2ZJSL

Crystal structure of secye translocon from thermus thermophilus with a fab fragment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase SecY subunit
publication title Conformational transition of Sec machinery inferred from bacterial SecYE structures
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Protein transport/immune system
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2008-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsL01
3NCYP 2BK8A 1YNKH 1PYWB 1DUYB 1CG9A 1MVUB 3STLB 1F8TH 1BAFL 5L2KA 2EYTA 1BGXH 2DL2A 5LKNA 1F58H 3T0WA 3TBVA 3FKUS 1NLDL 3BT2L 3VDBA 5LQBL 1HOCB 1X7QA 1TZIA 2ZOLB 1D5ZB 3BKJH 1U8HA 4U49A 4FQXA 2DLTA 1JPST 3MJ8B 3BISA 1B0RB 4OLYL 3BHBB 4AK1A 3VXTA 3HFMH 3GEWB 1JGLL 2O5ZH 3EYVA 1CQYA 3MBXL 3QDMA 5DVKA 4LVOB 3QFDB 5HVFB 3NN8B 3OGCB 1DUYA 1J1OL 4CADA 4KMLB 3SJVB 3K4DA 1JHKL 1Z0NA 4RNRA 3BKCH 4OF8A 3BAEL 1P7QD 4OKDA 1D5ZA 5E08L 3QJHB 3HTLX 1CLZL 1QFUL 3BVNA 1L7TL 1MFDH 3BHBA 4UUJA 4CN4A 4MLIA 4PP1C 1BHGA 2JKXA 1OF2A 5DVNA 1U9KA 3ARUA 3SE3C 3EJZC 4NNPL 1OAZL 3C6SB 1K5NA 1V7ML 4CNIB 1R3HB 2A6DA 4JM4H 5E99L 4QRRE 1PAMA 3FO9A 5F7HA 1HI6A 5CSZA 3OGCA 4U3HA 1S7QB 1ZTXH 4I77H 3TNNA 4LCUB 3P0YH 4N68A 4EVNB 1JHTB 4M8VA 2UVEA 2Y7QA 1B4JL 5I1LB 3ESUF 2RCSL 4H25B 4FMKA 4MQXC 3FB6A 5EOTB 5DFWH 2WUBH 4LCIH 4UNTA 1Q9OB 4PJIF 2F58H 4RRPG 4HWUA 5FGCB 2FD6H 1LEIA 2IFFH 3P3YA 3CPLA 4YPJA 2VC2H 2PW1B 4Y16B 4X6EB 3SDXF 1R3HA 1AR2A 4D0BB 5B8CB 4G42B 1FFNB 3I6KA 1QFWM 1NBZB 1S7QA 1HNGA 4CJ1A 1MCJA 3MRCB 4EVNA 3TC9A 1MFNA 2OJZL 2Z31D 3MBEA 5D93B 4FABH 2HMID 1FPTL 1S7RB 4OCNC 5EOTA 4R8WL 4PJCF 5JZ7D 2Y9RT 4LGRB 3G6JF 3VFSB 4WHTB 1Q9OA 1SBSH 2DQGH 3UTSE 5JR1L 3SDYH 5M95B 2A77H 4ONHB 4OBRA 5E8NB 5IVXF 4ONGH 5C09E 4FZ8H 5GISL 4IOFC 2VKWA 2PW1A 5HHMD 1DBBH 4O2EB 1BEYL 5T3ZE 2D0HA 4G42A 3C09C 4KWUA 4PP2B 1A64A 3UTZB 2BVQB 1I85C 1MREL 3MRCA 3LAFA 4XVSH 1LK3L 1GGUA 4PLOB 3WE6B 2MMXA 1WZMA 2EDFA 4JB9H 4L3EE 4OLXL 4WTZA 3MRGB 2W38A 5DURB 1CD8A 2YA1A 3FN3A 3Q5OA 1BM3H 3SKOB 2V2WB 3V4VL 4GRWB 4ONHA 3OXRB 3LEVL 3SDDD 1DL7H 3WNOA 1RI8A 3L7FB 5E8NA 1AIFB 5SV4A 2Q87A 4G7YH 1DVFD 3V6ZB 1U8NB 4BSJA 2OZ4A 3RRQA 4MCYA 3B9VA 3RVTC 2LE9A 1S7WB 3QJFA 1J88A 1MEXH 1TCRA 4GO6B 1IC5L 3L9RB 3EDDA 2BVQA 3SE3A 2NY6D 1CFTA 3P30H 1JYXA 3CFEB 4ZD3L 2ED9A 1VACA 4UOJA 4JO4L 1DLFH 3FO1B 5B3NA 1YMME 2CKBB 4ODSL 5ITBH 4X4XA 4HW6A 4FP8L 3L3OB 3J7HA 1FFRA 4YDIH 2EE3A 5C08B 2R1WB 3EFFB 3L7FA 3L5WB 1AIFA 1EZVX 1CK0H 1HEZB 1MY7A 4P4KD 3ES6B 4QF1B 5GGVY 4PUBL 5L9DL 1FFQA 1S7WA 2DMBA 5FOJA 5GRUL 3VWKB 4S1DC 2R56L 5FM4A 4U0RC 2K1MA 5F9OL 4QRRA 1UB6B 5GSVA 3VFVB 1UM5H 4X8XA 3V6FA 4HF5L 3FO1A 5H8DA 2ZP0T 2LV4A 4L29A 2VZ1A 3FRPG 4MJ4A 3L3OA 1OTSD 1PLGH 4C59B 2N4IA 3EFFA 1VERA 1F3DJ 3GRWA 3STBA 1M7XA 1P5UA 3U9PH 2F54B 3ES6A 4OCYL 4IHOB 2GTZB 3CX5K 3T0BA 2E9JA 1CICB 4JVUA 1FAKT 2E7CA 4NRZB 4KDTC 1F3DH 1QR1B 1QVOB 2B5IC 5BJTA 2VDPL 2XRAH 4PRHB 3N1FC 4JEGB 1UB6A 2FWOB 3TYGH 4O58H 5EO0A 1UVQA 4WUUB 3Q1SL 5JOPE 1FIGH 3ULVL 4PV8A 1EBAA 3RNKB 4FQ2H 5D7JC 1I85A 4HFWA 4L3EB 2ZCKH 5DA4A 1UWEL 1JWUA 1SEBA 1MLCA 1A22B 3O6FD 4G9FB 5C09A 4YHNB 4NRZA 5GGRY 2ESVB 3W39A 1QR1A 1QVOA 1WCQA 1ADQA 3ZKMD 3ARBC 4L4JA 1DFBL 1EGJA 2FEEI 3CUPB 2EYSB 3LEYL 3MRKA 4WUUA 3O6MH 4Z95H 1T20B 3DUUB 4K3JL 1UCTA 2RFXB 5B38A 2X09A 4IIQC 1R24A 2AV1A 1XGUA 1JTOA 4DW2L 4BQ8A 4L3EA 2Q3ZA 5IJVB 1T1WB 2MQ0A 5GGVH 5D9SB 4DEPC 3C8HA 4X7SH 5F9AC 4YJZL 1G6RH 5KN5B 1QBML 4XTRD 1BPVA 4K23L 3JVGC 3MLRL 4FG6D 3KWWA 1UZ6E 4K9EC 2BJMH 1IAIH 3BQUC 4KQ4L 2FIRT 3E0GA 2ESVA 4OZFA 4RBPH 1AGCB 5C6TH 1QSFE 2E6PA 1FVDB 1NEZB 4V2CB 1KIQB 3BXNB 4S1QH 4U7KA 2YHGA 1FE8L 5DD1H 4O51B 1QTYT 3QIWB 5F70A 3VFUA 3K4ZA 2VZTA 2I27N 3NMEA 5IP4A 1J12A 5FYLD 5EN2B 3RVUC 3O4LB 3VFTB 1J1PL 5DC0A 5DJXB 3UEZA 1S7TB 3MXVH 1T1WA 2R2BA 5ABDE 2OR7A 3C2SA 4MHHG 5ICXA 3UXFA 5C0RH 3SDAD 1HHKB 1MI5B 2IGFL 3GMQB 3TO2A 1M71B 3HPJB 4WTZG 1NMCB 1F6AB 1XEDA 2CLRB 3GRWL 3TWCH 5DWUH 5SWSD 1AGCA 5ICZA 4E9LA 5FXCH 5CZVL 4LCCB 4O51A 5JW5A 3WUWB 5E95B 4KDTA 5EN2A 2AEQH 4KJPC 3UZVB 2YPVL 1E27B 4FQ1H 4WHCA 4EKXA 3L3KB 2FDBP 5C0JB 5FKAB 1FSKB 3QHFL 2OX5A 3VGAC 2JELL 4F58H 4UI2A 1AHWC 2V2XA 1HHKA 5D7JA 2PF6A 1Q94A 1F6AA 2CLRA 4FS0A 4NRXA 4Q7DA 3RUGF 1WK0A 4K8RC 4KVNH 3S4SA 4J6RL 5DSCB 3DSFH 5L6YL 3OL2A 3FO0H 2X4TA 2UVFA 4G6KH 1HXMA 2Y4SA 4YO0B 4JDVA 3WUWA 4F7MB 3P9LB 5DVLA 3T3ME 4QOKD 3PWLA 1ADQL 3BN9C 3HS0B 1T4KA 1VGKA 2GUOB 5C1MB 3ARBA 1FN4B 4XNUL 4XRCB 3WJJC 3FTGA 3U4EA 1F13A 2VN4A 4XCNB 2QKIB 2WBJC 5T3ZH 4HD9A 4NO2B 1EGJH 4XI5D 3MLUL 3SKNB 3EKCA 4X7EC 3TH2T 3WIHA 2D03L 1R3KB 5CLTA 2X4SB 4IIQA 4KH2A 3B9DA 2AABL 3QIUC 4LDLB 1N64H 1JPTH 3FAXA 4KK5C 1G7LA 4C56E 2A0LD 3TEUA 1AD0B 4YO0A 3WV0A 3AC0A 3JVGA 4F7MA 1DBJL 5ADOL 3EZJB 5KOVC 3A6BL 2AXFB 1MVFA 1KIRB 3QNXB 1IT9L 3EYUL 4FFYL 2XWTB 3RY6C 1Q8MA 4I3RH 4XRCA 3SGEI 1S78D 1F4AA 3F5WA 4GKSB 3I6GA 4XCNA 2QKIA 3DV6B 1LHZA 1E4WH 1YECH 3S97C 1WT5C 4UOW0 3LKNB 3VFGL 1KEML 1ZVYA 1NDGB 1VENA 3I6LD 4NC2B 4DZ8A 1R3KA 4JZJB 3D5OF 1YNTA 3WHXB 3VWJC 1RZ8B 1JWMA 4P3CH 3R0MA 5HPOA 3LV3B 2AK1H 2F5BL 4KXZH 4NQDD 