2ZJSL

Crystal structure of secye translocon from thermus thermophilus with a fab fragment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transition of Sec machinery inferred from bacterial SecYE structures
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Protein transport/immune system
molecule keywords Preprotein translocase SecY subunit
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2008-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsL01
3O3BA 4PRHA 2R4RH 4L3ED 1IAMA 3MXWL 5SX4I 1CDCA 3ZKND 1T0PB 1NBVH 1Y6MR 4D3CL 3C08L 4P2OC 4S1SL 1PDKA 4XNUL 3N1MC 5D2LE 2YPKA 4GRLA 1ZLSL 1UADC 2VZ3A 1LE9A 1Z9OA 1NJ9A 4WGWB 4U1HA 2J8OA 3S34H 5JZ7C 5E2VH 3UTPD 1FJ1B 5GS2H 3SGJC 2WWMC 2VLLB 3DJ9A 4ZPTA 3VJ6B 4R97C 4GAGH 1QLFB 1X5GA 4K07A 2W38A 3HE7C 1BQLH 5GGRY 3U46B 1MCLA 5D72L 2F58L 5CWSA 5C71A 3A6CH 3DX8B 4TVPH 3HB3D 1W72H 3IXAA 4ONGL 4RFNC 5DD5L 4G7VL 5J4MA 4MJIE 3EHBD 4Y16C 3GHBL 4AM0B 4QY8A 4WI8A 3QEUB 1T89A 4JKLA 5MERB 3LMJL 1JNNL 3U82B 1EERB 2NTFB 4ZFZB 2UZXB 3CXHJ 3B2VH 5DLML 1P4LB 3MRHA 1DBAL 3RX8A 4GRLC 2V6HA 2XN9B 3A67L 4WEBL 3L3IA 3QDJA 4O58H 5AYUL 2YA1A 3WDIA 4BQ8A 2W92A 3V7MA 2P49B 4GW4B 5CKAA 4XPHL 4GXVH 2PO6D 4H25B 3GIZH 3PDDA 4PP1C 3N1GC 2HJLA 1A1OB 5ID0B 1MH5B 1A3QA 1YEDB 4K8RL 4X5XB 1LE9B 4ZXBC 3EO0B 5DURD 2B1AH 4H8WH 3OXSA 4FABL 4OAWB 4OIBA 3UTTD 1W8NA 3MA7B 2BSTB 3JTSB 1R3IH 1RSFA 1VEPA 4GXUM 4P4RA 5HY9B 1OAUL 3D25A 2AJ3B 4LHUB 1FNFA 4KXZH 3JWOL 3GUTA 5F9WB 4KJWC 5C09D 5FF6A 1M71B 3IKKA 3W0WB 1CFTA 5EU4B 2AEQL 1CLZL 4UAOB 4HMCA 4BH8A 2X7LB 3FHAA 1UWGL 4QTIH 3HNSH 4DGVH 1UCBL 1LD9B 4Y5YC 1P7KB 5IVXB 2G5RA 1B4JH 2DTML 1OT2A 3WS6C 1YEIH 3OR7A 1IEAB 3NCCB 2WP3T 5DTFB 4L3EE 4PGDB 1JGEA 3SDCD 4JGJA 2W0FA 2MQ0A 3FJTA 3QQ3A 1A6VL 3V6ZB 3IDXH 2R0WH 2A0LD 3HPJA 3S5LA 2PO6B 1VACA 1F6LL 2BHYA 1A3RH 2NCMA 3MRRB 4O02H 4YC2C 3GO1L 3DETD 3TN0A 4KK6C 3CLFH 1F45A 5DJCA 3PHQB 2DL2A 4YHIA 4TPRL 5JA9A 4IHOB 5I19H 5JXED 1UB6A 3CIQA 1KYOJ 1WZMA 3MV8D 2OBGA 1Q9OA 3H9HB 1CFSB 1NFDF 1GGYA 3KPOB 5EOCH 2AKRA 3A6OA 4LEXL 5A43C 3UTSE 1HHKB 5FUOL 4LHUA 2LAAA 1OSZA 3Q2CA 4J4PD 4OB5L 1WWWX 3C8KA 3HR6A 5C7XH 2H45A 1V7NH 4NIKB 3HS0B 1N5AB 4K8RH 1HH6B 4R26L 3LS5L 4PBXA 2NY6C 5JA8B 1DUZA 3L95A 5IQ7H 2EDHA 1XR8B 1H3WM 3HS0A 1Z3GL 3OX8A 1HHJB 4P5TA 3DSFH 1AQKL 5BW7A 5D7LB 2IMNA 2OR8A 2H3NB 3AY4A 2DB8A 4UDUA 3GSNB 4PG2C 1J0KA 3SKJL 5C9KA 1FGNH 1CVSC 3QCUH 2V5SA 2FIKB 3ZKMC 2YWYA 4LP4A 3UC0L 4GAJL 3L5WA 1FIGH 4WV1A 4NUGH 2VN4A 3FZUC 4YXLH 4AMKL 3HPLB 4HH9B 4PYGA 3F58H 4H0GA 1CG9B 5FDYA 5E6ZA 2V5YA 3L5XL 4P2RA 1XF5B 3QUYB 1UM6L 3ARBD 4KJYA 4Z0BL 2C4FT 1S9VB 3JV6B 3NFSH 3O2WH 3MRNA 1OARH 1T03H 4R4NC 3DO7A 5JORA 3GMOA 1J1PL 2HG5B 2FO4B 3LIZH 3MNZA 3GB7B 1JHKL 5LG1A 3MUZ1 4YUEH 4DVRL 2Q86A 3IDIB 3BN3B 5FGSA 2UY6A 3MFFA 4L4TB 1OT1A 1UWXH 3EZ8A 4QYOA 4U49A 3CC5B 2X7LA 3WLBB 1JPFB 1I1AB 4IRJD 1KN4H 1DCLA 2PTVA 1IARB 2RR3A 4PJDA 2XZCH 3ZYJA 3VD4A 1I9EA 1BLNB 2NY0B 4IIQC 4BFGA 2Q86B 1HHHA 2R1XA 3B3IB 1CT8B 1M1SA 2KUTA 2UV3A 2Q8AH 1ZANL 1S7VB 5HGAA 3RZCD 3FO9B 4FXLA 2BP3A 5I2IA 1S8DB 1UACH 5TDOA 3WNLA 5IW1A 1KPRB 3ARDA 4DN4L 3FB6B 3T0BA 7CGTA 3K2UH 1LK3H 3TYGL 1G7MB 4Z7VE 5DD1H 3D0VB 5D72H 3OAUH 3QUZB 3C5ZB 4G5ZL 3RPIB 3G5VA 4RFEA 4D8PB 4U1IB 3BP7B 5E9DA 3MJ9H 4LCUB 2L7JA 1CTNA 1RZ7H 1OW0A 4D9RD 4X80L 4JPWL 1KYOK 4GUPB 4WY7L 1MCOL 4EN3C 3U6RB 1BBDL 1QRNA 3G5VB 4RFEB 4D8PA 2UWEF 5T5NF 1U8MA 3WSQL 1X5HA 5GSRB 1AH1A 2O93L 3EYVA 5CWSB 3KYMB 1S8DA 1YEHH 1WFNA 4JHAH 5FM4A 4GG8B 2LU7A 1W0WA 2VQ1A 1RURL 3B5GA 3FHQA 4NJAL 4NO2B 1MRFL 2DD8L 3BKCH 1KB5L 4KDTA 3S88L 5EBWA 1A7NL 4QRSA 3RZCC 2R4SH 3BP6B 3SJVE 5I1LA 3NZ8A 3ROLA 1V3LA 4LPVA 1OSZB 3PABA 3UTOA 2J4WL 3FRUA 5JHLL 2R23A 2X4QB 4ZO9A 1W72B 2BJMH 2YD4A 5CJBA 4XWOD 4I9WD 3V4UL 4HG4K 1KJVB 2ICWB 4JFZL 2ORBL 2M8XA 4QRSB 1MIEH 5DJXB 3ZYZA 2FX9H 3HZMB 2GTWB 1MCPL 1Z5LB 4AIZB 3WIHH 4APQA 2DRUA 4MJ2A 3B8YA 3TN0B 3R8QA 1BD2D 1FLRL 4HUUB 4Z77A 4WENB 3SJVA 4QRPB 2B0SH 5HHOD 4I0KA 3VXPB 4PJEB 2E8ZA 3MPCA 4OLWH 2HFEA 1B9ZA 2ZKHH 5DTFA 4FN0A 4N8PA 3O3EA 5E8NA 4F7CA 4AIXA 5DO2C 2VB5A 4HUNB 3DUUB 4PJFF 2PR4L 1QZ1A 1BQSA 2GJ6A 3I6KB 4S2SA 4NPYB 4NNXB 3D18B 5ICZA 5I73C 4H1LG 4TSBH 1KC5H 3GBLA 4UDTB 4K7FA 2BHZA 4CMHB 2WSKA 1OSPL 1J86A 1EVTC 3ZKMD 4OCYL 2ORBH 1L4IA 1NCNA 1Q9LB 4N68A 2PXYD 4NO0D 1JV5B 1UQSB 4Y1AB 5T33L 1SBSH 2VLJA 3RY6A 1MVUA 2VZUA 5HGAB 4O9HL 5JDSA 3SY0B 2O61A 1IM9A 2DQDL 3IXTB 2ICCA 4NRXB 1T66C 3CZFB 3CUPA 2W0PA 2Y23A 1PLGH 1A7NH 4G6ML 3QRGL 1F3JB 2GT9A 1GHFL 2D7QA 4PLKC 3TVMA 1KTRL 5ITFB 2VXTH 5KS9E 4X9BA 3TZVA 4Z7UA 1FP5A 3KPOA 2Z93B 4IOIA 4F58H 5DMGC 4OLWL 5EUOA 3MRQA 5CIPB 4PV8A 4QYOB 1PG7X 4J23A 3P0VH 1RD6A 2FZ3A 3JVGC 3QEQE 3T3MF 1RULL 3DPBA 3KVQA 4G7YL 2R2HA 4NKDB 1I7ZB 4ZD3H 4U6HB 5HJ3A 4I4WB 1A5FL 1CCZA 3NIDE 4NUGL 4AZ8A 3OJDA 4KI5F 2OYPA 3C5ZC 2FHBA 5EO0A 5FYKL 5F9OL 3GSOA 3RI5F 3KLAB 3TPUB 1TNMA 4Z7QE 1J8KA 2F9BT 4YFLF 1KB5B 4PD4K 3EUUA 4UOW0 4D2NA 3GMMA 3HC4L 1IGTA 5IHUH 3OHXA 3VFRB 2UWEE 1OD9A 1K5NA 1OAXH 1F4AA 2NZ9C 2Q76A 4F7TB 5DI8A 3WLWD 3ZHDA 1FL6B 1MJ8H 1TVDA 3Q5YA 1KTDA 4HLJA 