2ZJSL

Crystal structure of secye translocon from thermus thermophilus with a fab fragment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/immune system
molecule keywords Preprotein translocase SecY subunit
publication title Conformational transition of Sec machinery inferred from bacterial SecYE structures
pubmed doi rcsb
source organism Thermus thermophilus
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2008-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsL01
1WIOA 5GRUL 2A9NH 1VEMA 1KTRL 3CH1A 2OL3B 2XOTA 2XTLA 1HDMB 2YUZA 2HH0L 4P4KD 4XPAH 2NX5D 1RZGA 5F3HA 1F6AA 5JW4N 1A5FL 4F57H 1FSKC 2BNRD 1G9MH 2QLVB 3KGRA 1INEH 5I8KH 1ONQA 1JPSL 3K74B 2VO5A 3BGFC 5E2VL 3MODH 1IKFH 4XNYH 1OAKH 3QHZH 1B6DA 2ITDA 2ED7A 1RURL 5L2JA 5EU7C 1F6FB 4WW2B 1YQVL 5IVOA 1Q72L 1JPTL 3N1PC 3G9VA 4PJ7F 3THML 4O51B 5DURB 1QBLL 1A6WH 3ABZA 4I2XE 4YAQB 1Q9WB 1MHPH 3BZFB 2HN7B 3LN4A 3C8HA 4E42A 7CGTA 2EDJA 2I9LB 3U6RB 3UTQB 4Q9QL 1JE6A 1OWWA 4K8RH 2K7PA 1CFTA 4JJ5A 1U8LA 1UM6H 4QRUA 1JPGB 4K7PY 1HSBB 2F15A 4HAFA 4Z7UF 32C2B 4M93B 2QR0A 3PG2A 4MCZB 5GHWH 1KSRA 2DICA 3MYJB 1BQSA 3C5ZD 1I7UB 1AHWB 3VWKB 1MCBA 5KVGH 4WUUD 5DJYA 3C09C 4KZEH 2YR3A 1QKZH 1S7RB 2BVTA 5J8OA 2JJUA 3LVEA 4UIKH 4WEUD 2ZG3A 4HKBA 4HHAA 3MBEC 5IV2A 4YXHH 1S9XA 4L1HA 5DA0B 4W81A 1DVFB 2EE2A 2H26B 1Y18A 4YH6A 3TA3C 2IG2H 4N5UA 3OXRA 3MXWL 3QCUH 2LABA 2ZPKH 3RWGA 3R0NA 5I74B 4NQVA 1J1OH 1CE1L 3OKLA 2AK4E 4MNQB 2O5XH 5E8DH 4XMPL 2NZ9C 5E2TH 2BNQB 4QWWC 5C0JA 4Y5YB 1RJYB 1ZSDB 5E5MB 4LCIH 3LN5B 3NA9L 2WZPD 4EJ1C 5ANMB 4F2MB 4HIXH 1U8HB 2OL3A 1G1YA 1KTLA 2C7UB 3QUZD 4JHBA 4WY7L 1HDMA 4PS4L 3S37L 1P6FA 1FFPB 4RBPK 3HMXH 2NY3C 4DTGH 2F58L 1UM4L 3WN5A 1V5JA 4D2NA 3H9SE 1DQQB 1UCBL 1TQBB 4CMHC 1IGMH 1I8LA 5L88H 2PTVA 5CIPA 5E6YA 3T0EA 1NCCL 1VGKB 2ORBL 3FJTA 1U3HB 4JQVC 1OAUH 1UZ6E 4WW2A 3OAZH 1QLEL 5FOJA 3AB0C 3L3OA 1OSPH 3GSWB 1BFVH 2E27L 1ZLWK 3SJVB 4APQA 4YAQA 3BZFA 1R3HA 2XXMB 1N0XH 5D70L 5JHLH 3CX5J 5B4MD 1X5LA 1MWAB 2M26A 3UTQA 3BW9A 2VERN 4BSWB 3D6GA 5I19H 1XGPB 2QHRL 4LSDA 4U2ZA 1JFQH 4QOKB 4UAOC 3BDXA 4U1GB 1L7TH 1DSFH 4MCZA 3VRIB 3O3BB 1T7YA 3ARWA 3SDXF 1I7UA 4XP9H 4MYWB 3QI9C 4OUUB 1DBBH 2ED8A 3MOAH 5IFJB 4PJBE 1YYML 5E8NA 2V17H 1EAPB 4JFOA 3CFCL 4LCUA 1PAMA 4XBEH 5GSVA 3F8UB 3M45A 2Q87A 4OGAD 1DVFA 5FGBA 3VI3F 3JV6A 3SE4A 4LLMB 5HGDA 1FL6A 2EH8H 4RAUA 4JFPA 4QYOA 2DQTL 4EEEA 4E41D 5A2LH 1UENA 1A6AB 2CLRA 4W6YB 1A1MA 5K9QI 1K9TA 3L5JA 4Y16A 5T33L 4QHMB 1MRDH 4PRIE 3MV7D 3VG9B 4PB9H 1D5IH 1DEEB 1JV5B 1R3JA 5IVXE 5DMIH 5E5MA 3BH9B 3BMWA 5AG9A 5I76B 3LN5A 4K3HA 2B4CH 4PYHA 4NKOB 1OTSD 4XVTL 1Z5LA 1HHIB 1U8HA 3RBGA 3KNBB 2C7UA 5T3XH 4K9EL 1KCLA 2HRLA 1C5BH 3G08A 3HFMH 3CLFH 5DUBB 5D5ME 4LIQH 4HLJA 3ZHLA 3HE6A 5DK2B 5I1EH 4PJCB 3IDMA 4KJPC 3P4LA 1U3HA 3TA3B 4NQEA 3HC3H 3GSWA 1X4ZA 2YC1B 3PF2A 3ULVL 4N8VA 4KKAC 2GT9B 2HJFB 5D2NA 2AEWA 2HFGH 4HUVA 3LZFL 3DV4A 3LPFA 4HWEH 2OZ4L 5EH1A 5GS1B 2I60L 2E6JA 2J8UF 3DVNB 5TGBB 4AY0A 1U8KA 2R2CA 4ALAH 4P2OC 3KPMB 3BHBB 4MJID 1NAMB 4KHTH 4BSWA 3CPLB 2YPLD 5GRVK 1XGPA 1FO0H 3DOSA 4XNUL 4QOKA 1F97A 3SDAD 2UWEF 1YJDH 3S36H 1UM5L 4ZTOH 3D48R 4JKLA 1AIFB 3VRIA 1BBDL 5E2WH 3K80A 3LRHA 4G9DB 4P59L 4R7DB 3LDBC 4FFVC 4OUUA 2AJZA 4PD4K 1EAPA 5EB9A 3QZWB 2ZUTA 5IBTL 1URLA 1FNLA 5AD0B 4ODHH 1YEJL 1G6VK 3AB0B 1I7RB 1M1SA 1WWAX 1YUHB 4H88L 3KXFB 2EICA 3RDTB 1IAKA 2J6EL 2XKUA 3FN3A 4XZUA 4QHMA 1T1YB 5D2LB 5IB5A 4WI2A 2ZUSA 1JWSA 4KUZL 5FGSA 3BE1L 5IMLA 1DEEA 3MA9L 3BH9A 1EO8L 5EORL 5DSCB 5I76A 4BFBD 4UAOB 3BMVA 3FO2B 3QIWC 4M62H 5JIKA 3U83A 1GOFA 1J05B 2OL3L 5FGRA 4GRWH 2Z35B 3QIUB 4RFNC 1CXEA 1CXKA 1FAKT 4RWYL 1NBVL 2DKUA 5BO1L 3GB7B 3QI9B 1RI8A 2PW1B 3SGJC 1NANI 4X4ZA 2JJSA 2YA1A 5F70A 4DKDC 4LVHC 4L8SC 3BGMB 1FYHB 4OQTL 4X80H 1ZHBB 1NC2B 1P9MA 1VA9A 2HVJB 5DUBA 3D85B 3GMOB 4KMQA 5DK2A 2VXSL 1P4IL 4NRXB 5CS7A 4XH2A 4CNIA 2RB8A 4WFFD 3RNKB 5I71C 5CD5D 4JFDE 4MDJB 1HINH 4XC3L 2XN9A 2YC1A 4O4YL 5EU3B 3RUGE 4U0QB 3REWB 1YN6B 1F2QA 3RPIA 1KCVL 4OQ1A 2XXCB 2DJ4A 5DQ9A 5T3ZH 5GS1A 3DGGB 2FGWL 3BZ4A 4ZUTB 2OMNA 1KEML 2W60B 3CUPB 5I1KH 1NAMA 4G7YH 4J3SA 3CPLA 1IGCH 1BWWA 1X5XA 1PVHA 1IQWL 4DQOL 3HRZB 4UOJA 3O4OC 5I1IL 1TTGA 1C16A 4G9DA 5GGTH 3QNZB 3EDEA 5I1HH 4R7DA 4WDIB 4KI5D 3HN3A 3QG6A 4EXKA 3DBXA 2RQ8A 5CINH 3GMQB 4LBEB 2J88H 5DTFB 4J3OC 3NZ8B 2NXYC 5AD0A 3KYKH 2R2EB 3MRMB 1ZGLP 1I7RA 3HZMB 1T21A 5F7MC 4PJ5E 1NEZB 3RDTA 1J12A 2NPLX 5CILL 4MWFB 1PG7L 4LLVB 3SE8H 1MNUL 1ZE3C 1T1YA 1RJLB 3NGBC 3VU2A 3GSNB 5IB4B 1UFUA 3GJEA 4LPYA 5HGHB 4P2OB 3V4VH 3VXSD 4LNVA 2YBRA 3KYMB 4P46D 4ENEC 4OCSH 5DSCA 4R4BB 5B38B 3V6FA 4R2GD 1BREA 2YUWA 5IM7B 3P9LA 2Z35A 5LBSL 3QIUA 1BVLB 2H6PB 5MENA 3VFWB 1OAZH 1BQLH 1D6VH 1AD9B 1DEDA 3LDBB 3GB7A 3EJZC 3VGHA 3N0PB 1JGVL 3KPSB 3TYGL 3BQUB 1NCBH 4XNQB 5L2KB 3RWIB 4NP4L 5FKAB 2VLLB 3BGMA 1NL0H 4Q6IC 1ZT1A 1ZHBA 3QPQC 1NC2A 1BOYA 3GMOA 2ATPB 2DB8A 1QBMH 1IGTB 1HN1A 3C5JB 4NKMA 4B41A 3I2CL 3LV3B 3O0RH 2W9LA 1JL8A 3MCLL 2CDEB 2MHAB 5C0BB 4JPWL 2IAMA 3RAJL 5DLMH 4Z77B 3KPNB 5F7HA 1MWAL 3ESUF 1PD6A 1KN4H 2DS4A 3P73A 5GGQL 3MLXH 