1I1AD 2QVKA 2AQPA 3PAVA 1FZOA 4XHQA 3BMWA 3ZQWA 3DHPA 3QQNA 3NQIA 5C07B 5EOTA 5FO9A 2SEBA 1UYWH 4UT9A 3EJUA 1DBKH 1F4XL 1CICB 1C5BH 1ND0A 2CU9A 1RUPL 2E27L 4FG6D 4FOMA 2VRKA 1U3YA 4WSJA 2VDPB 4M1DH 2WXLA 1ADWA 1AJ7H 1BQKA 1SFHA 2R2EB 2QADD 1ZK5A 3UTZB 4WO0A 3UTOA 1UQSA 1I85C 1A9BA 4ZAKD 3STZA 3WFHB 3HMXH 4FQQA 3KPOB 3BSGA 1U4EA 3BEWA 2A5UA 2X4NB 5IGXL 5JW3H 3MRMB 3FT3B 3K80A 3K5SA 2WUBL 4RESB 2FEDC 1MW3A 2OMYB 3WAJA 3LRSB 4S0TD 2BPBA 2H5UA 3QPKA 2A9AA 4D0BB 3ZYIA 4PI2A 2H2SD 4KJPC 4XP9L 3CC5B 4P57A 2XRAL 3SBQA 2QSTA 3GIVB 4KHTH 2FD6L 3HB3D 3BMVA 4TNVF 4JAMA 4H88H 1IAKB 1UATA 3K2UH 4NNPH 2DBLH 2OS7A 6PAZA 4PP2A 4Y7MA 1DDHB 2ICES 4UZGA 5CP7A 5I76B 2OULB 2JIXD 1NDGB 4HS3B 1OCWL 3EO0B 1RP9A 1JL8A 3C6SB 3F6IA 4H1LA 4LSTH 4NUGL 4OD3L 3K8LA 5CF3A 2CHDA 5CLTA 5E2VH 1YJDH 4Z77A 3NCYP 5KSAD 1OK0A 2L8AA 4O2FB 1T66C 3IK2A 1J1OH 5IM7A 5JQHC 1VFMA 1F3DJ 3R4RA 4N8VB 4BSWA 4XP4L 4JQVA 5EZOL 3IPFA 1P4UA 1O6VA 4KVCH 5J6HA 1UKTA 1WBYB 3SDAC 7FABL 1R33A 4Q9RH 3B9KA 1XF3B 1A6VH 3GHEH 3ARYA 4CSPA 2AKRB 2HVJB 3AQYA 4PJDE 4UTBH 2N3JA 4M8UA 3OF6A 3NOIA 3W0WB 4IYKA 2HKAA 4HJJH 4U1GB 4U1HA 3QARA 3S2CA 2P8LA 3QXUA 4CNIB 5DJXB 3ARBA 1A4JA 1ZA6B 1K8IB 4HETA 2EDRA 4KDTC 1FNEA 5INCA 2DL9A 1RZ8A 4GP5B 3ULVC 4OCXL 2YLHA 4NKMB 3ES6A 4JDTL 3O4OB 1T0NA 2JB5L 1QX1A 1F5WA 2ZG3A 1FIGH 3TEUA 1BVNT 1WZ1L 1MIML 1SN0A 1GGUA 5E8OB 2VL5A 3U7YL 5JW4M 2G9HA 4EOWL 2DQFA 2BSRB 2I5YL 1INEH 4ENZA 3E6HA 1OKEA 1EQWA 1II4E 2NX5E 3LSOB 4CJ1A 3IJEA 4MBRA 1VPOL 2ZX5A 3HOGA 1BQ5A 2G9HB 4OLXL 4OF6A 4J8RA 4TUJB 4PM1A 4ZXBB 3WJJC 2XICA 3BH4A 2GABA 2K70A 4TLSA 3T2PA 4DGYL 4P5KB 4EJ1C 3V0FA 5I1HH 4H8WH 3G04B 2DM4A 3HW7A 4N2DA 4HH9B 1W0WA 2OSXA 3VGFA 2FBRA 1WFTA 5T5NF 5L2JA 2F7IA 5LVEA 2VIRA 2XQYA 4GSRA 3RWCA 4DN3H 3QFJE 3D3VA 1HIML 3PDOA 3F5WB 1B88A 