3SHSA 1JZ3A 3GBML 2AXFA 2FECI 4PY7B 3HI6H 1UZ8B 4YIQB 2IG2H 1XCTB 3V6BR 5L2KA 3B9AA 1HXYA 3NTCH 3S35H 4TNVF 3KNBB 4G6JL 2CK0H 2VLRD 3RWGB 1QOKA 5IB1B 3GSNH 5CBEA 4PJIA 5FOBA 3GUTB 2Y36L 3MODH 3FOLB 3CVHH 4PRNA 4KJWD 1SJEA 4JDZA 2AXGA 4U6YB 3TBWB 4G9FA 5F7HA 1MFAL 4M1CD 1N2RB 1RIHL 2VERN 4N0RA 2QQNL 4P59H 4YHKH 1OW0C 4JHAL 4WUUB 4X5LA 2I24N 5T5FL 5LQBH 1G9NL 1BQHB 3RHWK 5MP6H 2DQGH 1H0DA 2IH3A 5I30L 5E6IA 3X14A 5GSVB 2VISA 1XT5A 3MJ8B 3H9SB 1NCBH 3ESVF 4XPTL 1KFAL 3CMOL 3H9YA 4LMQE 2HRPH 1B6UA 4X6DF 2MCG1 5JHDB 2N1KA 1D6VL 1KT2A 3MRRA 4WFFE 4JKMA 2EDXA 5L88L 4BELD 3CJJA 3DVNB 5CEZH 5IFHH 3CFCL 4P0DA 5D7LD 2VLKE 4LASL 3C5ZA 3K8LA 5JIIA 1XMWA 5TQ0L 1K4DA 4MJIA 3PWUB 1OHQA 4GRMB 1UYWH 5ANME 1CD9B 5HYQB 5F6HJ 3VXSD 1AY1H 5GS3A 1BQLL 2IJ0C 3HR5A 5D93B 2HT3D 2NY6D 5DJ6B 4F57L 3MV8A 3QDJE 3U2SA 4UNVA 1A6PA 2H2SC 4ZUTB 2ADIB 3AREA 2CUIA 3M8OL 1H15B 3S36L 5IGXL 43CAA 4WUKL 5JIKA 1T3FB 1OOAA 3H3PH 1OLZA 4LP5A 4POYA 3G9VA 1UXWA 5DMKB 1NAMB 3X12A 4JG0L 3ARYA 5IMKB 3DO3A 3GSNL 4RAVA 5I16B 3BW9A 1F42A 3VG9C 4JM4L 2C1OA 2AV7A 4AYFA 5JXEC 1BFTA 4LIQL 4LSTH 4WWKC 4RGNC 1RHFA 1IAIH 1JL8A 4K3DL 1ZANH 4HGMA 5DD5H 3QFJA 1ROWA 4N8VA 1U8LA 1NFDE 1XF5A 3L3JA 3SDCB 3MYZA 5ABDE 1RZ8A 1HIMH 5D7JC 4L29A 4XC3L 5GS1A 1GGIH 4IMKC 3TT3L 1DQTA 1S7UA 1U8NA 3I9GL 4KK9C 4M5YH 2X4NA 1ETZB 3RVXD 5F97E 1I7ZA 4XCFL 2ZCKH 1FNSL 2HT2D 3EDKA 4ODSL 3QUMA 3P30L 2DMKA 4OGZA 2GW5A 3O3DB 2NTSP 4BFBD 4TSBL 1IGJB 1SY6L 3DGCR 3GJEB 2PW2A 1QSEA 3H7BA 1PKQB 1FH5L 4WDIA 5A2JH 4FQIH 2BVUA 1DLHB 4EUPG 5F96H 3PJSA 1FO0L 1OARL 1BVLB 4TRPH 4UINL 5JW4Q 5HVHC 3WO3B 2IWGA 1T7VA 3ZDZE 3ARFD 3QEHB 5KSAA 2XWBA 3JVGA 4H8WL 4RAVB 3WFEL 2DQFB 3GK8H 3FO1B 5EO9A 2DLGA 2A74A 3S36X 4P2QE 4NQDB 5ACMA 1BX2A 1IZJA 1A14H 1PGRB 2Y1VA 2ADJA 4QLRA 1T7WA 4NBYB 3UXFA 2PTTB 3PGCB 4WI3A 1AXSA 4XRCA 5CGYC 4MD0B 3TJEH 1CD0A 2FWOA 1BFVH 3PV6B 4I3SL 1U0QA 2AABH 1AGFB 4L8DA 4NPYA 4OLUL 1T0MA 4OSUL 5JORB 5BXFA 3V7AG 4OUOA 2VNCA 3MRKB 4JZJC 1S7WB 4M48L 4M6NL 3LKNB 3TPUA 4Z5RB 1KN2L 2W59A 1L9MA 3D39A 2DKMA 3E2HB 4G7VH 3TN0D 4JO3L 5HGBB 3NIFF 4ODBD 3E1F1 3WS3A 5F88A 3MBEB 3HE7B 4JO2L 4IM8A 5T3ZH 2EIZA 1J11A 3QWOA 4MDJA 3RY5A 5I76B 5JPNB 4WFFD 5E0QA 5DF0A 5FKAB 5C0CB 2G9HB 4LCWE 5BVPL 4JRXD 4R90L 4KH2A 5ICYA 4N9GA 3FB7A 3VGGA 3IAQA 4PTTA 2NNAB 2CMRH 4PJHE 3DV4B 3W0WA 2BVOB 4IRZL 4LLDA 2IH3B 5AYUH 3NABL 2AJ3A 3SKMA 3MV01 4I3SH 3Q1SL 3QHTC 3T4AA 4U6TA 2RGSA 2IC2A 1XF3A 4YHNB 4NP4H 2XZAL 5D8JL 3X13A 1N2RA 4MCZB 3MLRH 1LO3L 4LSSH 5EOCJ 3WHXB 3X3FH 5BS0B 4KKBC 4NO2A 2ARWA 2AXGB 3U4EA 1YN7B 4NWTL 1I7TA 1KNOA 3REWB 4GS7C 4JRWA 5E99H 5AZ2H 4F8TA 3BE1L 1ZGLP 4L5FL 4TUJB 2F53D 5DEGA 5EPMA 1U8JB 3VXOB 4FG6C 2MKLC 1FIGL 4ZOAA 5INCA 1A6UH 3B6SB 5KOVC 3SDXF 1Z6JT 1H8OA 1NGYB 4OUUA 2HFEB 4JRXB 4K55A 4CRPA 5C0FB 4LVHC 4HH8A 4Z95H 1RJCA 3BHBB 5TGBA 3T08A 3UJIL 1YEFL 5EU6E 4RAUB 4F7PB 4M7LL 1QSED 1SBBA 2DM4A 3CVHB 1YEIL 4PJCF 4XHJD 3WKNA 1T6WA 3CLEL 1OM3H 1P7KA 2UYLA 3VRJA 5L7XH 1EEZB 3EFDH 4L3CB 2FH6A 2CR3A 5HHPA 1H5BB 2AJUH 3TNMB 4HKJA 4D0BB 3DMMD 2QKIA 4KU1A 1HDMB 4FQQA 2F74B 2AEIT 5DJZB 5SX5H 3UCRA 2QBWA 2DQJH 1NGPL 4PJFA 2E27L 3C5SB 2VDKL 35C8L 4LPCA 5IMKA 2R23B 3KJ4C 3PWPB 1T2XA 2HVKB 1MCEA 2MWCA 3MLSH 4U1LB 3U79A 1QA9B 1SJHB 3ZE1F 4O2EA 4JFDB 2UWEA 4ONHB 4IS6A 1MI5E 1FZJA 3LKQB 3OJVC 3IDUA 3P73A 4UTAL 1UWEH 1YMMA 2P5EB 4ZUWA 3HC3H 4OGYL 1ZWIA 1CXEA 3QDGD 4PRPE 1A64A 2VZSA 1QLEL 1CXFA 3M17A 1KLFA 5KS9F 1QR1A 3MNVA 3PXJA 4TOYH 1YPZF 4PJ8D 3EW3B 2VDQH 3BYTA 1HYSC 1KUMA 2OQJB 2OR7A 1F11A 2V7HB 1OB1A 4KKLD 1MFBL 2C3XA 1DVFC 1S5IL 3IDJB 1DBBL 4QHNB 1JRHL 4UBDC 1KJ2L 5F1IB 1BJMA 4K3JL 1IE5A 4HS6B 3O6KL 5GS1B 2ATKA 4D0CB 3F58L 4PRPB 1FAIH 3IXAB 3WL9A 2R69L 1R5VA 3PWJA 4EDWL 3Q0HA 3BXNA 2C26A 2OMBA 2VDLL 5FGCB 4KMQA 5T3XH 5CKGA 3HMWL 4YFDB 1UFUA 3CXDH 3E3QC 5GIRB 1B0RA 3BW9B 5C0GB 4TQEH 1T04A 5GGQH 5CJ5A 4NSKB 4YNYB 4JGMA 3RL1A 4YUEL 1FL3A 4DVRH 1C5DB 4KC3B 4G9FB 1MIML 1WAAE 4PJ5B 2Z31D 3BIBX 3I3DA 1TQCC 3U48A 4QHLB 2BSSA 5EU6D 5DEZA 1GL4B 5GHWL 3WUZA 3RDTA 3DVFA 3DX6B 4LPYA 1JPTH 1MFEL 4JPIA 5AYQA 4PTTB 5DDHA 3VH8G 1BF8A 4PJXF 4NGHH 2IAMA 4UUJA 4EOWH 2QSVA 3P4OB 5ITBH 4YHYC 1QLRA 2AVGA 3PP4H 4JY4B 4ETYA 3OMZA 2HJKB 1U8OA 4PRAB 5EU7C 2DI7A 2W65B 4HGWA 4NKMA 3ZTJG 5J3HD 4OM1L 3PWUA 4ODWB 5BJTA 5F1KC 3WNPA 5C0BA 1D6EA 1MHHB 2YPLE 3OHXB 4J2XA 4YHML 3EFFB 3BPCA 3OKDA 1U3JA 4JFQA 3FB8A 1LK2B 4FFVC 4TOYL 3RPKA 1ACYH 4QRRB 3I75B 1SMAA 5IGXH 4XVJL 3O2DA 2UUDH 3HMXL 1D9KC 2EDJA 2WUBH 4S1QL 2P8PB 3D0LB 5I17A 4EN3A 2RCSL 1AJ7H 3RVTD 1K85A 1U8JA 2DICA 4HJJL 1OSPH 4C56E 3OKNB 4RMRA 2XN9E 1WAAA 3OJMB 1NFDA 5IB2B 2FBJH 1UJ3B 4NQVA 2A83B 4PGJA 1A5FH 5E4IA 4UI2A 3FQTA 3EYUL 4MB5A 1U3YA 3QXAA 4RMVA 3O6FC 1I7TB 2JELL 1JYVA 5FYJD 5JPMB 1NBYA 12E8L 4XMPH 5IBLC 2NPLX 2DBLL 4PPTA 2YEZB 1RURH 3CDCA 1HH6A 5FA4B 4UV4L 1PX3A 2GJJA 2BVEA 4KV5E 3TBYB 3O45B 5CBEB 1IT9L 2QQQA 2AJZA 3LKOA 4LRIC 4O02L 3MV7B 2AQ2A 4JFDD 5BOPA 2JK5B 2V2WB 5D1QB 3RVUC 4BKLB 3QXDB 2VAAA 5E24E 2AJSH 1GYAA 3HA0A 2HWZH 1A1NB 4XP5L 3RWDA 4ODTL 4DAGL 1R6VA 3QWQB 1WBYB 2BRRH 5EC2A 1HSBB 