1CFVL 2XG4A 4JFDB 1IAOB 43CAA 3BP4A 1QSFA 5I1GL 5HDOA 5CD5D 2OK0L 2AXFA 5MP6H 1T83C 5AWNL 3VDCA 1GVIA 1N7ML 2FEDD 2XWTA 4H5SA 4Y2OA 2HFGH 3MA9L 2EIZB 3T65A 3GMRB 1PG7H 5K9JL 2EKJA 1TMCB 4PREA 4MVBC 5IHUL 5I17B 4E5XB 1F45A 4OFPA 3WHXA 1ZMYA 5F96H 2HN7B 3BIBX 1NL0H 5TQ2H 4HZLB 3T0DA 3UZQA 1JV5B 3CX2A 2XKNB 4J3UA 4R2GD 4MJ6A 1F4YL 3LV3A 1DQLL 4NKIH 2R4SL 5T1LD 4JFDA 3UTTE 1FNEA 1MFBH 4OZHB 2H8PA 5ITFA 5CZXC 4WI8A 4O02L 1AHWA 4WTWA 3BDXA 1I9IH 1S9YB 3LQZB 1QBBA 1DQJB 4GRLD 4P3DB 1K85A 3UCRA 4NZJA 5I2IA 1T1XA 3T09A 2VMFA 2EIZA 3E6FB 3MODL 3FO2B 5TFSL 4TRPL 3PGFH 4GG6F 5E6ID 3VXSE 5I17A 4CW1A 4E5XA 1NGXA 4M6ML 2QSQA 3TT3H 2HN7A 5ESVA 3WJJA 4QHNB 2W9EL 2FYYB 2X89A 3QRGH 3QYCA 4HLJA 2EC9T 2P5WD 2X1QA 4TSCH 5ISZB 3LIZH 2FR4B 3ARQA 5MI0B 1P2CB 3B9KD 3QUZD 1FZMA 2OTUB 4Y4KD 4I13B 1QRKA 4LL9A 1OHQA 3LQZA 1DQJA 2J4WH 5TPWL 2EXYC 4JKWA 5C0CD 1D5IH 1AC0A 4CMHC 3E6FA 4K9EL 3P4NB 3FO2A 4FHBD 3V0AC 5IW6A 1OT2A 4FQCL 3IDMA 3HZVB 1JZ3A 4YDVB 4IRJC 3RY6A 4QHNA 4X98B 4O2FB 3RA7L 2HFTA 5J57B 3QWRD 4M5YH 2EDWA 4LKCA 1NGQH 4GS7B 4Y4FC 3TVMC 3UDWC 1F5WA 5CGYC 3VRJB 4CBPA 4ELMF 4C56A 1URLA 2OTUA 5JXAH 1F4WL 4RMQA 3BKML 3VWJA 5ID0B 4YK4B 2G60L 1IVLA 1RULH 4XMPL 1EFQA 5C8JA 1FZJA 2XZCL 4J3XA 3S4SG 3P4NA 4HBCH 3HZMB 1CD1A 4TVPD 5B3JE 1UH2A 1MCDA 5HI3D 1T83A 2W0FA 3PGCA 4WEMB 1JMXA 4QXUH 4OT1L 1NDMB 4X98A 3MRFB 3BPCB 3FHQA 1QLRB 2OL3H 3EDKA 1I9EA 1XCQB 4C58B 3NFSL 3GNML 3IRZA 1UZ8B 2FX7H 1GC1H 4OSUH 1YY9D 3MLXL 1QFWH 2CDGB 4UINL 1NCAL 1PEWA 4LQFL 2DMKA 3NBNA 1LP9B 5ID0A 4D8PB 3MCG1 5T33H 5C0BD 4KQ3L 3MJ9H 1U95A 4RA0C 5FO7B 1XCTA 2FEEL 4BSWB 1QFOA 4TSBL 4K8RL 3GJEA 4GXVH 1MIEL 1WFTA 4YE4H 2VXTH 35C8L 3PP3H 2V2TB 4XAWH 1C5CL 1NDMA 2C1OB 4WU7B 4LAJH 3VI3E 5FYJU 3ULUE 4PR5A 2JCCF 1QLRA 3SKMB 5JDSB 1A0QL 3L3DA 1UZ8A 1CZ8L 2PETA 1K4DA 2V7HA 1EFXB 5L2KD 3UTTA 1Q38A 3G5YB 2QTEA 5EZOH 4MGXA 1ZT7B 3PHSA 4MXQC 1GGBL 5FO7A 4LLMA 5EPMA 5DGRA 4EI5B 5CKAA 3CMOL 4Y4FB 4CU7A 3CJJA 1CGSL 1NCTA 2QBWA 4LDOB 4PGDB 3X3FL 4B0MM 1CDHA 2NY3C 1HDMA 4HG4K 1KB9K 5LWYL 4KPHL 3EOBA 3ULUC 3LZFH 1OWRM 2V2TA 3V5DA 1CGYA 1BQHA 3IFLL 4GT7A 3VXSA 3G08B 2YK1H 1RU9H 1WGOA 1RK0A 3RDTB 3S3JA 3MUZ1 3RVXC 1P7KB 5GGSA 3PDOA 4IRJA 1EFXA 1I1RA 1NUDA 1ZT7A 1YEKH 1A3LH 3ZTNL 1TFHA 3UDWA 3TVMA 4Y4FA 5CGMA 1MLBB 1UJ3C 1QUNA 2AJVL 1JNLH 4L3AA 1FBIH 3DTXB 7FABL 1S9VA 2BVOB 4XPTH 5D7IF 2R1YA 2YC1A 2F5AH 3HMWL 1F42A 4RDQG 5I1DB 4CN6A 4DGIL 3EJYD 3RWCB 1HCFX 1P9MC 2BVPB 3G08A 3OKKB 5LGHH 2CK0H 3MV9E 1RK1B 4OIAA 3QAZC 1KULA 5DQ9A 5C0AB 3SJVD 2NNAB 3WEXA 1A9BA 4OI7A 2HVKA 4G3YH 4J3VA 3DGGB 1OW0C 4XBEH 1H3UA 2ZUXA 1XGYL 4N8VA 2EH7H 3RQ3A 1MLBA 3LRSB 3S34L 4A6YA 2EO1A 3W11C 2OMNA 3BP5A 2A1WL 1GZPB 5ESAB 1GZQA 1IFHH 3JV4B 4NSKB 1ORSA 2QV2A 3BDYL 5I1DA 3IU4H 4JR9H 1KJ3L 3KPOB 3O2WH 2EKSB 2H1PH 2DQTH 2QQNH 3CLEH 4XVTL 1IGTB 1DBKL 1S3KH 1HN1A 4HWZA 1GSMA 1MELA 3KPRB 3VRIB 3VE0B 5IBTL 2HVJB 1OP5K 5DJZB 3FT2B 2AJ3A 5HYSB 5AAMA 2BOCB 3ZYOA 4LLYB 3GI8H 3JWNC 4WV1B 1R5VB 3VD5A 1LE9B 1SY6A 1FHGA 2CGRH 3AREC 4QRPB 3IGAB 4X9BA 2NW2B 1CGWA 3QCVL 3O3AA 5ESAA 4FQPA 4P46B 5BW7C 4NO3B 3N0PB 4ODUA 1C08B 3DMMC 2P45B 2YMXH 1IGTA 3D6GA 4DUWA 5IBUG 2VDLH 3VRIA 3ULVD 1ACYH 4GFTB 2HVJA 1JNNL 2M1KA 1WF5A 5SWQB 5BVPH 5AG9A 1YPZF 1AC6A 4WV1A 1R5VA 3MPCA 2ITCA 2IC2A 1E4XH 4ODVL 2D0GA 1BVKA 2E9IA 4FNLL 3O81A 4NZRH 1NAMB 4PJGE 2WP3O 3GM0A 5GS0H 2NW2A 4DGVH 32C2B 4M8QA 4NFCA 4P46A 2GI7A 3VXRB 4PB9L 5F3BB 4U6TA 2P24B 5DC4B 4WVRA 3X13A 1C08A 2I60L 3IDIA 5KJRL 2IF7A 1RUPH 5E2VL 3TBWB 3MRBB 1D5BA 1UJ3A 2NW3A 3A6OA 2FH6A 3QO0B 2GJJA 1MCPH 1KPVA 1M7IB 3EJZD 3GSXA 4JPWH 4JZOB 1GIGL 4YHOH 1P9MA 3X17A 3H3PH 1KNOB 5DURD 2VITB 2YD3A 5ACMA 4XNYH 5DFVC 5AYQA 3ILQD 1WIPA 5JW3L 4GKOA 2H9GA 2AK4B 4HUNB 2P24A 3DBXA 4O5LL 1RFDH 4MAYB 1DBAL 5TE6H 1C5DA 5FYKU 5E00A 4A6YL 2DWEB 5J0BA 1Q9KB 5FM5O 1P4LB 1IZJA 4UT9L 2OTWB 3T77A 3RWJB 1AR1C 4QRRD 2CLVB 4MXWL 1A14H 3MV9A 3P0VH 1AP2B 3GSOA 3U2SA 2C7UB 4JZOA 5MERB 1AGFB 1PQZB 1S7XB 3FHAA 3RKPA 5FV1L 3NA9L 2VITA 4HUXA 1FQ9C 5BZWA 2GTWA 5ADPH 3RWEB 1MY5A 5C08D 2GSGA 3VFRA 5E2UH 3VRLF 2YOCA 1SY6L 5E4IA 1LO4L 4U1MA 1CT8B 3BO8B 1QA9A 3SCMB 1P4LA 3AREA 1GCFA 4Q6IB 3BIAX 2OTWA 4D0DB 3S37L 2WIMA 3RWJA 1OTTC 1X5LA 3RBSA 4XX1E 2D7OA 5BW7A 5IBLC 4POYA 2PUQT 1KTLB 2X41A 1NCCH 3DMMA 1AP2A 2C3GA 1F3JB 1S7XA 3DRQB 2R0LH 1IGYB 1H0DB 4DK3A 5EA0H 4Z5RA 3BGAA 3RWEA 2YS4A 3TPKA 1MQKH 4MNHB 3UYOD 3ULUH 2XICA 4YDKL 3O6KH 5ACZB 5E5UB 1CDUA 4TULL 1CICD 1SYVB 2IWGA 3WFCH 2JIXB 1CU4L 3OKLA 4D0DA 4BSVA 3O2DL 2NX5B 4PJFB 2XA8H 2AI0L 4PRHD 2B8OT 1KTLA 2VL5B 4PLJC 2R1XA 3LSOA 4I18C 1SJVA 4U6XA 1I1AC 2VIRA 4OM1L 5GRJH 3FN0H 3RVTD 4OLZH 4WUUD 1MFCL 4KMQA 3DRQA 3JTTA 3H42L 1IGYA 4U2ZA 3WFZA 2VXSH 5E8DH 1H0DA 4LSPL 2C3WA 1A4JB 3RWIB 3AY4C 2ZSVA 4P9HL 4L3ED 4UOW1 5FUOL 2VERN 5GSRA 5D7KD 1GPOH 3QDJE 3IRPX 3ZE2E 5DR5L 5E70A 1NAML 5A43C 1WZ1L 1RUMH 4G9FD 2VDML 4LLDB 3EGSB 1NCWL 3MJ6A 4JFHE 1KPRA 2ESVD 5F7EH 3QHZH 4PJFA 3SKJL 1YY8B 3DETC 2VL5A 1CBVH 5GJTH 4BZ1L 5I9QB 2IH1A 1QSEB 2ZWLT 3PL6B 4YFLI 4UMGA 3G9AB 2DRUA 3EIFA 2DM3A 4EEEA 4Z0XB 2YR3A 1A4JA 