4K8RC 4N4YB 4XCYB 4YSTA 2B8OT 3GBML 3FN0L 2F8VA 3BKYL 3UZQB 4A68A 3E0GA 4PW3A 1NDTA 2Z31C 4AV4A 3LN9A 1BEXA 1HWGB 2ZZUT 2Y1ZA 4FHKA 3MRGB 4DK3A 1YEFH 3S8WA 2KPNA 4X0KA 3N1MC 2DH3A 1ZVSB 1I3UA 3ISWA 2EXSA 2W9EH 4OD2A 4K9EH 3NH7L 1RY7B 4KVCL 2A6KB 4ONFH 3KGSA 2NCMA 1T83C 1KT2A 1Y1UA 4XBPA 3WKML 4DK5A 1MFVA 4GAFB 4YL9A 4HC1A 2X89A 4NO3B 1LO5A 1JDDA 1ZA6A 3OZ9H 1XCTA 1CL7I 3L54A 4L1LA 3FSAA 1AC0A 1HHHB 4O58H 1NCWL 4P07A 4CVWA 2VSMB 3UBFA 3FBQA 5EUKB 2WVUA 1WCQA 1JGDA 1TQSA 1OAJA 4A7SA 1IQDB 5DZNA 2CM5A 4ELDA 4FERA 5D71L 4E9RA 3SYAA 4Y4HA 2C4FT 2AI0H 3O8XD 2UXTA 1SYSA 4KROB 3GS0A 3QDHA 2Z31A 4YDVB 4LVNC 2H6PA 4WFEE 2EC8A 1NMBL 1QSZA 1F8TH 3BCDA 3NABH 4RZKA 4Y2OB 4DGVH 3KXFA 5B8CC 2YD2A 5I16B 2Q8BH 1WEJH 5C2BH 3QDGB 3QNXA 2LV4A 2WLYA 1MUJA 1RUKL 3T1FA 3K8KA 2AS5M 5C07E 1U8IB 3FFDA 1ZANL 4J3BA 2PCFA 5KN5B 5KS9E 5EEVA 1GRWA 2PW1B 4YSSA 4WUUD 1J5CA 3LKOA 3EJCA 3S8GB 2NY4B 2A6IB 2VW7A 3BP6B 5MENB 5FYJU 4Y5XB 2M83A 2N7AA 3SOTA 5GRJH 3GO1L 4PPTA 1R24B 1G7LB 1E5ZA 2CLZB 2VERA 1BZOA 1SUJA 4L2YA 1NAMA 1C12B 4MQ7B 3VI4A 4ZMLA 1TT6A 1CIDA 3B1UA 2AEQH 4XNXL 3FT2B 1KTLB 4TS6A 3ROLA 4FQXD 1CF8H 4G8EB 3PHQA 4UIMB 3OMAB 2J55A 4D0DA 5DWUL 3L95B 1A21A 2AJ3A 5DK2B 5LWYL 1DBKL 2B1HH 2ZOTA 4ZFGL 1IGIH 1ASPA 2JTYA 2R0ZH 3LZNA 5I0VA 1JVKA 3MV9D 5AD0B 3UMNA 2ICWB 4WUUA 1CGTA 4W9CC 4YE4H 4DERA 2J44A 4YS4A 1UM5H 1ZKAA 2NY2C 1FZMB 4N6RA 4E9YA 2FWLB 1EGJL 1RZKH 3F7VB 3X2QB 5A40E 5KSVA 2ZOKA 3IDJB 4OT1L 4NUJB 4P2RB 3RDTB 3KYMB 5FF6B 1CYWA 1RZFH 3N5AA 3HG1E 4GRWF 1QZNA 3NJFA 1AIFB 3GSNL 3RWGB 5B3SB 4IU2A 5EWIL 1T2JA 1KPRA 5KJRH 3PJSA 1A6ZB 1ZT4A 2GJZA 2HFFA 3SDCC 2R1XB 5A2KH 1KV3A 1S8DA 4PJCB 1ZD6A 1KBBA 1NUDA 1TYRA 3OC8A 4PH8A 1FSKB 3RTLA 4ZMOA 3N40P 5KTEL 5D1QB 1GHFL 1HH9B 2CCWA 2VZ1A 2YBGA 2DQ6A 2H1LM 3C08H 4FTDA 2VXSL 1Z3GH 