2XZQH 2XG5A 3S5LB 4Y4KC 5E8DH 1NMCC 4CVXB 4UTAH 4D9RE 4WGVB 1FDLH 3GI9H 3FAWA 3O6ML 2BNUA 2C1PA 4B50A 4PR5B 1Y0LB 3VWJC 2OTUA 4L3AA 2LTQC 3QFDA 6FABL 5IESH 1L0YA 3FMGL 3FFCD 1U3HD 1LNUA 4PJIF 3P11L 5GRJH 3O2VH 1DQJB 2BCKB 4DOHB 3CVIL 1HSBA 4O2CA 3RU8H 4A6YA 3V6OE 5IV2A 1JGEB 4ZOEA 5F89B 1ORQA 1XR9A 1NBQA 3INUH 3O81A 3CMOH 1SYSA 4MNHB 2YOCA 4APQB 2D31B 3RJQB 4BA8A 5I8CA 4HUXA 3ZO0A 3RZWA 1J87A 3QXTA 3O6FD 5AWNH 3GMRA 1J1XH 5A3IC 2VO5A 3PV6A 3QHZH 1RUQL 2ICWA 1ORSA 5CP3H 4LSRL 3ZKQD 1P84J 1T7ZA 2ATPA 5EU5B 3NCFB 4Z7UB 5T1DL 1IGMH 3LQAH 4OLXL 1FL5A 2ZSWB 5DVKA 1RHHA 5BQ7B 1KCRL 25C8H 2AXHA 1FVDB 3ULVH 3ZDXF 3MGOA 3CUPB 1F4XL 1T21B 3DETC 4DGIL 5FO8B 4ODHH 3OF6A 4WFEE 3IFPA 3UTSB 1I7UB 3GKWH 4P4KC 1MFDL 4RGOL 1AY1L 1JIBA 1T04B 2A77H 4M61A 1G7PB 4LF3B 3MLVH 1N5YL 1GPOL 4IRSA 3QZWB 2NYYD 4M8QA 2YWZA 3NGBC 3O3DA 3VGAC 3SBWA 4OI7A 3CX5K 5D7IB 3TLRA 4TUKH 2J6EH 2P43B 1KPVA 3V6FB 1I9JL 5ACZB 3HFML 1MLCA 3QUMH 4HJ0D 5HPOA 3OB8A 1E6OL 1XCQB 2EDOA 5KVFH 2OJZL 3OAYH 4S11A 2DMBA 2ZG3A 2J12B 2FEEI 4XXDB 2FJFA 2Y5TA 5E5MB 1P69B 4UILH 2GKIA 3SDDA 4J3OC 3QG7L 3EKCA 5A2FA 3MOBL 4EI5B 1INQA 4L29B 3C5JB 2G75B 1OB1B 3QUZA 1PY4A 3OGOE 3QNYB 2X4UA 4I13B 3P9MA 4PJGB 5E8EA 1EPFA 3OZ9H 1MHPH 3IKCB 4WFGD 4RGMC 1R3HA 1UJ3C 1G6RA 5DD1L 2ERJB 1ZGLA 4XNXL 3U7YL 4Y4FB 4E42B 5K9KB 5CP7A 2NY3D 5C07D 4KK6D 3TBTB 3TIDA 2ENYA 2MPAH 4J3VA 1TTFA 5K9OB 1QSEE 4PBWD 2BSSB 2CK0L 4KZEL 4G9FD 3Q6FB 5IB3B 1HILB 3RGVC 1ULVA 3OXSB 3SGDH 2Z4QB 5HHXL 5EBWB 1U8PA 4YIQA 4Z78A 1S7TB 5L6YL 4NP4L 3EAKA 1N6QH 2CGRL 3UZEA 1E4XH 2D9QB 3VXRD 4BZYA 4MJ6B 5EBLB 9CGTA 1HQRB 1W0WB 2DAVA 4P57B 5FCUH 3VXSB 3WN5C 1JF6A 5BVJB 1UG9A 4XP1L 3QIUA 1NCCH 3VU2A 1H3UA 4ISVB 4D9LL 5HSFA 4MSWB 3IAPA 4NHCH 4U7SA 4PJIE 5E1HB 2Z8WC 4HFWB 3WFBL 3ZKXC 4NM8H 2X2YA 5GXBB 1CGYA 1EH9A 3HUJF 5HYSA 5I1HL 4OFVA 1JWUB 1OAQL 3P9WB 4NOFA 1S7QA 1J0IA 5J13C 3TYFB 1AIFB 1FG2A 4LCYA 2CQVA 1XF4A 2FR4A 3R06B 3DURB 5T3ZD 4V1DA 1H0DB 1YN7A 2Q3ZA 5IBTL 5DEGB 3GSNA 5EPMB 4AMKH 2VDNL 1QO3A 2H32B 3V5HA 1TDQA 4PUBH 5I2IB 4XH2B 5DJAA 2NW2B 1MCPH 4HAFA 1C1EL 5ALCL 2EE9A 2FX7L 1I8KA 3KXFA 3C9NA 2YA2A 5CGTA 2F19H 4LGRB 1QFOA 4NYLA 5GS0H 2PW1A 2P5EA 3P4NB 5DJ8A 2XN9D 4HS8H 4ZS7H 1WWBX 3GIZL 5J1SC 3FFCB 1D5MA 4WU7B 2VLJE 3ARSA 4PY8I 3ZHLA 4KRPC 3IDXL 2E7CA 2EYTB 2I9LB 4NJ9L 2H1PL 2NW2A 5ID1B 2DQTL 3SKOA 2Q7NA 4OLVL 2P7TA 4EDXA 1U8KB 4Y4KA 3LIZL 4KTEH 3GMRB 1UJ3A 1JZ5A 5JUEH 1QVOB 2I25N 3BH8B 4E41D 3DURA 1T0NB 1EVUA 4P5TD 4KKAC 4MXVE 1KLUA 3MMEA 3O4LA 2XTJC 4I8DA 1JCKA 2AK4A 1KEGH 1IVLA 5DD3H 1BMGA 1EIBA 1JNJA 2HVJB 3TO2A 3CDGA 4IOSD 5JW3L 3TNNA 5IESL 5F7KC 3F62A 5FM8A 3O9WC 2BY1A 3KLAA 3QAZB 32C2B 3RAJH 1S9KC 4CAGA 1A6TA 1UEYA 4BFIB 4KXZI 2AS5M 1DDHA 2VXTL 5I1GL 2MQCA 2XWTB 1UH4A 3OKOB 3LB6D 4YDJA 1FE8H 3NH7H 4I2XE 4OUUB 1J0ZA 3BQUA 4FXGA 2VR4A 4GRWE 4NKDA 5HDBE 3VCLB 5JLZA 4JFPA 3VFUA 4QNPE 5I1IL 1UM5L 5J6GA 1L7TL 1INDH 4XC3H 1BZ9B 4HXBL 2GSGA 4OKVB 2EDNA 2F53B 1LO2H 3P4OA 3B9KC 4OD2A 4OZIE 4HS3B 3TCLA 1YYLL 1TENA 5FDWA 4N0CC 4ZTPH 5A3ID 2WINB 3WXWH 5LBSH 3WFDH 4U05A 3OX8B 1EZVY 5FM5M 2ILLA 3NFPA 3PNWB 3QDMD 3G9AB 4ELMB 4TRPL 3CFDA 3FN9A 5BV7C 3D1MC 2JIXB 2YPVL 5D2NE 3EYFA 3S5LG 5CJ8A 5C08E 4WDIB 3STZB 3NZHL 1IM9B 1BHGA 4YEFA 1OTSC 4DN3H 5FCSH 4JKPL 5GHWH 4EBQH 4PGEB 1P53A 1BBJA 1IKNA 3ARGB 2ZNWA 3KPQA 4ZFZA 2OK0L 4HS6A 5F1OB 3BIKB 2KH2B 1RZIB 4GKZA 5F1SA 2OI9C 5F7DA 4WEBH 5ISZA 3MV9D 2I9TA 4XVUC 5DRXA 5EU6B 1KIPB 4RA3A 3WXVH 2Y36H 5F7LB 3IDJA 4IMLB 2UZIH 3LKNA 3QDGA 4XTRD 5ESAA 4GAFB 3TO4D 3BZEA 3KJ4B 4G6AD 4PJXA 1KPRA 3ARDB 4XVTH 1K2DB 1FZKA 1IQWH 2YD2A 3HZMA 4WW2A 4XVUD 2NX5D 1U8PB 3OB0K 4XCCL 3RRQA 3GMLB 1NGXB 2X9XA 5I1JH 3TPKA 1FNEA 4MVBD 4OIIH 5DT1L 3D69A 4JQXC 3DX9B 2PTTA 3PGCA 4N0UA 5ADPH 3TBTA 4GBXC 4LDEB 3JTSA 2BSTA 1RY7B 4RNRA 5I15L 5E03A 3RTQD 4DKEH 4F8QA 1MCOH 5C09B 3P9LA 3PE9A 4HK0A 1U91A 3TM6A 5HHXH 2AI0L 4DKFH 3MUJA 1UM6H 2GFBB 2R0KH 1P2CA 2J8UE 4NQUA 5DRZB 3QUKB 1Z2KA 3UMTA 3O2VL 1G7QB 4TVPD 1YMHB 1AHWA 4AG4L 3QHFH 2Q8AL 4AY0A 4OQ1A 1IL1B 3WLWC 1P7QD 4JN2A 1IBGL 4F58L 3R4DA 4CNIA 3FRPG 2WW8A 3KHOA 3QBTB 4G8EA 4OLYH 3QDME 3QUXD 3RVWD 4NM8L 3MGTA 2I07B 1KSRA 3VE0A 4O5LH 3JV0A 4NDMA 4XP5H 1KT2B 4KMTH 4Z8FL 1BBDH 1UZ6F 2Y07H 3LQAL 3VFMA 4MA1C 1QSFE 3KPSB 4LLWB 2GY7B 1IC5L 4FQ1H 1A47A 3O4OB 3PWPD 2X42A 3GI8H 1I1FB 4OQTH 4B53A 2JCCA 4XX1E 4OZFH 1NH6A 3ARDD 4QOKB 3RWIA 2FX7H 3C5ZD 2CIKA 5DJYB 5FYKH 4JVPA 3VDAA 3MOBH 5TPWH 4I1NB 4TQEL 3PDOB 3KPNB 1ZWIB 1MQ8A 3K2UL 5DGRA 5LGJB 1SEBB 1T21A 3UDWC 5I16A 1OPGH 1QKZH 1VFAA 4HK0B 2VZOA 2C3WA 4ODUB 1KB9J 5FK9B 4H0HB 1CTOA 1QD0A 4HV8B 5I1AA 1XGUB 2FEDD 2UWEB 3VDCA 4MA8L 3PNWA 8FABB 1T3FA 2OCFD 1JFQH 2FL5B 2FGWH 1U8IA 1IGIL 3SCMB 2UVFA 1NGPH 4NNPL 2COQA 4RDQF 3P4LA 1TZIA 2E9JA 2EH7H 1AJ7L 1CGSH 2DTSA 2M2DA 2AI0H 5IROA 4FRWA 3P77B 5DJCB 3RWHA 1WT5A 4HZLA 3HG1A 4JFPB 4OLUH 4OSUH 3BQUC 1A7OH 3CVHA 5EOTA 1RUPH 5FO7A 2A6IB 1AO7A 5L2JB 2D03H 4EI5A 3VFRA 5E6YA 4HEPG 4Z5RA 1CE1L 2K7QA 1AHWC 2BY0A 1WV7T 1TVBB 4ZYKB 4P23B 4QHUB 2QQLL 1I4FB 2X4PB 1IFHH 4UQ3A 5EC1B 5DYOB 1JYNA 5D1ZB 3ULSB 