2XJKA

Monomeric human cu,zn superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Folding Catalysis by Transient Coordination of Zn2+ to the Cu Ligands of the Als-Associated Enzyme Cu/Zn Superoxide Dismutase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2xjkA00
1OEZW 1FUNA 1IBHA 1Z9NA 1E9QB 1TO4A 2ZKWA 5KBMA 1HL4A 1YAIA 2WYZA 2AQSA 3PU7A 2C9VA 3HOGA 3KM2A 1BZOA 1N18A 1F1AA 3HFFA 2GBUA 4FF9A 1SXNA 2VR6A 2GBVA 3MNDA 2WZ6A 1F1DA 2AQRA 1XSOA 3QQDA 1SOSA 4OJAA 1AZVA 3CQPA 2XJKA 1F1GA 2LU5A 2Z7ZA 4BCZA 2Z7WA 1E9QA 1UXMA 1Z9PA 4A7SA 3GQFA 1XTLA 3LTVA 1SDYA 1DO5A 2C9UA 4A7UA 1PTZA 3T5WA 1CB4A 2AQPA 3SODB 2Z7YA 2Q2LA 3S0PA 1KMGA 1OALA 3L9YA 1IBFA 2E47A 5KBLA 2XJLA 1XTMA 1YSOA 1PZSA 4BCYA 1YAZA 1JCVA 4N3UA 1CBJA 2SODB 1SXZA 2WZ0A 1RK7A 1SXAA 2WWNA 4A7QA 1OZUA 1JK9B 3KBFA 1F18A 1U3NA 2WYTA 4MCNA 4OH2A 3KM1A 3L9EA 2AQTA 1SDAB 2APSA 2NNXA 3GTVA 3GTTA 3GZPA 3KH3A 2VR8A 1EQWA 2ZKXA 1SXCA 2K4WA 1PU0A 3H2PA 1L3NA 3ECUA 2E46A 2Z7UA 3KH4A 1OAJA 2ZKYA 3GZOA 1BA9A 1SXBA 3HW7A 2AQQA 3KBEA 1B4TA 1UXLA 1JK9A 1IB5A 4L05A 2ZOWA 2JCWA 1HL5A 2C9SA 3MKGA 1B4LA 1TO5A 1E9OB 4BD4A 4MCMA 2V0AA 3K91A 3H2QA 1EJ8A 3F7KA 2WWOA 4U4IA 2WKOA 1QUPA 2WKOF 2AQNA 1SRDA 1P1VA 2VR7A 2WZ5A 1E9PB 1MFMA 3GZQA 4A7GA 3CE1A 4A7VA 5CU9A 4A7GF 2R27A 2JLPA 3ECVA 3F7LA 4B3EA 3ECWA 1N19A 1SXSA 3CQQA 1DSWA 1E9OA 5KBKA 2AEOA 1Q0EA 1IBBA 3RE0A 2AF2A 1S4IA 1IBDA 2GBTA 1ESOA 1SPDA 3QQDB 1COBA 4A7TA 1E9PA 1OZTG 4N3TA
chains in the Genus database with same CATH superfamily
2COQA 3L95A 4Y4KB 4M7KH 4N5ED 4JFDE 4YX2H 5I6OA 2WTPA 3SKUD 1SHMA 4FJYA 2APBA 1JK8B 2RHEA 4UUJB 4HUCA 5IOKA 5D7KE 4OV6F 2GSGB 2GBUA 4LLUB 3FK3A 3HI6H 5T1LB 4L4VD 3TVMA 4MJ2A 1OY3B 4DP1X 4N90E 3FCSA 2X1WL 1XF1A 1IVLA 3DX3A 3Q2CA 5G4MA 4XCYA 1RIVL 1MJJA 2CD0A 4WUUB 3VGEA 1T0OA 3W9EA 2DIJA 2NY1D 3KL0A 3SDCA 3QG7H 1BVNP 1S9YB 4ODXA 4X7SL 3UXFA 1P7HL 4WHDA 1IGTA 3HI5L 3A23A 1KELH 1G7HA 3SY0B 1WVZA 3WD5H 2DYPD 3CLWA 3WTVA 1WBZA 3M17A 3WFHB 5I74C 3ZTJG 5JA9A 2YFNA 3MLRH 4UAHA 3UH8A 3BLBA 5C0BE 2WD0A 2DYRB 3UFIA 4PREA 4RGMC 3UBXA 3FQTB 2YA2A 2VZSA 3MBXL 1INDL 3O6FA 1ZTXH 4QY8A 1YNTF 4P2YA 3PGDA 5CGBA 2QDVA 1KN4L 2E7CA 3DGCR 1I9IH 3B3IB 2YOCA 4Z7UF 2WXMA 3WNMA 1NLDL 1WBXB 3DX2A 3NEEA 4NZRL 5EU6B 4NQTA 3GZOA 3U4BL 1I7UB 3EIFA 2OZ4H 1OGTB 2DJ4A 1OLZA 5LAPA 2B4CH 1KIUA 4Z78B 2DBLL 3FTYA 4YL9A 1CFVH 1FV1A 2V2XB 1QSFD 2P5WB 2Q0ZX 4ZFOL 3IE9A 2IBZY 3EBAA 4KV5E 1GCFA 1HNFA 1MW0A 3MODH 4FFVC 4TSCH 5A2KH 4XNZB 4IBVA 1RZ8B 3P69A 2JQZA 4H8HA 2OMUA 4J8RA 2XQYK 5FFGA 5TE7H 5HGHB 35C8L 3RGVD 5LQBH 1W0WA 3PHOA 2NDFA 1J05B 3VXTB 2EH8L 1BVOA 1J1OL 4OAWA 4QOKA 1XQ4A 4MJ6B 4PRIA 4DQAA 2NZIA 4PJHB 1P2CA 5D5MB 1RFDL 5KVEL 2PXYA 4RNRB 3DSFH 4EXPX 2IAMD 3N85L 3P02A 3SKMA 2OXHB 5KSBE 4FNPA 3GUTB 1HWHB 1DEEB 1KTBA 2HPOA 4GMTH 1CDUA 2ZXBA 3L3OC 4ODHL 2CGZA 3D25B 1FYTD 3MACL 4IGBD 1HINH 1YMHA 5T5NF 1QQDA 4MB5A 3QA3B 1TZHA 1JV5B 4PJIA 1PCXA 1ZGLA 4PLKC 3UZEC 3ERXA 4B97A 3TBCA 3S97C 5GGSA 2J6EL 1QTPA 3OF6D 2PW1A 1M42A 3DXAE 2F1AA 1KV3A 4AV4A 1MPAL 1R3JB 1KEGL 3EJYD 4WU5B 5ECJE 1KIRA 5IM7B 1QFUL 1RUAL 4BWUA 1EZLA 2WQAA 1WTLA 4TF4A 2NY0D 2OTWB 2X4TA 4L9LC 1Z1WA 3D39E 3ARFA 2F7RA 4LBEA 1FZJB 1FCCA 3SOTA 4P4KD 3MFFB 3O3BB 3UZQA 3NRQA 1A6WH 2VMDA 5C0IA 4X7CC 1T6WA 2CLRA 4X4XA 2KZBA 4Z8FH 1BAWA 1S9VB 1MQ8A 4IRJD 5DO8A 1TZGL 3HRZB 3BSZL 4E9LA 4RFOH 5GZOC 1A9BB 4G8GA 3HKFA 5GRJH 5J12B 4QMEA 4Y5YA 5GS1A 1I85A 4NDMB 5DJ2B 2ZCLL 1SXZA 1XB3A 3OL2A 4MA7H 3LRGA 4JFFA 1WZLA 3NGBB 5FO9B 1HCFX 2J71A 3CZFB 3F64A 4JFOA 1GXEA 4AM0Q 3I3DA 4WU7B 4XGZA 2BINA 4NQXB 4ZS6D 3OAZK 3O3DB 1RXLA 4LVOB 2HFFA 1KCVL 2W8CA 2O61B 1JGVH 2Y25A 3J7HA 3ALWA 3ZLQC 4O9HL 1B4RA 3REWB 1KPRB 5LO7A 5KVEE 4Y4FC 2H45A 4M8UA 3WFZA 4Y9FA 2XYBA 3VGDA 4G6JL 3RLSA 2CO1A 1P6AB 5E8EB 1D7DA 4ZI8A 1T03H 4B96A 2HVJA 4EF3A 5C0BB 2NYZA 4YPGB 1BJ8A 5DK2B 3OHXB 2FJHA 5LLIC 1FSKB 3KXFD 1LHZA 4EIZC 3EFFB 1JYXA 4JG1L 2VL5B 2WSPA 2MCAA 1JZ6A 5DEGB 2WO2B 2GJ6B 2EICA 3JWNC 5D93C 1Q9OB 4OT1L 4LOUC 1FLRH 2FT7A 4PJXA 1U8LB 2H3NA 5DUMH 3PDOB 2VLKD 3LQZB 3D0VA 1ULVA 4Y1AE 4KQ3L 1EJ6A 2WANA 2HJFB 4ZUSB 1XCQA 2ZTBA 2DJUA 4W6WB 3G6AA 1P7KA 3HMWL 5CCKH 2UYLA 3GMOB 1XF2B 4MRBA 4KVPA 1TVHA 4HIEB 5DVNA 4E5XA 2CUAA 3HCVB 1RVFH 2N56A 4LPWA 2AXJA 1YEDA 4MSWA 15C8H 3T6XA 2RJMA 3O2WL 3R06B 4JEGB 1BQUA 1QEXA 5FHBL 2H8PA 2NZ9C 4RWYL 2YUWA 2X89A 4ZNCD 5FOBB 4KDTA 1I8LC 2G9KA 5CO1A 4YHNB 5IQ7L 1KCWA 1TTFA 4MZRA 1QNIA 5I9QB 2VW6A 5HI5C 2IJ0C 3ME0A 3V5KB 2HT2C 2P42B 4GXVL 2H41A 1JV2A 3GTNA 4TQIA 4EI5B 3OXSB 5JMOC 4EXKA 2Q5BA 3W2DH 1TITA 4JQXA 2VDNH 2YEZB 5BNXD 4F8LA 3IMWA 4JRXD 5KSBB 3F12B 4ODUA 2EECA 4Y4KD 3IDYC 2NR6A 1ZDSA 5DK0B 4AK2A 1BAGA 4QHNA 1E2WA 3LEVH 3MJGX 1A1OA 3AQDA 3ZDYF 1BSIA 3RVWC 3IJ8A 4L3AA 1AG6A 3WOVA 1RSFA 5T1LD 3Q3GA 1T6VN 1BQHB 4Y4HC 5D4JA 3HUJF 4TQPA 3T0BA 3LNFA 3OZ9L 3P30H 4R5VA 4J8QA 3ARXA 3QULA 2XKNB 3MLTB 1ODUA 3CFJB 4LPCA 5T1MB 3I9AA 4WUUD 4KROC 2OTUA 4QRSA 3SDDC 5KOMC 4CVZB 2Q7YA 1F0LA 3DXAB 1OSPL 2EXTA 1XXDC 1F18A 3VGFA 1MFBH 2GG1A 3VFGL 4F2EA 3GXMA 3PDGA 5I0YA 1DQIA 2EKJA 4N25A 