2ZJSL

Crystal structure of secye translocon from thermus thermophilus with a fab fragment
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPWTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase SecY subunit
publication title Conformational transition of Sec machinery inferred from bacterial SecYE structures
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Protein transport/immune system
total genus 45
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2008-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsL01
1PJ9A 4HIIA 1G9ML 2BOBA 5CINH 5AUMA 3MFFA 2AJXH 2DLFH 2RHEA 5E08H 3QCUH 1J88A 3EYFA 2WZPD 3VXQA 4WW2F 4NPYA 1NCWL 5CJXC 1WZMA 2VDQL 2NW2B 3FCTB 1UM5L 3QUXD 4FFYH 4MJ6B 2OMNA 3ARUA 4F7EA 3QUML 1K4CA 1HHKA 5KOVC 1EPFA 5EZLA 1RUKH 4LVNB 3BP6B 3MROA 5C70A 4AMKL 4ZOAA 5C7XL 4Z7UA 1DN0A 1N5AB 4WHDA 1L7IL 1TCMA 3ES6A 2IGFL 2P46B 4ODXB 5HD8C 1DTUA 1JPSH 1AGFA 4NO0A 4LOUC 2YC1A 2DWEA 4CJ1A 1MCKA 4JQIH 4L5FH 4AH2B 4M43L 1ERNA 2X1OA 5A2IH 3B9KD 5DJ2A 2CXGA 3TGXA 1CI5A 4UINH 3TEUA 3ZE1E 4U1MA 4KC3B 4GW5A 4JJ5B 3HG1A 1Z9OA 4Y5XB 1JF5A 3BX7C 3D39A 2EDDA 2F19H 1XGYL 2A0LC 5HYJB 4LKXA 3G5VB 1YEEL 1XF3B 2Z8RA 1F4HA 4P2QD 1TDQA 4S1RH 5ANMA 3VA2C 4NRZB 3WLBB 4Y19A 4JREB 3MV7D 4ORGB 4A6YL 5C0DB 3HI5L 1ZE3C 4APQC 3HI6H 2BY1A 4FQ2H 1R0AL 3I6KB 1F97A 4I48B 1KCLA 4M3JA 5TQ2L 5LGHL 3UBXA 1ZVYA 3DWTA 4K94C 3GMLB 4OZGA 5D72L 3UTSB 4AENA 4BYHA 3QA3B 4M7JH 5GGUB 2EDHA 1I85A 5KZCB 4P2RA 2VRAA 3REVB 5HI3D 4AYFA 3O0RL 4NZRL 5INDA 1NKRA 4XVTL 4TSBH 5JXEC 4PJDE 3BGFB 4XC3L 2YN3A 2OJZL 4M93B 2PW2A 3OKDB 2B4CL 3WFEL 3QUKB 4B41A 2KDGA 2R0WH 2YZ1A 5J1TC 1BGXL 5DD6A 1UWGL 4DOHE 4L4TA 2DQHL 2XN9A 3T77A 4LQFH 1YPZF 1RZKC 1KB5A 1PZ5B 5DJ8A 5IEKB 4CMHB 4YH6A 4Z7OF 1MOEA 4N0UA 4XX1E 4XP5L 2V17L 4LVHC 2JJTC 4YLQT 1YN7A 2WSKA 4JFEA 2NXYC 5D2NA 2AEWA 1WTGT 3RZCB 4XX1G 5MI0B 4JPVL 4X7TA 1OOAA 4LP5A 1KELH 2RB8A 3UMTA 3MNVB 5D7JB 1TZGH 2HP4A 3OR6A 2OR7A 3BGMB 4JFPB 2D9QB 1YYMH 2YRLA 1A6WH 2I5YL 1WCBB 4A6YB 3B6SA 3MNZB 1F3DJ 2W9EL 