2BXYA 2EICA 5DSCA 5KSVB 3LKSA 2CLZA 1G0XA 4MWFA 2VH5H 4GXUN 4DGVL 3MRQB 3LV3B 4XAWL 3DRTB 4P2QB 3W9DA 2J1KA 5IWLA 1MCCA 3N85L 1ZHBA 2JB6B 5EA0H 2I26N 4K3JH 3SCMD 4OZFB 1UZ6E 1I3GL 5GRYA 4HKXB 1MCNA 1WZ1H 2IPTL 4UDUB 4M48H 3GRWL 4NC1E 5LVEA 2Z93A 4K8RD 3MLZL 3VWJD 4GW1A 2F5AH 3QXVA 4XMLL 3DVIA 1FZMA 4RSVA 1EAPB 3VXQB 2DQFA 4WNQA 3LQZA 1HHIB 1QR4A 3V5DA 2YKLH 5I1CH 3NFPB 3UTTA 3WE6A 4TUOB 5GZNC 3UO1L 5LCVH 2WBKA 5B3JE 4F9PC 4X4MA 3ZDZF 2VLRE 3SKUD 5J8OA 1D5IH 2J8UF 4LVEA 2RIKA 3QQ4B 1BM3H 1CK0L 4OZ4B 4YDKL 1CLZH 5JXEA 2LABA 2ATKB 3DWTA 3VFMB 2APXA 3KPSD 4KZDL 1HK6A 3BRDA 1IRAY 4BYHA 1I4FA 4CDHA 4HJGB 4YHLH 5AZEH 2WUCH 4I18B 1S7QB 4LPUA 2OL3B 5IVNA 3W39B 1NCWH 5GGVL 4M93C 4AM0A 4HUWB 4J6RH 4X4ZA 1IGTB 1ZLVK 3EOTH 4PG9A 3MJGX 4JHZA 5I6XC 1S7XA 2D0HA 2ED7A 1A4JB 3ARBB 2MNUA 3JWOC 4G8GE 3MJ7B 1IL1A 5KTEL 1G84A 3MRKA 1EZVX 5DMGD 4NKMB 2MSPA 4UU9B 5CEXB 3IDNA 1BAFH 5I66B 1W0VA 3V8OA 1JF1A 2P4AB 4G43B 3DYOA 3EYQD 4HS8L 4ZS7L 1BQUA 5E56A 4YHZH 5AD0B 1NGQH 2C1OB 5EZIL 5K9QG 4PB0H 3X17A 4TSAH 5LKNA 1WWAX 2IQAB 1NFIA 3VFVA 4ZSOA 5I18H 4MNQA 2DWEB 1FVCA 3CFBA 4ZFFB 1KJVA 1MCKA 4K8RC 5CBAB 3MOAH 4ZO8A 4U1KA 2AJZB 3HG1D 5K59E 3E6HA 3QPQD 2VAJA 1RJYA 2X4RA 1S78D 3RWJA 1UGNA 1UVQB 1MJJB 1S5HB 2FSEB 4LQFL 5HY9A 5ANMB 1PYWA 4Y2DA 3CZFA 4HUMB 4U1NB 1XGUA 5FB8A 1G6RB 4LVOC 5E95B 2A77L 3ULUF 1OY3B 2BNQE 1NLDH 4NZDA 1VFAB 2YK1H 4EIZC 1CI5A 1V3JA 4F33B 3QDJD 3LS4L 2E7HA 2XN9A 2ICEA 1JPGA 3PDOA 4WFHE 1K4DB 4I0CC 2QADB 4R4ND 1L7IH 2VYRE 3HMXH 4GW4A 2FR4B 3D85D 1KCSL 4JY5L 4X6CA 2VDPH 2Q20A 2QHRL 1SQ2N 4Q7DA 5EZIH 4MNGE 1JK8B 1PZ5B 4R7DA 2YZ1A 1RUAH 1X5KA 4BQ6A 4I48A 1M7DB 2MCPL 3X3GL 1Q9KB 1GC1H 5HHNB 4GUPA 2OL3H 3OKYA 4OFKA 1FV1A 2V7HA 3NMEA 3TA3A 5J9PB 3HNSL 5C9JA 4MSWA 3JV4A 4X6DE 1QFWI 3UJJH 2DLEA 4UIMA 4QRPD 3RBSA 3U7WL 3B4NA 1UWXK 4GOSA 1F58H 4B41A 5KBNC 3LEXA 4HPYH 2BX5A 1JZ6A 3BX7C 4QT5B 5KZCD 5HI5D 5CLWA 5DK3A 1J0HA 5JOFA 1MLBB 2LE9A 4OCSL 1MHPL 3HZKA 2EDWA 3KJ6L 1DBJH 1N6UA 4N0FB 4LAQH 1QYGL 3BKJH 3IU4L 5AEAA 2FLBT 2VITB 1MY5A 1X5AA 2UY7A 5FYKU 4G9DB 4XNQB 1JHTA 1OTSD 1IM3B 3UTQA 4D0DB 3D5OF 4QHLA 2ADIA 5T1DH 2HKFH 2BVTA 1AO7E 1F4WH 3I9GH 5BVPH 3O8XD 3Q5OA 4PJ7A 3QHZL 4QTHA 5TE7L 4HD9A 1MQKL 5E94A 3NCJH 4TTDC 2A6JB 3T77B 5IKCA 5EZJA 4JQIL 3FQRB 1J88A 5E5RB 4PJXB 3BQUB 4QXTB 2E6PA 3KS0J 4L3CA 3P3YA 1QACA 3C5JA 4BUGA 1E6JL 1CFNB 4HIJA 3T3PF 4YGVA 3SE8L 1HWGB 4KKBD 4C4KT 4KJYB 4PJBE 3VXMA 2A0LC 4P48A 5IVZB 2EO1A 4H5SB 4JQVA 2IG2L 2AK4E 1IKFL 3NA9H 1CBVL 2LU3A 3RA7H 3ZZ1A 3JXAA 2VWEE 4WI2A 5HDBF 4LLUA 2DI8A 5HGDB 4U6HA 3H0TB 5CAYB 2VLRB 4QHNA 4JVWA 4K7PX 1G7IB 4MA7H 4Y1AE 3BVNA 1ZTXH 5E4EC 5FXCH 1HZHL 3S37H 3OPZL 3REWA 1ES0A 3AB0C 4GG6A 4ODSH 1R3LB 5JXAH 4IRSB 1T1XA 1JE6A 5FYLH 1MWAB 3BPLB 4QXGH 3QXUA 4NO5A 4Y2DD 4PRHE 3QEQD 4W4OC 1X4XA 4J6RL 3MV9E 5IK3B 4WWKA 1NL0L 2X09A 3STLA 5E2UL 1V7NL 2CDFB 1YY9D 3EO9L 1LP9E 1QBMH 3C60B 4UNTA 3SPVA 4XCCH 5E70A 4U3CA 4FXKB 4FA8A 3PL6B 1VSCA 3VG0H 2BVOA 2OZ4H 2ZNXA 4C55A 5HYJA 3FQTB 4G42A 3TV3L 2ZKHL 2CKBL 2PYEE 3O2DL 4FNLL 4K94L 2FHCA 3RQ3A 5TE4L 1NC4A 4PRIE 4GAJH 5JOEA 2R1YB 4X99A 4JAMA 2VL5A 4R4BB 1CZ8H 1JI2A 4FQXB 1XFPA 4I2XA 4HPOL 3STBA 5I76A 3AU1B 3ESUF 3IJYA 1MCWM 1F6AB 3BZFB 5D96C 1DN0A 1FG2B 3TNMA 1KOAA 2DQIL 3FT2B 3G6DL 2K1MA 4DKFL 4I18C 2CKBA 4QXUL 3SJVD 4OBSA 5F21B 1KCLA 5MEOA 3WFZA 1XH3B 2GITA 4KQ4H 4WJ5B 1WITA 4I77H 4Y16D 3HPJB 4UMGA 2IQ9L 2H26B 3GHEL 4WHCA 1UYWL 5D2NC 2HN7B 4MJ6A 1A14L 1NKOA 3O8XB 3QULA 3SGKC 1A1NA 1FGVL 1I9IL 2YHGA 1EMTH 3L3GA 1Z0MA 3RWDB 5JQ6L 4WHYG 4I0PD 5E99L 1IGIH 4Y2DC 3OG4B 3WJJC 5D7JA 1QHPA 3H3KA 2JK5A 1HWHB 4UBDD 2FJHB 4TUJA 1U92A 3CU7A 3WEXA 3P0YH 3QIBC 3CZJA 4Z76A 5EU4A 2X1WL 3DSNA 4PV9A 3VXRE 1V5JA 1AKJB 1LO4L 4WVRA 3O41B 1ACZA 1YEDA 4H1LH 4M6NH 3F6IA 4N5UA 3IJHA 4GW5B 4HC1L 4MD4B 2ZUUA 4X6CE 5LGJA 4CADA 1FVEA 3H7LA 3MYJA 3DUSB 1HYRC 4MDIB 3PHOB 1XF3B 4XMLH 3QI9D 4QOKE 3IT8D 1IGCL 4PB9H 1ZLWK 4A6YH 1K3IA 1WBXA 3QP3A 1NPUA 5C2BL 2O26U 5JOFB 2HTKC 4OD1H 2EDRA 1XGPA 2X1PA 1FNGA 3TT3H 3IJSB 3GRWA 4UIMB 3T0EE 5CSZA 3VXUB 5C0JB 3TA3B 3DXAE 3WHE0 4L5FH 3DTXB 4MXQC 4PJ9B 1TJGL 2G2RA 1MWAL 2J88H 2CJUH 4UB0H 1OP9A 4Q2ZA 3AMKA 4P23A 1OD7A 1JK8A 1PZ5A 4R7DB 4JM4H 4V1DD 4ZNCD 1WC7A 1FO0H 2H2SD 2HFGL 5EUOF 1JVKA 1QSFB 4IIQB 4Z7OF 2X5PA 1OAYH 3HI5L 3CDFA 2R9HD 1RJLA 2IFGA 1AQDA 2BSRA 4OZGF 4Z7VF 1Z5LA 3EGSA 3RFZC 3DVGA 1G6RH 4M7KH 1TLKA 1VADA 2MFNA 4U6XA 1I7UA 3LOWA 4OFPA 1CGUA 3ZT5A 2R1XB 3BKJL 3IU4H 1IAIM 4U1MA 1Q1JH 1IKFH 1QEWB 3N9GL 3DX6A 4KVNH 3PP3H 4G8FA 4AT6A 4CU7A 1WIPA 1IZKA 5IBUG 1BFOA 2WV3A 2Y06L 1MEXH 4XNZB 2WUCL 3JSSA 3I84A 4PGBA 5M7QA 4HDIA 4WI9A 1IGFH 4KZDH 2NY1D 5J06A 5FAAA 4NSKA 3D6GA 4C56B 2OTWB 3WD5L 5F3HA 4P2RD 1CICB 3MROB 5C0ND 3VGHA 1RK0A 3AS2A 3IKCA 1NCAL 4U6XB 3B2UC 1HINH 2O5ZL 2Y7QA 1DQLH 1T22B 2BC4B 4WUUD 4YHPA 3SE3C 1H3PH 2PNDA 5FHBL 3BZEB 1NGQL 5DQJA 1RZKH 3U83A 2QJDA 4MAYB 1BAFL 3RP1A 1MNUH 3BISA 1TPXB 1L7IL 1PW3A 5FO9B 1RK1B 3S37X 1JHKH 3GMPA 5EU3B 2JB5H 2BNQA 2D7PA 4Y19D 5DRWB 4X98A 4XXDA 3H42H 3LQAC 4CVWA 4NQCE 3D2UA 5I71C 3UX9B 2IAMC 4OCWL 