1JPGB 1FFOB 2GI0A 1GPOH 4WFFE 4MA8L 4PLJC 3H2PA 4PV8A 2XVBA 4HWBA 1KCSH 3G6DL 3L3DB 4G9DB 3JV4A 3UTQA 3GC3A 4KKNA 3W39A 2GTWA 1JPSL 3KPTA 3B9KA 4HMCA 4CN6A 4Y16B 1F3JA 2G30A 1A6AA 1JDAA 1RPKA 4M61A 1K8DB 4HJTA 4XRCB 3OXRA 5GRXG 4J5VA 1G5GA 3LXCA 1NMBL 4JPWH 1OSYA 1SHSA 3ZHLA 1SVCP 1UYWL 4EI6B 3EYVB 2YR3A 1FJ1B 1E40A 4NC2B 5HYFA 4HXAL 3KLDA 3EO0B 2FEJA 4FTDA 4JN2A 5EU6D 5GGUB 4ZFOB 4BFIB 3L6FB 3OMNB 1H3TA 4Y7MA 1RHFA 2Y5TA 3EYUL 5HYQB 3AGVA 1I9EA 4RQQB 2P5WD 1VFAA 3EO9H 1KJ2L 2OMZB 2P46B 4RX4A 3MRCB 1TG8A 2J8UE 3BO8B 4HWNA 1NMCC 5SWSA 2H6PA 2ZOKB 5ECGA 5HHXH 2W9EL 1R5IA 3DROA 4NO2B 2O5ZL 4OCXH 5INDA 4HALA 4HJGA 3IDUA 3LPFA 1QLFA 2LU4A 4ENEC 4AQ8A 4JQVA 2VNCA 5FDWB 4JFYB 5AL8A 1O5PA 4GG6F 2EE3A 3VMOA 3FQWA 1TVDA 1YUHB 4AGNA 5KJRL 2EABA 3FQXB 3WJMA 1IAIM 2QZQA 4QRRA 5AAMA 4Z7VE 5I1LB 3BUYA 4HD5A 2V3EA 4Y1AB 1KBGH 3P4OB 4NHUA 5I1DB 3WG7B 4GINA 5DQJA 3OKOA 3IDMA 4LASL 5JHDE 1B4JH 1BGXH 5TE4L 4ANVA 4BFKA 4N87A 2CH8A 1T2QL 1S7UB 2ZE0A 2OV0A 4G6KH 2YUXA 3P2TA 2EQDA 2WVTA 1WAEA 5H94B 4MDJB 4OF7A 4RRPM 4ZPVB 4OM0H 3JWOC 3QO0A 1KMGA 2NDGA 4IKKA 4OI7A 1I53A 2DJSA 4GW4B 1PEZA 5DZ9A 4YQXH 3SSGA 3TVMC 4JANB 3OGCB 2QVKA 3MLUH 4LHUG 5FFLA 4YHYB 1XF4B 4J3WA 1OD9A 2FQFA 4GFTB 4U1NB 1I7TA 5F72S 2X2UA 2HRPL 4R2GB 3H42H 3LKRB 1UT1A 4X8CA 5E9AA 5IQLA 5HGBA 1QA9A 3B43A 2F5BL 2WSDA 1YEGL 4OBRA 4Y9BA 2NYYC 2AK1H 3ARQA 5IBUG 5AALA 2ERJB 4EBQH 2ATKB 4ZTOL 5J11C 4OCYH 1BIIA 4X80H 5D7LE 2HT3D 5C0AE 1O6SA 2OI9B 4PY7B 4ELMA 2QHRH 4OZIE 5TFSH 1JZ5A 2BNRA 4PCTA 5I76B 1BM3L 5D7KD 4PRNB 5IMOA 4G5ZL 4ZW6A 3VVWA 5CMAB 4N90D 1NPJA 4FC3E 3O6FC 4X5QA 5I73B 1VGEL 2WNGA 3D2UA 1DZ0A 3LXUX 5LCVH 4KTEL 4F7MA 4XMLH 1P7BA 5EUKB 3O6LL 4UT9A 5AWNL 1XCWA 3DETC 5T3ZH 1MFMA 3VG9B 2IADA 1JWSB 1WPCA 5C0RH 2DLEA 4RMWA 3PS6A 4K5MA 2WLKA 4WI6A 3CN2A 1FFTB 5C0BD 4IDJH 4XP1H 4M7JH 1U9KA 1DQTA 1N70A 3IJSB 5D6DC 2BP8B 4HSQA 3FSAA 4JL1A 4TPRH 2I25N 3LHAA 2GJ6D 4XTRD 3FUEA 1JYNA 4C83A 2Y6TE 5F1NA 3BHBA 4HW6A 4P9HC 2X2YA 2MCPL 4L48A 2R0KH 5ACLA 3WSQL 4OZGA 3QXAA 3T6QC 1WUZA 3CDZB 3FUJA 3PREA 5AVRB 3P4NA 3HI1B 3VFSA 3VXUE 2KQMA 1FL6A 3IYLW 3TO4A 5ICUA 4YDKH 1BZ7A 3EW3B 5JQ6H 3VA6A 4PS3A 3AQXA 5HDQL 4P46C 2C3XA 2H9GA 1KXQE 2EEBA 4N2AA 3VFTA 3VNYA 2DQEL 3QJXA 1INQA 3AB0C 3TCXA 5TDNB 4FFZA 4TXVB 4FA8A 3TJHD 1TNNA 1ACYH 1M3IA 4Y2OA 1GJWA 1HTYA 5C0FB 1YMMA 1U8KB 2X2HA 5ID1A 1CD9B 4HZAA 1MF2H 2H1PL 3QDME 1G9NC 4UQCA 3QNZA 1LP9F 2PWGA 1I3VA 4UM8A 1CLCA 4XZUB 3DO3A 4KMTL 1NFKA 3R7RA 3MRJB 3HE6C 1BWWA 5I8CB 5IJKA 4BZ2L 4UIKL 3L5WA 2BLFA 2W07A 1ZA6B 3NVQA 5EBGA 1G7JA 3UTSA 4MCNA 1LYQA 3FN0L 2V7NB 5AB1A 3M1OA 5EB9A 4PS8A 1NA8A 3KBPA 2B0SL 3AFLA 4YDLC 3AS3A 5CJOH 1KBKA 4JDEA 5JA8B 4IJ3C 4JS7A 1IM3B 4IM8A 3SOBL 2NSMA 3CG8A 3G9VA 5JHLH 5B1AB 4YHLH 3EJRA 1I85C 3GM8A 3DXAD 4FXGA 3B9DA 4PJ5B 2CNYA 5F88B 1MFAH 1KB5B 2NSQA 3VRLF 3WENA 3K74B 3WY2A 4KNTA 3HS9A 2WO4A 2B8OT 1SLUA 2FX8H 2A73B 3PWPB 3RFRA 3I50L 3F7KA 5GS2H 2YSSB 4WNJA 1FZKA 3WEXB 1NWOA 1JZ3A 1SRDA 3PAYA 4NZTH 4K94C 1T1WA 1ET5A 4BE5A 2JLPA 1G9EA 4Y16D 4C47A 2CLVA 2HWZL 1E90A 2XN2A 1TZAA 4JX0A 1SJVA 3ZE1E 3PABA 2VMFA 2V9QA 4WNQB 5D7LB 5C0AB 3VG0H 2VLRE 4DZ8A 3PNRB 1D5XB 1FE8L 1KZQA 4ZOCA 1S7SB 4HEME 5CP3A 5CEZH 1EDQA 1FNFA 4GSDH 3VDBA 1ZVSA 3O2VL 3WNOA 3EJQA 3UERA 1RD6A 4XPGL 5D96B 3A67L 3BAYA 3BPOB 2OX5A 4X8JA 3QUYB 1IBHA 1I3GH 4XAWH 4M5YH 2VE6B 2BWIA 4JFPB 2ICWJ 3C09B 4DFIA 5IBTH 1QSVA 3PGFL 5JOFB 1H0DA 5K39A 1Q90A 2WZAA 4AG4L 4KTDL 3RGBA 4N26A 4CC4A 1MSPA 3FPXA 5FK9A 4GRMB 5HHPA 4PVBA 2FQDA 1XBRA 1BJ1H 2GBVA 4JE4B 5KN5A 5DD1L 4OZ4B 5DR5H 5IB3B 3GSVB 3BP5A 4EIUA 5I18H 4ILDA 1RU9L 3BCDA 1GZQA 2OL3A 3LQAC 2DWDA 2Z65C 4G8FB 3GBNH 2X0WA 5IV2B 4U3SA 3QXTA 4QHUA 1GJUA 3S7GA 3VFOA 5TQ0H 3GMPA 1ZT7B 4OSUH 4XNDA 3S3SA 1G94A 3IFLH 3W0WA 4HK0B 4XODA 5EEVA 2CK0L 1NGWA 5CCJA 4Y19B 4ZMYA 3WHE1 4DEPC 1WDAA 1EDYA 1M7DB 4PIBA 5JW4M 4K71B 2B7DT 4IK7A 3ZTEA 4U1IA 2PYFB 4Y1AD 4A55A 2Z8VC 1F58L 3PP3H 5IROA 2JXMA 5GJTL 4J3OG 2NY4C 4PRPA 3FUHA 1OF2A 3MRLA 4XBGA 1FNSH 3RILA 2NR6C 5J4MA 3ULUL 3GBLA 4H1LG 1BAFH 1YY9C 1Q1JH 4Z9KB 2H0EA 4WJG3 5J8OA 1N2RA 3E8VA 4DKEH 4CSZA 4U6XA 3GBEA 1M1XB 4EVNA 2LVEA 5LBSL 1QSEE 3JTTA 2GYSA 4JG0H 3BLPX 5JDSB 2OQJA 4WHCA 4R2GD 4J6RL 4YK4B 4ONGL 4WY7L 4HWEH 4P99A 2F19L 3BYTA 5IP4A 1ZS8B 4N0CD 2F0CA 3AU1B 2WP3T 3U2IA 3KJ4C 2BIQA 2IQAA 4ZX5A 3SE6A 1XGZA 1OAYH 1ITBB 4E2OA 4XPAL 1PVHA 3WL9A 3FQ1A 3KLAB 4QRQB 1YNKH 5DRXA 4OZFG 1U4EA 4V2BA 2EDXA 5DD6A 3SGEI 5D7EA 5F97E 5LXGH 1M71B 1IGCL 2CO6A 2HVBA 2PO6C 5FKAB 7FABH 2IIJA 4HQQL 4HA1A 2XWRA 1YYMH 8FABA 1AGCB 5EORH 4X98B 3OC5A 1WD9A 2Q2EB 3OPUA 1MFUA 2DWTA 1ZKAA 3EBIA 5HGDA 2YRPA 1LWHA 3TCLA 3CFDB 1QR1A 1L7TL 4IIQA 5EUOB 5AW4B 3WE1A 5KVGL 2H2PC 5JQIB 1EGJA 5BVJA 1AFVL 3MNVB 4WWKA 2QPEB 2Y5QA 2ZSWA 4FOMA 1DE4B 1IAKA 4JO3H 1XIWB 1YDPA 4IU2A 3KDPB 4JM2F 4WFFD 2B1HH 3I02A 5AZEH 3VQLA 4JJ5B 1A64A 1XGPB 4JY4B 4MXVF 1FO0L 1DR9A 5C0DA 3PUCA 1F4XH 4LU5L 3P3TA 2YAEA 3ZKXB 4JZNA 1WCBA 2QSCL 4JM4L 3FTSA 4TSBH 5K9QG 2ITEA 3H85A 3M86A 4MVBD 2D31B 1IGJA 4ISVA 2IOMA 4JQIA 2NXYC 3EOYG 