8CGTA 5EUKA 5A2FA 3CUPA 3WIFB 3CGTA 1CL7L 1DE4A 4Q0XL 4XVUC 4JB9H 2Y06L 1X5YA 4PLKC 5I8OL 2XACC 2GITA 1JHKL 1SMAA 1T5WA 4RFNB 4DW2H 4XNXL 3HRZA 3GJFH 1SBSH 2YPKA 3C2AL 4FFYH 5L9DL 3HTLX 4P9MH 1TVBA 1BD2E 4EZMA 3MRNB 4LVHB 4OF5A 4L8SB 1QUNA 2YD8A 1QPPA 5EN2B 4XMLL 4KKBD 4AEHL 3GHBH 1WC7B 3GMQA 4NFBA 4OCNC 4LBEA 4DCQB 3TNMB 5C0DB 1FFNA 1FDLH 1IGYA 3NZ8A 3PQYA 1S7XA 1EJOH 3E6FB 4NQCD 4GQPH 1NLDH 5TDNB 2R2EA 1HYSD 3L5IA 2CUMA 1MCOH 4K8RD 1BZ7B 3QJHB 4ZUWA 1TENA 5M94B 1BMGA 5GGSA 4NBYB 3V8OA 4OD1H 3NCBB 5HHOE 1FIGH 2QSCH 5IB4A 4X4YA 2WMPA 5HGHA 5I1AA 2FHCA 2HT2D 2YRLA 4Z76B 1ZLVH 4C56B 1I3RB 4R4BA 4MCYA 5B38A 3EUUA 5IIEB 1U3ZA 1DLFL 1MFCL 4IOFC 5GRUH 5IM7A 1P7QA 1MVUA 3ARYA 3O4OB 2H6PA 1FNGB 1WBZB 1AGFA 2FGZA 3MV8A 2QL1A 4IS6B 2HH0H 2BSSB 2NY3D 3KPSA 3BQUA 4I4WB 4XNQA 5L2KA 3RWIA 4H0HB 4LARL 2UZYB 5HHPB 5FKAA 2V6HA 1ZWIB 4K94C 3OR7A 4ZFGL 1JPSH 2N4IA 1LDSA 1HQ4A 2ATPA 2PETA 1XCQB 1ULVA 1RURH 1F90L 1IGTA 3QQ4B 2YZ8A 3V6ZB 3C5JA 5DZNA 4OLUL 3RIFK 5CJ5A 1YQVH 3LV3A 1Q72H 5FYLE 4BH8A 3RJQB 1I9JL 1JPTH 3L5HA 3SO5A 1IEBA 4I9WE 3THMH 1AXIB 3BEVB 3QSKB 1QBLH 3RZWA 1QFPA 2MHAA 5C0BA 5H37H 3MRQB 3NGBB 4F33B 1ZK9A 1NKOA 3TT3H 3QFJE 1NCNA 2HVKB 1DBJL 2AEPL 4Q9QH 1NAML 4OZHF 4YFDB 1H3UA 1NCUA 3WIFA 4YDJB 4Z7QF 3G6DL 2G9HA 5FM5M 5D7IE 3QH3A 1KULA 3B8SA 3CC5A 4F9PA 5ADOL 5BZDA 1TMCB 1J5OL 1MF2L 4YFLI 4F9LA 3DETC 3MRNA 1AY1H 4UNTA 1EDQA 1YEEL 4X7EC 4Q6IB 1C7SA 3PGCB 5DO2C 5LJYH 2VABA 3D2UB 3ARGA 3TNMA 3V4PL 5C0DA 2ICWA 4GUPA 3DJ9A 1S7SA 3E6FA 3PHQB 5TDNA 3BIKB 4Y2DA 4N0FB 1X6NA 3C6SA 3OZ9L 3UMTA 3H3KA 2BFVL 5T1KD 2J1KA 3MXWH 1BF2A 3MRHA 4NQDB 5A2KH 3GM8A 2G5RA 4PLOB 3WFEL 4R4FL 2W0PA 4BK5A 1SEBB 3EOBB 3OR6B 5GRJL 1R0AL 2J8HA 4XMPH 1MFAL 5CJXC 4F80A 3INUL 4Z7UE 4YO0B 1I3RA 4MQTB 3NA9H 3VD4A 5FO7B 2P5EB 3RVTC 2B8OT 1FNGA 1WBZA 1Q9KA 3GGWB 4WY7H 4PS4H 3S37H 4HK3J 4V1DE 3QDGD 2BSSA 5DHVB 2F58H 4JGUA 3GO1L 4OFVA 2GJZB 1E27B 1UCBH 1U8IA 3WFCL 1IQDB 3X17A 4X6CA 1UQSA 4IRSD 5KBNC 1XCQA 5A43C 4XHQA 4CW1B 1UGNA 4XCYB 3S3JA 3WL9B 1NCCH 3QQ4A 2ORBH 1WWWX 1C5CL 3V6ZA 2GTWA 4HX1B 1QLEH 3IFPB 3IDJB 4PJIB 3OF6A 3FOMB 2Z8VC 2E27H 2UYLB 2UUDK 4P5KB 1QO3B 1NAKL 4OV5B 3GSQB 4EDWL 2A9ML 4QRPA 4F33A 5T3XD 2NYYD 5D70H 2PXYD 2VOTA 5BRZD 4D9RD 2P44B 2DM2A 4I0PD 4LPTA 1BVKA 5EOQL 1J8HA 4ZAKC 2WUCL 4YDJA 2H8PA 5FYJL 1J1XL 5L8LB 3TJHC 4EI6B 5CUSL 4NOFA 4N0CC 2V2XB 3T3ME 3CZFB 3UTSD 2DLFL 3X3GL 5D8JL 1KCKA 3DMMD 3HCVA 3PGCA 1YYMH 3D2UA 5IJKA 3IF1A 3AVEA 3CFCH 3FONB 4HC1L 2VC2L 1JYNA 4MZ3A 5DD5L 3LB6C 1J0IA 3PHQA 4HH9B 4KK5C 1NCAL 4GW5B 4M5YL 5EDXA 4GKNA 3L5XL 4OKDA 3W39B 2VDML 5GRVL 4E0RB 2FATL 2YK1H 2DQTH 1HI6B 4LPUA 4PJ8C 4XPGL 4NQDA 4HKZA 3AROA 1GPOL 3GSNL 5T33H 1A7OL 1SEBA 3RX5A 5IMMB 4JRYB 1VFUA 4X0KB 5ETUB 4Y5VA 1JVKA 4PJDF 2D9QB 5EULV 4YO0A 4NN6B 3FT4A 4OCXL 3QEGL 4FNLH 2VZ1A 5FO7A 5AZ2H 3QIWD 4XVTH 3MRGA 3FRUA 1N5AB 3SO3B 3O6FA 3GGWA 3QDJB 3DV6A 4K9EH 1CL7I 5HHXL 4LLWB 4UI2A 1V3KA 1MJ7L 2GJZA 5IMOA 2ZUXA 1IQDA 5EZIH 4YXLL 1AD0A 4M7KL 3VI3E 4CW1A 4XCYA 3ARBC 2Y5TA 1FG9C 1T0MB 3IDYC 5C0GB 2I24N 3N1MC 4BSVB 3IDJA 3DI3B 3FOMA 3WUWG 2EIBA 2L7UA 4M6NL 3BUTA 1K5NA 3OKMA 5DFVD 3ULVH 4P5KA 2Z8WC 5D7JD 5DVOA 3LZFH 4AG4H 2OZ4H 2I60H 3I85A 1NFIB 2R9HC 4FN0A 5EBLB 3HZVB 3SE3A 5ERWB 4XNUH 2PR4L 4EI6A 4R0LC 4M1CD 5D1XD 5EPMB 1UM5H 3Q2CA 5IFHL 4Y0GA 3U4AA 1BBDH 2P5WE 4P59H 3B83A 4EUPB 2APTA 2MKWA 4BK4A 4YIQB 2VLKE 2W91A 4LVNC 5C0AE 4MZ2A 3LH2L 2X6MA 1YMMD 3ALWA 4JDZB 3IJYA 5IBTH 1BIIA 1NFDF 1MCIA 4GW5A 1YEJH 1YNTB 2IH3B 3OGCA 3W39A 4OI7A 5ISZE 5I75C 1R3IL 5K59F 2FR4A 4FTVD 4H88H 1HI6A 3RRQA 4XBPA 1KCUL 2J6EH 1AO7B 4ERSL 1CLZL 5FA4A 4LASL 1GIGH 4KK9C 4M03A 3NIDF 2J8UE 4CN4A 3SDCD 1W0WB 2IALA 4KUZH 4X0KA 3BE1H 1I7TA 3VDCA 1KGCE 2PO6C 4OZGA 3VD9A 3JWOC 1QFOA 3MA9H 1EO8H 5EORH 4X98A 2OL3H 1EUUA 2AQ3A 4UOW0 5E9DE 1VDGA 1N5AA 1RZJC 4HGWA 2EDLA 4WFGE 1U8OB 5EU5A 4RWYH 1NBVH 5BO1H 5DJDB 1QSFE 4LLWA 2X1QA 2UVEA 3EJZD 2FIKB 1W0YT 3RUGA 3WXVL 1JBJA 4Z7VA 1JTPA 2XPGB 3QIBB 4PP1C 3CDCA 5L7XH 4PJAF 4OQTH 3C5SB 1WWCA 5CIPH 3EO1B 2DIBA 2FJHA 3NCYS 3EYQC 2VXSH 4O5LL 4QTHA 1P4IH 3QWOA 4OBSA 2R8SL 3VXOB 3QXAA 3S3SA 1EVTC 1PJ9A 5C0GA 2N7AA 4PJ8B 4BSVA 4XC3H 1JI2A 2CDGA 4PRNB 4WEBL 4PRPB 4KROC 2H2PD 2BSTA 2OQJA 5EU6E 5HGGS 3PHOA 1KCVH 1MFBL 2SEBB 4OM1L 3JV5A 4NO3B 4U6YB 2FGWH 3E8UL 3QEQB 3MOBH 1NFIA 5C6WH 4NGHL 1KEMH 3OKKA 1ZGLB 2FL5B 4TUJB 5F21B 4EIGB 4JRXD 1CGYA 5ERWA 1E28B 1IQWH 5KSVB 4DQOH 4CU6A 3NN8A 2APWA 3MRJB 1G7LB 4OIIL 5I1IH 2V7HA 5DZOA 5F6HI 2ENYA 4EUPA 1S9VB 2VXVL 4S0TD 2VYRE 4NZRL 1ZANL 4YZFF 4RAVB 3VXTB 1X7QA 4GKSA 2DDQL 2FBOJ 3EKCA 2X7LB 2DLIA 1F11B 4P3CL 4G8GA 1QSEB 2J12B 3PP4L 3IDYB 3GSVA 1WT5A 1YNTA 2IH3A 3DTXB 4HGKC 1B0GB 2NX5E 4QLRA 5CEXB 4U1LB 2XQYK 4K55A 5HVGB 1NMCC 1L4IA 2BNRE 4OSUL 3GNML 5CILH 2APBA 2NY4C 5T5FL 4ZXBA 1KCRL 1SJEB 1PG7H 4I3RL 3MCG1 2XRAL 4I0CC 1MNUH 5H37G 5JNYA 4LDOB 3KYOB 4B0MM 1FNEB 1WGOA 5HI5C 4HMCA 1S9WB 4PREB 1I9IL 2H45A 3S8WA 5J1TC 3CX2A 4NCC1 4MAUL 4R0LB 5IBUB 3ARDC 4ONHB 4P5TC 4J7RA 1K2DA 1U8OA 2YPVL 3WFHB 1W72A 5DJDA 5E03A 1JGVH 3TYGH 4OJFL 2FIKA 