3FO0H 1FJ1A 3K3QA 5DRWB 4H1LA 1JTTA 4L1HA 4P2QE 4QO1A 1QYGL 1MF2H 3QUZC 3DIFB 3K74B 5J8OA 3HMXL 5LWYH 2VISB 3EOBB 3KPLB 2MKLC 1XFPA 1Q9KB 3DRQB 3WDHA 2YD2A 1OGAA 3S34L 1KACB 5FV1L 2YD5A 2DQIH 3IDMA 4PJGE 1OGTA 2VZTA 3BDYL 3MOAH 1D5XA 2VL4A 4QOKD 3P0YL 2F74B 2O5ZH 3FN9A 3H9SA 2ARJB 4YO0B 3OKLA 1CXHA 5BJTA 1MAML 2F8VA 5B39A 2X4PA 1MFDH 2VDLH 2L0DA 3IS1X 2DM2A 3BIKA 4FFZH 1S9XA 2QL1A 4AG4H 3LHPH 4JRXD 1LEGB 2X9XA 3D0LB 1U3HB 5I1CH 1X7QA 4NZJA 1ZGLA 1CT8B 5EUOF 1RURH 5E1HB 4TQEL 4JFZL 4JPIA 1S9WB 4MXVF 1I1AA 2R4SH 1DE4A 1F4WL 3SDAA 4CVXB 1WWCA 3BSZL 2D7QA 3L3KB 4O51B 4I3GA 1VFAB 4BQBA 3MUJA 5IFHH 2YD6A 3U0TB 3QYCA 2XWBA 1DLFL 5HHQB 1N6QH 4J3SA 4KTEL 5C0EB 4MD5A 5AD0A 4L4JA 3MLZL 1TZHB 2ORBH 5I1HL 1BZ9A 3THMH 1I75A 3NA4A 3L3OB 5E2VH 2EIDA 3GHEL 4PUBL 2APBA 3C8HA 3EGSA 1BD2A 5EZOL 4NJAL 3ZHLA 4Z7VB 3OKMA 4GXVL 4P2YA 3VRIA 5IGXL 2D03H 4NO2B 4JDVA 3O4LB 1IGYB 1XGPA 4FTVE 2VYRE 4NN7B 5CBAA 2WW8A 2BHUA 4JZOB 1NDGA 4OSUL 5F88B 1H15B 5I30H 1C1EH 3RDTB 1F90H 3B9DA 1CFVH 2V9RA 2VDKL 3V0VB 4OGZA 4ZUWA 5DUBA 3TVMB 1FE8L 2GAZB 4KH2A 3R06B 3CDGB 5ENWB 2Z8SA 2ID5A 4ZOEA 4OTXH 2C26A 4W4OC 4QOKE 4HIHB 1G1CA 5BVJB 4BFIB 3B5HA 3MRMA 3RRQA 1SJEB 1T1YB 4GRWH 1KNOA 5L9DL 2OTPA 1IAOA 4KAQH 1AY1H 4NGHH 2O5YL 2APXA 3WUWA 1KEMH 3NFNA 4JRXE 3KPTA 3L3IB 5HYJD 3PGFL 4RGMC 3VGAC 1BVZA 2E27L 4OLXH 1DVFA 5JA9A 1NFIA 1S5IL 4LSQH 4PBVC 3OKOA 3WJLA 1LILA 1Q9LA 4E0RA 5IFJB 3RBGA 1I1YB 5T5FH 5HDLA 4R7NB 2E9BA 4HWUA 4Y4KC 3BD3A 1I9IL 3GSNA 3KG5A 4H88H 4KJQD 4PP1D 1DQDH 3UTSD 4YQXL 4LBEA 4QF1B 5BRZB 4Y5VA 4JY6A 2NY4B 4IJ3C 4Z18A 1SMOA 3HC4L 5KZCD 4TUKL 3H3BC 2CDGA 5IB2A 4OI8A 1N26A 5IG7B 1GJIA 2AXGB 4XP4L 3SY0B 3ZHDA 3U2SA 2R9HD 3GSRB 2E7LC 2PYFA 5F96L 4DFHA 2GTWA 3BT2H 4MXWL 3P9LA 3PHSA 2NZ9D 4M1GH 3NIGF 1ONQB 1T04A 4O02L 5ERWA 3VE0B 4PJEB 3NCYP 4HUVB 3QI9C 5TE6H 4MQXD 3KWWA 3HPJB 3T65A 2AQ2A 3RZCD 2BRRH 4OQTH 1EHLH 3UTZA 4RISL 3S8WA 1EJOL 3P77A 2UZIH 4HUWB 3QXDA 4S0SD 1P4LB 5D7JD 1HIMH 2KUTA 1QFPA 3SDCC 5DD3L 3OXSA 5HDQL 1AIFB 1GGIH 1CE6B 4YDVB 1NGWA 