4AQ8C 5KVMC 1YYLL 4LKXB 4NQEE 3ULUE 2XTJE 2B5IC 2HP4A 3CVCA 1QMUA 1OP4A 5F0PB 4MNGA 1JZJA 1R3LA 4FRWA 4KKQA 4WZ9A 4HX1A 1DEDA 4TUOB 3ARGA 5IESL 3AG1B 1MHPL 4XX5A 3UBFA 2BVQB 4KHXL 1THCA 3FUDA 3ZT5A 4R4ND 2WP3O 5ITFA 3D18B 1C16B 5HDBF 4PJ9C 5ABZA 5SX5H 5BXFB 4Q0XH 2C1PB 1TZ8A 3GTVA 1U2HA 1U3HC 2LABA 3BKML 5FCUH 4FNLH 4L4TA 4PD4J 1IARB 4RGNE 1OM3H 4D0DB 5EEWA 1YRKA 1P4BH 3N6YA 5JW3H 4DAGL 2C7FA 3NQIA 1QUNA 3HC4L 1GGBL 5F6HI 3FXIC 5IVZA 4RZCB 4XBMA 3U30C 1XGYL 2ZNWA 3WMPA 2FJUB 1OAZL 2JCWA 1ILSA 2KS0A 1OO2A 4R3SA 1LMIA 3L81A 3NJLA 3C6LB 2ZSVA 3LKSB 5DJZA 3CV5A 4QDGA 1ORSB 5F7EH 3L3GB 5KVGE 1VFBA 5GHWH 1IRAY 2DKUA 3N50A 3B4NA 1IM3D 3P9LB 2YAHA 4PJ7B 4YN3A 4XWGL 5IGXL 5MP6L 5DJDA 3L16A 5B38G 4YR6B 3MXWL 3VACA 3UC2A 3IFPA 3ESVF 5D7HA 3VFVA 4GBXB 3GHEH 3QG6B 4PJ5D 3X1FA 4QKXB 3RVXC 1AACA 1A1MB 5EIIG 1E50A 2YMOA 3PWPD 1A9VA 4XOBA 1ESOA 2BJMH 4HKBB 5IEHB 3LVTA 4AMXA 2CJ3A 4AE0A 4WO4B 4LLDB 3Q1SL 4DPAX 2OA9A 3LEXA 3ZTNH 4QRTB 2RAMA 4PWHA 4I48A 2V5TA 3DX6A 2Z31B 4RMQA 4Q97A 5HPOA 2BDNH 4I9WD 1X4ZA 5D7LD 5C0AD 3SCMA 4ZNEE 3LS4L 4XMXA 4AYMC 4IEFA 4JCWA 4LF3B 1S7RB 4X6BB 5JIMA 1UCTA 1NIAA 1RZIB 3NH7L 1WIPA 3F6JA 3MYZA 3BAJA 1BW8A 3BGFC 4JW3A 1V54B 3ZMNA 2DL2A 3F58L 3UGEA 1VZIA 4F3FA 3B2DC 5IFAH 4P49A 3QUYD 5I16B 3MLSL 3TYFA 2I7SA 3EYSH 3UTPD 5CILH 3PGCA 1CZ8H 1PKOA 1NCBH 3BZEA 4OGYL 5I1AA 4O4YH 5K93A 1Z9SA 1XSKA 4A2EA 1FC1A 3SYOA 3HNSH 1FFNB 4LMQE 4LEXL 5BV7H 4GAGH 1DBAL 2V5MA 3LOWA 1YY8A 4UT6H 5JO5B 4B9CA 4NX0A 3F65A 3K6SA 3QJOA 5D7IA 3E0GA 4DKFH 3SBWA 1KEMH 1X7TA 1RHHA 5HJ3B 4AQ1B 3WMSA 2ZKHH 4FQCL 4Y19D 3UEZA 3JWDC 5JUEL 1ASOA 2JIXB 1LGVA 3KWVA 3PG2A 5J1TC 2GT9A 4IS6A 2Y6SD 4OF5A 4E9VA 9PCYA 2A5UA 4G7QB 3QRLA 1I7RA 1T0PB 1DJYA 2XTJB 1J9SA 2ZT9C 2NY7L 4X83A 5DMJB 4FAAB 1E7UA 4XCEA 2WN3A 3WUWG 3KWXA 4MHHG 5CD3A 4LL4A 4I3GA 2XIDA 1D6EA 4FXKB 2C9SA 1XX9C 5CZVL 4PB9L 1NM4A 4LSTH 3V4PH 4PWEA 2NW2A 3K91A 3GSUB 4CADB 1JFQL 4AI7A 4MAZA 5IHUH 4DN3L 4H25A 4FQ2L 1F6AA 2QFPA 1EH9A 2P45B 2X70B 1OQOA 4BKLB 5DMGC 4O2EB 5JIKA 4EJ1C 1A3RL 3CHOA 5FLVA 4LNRB 4M62L 2WOYA 3OG6B 2R27A 3L3IB 2RCSL 1AGEB 1F5WA 2DEXX 2MOGA 4JMNA 1Y18B 1F11B 6CGTA 3MV9A 5K5YA 4PJCB 4FXGC 4OF6A 1A14L 1JSYA 3ZDZF 2WM0A 4TNVK 4ERSH 3QZWG 3SDAC 3CUPA 5F3FA 5D55A 4EDWL 2F1EA 5E5LA 5GS0L 5JIPA 4GUQA 3QPXL 3UO1L 2BSBA 3MUY1 4MJ5B 3NJGA 2QPDB 3UIZA 1CDGA 3PQYE 3TCTA 4Q2ZB 3NJJA 3NIFE 4FQIL 4UQIM 1A8JH 5CLTA 1KYDA 4OLVH 4LRIA 4L4VA 3VH8A 1OPOA 2KQNA 1MHCB 1P5VA 1GC1H 1CI3M 1ZSHA 2HG5A 4APQB 4TNGA 3H9HA 2V7HB 5J13B 2DWYA 3V8CA 2ED7A 4PRDB 1GKEA 2X4OB 1QAWA 1AZVA 2AEPH 2BRRL 2YQBA 1F1GA 1JP5A 3IRCA 5GRZA 5I66A 3FU8A 3F6LA 1QFWL 4ALAC 5CLWA 5FA4B 4CSSA 5CZXC 1OTUD 1XIWD 1QG3A 3DX0A 1E4WH 5HI4C 1JD7A 2DYPA 2A6KB 2ITDB 1H5BB 5I2IB 4NRYA 1R3KA 3P3UA 4KI5C 3QFJE 4PJBF 5F7AA 3X12A 2VQ4A 5IG7B 1D5MA 3FSWA 3EUDA 3QORB 4FQQB 1R9FA 1HL8A 1BXAA 5L4IA 4Q9BA 2VDOB 2X7LA 4BQ6A 3O4OB 3EGXA 1KG0B 1HOCA 1AH1A 4OJCA 4NM4L 3VYNA 4QO1B 2XNAA 3BQUB 3E9UA 1BVZA 3G6JB 2AJXL 3VI4E 3OJMB 1L9NA 3BIKA 3NP4A 1LEKB 4WFGE 1A4KA 3AROA 3PYCA 3QXWA 4ONHA 5DFWH 2X4QB 3UC0H 3KMDA 3FB5B 3HPJB 1HEJC 2C8NA 2GCYA 1WAAE 4B50A 3CX5K 4AH2A 1TKWB 4E42B 1ZY9A 3OAZH 1U8NB 1PY9A 3OPZH 1NCWH 4M8QA 3F5WA 3EG9B 4OUUA 2Q8AH 1RIHH 5C7XH 5J0BA 1QSFA 4MX7B 1FH5H 5IROC 4XMTA 5MEQB 1ZK5A 4NQSB 3O3AB 1PQZA 4POZD 3ZHDA 5L8KB 1ADQA 1UB5B 1KGUA 1EEZA 1BFVH 1HHIB 2JI1A 3RGVA 2RTTA 3OLDA 3IDJA 4FHBD 3IBEA 1E8YA 3NPSB 4U1KB 1IC5L 1H8LA 3PF2A 5FXCH 1P4LA 3PHQA 3FH8A 3QXDA 4JHBA 1ZPLA 4V2CB 2IAMA 3RZWA 5SX4I 3S3PA 3F8UB 3QUZB 4FNTA 4MQXC 4CU6A 1RZPA 5TGBB 1YN6A 1OE1A 3DBXB 5EZPA 1W72L 3P9MB 3Q9QA 2WJ7A 1YHPA 2CE6A 2R2BA 3B83A 1HXYB 1WS8A 2P80D 3E3QC 1NFIB 1KB3A 2YRLA 1S4IA 3C6LD 3MXVL 4IGBA 1FYTA 5DUJA 5SX4H 4Y1SA 4DGYL 3W5MA 4GQ9L 5INCA 4OFPA 3MDJA 4U7SA 5T33H 2H4EA 4FLRA 3MVSA 4X7FC 4UF7C 4G6ML 4TM9A 3I6SA 4WV1C 4JUTA 2E4FA 3OF6A 3WTWA 5EZLA 2HJKB 4GBXD 4NKOB 3DKHA 5TJWK 1RZGA 3O41B 4NN7B 4QHPA 1NBYB 3FONB 4UI2A 3OZKA 3V52H 1KGYE 3FT9A 2IAAC 3RGHA 2VLJE 4WQOA 4XBPB 2KL6A 5EZJB 1LK2A 4F58L 4R0LC 5IB4B 1MVUA 4L1BA 2IG2L 4WEEA 5CFHA 1BFSA 5HHVL 3C8DA 2EXYC 1C12A 2AJYH 3BKCL 1WISA 3GJEB 4WO4D 5DSCA 4P4KA 4OCRH 1SFHA 5AUMA 2A9MH 3C5JB 4AYFA 2R0ZH 1CGSL 2YPVA 3HLAA 3MOBH 2VXUL 3MUJA 3QZLA 4LCIH 2Z31D 4MNQE 2XA3A 4MXQC 4EN3B 4IRJA 1ZHKA 1O7DC 5IMMB 1G9MH 1JOIA 4MMZC 2PYEE 5IIEB 4JKKA 1DBKL 1Q9KA 5AOJA 3WN5B 1L0YA 4TLTA 1NIDA 1YPZA 4PGDB 1XGUB 2SEBB 4PRHE 1TVBB 2IF7A 3NIFB 3G04A 3LN5A 2WQWA 3LPGA 2QLYA 3R4RA 4FNUA 4L3EE 2OYPA 1OSZB 2J1KA 2BVYA 1E5YA 2EYSA 3QHTC 3MRGB 4HUWA 5CR8A 1SBSH 1J88A 1OB0A 1KLFA 1V7NL 2ZOLB 2YD4A 5GRVK 4B9FA 4BSVB 4PGBB 3IRZA 2PPDA 1HHJA 1IC1A 4OF0A 3TEZA 3WFEL 2VR3A 4M93C 3S37L 1A02N 3MJ6A 4O2FB 1RJLA 3WU1A 1M9WA 3X3FL 4JHAL 1AZRA 2OXGA 4Q6IC 2F74A 1VCAA 2IH1B 4H40A 2Q10A 4XVSH 4GY4A 3RWFB 1DLHA 3QFJB 4A6YA 4BH7B 2VERA 3BUBA 2X1XR 3NSYA 4JZJA 5FUCC 4HSCX 4U2YA 4LQFL 3APMA 3KXFA 4N9GA 5TE6L 2AI0H 4Y9CA 2CMRL 2VDKH 4F1ZA 1G1CA 3KPRB 4Z76A 4YC2C 2JJTC 5KSVA 2X4PB 1D6VH 1Q9LB 1XR8A 3IFNH 3T4AB 4JPIA 5MI0B 4GRLC 