3VCLB 1HHHA 4N8CL 3Q6GL 5DA0B 3CZJA 2VZVA 1MWAA 1CL7H 5IFAH 1ZHLB 4J1UB 4PJHB 4HT1L 4R7DB 1UWGH 3EGSA 1FRGH 3SQBA 3LKOA 4D9LH 4XPHL 5I30H 1JGUL 3VXUE 4NFDA 1KPUA 1YY8A 5EU7E 2XPGB 4ZO8A 4W4OC 4KJWC 4FQLL 2PO6C 1N0XL 1OP3K 4GAFB 4PTTB 1UGNA 4RFNC 4EXKA 4HXAL 1IQWH 4KKAC 3O4LD 3WSQL 3B5HA 4HUVB 1HILB 1NLDH 4XP9L 4YGVB 3BT2H 1I1AB 1ROWA 3QEGL 1FGNL 4JY5L 3RTQB 1TQCB 3B6SA 3BZ4B 2A83A 3BEWB 3K7UA 1IGCL 2A2QT 2AXJA 5EU7C 1ZK9A 1JGLH 1MI5D 4OGYL 4PJXB 1O5DT 4O4YL 2NMSA 5KVFL 5E2WH 3GI9H 5DJCB 1A47A 4P2OC 3ROOA 5DMJB 3CDCA 4JG0L 1HHIB 3RU8H 4KDWA 3CFDB 4KZEL 1JIBA 4WW2F 1NC2A 3HMXA 3R06B 3RL2B 1OAQH 1JHKH 2G9HB 2VR5A 3LMJH 2D2OA 4HUVA 2QADC 3LD8B 3B2VL 3IDNB 3ARBD 1HILA 4YGVA 2W0LA 3BAEH 3M17B 1U36A 4GUPA 4I18A 1I1AA 4P99A 5FKPB 3FZUD 4JFQB 5E08H 4IM8A 5L88L 1QFUH 5HI5D 5DVMA 4E42B 1L7TH 3BEWA 3WNNA 2EIBA 3AY4A 1WC7B 4CMMA 4GW4B 5EO9B 2AAVA 4N0YH 4LSQL 5CZKA 4HIHB 3FONA 3TV3L 2I9LA 1AGDA 3CFDA 4P2CG 1PY9A 5DJDB 4WU5A 1KTDA 2X40A 4MD0B 2R2HB 2IALB 4AMKL 5EFIB 2C26A 5D1XC 1B4JH 4OQTH 1OARH 3NOIA 3IDNA 5F88B 3PQYE 4QTIL 4PBVC 5T1DH 2CO7B 1MHCA 1OPGL 2X9YA 3NIFF 5FKPA 1TTUA 1FNHA 5DRWB 3DO3A 1NGYA 3W2DL 3GMOB 4LOUC 4E42A 5HJ3A 4JGMA 3E6HA 4KKCD 3SY0B 4DVRH 1KOAA 3QDJA 4M6OH 4OD3L 3OKOB 3G04A 1YEGH 3LQAH 4PIRF 3S36L 3B8SA 5I15L 4OAWA 1XR8B 4BH8B 4KK8C 2WWMC 5EO9A 1JK8A 2YD1A 3H7LA 3CX5J 1EO8L 1QSFD 1GYAA 5DJDA 1JYWA 4MD0A 4XPBL 4R90H 3RWDB 2P5EE 1TQBC 4HDIA 5IMKA 1S9WA 3CCHB 5D7SH 1M1SA 4G8IB 1UXWA 4P9ML 4W4OA 1CF8H 4BZ2L 3KAAA 5D6DC 5DGQA 5JR1H 3GMOA 5GGQL 4YUEL 2YEZA 3OKOA 2ZCLL 1U93B 3MLSL 3DIFB 1KC5L 2BSRB 2DJUA 3OSKA 5FA4A 4DKAA 4JFDD 1F2XK 3P77B 3VXUA 3N85L 3UPRB 3U36A 1IC4H 4XWGH 3V5KA 1MREH 4ZUVB 4XC3L 3RWDA 3QXUA 3HC0B 5D6CB 4K8RD 4K94C 4NC1E 4P2OA 5EU3B 4YX2H 1P7HL 2ZUVA 2BVTA 5C0IA 3F58L 2HKFL 1WV7T 2QSVA 1J5OL 1MCCA 3DYMA 5JUEL 4JM2B 3DECA 5IB5A 3UYRL 1FO0B 3BN9D 1BJ8A 4JKPL 4UQ3B 5D2NB 1TCMA 3JWOL 1NMAH 5HBBA 1MFAH 1T0NA 2DM7A 2NY2C 4Q9RL 4U1IA 1U93A 2X89D 3D18A 2BSRA 5GRVL 3MFGB 4NM8L 3WKMH 2PKDA 3P77A 4NC1C 5LBSH 1I3UA 2CD0A 1QBLH 4KC3B 2X4RB 3HC0A 5D6CA 4KK5D 5EU3A 4JO4H 3BWAB 3LDBC 5FCUL 2HAZA 2OR9H 2K3TA 3GBMH 4FP8H 2IANE 5EZLB 1B0GB 1J11A 5D1XA 2YN5A 2J8OA 4QXWA 1QPXA 3ZYJA 4Z76A 1CLOL 3TH4T 2APFA 2GJZB 4ENEC 2DLGA 3DI3B 5F3HA 1S7SA 5D1ZC 3L6FB 1WCBB 3GMPB 3U48A 1AXTH 5EU6E 5F9OH 4Z8FL 4PJ7E 3VWJD 4XMKL 5E03A 1J1XH 2Y23A 4H1LB 3BWAA 2DQFB 2BRRL 5IR1B 3BUTA 1T6WA 4XCCL 3GO1L 3PQYA 1XF1A 2W65B 1N5YL 3U6RA 1U3ZA 3PV6B 2DJSA 4OCWH 4L4TB 3CC5A 3S5LB 1DN2A 3HZYB 2ADJA 3VXPA 2DYPA 4YHYC 5HHPB 3SE8H 4OF3A 1ZA3B 3EDFA 3SHSA 4HJ0D 2L4OA 4OCYH 5DZLA 1C1EL 1F11B 1RIVH 2HG5B 4UIMB 5D6DA 4MVBD 3VG0H 2YD6A 12E8L 4AM0B 5T1MB 1WCBA 4TUKH 3GMPA 2VDPH 5BOPA 2IPKB 5E8EB 5DMYA 1XZ0B 2PTUA 1EIBA 3PWVB 2H41A 3GSRA 1HCVA 3REVA 4ZS7L 1MAML 5FDWB 3IAGC 2GSIA 4XHJD 2P5EA 5DJAB 3X3GL 1ZA6A 4PRNB 5CZXD 4WI5A 2W65A 3PV6A 3S5LA 3QZWB 3NCYS 5HSFA 2JTDA 5IM7A 1WWAX 1RZ7L 4BQCA 2AQ1A 1ZA3A 3ULSA 4R97C 1NPUA 4PJDF 4HV8B 2ZUTA 1HKLH 4UIMA 5DHXB 5T1MA 3CFJB 4WW1B 5HDQL 2BHYA 3UTTD 1C12A 5EBLB 3HUJF 5AYUH 4RFEB 3V9FA 1G9NC 1D5MB 2WINB 3WNLA 3HA0A 1TITA 4JREB 2J1KA 1T1YA 1BREA 5JHDE 5DJAA 4MDIB 5DHVA 3S7GA 3EO0B 4K3JH 4Z7NF 4WO4B 2DQJH 4EDXA 2JJVA 3BH8B 3EYOB 2XWBB 4WRLA 4GW1B 4U2YA 4YAQB 3SQOH 2EXYD 2IANB 3TBYA 1UYWL 1QBMH 5JA8B 3TNMB 3VXSD 4P2QB 2W9LA 3T0XA 5HY9B 1I4FA 4PJ5B 2GEEA 1FO0L 3MLRH 4GRWH 1U0QA 4KQ4H 3L95B 4PJAE 3HAEH 4JGJA 3LQMA 4R4NC 3CFJA 4YHYB 4IRJD 5J6HA 2BFVH 4QT5A 1EFXD 1D6EA 5CD3B 3AU1B 3U46A 1FE8H 3O9WB 1D5MA 3MOAH 4MX7B 3UO1L 5EU6B 3P4MB 5T3XE 4EI5D 5E7BA 4Z7WE 4Y4FD 1RUQL 1FYHB 4CVXB 4OF5A 1J1PH 4JFPA 4PLKC 4S11A 1Y18B 1T03L 3BH8A 3NPSB 3C5ZB 2X44D 3RPIB 2IANA 5TDOA 3IDGB 4NN5C 5F93C 2CKBH 4LCYB 5GGTA 4NCC1 3TNMA 4LU5L 5GIRB 5HY9A 2UWEF 5EC2A 5K9QG 4L9LC 3RDTD 4GXUN 4R4FH 1T7YA 1R3JB 4HULB 3L1OH 5CBEA 1O0VA 2H2SC 3MV7E 4P5TB 2E7BA 1U2CA 5EU6A 1B2WH 4ZTPL 5JIIA 3P4MA 2CJUL 5DJ0A 3WHE0 4CVXA 4QRUB 1YEIL 2BHUA 4K2UL 4MMZC 1ZGLP 2PTVA 4OCRH 4G6FB 2W91A 4PV9A 4XPFL 4R7NA 5D5ME 3PHOB 4TTGA 4AG4L 2H2PD 1A7PH 4DKDC 2ITDA 3LOWA 3HC4L 4HQQL 1W0YT 4RIRA 1FNSL 3HAEG 4OZIE 3CAFA 3OZ9L 1V8HA 5L6YH 3L3IA 1G7MB 3BUYA 4K94H 4P2RE 3BGMA 4L5FL 4HJGB 3AS0A 2R0WH 2VXUH 5F7MC 2DOCA 3HNVH 2GFBA 4Z0BH 1D3CA 3S36X 2OJEA 3V2AR 3WJLC 4QRUA 1NANH 4XNUH 3CU1A 4LEXL 4UU9B 1F97A 4RISL 4F57L 4LP5A 3VJ6B 3WS3B 4MXQD 1G0DA 3M8OL 3PHOA 4K07A 3MFFA 5C86A 5I75B 5KSUA 1CDBA 1JF1A 1U8LB 3KPRD 1E4KC 2NY0C 5INCB 4ZG1A 1ZVSA 2NY3D 3UX9B 2AABH 3AXLA 4FZEL 3QDHA 1T7VA 5SWZE 3QXAA 2KDGA 1EEZB 4HKZB 1LO5B 5JPMB 2DL9A 1DBJH 4UV4L 4HJGA 5ADOH 1GGYA 4LSSL 4C4KO 4GG8B 3ZZ1A 1KLFA 3MREB 1AXSB 1NSNL 3RVXD 4MD5B 4QRPD 4WHYH 4FFYH 4I0PC 3T2QA 2AJUL 5JHDA 2YD4A 4K3GA 1OAKH 3C2AL 4P46D 1MCBA 3VJ6A 3FQWB 1UT9A 5I0DA 4XVUD 2DN7A 4RMRA 5J89A 3VFGH 2W60B 4F8TA 5CAYB 1WEJH 3G6DH 2AGJH 3BP7A 1FL3B 4PJBF 3R1GH 5KZCB 1ZHBA 3NFNB 5AUMB 1LO5A 1CFVH 1YJDC 4PJAA 3I9GH 4S10A 4EXPX 5JPMA 1EVUA 3FRUB 2P44B 1L6XA 4WIQA 5I1EH 3MV7B 4L9LA 1N7MH 4MD5A 2BNRE 4JFEB 3MRPA 3X11B 1CS6A 3MA9H 1VCAA 