1FFPA 4M02A 4G5ZL 5IROA 4CN1A 4XHJD 3VFMA 3JV0A 3JWNC 4S2SB 3IRPX 5FO7B 2FHFA 1NC2B 4RWYL 4LSRH 4X9GA 5HYJE 3VI4E 2FEDC 4OCMC 1RK1A 3NCMA 4QHNB 3UJTH 1MIEH 1YNLH 1I7TA 2VABA 1W72L 1F4XL 3VFPA 3X11B 5KAQG 2IADB 3MRLA 1DL7L 3X3GL 4MX7A 1C5DA 1W0WA 5C09A 2QADC 1GZQA 1HNFA 3NPZB 2YD4A 1I9EA 2VQ1B 4JFQB 1X5YA 4DKDC 2HVKA 1MWAL 3RIFK 3UTSE 3X14A 4H0HB 4X4ME 3CFIC 2CGRH 3RWEB 2FWOA 4X5XA 5GGRA 3UTOA 1XGTA 5L7XH 3SGEI 4LKCB 1OVZA 3MODH 4W81A 1AD9A 5EOCH 1MEXH 1JWSA 1QG3A 2VR4A 2HTKD 4JFYA 4RMSA 2R2HA 4ZOCA 5KS9A 3CCHA 1T20B 4F7CB 1YEHL 5C2BL 1UACH 4MNQA 1U3HD 4C58B 3L5XL 4U3XA 4Y8DC 4AEFA 1WT5A 1FL3B 4HEME 3F7QA 3HZVA 1EAPB 2WK2A 4JE4B 4X83A 1I8MB 2DQUL 2QKIB 4GAYA 4JFXB 3MYZA 4QHMA 1O5DT 4P2OB 4MZ2A 3G08A 4LEXH 1RZ8B 3S35X 2XPGA 1C8PA 1FZKB 4LIQL 5J6HA 2VE6B 4IDLA 4OCRL 1K2DA 3JWDC 3W0WA 2R0ZH 4KXZH 5BZWA 3DTXB 5EU6B 3AB0C 1TLKA 3PL6A 5IIEA 1R24B 1CE1H 5EULV 1EA9C 3WJJC 1PKQA 4QTHA 1NMBH 32C2B 4FXLA 5DA0B 5IMMB 1A21A 1IGTA 3MV8A 4OD3L 5H35B 3QAZC 4Z8FL 2N4IA 1NLBL 5CJ8A 3RWHA 2C7UA 4XPHH 3WL9B 3RUGB 1T0MA 1OAYH 1OLLA 3VGEA 3MA9H 2ATPB 1T2QL 3O4LD 1IM9A 2WQRA 1ITCA 1HHGB 1MWAB 1GAFL 5FUOL 1J10A 1GYAA 5JA8B 1RIVH 3RDTD 4D8PA 1QFWL 1EMTH 3TVMD 5IJKC 2DQFB 5FOBA 1MCHA 4D0BA 4HMCA 3IFLH 2BNRB 5INCA 4EN3B 1I8KA 2I26N 3BXNB 1UB5A 1TQCC 3QDGB 1FNSL 1QNZH 4LHUB 3BKJL 4CBPA 5IWLC 1QSFB 3QZWB 2NY5L 3ULSA 3V52H 4JQXA 4G3YL 1WGOA 4PRHB 4QRPA 4UIMB 3BAEH 1LK2B 4N8VA 3WIHH 4GKSA 1BQUA 2GUOB 3PWPA 5CP7A 4NN5B 1Q9OB 5I71C 3DSFH 3INUL 2RIKA 5K9QI 5B21A 2CMRL 4MAUL 3X12A 4NC0B 5JZ7C 4NWUH 3OPZH 4BZ1L 4X6BA 1FG9C 1RZJH 3TO2B 1FVEB 3OHXB 2F53B 5L2KA 3LDBB 2AXFA 5E94B 4QWWC 1FRGL 1A6UH 1MJ7H 1S5HB 4M4RA 4WTZG 3T8XB 3WSQH 4J23A 5J4MA 1AQKH 3GSUB 4NZTH 5LVEA 5HI3C 4NNXA 4XP9L 1IKFL 2P49B 4HUXB 4D0CB 1GPOL 5BRZD 3L7EA 1CXFA 2NY4D 5CWSB 3VGBA 1J1XH 3IVKA 2HLAA 4Q58C 4XB7A 4YHIA 1W0VA 1WJ3A 1UKSA 1GGCL 1JWMB 4IOIA 2GK2A 3S96B 1SHMA 2XQBL 3QIBA 1IC1A 1JVKA 8FABB 1WWAX 4NWTL 4R3SA 1SJXA 4KI5D 5E00A 2PO6A 4PGDA 5EZJB 1RZFL 1EBAA 2ZG1A 2ICEB 3VI3E 