3DUSA 3VI4B 2JIXD 1SVBA 2VLKA 3W9DB 4CGTA 1UJTA 4NNYB 4JREC 2XTJD 1P5UB 4R90H 1G7PA 1A7PL 2CALA 1Q94A 5J6HA 1DN0B 1Y0LB 3BT2H 1WIOA 4WLCA 3H3KA 3JT0A 4QXWA 2EDFA 3FW6A 4Z6AT 4WTXA 4GUPA 4ADIA 3IJHB 3FQ2A 4FI8A 5D7JD 3GLEA 2RR3A 4L1HA 5EOCL 1LNUA 2WLHA 4X6DA 5JW4R 5TTRA 1AIFA 5B1JA 1AHMA 4ZDHB 3VI3E 2VRQA 3GMLA 3OKDB 1QW8A 2QQKL 1IKFL 3CIQA 1ZVNA 4FZEH 4RGND 4F37K 2XHNA 2N01B 2P26A 5LGJB 2R29A 1UD5A 4PV9B 5AW7B 1WRFA 2IANE 4R4FL 2H32A 2V2WB 1UXSB 4BZ1L 5FFOA 3PWVB 5CGMA 5C6PB 5AD0B 4JRXA 2VW4A 4OIIL 4Y4KA 2VM3A 4JGUA 4M7LL 4DKTA 5I1KL 1FZMB 4OFIA 2WLLB 2P4AB 2CDGB 1JK8A 3W82A 4UUJA 2GSGA 4LLUA 3IB4A 5HVHB 5T1LA 2FL5B 4WK0B 5JIDA 3SCMC 2DD8L 4APQD 5DJXB 3NCJL 2FBRA 3PP4H 5F21B 3ESNA 3VRJB 4WUUA 5J1AB 3UTZB 3T0DA 3ILQC 4FYRA 2QPUA 2DQDL 4JHUA 1S9YA 3BDYH 3NRFA 3F62A 4G72B 5DHEA 1SDDB 4FJ6A 5JIQA 4N0RA 1A7RH 1TPXC 1EMTL 2BRQA 1I1YB 4FXTA 4HJUA 4Q6KA 2DQGH 3P9WB 1WWBX 3SY0A 2UZIL 4W4OC 1T21B 3PAVA 1AR1B 5C6TH 3WFHA 4ADJA 1NAMH 1H8OA 5ESQB 4L8DB 1SEQH 1JTOA 1OLLA 3QORD 3ZY7A 4ZQKB 4YFEA 3UEQA 3FQTA 4WI4A 1II4E 2EO7A 4MNQB 3BQUD 1D5IL 3AVEA 1BZEA 1MRFH 3POCA 2OMXB 4U6VL 2PF6A 5F9OH 1PG7L 1W0VB 3I84A 1B6DA 1HT6A 2AZUA 3B3IA 4PRHB 3N44F 1KJMB 2P8MB 4L3EB 2IFGA 1WBXA 3DECA 4I9XA 4CJ1A 3V4VH 2ZCKH 3SPVB 5EU6A 1YQVH 4DVBB 3GJFB 1I7UA 4Z78A 5CINH 3TT3L 2UXTA 5F7WC 2V2XA 3D33A 2P5WA 4OM1L 1CPUA 3GPEA 4LE8A 3V0JA 1BBJB 4L8BB 3W11D 3D4CA 3F3HA 1ETJA 1RZ8A 3LDBC 1WO2A 4UQAA 5HGHA 5ID0B 5F9AC 4YVNA 5C9JB 5G5DB 1J05A 4TNWF 3VXTA 4MJ6A 4OLWL 4PJHA 4GT7A 5D5MA 1S9XB 4U1HB 3OX8B 4KUZL 4UQDA 3HTLX 5DMKB 3TWYA 5CD5D 4RNRA 1FA4A 3QUZD 2OXHA 2Q8BH 3LKPB 3GUTA 2A3TA 2ZUWA 3GO1H 2YUVA 4M1CD 1DEEA 3CZKA 3L7FB 3QJVB 3GKWL 1DN2A 1QZNA 3D25A 1X9RA 1VJSA 3JUYA 4E5XG 4MHHI 3QA3A 1RMFH 3WKQA 4OGXH 3U7YL 5CJXC 3GSWB 4AQOA 2FNWA 4ODTH 1CD8A 3LEYH 3WNIA 1KB9K 4N5EC 3ZR5A 3ZKMC 2AITA 2UVFA 3NIDF 2JJSA 4OKDA 2VLLB 3HS8A 4F2ME 1M7UA 5FYLH 5K9KB 2Y07H 2OR8A 1L0XA 2HT4D 1J5OL 1R3JA 4WU5A 1NCAL 2EIBA 5IM7A 1HZHH 4CUCA 5EFIB 3NA9L 2QKIC 1MCPH 3VI3B 1N7ML 2CXGA 3O2DH 4H4NA 1XAKA 2OTWA 1UZ6E 1A6VH 3SKNB 3KPOA 1N5AB 3JWNH 3CVIH 1FZJA 1UCBL 3MCKA 3QIWB 3CXHJ 4P2OB 4IHOB 3ISWA 1SM3L 4FFYA 2WYHA 3MFFA 3B9VA 1IGFL 3O3BA 4J4PD 4KTYA 2IANB 4YDVB 1JNNH 3MTXA 1AKPA 1NGPH 4L1SA 2ZJSL 1S9VA 4EN3D 4H8VA 1K6QH 4JPQA 3ULVL 3IMRA 5HD8C 4MKMA 3HRZA 4L8SB 1BZDA 1WS7A 4PI0A 1A9BA 5DUPL 4YFDB 1A21A 3ESOA 3CIAA 3IMBA 4NDMA 5DJ2A 1NCDL 2OJZL 4HS8L 1KWGA 1WFTA 1QATA 3IETB 3FQNB 4WFED 2D2OA 3IMTA 5FO9A 5SWZE 3CZFA 3APDA 4EAEA 5CSGA 4WU7A 1Z5HA 5B4MD 2O5XH 1I8IB 3T0EC 3TH4T 4NQXA 1AGFB 1GHFL 3O3DA 3UJTL 4TSAL 4PV1C 2IWEA 5IQOA 4WJKB 3H3PL 5BRPA 5JOEA 2O61A 2CHDA 3LRSB 3MREB 4XNBA 1PJ9A 2ILLA 4JKNA 2HTKD 3REWA 1KPRA 4B95C 3HZ3A 2MSPA 2XQBH 5GS3A 3SKOB 3NJFA 3RQ3A 3V8OA 5AW5B 5LNEA 2E4TA 3QFJD 3QNXB 5E8EA 4B3EA 3TXAA 2Z9TA 1NKGA 3OB0H 5IT2H 5C0BA 2XBZA 4YPGA 5DK2A 3OHXA 2K4AA 3K2UL 1ZIBA 5J7CC 1JL8A 3CSFA 4Z0BL 3EFFA 2VL5A 3KPRD 2D4FA 1R3IL 4RSVA 1YEEL 4X7EC 5DEGA 3ZYIA 2GJ6A 1KPUB 1KACB 3ATEA 1Q9OA 1U8JB 1LDSA 3IMSA 3K4AA 1HU8A 4XOEA 1U8LA 4IBLT 1Z9NA 3PDOA 3LQZA 5J57B 5LNDA 1NGQL 3WFBL 2HMIC 5DJ6B 2HJFA 2XPZA 4DPCX 4ZUSA 5ADOH 1FG9C 3O6KH 5BVPH 5K1NA 5H2BB 3US0A 2W60B 4ZX3A 2ZP0T 3GMOA 1XF2A 5KOVC 1U8PB 4JKMA 3VJ6B 1KFGA 1N0XH 5IW3A 4HIEA 4UZUA 3HCVA 1IAIH 5GJSH 5HHMB 5LN8A 1EUTA 2ZAHA 3R06A 3TA4D 1XB6A 3HI6L 1T0MB 3MJ8B 2VDRL 4L2YA 5FOBA 3LRKA 4ZAKB 2NNCA 1FCGA 3L17A 4YHNA 4ZMXA 2WB7A 3QHFL 3RZCB 3FCUB 4E9TA 3V5KA 4KKBC 3ULVE 3GXPA 4EI5A 3OXSA 3P0YH 3EJYC 2P28B 2LLGA 3QCTH 2N7BA 4GMSL 4QHKJ 4XVTH 2YEZA 2WLMA 2C9QA 3PE9A 2KPWA 2QQLL 4B9GA 2C3VB 3F12A 5KSBA 4S0HA 3MCYA 1C08B 5DK0A 3C5ZB 2WWNA 3DC0A 5I1HL 5AOIA 1MLCB 2AERT 3GD1C 3RHWF 3ZDXF 2R8SL 1PGRB 2J72A 5E08L 3ARBC 3OKMB 5F7KC 1E6OH 3RAJH 1BQHA 5D1ZC 1OM9A 2HN7B 3VYOA 5FF6B 3FSZA 2C1OB 2DQIL 4MAUH 2XKNA 3MLTA 3UABA 2APWA 3CFJA 1ZTXL 4IIZA 3U0WL 2O5YH 3CZNA 4HJ1A 2BY1A 4PHXA 5T1MA 3EYQD 3WJJA 3J07A 1CXIA 2YLKA 2DMGA 3K1KC 4CVZA 3MSPA 1TJHL 3KBEA 3KGUA 3DXAA 1RP9A 5T5FH 1DTUA 3FYEB 3DPBB 3ROLB 3GSNB 3Q8BA 3R19A 1B4LA 4DERA 2GTQA 5HPMB 1QHQA 2BHZA 4MJHA 2WXNA 1DBML 2GAZB 4O5LH 4PJFB 1JPGA 1FFOA 1AR1D 2YBRB 4KWUA 4JGNA 2OYMA 4NC1E 3NP3A 3L3DA 4G9DA 1LEGB 4I8DA 4XZ4A 5HTSA 2VXVH 1CT8B 2AP2A 1TMCB 1MNUL 4GP5B 4Y16A 4M48H 4MNQD 4H1LB 4JRYB 2UXVA 4M00A 1K8DA 4XRCA 1G4RA 3M1CA 3S5LB 1TQCC 3CVHB 1NFDB 4I1RA 4EI6A 4LGSB 4PRHD 3DSFL 3EYVA 1CE1L 1FJ1A 3JWOH 4IHBA 4L3ED 4YXKL 2J5LB 3T8MA 3EO0A 5GGUA 4ZFOA 4NKDB 5GS0C 4BFIA 1Q1PA 3L6FA 4PVMA 2XWJB 3JV5A 1ERNA 2VXSH 5HYQA 4RQQA 2WV3A 4XNXH 2OMZA 1VFOA 1G43A 3Q5YA 3MRCA 2P3YA 3FF8A 4R5TA 2GSIB 3BO8A 1NSNH 1U8QA 3DNKA 2DH2A 3I74A 2ZOKA 3FMGL 3UBXI 2G60H 3N9GL 3EJUA 4NO2A 2O72A 4P48A 1I3RB 4HXBH 4M5TA 4UTAA 2LU5A 3QWQB 2WUBH 4PRBB 5FDWA 4JFYA 3ZMEA 3SD2A 1HQRA 4BRJA 5B1JC 5AYTA 1L9QA 1MJ8H 3ML9A 1YUHA 3UIYA 3LAFA 5LJYH 3AREB 2R51A 3CSGA 2VDPH 2HH0H 4K5OA 3BIBX 8CGTA 3AADB 1BQLH 1G7LB 3FQXA 1QBMH 3OAYK 1NQBA 1VKXB 1L6XA 2HRHA 3ARZA 4OU3A 4NBYB 5I1LA 4ZXBB 1ZTXE 3P4OA 4Y1AA 4CKQA 