5J1SC 4LVNB 3QIBA 1BM3L 4NP4H 2IPTL 2X4OA 2DMCA 5CP3A 5C09A 4L4JA 3IRPX 3C5SA 2O5YL 5JXED 4PTTB 4HUNB 4FQHA 3AREC 3MGOA 5J3HD 2MWCA 1E6JL 3NCMA 3ULUL 3RGVC 3I2CH 3GBML 1BFOB 4Y5XC 1AKJB 4WUUE 1ADQL 3MCLH 2F5AH 4JZJC 4PRDB 4JPWH 3RAJH 1V3JA 3V52L 4JFZL 1MWAH 2X5PA 4OCWL 5ICYB 1GCFA 5CSZA 5DD1L 4PRBA 5GGQH 3GKWL 2Z91B 4QXGL 4O2FB 3P4MB 4QHUA 3EDDA 2K7QA 3SBWA 1ZGLA 2FL5A 5CSGA 1CL7H 4Q0XH 4U6HA 5TDOB 1G6RB 2Y06H 5I8OH 1YPZB 1RK0B 5F9DC 4XNXH 5KSVA 4EQ3A 1MUJA 4GQ9L 1GGCH 2EO9A 3L6FB 3T3PF 1BJMA 3DARA 1G7LA 3C2AH 4PJHF 5L9DH 1CI5A 5IR1B 1GH7A 5I16A 4X7CC 4U1JB 4KGLA 1RV6X 5LVEA 4XMLH 4F7CB 4AEHH 3TESA 1H3GA 1RIHH 2QSVA 3EYFB 3VXTA 2PYFB 5GRWA 3IAGC 4NKDA 2X7LA 3PWJB 4HH8A 4I13B 1VHPA 1ORQB 2XI9A 3TBTB 4M7LT 1B0GA 2EC8A 5CEXA 1WAAA 4KROB 3HE7C 1FPTL 3RHWK 4P4RB 3SOBL 1SJEA 1MHEA 1M71A 4MJ4A 4Y4FD 1I3UA 1TTUA 2W92A 1FNEA 2F53A 5B8CC 1S9WA 4ELME 1BWMA 4Z78B 4X7FC 1UG9A 1WZKA 4IRZL 3EFDL 2CR6A 1DLFH 1N6UA 2HT4C 3T4AA 5K9OB 2DWDB 3QO1B 3WFHA 4AQOA 4LHQB 2WV3A 3H7LA 4LARH 1HNGA 3CVHB 4PRHD 1QRND 5CHNB 3SPVA 2IBZX 1AR1C 4ZFGH 5HD8C 2OR8A 5IVZB 2X4RA 3RWJB 4H20L 1NBZB 1RZKC 4N90D 3B9EA 3TLRA 2CKNA 3UAJD 1F90H 3MR9B 3TEUA 2FZ3B 5CJ8A 4OLUH 3X13B 1NMCB 1BFOA 3JTTA 1MCHA 1I9JH 4HT1L 3LHPL 1AKJA 2F5BL 2NY4B 3V4UH 4F8QA 3CDGA 3D3VD 3DUSB 4KQ4H 4HULB 2VL5B 5JTWA 35C8L 2XICA 3FTGB 1DBJH 2VJXA 2AEPH 2Z91A 5BZWB 1NAMH 3P4MA 2JJTC 4O2FA 3L3GB 2P8PA 4M43L 5DHYA 3ARDB 1FN4A 6CGTA 3G6DH 2E7MA 5KOMC 3JV4B 2UZIL 4E41E 4KY1L 4PJ7A 5JMOC 5ADOH 2ESVD 1J5OH 5IJVB 4JY6A 4EOWL 4GRWF 5IR1A 3MV7E 5CP7B 1LWRA 3O11B 4RGNC 1XGYL 1YEEH 1ZLWH 4IIQA 3MTRA 4U1JA 3RP1A 4PJGE 3KLHD 5HGBB 3WIHA 1KBGL 1PBYA 2D7OA 4A2MA 3V4PH 4Y1AB 3AREB 5J1AB 3PWJA 4NZJA 1RUPL 1F4HA 1ROWA 3FB5B 5DMKB 2EXYC 2O5ZL 4NKQB 3TBTA 2H2SC 3OZ9H 3WKNA 2VDRL 2BFVH 2HKHH 3OPZL 4JZJB 3ZKND 5F9JB 1RZ8A 5IEHB 4X9FA 4R8WL 3KPLB 3WFEH 5E08L 4ZO9A 4R4FH 1AP2B 4OZHE 4G5ZL 5FM8A 1H15B 1R0AH 3O2DA 4CVZB 1MFAH 4XBGB 4Z78A 4Z7QE 3INUH 5ESQB 5ALCL 1GVIA 5EBWB 3B6SB 3WJLC 3IS1X 4EI5B 2Y4SA 2EDWA 4PGEB 5ITFB 5CSBA 3BYYA 5BV7C 2Q3ZA 5F6HJ 1MHHB 4LQFL 4G42A 4X5WA 3GO1H 2VE6A 3VXMB 3BKYL 4MJIE 1L0QA 5C08B 4U1KB 3WFCH 2YPLE 2BRRL 2NLJB 3V6OA 3ZMRA 4U33A 1C5CH 2FZ3A 5HYJD 4IOSD 1DP0A 2FJGB 5C0CD 3RI5F 3TFKC 4PJXF 2A83A 4WWKA 3HLAA 4WJ5B 3VFPA 1NAKH 3L3DA 5DZLA 1HHHB 3DUSA 4EDWH 2A9MH 4GG8B 2O26U 2VL5A 3GI9L 3ARUA 1GZPA 2Z9TA 5EOQH 2BVUA 2XZQL 4UNUA 2WUCH 5EO1B 3DO3A 3L95B 4HWUA 3IAQA 5FYJH 3TIDB 3HUJB 3KJ6L 1V3LA 5A16B 3JV4A 5DJ8B 3IGAA 4UV4L 3QDAA 3IDNA 5CUSH 4WFEE 3S88L 3U2SA 3ISWA 3BRDA 4YPJA 4QHLB 3T0VA 4OI8A 2F74A 1XIWC 5CJBA 4GMSL 2OXHA 3O11A 1SYSB 3X3GH 5D8JH 1VACA 5E2UL 8FABB 3VFGL 3VFVB 3PDDA 3ULVD 5INCA 1D9KA 4HC1H 2VC2H 5J1AA 4MNGE 4H26B 4M3KB 5DD5H 1NCAH 4HZAA 3L5XH 2AV7B 3FCTB 3L3JB 4NNPL 2VDMH 1NDMB 5H35B 4JFFA 3HKFA 3SDXA 5KZCD 2FATH 1Z9OA 3VWJB 4XPGH 3DX6B 3IT8D 5BXFA 5F9JA 4QGYA 4EXPX 1XF2B 1GPOH 3GSNH 3KPLA 4KK9D 2RR3A 4MQSB 1V05A 4U1MA 2AABH 5CZKA 4L8CA 1A64A 5AUMA 1UWXK 4WFFE 2PO6D 4OCXH 3B6SA 3QEGH 4JY5L 1F13A 2X4QB 5JW4Q 4MB5A 2R4SL 2HAZA 4EI5A 4KV5F 3MLWL 2JF1A 2EIZA 1MLBA 2DQFB 2W65B 4RGNB 1MHHA 5HHXH 1JN6B 3U36A 2C1OB 1MJ7H 1G7PB 4PP1D 3VFSB 3WBDA 2XWTB 4U1KA 1KUMA 4M7KH 3MX0A 4HGMA 1IVLA 5B39A 4YDKL 3MJ7B 3I02B 3MV9A 3UTOA 2C3XA 4PY8I 4GAFB 4KI5E 4M6NH 3IS0X 3TZVB 4WJ5A 3E2HB 5EIIA 4XP5L 2BMKB 1FRGL 4GG8A 5K93A 4JFEB 4PJDE 5CKAA 3JWOL 1DJSA 4GAYB 4Q2ZB 3MRPB 3P9MA 5HHMD 2E9JA 1LO5A 5KSBF 5HJ3B 3M1BA 2H41A 2EDBA 5EO1A 1G6RL 2B20A 5FECB 4OF7A 1RZJL 4XPHL 4MGXA 3HUJA 5A16A 5I73C 5DJ8A 3MREA 4LPXA 3RBSA 4JZNB 3T0ED 2XNAB 4CMMB 5BV7B 2HT3D 5IFHH 4KRLB 3QAZB 4HG4J 4QHLA 5FDWB 3EBAA 4WTZA 4DJMA 3Q3GB 5EO9A 2X10A 4QRRA 5CD3A 4U6XA 3VXSE 1JF1A 4HFWB 4APQD 3LH2H 2QKIA 5GJTL 2BXZA 2LU3A 3S9DB 3SKOB 2YEZB 5DQJB 2DLHA 3AY4A 1UJTA 1CDYA 3WEXA 3HZYB 5IB3B 2AXGA 2AV7A 3FCTA 2UWEA 3QFDA 1NDMA 3AMLA 1R3IH 3WIIL 5E9DA 1MI5B 2DKSA 4DUWA 3ROOB 1OQXA 1BEYL 3VWJA 4BELD 2AGJL 2HTKC 3DX6A 1KCUH 1M05B 4N8VG 3U7WL 4BJLA 4ERSH 1CLZH 4LASH 3OSKA 1XF2A 4OIBA 1RD6A 3CDYA 3O2DL 4JGJA 1YMHB 5DEFB 1T1ZB 5C07B 3QUKB 3MUHL 5ADPL 4X99B 4GRLC 5SWQA 3QUYA 4X5XB 5EOCH 4DN3L 1G1CA 1Q1JL 3HI1B 4HKJB 5F1SA 3X14A 1DVFD 4KVNL 1X6LA 1XIWB 3IDXL 3VXRB 2GFBB 2W65A 1JK8B 2P4AB 1QFHA 4OZFA 3CVHL 1LD9B 1J1PL 1T2QL 5EOCJ 5LCVL 3TO2A 3WXVH 4GW4B 3RNQB 4WCYL 1BJ1J 5EU6A 4J4PC 2D9CA 1NFDE 1T6WA 5DD6A 4PRAA 4Y16D 1MFNA 3SKUD 5DJZB 1F3RB 3EOYG 4O5LH 2R8SH 4ZQKB 5K59E 4ELKB 3MJ7A 1QA9B 3AM8C 1TJHL 3I02A 4HKXA 3T8XB 1C8PA 2IF7A 3DXAB 2GK2A 3L3KA 2WBKA 4WEBH 3NIDE 1PZ5A 3TZVA 3KVQA 2ZOLB 2BMKA 3BAEL 4ZUVB 5GRZA 4JFEA 2AXFB 1MFBH 4KVCL 3MJ9A 4OM1H 4NQCE 4Q2ZA 5FM4A 5SX5H 3E8UH 1JZ4A 3B9KB 4NGHH 3UJTL 4XI5D 4X9HA 2BCKA 3LOWA 1OGTB 5AYUL 3QQ9C 1I1AC 3HE6D 3OX8B 43C9B 5IHLB 1NFKA 2EYTB 3ARTA 3F62A 3MA7B 4OIIH 3WCYA 4NQED 3RVWC 5FDWA 5KANI 3Q3GA 2VXVH 4PJAE 4NZRH 2E8YA 1ZANH 4HCRA 3WKML 2DDQH 1YEFL 3F6IA 1I85A 4P3CH 4LMQI 5FUCE 3ILPB 1CYGA 3PP4H 5CKGA 5IB3A 3W9EA 1RK1A 5BMFL 2VXUL 4J1UB 1ES0B 5DD0L 5E8OA 1EGJL 4WU5A 3ECBA 5AWNL 4QOKD 4RA0C 4N9OB 