4BFGA 4R4ND 4X5LA 2P8MB 3CMOL 3UJIL 5ADOL 5T3ZD 3ARZA 1CL7L 3C09B 3HE6B 4Z7VE 3V6ZB 2Q8BH 1MREL 4EKXA 1KJ3H 3PABB 4WRLA 1SBBA 2ZSWA 3O4LE 2EE6A 2FHBA 1ZSDB 4DVBA 5C9JB 4NHCL 4TPRH 5E2TL 1ZEAH 5EB9A 1UYWL 4GRMA 4PLNC 5T5NF 1A47A 2D7TH 5IEHA 3QFDB 2Q86B 1WFUA 5GS0L 5KG9A 4WWKB 1MHCB 5CEXA 5D1XA 4QEGA 5TDNB 1UB6B 2HVJB 1OY3B 3DBXA 4U1SB 5MP6H 1FC2D 2FECI 4PJXB 4FQLL 5JR1H 3NIDF 1FNAA 3WS6A 1JHLH 4NQEA 4BJLA 4HCRH 3D69A 3HMWL 2FLRT 35C8H 1EHNA 4Z7NF 5L0QC 1LE5B 5C3LD 4FG6C 3DO7A 1F00I 1NC2D 2EYTB 2ED8A 2A73B 4LRIC 5FYKH 4HBCH 1NGXB 5DQJB 3AUVA 2IALA 1NFDB 3HNVL 1ITBB 3PWUB 4F7PA 2AEQL 1MHPL 3QH3A 1OM3H 3MR9B 3RWDA 4XP6L 2OJEA 4OIAA 2VLKA 1BEYL 4MA8L 3RHWF 3ORJA 3SKJH 2X7LA 2NY0B 1J5OH 1ZA3B 5BRZE 3MXWL 2J8UB 1LO0H 3RVTD 4OCWL 2VDPH 4U1NA 2CDEA 2P8PB 1T4KA 1JPGB 3I6GA 4KI5E 4UAOC 2VLJA 1T6VN 3D25A 4ODBD 5IV2B 2R15A 5GQBA 3T4AB 5JDJA 4X6FB 1FVCA 2FGWL 1MJUH 3QRGL 3RVXD 4K7PH 5IR1A 3OKEA 3VXSB 6FABL 5T3ZE 5D6DA 3L3DB 3D48R 4PYGA 4P2OD 5F7YC 5TE7L 5J3HD 5SWSA 3PWJA 5L88L 2DQCH 4DGYL 2IPKB 4PJEE 4PGCA 5IQ9A 2H3NA 2VITB 2NY3B 4Q74A 4KMTH 3JWOL 4B0MM 1AHWC 1NPUA 3CSGA 1A14L 1G6RA 2GFBB 5EFIB 4L9LA 2DQJH 5KW9H 1AR1D 5EU6D 2F58L 5BV7C 4Y4FB 3PG2A 2ATKA 1H9VA 4MAYA 2EDOA 1P2CA 3LPFA 4U1KA 5BZDB 4J3XA 4BSWA 3B2UD 2R56L 4TVPH 4X7SH 5DUPH 5E99H 4YBLC 2YK1H 5AZEL 3MLSH 3OXRB 3ROLB 4EXKA 5C6WH 5DVMA 5TFSH 4M8VA 4G42A 2YPVL 3G5ZA 2YSSB 2UWEB 4FQHB 4ZG1A 1QSEB 4FZEH 5E5MB 5B3JE 5EBGA 1DEEB 2C3WA 1ORSA 5DMIH 3BD5A 3TBYA 3MLPA 5I73C 1ZHLA 4HAGA 5T1LB 4WTXA 3P11H 2AJSL 4ZS6C 1HKLL 1LO3L 1VEOA 3IJYB 3O8XA 3QFJA 4U6YA 1CGSH 4R0LA 4UT9H 5EN2A 1BOYA 3I3BA 4U0RB 1P4BL 4EN3D 2BNRD 4M62L 2EH7H 2V7HA 1Q0YL 4PGEB 2ZOLB 4YX2H 3QDGD 4LHUD 1QSFD 2HJFB 3RVUD 2CDFB 5IVZB 1MFBL 3NH7H 1T0NA 1IAKB 4PRHD 4L8CB 4CL7A 4HF5H 3VXUA 4EQ2A 1G9MC 5CEZL 2M1KA 3MNWB 5T1KB 4YE4L 1ZWIB 2GITB 3GI9H 3DMMC 4U3CA 1M7IB 2K7PA 3LIZL 2X4RA 1JE6A 1D9KC 4LASL 1FL5B 4HZLB 2F53D 4LPXA 2B1HL 5DK2B 1ORQB 3STLB 5IMLB 3NCEB 1BZ7B 4UV7L 1Y18A 3GSWA 5IB3A 5EU7C 1RJYA 2DQGH 