3VXRD 3FQWA 3FQUB 1HWGB 2J12B 1E6OL 5K9JH 1G84A 1A6TB 5HI4D 1ZLVK 1FL6A 4U1KB 5MENE 4Z7VB 4XP1L 5D5MB 1FL3A 3MROA 1JCKA 1HXYA 4YZFE 1S8DB 1DQLH 3MV9D 2VLMD 2QQLL 4KTEL 4MQTB 1MJ7H 1T66C 3DX8A 3MA7B 1ZT4A 2NY0B 4YBQC 3MV7A 3NCEB 1R5IB 2HYMA 4LARH 1QQDA 4LKXB 4IRZH 1JP5A 4WHYG 3X11A 3OHXB 1V5JA 3KHQA 4WFHE 1FFOA 2AK4D 3F7QA 1ZT1B 3FQUA 2FSEA 4WFEE 4MAYD 5TFSH 2NZ9C 3C5SB 3PHQB 1A6TA 4HJJL 3U0WL 3ARED 3WJLA 1VDGA 4M6MH 4WCYL 2AEPL 1KB9J 5TDNA 4HG4J 5D5MA 3L3GA 1T7ZA 3CSBA 3ROLA 1WBZB 1GGTA 3NCJL 3DMMD 3DX7A 1IEBB 3OMZA 4TN9A 3BX7C 2Z93B 1J8HE 4OZIA 3OG4B 3MA7A 5CP7A 1U8KB 1I3RB 2A6KB 2EDLA 4YXKH 1NEZG 2CIKB 4PGCB 2E9BA 3K0WA 4P2RA 4BUHA 3OHXA 1I9RL 5CJQL 5FCSH 3DARA 1Q0YH 1FLRL 2MHAA 4JN1L 4JG1H 1ZOXA 4Q97A 5I1IH 4Z7UB 4YQXL 4M48L 1A4KA 1FZKB 3FT4B 4I0PA 4M00A 2ZKHL 5DJ2B 1EDQA 1IEBA 1AGBB 3DURA 1HZHL 3MRHB 5SWZA 4DJMA 4QRSA 1CWVA 2ZNWA 1I3RA 3BKMH 1T2QL 4OM0H 2CIKA 4NNXB 4FXGB 3RNQA 3H9SB 3NCBB 1WISA 3ZE1F 5IJKC 2ZPKH 4XMPH 1NC4A 4JHAL 3RFZC 4OD2A 4LHUG 4MA8L 4N0RA 4HX1B 4Z7UA 3QO1B 4OI9A 5AZ2L 1I1YB 3X14B 1FZKA 3FT4A 4OT1H 1BP3B 4WUKH 5DJ2A 3O8XB 3QXDA 4HWBA 5E8PB 1RHHB 4LBEB 4ZAKB 1N0LA 1N6UA 5CUSL 3EYFB 4JPIB 3GNMH 2VDOL 5JQ6L 4XP6H 1Q1JH 4KJQD 2D3VA 5DD6B 2QSTA 4X80L 3F7VB 4UINH 1BMGA 3RWFA 3ZKND 1NCAH 2AEWA 4LQFH 5I8CB 4KQ3H 4WFGE 4Y89A 4DTGL 3MLVL 1CXFA 3SOBH 2BNUA 3OKYA 5B39B 2BNRA 2VLKB 1F4HA 2CDEB 1OP5H 3B8YA 4FFZL 3VFOB 5D71H 1MIEH 4XVJL 1VADB 2YA2A 1VFOA 1I1YA 3JSSA 3WFHA 3DLQR 1IBGL 2Q8AL 1EUTA 5MENA 4JRYB 3O8XA 3BRGC 1AQDB 1I7TB 2YUZA 1A0QH 1RHFA 4NN6B 3FQRA 3EYFA 3AM8C 4ZOAA 4BFBD 3ARGB 3H6JA 2GK0B 2VLRE 1QSED 2AXHA 3EO9H 3R8BB 4M43L 4OB5H 3ULVF 1IGJB 4M7KH 5J12C 2AV7B 3EW3B 5IBLD 2I07A 1ZSDB 3GIVB 1GGBH 4OZGB 4OLWL 3CMOH 3NH7L 4MQ7B 1CGSH 3MC0A 3X3FH 2CDEA 4CDGC 4DZBB 4KPHH 1GOFA 1OP9A 2VE6B 1ODAA 2HFFB 2Y5EA 5K59E 1BZQK 3UZEA 3CFKB 2ATKB 4TSAH 3LN5A 3NFPB 4P57B 4JQXC 1T22B 4F9PC 1D9KB 1ND0B 3BIKA 3QNZB 3HB3C 3SGDI 4LIQL 3OR6B 3RX8A 3OJ2C 1XH3A 4O2CB 2WWKO 2GK0A 3JWDL 5HVWA 2R0KH 1KT2A 3ARDB 1IGJA 1TENA 2ARWA 3EOTH 1PSKH 2AV7A 2HLFD 1G7PB 4MXVE 4YHML 4ZDHB 3GIVA 4PLJD 4JQIL 5HHVL 4L8CB 3F7PC 1I1AD 3ZTNH 4KTDL 1MCWW 4MQ7A 3RTQD 2AJVH 4ORGB 2Q76B 1A7NH 5DZNA 2VDRH 5C6PB 1GOHA 2YBRB 3BZEB 1FZOA 1IGIH 5DK3A 1YJDL 4GRWF 3HMWH 1KCRL 5IJKA 4ODXB 4DGIH 4B53A 3DVIA 5ELIA 1T22A 4LVNB 4DGYL 3QNZA 3PE9A 1HYSD 4MLSA 3K3QA 3ZYIA 3IFOA 3NGBB 2GAZB 4HWBL 1MIML 1G7PA 3QUXC 4BFEA 3DETD 1RJZB 4N5ED 2P8MA 1D7FA 2CK2A 5J8OA 2VZSA 3TIDB 2EDRA 1NFIB 2Q76A 4NBYB 1U3JA 3QDJD 3BZEA 1U8MB 3HG1B 4ODXA 4EDWL 3F12A 3CK0L 4JFHD 1ED3A 1ETZA 3UC0L 3MRQB 4MWFA 4J4PC 2MKWA 5EZIH 5DJ6B 3KJ6H 3CVHB 5GGUA 5IF0A 3MOBL 2VLRB 4K71C 1UEMA 3NA4A 1RJZA 2A38A 3AM8A 3LHPH 1JZ4A 3FL7A 4LASL 5BV7C 5EBMB 3TIDA 4JPVL 4NO5B 2VR4A 4AH2B 3O4OB 1QLEL 3QG7L 1FDLH 4NKQB 1KN2L 1SVCP 2R4RH 1U8MA 4F9LA 5IVZA 3GSNB 2ZNXA 3CZFB 2EH8L 2YPKB 1PDKA 2HJLB 1ZGLB 4HFUL 2X4PB 3D2UA 3MX0A 4FFVC 2YKLH 4D3CH 3S3SA 1W0WA 4YH6A 5CWSB 3HE6B 4M1GL 4YPGB 1XF2A 3QDAA 4GW5B 4N0CC 3ELAT 5CHNB 3OKDB 4QHLA 4JQXA 2LABA 2VLRA 3QCUL 4P2OD 4F9PA 4BA8A 1BIIB 4XNZB 3SPVB 5FM5M 4FNLH 3UTPD 3TZVB 5TGBA 3C5JA 1SBBA 1UM4H 1XF5B 2B2XL 5CSGA 4ZXBC 1OAYL 2NPLX 3IFNH 4GAGL 4JRXB 3VFMB 4OGAD 5BMFL 3GZKA 4PB9H 1XGPB 4ONFH 4ZNCD 3ZDZE 3CZFA 5KJRH 4WWKB 2HJLA 1ZGLA 5E2VH 2X4PA 2H3NA 1CXHA 3S35H 1CDGA 4Y5VB 5I18H 4NGHL 4X6CE 3BPLB 3HE6A 4YPGA 3F7YA 1RVFL 2WUCL 3PF2A 4GW5A 1I8MA 4OCXL 3OKDA 4ETQB 2FO4B 3ZT5A 1SEQH 1IJ9A 3MRMA 1CYGA 2ADGB 4YXLL 4BH7A 3TZVA 5BS0E 5IMMA 4JM2D 2B4CC 1NCBL 3ZL4H 4IS6B 2IPTL 1CDIA 1G7HB 3VFMA 2BOBB 3VFWB 5F7FA 3QUXA 1CD0A 1A21A 4JDZB 3U30B 5HDBF 4KVCH 4MJIE 2WMPA 3PNWB 4LOUD 4XCFL 4Y5VA 1LD9A 4KKNA 4ODWB 4U0QB 5JTWA 5IB4B 4MXWH 5CKGA 3VH8A 3WHE1 3LS5L 2WWMD 2HT2D 1IZKA 4PLNC 1RIHL 4WY7L 5DFTA 3C60B 3NA9H 5T1KA 4J4PA 1EEYA 4AEFA 1NBYA 3PQYD 4L8BA 3GB7A 5EOCJ 2FLBT 4QHKI 3OJMB 4ZSOE 4F7CA 1OQOA 1VPOL 1N6VA 2R29L 3B2UC 5FYJE 2NY4C 1G7HA 2C3HA 4D94A 4NHCL 3MRNB 1OP3H 4HMDA 3LEXA 1LO4H 3TIEB 1S5IL 5EOCH 1YN6B 3LCYA 3OKNB 3PWPE 3U4AA 1AQKH 2DM4A 1DN0A 5EIIB 5FB8B 4KY1L 2R0ZH 2P5ED 3C60A 3MNWB 3MRDB 1L7IH 5I8OH 3CVHL 5GZNC 2XZAH 4L4TD 4YDKH 3KJ4C 3QA3B 2X1XR 2EDYA 2C9AA 4TULH 1W72A 4Q6YA 4ZXBA 5DDHA 3I75A 3O2DH 1VA9A 2NY2D 2P4AB 1OD7A 4LLVB 3QUMB 1TJIL 2DF3A 1Q9WA 4RAHA 5IESL 5CGTA 2DQDH 1K4CA 5GS1C 3HPLA 4OM1H 5EIIA 4FFWC 3QWOA 1DSFL 5E0QA 2DDQL 4XNQB 8FABB 1JZ5A 3MNWA 4FTVE 2J3SA 3CH1B 4NKDA 2XG5A 2OCFD 4R26L 4DVBA 1YQVL 4MB5A 1X6NA 3CFBA 4PJIE 5CIPB 5FHBL 1JF6A 1INQB 1TPXB 2HTKD 4QXGH 1NAMH 3RL1A 2VDMH 4LSUL 1A7OL 1H8SA 3HC3L 4F15C 1NCWH 5IW1B 3B9EA 3SDXE 3S98A 5IQ7H 3W9EB 4LLVA 1YEDB 5KSBB 4KGLA 2YD7A 4MJIB 2H6PA 3GDBA 2C4XA 1A6AB 4JGUA 4PS4H 1LEKB 4X6CA 4OKVB 4GLRI 2YD2A 3WD5L 4XNQA 8FABA 4S1RH 3CH1A 3C87A 2BNQE 4OTXH 4PJCE 4P3WA 2XTJB 3CXDH 2YPLE 3M1BB 5CBAA 1GOGA 3QFJE 5BS0A 3MRJB 5FUZL 2IAND 4NBXB 3MRRB 4RAUA 5IVXE 3QEQB 3D0LA 3R8QA 2Z4QB 4HT1H 2X9WA 2NY5C 1JZ8A 2FIKA 4NOFA 5E94B 3WNKA 3RZCB 1JGUH 1R0AL 2BY0A 3QUYB 2Q7YB 3ZYZA 1CVSC 4N0UB 5GQBA 3KJ4B 4MJIA 3NCMA 4MNQE 1FH5L 