2ZUQC 4MAYA 3N1FC 2OMNA 4UZGA 2XQYK 3MRCB 1YN6A 1A2YA 4EVNB 4YBLB 2GJZB 1BP3B 3P4MB 4LQFH 4M61B 4MB4A 2PYEA 2EIEA 1NC2A 1A6ZA 1KNOB 3DUSA 1F3RB 3BDXA 3S97C 4FQHB 5DGQA 2WK2A 3VI3E 4KUCF 5LJYH 4LIQH 1XF2A 4I3RL 1NGZA 4GKNA 3VRIB 4QF1B 2PETA 1YC8A 3PWPE 1LO3H 4PRNB 5E2TL 5B8CA 2D03L 1E27B 1AGDB 4WCYH 2ERJC 1GHFH 3UAJC 4KUZL 1DQDL 1XGRB 1KLGB 3KPLB 3GSXA 4JFXA 1FSKB 4XMKL 1BVKA 2QSQA 5JQHC 5BRZA 2DQTH 2FD6L 2YD6A 3I02A 4NRYB 1GGIL 5L0QC 1NLBL 4HHAA 1QFWM 5HDOA 2OSLB 4JM2F 2EECA 2EEBA 1CE6A 4YDVA 5FYJE 2CRYA 4NN6C 2EKJA 3G6AB 1GGCL 4L8BA 1XR9B 1RZFL 3NCEB 4MAUH 4EN3B 3EOAA 1B4JL 2DTMH 4PRIA 4JFFB 5I8CB 3VXTB 4XB8A 4F7CB 3OKLA 3V0WH 5DUMH 2D7OA 2VDNH 2C3GA 5CILL 1Q72H 1VACB 4KK5C 5IJVB 4GH7B 3V6ZA 3HI1B 3MREA 1DEEA 1RMFH 3TJHD 1JYXA 3RWCA 1KELH 1PQZB 1FGVH 1I9IH 4NNYA 5FYJL 1XH3A 3UJTH 1BD2E 5I19L 5JHDA 2XFXA 4HKZB 1VB9A 3EOAB 4DFIA 3QUZC 4DOHE 1RFDL 4K2UL 4MQSB 2H3NA 4XPAL 3PIQA 3BKMH 4JPVL 2NX5E 3VXNA 1J5OL 3SCMA 2A73B 4D9QD 3BH8A 3FRUB 3NFNB 4LPTA 4N8CH 1N59B 2ESVD 2HAZA 2P45B 4ORGA 4LHUG 1WBXB 2ESVA 3W11C 3QDMA 3LKOB 3J8F7 5DO2D 1F6FB 2VMFA 1IC4H 1RUKL 4WO4A 2R56L 1MVUB 1Z9SA 2P8MA 1CD8A 3HZYB 4Z0BH 4FQCL 2YRPA 1OF2B 4JY6B 3KXFB 2CRZA 3OBAA 1MRCL 1YDPB 4HIEA 4KK8D 4N1EA 5C3TA 1I8IB 3BP4B 5CZVL 5J1AB 4QOKA 3RWIB 4AL8L 2GQHA 1PKQA 4ZAKA 5MENE 4FTVA 1LDSA 1WAAF 3PWLA 3R06A 4LLVB 1DBML 4LLWA 1KG0A 4RZCA 2AK1L 2XWJA 1EX0A 1OP3K 3VCLA 1KJ3L 5T1MA 5JLZB 4PLJD 1S78C 3RIAF 4NM4L 3FCTB 1NMBH 4JJHA 4N0YH 4U1SA 1NCDL 2EDTA 2Q76B 3MXVL 2VR9A 1T66D 3SDAC 3OQ3B 1TZHB 2GK2A 4WFGE 4U33A 3MLPA 1BVZA 1V7ML 2CIIB 2AQ1A 4GFTB 5IUSA 2C3VA 4QXTA 3MLUH 4PJGF 2PXYC 4E9LA 3QIBA 1F4HA 3QIUD 3P77A 3VMNA 4MNGA 4PLJC 1DQLL 3T77A 4Z78B 1EGJH 5IKCB 5T3ZL 3QDGE 4V1DE 1UKTA 4M93B 3MFGB 5BJTB 2VUYA 2R2HB 4LLQA 5BS0E 2OTWA 2XPGB 4YQXL 15C8H 2E7BA 5H35A 2P5WD 4KK8C 1A1MA 4DTGL 1NC4D 4X7TA 4PV8B 2X1XR 4W70A 1YA5A 2YD3A 5ITBL 3VXUD 2ZOKB 5IB3A 1R5WB 1JBJA 4XP4H 5IMMB 4FZ8H 5CINH 2WBWB 4DKEL 1MIEL 4PJGE 5F8QC 3ZT6A 1SEQH 3O6LL 5TDPA 3ARUA 3OKEB 1Q0YL 2X1QA 3TO4B 3ULVL 3S34L 3N06B 5IMLB 5IK3A 2R0WL 2ZOLA 3GSVB 4QHKJ 3FO2B 1RIHH 5E8EB 2EZ0D 3EYOA 3OWEA 3QDHA 5FGRA 1IAII 1BD2B 4HUKB 4KGJA 2WMPA 1R5VB 1C5CL 2F5BH 2VQ1B 2VWEC 3AAZB 3BUYA 2Y5TB 4PG9B 5EOQH 5SV3A 2EH8L 2YUZA 3S4SA 4IDLA 3MXWH 2NTFA 3MC0A 3W81A 3DMMC 1AE6H 2G60H 3A0OA 5FA3A 2PKDA 1L6XA 1NGWB 5SWZB 1PSKL 2BVYA 4J8RB 4IOFC 1RPQA 4GKZB 4Y88A 3V6FA 5ACZA 4XCEA 1U8QB 5J89A 1J8HE 5J3HC 4ALAH 2IBZY 4X6FA 3RPIA 4NKOB 5C70A 4J8RA 1M7DA 1R3JB 2PUQT 4JFEE 5BRZD 3RTQA 2EZ0C 1FLRH 5CLTA 1SY6H 2ZUVA 4U1GC 4TULL 3DXAD 3W5MA 1QLFA 4PJ7E 1HQRA 4P57A 4QNPF 3CLEH 3B9KB 3E0GA 4ELME 4GRWF 5JIHA 2X89D 2VDQL 2E5EA 2ZPKH 3JWDL 2A9ML 3QH3B 1JP5A 5BO1H 2B5IB 3L3OA 1O0VA 1AQKH 4M3KB 4KDTC 3B9DA 3OG6B 4JRYA 3MYJB 5D6CB 4XCYA 4RRPG 4WEUD 3IJHB 4GW5A 4MD4A 5CBAA 1VPOL 4PJAF 4UNUA 1FSKC 4LPWA 3GDBA 4BZ2H 4MNQB 1I9RH 3WNNA 4KROC 1Q8MA 5CP7B 1JHTB 1X5XA 1M7IA 4HWBL 3SE3A 4DKAA 3WEXB 2XQBL 3LRSB 3MV9A 4YE4H 1X44A 3HHRB 5I8EB 1CDYA 1NFIB 5GJTH 3QZWG 3PL6D 4TNWF 1K9TA 1XIWB 4IEFB 4R3SA 4D0BA 4DZ8A 1DFBH 3ECBB 1F8TL 4NNYB 4HSQA 1JNHA 4R96B 1FDLL 3GI9L 2H8PA 3WKML 2BCKA 4M7KL 5JOPD 1FRGH 4RWYL 1T1WB 2C5DC 4GRWB 2ZPKL 3JWDH 2AEPH 1K3ZA 1Y0LA 5DFWH 2R15A 4EBQL 2QHRH 2YSSA 4JZOA 5JO5A 1UB5A 2BY2A 3LN5B 1MNUL 4I48B 2KQMA 4RWHA 4K3GA 4QHKI 1EHAA 5E1AA 1FPTL 3ARDC 3KYKH 2B2XL 5DA4A 4ZAKB 4P2OD 3UYRL 5E08H 4QRUB 2YR3A 4XBGA 1K6QL 4FFYH 1D5XB 1CZ8L 2BVPA 1YJDL 1T0NA 3ULVE 4HQQL 4G6JH 3B2UD 4PJ5D 2LV4A 5DUBA 3HMXA 3MV7A 1VFBB 4R2GD 3SKOB 5FUOH 2EXYD 3VG9B 1YEHL 1C5BH 3U7WH 1EEYA 4ZNEA 2NY1C 2ZJSH 4NWTH 1DUZB 1PBYA 3L95B 3BQUD 2WWKO 3T1FB 3ZE0E 3MGOB 4ORGB 1PD6A 4WNQB 3LDBB 2Y72A 1I3RA 4NJ9H 1EEYB 2JKXA 3UTZA 4CMMB 5L7XL 2WINA 4LARL 2VLJB 3GJFH 3VXNB 3L5HA 1FGNL 2DI9A 4XBGB 3WLBA 3HKFA 5JDJA 4ZUVB 2RCSH 5IFAL 1RVFH 3NFNA 2BJML 2J8UA 1U93B 4P46B 2AQ3A 2GTZB 5J6GB 1PY9A 3LKRA 3CH1A 3WFHA 3QUML 3DRTA 4QRRE 2WANA 1MREH 1UENA 5IBTH 2CDGA 1ORQB 3CSYA 1BZQK 2UUDK 3IETB 2F54E 4WW2F 1NCTA 4UTBL 1DUYA 5DD3L 5B21A 4JLRB 4OF7A 1CL7H 1YUHB 3AMLA 4LCIH 4XXCA 4NJAH 4WHTA 3BWAA 3VXRB 4PR5A 2CIIA 3V0WL 1IQDB 4HT1H 3D3VB 1D5ZB 1I85C 3LAFA 2W07A 1JGVL 3WN5A 3LCYA 3OJDB 5DJ2B 4ZSOE 1UKSA 1WFOA 1EMTL 1JWMA 1WCBA 3K4ZA 4G80A 3T3ME 1BJ1H 1KEML 1UEMA 3I3BA 1EV2E 3DLQR 5HI3C 4GAYB 2W1NA 4LFHD 3CSBA 3AU1A 5D7JD 4Q74A 4I0PA 4H1LA 4N5ED 3BO8A 4PB0L 3B5TA 2JCCF 4RBPK 3G6AA 4JFZH 1RVFL 4L8BB 3M45A 4ZAKD 1W2KT 2W60B 1OCWL 1J05A 1S9YB 1CFTB 1OP5K 1ZHKB 4LRNL 4M6AA 4WWKD 1R0AL 1AGDA 3EO0A 1KIQA 4M6OL 3ZDYE 4KAQL 3JUZA 4M7ZB 2CMRL 2BOCB 4H26B 4K7PY 4TUOA 5FA4A 4YK4B 3RX7A 4G8GD 1I1CA 3IF1B 5GIRA 4Q9BA 4YPGA 4E0RA 5SV4A 1CN4A 4HKBB 5CSBA 2FGZA 2UVEA 2HRLA 3EOBB 4NT6B 5TQ2L 4GBXA 2AERT 1J8HA 3CGTA 4KQ3L 5ENWA 4K3EL 3F7PC 1HCVA 3I6GA 5DR5L 3T8XA 4OTXH 1DBBH 1OAQH 2JIXD 3CVIH 4GG8A 4JKWA 4XP6H 4ZXBA 3TN0C 3RY6C 2ESVE 2GCYB 5GS1C 5EULV 3V4PH 3WFBH 5HGDA 1AIFA 2D3VA 4LEOB 1MIMH 1VPOH 1OVZA 1WVZA 3BDYH 5EFIB 1P4LA 4P46D 2J5LC 3S36H 2P5EE 1MFCH 3S4SB 1U8QA 2DJSA 4K23L 5KS9A 3C08H 1JNLL 