3V95A 2VSCA 3D18B 1M05A 4NWUL 3GNMH 4OSUH 4G6FB 5T5FH 1FL3B 4DGYL 1KCRH 4I3RH 4I2XB 3QEUB 2WINB 2XRAH 4RMSA 5T1DL 2RAMA 3QUXA 3VFRB 2CMRL 1H8OA 3OTTA 1I9IH 2VLRE 4X5XA 4MAUH 2Y72A 1P2CA 4WV1C 5E95B 3HI1A 4WHYG 5FGCE 3ARRA 2HT4D 3DX9B 4DFHA 2BX5A 2DQHL 4XB7A 2YPVH 2LFGA 5DHVH 4ZO6A 4I8DA 2XZAL 4EN3C 2D7PA 4LEOB 3VRJB 4OJFH 1KJMA 4GW4A 2LU7A 3JUYA 3RNQA 1BM3H 1DQDL 2BC4A 1UADC 2IPTH 4N0UB 1JGEA 1TPXC 2O5YH 5DJZA 1FZJA 2W0KA 1H5BC 2R69L 5D72L 4ELKA 4YGVB 4YFEA 1E6JH 4WO4B 1PY9A 3U46B 3O9WC 1FH5L 3CFIC 2QHLA 1PX4A 5GGRY 3T8XA 3ULUH 4CU8A 3GBMH 3V6BR 4BFEA 4JCMA 1ADQH 2EKSB 2ZOLA 2VRAA 1X5JA 4ZUVA 1SYVB 4JFZH 1K4DB 3V52H 4OCWH 5DD1H 3RKDD 4GS7C 1B9ZA 5CJQL 3QHFL 3OKEB 2AK4B 4QXGH 3B9KA 4GRLB 4TNWF 3U7YL 4X4MA 3ZDXE 3S96B 1OGTA 2R2HA 1T0NB 1R5IB 2XWBB 3OX8A 43C9A 5F97E 3SKJL 2D31A 3EFFB 4AT6A 2OK0L 4GQ9H 5F7DB 5IBLD 1S9YB 4JE4B 3KDMA 2XN9D 1LEIB 1A6UL 1RZKL 1PDKA 4MXWL 4UDUB 1Q0YL 4U49A 3H9SB 4AM0A 1N3NB 4Y4KC 4YBQC 1A7BA 4QRQA 3O6KL 4R97C 4HZLA 3RJDA 2AP2A 1ES0A 2CDFB 1RSFA 2PKDA 3IAPA 3QDGE 1F5WA 1SBBA 4PY8J 2E7CA 4FQCL 1FPTH 2JCCA 4BFIA 1KJ2B 5JPNA 3SOBH 3D18A 3KPQB 1HXMB 1I8KA 2WUBL 5IHZB 1CQYA 3BDYL 3MRIB 1T1XA 3ULVF 4JQXC 3LKRA 3QHTC 4PB0L 4XNZC 2EEDA 4HUMB 1I1AB 1S7VB 1TFHA 3VA6A 2RHEA 3NCJL 4IRZH 5I1GH 1CT8B 3FQWB 4ZOAA 2UY7A 2IQ9L 4PJHE 4KKLC 1UA6H 3U0WL 5FA3B 4YJZL 5INDA 5T3XE 3EYOB 1J18A 5CGYC 4D9RE 5BRZE 2DQDL 1J9CT 4FQ1L 2CLZB 5GXBB 4N0YL 4N0UA 4PJBB 2ZG2A 4MNHB 4H20H 4MXVF 2NY2B 1ND0B 4FABL 2BY2A 1TJIH 1PFCA 3RVVC 2R29L 3B4NA 1QFUL 2ARWA 3UTSE 4HT1H 3LHPH 2F5BH 1WICA 1KIRA 3QIUD 2EKSA 5MEND 3VD5A 4KUCF 4J2XA 2CPCA 2NTFA 1SYVA 1K4DA 3RL1B 1N7ML 35C8H 3FQNB 1MSPA 4PRIB 3OKEA 4M43H 2VXTL 3DROB 1NC2D 4XCNB 3OKNB 4LHUB 4JM2F 1QG3A 5B38G 1HIML 1EZVX 3FMGH 5IVXB 3J8F7 1R5IA 2XWBA 2UZIH 1N6VA 5BV7L 5DA4A 3SEPA 4KY1H 1KYOK 3Q6FB 5J6GB 4ZS6C 1YA5A 3RU8L 1S9YA 3ZYIA 4EUPH 3IDGB 4OLEA 4EOWH 1ACYL 5KSUA 4QCIB 4HCRL 5D1ZA 1OL0A 2UUDH 3MFFB 3BRFA 1L9MA 3BPLC 1TPXB 1UH2A 4ZSOE 2IAMD 1KBGH 4PGDA 3VJ6B 2AV1A 3UBXB 1N3NA 1H5BB 1RUPH 3NVQA 5FFLA 3O9WB 2XG4A 5C92A 1TITA 1IRAY 2O5ZH 1K85A 2VDRH 5FYJD 3OPZH 4WHDA 4WW2F 1G7MB 1KJ2A 4BH7B 4FZEL 4RZCA 4R8WH 4XPTL 4GS7B 3JTSB 5E08H 1TCRB 3K0WA 4YNYB 3IXAB 1BOGB 5CLWA 5A1AA 1S7VA 5ALCH 3AU1B 1CT8A 3FQWA 3PQYD 1U58A 4GRWE 4LFHG 2BSRB 4NCC2 1BZQK 1KN2L 2WWKO 5TF0A 4LSQL 1MCQA 4LQFH 1NGXB 5IG7A 4HPOL 3G5VB 1R3LA 1A47A 2CLZA 2V2WB 4DWHA 3OAUL 3BKYH 3KYAA 3EJYC 1S5HA 5LGJA 4YBLC 4Y4KB 4MNHA 3ZSSA 2EIDA 4KTYA 1L7IL 2BRRH 3ZTNH 2OJEA 4R97B 4YBHA 2A6JB 4JLRB 5C0NC 4LP5A 4OZ4A 3RWEA 2WBWB 2ARJB 4MXQD 2A38A 2VAAB 3MXVL 1P7QD 5F8RC 4D0DA 1MY5A 2AVGA 3MV8D 1YMME 5JLZB 1IAII 4IMKA 3RL1A 1FNFA 3BQUD 5GIRA 5CZVL 1ZA6B 4ZPTB 1AQKL 3MZGB 5T3ZE 1XF5B 2XZQH 2NY6C 1JUFB 4XCNA 4LHUA 1N59B 3HI6L 3KJ6H 3D5OF 4UV4H 2B7DT 4L9LC 3TO4C 3S88H 4UU9A 5BS0A 2PYEA 3IDGA 1XF3B 4LP4A 1HCVA 4UB0L 4QCIA 4GMSH 4P3DA 2ZCKL 4BQCA 3MFFA 1A4JB 2V9QA 3OJDA 5E2UH 3VFGH 5C0BD 4ETYA 3G5ZA 5DVKA 3UBXA 2XTJB 4UQ2A 5LAXB 3ZDZE 3QXVA 4PJXE 3D39A 2Z92B 1QTYT 1G7MA 1MPAL 1YEIL 2I5YL 4HMDA 2FH8A 3X11B 4ZDHB 1CD1B 3S34L 1YNKL 3G6JB 4I5BA 3IXAA 3ARGD 4BZ2L 5AG8A 3AU1A 4JY5H 1FFRA 5E0QA 3S6CA 4HS6A 3TP4A 3NFPA 1KFAL 3SGDI 4Y2DD 2BSRA 2R4SH 1VPOL 3B2UC 3BEWA 3GFUA 4OFKA 4YEFA 3F7YA 1KC5L 5GRXG 5MEPB 1F3JA 4QO1A 4CVXB 4J4PD 5C71A 4HUWB 3L7EB 4NO0B 4PLJD 4YDKH 2CK2A 2IANB 4EVNB 1H8NA 1WV7T 4WU7B 5D93B 5DK0A 2EE3A 5TH2B 2BOCB 3V5KB 4CAGA 5C3LD 4ZYKB 4ODUB 4PJ5B 2W07A 1OB1B 5I30L 4XP5H 5J7CC 1FRGH 5JLZA 2ICEA 2FWOB 3JWOH 4ZPTA 4P23B 1XF5A 2OLDA 2FIRT 3ARXA 4L4TA 1G6RH 3W5NA 3PIQA 1RZJH 1N59A 5F1KC 1U8QA 4JANA 4KV5E 5D6CB 2DYPB 3ZTJG 2ZUVA 4H25B 3QISA 2V5SA 3V5DA 4NUJB 1CTOA 4R96B 1XF3A 4F7TA 3GMLA 3BH8B 3OF6D 6FABL 4YBLB 4ZTPL 3SCMA 3ZLQC 4QRPD 3FFCB 4HMEA 3VFMB 5C0EA 4DKEH 1WTLA 1ORSB 5JDSB 5LAXA 1J8HD 1A7RL 2H1PL 1I9RL 4PJCF 4YHKL 1UKTA 5HY9B 3WIIH 4KJWD 1KJ2L 3WNLA 3IJSB 3BN3B 2QADC 1QBAA 1BEYH 1PLGL 3SGKA 1EX0A 3U7WH 2GIYA 4JFXB 4Y19E 1KB9K 2X9YA 4ZDHA 5DD3L 3G6JA 3T77B 5KSBE 3O2DH 2FYYB 1XF1A 1MRCL 3D2UD 2BERA 2AJUL 5ADPH 3VW3H 3ORJA 2L7JA 3HC0B 1DR9A 4Z7NE 4L9LB 3TO4B 1Q1JH 2OX5A 1LILA 2Y36L 3S35X 4DN3H 3CFKA 1U8NA 3WHXB 4KVNH 1BF8A 3IDXH 4C54A 5IF0A 3P4NB 9CGTA 3CVHH 1J1PH 1T2QH 3HR5B 5CMAB 4B7IA 4EN3D 4NC0B 5E4IA 4WCYH 4MD0B 3N50A 1CFQA 3WS6A 1CZ8L 2E7HA 3BVNB 4QF1A 1B4RA 4MJ6B 1CFNA 5DF0A 3L7EA 4LKCA 1E4XL 2IANA 1TJHH 1RUQL 4WU7A 5B3JF 2CXGA 2OTUB 5EC2A 1CVSC 3NFSH 3O6FD 4D3CL 3BAEH 5HHOB 2XZCL 1YEKL 4KVCH 4LSUL 4XP1L 2FWOA 4OFPA 4P23A 3AAZB 5D2LF 2CIIA 4U31A 3UJTH 1Q9OB 3FN9A 2D03L 5E6ZA 5AYUH 3WFZA 3LEVL 1C7TA 1KENH 2X4TB 2MNUA 3HMWL 5D6CA 2DYPA 3KPRA 3PABB 4Z6AT 3E1F1 5ACZB 1LP9B 4NUJA 5J13B 5EZOL 4R96A 3HZKB 5BW7C 2MTPA 3BH8A 3O3UN 5JOFA 1I4FA 4K7PX 5F3BB 2JK5A 3P4OA 4KKNA 3WKMH 1HSAA 4HXBL 4N0RA 1KG0A 1YEFH 2CJUL 3N1GC 1X4XA 1ORSA 4YBQD 5JDSA 3UZVB 2A73B 5BMFH 3VD3A 2VXUH 3UPRA 1Z3GL 5DD0H 1EGJH 2WNGA 3BP4B 4LF3A 2NXZC 2LVCA 3IJSA 5AWNH 1IKNC 2EH7L 5E6IC 4PRHE 2WP3O 1QRNE 4NWUH 1EA9C 4DGYH 3O4LA 3S36X 5JDJA 4L29A 2MPAL 3T77A 4N90E 1E6OL 