5I1DA 1YSOA 4R7VA 3WLWC 5GPRA 4WW2B 4RCAA 2EDRA 2J6EA 2VUKA 4KUCD 5I1GH 4N28A 4U6TA 1SYVB 1I3UA 4OLYL 2TAAA 5EG6C 4WFHD 1S7UA 1SLXA 4AZUA 1Z5YD 3FN9A 5H94A 4MDJA 3RPIB 4ZPVA 1ZLUK 1OVZA 3MV8B 2FUQA 4GW4A 3FH5A 2DLTA 1E2VA 4KRPB 2WWMD 3U25A 4JANA 3OGCA 4OBSA 5AG8A 4HUKB 4P4RB 1XF4A 2VN6A 4U1NA 1KENH 3ATDA 4J3TA 3NSJA 3B3BA 2AQQA 5F96L 1BYOA 1XZWA 3QIWD 2OK0H 3LKRA 4P2OD 4P9HH 5FR3A 1A0QL 1CTMA 3SN6N 1AQDB 1JGVL 2IAND 3BSZA 1TQBB 2GVYA 4LDEB 2HX7A 2ZUQB 4U49A 1JMZA 4Y7OC 1IC7L 2ATKA 3QDAA 1U93B 4PY7A 3Q01A 1NINA 5C1MB 3KPPB 3LB6D 3KLSA 1YJDC 5I76A 3EYOB 1BBDL 2VR7A 4PRNA 1J9QA 5DEFB 1EPFA 5CMAA 2X9ZA 3BVXA 4EZLA 4YHZH 2VDQH 1P1ZB 3WS3B 5I8EB 3TPKA 2UVEA 1SOQA 3OAUL 4YXHH 1G9NH 1AZCA 1WWAX 3WKPA 1JHKH 1BQKA 1RUPH 5IZ7A 5EUKA 4KV5F 2VMEA 2C3WA 1J0IA 4RDQF 4G9FE 1JWSA 4KQ4H 3FT1A 4Z7UE 4NT6B 4IBYA 3KG5A 1DVYA 1VPOH 4GQQA 1YCSA 3QIBC 3EJZD 1O7SA 4HC1A 2ZCZA 1RVFL 4Y89A 2BXYA 4EQ2A 3IJSA 1V7MH 2BP8A 4CC0A 1NEPA 2V8LA 5J9PB 3H9SE 5KSBF 2GQHA 2GPZA 3V0HA 3PXJA 4GOSA 4OJAA 1DDHB 4KZDH 3KGRA 5DRNB 3E2HC 5C0ND 4FQ1L 1URZA 4Q56A 2HJLB 4Z5RB 1EXUB 3ABGA 4UAOB 5EZIH 1KJVB 3CDZA 3MRPB 4HIPA 5JMRA 3W2DL 4GXFA 3HI1A 2C9AA 1Q8MA 3IS0X 3ZRCC 1A7NL 3ARTA 1CVRA 1E4XH 2JKRM 2NQDA 1A1NB 3HBGA 5FECB 1ZSDB 5HHMD 4BFNA 5TDNA 1KIQB 4KK5C 2YAOA 3U7WL 5IHLB 4ZAKD 4HFUH 3T0VA 3H53A 5C0FA 1U8KA 3DO7B 3NZSA 2EDDA 4IK6A 3RZCD 1PD1A 3KLKA 1KZYA 1KBVA 3T2NL 4XZUA 3MRJA 2WQ8A 3TEUA 5I8CA 4RWHA 3WS6A 3HE7B 5A2FA 4U1JB 2NXZC 2X12A 1KTJA 3MOAH 2XZQH 4X9BA 5DWUH 1HSAB 1ZA6A 3CDYA 5BO1H 3C5ZD 2V4LA 2NNAB 4G83A 3BH4A 5ANME 4MS6A 3M7FB 4EQ3A 5C0JB 3D5OF 2V7NA 1AHWB 3MPCA 1CQYA 1NPNA 3W57A 3F7QA 4HZLB 4KKLD 1S3KH 1EAQA 4MCMA 1SBBA 4NOFA 5F44A 5IVXB 3FL7A 3U82B 5D1QC 4FGMA 1NCCL 1IM3A 3B2XA 3LQAH 1P1VA 4OV5B 1RIVH 1Z2KA 3GIVB 5AL0A 4ZOAA 4PJ5A 3EAKA 5F88A 4X7SH 2M26A 2E7MA 3APNA 1KB5A 3BDBA 3HI5H 3D0AA 3S35X 2J43A 4LL9A 2A73A 3PWPA 4LLAA 5AB9A 1U8CB 2VQ1B 2YSSA 4PUBL 3SGKA 3WEXA 4PJ8C 1Z6JT 4NCDA 4A7TA 3IVKB 3BPNB 2VXTL 3DMMC 2W65A 1KY6A 4JRYD 2XWCA 5D7LA 4G7VL 2VB5A 3MBXH 4OLEA 4WNQA 5C0AA 5I75B 1INDH 1E3XA 1D5XA 2CJTA 3SYCA 4BQCA 1S7SA 1UA6L 5I5JA 3VXNB 1FSKC 1CF8L 1KN4H 2DTSA 2YXMA 2PCPB 3FT0A 1AQMA 4KGLA 3QUYA 1NLDH 2VE6A 1LK3H 3K6FA 5D4QA 4JFPA 2V9TA 2G2RB 4AK1A 5F7YC 2CO4A 5JOFA 3U4BH 4P5SA 1WWCA 1YNTB 2DBLH 2DDQL 3U4KA 4GRMA 2Y4SA 3N41F 4FG4A 4P2QE 1BX2B 2DI7A 5I1EL 4OZ4A 5IB3A 3GSVA 4G9FB 3IWUA 1UURA 4IOSD 3DI2B 3GUFA 4Z7UB 1XV8A 1OANA 2BY3A 3WHXB 35C8H 2X9WA 3ESMA 4G8FA 5IV2A 2EYRB 4Y2NA 2FTAA 2EH8H 5G4OA 1J1OH 3G5ZB 2KUTA 2WZ0A 5KANG 1KTLB 5KVEH 2H0PA 1RFDH 1ZT7A 3MRFB 4BUHA 5CEXB 4P04A 3DJRA 3MLUL 3N85H 4HK0A 3ARED 4NQCB 1MG2C 2CO3A 4Y19A 2YMTA 4AC2A 3QZOA 1M7DA 1NIBA 5F9WC 3TM6A 3OV6A 4ZXBD 3F00A 1DQQB 2PYFA 2ZXAA 2OSWA 2CDEB 3SHSA 4ODHH 4EI5C 3I9GH 1OTTD 2AK1L 5EBLB 1S7QB 3VMPA 4EBQL 1JHLL 4ZMZA 3QQNA 4P5TB 3X14B 4KITB 3V0EA 4ZMPA 5F1KC 3MV8D 3HKZA 4KRPD 4JFWA 1MPAH 1M1XA 1QFUH 1RUAH 2ALWA 2AQ3A 3HUJE 1UA3A 2J8HA 5JDSA 3H6JA 5EA0H 4KMQA 3SPGA 4UT7H 1V3LA 3TF7C 1JZFA 1IO4C 2NX5E 2AABL 1QO3B 5LCVL 4CSPA 1KGJA 3US9A 4C56E 3TF4A 5AB0A 1ZS8A 1WZMA 3AU1A 2B77A 1E4KA 4XN9A 3BD4A 4K3JL 3PCYA 4RMUA 5FDYA 2M8XA 5GZND 5C0RL 2BNQE 3ZE2E 3KLAA 4MA3B 2DOCA 4QRQA 1F4YL 4XO3A 2EDEA 4XI5C 3HG1E 4NOBA 4IDJL 2BS8A 3I6GB 3OJDB 1M71A 4M7JL 5FKAA 3NJVA 3FB8B 1AGDB 5EN3A 4I88A 1AGCA 4Z3HA 2MPVA 2ZCLH 3H7LA 1P6FA 4X98A 3F85A 4TPRL 3UJIL 4XHQA 1ZIAA 3U79A 2F8VA 1PZUB 1KJ3L 1OARL 2VQUA 3CFDA 1EO7A 1PIGA 3RWGB 3WNKA 1JE6A 3QQ4B 5EUOA 1XSOA 2PTVA 1QTYT 2J8UF 2QVFB 3PXLA 3MNVA 3GS4A 1KCVH 1TEGA 4HDIB 3E6FB 2WNKA 2YJQA 4ICWA 3S6CA 1DE4A 4O9HH 3WO4B 1M7XA 4NEHB 3NJNA 1XIWA 4HUNB 4K7PX 1XTLA 3F7PC 5HGAB 3B8SA 3GXIA 4WTQA 5AG9A 1JGEB 4Z7NE 3FU3A 1XGPA 2D3JA 2VXQL 3EFOB 4JJ5A 4G6JH 4JY4A 4XMKH 3UDWA 3IPEA 4JB9L 3Q2NA 2ADJB 1BMGA 2ZNXA 3U0TB 4U1LB 3U1PA 5I0XA 1RUQL 1FORL 1UD4A 4JG1H 4HKZB 2D31A 1JCVA 3GNML 3FAXA 2VDNB 4Z7VF 3CFNA 4OT1H 5GGTA 4LKXA 1FBIL 1JK9B 1CTOA 2ED9A 1LL1A 4WAFA 4PWGA 2JTDA 1BVLB 2BVUA 3MJ9L 5F2FA 3VSTA 4F1SA 4GG6E 1GYCA 5F1SA 3N91A 1ZK9A 2DY2A 2OR7A 3O3EB 1I9JL 3EADA 4JPVH 4TUOA 3HMWH 3ULVC 3NJXA 1C7TA 3A0OA 2R0LL 3NCMA 1F3DJ 3AT8A 4UV7H 2E6JA 5D8JH 4RGOL 3O2WH 1PSKL 9CGTA 3WIHL 1HHGB 1C16A 1TJXA 3D18A 3RNKB 5FHBH 4F8QA 5HYIA 5BXFA 4RWYH 2C1PA 1JZ4A 3E1F1 4JO2L 5KYUB 5IQ7H 5G2NA 4D0DA 2QQNL 2BH0A 3OQRA 3RWHB 2YUZA 2R56L 1NEZA 1Y6NR 3DYMA 4P3WA 2RALA 3F84A 3HE7D 2AK4E 3JYBA 4YHYC 4RZCA 4H8WC 5C2BL 3ECVA 4OZIF 2KBGA 1I8MB 3ECWA 2P80A 3C6LA 3LKSA 3R8QA 4NZTL 2CBTA 1ORSA 2ZIDA 3L3GA 4LCUB 6FABL 2ERJC 4G71B 5CJBA 5AZ2H 3P9LA 3DVNB 3QIUB 1R5VB 1U3YA 3OZ9H 4G70B 2NOYA 4HJIA 4JO1L 4PJ7A 1MJ7L 5CEZL 1XH3A 1OE3A 4KOBA 3KWTA 5AB2A 4YR6A 1LO0L 1V27A 4HLZG 3DHMA 2WYZA 5LDSA 1E4HA 3PU7A 4GBXA 3QG6A 3FF7A 3L4VA 3T3PE 3ZDYB 1OSPH 4NC0B 1SLWA 1A1MA 1M53A 2XSKA 4ZTPL 3VFGH 5AW9B 2DZEA 2VJXA 3L5XH 3PLYA 3HUJB 3HAEH 4IOFD 3TIEB 2NY3B 5IBTL 4HKBA 5IEHA 3JWDH 2NMSA 4MA8H 4C56B 1EEUA 4WO4A 4LDCA 2NUPB 2GC4C 2W91A 3G6DH 4LLDA 2NRDA 3IJYB 4H20L 1D2PA 4QRTA 4RDBA 