1A21A 3MZTA 2CRIA 1DANU 5JMRA 2MMXA 2PYFB 4YDLC 1MHEA 1XGPB 2QR0B 2OZ4A 4AEIH 1DFBL 4DZ8B 1JTTA 3KDMB 1MCWW 2WBJA 5B38B 1BQHA 4FQ2L 3S88H 4MD5B 3C2AL 4LSPL 3ZTJH 4MDIA 2B4CC 5B4MC 1Y18B 3VMOA 3TA3C 3V4VH 1LP9F 4HKBA 4CADB 3WCYA 4K94H 1FC2D 1A7QL 2Z31A 4Y19A 5CD5D 3RVVC 3JWNC 5I73B 3RKPA 3OXRA 1MVFA 3KLHC 3CAFA 2AV1B 1AKJA 4NRYA 1AGEB 5IHLB 3O8XC 4V2CB 1TJIH 4NHUA 4YDKH 3GSRA 5TDNA 5FK9A 2HVKA 2X4TB 2HKFL 25C8L 4PJAB 4U1LA 3WIHL 3ARFC 3IAGC 2OL3L 4M1CC 1FCCA 4BK5A 5BMFL 4PJDF 2LVEA 5I8OL 4OM0H 1A1OA 2Q87A 1KGCE 4I5BB 2VLMD 3VXMD 3CSPA 4BQ9A 3LS5H 5LQBL 1U42A 4XB7A 3LEXB 4A6YB 5IV2B 4OZHA 3Q3GA 1ZMYA 5FUZL 3KJ6H 2R0LH 1A6AB 1F2QA 3LSOA 4LLYB 3MCLH 4J4PC 2DL9A 1ACYL 1BIIA 4OIIL 5DT1H 3U0WL 2C3VB 3RVXC 4MA3B 2ZUSA 2J6EL 2VKXA 5SWSA 2IPUG 4RISL 4WHDA 4N0CD 3QPXH 1WT5C 3D85A 1HH9B 1D7FA 3THML 1KG0B 4RZCB 3REVA 3D2UD 2CKNA 4XNXH 3U7YH 3E6FB 3NTCL 3S35L 2R0ZH 3BGMA 3T2PA 1I85A 2I07A 1TETH 4HWBA 5I18L 3MRIB 3HCVB 4QWWC 2XWJB 4ODVH 4Q9RH 2QL1A 1NANI 1YDPA 1CFBA 3P40A 3QQ9D 3RNQB 4MQTB 1LDPH 4KRNA 4FQIL 5I6XB 1QG3A 4YJZL 5TE7H 2O5XH 2R0KL 1NDGA 4O2FB 1G7LB 4Z7WF 4K23H 4PJHB 1BZ7B 5JXAL 1T22A 2BC4A 4TYUA 4R7NA 1P6AB 3O9WD 3TIEA 5ITFA 2VLLA 4ZPTB 2ZZUT 3VJ6A 4GG6E 5I75B 5ACLA 3OGCA 2DQGL 3BD3A 4KWUA 5J57B 1HHIA 1REIA 3S3SA 3V7AE 3IDMA 3BEWA 4IS6B 1I1AA 4AEHH 4RNRB 3S9DB 3VFSB 4Y1AD 5D6DC 4NO0B 5TH2A 4C57C 4KRMB 4KKAD 1T1XB 1TJIL 3QA3B 4GRWH 1RULH 3QPQC 4K94C 4PJIB 5FOBB 1GIGL 1BZ9A 4PY7A 2R4RL 2H32H 1F5WA 3OKNA 5HPMB 2A38A 1FNEB 4OD2B 2VH5L 5SWQA 3OAZK 2WZPD 1YNKL 4HWBH 2AEWA 3MBED 1WCBB 4F9PA 1VADB 1FFPA 5KW9L 3H3BC 1NUFA 1KJMB 4JG0H 4JANB 2W9EL 3UPRA 4JDVB 1EUTA 1PKOA 4IIQA 5HHMD 1S7XB 5HGBA 1YUHA 5MEOB 3MCLL 3IFLH 4N8VG 4L8SC 5D7KE 3LN9A 5EO0B 1QRNE 3NAAL 5H8DA 5BO1L 2OI9B 2FYYA 5GRZA 1OQOA 4HJGA 3MLTA 5DHYA 1QYGH 4Y5VA 2OSLA 5FYLD 1INEL 1HHGB 1U8OB 2DOCA 3UYOD 2Q1EA 4MAYC 1PG7L 2XTJE 5MHSE 4XRCB 4G42B 1EEUA 1TCMA 3BPNC 1F3DJ 4HHAB 3WUWG 2BDNL 5D1QC 2IGFH 3FQXB 4GLRH 1TCRA 5F1NB 2VSDA 3ZYIA 5IG7A 3KPRB 4IOFD 7FABH 4JZNA 5CJOL 5E8PA 1FL3B 1CGTA 3QNZA 2JIXA 5SX5K 2VXQH 4FFVD 4P9HH 4GW1B 4IDJL 2YD7A 4Q58C 3UO1H 1MH5A 1MSPA 4L4VA 3D9AL 4I77L 1DLFH 3K3QA 1E0OB 3MLUL 4KHXH 5F1NA 1YPZE 3NPSB 3L3DA 1A7RH 1I8KB 3ZE0F 3K0WA 2H9GB 2NZ9D 4CU6A 3TVMD 3GSWA 1M6OA 3F12A 3S3JA 5I30H 1FFOB 2XIDA 3IGAB 5DHVH 4X98B 4UOW1 1I1FA 2R29L 5C0CA 4LHUD 3N1PC 3DUUA 3DI3B 3KPSA 5EA0L 1KGCD 4R0LB 2VLJD 4BK4A 4NFBA 2WBJC 5ICZB 5H2BA 3TYFA 3MBXL 1UWGH 2AGJH 1BIIB 4LEOA 4HLZG 2DJUA 4X9HA 4AH2A 2BNRA 3BAEH 4WFHD 2JELH 1CGVA 2VXVH 4JREB 4JO4L 1DBKH 4O4YH 2Z31C 1ND0B 4OZHB 4R6UA 2RJMA 2RB8A 3ES6B 2QSCL 3WNKA 1VGKB 1T20A 4HIXH 1GZQB 1KBGL 3QEGH 4R2GB 4LLYA 3HAEH 4KVCL 5TPWL 3QG6B 5E2UH 5D7IE 2E7MA 1S7TA 2CLVA 2A6JA 2EH8H 3F7VB 4FQ2H 3AS3A 3HUJB 1PLGL 2DBJA 3MV9B 2O5YH 3GSRB 4P2OB 5I0ZA 4Y2DB 2A9NH 1UH2A 4NCC2 3MACH 1CGWA 2X9YA 5FYKE 1KTKE 2X4RB 4E41A 4JPVH 4AQ1B 3C60C 2HLAB 1RUML 3FT3B 1U8KA 4I3GA 4Y4KD 1M05B 1UA6L 4P3WA 4Y4KB 4U31A 3DMMB 1A3LH 1SJHA 4HZAA 4Y19B 3GI8L 3UBXI 4OCYH 5CCKH 2I9LA 3PL6C 1OGAE 3VGDA 2VLKD 3UP1A 4ODUA 3MR9A 3CFCH 3AREB 3UTQB 1N4XH 4MD5A 1UCBH 2DQCL 3HNVL 5C0AD 2PW1B 3P4NA 5DJ8B 5JOPE 5JHDE 3KPNA 1LO0L 4AENB 1UACL 5SWSE 3MRDA 1JGVH 3IS0X 3I3EA 5DHVA 4EEEA 4U0QB 4YH6A 2KZWA 4LSTL 2E7LC 4LBEB 2LVCA 3H7BB 4QO1A 1TITA 1RIVL 1QBML 2UZYB 2GSIB 2FJFB 4JJ5B 1AE6L 1CD1B 3FQNB 4L8SB 4YBQD 5IR1B 1KTLB 1DUYB 2B5IC 4QRTB 2FNBA 4U6VH 3TZVC 4LSQH 1FBIH 3T1WA 1U58B 3GBNL 4FMFA 3MRLB 2CDGB 1RK1A 3T0EB 4F7EB 4U0RB 2PN5A 4WV1B 4F15C 3CH1B 5J0BA 3OB0H 3UTTE 3OL2A 4PJHF 1CD1A 2C3HA 1FNSH 4HWNA 4Z7WB 5EIIA 1TNNA 1MAML 2E3VA 3QZWA 1CF8L 3SGEH 4LCUA 1URLA 3LSOB 3TF7C 5BZWA 2BHUA 1P5VA 1MELA 3IFNH 4FZEH 3GEWB 3T04D 5ENWB 4Y5XA 5GJSH 2F54B 4BQBA 2XA8L 3IF1A 3T1FA 4UINH 3S8WA 4B7LA 3LQMA 4YX2L 3LKQA 3MLYH 2NY5L 4DQOH 1IBGH 1J7VR 1R5WA 3TBWA 1MJ8L 5IW6B 3RY4A 2AJUL 3LH2H 1BFOB 1J12A 3O0RL 1DVFA 1RHHB 5BQ7A 3F7RA 4X7TB 1G9MH 1PFCA 1P4IL 3HI6L 4FQLH 3DIFA 2JB6A 4LRNH 4NO3A 4QCIB 4FOMA 5KOMC 3T0DA 4OIAA 1FPTH 1T1ZA 3KYKL 4FQJH 1EO5A 1AD9B 5C07B 4HGKC 1YYMH 4OT1H 3ZKXB 1Z0NA 4IRJA 1KXQE 2RFXA 1KTDB 1SEQL 3O6LH 4WJ5A 1FRGL 3RWEA 1AI1H 4UU9A 5CEXA 3GSOB 4F9LA 4PD4J 1MJ7L 2F15A 5KVMC 3RAJL 3S4SG 3VD5A 1JNHB 1GOFA 4R96A 3VWKD 4L4TE 2OL3A 3BGFB 1SYVA 3K81A 2DQHL 5T5NG 4P23C 2V2TB 1KELL 5T3ZE 4P5KA 2DYPA 3UAJD 2CKBB 2W65A 4RISH 3RGVB 1IEHA 3ZTNH 4UIKL 1MF2L 4MHHI 3BD5A 5F3BB 5D5MF 4YXLL 4NQDE 1F6AA 4JHBA 2IAMB 4CN1A 1FYHB 4HQQH 1WZLA 4MMZC 4P9ML 4K71C 5ADOL 3HZVA 3GGWB 5E8DL 3W0WD 3BYYA 4NQEE 3ZE1E 4S1RH 1BEYL 1RZFH 2IBBA 1ZE3C 4IRJC 4ZUUA 4JFHD 4WI4A 1FIEA 5D71L 5HYJB 3RUGA 4N8CL 1KCRH 5IF0B 2PCPB 4NCDA 1NCCL 4FXKA 4LMQI 5DURB 1YQ2A 4F3FA 2XG4A 4DGYL 3OV6A 3NZHH 3RUGB 1DQQB 4PJ8B 3D87B 5I1EL 2CXKA 2A83A 4F3FB 1AP2B 2VXUH 1R24A 4MX7B 3RIFK 1UH3A 4I9WE 1D5BB 3INUL 1FVCB 3CFBB 4C59B 4ZFFA 4LKCB 4BFEA 4DQOL 2JLLA 3O6FA 4OKVA 5GGRA 1X9QA 5DQDL 5EO1B 3PDGA 2X05A 1U9KA 5EOCL 1I9RL 3MLXL 5IFJB 1VESA 4PREA 4U4BA 4X0KB 3JZ7A 5E1AB 4XPBL 2GJ6D 3BPCB 1CU4L 3F6LA 2Y4SA 1EDQA 4XWGH 5E7FA 