2YEQA 1B6UA 3P77A 1L7TL 5EPMA 5FA4B 3B1TA 4HKBB 4R90L 4FNRA 5I71B 2APXA 5KANI 4DW2H 2XXFA 4QRUB 5TDOA 3Q8AA 1OP4A 2YRZA 5HPMA 1K5NB 1WTLA 4JRXD 3LPWA 4N85A 1LEKA 3LH8A 1NUNB 3B6SB 5DSCA 3T0EE 5E8PA 5C0BD 1O7VA 2OSLB 5AVQB 1IEAA 4GSUA 1HHKA 3CVHH 1M2VB 2VO8A 3MV11 1XD1A 3VXSD 4MCNA 1XF2A 4QI3A 3FMGH 4K0OA 4X7FC 3FTUA 3A5VA 2R56H 2CHNA 4FXGC 1RULH 2AQNA 3DARA 4R7DA 1DBJL 3ZE0E 1BAFL 2IQAB 5CJQH 4LEOA 4CMMB 1L6XA 1PG7L 3IXTA 3VI3E 5I1IH 4GMTL 1XXDC 4X6CB 1ZHKA 2OA9A 4ZG1A 4MA7L 1ZLUH 4JQIH 4R4ND 3KJ6H 1KYOK 2BXZA 3BP7A 1ZIAA 5ALBH 3RVTD 2E7BA 3LPGA 2VDRL 2QPFA 1CTMA 4F9LC 5G4OA 5KG9A 5BUAA 4WO4A 1XF1A 2JKLA 4H20H 4L3EB 4PJGF 7TAAA 1BQHB 4E0RA 3DROB 5T1LA 3J07A 3H2WA 2WVVA 1EEYB 4PREB 5IB5A 3PYCA 3LKRB 3L3DA 2G75B 3HI5H 2YAFA 1JV5B 1HNFA 4AV5A 1XDTT 3GM0A 2M8XA 3DJRA 3VG0L 4M4RA 1TIUA 1MW2A 2XTJE 3EZ8A 4AW4A 3I85A 1U8OB 3LKRA 1X9LA 4G42B 1AFVH 5D2LE 3H0TB 3PWNB 1U91A 1NC2D 1R3LB 2DH2A 2VN6A 2IXQB 5D72H 2LU5A 2AFNA 2ZUQB 1W72L 3BLKA 5DWPA 4ZMPA 4GNKB 5KVFL 1MLCA 1WS8A 1FV1B 2DJMA 4OT1H 2FX8H 3CLFH 4XE5B 2K3HA 4OUOA 2ERJB 3T0EB 5HHQB 1PMYA 4YBLB 3DX6A 3QG6A 4KGJA 4P48A 4RDQG 1UM4L 3D0AA 1AACA 5DLMH 4BHUA 3VX1A 4DGUA 32C2A 3MRQB 1YCSA 5EBWB 1H8SA 1VERA 3OB8A 2Z8SA 3DYPA 3GK8L 3V0IA 1WFNA 4LRIC 1EBAA 1OAKH 3NIGE 1S7RB 3O3BB 3VXTA 2PWHA 5F3BB 5E8DL 4CDGC 3EDDA 1F18A 1FPTL 1U8QB 1VGEL 4QWWC 3TFBA 3IJYA 3MRNB 3QEGH 4FLHA 2O26U 2X1OA 3IGAA 3DI2B 4NLAA 2E8ZA 3U48A 3TNNB 3FCGA 4TL5A 4RMUA 2DEYX 4FG4A 2HLAA 1PQZA 2VLRD 1PZCA 1ZS8B 3PREA 4X7DC 3CHQA 3TM6A 5LGJB 3EYOB 5AYQA 5GS1A 3TT1L 4PRID 1DVZA 1IE5A 4M8QB 5HJ3B 4NPKA 1RD6A 4JFSA 1KXVC 3ALPA 1J11A 5F89B 3MXVH 3WI9A 1JDCA 1G4MA 1YY8B 2NTSP 2AV7A 4FCAA 1JGUL 3BZ4B 3R1GL 4L4VA 1JXJA 3JVGC 2Z9TA 4HK3N 3RY4A 1CDJA 3KHOA 1N6QH 4BXSV 3B7SA 1BXXA 5KSAA 3QJSB 