1JPSH 2AV7B 1RIUH 2Z31A 4C4UA 3V7AE 2WWKO 1T66D 2BZDA 5L2JB 1RZKL 3ABMB 3PWUB 4LF3A 4X6BA 1S7RA 4YSRA 3GBNL 4DH2A 4OR1A 3HG1B 1RZIA 1NMBH 4X50A 2CM5A 1HWGB 1JZ2A 1VGKA 4U33A 1UYWH 4OSUL 2IDTA 3HLKA 5B1CA 2B3RA 1QHOA 3IFLL 2Q87A 4UOJA 2FGZA 1YEIL 4HXAH 5I16A 1YG9A 1QLEL 5E1AB 4BK8A 1CFMA 4RFNB 4G7YL 2E8YA 4H88L 3EYUH 4F8TA 2O30A 1WQVT 4JHWL 3FT3B 1K9TA 5KYWB 4MTMA 3WMQA 5I6KA 1KJ2H 1IMHC 4G9FD 1XXFC 2AV1B 4DEWA 4ZT1A 2YD0A 1FFNA 4AWJC 3K80A 1TU2B 4Z7NB 2J25A 2O5ZH 4PWFA 2N3JA 1SMOA 4YGAB 4TUUA 3GSRB 5E7FA 5EU3B 3QZMA 2I9LB 4L1TA 1AR2A 4YHOL 1VESA 2UX7A 1MFCL 2AMGA 2Y1VA 5HJ3A 2TRHA 4AQ1A 1L6ZA 4X6EB 1BQRA 4B6ZA 1O0VA 3BP7B 4NQCD 4UBDC 4G7SB 1DQLH 2FX7L 6PAZA 2EYTB 3ZKNC 1EJ8A 2JIXA 5KJRH 2FX9H 1MVYA 4BFBD 4HWEL 1LP9E 2K7PA 3KLLA 5CEZE 1NOAA 1T5KA 1VEMA 1X4YA 4GG6B 1E3ZA 1T1XB 4YBLC 2E74C 4ALAH 4FXKA 4LASH 4P5TD 5E6UB 4M4RB 2X4UB 2F8IA 4HOXA 5TE4H 1DSFL 4DJMA 3GSUA 2QGDA 4TTDD 4CADA 4OGAD 2ODIA 1T2QH 2G5BB 1VIWA 3QYNA 4OFYD 1S2EA 7FABL 3FZUD 2X70A 5B7FA 1B90A 2IBZX 2YLHA 4BKLA 1YECL 1SPDA 4O2EA 3AGWA 1RK0B 4M9OA 1SJXA 5JPMC 1ACXA 2BS9A 3BD5A 4LNRA 2D7NA 3IN2A 3P54A 3L3IA 3N1FC 4AZ8B 1AGEA 1DVQA 4XCFH 2XV3A 2BIOA 5JLZB 1U6AL 1FRGL 5CP7B 2FO1A 1Y18A 1F11A 2HRPH 3C87A 4PJCA 2VO5A 3SPIA 1RUKL 1SN2A 1QRNE 4WHTB 2GI7A 2F5BH 2AK4B 4PVNA 1UT2A 4QYOB 3ZE1F 3CMOL 1EHNA 4K3DH 2WK2A 5F0LB 4JCLA 1MIMH 2WVVB 4Y5XB 4MJ5A 2XVLA 3WJLC 3CHPA 4Z3IA 4TMPA 4JNXA 4DZBB 3BGMB 1MAMH 3SGKC 4CU8A 5AKVA 5BW7C 4EUPH 1E65A 2JWYA 4Q2ZA 2Y7NA 1M56B 2P8PB 1S7XA 4G5ZH 3JUZA 4WI7A 3QRFM 1MHCA 3LIZA 3ETBF 3JWNG 4B9JA 4OD2B 4HIQA 1CC3A 2V7HA 4PRDA 2D3VA 4W9KC 3T04D 1VGEH 2H1LM 2X4OA 4AEHH 3HRPA 1X5KA 5HYEA 1PPIA 2D7QA 5DMYA 3FFCB 4W9IC 4KTEH 5DJ8B 3GSOB 3BPOC 4MYWB 3T3PB 3O6LH 2SODB 5AWNH 5FA4A 3QUYC 4XPHH 2NPLX 2A6KA 2ITDA 1H5BA 2XPYA 5I2IA 1JZ8A 1R34A 1H9VA 3G08B 5IG7A 2MOQA 1ZT4B 4FQQA 4YDNA 3QORA 2OTPA 3GSQA 5FEBA 1HZKA 1SXCA 3JV0A 1JNHB 1KGCD 1CYGA 1KG0A 4Y8AA 3EDKA 2UWEF 4GG8B 4QO1A 5JYMA 3BQUA 4HGMA 3B1TA 3QJUB 3G6JA 3QISA 1UENA 2KZ1B 3RUGE 4S2SB 1LEKA 3RKDC 2MCPH 2X4QA 2XN9E 4JUSA 1I1AC 4MRCA 3FB5A 3HPJA 3TTSA 3WSQH 3ZO0A 3VA2C 2WY3B 5C09E 5KTEL 2VIRB 3GRWL 1KLGB 3VX1A 3ZIMA 1BV8A 3VGAC 1TKWA 4E42A 4B0MM 2YARA 3U1SH 3QCUH 1U8NA 3EG9A 3QDJE 5HDQH 2HX9A 4BUGA 3HN3A 4MX7A 1WFJA 5EN2B 2DQEH 5MEQA 3DUHA 3TEWA 2W9LA 3CH1B 3O3AA 4KGJA 4NQSA 3ZBMA 4NXSA 4PCSA 4M5ZL 1AZUA 1UB5A 3R8BB 4CVXB 1HHIA 4QTHB 4WGKA 3LZFL 4ZW7A 4NQUA 3RE0A 5GGVY 3CLEH 2E8ZA 2H1PH 2BWQA 4U1KA 2GIYA 4WTZA 1SOKA 2FH6A 3GHEL 2VM9A 3II3A 2E6PA 3LH2L 3QQXA 4K15A 4KMTH 4L4JA 5IR1A 3CVBA 4Y8DC 5D2LE 1ZOXA 3QUZA 4BZ2H 1W6WA 1IEBB 5TGBA 4XOCA 3U6XS 3LQMA 3DBXA 1Z3GL 3KPSE 2XZCL 3W3BA 5BRZB 5D72L 3P9MA 3QK0A 1HXYA 1JXKA 1NFIA 3BISA 3FN0H 4KZ0A 1LP9B 5MERB 2EUWA 3FFOA 3KLHC 2WXLA 2B0SH 3QIUD 4L5FL 2QT6A 1AOZA 3KEHA 3SOBH 4ZUTB 5EOQL 2A2QT 5IHZA 1B6UA 1WH0A 2HJKA 1J0ZA 4NKOA 3O41A 1NBYA 2LLLA 4BKTC 5IFAL 3FONA 3KPMB 1IIKA 3IGUA 1G6RL 4XBPA 5EZJA 4HCRL 4N8PA 5IB4A 4M02A 2O6FA 2NY3D 2E7LC 3BI9X 3I50H 1PS3A 2ZUUA 3ARWA 1NCBL 3EOTL 3GJEA 4C56D 4A66A 3E80A 3C5JA 4J4PA 4YVUA 2XXCB 3HJEA 4LPVA 2WQSA 5IB5B 4EN3A 1XIWC 3HNSL 3SPJA 3LKOB 3EKCA 4QHLB 5IMMA 5E1QA 1NH6A 3UGUA 1CDJA 5IIEA 3HG1D 1FE8H 3WN5A 2YPKB 3ULUF 5I24A 4PGDA 1XGUA 2SEBA 3EZJB 4MXVE 1TVBA 3O2VH 2HLFD 3NRPA 4PD4K 1OSZA 4XPGH 1KEML 4YZWA 5L4FA 5F6IC 3MRGA 1BD2E 4E9WA 4BSVA 2ZOLA 5HXMA 1HC1A 1XMEB 5H8DA 4NLAA 3PGFH 3RWEB 3T9WA 3D85B 1FNHA 4KTDH 5K33A 2PPCA 4O2FA 5MHSE 5D1XE 4B27A 1JF6A 4F7KA 3WY4A 1ZLSH 5CSBA 1FAIL 3IU3B 4D9QD 2YK1H 2ZUVA 5DD1H 2IH1A 2WINB 1NMAL 2IMMA 1RU9H 2XN1A 5DD3L 3RWFA 3QFJA 4BV1A 4S1DC 4BH7A 2FH8A 5IHUL 5L8LB 1OT1A 3O4LE 4Q8BA 4ZD3L 5DGRA 1PMYA 4KI1A 1MHEB 1E28B 3NG5A 3KPRA 1U0QA 2R39A 3B9AA 2X4PA 1Q9LA 3K72B 4P3CL 3T4AA 4K3EL 3VI4A 2CK0H 1Z5LB 4IRSC 4X9GA 1NFAA 3B5HA 4L5FE 3W9DA 4N8CH 4NNYA 4PCKA 5E56A 1P5UA 5EDSA 1E9QB 3QAZC 5DHVH 1HL4A 1F58H 1DN0A 4ERSL 4L3CB 1Y0LA 1AOHA 3K2IA 2JJUA 1UZ8B 2B9BA 4FKHA 4A1RA 3BZFB 1X5HA 4UOW1 3RA7H 4AL8C 3ULUH 3IJHA 1AQKL 1O75A 2AXFB 3GXDA 3C6LC 4F92B 5DRWB 3BH8B 3NCYP 2Y24A 1G1OA 2DICA 5I71C 4KX7A 1KC5L 4KZEL 2E7BA 4MD4B 4ZDHA 3OKDA 2F53E 3EJSA 2VDMH 1NWPA 4FQJL 5LBSH 2IALB 5T3ZD 1GCYA 3HVDA 1NCGA 2VSDA 4M3HA 1PZ2A 3LNDA 3TTYA 5LGJA 4GIOA 4GBXC 4ONGH 1CIDA 3CFCH 4PV9A 1J87A 5HHOE 1MG3C 2ZD0A 4YUEL 3BAKA 4MQSB 3DOSA 2CKNA 2AK4D 2V2WA 3SGJA 1UXSA 3TH3T 3PWVA 4EKJA 3N0PB 5AD0A 4HZ1A 2OLDA 3KPSB 4B60A 4X4KA 4BK5C 3OAYH 4TRPL 4ZK8A 2CNZA 1FZMA 4UCFA 2WLLA 5F9DC 5KZCB 2CDGA 2E6QA 1X5IA 4C4KT 4PJDE 1F45A 3WV0A 4I0PB 3LSOB 4RAUB 1SYSB 3H8NA 1SY6A 1ZWIB 1OTSD 3JQOB 2DAVA 2FL5A 4QGTA 2IH3B 2HLEB 4XC3L 1HKFA 4HJ0D 4K5NA 1IT9L 3MLPA 5DJXA 2KH2B 1ZLVH 2CAKA 2K4WA 4HUMB 5J1AA 3BOVA 3VRJA 3UTZA 2AVFA 2K3HA 1HNGA 2R9HD 1E5AA 3UC0L 1L7TH 3FFCD 5KVGH 1ZLUH 1SDDA 5FUOL 3B34A 3WDHA 1J18A 1AFVH 1I1YA 7TAAA 1N59B 1T21A 5BUPA 3SPCA 3WHE0 1HJCA 5ESQA 3OPZL 1NCWL 4L8DA 4ZQKA 4W9CC 5T3XL 1FO0H 3RWJB 4ZOEA 5ISZE 4LU5H 1ND0B 1HIML 4MNQA 3BPLC 2QSCH 4HIHB 1KBPA 4QXGH 4PP1D 2OMXA 3MO1B 3RX8A 