4C54A 1RUKH 1MFDH 1U3HA 2EIDA 3O3EB 5E8NB 3U1SH 1RUPL 1K8DB 3L3HB 1IEAA 5LAXA 1Q9WA 4RWYH 3RGHA 1U3HB 5I71B 3K4DA 3VRLF 5EZJB 3QQ3B 3WKMH 3OAYK 4R8WH 1ZHLA 3FQUB 3FTGA 3SGDI 4XHJC 3KPTA 3WFHB 4RFOH 3DRQB 3HC0B 4TNVK 3HB3C 2OJZH 3O3AB 1UXWB 2BK8A 5DRNB 3PABB 4Z0XA 4DUWA 4PJ7B 4QTHB 3U0TB 5CD3A 3FT3A 4NZUH 3ZKSD 2J88L 4EXKA 1E28A 3KWWA 4PTUA 1K8IB 3C6LC 3KPMB 8FABA 3CPLB 5L2KE 5IJKC 4PS4H 2BMKB 1VDGA 5HHVH 3CFJB 2ARJB 4X7FC 5GZOD 1WFUA 5L0QB 1R3KB 4RGNB 4YNYA 3PJSB 2UYLB 2BSRB 3B43A 3BZ4A 2H32A 3V5HB 4ELKB 5AG9A 2JCCB 2OX5A 4CW1A 2VDOH 5KJRH 1DQDH 1G9NH 4J1UA 3QFJD 4A6YL 3NBNA 4NQED 1P4BH 4MXWH 5I1GH 4QWWD 3TC9A 1INDL 4HMDA 1MAJA 1WC7B 4M6MH 3LV3A 4YXKL 4F2MB 4BJLA 3GM8A 5FECB 3WL9B 1V8HA 4LSQL 2CLRA 2YRZA 1LO5A 3NN8A 1Q94A 3GNML 3NCMA 1OL0A 4U0RC 5HHNA 3P0VL 5DQDH 5GRUH 3VA2C 4NOBA 1MCFA 5F8RC 1CU4H 4EDWH 3BUYB 5DQ9A 4Z9KB 4LDOB 2X4OB 1KPVB 1BD2A 3L5XH 4M1DL 4NC1C 5L2JA 1MHHA 2VC2L 2D7TL 3UEZA 3BAEL 5F6HI 1K4CA 4J1UB 5J12B 1EO8L 3DHJA 3B3IA 2DQDH 2XXCB 2B1AL 1LHZA 2EE2A 3WHXA 2WM0A 5IHUL 5D7IF 4HIIB 1WZKA 5C07A 4R4FL 4F37K 3F7QA 4OZIF 3QRGH 2EXWD 2NY7H 5IFAH 4APQC 2APFA 1A3RL 1I1AD 4MJ4A 4F57H 4QOKD 3VGEA 3MZGB 1J5OH 3DX9A 3OXRB 3ALPA 4EI5C 3G6DH 1F13A 3PQYB 5C0EB 1RUQH 2FO1A 1OTUC 5DJ6A 3TP4A 1N6QL 4YDIH 3VD9A 4H1LB 5GGTA 3WNOA 1V05A 1HHGA 2DIBA 1IGFL 4Y8AA 1NCAH 2ZUYA 4GAYA 3MLTB 2CO7B 4OB5H 2DQCH 3HNVH 2NXZC 5JW3H 5TF1L 4RAUA 4F7PA 2CLVB 3D3VD 1KB5H 4L9LB 5IB4B 5CJXC 5HI4C 1MI5D 2VDMH 3ARPA 3ARFB 3QFDB 5C0FA 1U8MB 4FS0A 3MBEC 4YXKH 3GHEH 1KF9B 3JV5A 5AG8A 2CH8A 3U30B 1YY9C 1A7PL 3KYNA 3N9GH 4U3XA 4JFFA 4XCEB 4HXAH 4JPWH 4HIHA 4NDMB 3HE6A 4DVBA 4Y7MA 1A3LL 3V4UH 3JUYA 2YC1B 1DN0B 3SKNB 1FBIL 3MGTB 4X0KA 1UXSA 5ERWA 3LPGA 4H88L 5EH1A 3QUXA 3V0VB 1DBMH 3BKYH 4Z95L 2EO9A 3T8XB 3BFOA 5D71H 4S1SH 4OZ4A 4K3HA 1PEWA 4FFZL 5K33A 3GSWB 1U95B 1R24B 5IFHL 4PRDA 1CDJA 5MEQB 3ARQA 3LD8B 2JJSA 3TEUA 1YEKL 4YO0B 2Z92A 4FZEL 4QGYA 3SE9H 1VGEH 1IGYB 3CSGA 4HWZB 3X13B 1E6JH 3GSUA 5HHQA 1ZSDA 4K7PH 2QLVB 2PCPA 4YR6B 3DHMA 3GBMH 3OZ9L 4ZFOL 2J6EA 2P8LB 5ILTH 3SKJH 3ILQD 5ICYB 1N59A 2FJHA 3O3AA 5FUCE 2AJSL 3CCHA 1DL7L 4HUVA 3L1OL 5DMJB 3DRQA 3HC0A 2EE6A 4X83A 2FD6H 1MQKH 3QUMB 4TTDD 5KSUA 2BRRL 3G5ZA 4UILL 1NDMA 1RFDH 1J1OL 4JFFE 3LPFA 4MJ5B 3AS0A 4LHQB 5HDQL 2CGRH 4S2SB 1CLCA 3IYLW 2VIRB 5IQ9A 3HNTH 5CJQL 2XRAH 4OKDA 1EFXB 3QI9B 4UQ2B 2P24A 2DQEL 1A6TB 1WTLA 4NQCB 5FCUL 5IOPB 1PVHA 4XHQA 3BPOB 1BOGA 1OAYL 3DROB 1SJXA 3S96A 7FABL 1X5FA 4JDVA 5T3XL 5ALBL 1MUJA 5C8JB 4OGAC 4BFIA 4X4XB 4JO2H 3OF6D 1S3KL 2J3SA 2G5BB 4FQCH 5D2NB 5H2BB 2BNRE 2VUOA 3HG1B 1WLHA 2D0GA 4YX2H 5ESVA 2W91A 1GGBH 3SDYH 5HXMA 1OAUH 5HHOE 5T1LB 4NO0A 5F7EH 4DAGH 4LQ1A 5F7WC 3MBXH 4OCNC 4JPIB 2P8LA 4KRPD 1MPAL 4L3EB 4QXUH 4XPGH 1QFWH 4MYWB 4WRLA 4WU7A 4Z7UE 1H3XA 5DFVD 2HJFA 4QF1A 3HZYA 3KYAA 2XQYG 3R0MA 4NZTL 4IDJH 1GSMA 4F7MB 3UTSD 2V5MA 5GS2D 2ITCA 3O4OC 4N0FA 3UJIH 4M9OA 3VGBA 5DFTA 3DVGB 3V52L 5SX4H 4WW1B 4UV7H 4HIXL 4PJHA 4CJ0A 5IBLD 5FFLA 5GGSB 2WAHA 2R4SL 2NY5H 2ICES 5EU7E 5EZLA 3CFEA 1A4KA 4OZFA 1IGJA 3DXAB 2EDBA 2G75A 1DBJL 4PJEF 5IM7B 1RZGA 4CL7A 5F3BA 2YPLD 3BGMB 4P46C 4RRPA 5DRWA 3WIIL 4DJMA 4U7MA 5KSBE 1PEZA 5GRUL 2GY5A 5CJXA 1JWUA 1S9WB 1NSNL 4ERSL 1I8LA 4BH7B 2G2RB 4Z7NE 3BI9X 3MBEA 4H5SA 3SEPA 3UJJL 2HT3C 4CMHC 5DK0B 1I3UA 1RZGB 4L4VD 5I74C 2B7DT 4KAQH 1TXKA 1KTLA 1SM3L 3PGFH 5E9DB 2XRAL 1P84K 5GSVA 2OXGA 1W8OA 1Q0YH 1T89C 4JG1L 4YHMH 1I7RA 3NAAH 4DKDC 4HZLB 4OFIA 4R4FH 5MEPB 1GAFL 4U1HB 2AJVL 3WBDA 3G5XA 5BVJA 3NA4A 1OTTC 5C09A 1R3KA 2DQUL 5TE6H 2Z8SA 3WS6A 1CE6B 4YDVB 4O5LL 4UIKH 3EJYD 5FV1L 4CGTA 4H26A 1M71A 1P1ZA 3V2AR 4D94A 2CO6B 2Y9RT 3SO5A 3D25B 4U1KB 2HH0L 1KJ2H 5HYFA 3LDBC 3QO1B 1HXYB 2AEQH 3BO8B 4Y0GA 1TTGA 5KN5B 3MJ9A 3HAEG 4LAJH 4PJFE 5C09E 1NGXA 4MJIB 1QQDB 4DW2L 3B9KA 5I8OH 4Q9QL 3U0PB 4XZUA 2FH8A 4MGXA 1A6ZB 4KI5E 2XY1A 1JWSA 2A1WH 1A7RL 1OGAD 1QUNA 2CRMA 3GMMB 3L3IB 3MJ7A 1AR2A 3BPOC 3ZL4L 3O3UN 4OFYD 3L7FB 1R3JA 1FV1B 5F7DB 3QIWA 1ZS8A 4HXAL 5J56B 1KIRA 1U3ZA 3DVNA 4WTWA 1G9ML 3V5KB 1D9KB 3NCYS 1RQ5A 4TN9A 3VFOA 4WFED 4ZTOH 4Z8FH 3W39A 5EC2B 5T3XE 2CKBH 1EHXA 4QTIL 2N7AA 2IAMD 3G5ZB 3IB4A 3HLAB 3RNKA 3BP7A 4JFYA 3QIWB 4MA3A 2DLHA 5D1QA 1FFNB 2R2BB 5HVHB 1YMMD 3QAZC 3MO1A 5AUMA 4LCIL 4M43L 4QGTA 1C08B 4P4KD 5EUOE 1PKQE 4P4KA 3F5WB 1FORH 4PLNC 4WV1C 4CW1B 1XR8A 3SDDD 4KQ4L 3U0WH 1I8MB 3EO9H 4JY5H 1FL5B 2ZSWA 1KCVH 4JO1H 2NY5C 4L3EA 2A9NL 4X9IA 3H9ZA 1J9CT 2I60L 3DMMA 1RUAL 4KDWA 4JB9L 4ZO6A 4ZUUB 3RUGE 1J1XL 1AR1D 3U4BH 3ULVD 2VDPL 1MRDH 5GISH 1ZGLM 1NFDB 4K7FB 4Q9RL 2WNGA 5DVNA 2J4WH 3MNWB 3QIWD 2BRQA 1G7IA 1X7QA 1Q9OB 2O5XL 4WHYH 4NNXA 3EYSH 5F9WC 3S6CA 2SEBA 1DBKL 3B2VL 5K9JL 1F58L 3ELAT 4XXCC 2OR9H 4LCWD 2NY4D 3QEQA 2NY6B 4NWUH 1BIHA 1C7TA 5B38A 5KG9A 4OCRH 2QTEA 4MQ7A 3BWAB 4OM1H 2F58H 2ADGB 2Z35B 3D3VA 2OP4H 5TF0A 2VXUL 2HVJA 4MQXC 3WV0A 4N1CA 5B3NA 5IROC 1KB5A 1DE4A 2GUOB 5HDLA 3UPRB 2J5LB 3BP5A 1NLBH 3IETA 4LLVA 2C9AA 1FFPB 1T0MB 5IQ9B 2ZCKL 1AD9A 5FIEA 2VXSH 4I4WA 1ODAA 1BFVL 5EUOB 1NMBL 1X5YA 1JGUL 1DBAH 1RZJH 1TZIB 3T0ED 3VW3L 