3T0WA 2CMRH 4ZFZB 3QFJB 1M7IB 5TE7L 5K9KB 1EEZB 2OR9L 5DC4B 2ZP0T 1EBAA 5MERA 1ZLUK 1ZHKA 2W0FB 4JDTL 3WSQL 5D7IB 2YXFA 2CRIA 3D3VE 1AXSB 2DQHH 4NKIL 3VGBA 3WHXA 2ADGA 2XZAH 3P4NA 3P0GB 4EUPG 3HR5A 4TUKL 4TULL 1QHOA 3C60C 3FRPA 2VR9A 4BQ8A 2VITA 2A1WH 5GZOD 2R0ZL 3FQTA 3MGAA 4ODWB 4IOIB 3VI4F 1KTKE 4LK4A 4UBDD 4OLVL 3W11C 2R69H 1X5IA 5D72H 5MHSD 2ESVE 4MAYA 1QHPA 5F88B 4N5EC 1FH5H 2UV3A 3DI2B 2QADB 1CLCA 1AC0A 1A6PA 2H9GB 2OS7A 1MREL 3I6LD 2GSIB 4IMLB 3FAWA 4KRPC 4WNQB 5MEQB 1CE6A 5SWZB 3W9DB 1JGLL 5CJQH 3QHFH 5FO9B 3SGDH 1AGBA 3WJJA 3U7YH 4PJ9C 5ICZA 4MSWB 4Z7UB 1HH6A 4A6YB 2X4TA 3VXQA 3SKJH 3WMSA 2OK0H 4RNRB 2AEQL 3PABA 1P1ZA 2X4UA 4OT1L 1LP9A 4URTB 2C4FT 4HV8B 1RJZB 3UYOD 1N4XH 1A6UH 1SY6L 3EZ8A 5D1QA 1R5VB 1RZKH 3C6LC 4MXWH 1Q0YH 1IEAB 3ILQD 5IEKB 3QQNA 2Z31A 1KTDA 5IW1A 3Q1SL 2V5TA 3O6KH 4PV8A 2HFTA 2D7QA 3BP4A 4FQCH 4M6ML 4G6JL 3QA3A 4FG6D 4OFIA 5IWLA 1NC4B 5F7KC 2E7LC 2WUBH 3BDYH 5DJXB 4CKVX 2IPUG 4KK6C 3NMEA 4HXAH 4LLQB 4PB0H 1TTFA 1FQ9C 3CZJA 1EEZA 5HYJE 5C0CE 1PSKL 4Q6YA 1LMKA 3NCJH 1P7HL 4YHML 4DOHB 1HQRA 2IQ9H 3IU4H 4G8GD 5FYKD 3U0WH 1U3YA 2DQDH 4BQBA 2YD9A 3TV3L 4FQ1H 3SDDC 5IB1B 4ZXBD 4CDHA 3CFEA 4N0YH 3EO0B 5J57B 3TYFB 3NACL 4XWGH 4ONGH 3KLAA 4FABH 3S4SB 3LCYA 4HJGA 1G7QB 3MJGX 1X5AA 1CS6A 2NXZB 4C83A 2R29H 3CXHK 5E6IB 5ILTL 1QFUH 4YC2C 1FO0A 1U42A 5F7LB 3FOLB 1QLRB 5HYQB 3RPKA 2GSIA 3VGAB 2DQEL 1YYLL 2WBJB 5E99L 3ULVE 2BXYA 4NQTA 5BVJB 1CF8L 3GI8L 4ISVB 4WNQA 1XH3B 1OTUD 4L3EB 12E8L 3UP1A 3VFNB 1OP9A 1N7MH 3HA0A 3W9DA 5D4QA 4JPIB 4DZBB 1EUTA 5C09D 5KS9A 3GSRB 2IQAA 2VXTH 3FO1B 4ZO7A 3QXDB 1HIMH 3QP3A 5IBUG 4MSWA 1ED3B 1DUZB 4PJFA 5BV7H 4RNRA 3PHSA 3BSZL 3RU8H 3W0WA 4HV8A 1RJZA 4PG2A 1ACYH 1Y0LA 4ZS7H 3VFUB 3C60B 3NFNB 1CGTA 4HCRH 3RTQA 3ARFB 5LQBL 1R5VA 3MCKB 4MXVE 3WO3B 1BD2D 1FZKA 3O45B 1LK2B 5IEKA 4BA8A 4WI3A 4G9FB 3I6GB 2OSLA 4X6CF 2EDKA 2B0SL 1PG7W 1KPUA 1T4KB 5CZXD 2P7TA 3JVGC 3T2PA 1NQBA 5GZND 1OVZA 3VGGA 4KRPB 4P4KC 1E4XI 4FZEH 4XPTH 3LD8C 4FMKA 5DJXA 1FBIL 1AGEA 4HS3B 3N9GH 1T89A 1SJXA 3GSOA 4PJ9B 4PV9B 3U0TA 2HG5A 4OTXL 3WDJA 2X70B 5E7BA 4AMKL 1KN2H 3HPJB 4S1QL 3BD4A 4LSQH 2GSGB 3ALPA 5I17A 1P53A 2HTLD 2P5WB 3DYMA 1EK3A 4HPOH 4NO5B 5HHME 5IT2L 1LO3L 3OAUH 4JKPH 4GBXA 5C0AB 3TYFA 3V7AE 1L7IH 5F7WC 1UWXH 2F53D 4DUVA 3IFOA 5EBMB 3T0EE 4ZFFA 4RMRA 1NJ9B 4FOMA 3UBXI 4X7DC 5ISZB 3F7RA 5DJAB 1YZZA 1BJ8A 3MXVH 5DRXB 1I7ZA 3TVMA 3C5ZC 4W4NA 2WBJA 3QULB 5FYLD 3ZE2F 1XH3A 3K2UL 3MNVB 2X4SB 5FHAL 4L3EA 5GGTA 4JM4L 1ZHNB 3DYPA 5CZVH 4V2BA 4XTRD 4PJEB 1AQKH 1IAOA 3GSRA 2ADIA 3S35L 1CGUA 3FO1A 1SJHA 3QXDA 4N1CA 1ED3A 3NCCB 5FK9B 3MV01 3ZT6A 2Q76A 1B2WL 1EERB 5JMRA 5HVFB 4YE4L 1BBJB 4UB0H 4LAJH 4W6XB 3NFNA 3ARFA 1AKJD 2XQYG 2ZCKH 2A6IB 1QSFB 1RQ5A 3MCKA 4ZFOB 1GC1L 1PQZB 2MOVA 2AERT 3F5WB 1INDL 1BX2B 4GXVL 1Q38A 2X2YA 2P8LA 2CGRL 4G9FA 2DIAA 3SY0A 1K8DB 2VDNL 1QNZL 4YC2B 2OI9C 5JW4R 2C1PB 5BOZG 3EYVA 1OM3L 3D0LA 1MPAH 1MAKA 1YEIH 3ULUF 4PJIF 3MRFA 2GEEA 1JMZA 3S34H 5IB2B 1KB5B 5FYJU 2VQ1B 4XXCA 5MI0C 2BNQE 4M00A 4KI1A 1J10A 2Z93B 3NIFF 3A6BL 3QXWA 4BZ2H 2YOCA 1GXEA 1IFHL 4R26L 4U1NA 5DT1L 2J7LA 1OLZA 1KFAH 3GHEL 1VPOH 1JCKA 3HPJA 5KTEL 4R3SA 4K7PL 4LAQL 1KC5H 1WITA 3GSXB 4WVRA 4JO4L 4NO5A 3RIFF 5SV4A 3OXSA 4V1DD 5B4MC 3STLA 4MVBD 3AMKA 1VEOA 1UEMA 1LK3H 2EDYA 3V0VB 1NJ9A 5DMGD 5DEZA 1JYVA 5BCAA 4NQEE 4ZD3L 3PWNB 4P4KB 5DJAA 2VLJA 2NX5B 2EDQA 1JZ6A 3KYNA 5D2NE 5I30H 3LD8B 1JPFA 2BNRB 1S5IL 3QULA 1QR1B 4KMTL 4TUOB 1YEDB 2X4SA 4LRIC 1GGIL 4WI5A 1UXSB 3S37X 2AXJA 4HK3N 1NGZB 1JJUA 1ZHNA 3RVUD 4PJEA 3CLEL 3TM6A 3F58L 1KIQB 1CIUA 2V9RA 3FT3B 5GS2H 4A6YL 4OGAC 4QY8B 2R4RL 4X7SL 4OZGF 5I0ZA 4QOKE 2DI9A 5JQHC 2BVPB 1K8IB 4G80A 1ZS8A 3CFBA 3E3QE 4OKVB 4G8IB 1WBYB 6FABH 4Y19A 4WWKD 3UXFA 4JO3L 4TQEL 4Z0BL 3F65A 4Z7VF 4NRZB 1PQZA 3TCLB 3F5WA 4N9GB 5FM5O 2ADJA 1DFBL 1DL7L 5B39G 3TBVA 2EC9T 4Q7DA 1IAMA 1A7RH 1OTSC 1I9RH 2H1PH 4YHKH 4FS0A 3TH3T 4TSCL 1KJ2H 1A14L 4XNMA 3JWDL 2HJLA 1M7XA 4JQIL 2Y6SD 3PL6B 1QFWL 3C5ZB 1T0PB 1PLGH 1QSZA 3VXNA 5DVNA 1U3JA 3U30C 2W0LA 4WUUB 5F1NB 1T22A 3GDBA 5DD3H 1CLYL 5I18L 5IB2A 5JHDA 3PJSB 3K3QA 2VQ1A 1MRCH 4MX7A 4NHUA 1OGAB 4FQXA 5EWIL 3KWWB 5ESAA 2AJUH 3MLRL 1DN2A 1D9KD 5SWSB 1Q94B 4OCMC 5F72S 5ELIA 2Y36H 5IGXL 2RGSA 2CKBB 3T0AA 1N6QL 1WVZA 5DS8B 2J4WL 3IU3B 1P84K 3VDBA 1IGJA 4JFFD 4MDIB 4TVPL 4WTZG 3IDIA 3MLZL 4M02A 3ZHKA 3GSXA 4KMLB 2HFFB 1LHZA 4IDJL 1CZ8H 1KJVA 1NKRA 4RFOL 2YHGA 3DHMA 2OI9B 1E4XH 1UCTA 3OKDA 1ZAGA 2AJSH 1I1YB 1RUQH 1PKQB 2VISB 3QUZB 4XXDB 3SDAC 3P0YL 3EIFA 3PWNA 5JIPA 2XN9E 5IMKA 5DRNB 4JO2H 4WWID 3VFTB 1EHLL 1CK0L 4IRJA 4D3CH 1QR1A 1VFAB 2XZCH 4CADB 1YEKH 1YEDA 3ES6B 4KTEL 4LSUH 5HDBF 2OR7A 5MI0B 4XP1H 5I1CL 3RZCA 4FZ8L 3LQMA 3FT3A 5GSRB 2DBLL 4JDVB 4ELMB 2D03H 3LEVH 2Y07L 3HMWH 4MLIA 4DZ8B 3CDFA 3MV9D 2VQUA 5EZOH 2X4NB 2KBGA 4OZFG 2Q7YA 4Y4HA 1WBYA 1U8PA 1OT2A 4M9PA 2BNUA 3C6LD 4JZOB 4NRZA 3LKNB 2Q86B 4HXBH 1OARL 3AS1A 4KDTC 2CJUH 5JPMB 2DF3A 3O3AB 4NN5C 2LTQC 4X6DB 3P0VL 5B3JE 3GK8H 1Z3GH 5D6DA 2EH7H 4YWGL 5KVDL 1YN7B 3KXFE 3PL6A 3EOAA 2GUOB 2X1XR 5DI8B 4N8CL 3EJJX 