1A1NA 3UTQB 3WLBB 3RKDC 3O9WD 4M1DL 2H32A 1QBAA 4OKVA 2ARJB 1F6FB 3B43A 5EU6D 2ICWI 5AD0B 4HXAH 1QNZH 4NRYB 1NAKL 1AI1L 5KVDL 5BV7H 4ZUUB 2BERA 3M1BA 3X12B 3ZE0F 2C4FU 5D96C 2APBA 1FGNH 3KPMA 4WI7A 4JY5H 5C7XL 4ZSOA 1N4XL 2B1HH 3Q48A 4M7ZC 3OAZH 1IGCH 4NZUL 3K8KA 4J7RA 4XPAH 4OGYH 1GGCL 3RZCA 4O4YH 2WV3A 5B21A 1JRHI 3OR7B 1IKFL 4N0UA 3PWPA 3LPWA 4KROC 4UTBL 4P5TD 3RGHA 3WLBA 4KZEH 1FAIH 1U3HC 5KAQG 2XKSA 3CGTA 3OAUH 4QRQB 2I5YL 4LNRA 2GJ6B 5D72L 4NRYA 2JJWA 4OZHF 4P4KB 3B2VH 4KRPC 4M9OA 5CJ5A 4ZUUA 3IDYC 3ET9F 4OD1H 3HI6H 3BGFB 3T0EE 3IFPB 5GS1A 4FTVB 4G6FD 4HC1L 4LSVH 4EUPA 1BJ1J 3CU7A 3TJEH 4N1EA 4LCWB 2WM0A 3QEHB 2YUXA 2XA3A 5KVMC 5DYOB 4RGMC 1XAUA 1BJ1H 4IRSB 5F71A 3PWNB 1I9JL 4N8PA 2BRQA 5KS9B 3ALPA 2EIDA 3TV3H 4L8DA 3TPUA 1LQSR 4ZFOA 4J3WA 2B4CL 5CP3A 4OJFH 3UBXG 2F8XC 3CSGA 4MA3B 3T0EC 2GCYB 1K8DB 1HQRB 3HZKA 4WNQA 1BLNB 2YD8A 4R4ND 4FQIL 1FJ1A 4I4WB 5FYKE 1NJ9B 1OPGH 5EORH 4FTVA 1KYOK 3AUVA 5I71B 3ZMRA 3BPNC 1WTLA 4PJIA 3QFJB 4R3SA 3MJ7B 4G6AD 3U83A 4U7SA 5E9DB 3T4YB 5DYOA 1IEHA 4PLKD 1XIWB 2XKUA 5D96B 3O2VH 2BSSB 3SDXA 3IAQA 5TH2B 1NUFA 3QIBC 5CJOH 4X99B 4XPBH 4H8WL 2GCYA 4WFFD 1IE5A 3N1MC 5CINL 3LKPA 3UAJC 4HS3B 4YXHL 4YHLH 3O6FB 4BFGA 1FV1A 1RPQA 2H2SD 4P9MH 4XPGH 4ISVA 4AEIL 3V5HB 2BNQA 2V6HA 2CXKA 4PJCA 4P59H 3UJJH 3WO4B 2YPLA 1J86A 5GGQH 2IADA 4YUEH 3QFJA 5D70L 3MJ7A 4UBDC 2X9XA 4OUUB 5IVXA 3ZT6A 3KG5A 2FJHA 1N59B 2X6MA 2X4OB 5KZCD 1NMBL 2PCPA 4CKVX 1G9MH 2FX9L 1Q9LB 3H0TB 1K8IB 4MNQA 3NTCH 3MV7D 5FYJH 3TO4C 3BW9B 2Y36L 2BY3A 2B1AL 3F58H 1LP9F 5SX5H 3NAAH 1U3HA 4FQQA 3V5HA 4U6YB 4KHTL 3GM8A 3FQNB 4U6VL 4WI9A 4JKPH 4MD4B 1U6AH 2ORBH 3JWOH 4N90E 3KPSE 3BE1H 4Q9RH 1CGUA 3DNKA 4F7PB 3PXHA 3BD5A 1QLFB 2A74B 1N59A 3K1DA 1OM3L 4KRLB 4NM8H 5L0QB 1IQDA 3HNTH 3BPNB 2NY0D 2ICCA 2NXZC 5HYQB 2Z9TA 3ILPA 2APWA 3QNYB 3D0VB 3G5XB 5DMKB 1YNLH 2ICWB 43C9B 2XNAA 2OP4L 5FCUH 2VXQL 4QLRA 4PRBB 1DQDL 2X7LA 1WZKA 2AQ2A 2PR4H 5IB2B 1JPSL 1CLYL 3FQNA 3CDYA 3T0EA 2EC9U 4MD4A 4X7TA 3GMNA 4OLUH 1KFAL 1U91A 4F7PA 1VFBB 2A74A 2DJ4A 3MV8E 1OTUC 1CLOH 1DBML 5EUKA 3A6CL 4X9IA 4LPXA 4G9DA 1G6VK 3ZKSD 4Z8FH 1BFOB 4XMKH 3MLTB 1YUHB 4OIIH 4RQQB 4JO1L 4G5ZH 5DMKA 1HIML 4GKZB 1DQQB 2APTA 5ALCH 3OPZL 4XCCH 2EDTA 3GO1H 1N5YH 3QIBA 2E27L 2NXYB 3VGEA 1EMTL 4JFFE 3WL9A 3PV7A 1ZS8B 2NY5H 4KJYA 4NWUL 3LKQA 1OAUL 2P48B 2Z35B 3TGXA 4ZMAT 4MSWA 3RX7A 1T1ZA 2M8XA 1MHPH 5IT2L 3SGJC 4LAQL 1A7QL 3WFBL 1EEUA 2CUHA 1RJYB 3RUGE 4JO2H 1JI1A 4DKFL 1A3RL 3HHRB 1FFPA 5ERWA 3IJHA 1ZHNA 4ZS6D 1HSBB 1V7NL 3VMPA 1YUHA 2D7TH 3QQ9D 1HH6A 4GKZA 5F7LB 5I73B 1HINL 2BNRD 1T66D 5IIEA 3GKWL 4LNVA 4C83A 4W70A 3U9UB 1KJVB 1RZKH 3D69A 4YBQD 5DLMH 4HH8A 5LXGL 1BQUA 1P84J 1ZS8A 3TO4A 1RZ7H 5AAWA 1IC1A 4UAOB 3VXNB 4RGNE 1HHJB 4LDEB 1YYML 1RAMA 1KENL 1TNNA 5MEND 3O8XD 4HXBH 4ZAKD 2R39A 2HH0H 3V6BR 3MMEB 4OCSL 3BP6B 4QHUA 4JN2B 4X4YB 5IK3B 4NM4H 3HI1B 5C07B 4W6WB 4ZODA 1VGEL 3RGVB 1XR9B 1M6OA 3TN0C 3SE9L 1S7VA 1UQSA 1NH6A 3TF7C 4JKKA 5IMLB 5FGSA 5CEXA 4NT6B 4ALAL 3L7EB 4RGNC 4WFHD 1KJVA 1VFAA 4D2NA 5HGAB 4NQDB 3N9GH 5CS7A 3HRZA 4WFED 1CFQB 1UYWH 5DUPL 1BX2A 4NN7B 3KPSA 4MNGE 3I84A 5I1JL 2FHBA 3MMEA 3BZFB 1V3JA 4JN2A 5IK3A 3I50H 3ARGD 4POZD 5FOBA 3KXFE 1JN6B 3BKYH 3RY4A 3DO7A 4WTXA 2G5BB 4NQVA 5C07A 5J6GB 4BQBA 1IAIM 1I8IB 3UO1H 1KJ2A 5IMLA 4Y8DC 1MCIA 1MCFA 4HBQA 1ONQB 3NZ8B 4GBXC 5IV2A 4R2GB 2C1PB 1CXKA 3SDCB 4HIXH 3D25A 1WWBX 1BVLA 4UB0L 3IJSA 5A3IC 4DN4L 2O93L 5TE4H 4S1SL 1A1OA 1UA6H 3RIFK 1D9KD 4AENA 2RJMA 3BZFA 1CXLA 1I1CA 5KAQF 1WAAF 3O3BB 1QOKA 3KPTA 5FYKH 5J6GA 3TBTA 2QQQA 1S7UB 3AMKA 3ARDD 3SGJA 2F8OA 5K9KA 2EE6A 4N9GA 4WJ5A 1ZLVH 3DRTA 5E6IB 1JRHL 2DBLL 4U1LB 2CJUH 1Z6JT 5DQDL 1YEIH 5EB9A 4DOHB 1H3TA 3NACH 1MFEH 2C1PA 3O3EB 4K3DL 1NFKA 3SDCA 4F3FA 1J05B 4GG6E 1SJHA 4H1LH 4KK6C 4AEHH 4XPFH 2PYEE 4IDJL 4S0TD 2F15A 4AG4H 3LS4H 4JFFA 3U7YH 5I66A 4YFDB 3DVFA 4I48B 4JVWA 5IW3A 2QQKL 1Y6MR 4NWTH 5I1KL 1T2XA 3DUHA 4OGXL 4KAQL 3KNBA 3O3BA 5F6HI 3G5ZB 3RUGA 3K4AA 1HNFA 3MNVB 5C3TA 3JUYA 4L5FH 15C8H 1XMWA 3EOAB 2DQEH 2DQHL 4WFGD 1BZ7B 2D0FA 5J3HC 1F4XH 4Z9KB 3O3EA 4MA7L 4JFXA 1J05A 2NTFA 3S3PA 3SE4C 4RRPA 3TN0A 3D39E 4TYUA 4GRMA 4LRNL 2H26A 1N2RB 1DE4B 2RB8A 1LO3H 4PJ9C 5DMIH 3VMNA 3PXJA 5AEAA 4MNGB 3G5ZA 4F37K 1MF2H 4ELME 1JPGB 2VLRD 3KXFB 2W9DH 4UV4H 1WBXB 3HB3D 3QISA 1H3XA 3EOAA 3FOMB 3A67L 2Y07L 4PTUA 2EE9A 4WDIB 2A9ML 2W92A 4ZPVB 5GS2D 2X4NA 4N9OB 5FHAH 1MJ8L 2DQIL 2NQCA 1UADC 4MHHI 4ZUWB 4FQHB 2O5XH 1H8NA 1DE4A 2ED7A 5LVEA 2OQJB 2CMRH 2FJGB 2HRPL 4M9PA 4GBXA 5MEOB 3B3IB 5EO1B 3D3VE 2GITA 3HE6D 3OKEA 4MNGA 4QRTB 5KVEL 1H3PL 4MJ5A 1I1FA 1T3FB 4PJFF 3T4AA 3TA3C 3KXFA 3B5TA 4NUGL 1WBXA 4YIQB 3H9HA 4G8EA 1VEMA 3FOMA 2UYLA 4M7LT 4ZTOH 3TZVD 2EXWC 5F9JB 1ZEAH 4WDIA 4MAUH 5DK2B 3NCFB 1UB5B 2J8UE 2FATH 2OLDA 2QR0B 4ZOBA 5KOMC 2G75B 3QUXD 1E6OH 4CJ0A 3B5GA 3PABB 2UY7A 4FQHA 1EPFA 3OKMB 4WWKD 4Y2DC 1PW3A 1IAII 4U1NA 2OQJA 1EAPA 2FJGA 3K46A 2EYTB 2V5MA 3LH2L 3QZWG 2JCCE 3TBVB 4XP1H 2VDKH 2ADFH 3IU3B 3UPAA 4M7JL 5IROC 4QWWC 1X7QB 5SV3A 1TZIB 3JV6A 3S88H 1OLLA 4E0RB 4P4RA 3T04D 4CAGA 1U8HB 