4POUB 3IU4L 4LLVB 25C8L 1N3NA 3H8NA 1SY6L 1UGNA 3OX8A 2WWMC 3FOLB 1HHHA 3HNSH 2FJGB 3B9EA 3MLRH 5EU6E 2WNGA 5GZND 5C08A 2XTLA 3SCMB 4WY7H 3MRJB 4DTGL 4P4RA 3C9NB 3RI5K 3HAEB 1KPRA 3LEVL 4G43B 5FYJH 3ARBB 1DCLA 1JGDA 3SKNB 2VUYA 3OKYA 3RUGE 1TITA 3HE6D 1KC5H 5AG9A 1MY7A 3C5ZA 3SE8L 2UVFA 1CFQB 1FVDB 4PY8I 5ITFA 1RMFL 4I2XB 4PRAA 4UU9A 1QLFA 5JPMA 2D31B 2VDOL 2BNRE 2YPLA 3QJFB 3DX9A 2ZP0T 4F33B 4WWKD 4ZQKB 5FGBA 2EKJA 2VMFA 1F11B 3QDGE 4WU7A 5HYIA 2IANA 1QSFE 1AQDB 3D9AL 4RGOH 5MEPA 5DRNA 1HCFX 3JTTB 3GJFK 4PRHE 1S7TB 4OM0L 3CSPA 4LHUG 1KTDB 3QZWG 1LD9A 5E56A 3MRRA 4WV1C 2JJWA 2V2WA 4UQ2A 4KUZL 4FQIL 1SEQL 3ARDB 1Q8MA 3HC3L 1U8NB 3S35L 2Q8AH 4S1QH 2JJSC 4PRIB 5ITBH 2IPTH 4YHLH 1B4RA 3KJ4C 5IK3A 5CMAA 4DKEL 4WI6A 3QCTL 3HFMH 5JUEH 3GI8L 1TNNA 2F53E 4HH9A 3PJSB 4U6TA 2RR3A 3P4NB 4GSDH 5FUZL 1DQJA 2B4CC 2FL5B 4JM2C 2NR6D 4TOYH 3AAZA 3IAQA 3VGDA 4AEEA 1DDHB 1B90A 5D7IA 2NY0D 1JNNL 4W70A 4MWFB 1U93A 2WIMA 1UXSB 4XVJH 4WEMB 1HSBB 3NCBB 1N64H 4PJFA 1N5YH 1PY4A 4IS6B 3NN8A 3MO1B 3BPOC 2BC4A 3MRCA 1V5JA 3P0VL 5AWNH 1VCAA 4HGWA 1GGTA 2OSLA 3LZFL 1MIML 3HS0B 3U4BH 3IF1B 3LN5A 1OB1B 5MERB 3VXSD 1EXUB 3IDNB 4ODWB 3UAJC 1I1FA 3R8BB 1A4JB 1KPVA 3BUTA 3QIUB 4FABL 1CGTA 2JF1A 5IOPB 2H26A 3V4VH 4NNYA 2J5LC 3V5DB 2JIXB 2WLZA 3MLYH 1XF1A 2NY3D 3NCJH 4OV5A 3CXDH 4WW2B 4ODUB 3O3BA 2UYLA 1FIEA 1I7UB 2H1PH 1U8LB 4JB9H 4FRWA 4DAGL 1DBML 4Y4FD 4QHKJ 4S1DD 4PJXE 2YD1A 5AYUL 3IS0X 1ACZA 5SWZB 1FFNB 1JZ3A 4DQOL 4KTYA 1J18A 1DFBL 4K3EL 4BM7A 1BFOB 1QSED 3U0WH 2EDKA 3NMEA 2IQAA 5HYQA 4QXTB 3LS5L 3VFSB 4XCEB 4L8SA 3TVMC 1NFDE 4ELKB 2H45A 3QUYB 5T1LD 5BVPL 1HQ4B 1KTLA 2RJMA 3LKQB 4KJPC 2VLMD 2BFVL 3LKSA 1RJCA 1WFTA 3GMOB 5L8KB 4PR5A 3FMGL 5F44A 3UC0L 2J8UE 1P9MA 1MVUA 3CXHJ 2V9TA 1NJ9B 5EOQL 3VG0L 5H8DA 4QHUA 3B43A 3W39B 1MCLA 4X99B 1A7BA 2DL9A 2Y7QA 4GRWF 5T1KD 2ZCLH 3Q6FB 3MJ9A 1S7UA 4LAJH 1UENA 3O3DB 1KIRB 2YOCA 3HZYB 3MRQA 1RUPL 3PNWB 3JVGA 4IRSA 2IFFL 1KJVB 1U6AL 4K3JH 3VXSE 12E8L 2FEEL 4JGUA 4LGPB 4NUJB 1H5BB 4PB0H 2J6EH 3DJ9A 5EO9A 4M1DH 