1O6VA 3N5AA 4KRMB 4F9PC 1DQJB 3JVGC 1W0VA 4URTB 3EO1B 4JM2B 3S8WA 4PRHA 3PFUA 1KJMA 1YYLH 2P8MA 4L3EA 1BOGB 4OD3L 5CF3A 4MA1B 4Z18A 4PJGF 3SPVA 2NTFB 3QJFB 3GMNB 2IWGA 3NOIA 4U6YB 5AVQB 1VA9A 5A7EA 4NFBA 5C2UB 4DVBA 3GJFA 3MAWA 3L2LA 2AQ2A 2IVFC 3L3KB 3VSQA 5IESH 1MHPH 1BBJA 1C5DB 4L8BA 4KHXH 5D1XB 2ARJB 3AT0A 5EDXA 1MCKA 4MD0B 2YAPA 1OGAB 2VAAB 5LKNA 1HNYA 3TA3B 2IO5A 5ID0A 4J2QA 3BN3B 4W9DC 5IREA 3L8QA 5C9JA 5G5DA 3TFKC 1OWWA 1SJEB 3BKMH 4N1HB 1S9XA 1NGZB 3O4LB 3OX8A 2BZCA 4U1HA 5DMKA 3S34L 2FHCA 5GS2D 1BCIA 2X38A 2VH5L 5KAQF 4FQXB 1LO4L 1WTGT 2NY2C 4DAGH 3LKPA 4XNUH 4UQ9A 3HC4H 5BOPA 3BMVA 1GGBH 2FBJL 4KJPC 2HUEA 3MBEB 5HDBB 1PTZA 5BRZD 3L7FA 4NAMA 1OAZH 2JSFA 4YSCA 4JDVB 2AJYL 1EEQA 4ODSL 2XV6B 3L9YA 4N86A 5M95B 5CEZD 1JGDB 3G7TA 4K3HA 3MOBL 1SGKA 1J0YA 3C60B 3GSWA 5J5EA 4NO0B 4R7DB 3ZDZE 4KRNA 1KBBA 3ILDA 4M3KB 4X4ME 1G9ML 2VLLA 5IGXH 1DVFB 2HXAA 2OR9H 5MP6H 4RDQG 5K9KA 4OH2A 2IDCA 3IGAB 3CD4A 1N0LB 1JWMA 1OAXL 4MJIE 1SDAB 3B5GA 5EFIA 3TL5A 3VI3A 4DGIL 2E3VA 5T3XE 3FHQA 5EO9B 2F53B 1SBSL 3SKNA 1N5AA 4HPYH 1CD1A 3QIWA 1FH2A 4G1EB 4IHOA 2AC0A 4QAWA 5CFAA 2KC0A 1IFGA 5BV7B 5HHOB 2IANA 3Q1SH 3RDTC 2AEIT 4YDVA 1G87A 1OK0A 1KCBA 5FYJL 1MRCL 1H5BC 3V9EA 2FR4B 1F6FB 4L8SA 3QEGL 5AVYB 5FYKL 3UP6A 3LS4H 3UTQB 4FHJA 3KAAA 5JW4N 5KSAC 4PMFA 4TKWA 1WAAF 3NH7H 1ZAGA 2B1OA 1JVLA 2Y22A 2IWFA 2BSDA 2VDKL 3F58H 2EEFA 1TQVA 3FQNA 3IETA 3QE5A 1PZAA 3UGXA 2JV6A 4QTIL 4JHZA 4KX8A 3VD1A 1KV7A 3MLSH 3MYJB 1I8IA 1AGFA 2BCKB 2K3TA 3D85D 3K2MC 3TOPA 1CURA 1CLYL 3V4PB 3LRSA 3MREA 3RWIB 1ZTMA 4OGYH 2ZZUT 3SKOA 4QJ3B 2PP9A 4KKAC 2OYKA 3CFKB 4GXUM 5D1ZI 4DSYA 5IOPB 2IDFA 2YAFA 4U0RB 4Y2DB 4TS6A 1B0WA 4HV8B 5EF3A 1DBAH 2DMKA 1NCJA 1VSCA 2B16A 1E7VA 4BM7A 1BPVA 3P4MB 5HDOA 1RJYB 5A2CA 5GRUL 1KPUA 3GDCA 4IBQA 2PWFA 4B41A 5CNHA 1U8JA 3HC3H 2D03L 3FTXA 4FQCH 1G7IA 4FZEL 5BS0E 3NPSC 4X2UA 2XZAL 5JUEH 1EO8H 3QUMH 5EC2A 4GAJL 5DJ6A 5F89B 5H37H 4M7ZB 1NC4B 3HHMA 3TBTB 2KYIA 2VO8A 2NY7H 5H2BA 2QVTA 2QADB 2W60A 2LFEA 4F15B 2YPLE 3MRQB 4ZS7L 1U8PA 1KWKA 4N68A 3VJ6A 1RZKC 1ED3B 2AJVL 4OF8A 5CZVH 4PB9H 2CBOA 2G75B 1J5CA 1JFQH 4LRNL 4X4ZA 2B2XL 2VISB 1IVTA 1ZS2A 2FHFA 1T0MA 1ZHLA 3MJ8A 3QRGL 2ZUXA 4ZO6A 4F2FA 4EZMA 4ZAKA 1FHGA 3MRDB 3II1A 5CHNB 1A3RH 3DX1A 4M62H 4UILH 3RZCA 3HFML 1XMWA 4YEFA 1JCKA 1WEJL 2FBOJ 5FYJE 3T08A 4Z7IA 3HMXA 3KVPA 2YA1A 1D5BB 1Q0XL 4QXTB 5FYKE 1F4HA 4U1GC 2DQGL 2JE8A 5GSVB 2QSVA 2C3VA 3PFQA 1C08A 3KPSD 2BSTB 5GS0H 4EDWH 4PG2A 3C5ZA 5KZCD 3UO1H 1MLCA 1IEAB 4GI6A 4GIPD 1I8UA 4I0PD 2R23A 4J4PC 2Y7QB 3BP6B 4PBVC 1HZLA 3OKMA 2R69A 3CC1A 4TVSa 2HN7A 4FQIH 4LT7A 5FF6A 1TTRA 4A38A 2C1OA 4XO8A 2F15A 3ZDZB 3DV6B 1J8HB 2XXMB 1JXDA 2Q9OA 5F9OL 3B7YA 3F6IA 3WN5C 3RWCB 4XCCL 1DBJH 2BRRH 5D2NB 1QHPA 3BT0A 3RPBA 3DPBA 3ROLA 4QWWD 3GSNA 4S10A 5HPMA 2FYYB 4DT2A 1AQHA 4GQPH 4PJFA 4GAYB 5E5UB 2YBRA 1E2ZA 3GHBL 2G4GA 2AF2A 1IAOA 4PH8A 2P44B 3CX2A 1LEGA 4GB9A 1CT8A 3ZDWA 2HTKC 3SJVE 3F7VB 3VD5A 3VQ1C 4H1LA 4JRYA 3ZHFA 3V5DB 2NYKA 1NANH 3S5LA 2EZ0C 3U36B 3CVHA 5BRQA 2AJXH 4QIRA 1N18A 4JM2D 1NFDA 4GQRA 4NZFA 4PJBB 1PZCA 2YD8A 5KS9E 3RIKA 4I4WB 4KUCF 3HS0B 1ZMYA 2Q8BL 3RL2B 2EKSB 2AS5M 1HE8A 3LS5H 4NKDA 1DVTA 2VC2L 3AJ7A 3LMJH 5MI0C 3FOLB 4KX9A 1UXMA 1XCTB 2XWJA 4JG5A 3Q6FB 4UDTB 1XAUA 2IPUK 3GWJA 5I30L 5JXED 4FA7B 1E5BA 1P5UC 5D1XD 4ATWA 2GSIA 2JELL 3AACA 1OGAD 3W38A 3TA3D 1MNNA 1U91B 2X53A 4IOSA 3U0PB 2XG4B 3FQYA 3IJEB 2Z0BA 1I3RA 1SQMA 5IK3A 5L0QC 4OQTH 2YGOA 3TFKD 3O4LD 2UY6B 4PRBA 1YJDH 2Y07L 3H6AA 3P3RA 4GO8A 1IC5H 3S36X 4FQXD 5K1JA 3AREA 3A47A 1A6VL 3MBED 1G7LA 2YJLA 3ESPA 2BMKB 4ZJ9A 1VKXA 1W72H 3BSHA 2EC9U 1Q72L 4ZXBA 1M6OB 2GTZB 5D71L 4J6IA 3MXVH 2PLTA 3AQYA 4O00A 4WW2A 5EF2A 1HHKB 3AUWB 3SGJC 4DGYH 2APFA 3C60D 1SYVA 4GQ9H 1K6QL 2K6ZA 2XPGB 3AQZA 3QUGA 4NO0D 5CR1A 2IGFL 2YPLB 5B22A 3TT1H 4CN1A 4N8VB 3UAJD 1DVFD 4ZO8A 4XE0A 1FG2B 1JZHA 3RPIA 1UC6A 4WO0A 4FYSA 3MV8A 4P07A 1KYOJ 3VB8A 4G42B 4P4RA 4OVVA 2F53D 3VB9A 4KJYB 4EZKA 4UTBA 2XX0A 4F58H 1MJUL 3EYQC 4IOIB 3BVWA 1AXTL 1MFVA 1JN6B 5HHVH 4GRWE 1AQDA 3BKCH 5HHOD 3AT9A 2NNRA 4GIAA 1N19A 3NK3A 1X9UA 5AAWA 3P40A 1NGXB 1CGSH 2LGNA 3NABL 1LWRA 5GZNA 2VXUH 5HYJE 3ZXAC 1U93A 5A16B 1SF5A 4G43B 4W93A 4XO5A 4PN6A 2VDKB 1IL1B 2F9BT 5JHBA 1EJFA 3EYOA 4W81A 2XKSA 2JJWA 4KY2A 4IU3B 4AOFA 5DEFA 1UOVA 1CQKA 4KK8C 3EH1A 1KTKE 1JUFB 1GY1A 2GC7C 3Q13A 5AOLA 1LQBC 3KL3A 4GO9A 1P1ZA 3WS3A 5I8EA 2AEQH 5LWYH 2XG5B 5SWQB 4FLSA 1TCRB 1CUOA 3WFEH 3SE4A 3S37H 4WGWB 5ABAA 3L4WA 1AP2B 5BVPL 4DO6A 3TZVC 1R17A 3X3FH 2ADGB 3D69B 3PIQB 1JMXA 1IE4A 4RGMB 2I32A 1Z32X 1N0XL 4Y2DD 3LN9A 4PP2B 1JGIA 5GJSL 1QWUA 1HE7A 2HLAB 3SE3A 5J9PA 3SODB 1ZV5A 4GW1B 2Z8WC 5TE6H 3UP1A 2CMRH 1DQKA 4U2ZA 1DDHA 2Y06L 3INUL 1BQ5A 5DRNA 2HJLA 1JTPA 4Z5RA 4ONFL 4N3UA 1EXUA 1V8HA 3V6OC 3X1NA 3VWJC 1KJVA 1B88A 3MRPA 5KS9B 3RFZC 1EFQA 1NC4D 3U9UB 2VR4A 3QCTL 2IXQB 2NW3B 3CXHK 2QADD 1A7PH 1JDCA 2MNJB 1F90H 2ZKMX 5MENB 2ZKXA 3FH7A 1HH6B 5FPIA 1A1NA 4AKOA 5TK2A 5FECA 1FPTL 1ZSDA 2P5EE 2J6WA 4J3XA 3VXRB 1KIQA 4NENB 2KKQA 4FDWA 1M05B 2E0PA 