4HCRH 4FQXB 1FCCA 4YDJA 2QQLH 3QDGE 4NBZB 3VXTB 4L1DA 5T1KD 4J4PD 5BRZE 1CDYA 5DD0H 1YNKL 4TNWK 2VDQL 3QDMB 4APQC 4AT6A 1UB5A 3AFLA 3K2UH 3W0WE 1JMZA 5ID1A 3PABA 4LGSB 4PGZA 4CADB 4HS8L 3OKMA 3ZO0A 5IVNA 4XBPB 3MCKA 4W68A 4GG6A 1KBGH 4X9HA 3BKJL 4RNRB 4I2XE 5I74B 2CO6B 4PJHF 2AEPH 2PYEA 5BQ7B 1OGAE 3IU3A 5MHSE 1CE6A 5MEQB 3HFML 4KUZH 3SE4A 4QKXB 4LEOB 4E0RA 2O5ZL 4BKLB 1LO2L 3BVNB 2MPAH 1IGMH 4U1SA 4UUJB 4YBHA 1OF2B 3C60D 4L4VE 5IEHA 1G7QA 4PJ9A 3QUKA 1K5NB 4ZFFA 4N0CD 4KZDH 1I9RH 1AO7E 2A6DB 3FRPA 4GSDH 4K7PY 3FO9B 1YEHH 1HI6B 1M4KA 5CSZB 3TJHC 3BKCL 4LFHG 5D7IE 3TNNB 5KSAC 1U8IB 4XBPA 4M48H 5JQHC 3CMGA 1ULVA 1FORH 3HCVA 2Y7QB 4TTDC 4ZXBD 5BQ7A 5JNYA 2ZKHH 5MEQA 4PJXF 3FB6B 4LEOA 2Q1EA 4X5XB 4BKLA 5A2KH 3DROA 4Y2DB 1BD2E 1BWMA 1T5XB 4JM4L 2CSPA 3KPNB 4ELMA 1O7SA 1LEIB 1T2QH 3TFKC 3INUH 3CPLB 3BEVA 1ZTXL 4I77L 3MSPA 4TVPL 3FFCE 4N0FA 1HHGA 2WP3T 4YHKL 2F74B 3MQIA 3I6KB 3TA3A 1BBDH 2J8UB 2CKNA 3LVEA 4EZMA 1U8IA 4Y8AA 5AZ2H 3JUZA 1OSPH 1YC8A 2FGWL 2WUBL 4LCIL 4YWGL 1SHMA 4DWHA 1ORQB 3MBEB 3GSVA 1HH9A 2W1NA 1E4JA 2EC8A 2V9QA 5CUSH 3MO1A 2IFFL 4X5XA 1G7IA 1N26A 2VC2L 4RMUA 4Y2DA 1T5XA 1WFUA 4X80H 1WTGT 3KPNA 4F2MA 3QP3A 2QEJA 5IROA 5DD5L 3O41B 1MQ8A 2F74A 5BS0D 4YBLC 4HK0B 1RD6A 2J8UA 4I1NB 3VD7A 4FABL 4FFZH 3RJDA 3QI9C 3L5IA 1ORQA 1IBGH 1T5WA 4NCC2 2Q8AH 1MPAH 2NY4D 4LLUA 4KXZI 1LO0L 4MJID 4ONGL 5GJSH 2QLVB 3P9MB 2JCCA 1OGAB 4FXLA 2BSTA 1IILE 1DBBL 3WIFB 1YPZE 3VI4F 3MLWH 2V9RA 4MDJB 4MCYB 4K7PH 2XTJD 1C16B 3O41A 2KH2B 4D9RE 5BRZA 1BF8A 2IPUG 3QJFB 5DO2D 4XVSL 3ZT7A 4HK0A 2NY1C 3QEQD 5FDYA 2DKSA 1TCRB 1I3GH 1KCSH 1YEEH 4JB9L 3NIDF 4PJ8C 3W0WA 3VXOB 3W5NA 1BM3L 1CFTB 3QQNA 3RZCD 1VACB 3DVGB 3QUYD 4X0KB 5DT1H 2BCKA 1KG0A 1QFPA 1X5JA 5IUSA 3NABL 1LK2A 3QHTC 3P9MA 4X4XB 5KBNC 3TLRA 1OGAA 3EHBC 1P1ZA 5KSAA 1YN7A 4RWYH 3P73B 3WIFA 4DFIA 3JWDH 4M6NH 4OZ4A 1VEOA 5CEZL 1GAFL 4MDJA 4KRMB 1MEXL 4U4BA 1C16A 4L4VA 5HHOE 2NR6C 4L3CB 4HUKB 3VFPA 1ZWIA 1CXEA 4FFWD 4LHJB 5C71A 3P30L 4YFLF 4P23C 2J8HA 1AO7A 5B4MD 3LKSA 4Y19E 1TJGH 4QRRB 1G6RA 3VXOA 5ITBL 4JM2F 2YD9A 1R5WB 5KSVA 5D7IA 5EU4A 5GSVB 3KPPA 3DVGA 4X0KA 3V6FB 1U8QA 3QXWA 4Y5XC 3FOLA 4LVHC 2DQCH 2VH5L 4L29B 4G8FB 4NJAL 3P73A 2GJ6D 5JLZB 1PKQE 2DLIA 1KLGB 1FNAA 4Q2ZB 1S5HA 2BMKA 4HH9A 1MIMH 4EOWH 3K2MC 4FTVD 4L3CA 1IEAA 1U8OA 3KYAA 4TUJA 5IHBA 1F02I 4UV7H 4LCWD 2GT9A 5BJTB 2B39A 3VRLE 3FFCA 4ZFZA 3SBWC 2DKMA 2IFGA 2IQ9H 4I0CC 4H0HB 5I1CL 4CDHA 1X4YA 1R5WA 1R3LA 5GGRB 3WXVL 5EO0B 1UVQB 5DK0A 4EDWH 4IRSD 3PP4L 1NBQA 4PV8B 3C09B 5J11C 2NY1B 2XN9E 2EZ0C 2ARJQ 3U9PL 5FGBC 4G8FA 4HFWB 3QI9A 3EJJX 1MH5B 5EWIL 5JLZA 1KLGA 4DAGH 4UNUA 5F21B 4Q2ZA 2R8SL 1JWUB 1SEBB 3UTSB 1MLCB 5KW9H 1QP1A 3MOBH 3V95A 1FL5A 3GHEH 2XRAL 1CR9L 5C09B 3RKDD 3TYGL 4O58L 3W39B 4HUMB 5JPNB 2I26N 4LPVA 4HEPG 3QFJD 4HIIB 1KN2H 5E9DD 5DEGB 1AKJA 3GSQA 1A7BA 5GGRA 4FQ2L 1XIWD 3MRKB 3RVVC 3BSZL 2MCPL 2ZCKL 5L8LB 5B38B 4P23B 1R24B 2G2RA 2AV1B 1XGUB 4PJ8A 1QFWI 1MH5A 4Z7QF 3UTSA 3QXVA 4KKBC 4MJ2A 1ZLUH 1AFVH 1YPZA 3QCUH 1MRCH 1REIA 4P2YA 1MJJA 5HHXL 4Y5XB 2IG2H 3KWWB 1JGVH 1BECA 1VESA 4OZFB 4V2BA 1LEGB 1UWXH 5JPNA 1J8KA 3EYSL 3O6ML 2OZ4L 2E8ZA 4HIIA 4NP4L 6FABH 1AGEB 2AJYH 5DEGA 5LCVH 1X44A 4I9WE 3VFUB 1RZJC 3V7MA 3M07A 1VKXA 1H9VA 4XXCC 5GGVL 4X7SL 5DXWA 4Y1AE 4P23A 4U0RB 3T8XA 3RX5A 3MLZH 1YMMB 1NFDE 1RVFH 2WUCH 5CEYA 2R2BB 1IAIL 4H26A 4OCXH 4XWOD 2D7QA 4JANB 3VXME 4U31A 4XZUA 5ICXB 4S1QL 4Y5XA 1CIDA 3TO2B 1YQ2A 1LEGA 4R96B 1BFVL 3WXWL 2VSCA 1RUKH 3T0ED 3THMH 5HHOA 5ICZB 2IPTH 1AGEA 1U92A 1MCNA 1FYTE 2GW5A 2LU4A 2YUVA 4ELKB 5FFLA 5JW5B 4NJ9L 3MXVL 5B39G 4D0CA 1Z9SA 1V3LA 1IM9A 1A5FL 2B5IB 3SBWA 3U7WH 1YMMA 3QCTL 3LS5H 3TWCL 4JANA 5DWUL 1KF9B 4X8JA 2Z31C 1H15B 1PKQA 1X3DA 4JRWA 4M3JA 2V2XB 2HMIC 2HT4C 5FGBA 4NKOA 3GK8L 3FB7A 5D7JB 4DCQB 1JFQH 1Q94B 4R96A 5JORA 5JZ7C 4WI2A 4NRXB 3S4SB 1CFSB 4RGOL 2CDFA 4D9QD 1VPOH 2R29H 2X4TB 1KCVH 3GHBH 1HXMB 4ZO7A 4NHCH 4ELKA 4JDVB 4XB8A 1GC1C 1SM3H 3PWLB 3UYPA 1T4KB 1VGKB 3ARBB 3ZLQC 2Z91A 3FTGB 5F1NA 4UBDD 3AB0C 4WEUD 3U4EB 1EHAA 2I9TA 2XN9A 4LSTH 4OF7A 1KUMA 4KVNL 5J1AB 5TF0A 2OS7A 4KY1H 1H15A 3I2CH 4UT7H 4IIQB 4G6KL 1CGXA 4DCQA 2JE8A 2NXYD 3VFNA 1CFSA 1SMOA 1G7LB 4DEPB 1LNUB 4NNYA 2XT1B 3U1SH 4HMCA 3SDDC 1UKSA 2M26A 1DVFC 4QGYA 5I8KH 1GGIL 3BQUB 3O6LH 5T3ZL 4ESKA 1EGJL 4WW2C 2EDHA 3F5WB 3I6GB 3GSNH 4Y1AB 4UIKH 3IXTA 1N64L 2PXYC 4J12A 4XXCA 1JPTL 5J1AA 1DSFH 1NFDB 4DZ8B 4IJ3C 1YNTB 5GRWA 5DRZB 3NIFE 4XNXL 3CNKA 5I1AB 1JWMB 3GJFH 1LNUA 5FHBH 2L7JA 43CAB 1ES0B 3AAZA 3BP4B 1QSFB 4I3RL 1K2DA 4RBPK 3IDJA 4N90D 2YSSB 4PB0L 4LSUH 3P0GB 2N7AA 3BQUA 1KYOJ 1E4WL 4OCMC 2DM2A 4H5SB 1MHEA 5DS8B 1K3IA 2OL3B 4ZOCA 1MRFH 4Y7MA 5C07D 3T65B 4X6BA 4Y1AA 2O61A 5DUMH 3RGVD 2LTQC 1OTUD 4PREB 2EYRB 1E4XI 4XT1C 3BH9A 1U8JB 3R0NA 1NFDA 1OWWA 4KK9D 5I76A 1NGWA 4GAJH 4BK5A 5DRNB 2OSLB 5DRZA 5E24E 1YC7A 1YEFH 3O3DA 5E4EC 3VXMA 5I1AA 3I02A 1EK3A 3OXSA 4MJ6B 4J8RA 1OTSC 3VG9C 5MP6L 5FUZH 1ES0A 1FNEB 2HFGL 1VSCA 3VGAB 4F7TA 2H8PB 2Z31A 4HLZH 4OLVL 5ITFB 1KJMA 2YSSA 1AHWB 1X5FA 1FYTA 2Q6WB 5CCKH 1PG7L 3QWQB 5DS8A 