5CCKL 4ONHB 1A7OH 2FATL 3FFCB 3GMPA 3WO4B 3EDFA 4KJYB 3GJFH 1VADB 2FJFA 4K3HA 5GRXG 4YUEH 3V6OC 4UT7L 1Z0NA 3IB4A 1PX3A 4MJ5A 4NKQB 2NTFB 4ZUSB 2CRMA 3TH3T 1T80A 3EOAB 5A16B 4M6MH 1YMHA 4NHUA 1RZ7L 4G8EA 4P0DA 3FONB 3SCMD 1U2HA 3NZ8B 3VWJC 1B4JL 3H9ZA 3VD4A 2CH8A 3FQUB 5EBLB 1JHTA 2OTWA 3G6AB 3ARBD 1KLFA 4U3HA 1YPZB 2UWEE 4U6XA 4C4KO 3ULUL 1QSEE 2Q76A 5I75C 2BNQD 2KKQA 3RWGA 2XY2A 1U2CA 4H8WH 4W6XB 3T0EA 3HE7B 1R5WB 1KV3A 3CU7A 3O6FC 3O81A 4JN1L 2A77H 1J87A 2KL6A 4WI4A 4X7CC 3ZL4L 3NTCL 2JK5A 4PJ8A 3Q3GA 1GHFH 3EO9L 3QPQC 2VLME 4XNQB 3ALXA 2X89A 3QDMB 1NL0H 4O4YH 5J13B 4KVNL 5CEZD 3N50A 4MQTB 1YN6B 2VTFA 5EBWA 5TF0A 3AS0A 3TPUB 3VFNA 2E8YA 1Z3GL 2VNCA 3H7BB 1MQ8A 2B5IC 1EUTA 1FZOB 3ARDD 2HJKA 4WU5A 4JZJB 3PV6B 4OD1H 4PRID 3NA9L 4R6UA 5F6IB 3UTQA 1F3JA 3QUXA 1Y6MR 2HWZH 5ECJE 1YQ2A 3IJHB 3GBNH 4Z7WF 5IMKB 1T7VA 5ICYA 4OZ4B 5I1DB 5D2LF 3T3PF 3M8OL 1T1XA 5C0CB 1MNUL 4NT6A 1IE5A 3GFUA 3EDEA 5IKCB 3MJ8A 1IGCL 3T0WA 4MGXA 3BPNB 5EPMA 3LEYH 2VN7A 3B2VL 4TSAH 4JKPH 4Z78B 4OF6A 3MPCA 3TBSB 3OQ3B 4BFEA 4WFHD 3KPNA 1IFHH 3BHBA 4HX1A 3GKWL 4J1UA 5EUOB 1P7KA 3LMJL 2V2XB 3QG7H 4MDIA 5GRWA 3HAEG 1PEZA 5HYEA 4MJIB 4UMGA 5D96C 2ADIA 5KSVA 4P59L 1BFTA 4JFFA 2FYYA 3HC0A 3I9GL 3QIUD 1M05A 4X7DC 3F7RA 1AXSA 5A3ID 5I74C 3N1FC 4I2XE 2BJML 1OF2B 3WO3B 1DR9A 2JIXD 4XXCA 4N9GB 5GGSY 1L6XA 4JQVA 2NY2B 3FB8B 3MRHA 1BIIA 3MV7A 5EU5A 5CEZE 5J57B 4Q6IA 2DMKA 1TFHA 3ZYOA 3OGCB 1GZPA 4XMLH 4PJGA 5SWZD 5TDPA 4NRYA 1RIUL 2E7HA 5DHVA 4EDXA 1IVLA 1OP5K 5HHVH 2H32A 4MB5A 2B39A 2Q7NA 5F1IA 2CPCA 2DD8H 1DZBA 2PF6A 4PRIE 3EBAA 2P4AB 1WZKA 4WCYL 5GS1C 2WUBL 4YBQC 1QKZL 5FV2A 3U1SL 1ZHBB 3QUYD 3V7AE 4EN3C 4H5SB 5JIPA 1CBVH 5CP3H 1NGQL 2CUHA 4QXGH 4AQ1B 4P49A 4QNPF 3V7AG 4YNYA 4ZPTA 3RVUC 3SQOH 1NCDH 2V7NB 3HB3D 1IGJA 4I3SH 4UBDD 2IH1B 5IFAH 4QY8A 2Z93B 1R3LA 4DKFL 4OUUA 4ZMAT 1KYOJ 2OI9B 1B6UA 2J8OA 1R3IH 1B0RB 3VA6A 4Q7DA 4WFHE 3TZVB 3O9WC 5F70A 4M7LL 1QSZA 5FAAA 1QR1A 1IKNA 1TTGA 3CFBA 4YHML 1ES0B 1FFOB 4IEFB 1JZ8A 3CVHH 5F1SA 4ZDHA 4PJ9C 3ZT7A 