3OAYK 5J12B 2MPAH 1E6OH 3QR2A 4ETQA 4QRRD 3BIAX 1JZ2A 5TE7H 2KL6A 1FIEA 2DBJA 1OGAA 2OR9H 3KWWA 2R2BB 1CD8A 5SWSA 1Q94A 1UJ3C 3GMNA 3WLBB 3GMMA 3UDWA 5CD5C 3T4YB 4JDTH 5MENE 5JQ6L 3WSQH 3VXPB 5CEZL 2V2TB 4E41B 2X40A 1J0JA 4NKIH 5F1IB 1N64H 3IU3A 5E9DD 1UKQA 1ZA3B 3BOVA 3IETB 4MDIA 4TUKH 3MV7B 4TULH 3VWJD 4HK0B 2HFFA 4LGPB 5KG9B 1A6ZA 2PF6A 2VIRB 1UWEL 4PJGB 3STBA 2R0ZH 2GYSA 3MRDB 3LRSB 4POZD 5I8CB 4OCLC 4OLVH 5I66B 1FV1B 3AFLA 2VISA 1LEKA 3QUZA 5ITBL 3QUYD 3SE9H 1MREH 5DRNA 1RPQA 3VFTA 3PDOA 3MMEA 1JNLL 4KI5C 4YUEL 4CADA 3OKYA 1MCDA 4HWZB 1KNOB 1JGLH 1DQJB 4M1GH 5EU6D 4LLAA 5F9WC 1FG2A 2D2OA 4HIIB 2EDEA 4JDVA 1SVCP 1M7DB 4MHHI 5HHNB 4AENB 5FYJE 4AQ1B 4DZ8A 2AEQH 4NRYB 4R9HA 4OT1H 2PTUA 2QQNL 4L5FL 5JOPD 3ZSTA 2VZSA 1SY6H 3DRTA 4ZFOL 1YY8A 5DXWA 1DLHA 4QXTA 1AGDB 3VI4E 1FORL 4XPFH 4M7LL 2NR6D 3GRWA 1S7UB 3LKNA 2Q86A 4JFED 5C9JA 1CICA 3PQYE 2YPLB 3BP6B 1G7JA 5JPMA 1ZGLM 3CSYA 2VMFA 2NY0B 4X6DA 1KPRB 3Q1SH 1WFUA 3SDAB 2FLBT 2DD8L 4G6JH 1A7QL 1SJVA 2YZ1A 4G43A 5GQBA 3UTTA 3KG5A 2NY1D 1KB5L 5CBEB 3QRGL 3LQAL 4MA7L 1HXYA 1T83A 1I8MA 4KZDH 3GMRA 5FDYA 1KT2B 1PSKH 1WLHA 3B3IA 4WHTB 3QNYA 2DQCL 3ZT5A 3OB8A 3VXPA 1TJGL 2V2TA 5DJ2B 3MV8E 2CSPA 1ZA3A 3KPSE 1RU9L 5L2KE 2GK0A 1CDGA 3UZQA 3TV3H 1K4CA 1CGSL 4OZIB 3CNKA 5KG9A 2R23A 1RZIB 3VE0A 5EG6C 1A1OA 1PG7X 3NACH 3MRDA 3QUXD 2OZ4A 3LRSA 4TPRL 5I8CA 2VTFA 3MLTB 5I66A 1FV1A 1D5MB 5ILTH 1U91B 1IZKA 1QVOB 2LVEA 3MRLB 3PGDB 2YSSA 3RL2B 2HJKB 3PGFL 1HKLL 4FQIL 2YWZA 5C0BE 1OW0A 1CF8H 3GI8H 4KKBC 12E8H 2HP4A 1KNOA 3G6AA 1QFWI 1DQJA 4NZUL 1GGTA 4KXZH 2GTZB 3WHE0 1NCWL 1XF4B 3PWUB 4PGJA 1FYTA 3UCRA 4FQLL 1HYSC 3K1DA 3IJHA 5HHNA 4AENA 4NN7C 4YQXL 4K8RC 1GRWA 1O0VA 2FO4A 4NRYA 5C2BL 3U9UB 3LSOA 3ROLA 4PBXA 3TBYA 5LQBH 3H7BA 2J6EA 3O8XB 5GS0H 1AGDA 4Z7WA 1X5KA 1S7UA 3RGHA 2R1YB 5DR5L 2HT2C 3BP6A 1E4WL 4JM2A 1KPRA 3WFDL 3B9KD 5IQ9B 5FUCC 3U48A 5C86A 2GJ6B 5HHVL 3B9AA 1MY7A 1DANU 4MJ5B 1FBIH 4PJDB 4Z0XB 1AC6A 4DFIA 3DECA 4P9HL 4OQTA 3KPPB 1W0VB 2CKBL 4WHTA 4OTXH 4HSQA 1UYWL 4RMVA 4AMKH 5I1DB 4S1QH 3GZKA 4JFQB 4V2CB 4O51A 4XCEB 1UXWB 5IT2H 5FYKU 1Q9WA 3CSBA 2HN7A 4OZIA 4G6FD 1LO3H 3VXSB 5HTSA 1KF9B 3DVFA 1IL1B 4P46B 4X6CE 2I9LA 1PGRB 3U6RA 7FABL 1TQCC 1BFSA 4DUXA 4HW6A 3NAAL 4R2GB 3SDYL 3SQOL 2R0LL 3MLTA 4YDVB 3UO1L 1JPGA 3PWPB 2HLAB 1HSBA 1D5MA 32C2A 3EO9L 3FB6B 4PBWD 4OD2B 4JPKL 4L9DA 2FX9L 4MLSA 5KSAC 5LGKA 3MYJA 2YD5A 4LLDB 1FSKB 4QRPE 5FHAH 1AHWA 3VWKA 4C55A 4JM4H 3BGFB 4EQ2A 3UTZB 1S7RA 1J8HE 4S2SB 3PWUA 3S35H 1M6OB 2WQ8A 5JORB 1C12B 5EBGA 3BWAB 3O3EB 2A77H 2H26A 1B2WH 4HDIB 3FB8B 4RGOL 3U9UA 2PCPB 2H32B 4ODVL 4YE4H 4H8WL 2Z4QB 1Z9MA 3O8XA 3GRWL 5DRWB 4JGMA 1REIA 4OLWL 4AK1A 1GC1H 3RHWF 4F37K 3GBLA 5FEBA 2R1YA 1NFDB 4MNQA 5I1LB 3OKOB 1INDH 4GXVH 2CGRH 2BNQA 4Y5YA 1RJYA 2J3SA 1ZSDA 1D5ZB 1WSST 5D7LB 5IQ9A 1QNZH 5ANMA 4F2MA 4BSJA 5GS2D 4YHPB 1A02N 4NQDE 1FFPA 2GJ6A 1OTTD 1H3VA 3WHE1 2CUIA 3C09B 4MJ5A 2YKLL 5HBBA 1WZLA 5D1ZD 1MCJA 3MRCB 1EV2E 5L8JB 1DQQA 3MGTB 1QLFB 1L0YA 4NQCB 3MBEB 4CDGC 4IRSC 4Q74A 2V5MA 2MCPL 2NZIA 1W0VA 4LHUG 4NN7B 3MNWB 1HHGB 4CN6A 1VGKA 4R26H 5DT1H 2EEAA 3HUJF 4FQPA 5IQ7L 4I18C 2B4CC 5I1DA 4LCCC 3BGAA 5KTEH 4K7PH 4LAQH 1N8ZB 3SJVA 4XCEA 3C08L 3Q6GL 4JO4H 1EEQA 3TN0C 3HB3D 4PJAB 2YA2A 4IHOB 2NYYC 2PXYC 2C3HA 5JUEL 4HLZH 4I0PC 1MWAA 2XA8L 4P46A 1T3FB 3UBXG 2W59A 4I0KA 3PWPA 3DSNA 2HLAA 4ZD3H 3FB6A 3ULUE 4OD2A 1BIHA 2NY3B 1IILE 2A0LD 3O3BA 4PUBL 4WRLA 4GRMB 3MRBB 4UT7L 2DTSA 4KMTH 1RMFL 2WW8A 1GGIH 3DMMC 5I6XC 3MFGB 5IFJA 4CMHB 3NIFE 3CLEH 4Y7MA 3F58H 4TRPL 1S3KL 3R8QA 4S2SA 3ALXA 3UJIL 3DUUB 1M6OA 4A6YH 1CR9L 4X7SH 3MV11 3GIVB 5MEOB 3QDMB 4HUXB 4FQJL 2AJ3B 5GRYA 4LLMA 4HDIA 3LQZB 4XVJL 2DQGL 2PCPA 4I3SL 1A4KB 1A6AA 1GAFL 4WFED 2Z4QA 1C1EL 5DRWA 4JO3H 4TQEH 4G6KL 4Z0BH 5F8QC 2BOBB 1TQCB 5I1LA 3DIFB 4HJ0D 1DFBH 1JV5A 1J0YA 5D7LA 2N7BA 4CN1A 5IROC 4TSCH 4LHUD 4NKOA 1T04B 1HHIA 3BO8B 1P7KB 3JWDH 3KNBA 4JQIH 1QFWH 4RMWA 1S7TB 2ZSVB 4MMZC 2VWEE 1IE5A 4BUGA 5BS0D 2PYED 4YR6B 5I18H 1CLYH 1U36A 5FCUL 2WSKA 3MRCA 4YPGB 1EXUB 1JRHL 2F8OA 2XV6B 5MHSE 3MBEA 4PGCB 4OZGE 2ZJSH 5EWIH 3Q5YA 2DLTA 1J8KA 1B3JA 4PJCA 4NM8L 3MNWA 3I6LE 1OY3B 3TA3A 5JW5B 4YHOL 1N6QH 2J4WH 3D39D 2Q6WB 5DFVC 4TVPH 3MLZH 1N8ZA 2GT9A 2HJFA 5D7JC 4Z7VE 2EECA 3ARQA 1EO7A 5IUSA 3GSUB 4IHOA 2VKWA 4IDJH 4RFOH 3WXWL 4X9BA 3WNOA 3DVNA 3QNXB 5TGBA 3KPMA 3BHBA 25C8L 3RWFB 3BRGC 1J0KA 3NIGF 3CCHB 3P0YH 4M1CC 5D1XC 4MQXD 3V79C 2R1XB 1AIFA 1CFVL 5EU4B 1EHLH 1CK0H 4GRMA 1MFEL 3VGEA 1EBPA 5DJ6B 1UB5B 4KTEH 5ACLA 4JFYB 5I1CH 3NPSC 5ACMA 3GBNH 4FZ8H 4IRSB 3QZWA 1OD7A 2DBLH 4I48B 4FQQB 5DFTA 2Y07H 4JQVA 4J3VA 3QDMA 2LE9A 4DK6A 4I18B 5HYEA 2AJ3A 4PJHB 3LQZA 4Z18A 1YUHA 3KXFA 1P5UA 1XCTB 2PXYB 5BRZB 2Y7QB 4I77L 1TZGL 3SDCC 4I0PB 5D2LA 3BIBX 5FB8B 4ZODA 3UROR 1OARH 3BKJL 4G8GE 5FYKE 3P0VH 4ZNEA 1FL5B 1N26A 3FO2A 4O2CB 4L4TD 1J05A 5HDOA 4LKXB 4YWGH 5KVDH 3RWCB 4XGZB 3UTSB 3WNMA 2ZSVA 1AO7E 4XHJC 3QI9A 5HDBE 2EDXA 4N8CH 2PW1A 3KAAA 3O2VL 3D0VB 4YR6A 3L5WB 1CIDA 4NC2B 2BHUA 4GFTB 1IGFL 3TJEL 3ZE0F 5E1AB 1I8IB 2HVJA 3D85A 2IWGA 3KR3H 