2BJMH 2HRHA 4RGNB 4GMTH 4GRLB 2R29H 3IB4A 3KL5A 2EH8L 3QUZA 2BIOA 2LAAA 1F41A 5CZVH 1MZZA 4GW1B 5DMGD 3MJ7B 3PRZA 4HGWA 1OANA 5DHDA 3SDAD 4UDUA 4JO2L 3HZYB 5PAZA 3ZDWA 4B50A 1O5PA 3LZQA 4N28A 1F90H 1G7MB 1MI5B 5D4HA 2FBJH 1Z3RA 4QIRA 4PJEF 5CBAB 4ODTL 2YRBA 3N55A 1B9ZA 1ZAGA 1Q9WA 2X28A 5ALCH 3FXIC 4K55A 3CFTA 3LKSA 4UZUA 2GCYB 2XC8A 3QJTB 1CN4A 4IIQC 4PBDA 1AFVL 5D1XE 3KPQA 3P4OB 3K6SA 1ZJAA 1R3HA 1UWEH 3NABL 2R0WH 4NRXB 4B96A 4DGVL 4K5PA 2DB8A 3QNFA 3D1MC 4OLEA 1BGXH 3BI9X 3NTCH 4XPGH 1IBYA 4UQ3A 4UM8B 5HYQB 5BZWA 1JF1A 1XH2A 3NFNA 3NSXA 1BFVL 1KPRB 4RWYL 2EIBA 2C4XA 1J86A 1MPAH 5BS0D 2JJTC 4YHZL 1PJWA 3M17B 5DSCB 3TBTB 4OFPA 4L37A 3VDAA 1CTOA 3ARDB 4MDJB 4K3HA 4B95C 1BM7A 3GZOA 3TONA 1ETJA 3H3BC 3MOAH 4FNUA 2C1OB 2DQCH 4OJYA 4WU5A 1SZNA 2RQ8A 2YPLD 1ZMYA 2QT6A 5EU4A 5IUCA 1ZY9A 2ATPA 3G5VB 4N2LA 3BIAX 3AT0A 3C5ZB 4P99A 4AQ8A 1YMHA 4N24A 2OZNA 2IDFA 2Z7WA 5H37H 3DWTA 4BGDA 2QTEA 4ZDHA 3WOVA 1EO8L 1JG9A 4APQC 1CT8A 4U7MA 4LARL 2OTUA 2B15A 1A5FH 2IOOA 2ORBL 2YD8A 3NCXA 2OZ4A 3WDHA 4WO4B 3BD5A 3L4TA 5EBWA 1ZEAH 4ZAKA 4N6RB 3HC4L 2P49B 3FH5A 4F7CB 5BOZG 4TLUA 5JIIA 2HUHA 1R4XA 1F3RB 2OM5A 1BA9A 1MPAL 1U2YA 1GOHA 4IKKA 5D1XB 4ZSOA 3UP1A 5EEUA 1A9VA 1LYQA 2EDYA 2W0FB 1JK8B 2V5RA 4AIOA 1TZIB 1ZHLA 3OZ9L 2MQ3A 5HDBB 5DMKB 1LE5B 3O6FA 1CMOA 2GFBB 4YX2L 3V4PH 4WTZA 3AG1B 5DJ0B 1U91B 1YDPB 1URZA 1DQDL 4NZUH 2OCFD 2RMNA 3ETTA 4PJ5E 2XWJB 3CZGA 4FHJA 1T5XA 5F7YC 1A14L 2D7QA 2P52A 3HG2A 3I75B 3UAFA 3U9WA 1CFBA 2NUTA 1PIGA 1QAWA 3MJ9L 1YMMA 4KXDA 1FP5A 3KM2A 4XCEB 4A39A 1ES0A 2CIIA 5J1TC 2A9DA 3HC2A 3FQXA 4ICWA 5DT1L 1LE9A 4AUYA 3FB5B 3UO1H 3ZN6A 4NT6A 1DSFL 3RU8H 1XWVA 4AQ1C 1GIGH 2OP4L 1V05A 4NQXA 5IBUB 5IW6B 4HUKB 3ULUF 2CDEB 1BDYA 4OCMC 1MCPH 1S5IL 3S37X 3QJZA 4AJVA 4HWEH 4Z7NB 3VFUB 2H1XA 2X09A 