5AAMA 5DJ0A 4NBXB 4OZHF 2AAVA 1T89C 5SWQB 5HHXL 3WFDH 3NAAL 1P6AB 3FFCD 1ADQA 3BYYA 3EJZD 3FN0H 5J6GB 1UADC 3DX6A 3OAUL 4ZD3L 4XXDB 4ALAL 3CSBA 3MJ7A 4KK9D 1UWEH 1HSAA 3GO1L 1C08B 2VR9A 3HZKB 3HR6A 2X40A 2ZWLT 3AU1A 3C08L 1DUZA 4XH2A 2HKHL 1FLRH 1HWGB 4RFEB 3QB7C 5SWZE 5EC2A 3EYSL 3I85A 5ILTL 3TM6A 2FH6A 3S37X 1YEDA 2VXSL 4QOKA 1FO0H 1ZHNA 4KXZI 3F8UB 2WQ8A 2AEPL 3E6FB 2H9GB 5TGBB 2GT9B 4OZFB 1QVOA 4N5ED 1R3JA 5TQ0L 3RIFF 4LK4A 2HFGL 3PGCA 3FQWA 1IC5H 3HE7D 1NCBH 4JRXA 2DLTA 3BZFA 4FQJL 2FBOJ 4QRRB 5CILL 1DQTA 3MREB 3WBDA 5F9JB 3QDMD 3ZSSA 5T1DH 4LCCA 2HN7A 1DQQA 1W2KT 2QSVA 1U41A 4F7MA 3MMEB 2AS5M 1XR9B 3QQNA 4U6HA 5DO2C 3FT2A 2H8PB 4AL8L 3ZKMC 4TN9A 3RKDD 1TJIH 4F58H 4ETQB 1A3LL 2JTDA 4BH8B 2FX8L 3CK0H 3KNBB 1JPTL 4D2NA 3B8SA 4MSWB 1FNLA 3JTSB 4M7ZB 4MVBD 4XAKE 2XYCA 2NW2A 3FCTA 2HRLA 2ZUYA 3PWNB 1MLBB 3RU8H 1JMXA 4IIQC 4AEIH 2AERT 2CLVA 1SJHA 1QBAA 4IHOA 4P9ML 1AE6H 3F7VB 1YEFL 4GJTB 3BP6A 1CFNB 3FFCE 5C0CD 2H2SD 2ARWA 2Q7YB 4UV4H 2CKBA 2DQDL 5K59E 2J4WH 1OP5H 4BKLB 3CSYA 5DJDB 2BHZA 3QIWB 5DVNA 3DYPA 4ODXA 5DJCB 4ZAKB 5KVMC 3OG6B 4MD4B 3FN3A 1OTTD 3MACL 1PDKA 3EAKA 1BVKB 4M5YL 2OR9L 4AH2A 4DVRH 5GS0C 2R2BB 4X6DF 2WBWB 5JXAL 4MJID 1YPZE 1EO8H 1DBAL 4Z7OE 3FT4B 3QEGL 2VDMH 1ED3B 2VL5B 4G80B 1NSNH 4JJ5A 5JW4M 4Y5XA 1DUYA 2IQ9H 3IJSB 5F3BB 5HGAA 1KENL 3HTLX 1UXWA 2FX7L 5HYJA 3ZKXC 3G5VA 1XF3A 3QDME 3RWIA 4K23L 3WLBA 2NY2D 4NRZA 4OGYH 5K93A 2XRAL 1A1MA 3RTQC 2I07B 5C0DA 2EDTA 3I6KA 4MHHI 1RFDH 2OL3A 5I16B 3GMLA 3GK8L 2GJ6B 3UTSA 1G7MA 4X4MA 1SVCP 2VC2H 2BNUB 5D4QA 3C6SB 2NYYC 1X4ZA 3KJ6H 1PBYA 3GBMH 4CU7A 1S78C 2VH5L 4JVPA 1Z9LA 1X3DA 3QQ4B 3AVEA 1MLCB 1FIGL 4DEPC 2PR4L 4RDQF 3OKDA 5FKAB 1T2JA 5EWIH 5C0CE 2P47B 2P43B 1X5IA 4NKIH 3KHOA 3WIIH 5CJQH 3TYFB 4DJMA 3WN5A 1TXKA 1S7VA 2Y06H 3UCRA 2HT2C 3BPLC 1K3IA 3KPMA 4LLUB 1RIHH 1G84A 2Z91B 1FPTL 1IARB 2AABH 4FQCL 3TZVD 3F62A 3EIFA 1U8MA 3D2UA 3JWOC 5EO0A 4PD4K 5EUOE 1V7MH 5LBSL 2VXTL 5D7JA 3AM8C 3CLEH 2MSPA 3QISA 4MJIE 4DGIH 1F02I 5K33A 3K0WA 5KVEH 2ZKHH 1KT2B 4XBPB 