3SCMD 3RI5K 4ZMAT 4TNVK 4NRXA 1WUNT 4I3GA 2XTJD 3RNKA 2XT1B 4L1DA 4Z95L 5JQ6H 5JW5A 5CEZH 4MDJA 1EHAA 2Q6WA 5H2BB 2H2PC 1A2YB 3F7VB 5EU3A 3REWA 5EZLB 1YN6A 3LAFA 1I1FB 1OLLA 2F8XC 4AIZB 5C09E 1ZOXA 4M6OL 2IPKB 1UWEH 1TZIB 1F6LL 3DGGA 5F7UA 4ZUTA 3QNXA 3QPXL 2W60A 3QIWB 3RWFA 2FEDD 2X89A 1OSZB 3CCHA 5HI4D 5D7SH 2R1XA 5EOTB 3IB4A 4LEXL 5EU4A 1KEGL 3EHBD 2JCCF 4HWBL 3QNZA 5CGMA 4WDIA 4NNXB 1VFBB 1UB5A 1VERA 3CJJA 4JFYA 3MUGB 4S1DD 3H9YA 4OIAA 5DTFA 4I48A 1C08B 4FQQA 4HC1A 5I71B 2QSTA 4LNRB 3MRMA 5J4MA 4UUJB 3HZMA 2IAND 1H0DB 1CFSB 3PP3K 5D7JB 1NEZA 2QQNH 2GW5A 4L5FH 1OCWL 4MWFA 3FRPG 2Y7QA 4LLVA 3X3FH 2BSED 2ZOKB 1RJLA 5J9PB 1FORH 3GSNA 4M7LH 4J8RB 1S8DB 4OF3A 4P2OA 5EIQA 3I50L 1MIEL 1A6TB 1OAKL 4P23D 3KYMA 1QSEE 1HEZB 2DD8H 3O6ML 3MO1B 5D1XB 4O2CA 5C6TL 1BVLA 1WAAE 4LKXA 5AAMA 3VFWA 4XGZA 1A7QH 3KPRD 1AD9A 4JN2B 3T2NL 1HYRC 1KB5H 3D0VA 1A5FH 4JY4B 3QRGH 3LQAH 3R06B 3OJVC 4MA7H 2F53E 2VLLA 2NXYB 3HI5L 5E1AA 1I8IA 5E2VH 5JXEC 2HMID 3MOQA 1IGIL 5GS0D 2DQUL 5J3HC 2VUOA 1I3VA 3B9DA 2WWKT 4G8FB 5E70A 2DQCH 4FTVB 1V7ML 3HC4L 2VLRD 1TJGH 3MBXL 2EYRB 3ZE1F 4U1SB 1HHJB 5E4EC 5H2BA 3F7VA 1DANT 2EXWD 5AZEL 1RU9H 2CDEA 1NCDL 3DHJA 3K81A 3FQRB 2EZ0C 4Z77A 2G75B 5TQ0L 3KPNA 3O4LD 4KRNA 1QKZL 5HPMB 1CU4L 4YXHL 4TPRH 1H9VA 3QIWA 4XC1L 2RFXB 2VZ3A 1NANH 4PG9B 4G3YL 2AAVA 3LS4L 4ORGB 4AIXA 5EOTA 4O9HL 3PGFH 1HKLH 2HA1A 4FQIH 3SGJA 3WUWB 3DSFL 2R15A 3SKMB 1FE8L 5KSAD 4L8SA 2RJMA 2YUVA 5EN2A 5A2JH 3Q0HA 1WC7A 4NZUH 2CO6B 2DMBA 3BI9X 4DCQA 1NCWH 1G0XA 4FQLH 5DJCB 2ZCLL 3HHRB 4LNRA 1JRHI 2WK2A 1BZ7A 4PJ7E 3QJHA 2AXHA 1WQVT 2HLFD 2PNDA 3MNZB 1H0DA 3KPOB 4MAYD 5C2BH 1CFSA 3LKPB 3RWDB 1A3RL 3HMXL 4Y4FC 2DWEB 3BN9C 5F89B 4M1DL 3MYZA 4GMTL 1CE1H 1KELL 5DR5H 3IRZA 1A6TA 1E4WH 4PJBF 4HLZG 4JRXB 2E6QA 4Z76A 4C56A 2AJYL 5J11C 3WFDH 3C87A 5IIEA 3RY6C 3Q48A 4NDMB 2EDOA 3STZB 1HH9B 4UV7L 4IS6A 4JN2A 4Q9RL 3UC0L 2NW2B 1QOKA 4J3UA 1EVUA 4I4WA 3A6OA 1UM4H 4K23L 5L0QC 4JY4A 3R06A 1AQDB 5HHPA 1ZWIA 5JHLL 5D1QD 3R1GL 4MS8D 5EA0L 4P9HH 1A9BB 4MD4B 4RIRB 2Z31D 3UAJC 1LE5B 5C0FB 1MLCB 2CKBH 4ODXB 5IVXF 4FTVA 4GXUM 2IFGA 1IM9B 2D7NA 2PTTB 1JHTB 3BEVA 4FRWA 1MELA 3MRQA 3C9NB 3FT2B 3BKCL 3TN0D 3P77B 1D6EB 1XR8B 1MRFL 4W4OC 2CRMA 1FJ1B 2HVKA 4O58L 5F6IC 4F15C 2NY5C 5FF6B 4X8JB 7FABH 5GGUB 3V6OE 5HPMA 1QSVA 3NAAH 2B1HL 3SDYH 3SQOH 2R0LH 3UO1H 5TDPB 2RFXA 2QHRH 1NGYB 1FCGA 4PG9A 2O61B 3EO9H 4JPKH 2FX9H 1L6ZA 3IKKA 4U3XA 3SKMA 5HDQL 2HFEB 1ZVSB 4MA1C 4F8TA 2LQRA 3KLHC 4Q6IA 2QQQA 4R7NB 1E4KC 4GJTB 1HHKB 4QRSB 5EC1B 4YHZL 1KLUB 4DVRL 3BIKA 4N0FA 3HG1B 2ZWLT 4U7SA 5E4EB 4RGOH 3KPOA 1B0RB 3LKPA 3O3DB 1CDIA 3PV7A 5T3XL 3ZKNC 3ARSA 2DWEA 4H8WH 2BHZA 1MCLA 4U6VL 1RHHB 3GRWH 2WAHA 4OLWH 3RVXD 4M48L 1WF5A 1LVEA 3EOBA 3RX8A 1II4E 2CRZA 3OR6A 4XWOD 4JRXA 1W8NA 1GGYA 4KC3B 2P5EA 5DFWH 2K3TA 4JFFE 3SDXE 4NDMA 1HH9A 1YEHL 4NYLB 3G5YB 1XR9B 4D8PB 1H3WM 2DRUA 3DX7B 5DHVA 3W0WD 3PWVB 4NC1E 2YKLH 1AQDA 3ULSB 3RTQD 1E27A 1GOGA 5HGAB 2ADFL 2QSQA 3LKQB 4PGBB 1ETZB 2MCPH 3WNKA 3WL9A 4ODXA 2V5RA 2X1OA 4HX1A 1IM9A 3T65B 3IFPA 5IQ7H 5FXCH 4Y4FB 3OQ3B 4PJIA 1XEDA 2UYLA 2BK8A 3ZKMD 3C08H 1QO3A 4TNWK 4OV5A 1ADQA 3GSQA 3WFBL 3C9NA 3PUCA 4K9EC 4YHNB 5C0IB 1D6EA 1PKOA 2WQRA 4LCWB 3RKPA 1DTUA 3LEXB 5GGUA 5J11B 5A3ID 4G7VL 3VGDA 4ODHL 3MV9E 1NGYA 2O61A 5DEGB 1A1NB 2NTSP 5HYFA 3TPKA 5HHQB 4K3JL 2YWYA 4MQ7B 4PUBH 1CXHA 3BJ91 2V2XA 3P9WB 4PRHB 4UT7H 5L0QB 2HFEA 3CZFA 3E0GA 1RMFH 4POUB 2OTWB 1GL4B 3U0PB 3ULVC 5B3NA 4Y8DC 3HNTL 3G6JF 4TRPH 1S3KH 4HQQL 1HHKA 4XB8A 1Z0NA 3FONA 3UJIH 5DMJB 4GBXD 4HH9A 1CR9H 3HUJE 4MD5B 1NDGB 5T3ZD 4S10A 3HG1A 3C8KB 4NZTL 5K9QG 4XVJH 2MKLC 4E0RA 1HK6A 1JWMB 1B0RA 3O3DA 2DQGH 4I3SH 4WI7A 2MFNA 1RUML 1MAML 1GAFH 4QRRE 1J86A 3TVMD 1RHHA 2WBJD 5F6IB 4G6KH 1O7VA 2FO1A 2DM4A 5IMMA 4JRYA 4L3ED 4ZAKB 1U41A 5ETUA 4L8DB 4P99A 2AKRB 2QEJA 4X6FB 5FO8B 2UWEE 2WP3T 1HCFX 2ESVB 2MQ0A 2OP4L 4M8QB 4NM4L 3QDJA 4MA1B 3DX7A 5J6HB 2IGFL 1EEYB 2DJSA 4XHJD 1T7XA 3LEYL 5FCUH 3ARFD 5GGRB 2E3VA 4L8BB 1FGVL 2BVYA 3LKQA 1LEGB 1A9EB 4RQQB 4G7YL 4NM8H 4G9FD 2KPNA 5T1LD 1T0MA 4JEGB 3ZYJA 3T65A 1P69B 3U9PL 4YHOH 2I07B 3ZT7A 5BJTB 4O4YH 2P8MB 4JKMA 1MCKA 4KPHL 3LPGA 4YHNA 3WN5C 5CJXA 3WXWH 4RGMC 4KGJA 4LCWA 3LEXA 1OP3K 3IKCB 1JNJA 3MQIA 4BKLB 2VLMD 5TE6L 1CXFA 2EDFA 3WLWD 25C8H 3KYKL 1I8LC 1OHQA 3HZVA 4M7JL 5EBLA 3T0EC 2HT3C 3K46A 5JOPE 5EPMA 5DJ0B 4WW2C 1CFVH 1XAUA 1MFEH 5GS3A 1WBXB 4JFEE 2WIMA 4APQC 3SE8L 2OTWA 4YIQA 3U0PA 3I9GL 2IMMA 4JDZA 3V4VL 2FDBP 3VDAA 3ARBB 4MD5A 4K7FB 1NDGA 1MAJA 3C8KA 3MLPA 3CH1B 5F7NC 4JR9L 4WHCA 1CBVL 4R4ND 4M93C 2UZXB 1AO7A 2VLJD 3MRKB 1F6AB 3P2TA 4I77H 1NL0L 1W0WA 1ONQB 1RHFA 5EUOB 1G9NC 4ZAKA 4L8DA 3BKJH 1NUNB 3NIGE 4HJJL 2VB5A 3RY4A 2AKRA 5KN5B 5FO8A 3MZTA 5L2JB 5DK3A 5TJWK 5LBSH 1DVFC 5FGBC 1CXIA 3SE4C 4P2CG 4UILL 3BP7B 5J6HA 1IARB 3O2VH 4OFDA 1NGQL 2XPGA 2VAJA 4JKWA 5I74C 5E8PB 4E42B 5GGRA 1TNNA 4Y16C 1IGFH 3TJEH 4Y19D 5C07E 2DM3A 3VRLF 3KJ4C 3EO1A 1OT1A 4JJ5B 1U8LB 3D1MC 3G04B 4QRUB 5I75B 2YUXA 3VXOA 1MCPL 5KZCB 4Z95H 2H3NB 4XAKE 4PJ8A 4PRNA 1LP9F 1QRKA 4PRPA 2P8MA 3QWRD 4M6OH 