3LKRB 2OL3A 2ATPA 5I2IB 1T1XB 1INDH 4ACPA 1FH5H 1NL0L 5TQ2L 1JL8A 1SMAA 2LAAA 2EYRA 4M1DH 1U8JA 1FVCB 4CW1B 2CXGA 3V6OE 1NGXB 3MRIB 2FCBA 5DRNA 2OSLA 3MJ9A 5ESVB 1MFBL 5A16A 3LN9A 4KUCD 1YYLH 2WBJB 3SDCD 2APVA 4JAMB 1DDHA 1I9IL 3IS1X 2PTTA 5IGXH 3VGHA 4G8GE 2XXCB 4JE4B 3MUY1 1N4XH 2IH3A 1FZMB 5HHNA 2Q6WA 2KBGA 1Z5LB 3GSWA 4NZUH 3WDHA 3QIUB 2DMCA 4H88H 1UACH 4NOBA 3LKRA 4RCAA 5KANG 3SDDA 3ZKMC 1HSAA 4Z7VF 3V6OC 4DFHA 5IW6B 2GQHA 1TZGH 3IDMB 4G6MH 1FVCA 3HI5H 3MRIA 4WW2A 1B3JA 3KYKL 2X70A 5E1AB 4JFZH 2WSKA 2WBJA 5C0NC 4JAMA 3WIHL 4R0LC 4UNVA 2PXYA 5HGHB 4LKCB 1V3MA 3CXHK 1Y0LB 2J4WL 5F1SA 4TOYL 4QXTA 2BVEA 4HLZG 4XMLH 4C56B 1RZJH 3DWTA 4XTRC 1Z5LA 5E4EB 3VWJB 1R3IH 2MSPA 4HIJA 2XV6B 3QIUA 4FG6C 3BOVA 3VD9A 4ERSL 3VG9B 2NZIA 2YRLA 4LLQB 5C8JB 1FZJB 2CIIA 3RBGA 3RIAK 1CD1B 5GS0C 1IARB 5SWSE 2W0FB 3PGCB 1JUFA 4XP5L 5DMGC 2B0SH 1T0MB 3QUMH 3BN3B 2QHLA 1NGQL 4RZCB 4NQXB 5E1AA 1J10A 4HWEL 4F33A 1AY1L 2AXGA 1WT5A 2PNDA 1OAXH 3ZDYE 4QYOA 5HGHA 4WEBL 1Y0LA 4PRDB 3SO3C 2ADIA 1FLTX 5JXED 2HJKB 4A2MA 3T1FA 4GAYB 3K81A 1Q72L 5J13C 4GBXD 3SDAC 5CIPH 4PGBA 4Z7UF 5H2BB 1U95B 5H35A 4PRPE 4LLQA 1XCTB 4RAVA 5A3ID 1IM3A 2VYRE 1B4RA 3KXFD 1UXSA 3GJEB 5F7NC 3OF6D 3OGOE 4PGEB 2OL3L 4H8WH 1T0MA 3KPQB 1KXQE 1IL1A 4RZCA 4NQXA 4WWID 1KN4H 4G6JL 3MR9B 2FBJH 3Q3GA 4OSUL 4PR5B 1QFWL 4QOKE 4PGJA 3L3DB 3WDIA 5T33L 4PRDA 4BELD 3MJ9L 1OCWH 2HJKA 1K4DB 1LDSA 2V7HB 5ACLA 3V8OA 4GAYA 3UTTB 1Q0XH 3FFDB 4G8GB 4PJDE 5BCAA 2B7DT 3KYOB 5H2BA 4N1HB 1ZLSL 4KK6D 4GXVL 3QG6B 4LLMB 4NUJA 5EPMB 4YE4L 2VXTL 4XAWL 1HDMB 5KTEL 3HUJE 3EOBB 5SX4H 4PGEA 5F1IB 3KPQA 5I16A 3V5DB 3VXSB 1BQHB 3MR9A 2RQ8A 4Z7NE 4CMHB 1CLCA 3V6OA 5I6XC 1CL7I 1DQMH 1RK0B 1TZHA 5EZOL 4KHTH 4XI5C 3QXTA 1A7RL 4ZNEE 5GGSB 2HWZH 3PDOB 4IRJB 2H45A 5J3HD 3FFDA 1A6ZA 1AD9A 4G8GA 3MUGA 3KYOA 1WIOA 5JOFA 1PKOA 2BHZA 4R0LA 1G9EA 3QG6A 3LRHA 3TVMB 4FQXD 4KI5F 4DN3H 1II4E 4OFIA 2PYFA 2YK1L 1JNHB 1S9VB 5J13B 5F1IA 2R1YB 2YC1B 4PJ9D 1RU9L 2JJSC 5F89A 3QDMD 3JXAA 2EECA 1S78C 5F6IC 2OP4H 2VXQH 3VGGA 1DQDH 3BPOC 3H8NA 3WLWC 1JPSH 4KTYA 4OZGF 1CLYH 4Y5YC 2KQMA 5DQ9B 5E5RB 3VXQB 4ZYKA 1YEKL 3WEXB 1A9BB 5FA3A 4K55A 3L3JB 1Y6NR 2O5YH 2UWEE 3FAWA 3V0VB 2HVKB 3ALXA 4XH2B 4NZTH 5EUOE 4H20H 2YUWA 2N7BA 5L7XH 1DBMH 5CEZD 2E7MA 4L1HA 3A6CH 2VZUA 3GMMA 3T0VA 4B5EA 4N8VB 4A6YB 1XGRA 1E6JL 3BP5B 3VA6A 4PRPB 2B20A 1JNHA 5IFJA 1GZQB 3IF1B 1WQVT 4XC1H 2CK0L 1ORSB 1NCDL 4C4KT 4NDMB 1QEWB 3IDXL 4JO1H 3KLDA 5HGGS 4HWZB 5T5FH 1MCLA 3OPZH 4JFYA 2E5EA 4G3YL 2E27H 2DIAA 2HLAA 3VXQA 1EMTH 2AJ3B 1NKOA 1DCLA 2EH7L 3L3JA 1EERB 2VOTA 3V0VA 4XH2A 1A7QH 4M62H 2AERT 1INEH 3N06B 5EU5A 3UJTH 1IFHL 25C8H 4LPCA 5K9OA 3L3HA 3IU4L 2IQAB 4Y2DD 5JHLH 1BBJB 4PRPA 2QQNL 2H1PL 2DQTL 3O3AB 4AL8H 4DKFH 2NY7H 1X5AA 3WIIH 1NGZB 3IF1A 1S3KL 5C9JA 2CLZA 1V7NH 2P5WE 4J23A 3U82B 4ODUB 1RMFH 4NDMA 1EEQA 1QEWA 4JFOA 4GRLC 1RZGB 3IKKA 1XF3A 5J4MA 3ZDXF 3GI8L 1MHHA 2NY3B 4M93C 3GKWH 3PP3K 3PDDA 1OLZA 5C0CE 4I0KA 5GHWH 2CGRL 3MBED 2ITCB 1KENH 2OR8A 5IG7B 3TESA 3KVQA 5F6IB 1BVKB 2QSCH 1RUAH 4OCSH 4PJDA 3ZKXC 4F8QA 4Z7OE 4HS6A 2IQAA 1BBJA 2Q3AA 4M8QB 1NGZA 1P5VA 3B9KC 2VDLL 4QGTA 1VGEH 3X13B 1JGDB 4HIEA 5C0DB 3HUJA 3IDIB 4GQ9L 1PG7X 1RZGA 3C08H 2IMMA 5BVPL 1D5BB 1ZHKB 1UJ3B 5E5MA 2NW3B 5HHQA 4LSRH 4ALAH 1KPVB 3PWJA 2ENSA 3CDGB 3GSXB 4GLRH 3W0WD 2JJSA 2HKHL 5GS0L 5DUPH 4ZNEA 1NEUA 4DGVL 3MLYL 3D9AH 5IG7A 2UZYB 4PJBE 3IETB 3TJHD 3QAZB 4Y5YA 1OGAD 2VSDA 5MHSD 5EUOB 5KSAD 3DVNA 5A2JH 2Y5TA 1RUPL 2IJ0C 2H9GB 5FYLH 3DBXB 1LE5A 1JGDA 5C0DA 1DANU 1C5DB 5DI8A 5E00B 2ICWJ 4L4VD 3PG2A 2A73A 1ZHKA 2J6EH 3G6AA 4YHOL 3T77B 4MCZA 4PP1D 1N8ZB 1AO7D 1QO3A 3CDGA 3H3PL 4P5MB 5C0BE 5HI3C 4V1DE 3MV9B 3T3PF 2AJSH 3U2SB 3GSOB 3GIZL 4M4RA 4XNYL 5JW4R 4Q0XH 4S1SH 1JYNA 1T2JA 3IETA 3PIQA 4HUXB 5C0GA 2UWEA 5BZWB 1RFDL 5EUOA 2GTWB 4LRIC 5TE6L 2VAAA 2GSGB 3VFRB 4QO1A 1A6UH 4MQXD 1QYGH 4U1MB 1OW0A 1JRHH 1QA9B 2DBLH 3AREB 1A14L 3P0VL 3LQAC 5HGDB 3TT1H 5F7DA 1PY4A 1N8ZA 3KYNB 3FFCD 4P5MA 1HQ4A 5F9WC 4K3DH 3DMMB 5JW4Q 1MAKA 1MCWM 4GRLA 3ORJA 5ADPL 1A1MB 5TE7H 3QPXH 1FNGA 3KLAB 1FG2A 5DHYA 3FMGH 5E2UL 1JF5A 4PJEE 2DICA 4QHMA 3STZB 4CGTA 2DTMH 2ZJSH 4Z5RB 4OGXH 3D1MC 1FG9C 4BJLA 5I19L 1S9XA 2D7MA 1HE7A 4U1GC 1OGTB 3QEUA 5DEFA 3V0WL 1KB5H 4KV5F 1P4IH 5JIKA 2X4QA 2ZZUT 3O0RL 3EFDH 1I7ZA 1NCCL 2HJFB 1KCUL 3OKLB 5HGDA 4W6YB 4BSVB 4GMSL 2FL5B 3KYNA 3CLFL 3B9KA 3FQTA 4U1JA 4IOFD 1QSZA 2R1XB 3LSOB 1H3WM 4U6XB 2VIRB 4IOIB 5EA0L 2V17L 1Z3GH 1A1MA 4ODHL 3AS1A 2COQA 5C0CA 3JTTB 1MQKL 2VISB 3KLAA 3EDEA 5TF1H 3ULUL 2NY1D 3KDMA 3O6KL 4NYLA 3STZA 4TQEL 1MJUH 5EIQA 2ZSVB 3WFDL 1FP5A 1OGTA 2CRMA 3MXWH 5GSRB 4WHDA 3WFCL 4PJGB 2P8LA 3AS3A 3UTSD 5C2BL 2Y06L 5BO1H 2XA8L 1D6VL 2MKLC 5DD3H 5C09D 4Z78B 3EHBD 3SJVE 2Y07H 2HJFA 1KPRB 3ZE1E 4Q9BA 5GRJL 3FN0L 3E2HC 4OLZL 5T3ZD 2FL5A 5A2FA 3DSNA 2ZSWA 2VXSL 1WFOA 4OFDA 1MJ8H 4OV5A 4IOIA 4OIBA 4HKXB 3KR3H 2NR6D 2IH1B 2VISA 5K9QI 1F90H 3EJYC 3Q6FB 2XQBL 2HRPH 1T21A 4P23D 5F9WB 1HHHB 4PJBA 1A2YB 2FX8L 5IFHH 1N5AA 1MWAB 3ZDZF 2WWKT 4Q9QH 4PJGA 5F7EL 2QJDA 3QHZL 2W0PA 1IC7L 4NUGH 3F6IA 