3Q9PA 2OMYA 1UZ6F 5L2KB 1JHTA 3DO7A 2OMVB 4ATTA 5F9JB 3FJTA 3SO3C 4BFOA 2BP3A 1IKFH 1SVZA 2YAQA 4GT0A 5BJTB 5ICYA 2GFBB 1A7OL 3MNWB 5T5FL 1EX0A 1NAMB 2WWOA 3HE7A 2WWMC 4U1JA 2VJ0A 4HYTB 3L3OB 2XZZA 4MB1A 3QDGE 1PW3A 4BZ1H 2KLTA 1HSAA 2IH9A 4AGMA 4OIIH 1U92B 4XE5B 1TNMA 3O6ML 4KHTL 1UWFA 2MKLC 2NNAA 4NUJB 1NL0H 5E4EC 4M7LH 5I1KH 3BCFA 5C0JA 1AHWA 3RIFK 3L4CA 2AVGA 4HZLA 4XN2A 4FQLL 1XZ0B 1KPVB 2JFCA 4JVWA 2YS4A 3SEPA 5IVXA 3RVVD 4WEBL 4PHZA 1J8HD 1RERA 2LAGB 3LB6C 4M1DL 4OV5A 3IDIB 3V4VB 3CSBA 3S4SB 3GIVA 5CN2A 2F7OA 5K69A 2JCCE 2DQDH 4L9LB 2OZ4A 3JWOL 1MCSA 1UEYA 2VLME 3NCFB 5EPMB 4GS7C 3VWKC 2E9WA 2FB4H 1U8CA 2VQ1A 2UZIH 3R7QA 1T83A 2Q20A 4EUPG 4HOMA 3ZR6A 3OWRA 1PG7W 1MWOA 2VXSL 3QJHB 1D3CA 4R4BB 4KBPA 1S8DB 3IVKA 4BCZA 2WLNA 2GSMB 1NCUA 4RA0C 2FWUA 4KK9D 5CN3A 1IQDB 4LSSL 4OIFA 4B7LA 2OW7A 2Z1KA 4ZMOA 3LTVA 3MLXL 1A47A 2QGEA 3VXNA 4WW1B 2HTLD 4K4KA 4XNAA 1JGLH 4I2XB 5CLZA 4U6VH 4HULB 5H4YA 1FI8C 1R47A 1PG7H 5KVDL 3IKCB 1QD0A 2ESVB 2PCPA 4GH7B 4KJQC 2VKWA 4XBEL 3W5NA 3FS9A 5DO2D 5DD0L 2ITCB 1PAMA 3GBDA 2ATPB 2VDPL 5IHHA 3IE4A 4OGQC 2G2RA 4J3UA 5C0NC 5HY9B 3HEIB 3VGBA 1ZJBA 2A9NH 1L0QA 1YNTA 4ACTA 1CCZA 3Q43A 1TYJA 1BWMA 4KH9A 4GKLA 4TLUA 1BX2A 4OM1H 1UT9A 4NUGH 4OW6A 4G9FA 1PDKB 3N44B 4JM0A 3D3VE 4Z7UA 4K5LA 1RLWA 1TENA 3ULAB 3WHXA 2EYRA 4W70A 3ET9F 4R7NB 3RY5A 3ULVF 4MZIA 3G5ZA 1QLRB 4POUB 1KTLA 4OLWH 4PJEE 4KUZH 5D93B 3C8HA 3MRFA 5CEXA 4ZAKC 1NDGB 2BVTA 2PP7A 4NQCA 3KJ6H 3K0YA 2K8QA 2WQUA 3MUZ1 3CBRA 2MKWA 4KKRA 4RMRA 4UZSA 1CG9B 1DJZA 4P9HL 2UV3A 2OS7A 1X5MA 5AVUB 4LDOB 1DQQA 3GKWH 2EIJB 3ARDC 4YHIB 2CDEA 3UX9B 5EBLA 1EHAA 1WFIA 2FO8A 1S7QA 3WYRA 4PLNC 3K8LA 3UPRB 2GHZA 3AS1A 4K8RL 2FYVA 4P5TA 2EDMA 1MW1A 2YPLD 1KXTB 3U7YH 3X14A 2GJZB 1INEH 3LPWA 4HISA 2IV8A 5CGYD 2WVUA 1HYSD 4OFYA 2O4EA 3JTSB 3HG3A 1A7QL 3V6FB 5IFJB 4XX1E 3RX9A 2FZ3B 3QFDB 1NCAH 1O7VA 4PS7A 2WAHA 3NA9H 2YKKA 1WZKA 2L0DA 1N7MH 1FHNA 2VDQL 1QBAA 5L6YL 4YXHL 1A3QA 1A8ZA 2XIIA 1QO3A 4M43L 5E1IA 4XHJD 1UCBH 4I1PA 1RUPL 3E8UL 3IDYB 4HMEA 1SM3H 3DTUB 1EXGA 1WA1X 1XO8A 1N64L 2GEQA 4FTVB 4JGJA 2B59B 4R9HA 3RBSA 5KVDE 4LKCB 4DOHB 3QDGB 4MA3A 4W9ZA 1BXXA 1VPOL 3T09A 1OF0A 4ZUVB 3VU1A 1JJUA 4Y4HB 3ULVH 1CICC 2XT1B 3FUKA 4OJYA 1R0AL 4J3OC 2M1KA 3I6GA 2YXFA 3FT4A 3OJDA 3FB8A 3TFBA 5A7BA 1AGDA 1G6VK 1NCDH 2OJZH 4HS8H 5BO0D 1QTSA 4KROB 1SDYA 2JKSA 1GS8A 4CVWA 5CBAB 2FCBA 4NXKA 1TFHA 3RWGA 3KYKL 4HKXB 3QQ4A 4IKLA 1IQWL 3VFPB 3L2NA 1GHFH 5CXPA 3V4UL 2PUQT 4TSAH 5TK4A 2PW2B 3SDXF 1MEXL 3TU6A 2VZ3A 5T1JA 3H3PH 2N0MA 3E6FA 1PZSA 4HDIA 1GAFL 2EIEA 2P8LB 5IEKB 1S9KC 5LN4A 5AVSB 5HGAA 3IDXL 3RY6A 5AAPA 5DS8B 2PPAA 1D2OA 1JGEA 4I7ZC 4YFLI 3EFOA 2Y1ZA 3VFWB 2IMNA 1JNJA 4WSKA 3COOA 2ADJA 3K2UH 4K94L 4KVCL 4U1LA 2CKBH 4QOKE 3U0TA 4PRIE 2VR5A 1OT4A 2BX5A 3P3YA 2V8MA 2YD5A 4HFUL 4Z0BH 2JQMA 1K5WA 4KRLB 4HKZA 1NEUA 1QX1A 1OAJA 1YEEH 3J2PA 4PWIA 1A2YB 2QKSA 1EUUA 1UM6L 4FMFA 3V10A 1JK9A 5BUGA 1JTTA 2X6MA 5DYFA 3U6XA 3FB7B 1TT6A 3P11L 1NGQH 1BVLA 4KJWC 4G8IB 1M2OA 1KCUH 3MR9B 1ZHBB 3O3EA 2W0KA 3JYCA 4WRLA 4D2NA 1C8PA 5MEND 5JOPE 4PTTB 4FFVD 1NMCB 1DLFL 1GIGH 3GLDA 1UKSA 4BQ8A 1RJZB 1S3KL 3VXRD 1KDJA 4WW2C 2IFFL 2YAMA 1HHGA 2NTSP 5I28A 3RNKA 4NN6B 2VDRH 5L2KD 1W91A 3D3VB 3HA0A 5KYUA 5K9OB 2W0PA 1SZNA 3LQAL 4S0SD 4AKPA 4AITA 1T0NB 3QHFH 1OKEA 3BN9C 5ICYB 2QR0B 3CXDH 1T22B 3MNZB 3RWHA 1PZBA 4PJEB 1T5WB 3OJ2C 5H35B 3IRPX 5E94B 1F86A 5EU5B 3ZSSA 1NCIA 4GMSH 4AV0A 2XC8A 2HG0A 3QPQC 5AW3B 2QQLH 2Z8SA 3FUMA 3VFUB 1I8MA 2AQSA 3BYYA 1OOAA 5A6MA 5I1HH 4PLKD 2GITB 4U3CA 5AKSA 1I1FB 5D4HA 2YWZA 2R8SH 2CCVA 4LCUA 4PVLA 1IX2A 2ZUQC 5E08H 1GGTA 2MQCA 3CN0A 5GZNC 1UUNA 3GZKA 3DVNA 3QIUA 1R5VA 2MEJB 2DQIH 2EO9A 2Z7ZA 3A21A 3U0WH 4JFFE 4ZX6A 1JXGA 5A2LH 3SYQA 2VR9A 3QWRD 2YMXL 4HU2A 3ZDXB 1TJHH 1MJJB 1NUGA 4FNSA 3HNVL 4OZHF 3HUJA 1LK3L 4E36A 3UG3A 3TIEA 1DBMH 5C71A 3DUUB 4N2NA 3DLQR 4ZFZB 4C56A 1SNRA 2NUPA 5J11B 5DVLA 3C2AH 3IJYA 2HVKB 3INOA 3P0GB 3SE4C 3TN0C 1GMIA 2WKLA 2AV7A 5GZOD 4AIOA 5F7HA 1MNUH 3TONA 4ZUUB 1JRHI 2BK8A 5L2JA 1AQ8A 2E9GA 1NBVL 3PWUA 3JSSA 4QXVA 1IC0A 2PTTB 3HN8A 3HG1A 4IKIA 3GTTA 4HWBL 2VDPB 4MASA 3CPUA 2ESVD 1QFPA 3P73B 5BOZG 2YA0A 1Q9WB 4PJXE 1CE1H 4YXKH 2BSRB 3TBYB 5C3LD 4GSQA 5E1AA 1T1YB 2BP0B 4K3GA 5FHAL 3TEYA 4N22A 4FFWC 3BMWA 4E9XA 5LAXB 3S3BB 3FT3A 5KYWA 1TO5A 5DC0A 3B2UC 2DTML 3I9GL 4ORZC 5E8OB 2V0AA 5FYLD 4LGPB 4DGWC 1RKRA 1CXFA 2AV1A 4LSQH 2VZOA 3FO0L 4BGDA 5IW6B 4X6CF 3GLAA 3FMGH 3AC0A 4GO6B 1ECYA 1TU2A 5EH1A 2B14A 3N9GH 3L1GA 2WKOF 2LW3A 2NCEA 4TULH 3DVIA 1JIBA 5EU3A 3X1EA 1RLBA 1XHHA 2I9LA 1DFBL 1JDDA 2CUMA 4NLHA 2FT6A 4UNVA 4LOUD 3U1QA 5DZJA 3GMRB 4X6EA 1JG9A 1HAWA 3BP7A 3IJ9A 3L4XA 4MCYB 2K6WA 4R26L 2EYTA 4M7LT 5EA0L 4UT7L 4XXWC 3OLEA 3MOQA 1MXDA 3P0VH 4IMKA 4S1QH 2FD6L 2RMNA 4DP9X 2G3XA 2D7TL 3RKPA 2V9UA 3BUQA 1AO7B 4P46B 4S1SH 1DVZA 3V0GA 2HFEB 1T1XA 1D5RA 4GG6A 1WA0X 1YAIA 3OMIB 4M4RA 1BFOB 3AB0B 2X4UA 4OLYH 3V7MA 2BSSB 2MJWA 1WIUA 2WLYA 3PJSB 2NZ9D 1LWJA 2G5BA 1MH5A 4JFDB 2CA4A 4MD5B 2VDQB 3B7UX 4KY1L 4I85A 1L9MA 3X1GA 2EUVA 4DTGH 1RK0A