2EZ0D 2JB6B 2SEBA 4GSDL 5DJYB 1D5BB 4AL8L 4NO3A 1WJ3A 5JHDD 4U6YA 3F6LA 2PO6B 3IKCA 3QEQA 3QPXH 4UOW1 4BKLA 1A3LL 4XI5C 4HKBB 4HHAB 5IV2B 4PY7B 4C4KT 4TUJA 3QWQB 2Q7NA 4RISL 3HE6C 4FQXD 3BDBA 1LO2L 1VFMA 1JHKH 1BGXL 4ZOEA 1E28A 1Y18B 1U3HC 5ESVB 5DJ0A 3OXRB 3MRJA 4LEXH 1KEGH 5DC9B 2CUHA 4HWBH 3RWGB 4K94L 1WBXA 5HVWA 1S9VA 3ZE0E 4RX4A 2D0FA 5D2NC 2ICES 4RAVA 3WNNA 4JVUA 2AK1L 2BJML 4X4ME 2VDOL 5C0JB 1E0OB 1F11A 3ARBA 2GI7A 3H9HB 4K7FA 1QSEA 3D9AL 3DTXA 3WD5L 2H32H 1KTLB 4U1GC 1F4YL 4U1LA 5D7IF 2P48B 3MRKA 1OCWH 4DGVL 3BN9D 5GJSL 2IADB 2QTEA 3E3QC 4IRJD 3WN5B 5HHMB 1SEQL 2AJXL 4RGMB 5C1MB 1Y6NR 3KYOA 3CMGA 3FQUB 5EUOA 3I50H 1MIEH 2F54B 4PREA 3RZCD 3Q5TA 3OJ2C 5CIPB 4M4PA 5KN5A 4LLUB 3T0EB 5HYIA 4R0LA 3O6MH 3T1FB 3MACL 3VXUB 1J11A 1MFCH 4ONHA 5JZ7D 5C6TH 1G84A 2DIJA 2AW2A 2E9IA 2JCCE 1K3ZA 3L3OB 4PLNC 1WZ1L 3BP7A 3T2NH 4APQB 1R3HB 4Y4HD 5E8PA 5IVNA 3Q5OA 3TT3L 5TE4L 3HI5H 1IGIH 3BW9B 4PTTA 3VG9C 2XY2A 2DQUH 4KRMB 5KS9F 1IT9L 4UTBL 3G04A 1T7ZA 3NTCL 1V7MH 3HC4H 4PJFF 2H3NA 3MBXH 5AZEH 4RBPH 3PL6D 1NCDH 1AY1L 4PRDA 5TQ0H 3S5LB 3RKDC 2JB6A 5AAWA 4N0UE 5E8NB 4HIHB 1D5BA 2JJSC 5ICYA 5IW6B 4JFOB 4JHWL 1XGTB 2PO6A 4LCUB 1P9MC 1CU4H 4PY7A 1WTGT 5GSVB 5TDOA 1OGAD 4XC1H 1ITCA 1G6RA 1YPZA 4P5TB 1RK0A 3JV6B 5SWSD 2L0DA 3V0AC 4G3YH 5HGDB 1FL6B 3LS4H 5IBLC 5ESVA 4RAUB 2DN7A 1QEWB 4JFPB 4TSAL 3L6FA 4QYOB 2MCG1 4O9HH 1BFTA 1MF2H 3DSFH 3S3PA 2EYSB 2CLRB 1FE8H 1A1MB 1DBML 2AQ1A 4Y16B 4F7CA 3EYFA 3KJ4B 2PYFA 4CUCA 4BQ6A 5GS1C 1JNNL 1R3JB 1XGQB 2ZCLH 3H9HA 3F7QA 3V8CA 4NNYB 5JOEA 3ZE1E 1ORQA 4RMUA 4HWNA 4P2QB 3RGVB 4Y5XB 1Z5LB 1XGUB 3QDHA 4DKFL 4P4RA 1A3RH 3QRFM 1CDBA 3EW3B 4YGAB 2NCMA 2NY5L 2IADA 4M1DH 2R39A 3G08B 4GMTH 3T3MF 1KELH 5GRJH 3FQUA 4ODTL 1CQKA 2YA0A 2E8ZA 2F54A 1W8OA 1UZ8B 2Z8SA 3HE6B 2ZUYA 3NCEB 2AJYH 3IDMB 4LLUA 2X4PB 3T1FA 3VXUA 2YXMA 4NJ9L 4NQEB 2DAVA 4YHIB 1GGBL 4UV7H 4HF5L 3HRPA 4F7PB 5JXAL 5K9OA 2DWDA 1INQB 3QO1A 4Q9RH 3R0MA 4XRCB 3UC0H 4N8VB 2DOCA 2VSDA 5D2NB 4L4VB 3RDTC 4K23H 4HUVB 3CVHA 3V9FA 3DV4B 5CHNA 3R1GH 4IM8A 5IVZA 5EA0H 2JELL 4M3JA 3RWJA 1NBZA 1U8KB 5DQDL 1NSNL 1CICD 3BESR 1TVHB 3MR9A 1NGWB 1MHCB 4TTDD 3HE7B 3X13A 1RZ7L 3QIUC 1QFWM 1BQUA 5HI3D 2AJZB 1TVDA 3BKCH 3S5LA 2W9EL 2FECL 3UTTD 5IW6A 4HIHA 1MRFH 5B8CB 3FTGA 4O58H 3KHOA 1XGTA 4G8EB 5BZWA 3L3GA 4KK8D 2B1HH 2VL4A 4AJ0A 2N1KA 3ARDA 3CK0L 2WWMD 1J1XH 5GGVL 4J3TA 3MLSL 4HIEB 4P5TA 1QEWA 2CQVA 2YK1L 1N5YL 5IJVA 1IAKB 5CP7A 2EYSA 3ETBF 5HDQH 4POYA 5ABDE 4XZUB 5EIVA 2DLFH 3U1SL 4AIOA 5IB5B 1EFQA 2IAMC 5HGBA 4LU5L 1JWSB 3BD5A 4Y1AA 5IMLB 3AREA 5KVFL 1XGQA 4YHZH 2VDKL 4DVRH 1MCRA 3EDJA 4M5YH 3FB5A 4NNYA 5DMKA 4FNLL 5AZ2L 4P2QA 3RGVA 4Y5XA 2XZZA 4KHXL 5BS0E 4TSBL 2PYEE 1XGUA 1EGJA 4JZJA 1N2RB 2COQA 5IEHA 4U6VH 4M48H 2LV4A 1AP2A 2ZCHL 1A7OH 1CLOL 4OF8A 1H15A 4OLZL 4CVZA 5EZIL 1DQTA 1SMOA 4XBGA 1UZ8A 5ESQA 1CWVA 4XH2B 3WE6B 4CNIB 5EBWA 1FYTD 2X4PA 1I1RA 3D39E 4PD4J 4H0GA 4YHIA 4PGEA 3EYUL 3FZUD 4F7PA 5ITFA 1YEHH 1YDPB 2BVQB 2XN9B 4NQSB 1INQA 3DURB 4XRCA 4P48A 4TYUA 4U3HA 4L4VA 3RPIB 4KUCD 4KU1A 3VXMA 4GG6B 1U8JB 5DQ9B 4AG4L 5C08A 2ADFH 4LGSB 4JVWA 3BZ4B 4PJEF 4WGVB 4YXLH 2GJJA 2NLJA 1JI1A 4KKCD 2IFFL 4JM2D 1TVHA 1NGWA 1MHCA 2NY0D 4MXQC 1HWHB 2FJGA 3HE7A 4K71C 3UEZA 3W2DL 4JJHA 5GPRA 1C16B 1J0ZA 5DUPL 1HHHA 4WEMB 3WFBH 4C58B 1X5FA 3QG6B 3BQUC 3DBXB 1MQKL 5B8CA 4QEGA 3L3HB 1CGWA 4G8EA 2WANA 1Z0MA 2GAZB 4G7VH 3L95A 3TIDA 1KLFA 2PR4H 2FCBA 4HIEA 2BY0A 1T21B 4JCLA 4U7KA 4K3JH 1JTTA 4C57C 1GIGL 2KDGA 1SYSA 4WFHD 1EMTL 1S78D 5DURD 8FABA 3VFVA 5K33A 3HNTH 3GJEB 4R6UA 4HQQH 4L4TE 2YBRB 4H26A 1RUKL 1JNHB 4OFYA 2L4OA 1V8HA 1LO4L 2D4DA 3V6FB 4EDXB 2K9UA 3L3JA 3P9LB 4ZO8A 5TFSL 4MMXC 4NZTH 4M7ZC 5MENB 5H35A 1VCAA 1RUMH 1MAMH 4F9PC 3ARPA 3NA4A 1N2RA 4WI6A 4H5SB 2C3VB 4F9LC 5CLTA 5L7XL 3SGEI 1ZT1B 5I1JL 2JJTA 3VWKD 1IC5L 3LIZL 3ARGC 2XTJE 1FVDB 1NMBL 4HG4K 1H3PL 3DO7B 3WE6A 2PN5A 1FFOB 2X4QA 1MJ8L 1GOHA 4Y2DC 4NKMB 2OP4H 4X5LA 4NM4H 1YDPA 2BVQA 3BZDA 4LSRL 4NQSA 2DQFA 3DURA 2IGFH 1JN6A 2IAMB 2C1OA 3G6JE 3LEYH 3BFOA 1ZVHA 1G7PA 4GG6A 3UYRL 2ICCA 5JIIA 3VFSA 1U8JA 1FGVH 2XWTA 3O8XD 5CEYB 2G2RB 3P73B 4NFCA 5EUKB 3MOBL 4OCYL 4PLJC 4MNQD 1H8SA 1DE4B 3WS3B 5I8EB 2BNQD 4B7LA 4Q9BA 4JHAL 2GITB 3BPOC 1T5WB 3U9PH 4HS8L 1IBGL 2D3VA 2YPKB 2FX8L 2D4FA 4M5ZL 1TVBB 4P2RB 1V3MA 4NSKB 1G9NL 4KPHH 3ZYZA 2GJ6D 1T6VN 4HBQA 4GAYA 3MRPA 3L3HA 4XCCL 1FFNB 1IGYB 3DYOA 5HJ3A 5TE6H 2GAZA 3PQYB 1S7XB 4J23A 2A6KB 4M7JH 2IANE 3WJLA 5FECA 4FFZL 4JZNA 4ZUWB 2XNAA 4CMMA 5GGSB 1U3HD 3T08A 4B50A 1DQLL 2C9AA 1D3CA 4UMGA 3SJVD 4HFWA 3I9GH 4IEFB 4FP8L 3KLDA 4X4YB 1LQSR 5I1AB 3SKOA 2YEZA 3HNVL 5DQJA 1JNHA 3FN0L 3HZYA 4MCYB 5CGTA 4K71B 4EDXA 3KPRE 4KJWC 1P7QB 1MVUB 3RIAK 1IAIL 3I3BA 3PWPD 1MI5A 4JR9H 4TTGA 1AGFB 2EIEA 3ROOA 3MV8B 1CBVH 3CVIL 4H5SA 4NHCL 1FNSL 2C3VA 4PFEA 5SX5K 2RBLA 3FFCE 1YMHA 3B9VA 3OR7B 2QV2A 5IJKC 5DEFA 1T1ZA 1FVDA 5C07A 1HQ4B 4HJJH 3DO7A 3QUKA 4PTUB 4UIMB 4X99A 43CAB 5I73B 2FECI 1FFOA 4HEME 3AS2A 4Y8AA 4HKJA 4BH8B 4UILH 1IEBB 1XIWA 3VXRA 2GFBA 2BZDA 1YQ2A 3P11L 3O4LE 1JK8A 3PP3H 4YZFE 2F5AL 1LD9A