3KCPA 4FNPA 1T21B 4PQXA 5D1ZD 3GHBL 3H4FA 4BYHA 2R56L 4DT2A 3FFOA 2NTFB 2VM3A 4ERSH 4LEOB 4O02H 2PO6D 3G6JA 3PG2A 2KQNA 3B7RL 1Y1DA 1QW8A 1EJOH 1H3XA 3ARFA 5GSVB 3QHZL 1ZVSA 4DF9A 3SQBB 1OL0A 4P3CL 1L3NA 4DP9X 1KJVB 3RG1C 2UWEA 3V4VB 4Z3IA 4HVBA 1JVLA 4E9XA 3BUYA 1PW3A 1BIHA 1F13A 2BHUA 1MCWM 4XO9A 4LGPB 3MN8A 4ZFOA 4OM1L 2R8SL 4GXVH 1MCBA 3UXFA 5BO0D 4GOSA 1YNTF 3DX8B 2WY3B 3DSFH 2OTWA 4FQXA 4DAGL 3QH3A 3GRWA 4OZFH 3C5JA 3OLDA 5D1QA 2XWTA 3D3VB 2HWZH 5GZOD 4JPKH 3DMMD 5INCB 3VG0H 3WY4A 3VRIB 1S7UB 2VUOA 4XMKH 1KJ3H 1UXLA 2GUYA 3QH3B 1WP6A 4M7KL 5E4EB 5HHVH 4R4BB 2Y2WA 5F1KC 2RALA 3VXSB 1INQA 1MCRA 3UZEA 2EEAA 2AXGA 4LE8A 3MNVA 3VI3B 1TCRB 5IEHA 4HUUB 4ZSOE 2QPEB 5F6HJ 2Z91B 3W0WD 1YEJH 2VLKD 3DGCR 1PLAA 1HU8A 2ADGA 4MHHI 3RUGF 1H6UA 3FTZA 4O02B 1IL1A 1OTUC 3O4OC 2PCFB 3NCYS 4NFDA 3ARGB 4S1SH 3TBYA 4XPFH 2QSCL 4PRPD 1SMOA 2Z1PA 1OE2A 1FLTX 5T1KD 3K1KC 4KOBA 5SWSA 3DXAE 3WL9A 5DWUH 5HYSG 1F11B 1MRDL 2DWYA 3BAIA 3IJ9A 1A7RL 4M5YH 5EZJA 4EXKA 4ZXBC 2WTRB 3VI4E 2HLFC 1QW9A 1ROWA 2WQSA 3ISRA 2V5TA 3X13A 1Q9KA 2DQJL 2PCXA 1G9MC 3GMMB 5GPRA 3LXUX 1J8RA 1SBBA 5EMYA 1UCBL 2CO4A 4G9FB 4Z5RB 2XN9E 4PGDB 4UF7C 4GXUN 3UTTB 5HDBE 2MOQA 2DWXA 2ZCKL 1MVFA 3NN8A 2JJUA 5DZLA 1URLA 4B0MB 1EAQA 4YSEA 5D2NE 4TNGA 2RACA 3BWAA 3G08B 2X05A 4L9LB 1F56A 2N0MA 2HTLD 3HVNA 1NM9A 4E41B 5T1KA 3EBGA 1R5VB 5GSRA 3VVVA 1NCDH 4ZZKA 1QUNB 3NCEB 5I5JA 1V7NH 1ZT1B 4UCFA 1LVEA 4UI2A 2C4FU 4FJZA 1OV8A 4CILA 4LRNH 1AI1H 4DQAA 1YEGH 1QEXA 5BO1L 1CI5A 3QIWC 5GGSY 1MRFH 4OM1H 1J9QA 3P40A 4KNSA 2H8PA 4DW2L 3OC5A 1SM3L 3HTLX 1UWXH 5JHAA 1EBPA 1I1FA 2DOCA 1AJ7L 3T6WA 4UILL 1UWFA 4A7UA 3V6FA 3LY6A 2QADB 4YIQA 3SPCA 2QSVA 1AS8A 1KJ3L 1H6FA 3I74A 5C08E 2EIMB 4TSCL 1SUHA 1OPGH 1BX2A 2ENPA 4RNRB 4EIZC 2ERJC 2GUOA 3FSOA 5F8RC 3O0RL 2ZXGA 2WB1A 