3NVQA 4FZ8L 4WU5A 1ZLSH 3TZVB 4OZIB 1WTGT 2Y07L 3W82A 1N3NB 1CXHA 1MI5B 3MLZH 3L5IA 1YNKH 1F8TH 3BGAA 3FT4A 1SHMA 4RDQG 5I9QB 3TH3T 3SDDC 2MTPA 1ED3B 3K46A 4HLZH 1FYTE 5D6CA 4S0TD 2GHWB 3MA9L 3WFEH 5IHZA 2VRAA 3FT4B 3OKMA 3C8KB 6FABH 4XNMA 4AEIL 2EC8A 3MRBA 1EHNA 1Q9LA 1NFKA 1MI5A 4YPJA 4NQVB 3TVMC 1QNZH 1R3LA 4CN6A 3ILPB 3RZCB 5DWUH 4BSJA 3SDCC 2DQJL 2R8SL 4F80A 2DM2A 1TTUA 1BGXH 3SKNA 2F53A 2MQ3A 3ARGD 4PJCA 4Z7VB 4Z7UF 2AXFB 5GISL 5DHYB 5DMIL 2GUOA 2V2TA 1ONQB 2BNQB 2MOVA 3TJHC 5SWZA 3AB0B 4OM0L 3EFFA 5D1QD 1JPSH 3RGVA 1MCQA 2HFGH 1O7VA 5FO9A 4XNYH 1IEBB 2ADFH 3I75A 3VXSE 1TZGL 2FATL 5DD6B 1FN4A 1KACB 1JPGB 2YD8A 3MA9H 3TWCL 2QSTA 3ULVF 2Y25A 1NLDL 5FYJU 1MRCH 3PUCA 1G7QA 2MJWA 1DR9A 5EBLA 5DJXA 3ECBA 4K3EH 4LHJB 4KY1H 4ELMF 5KSBF 4EN3D 3OKEA 1S3KH 4NQXA 1VKXB 4PJ7F 1NJ9B 1OGAA 1N6VA 3T2NH 5I8EA 3P2TA 1GC1L 4G8IB 1G0DA 2Z4QA 1T1ZB 2R29H 1HSAA 2VXSL 1G0YR 3NABH 4YXHH 4YR6A 43CAB 3MFFB 4L4TA 3C5SA 4E41E 4DW2H 5BS0D 2Q8BH 5HDQH 3NZ8B 3ROLB 1NGZB 4GKNB 3VRIA 5IHBA 5MEQA 1I1AC 1WZ1L 1MLBA 5AD0A 1H5BA 5TFSL 4K3DH 2A1WL 5DJDB 5E5UB 5IWLC 1HXMB 3GK8L 5CZXD 1AQDB 4OTXL 1QO3B 4LGSB 5FEBA 1KEMH 1NAKL 4EUPH 4M7JH 3GJFB 3V4PL 3GHBH 2M26A 2IBGA 1EFXD 2BNRB 3MSPA 2B2XH 4G8GB 4NZJA 5SWZD 3RKDC 3E6FA 5KS9B 1IAKA 2BOBA 5BV7H 2NLJB 1NMAL 2EIBA 1KIRB 3HNTL 3JTTB 5CJQH 5CMAA 5SWSB 4M8QB 2Q3AA 1JI1A 4HJJH 3RL2B 3IU3A 5HD8C 4JN2B 4HBQA 3ARFA 5KSAD 2W9LA 4XGZB 2ICEB 4EKXA 4FQ1L 4LBEA 4JREC 4Y4HD 4UT6L 4GXVL 2GYSA 3IFOA 1KPUB 2APBA 2GI7A 1NANH 5KTEH 2B1HL 1ZK9A 4NZTH 3MX0A 4QEGA 5MP6L 2NY2B 2AEPL 4AIZA 4P9HL 3LB6C 1K8IA 3KPMA 1IT9H 2FHFA 2NXYC 4LCCB 4WO4B 4OLYL 3P73B 5MI0C 3E6HB 3WIHA 1D3CA 5IMMA 4B0MM 1YMMB 3UZQA 4Y4HC 2YMXH 2ITDA 5ANMA 2HLAA 3MLYL 2OZ4L 4G8FB 3O41A 4AT6B 5GGUA 3HTLX 3MLXH 4P2RE 1S9XA 3O3BB 4PRPD 4PRHB 1F90L 2ITDB 3DYMA 2XPGA 3D39E 1PSKH 2F8VA 2DIJA 3UYPA 4JQIH 4I0PB 4HKZA 4JDTH 3ULSA 4X6BA 3ZHKA 5E00B 3V79C 4CN4A 2EEDA 4MNHA 1S9VA 4ZUSB 1XIWC 4JG1H 4QXGL 3Q1SH 1F4XH 1DE4B 1T83A 4JFEB 4QT5A 5DD6A 3HAEA 3WN5B 3A6BH 4O9HH 3TT1H 3C6SB 1MUJB 5C8JA 2WLYA 1P4BL 2ADGA 4MXWL 1CFQA 3W0WE 1A4JA 2A9MH 2JJWA 4X9GA 2I9TB 1P5UA 5HI4D 2FCBA 1AGBB 3UBXB 3MJ6A 4X6FB 3RA7L 2ENSA 4K7PL 4MXQD 1ZXQA 1LEKB 5BXFB 5D70L 1TETL 1I1RA 3QFJE 2XY2A 1HE7A 3LH2L 3MGAA 1CGSL 3HE6D 1FAIL 5HPMA 2X6MA 2NY3B 3ILQC 5LGKA 1I3GH 2DDQL 4LKXA 4OLZL 4QCIA 5DXWA 2FB4H 3C09C 5IEKB 5DA0B 5HHME 2HTKD 3V6OA 5GGSA 3U4EB 2ADJB 3SGJA 1FFOA 1J8HB 3V5DB 5T3XD 5E8OA 1KLGA 3KPLA 5D7LA 4WI5A 1ZT1A 2R56H 4RAHA 1ZA6A 5FUZH 5DJDA 3HC4H 1ED3A 1DSFL 2KQNA 5HD8D 1YPZB 5FB8B 4GT7A 3C60A 2NR6C 5IHZB 5J6HA 2AAVA 1VEMA 3QIBD 5DJAB 1Z3GH 3KNBA 2GJZA 3BDYL 4BSVB 3TCLB 2WWMD 2OXHA 2YUWA 1KJ3H 4LLDB 4JFYB 5JZ7D 2IQAA 1ZHBB 1MCRA 5F9AC 5ADOH 5JPNA 3PHQA 5JHLH 3PIQB 4KMTL 5F88B 4G80B 3VH8A 1ZLWH 3FB8B 1H3VA 4RMTA 3D0LA 4CDGC 1KCUL 2JJVA 3VRJB 3T0VA 1K5NB 1D9KA 1E4WL 1TJHL 3PWNA 5TF1H 1DN2A 2X1OA 3ARBA 4XVSH 4P23D 4WHTB 2GITB 1V7MH 1DEEB 2ICWJ 3PWNB 2P24B 4L9LA 4ISVA 4NQCA 5IB4A 3HN3A 3L3KB 4JFFD 5IEHA 2E9IA 1JWSB 4OBRA 1H3GA 3VXSA 3DECA 4HUUA 4Z77B 1OPGL 1QKZL 3QUKA 4I18A 2I5YH 1LE5B 3TH2T 4NC0B 4RA0C 4PGZA 3B6SA 4LARH 4HEME 1Q0XL 3IDYC 5EBMA 5B39G 5FF6B 4RMQA 3PWLB 1LD9A 3RDTB 3BEVA 3O6FB 2NMSA 4CKVX 5BRZB 4OZGB 4J12A 1PX4A 3PQYA 1MCHA 1XGRA 4OCMC 4HW6A 4A2MA 5L6YH 4D0DA 4IRSC 4X5WB 4YAQA 3ARRA 3O45A 1D5MB 1LEGB 4YO0A 3MA7A 3ZT7A 4OV5A 4RQQB 4HBCH 5CUSH 4ZFGH 4XMPL 1CIUA 1QFHA 4UTBH 4JRYB 4JO4H 3SDAB 3QXAB 3P11H 3CX2A 4LSPH 4NN7B 3N1QC 2BVQA 3O11A 2XWBB 3PP3K 2YN5A 2YZ8A 2NYYC 3KDMA 4GRMA 1XZ0A 1T20B 3ME0A 3MUHL 1EK3A 4D0CA 1C08A 2W0LA 1Q1JL 4M02A 1CFSA 1GZPB 1XEDA 5KVEH 1A8JH 4QRUA 2MCPH 1T5XA 1N64H 1ZLUH 1VEOA 2YC1A 3SGKA 2GJ6B 3I6KA 2HWZL 3T2QA 5DSCB 5D6DA 3WJJA 1UB5B 3LN5A 3OPZH 1NUDA 3BP5B 1IGML 3L1OH 4RX4D 1IAKB 1LO5B 2VABB 3NN8B 3FQNA 4ACPA 5A2IH 2K7PA 3L3JB 5E6IC 1AR1C 4KDVA 4NM4H 1T5XB 3MREB 4RX4A 4EI6A 3D85B 3MODL 1FZOB 4JDTL 5IR1A 2Y7QB 4LRIA 1ADQH 2W0FB 4M1DH 1EHLL 1MRFH 4YBQC 4HBCL 4MQ7B 5CUSL 1X6NA 2YUVA 5HHVL 4YDLB 4KQ3H 2MHAA 4ZUSA 1LWRA 3QR2A 4K71B 2ED9A 3FL7A 2SEBB 5B8CC 3UTSA 3GMQB 2V7NA 5HYJD 2HYMA 4XI5C 5FM5O 4PTUB 4K9EH 4WY7H 5D93C 2AV1A 3P30H 4RIRA 5IB1A 2HTLC 3TBVB 4HCRA 5JUEL 4XAKD 5CCKL 2BERA 4N0YL 4OF8A 1CL7I 4MQXD 2VITA 1ORSB 1LO2L 2B4CH 1RUMH 3O4LD 4Z6AT 1HQ4A 5DMIH 1H15A 1MFCL 3IDIA 3EGSB 3ULUL 4XNUH 2FEDC 1L9NA 4M3JA 1SEBA 2IPTH 2DS4A 2CR6A 1H3PL 1K4CB 5C92A 4LK4A 5HHOA 3BKCL 5BZWB 1XGTA 4Y5XC 3H6JA 5DK0A 2GJ6E 2NY2D 2X4SB 5GJSL 4KY1L 4Z7WA 5EIIB 3SE8H 1EGJL 4JLRA 3T0WA 5JW4M 4BH7A 5IBUB 1AO7D 1T5WA 1NBZA 1GIGH 4L9DA 3WIFB 3MRFA 5CS7A 1QSZA 1YYLH 3W9EB 3GMPB 5EU3A 1KFAH 4G6FB 5EBGA 1JRHH 3BIKA 4OD3L 5IVXE 4WUKH 3F7YA 2FX9L 4U1IA 2VL5B 3BD4A 4LLAA 3OR6B 3T0XA 2HKHH 1A4KB 3FN3A 1AC6A 2VKWA 1GGCH 3D3VE 3FONA 4JE4B 5IW1B 5TDOB 8CGTA 3MCG1 4S0SD 5CINL 4ZXBB 1HXMA 4YEEA 4ZODA 4XP1H 4JRXE 1NC2D 4TULH 2IADA 1LK3L 3TYGH 4E0RB 1FJ1A 5F6IC 5TQ0H 5IG7B 1DSFH 2B20A 5DS8B 2YK1L 3RWJB 1NBYB 2OP4L 3FQXA 2ED8A 1X5LA 3NA9L 4X5WA 1ZA6B 3LPWA 3LEVL 4YAQB 1CBVH 5IF0A 3FFCE 5TE4H