4OQTA 4Z78A 2EDBA 1JGEB 1IAMA 1TVHA 3LKOB 1CBVL 5GJTL 4U1GB 1KPUB 5TDPA 4OGZA 5HHOD 3E3QE 1KLUB 5FV2A 1DLHA 4HKXA 3N1QC 5EH1A 5KVGH 4UZGA 2VDNH 2C3VA 5M94B 4V1DA 2X5PA 4S1DD 1CL7L 1IM9D 2F53E 1DTUA 3MYZA 3Q6FA 3TCXA 4ONOA 4LPUA 1A2YA 1YMMD 1UWGL 3HE7C 3P40A 4PJEB 5EBWA 1UM6H 4D9LL 5DZOA 1JWSB 5I30L 3OTTA 3B6SB 5KSBF 3ULVE 2A83B 5F8RC 3E3QC 2EZ0D 4PG9B 1JGEA 2VDQH 4KI1A 3ROOB 4CU6A 1KLUA 1IQWL 3V4PL 4YEFA 4HS8H 4KFZC 1G7JB 1NC2B 4Y16C 1B88A 1CFNA 3PJSB 4NQEE 2MOVA 1I7RA 1BAFH 3E2HB 5B8CC 5CJBA 5LQBH 4GUPB 4XXDA 3ULVC 2KUTA 2E7HA 4I18B 4Z18A 2XN9D 4PJEA 3RVVD 1JWSA 1LO2H 1WFNA 4NFBA 5E2WL 3ARWA 3FB8B 3GI9L 2BVUA 4OLYH 4HUWB 5D93C 4RA3A 4X7DC 4PG9A 1XFPA 5D7JD 3MBXH 3RU8L 1RY7B 4TVSa 1PYWA 3AROA 1AXIB 4CMMB 1MVUA 3STLA 5C0EB 2VLJE 1OAQL 3FONB 3LMJL 4KKBD 2I9LB 1AGDB 3TP4A 2PN5A 4HHAB 5BZDB 1J1OH 4WU5B 2DQUL 1KTDB 1HOCA 1G7JA 4GRWE 4YR6B 2YXMA 2ZOLA 3PJSA 5D2LE 2XY2A 1YZZA 3MJ8A 5JOPD 1MHCB 5I8EB 1B0RA 5FEBA 1A6PA 4F7EB 1CLZH 1NGYB 3ARFC 5EG6C 3FB8A 5HJ3B 4HUWA 3E6HB 4N0YL 4Y88A 3QDJB 3QFDA 1A8JH 3G04B 4NNPH 3NN8A 1NANI 1OAZH 4EIZC 1LMKA 4OAWB 1KV3A 1V7MH 3HE7B 5C0EA 4TVPH 1JK8B 3ILQC 5E99H 3SJVA 4YHKH 4QNPF 4MA1C 4OQTL 1OARL 2C3XA 4NO0B 4HHAA 2BXYA 1PJ9A 5T1DL 5BZDA 2VAJA 4Q9CA 3BQUD 4YR6A 5C08E 2WZPD 3QJHA 1KTKE 2FGWH 4I9WD 4YWGH 1C8PA 5TQ0L 1EA9C 4HDIB 5D4QA 2RCSH 5I8EA 1S9WB 5IMKB 2F19L 4RFOL 1UXWB 2F53B 4Y4HC 4DVRL 1BOYA 4M6OL 4Y1AD 3SN6N 2PO6B 4F7EA 1YEGL 3C6SA 3LQAL 4RFNB 3RVUD 4LP4A 5KS9F 1H3VA 4CNIA 3RY5A 2YEZB 3RIFF 3VXMD 1MWAL 1UKTA 5DD5H 4LCUA 3HE7A 1AE6L 5FA4B 1JHTA 4R90L 1RZFL 5I1LA 3VXUB 1A3QA 2P1YA 4NO0A 3T2OA 3U36B 2VNCA 4H25A 3BFOA 5D7SL 3V5KB 2HT4D 3GGWB 1FYTD 2JB5L 1CF8L 2OJZH 1CCZA 3EOYG 4IOSD 3VWKC 4P2OB 2F54E 4J2XA 4U7MA 5L8JB 5C0IB 4NQEB 1LO0H 1FPTH 2F53A 1FGVL 4R8WH 3E1F1 2PO6A 1AJ7L 4ZO9A 5IB5B 1OB1B 2OXHA 4Y16A 4X6EA 4KJPD 4FQJL 4I5BB 1IAKB 1T0NB 2QADB 4PRHE 4D0BA 5B8CA 4U1IB 1FFNA 3L5JA 5GISH 2VWEE 1NBZA 3D18B 1IC4L 4XWGL 1EBPA 2VB5A 4WUUE 1BEYH 3SO5A 3ARFB 1JHLL 4M5ZL 4PY8J 1K3ZA 4YX2L 1Z2KA 2HTLC 2VLJB 3GGWA 4ODBD 1S7RA 1FNFA 1CICC 5D7KE 2M2DA 3VFSA 1LK3H 4WHTA 3NZHL 2BP3A 1NMAL 4MA1B 4OLXH 4NQEA 4G9FE 1MFAL 4B41A 3NABH 5D2LB 3HAEB 3HMXL 4KMTL 2ESVE 2VWEC 1OB1A 3V4VH 4NHUB 4O2EA 3LEVH 5D1XB 3WKML 4I5BA 1IAKA 5CEZH 1GAFH 1ACZA 4PP2A 1BZ9B 3CVIL 4Z76B 3UTZA 4Y4HB 2WBJD 5LBSL 1QBLL 3AGVA 3ARFA 2PXYD 4F37F 5F3HB 4HK3J 1S7SB 3WE6A 1IC5H 1SJEB 2VLJA 1NGPL 4KGJA 2V5YA 3MRGA 3ARYA 1UJTA 3QIUD 2OR9L 4O9HL 3GBML 3SKOA 5BVJB 5HDBE 2V2WA 3KLHC 1J0JA 4ZD3H 2FECI 3OXRA 4HSQA 1BQSA 2DD8L 5D2LA 3HAEA 4ODSH 5ILTL 3V6ZA 1U8NA 2VH5H 3PQYB 3VGBA 3U6RB 4NJAH 5ESQB 4NHUA 5F6HJ 3CC5B 1L6ZA 2ADJB 3VXPB 1TQBB 2DYPB 3P11L 1IMHC 1BZ9A 1EH9A 3L9RA 4HPYL 4PUBH 4Y4HA 5L9DH 1BF2A 2IMNA 2KL6A 1AXTL 5GRUH 3O4LE 3CFEA 3N1GC 1J1XL 2R56H 4GJTB 1SJEA 4C56D 1U58B 2CKBA 5I1CH 3GSRB 5BVJA 3WXVH 3REVB 3EAKA 1RSFA 4OCWL 2VQUA 4M3KB 3PP4H 4HF5H 5C08A 2R1WA 2GSIB 3HRPA 3JZ7A 2P5EB 3L5WA 3SE8L 1ZA6B 5E56A 1HEZA 1MI5E 5AG8A 4QF1A 5ESQA 4CRPA 3QIWC 5EWIH 1RIVL 5IM7B 2R8SH 4C54A 3VWKA 3VG0L 4KDVA 1LILA 4ETYA 4TUKL 3ULSB 2EICA 2WNGA 1CR9H 4RMSA 4KU1A 2ZG3A 3VFVA 1UEYA 1VHPA 1L4IA 3WYRA 2NY2B 1U58A 2PW2B 1C12B 4WI6A 4TNWF 2HFEB 2XQYK 3QQ3B 1NMCC 2MCPH 3BSZH 3Q1SH 1T1YB 5EOQL 3ULVH 3VGDA 5DHVB 2ILLA 2AJXL 4IBLT 2K7QA 4LCCC 2GKIA 2F54A 4IHOA 2GTZA 3EUUA 4EDXB 4ODTL 1CICA 1HKLL 1UWEH 2P42B 3TBYB 1KCLA 3MCLL 3LDBB 1I4FB 4PRHA 3WKNA 5HHXH 1NCNA 4EBQL 2X10A 1UC6A 2FWOA 1W0VB 2R69L 5AYUL 3FZUC 5HI5C 1FSKC 3EYSH 2OZ4H 5J6HB 1DFBH 4NP4H 4QT5B 1D6EB 2PW2A 3RNKA 3U46B 4G8GD 2EO9A 2HFEA 3LEYH 5C0ND 2DQJL 3QQ3A 4YDLC 5GRVK 3F65A 4PY7B 3SQOL 5D1ZB 1DJSA 2XXMB 4DW2H 4JFPB 4G9FA 3WS6C 2GIYA 5ECJE 3IYLW 4YHNA 3ZHDA 1C5BL 2D31B 5TDOB 4JDTL 4K23H 5IVOA 1OSZB 3CUPA 2BFVL 5GS0D 5EC2B 1W0VA 3DPBA 2R2CA 2EYSA 1BFVH 3MOAL 3WXWH 1WUNT 5DMGD 1X5IA 2ZUYA 1T20A 3DUUA 2RFXA 5CBEB 4KKCC 2A9NL 4LLWB 4NJ9H 3MZGB 5IJVA 2RAMA 4PJ7B 5DJ0B 5HDLA 4PY7A 4MB3A 3TVMD 5D9SA 1A5FH 3MLPA 1NBVL 5CGYD 5D1ZA 1YMHB 2R15A 2CKBL 5KN5A 3ABZA 2X1OA 4PV9B 2C4FT 2IEPA 3QCTH 3ARRA 2D31A 4JFDE 4R7NB 4R4FL 5JA9A 3O45B 5GRYA 1FVDA 1NEZA 1OSZA 3GFUA 3K80A 3L1OL 1KIQA 2ITDB 3BXNA 2IGFH 4RIRB 3GK8H 3ZE0E 3QIWA 3GRWH 4RGOH 1B2WL 4LHUB 4X4ZA 3MUHL 5CZVH 3L3IB 3O4LA 3VFTA 2XZZA 4JZJC 4KUCF 4R97B 4LLWA 3BUYB 5DJXA 3BGMB 1S7TA 4PJ7A 4OCRL 2GFBB 5HYIA 2OJEB 3WUZA 1YMHA 2YPVH 4PRPD 1A7PL 4XHQA 1U3YA 1MI5A 3GMQA 1M71A 2YA0A 3HPJA 3QHFH 4TNVK 3O45A 4OZHE 1MRDL 3MFFB 4YDLB 2L0DA 2JELH 2DTSA 5KSUB 1JF1B 2A6JB 4LCCA 1C7SA 1ZVSB 3AXLB 3CIQA 1MCOL 2WQRA 4K94L 3UP1A 4HGKC 4J6RH 3DYOA 3QXAB 3LB6C 4LHUA 2R0WL 2VXUL 3REWB 4Z0BL 3HNVL 4B7IA 3MNZB 2YWYA 3BI9X 1E27A 5FAAA 3CXHJ 4NCDA 1ADQH 1GGIH 1X5KA 2JJUA 3L3KA 5C0JA 5FKAA 5DRXB 1WWWX 5JHDB 3EDJA 4XBGB 2XYCA 3MLUH 5ISZE 1I8KB 1FC1A 1MCKA 1TVBB 5DSCA 2D03H 1Z9MA 2A6JA 3BP7B 2FH8A 4XNXH 3P9LA 3ULUD 3WS6A 3NIGE 1ZHBB 3REWA 3HS0A 4NN5B 4PJAB 3MNZA 2GUOA 5E6YA 1FN4A 4OZFH 4X6DE 4PB0H 1OAKL 3A6BH 2Z8RA 4L9LB 4NO2A 3WLWD 3DV4B 4CVWA 1IT9H 3SKNA 1V05A 3EYUH 3V8CA 3MRPB 3T2NL