4LL1A 5I1GH 3ZPDA 3A21A 2N56A 1J9CT 2GVYA 2VXQH 5E1IA 2LOEA 2EXYD 1HZHL 3PP4H 2BSED 3GSNH 1QFOA 3B2XA 4N25A 1HOEA 3FSZA 3GEFA 2IGFL 4EDWL 3LD8B 4WWNA 3M1BB 1WYJA 4NLHA 1J05B 1T0MA 4RGNE 3UBHA 4H8UA 5DMIH 2E5EA 2EKSB 2KYIA 2VDML 1NAKL 4JHVA 4OR1A 5HGAA 1WAAA 3RGVC 3UTZA 5F1NB 1CGYA 2CBMA 4RAUB 4S1RL 5DD0H 3SDAB 5GGTH 2TSAA 4HLEA 2R51A 2OYPA 1WVZA 5JPMA 2JXMB 1M3IA 1I85A 3AU0A 1NH6A 5CJBA 3GRGA 3V4VL 1J18A 4H5SB 4OGAD 4RGND 4QNPE 5MEPA 4PRBA 4OV5B 3PP3H 4PFEA 3VFGL 2Y72A 4Z18A 4BKLA 4BH8A 5DR5H 4FA7B 2WXPA 2WBXA 4JGNA 5AAMC 1TTRA 3S96B 2GPZA 3RUGB 4TRPH 2J43A 1CFNB 1DTUA 2BNQD 4A38A 5D7LD 3BGFB 2BC4B 3HAEA 3LCYA 1M1XA 1S6NA 4M6ML 4XO8A 1IC5L 1FVCB 2OYMA 4I5BA 3EGDA 3SDXA 4DP8X 4KV5E 4J12A 4Y2NA 3NRPA 2J8OA 2JJWA 3H8NA 4S11A 1PNCA 1FPTH 3TTSA 3C8DA 5DD0L 1JF5A 2Q87A 1RZ8B 2O6DA 1UYWL 5I23A 5AQ0A 5D1XC 3RZWA 4LSUL 1YEKH 5EO1A 3EBIA 2X2HA 3U4BL 4NT6B 4NFCA 2AK1L 3FU6A 1ZLVH 1Y6NR 4DK6A 4PBWD 3ZKQD 2PYED 2IADA 4PY8J 2GITA 3B9AA 5TGBB 2HVKB 3WO3B 4J4PC 2JCCA 1U8MA 4FZ8L 4FXGA 4W9IC 5I30H 5IBLD 1P0SE 5JDSB 1L6ZA 3S8FB 3V6BR 5E6UB 2X2YA 4TM9A 3KPSB 3PWLB 4I48A 3ARPA 1VACB 2X4SB 5HDQH 4JY5H 4RX4A 4UBDD 1YDPA 1PPIA 3WS3A 5CJXA 3JWDC 3ULUH 4AEHL 4FLQA 3CQPA 4O02L 5D1ZB 3SY6A 2M26A 2VR9A 5C8JB 1ZLWH 3RIFF 1AQMA 2YRPA 4UYQA 5I18H 1ERNA 1JV2A 2NLJB 2UZYA 3DGGB 2WXRA 2UZXB 3SDCD 3CDZA 2K1MA 3MOAL 3QUYD 1J7VR 1F0LA 2ZF8A 2EP6A 3W9EA 2MCMA 4NI3A 4NWTL 4DZ8B 4GIOA 1SHWA 3HHSA 4NWUL 2AK1H 1A3RL 1NGQL 3MJ8A 2WUCL 5EOCL 3NFPB 1GJIA 4HKZB 4MAUH 3BESR 3MOBL 2QFRA 3TYFA 1MDAA 4RA0C 1TCMA 3F00A 3MRDB 3TV3H 3V4PB 3K91A 4Z7UB 3DRTB 1JV5A 3FH7A 4M3JA 1CR9L 1BSIA 3AAZB 5F1IB 5A43C 5BXFA 2QMKA 4DH2A 4DVBB 3WIAA 3FTXA 4RMTA 3LKPA 2WN3A 4R2GD 1BQHA 5GRWA 3BX7C 5I1LB 3QGVA 1D2OA 4FYTA 4FE9A 1VPOH 3K6FA 5EC1A 2IH3B 1S9YA