4YWGL 1WCBA 4LSTH 3PF2A 5DQDL 3TIEA 3L3HA 4ZUUB 3MNZA 3GM0A 3WXVL 5DRWA 8CGTA 4HAFA 4P57B 3EFDL 2KZWA 4KQ4L 2G60H 1OL0A 1S7WB 3DV4A 3DIFA 3SCMC 4D3CH 4ZO7A 5AUMB 1A8JH 3EOBA 3KPLA 1X4XA 1Q9KA 3DRQA 5E2WL 43CAB 2IJ0C 3VXQB 3BKYL 3BFOA 4NPYB 1UFUA 4JG1H 1EGJA 5HHNB 4KK5D 4Y2DB 4KZDH 2R0KL 4GKNB 4U1GB 4YO0A 2ARJA 5LQBH 5E8DL 4PJAF 1RPQA 4XCCL 4FQXB 3WEXB 2WMPA 4HK3J 1A5FH 4JM4H 4XP1H 1RUAH 3MROB 1AC0A 4MNHB 3DX8B 5DWUL 5I2IB 2Z4QB 1G9NL 3TT1L 1NBZA 2D0HA 2FIKB 4QRRD 3D0LA 4G7YL 3QNXB 5E70A 4DN4L 2HFEB 3ES6B 1FP5A 3K4DA 3OZ9H 4NDMB 1CT8A 1BF8A 3GIZH 2A6JA 1FNFA 4NO0B 1IAIH 1T7ZA 2W60A 4ODHL 4WTZA 5F9WC 2YC1B 2DWEB 4JY5H 3D5OF 4F15B 3IAGC 1KB5L 3BJLA 3BZ4B 3L3KA 3WKML 3ZKQD 4O51A 1VFAA 5LG1A 5DJ2B 1QPXA 4M7KH 2FZ3A 4YR6A 3U0TA 3VFGL 4Y88A 1W8OA 1DBKL 2E6QA 2XKNB 1IL1A 2XY1A 4GW5B 1NMAH 1MPAL 2CK0H 4NFBA 3D39B 2P24B 3Q48A 4KKAC 4NRXB 4P46C 4FP8H 5I18L 4LKXB 3EDDA 1E4WH 2VXUL 3L3OA 1KEGL 2P44B 4Y19B 4WIQA 4JHWL 3KR3H 1XMWA 3JUYA 1H8SA 3PXHA 2A9NH 4KY1H 3CFCH 3MZTA 4XCFH 4Z7VA 2AI0L 4YDKH 2DL2A 1A7PH 3MV9B 3T1FA 3DOSA 5E24E 3O4LA 4Q2ZA 1IGYA 3QULB 3QIWD 4JZOA 5ESVB 1T66C 1BQHB 1H15A 3NPSC 2PTUA 4KRLB 5EORL 5C6TH 3RDTA 3H2WA 4ZAKD 1U8KB 5ACZA 3TJEL 2Z8WC 3R06A 3CDGA 2ZCKH 5ENWA 5DK0A 4HIHA 2ED9A 3S4SB 5FGSA 4Y4HD 5MHSD 4BFIA 3WXWL 3NIGE 4ZFGH 3ARGC 5TPWL 5HI5D 3UZVB 1K8DB 1V7NH 4JR9H 4GT7A 5DD6B 3GBLA 3T77B 5CD5C 1PG7W 5I19H 1L0YA 3A67H 3E6HB 4OZFG 4QRRE 1BAFH 3ZDYF 5DJ8B 2V5RA 2HT4C 3IGAB 4KRPB 2XOTA 4NM8H 1JYXA 4M1CD 4PJ5B 4B53A 3T0VA 4ZTPH 1EHAA 1K5NA 3V6BR 5DJ6B 1TENA 1E4XI 4R7NA 1O0VA 2EH8H 1KF9B 3OR6B 5D9SA 4NZDA 2GJ6D 4QF1A 4M9PA 5DR5H 4YC2C 3B6SB 4U2ZA 3ULVF 4F9LC 1FJ1B 1QO3A 2AXGA 5H94B 3HB3C 1A22B 4RAVA 3N0PB 4J2XA 1TMCB 1NGPH 4EBQL 1OGAB 1KPUA 4IBLT 7FABH 1URLA 5DC9B 2WBJB 4IRJC 1ONQA 5I1EH 5K9QG 3PP4L 3NACH 3QNYB 3S37L 4PJEA 4HUVA 1RUML 4CADB 3ARSA 5BJTB 2P7TB 2SEBA 3O3AA 1A3RH 5K9JH 2MFNA 4XCYB 1KCSH 4R90H 4OD2B 4HUWA 2AGJL 1S9XB 1J9CT 1P4LA 5MHSE 3FQNB 1AIFA 3CZJA 5ETUB 1ZLUK 4ODSH 2MTPA 4YPGA 3WO4C 1BJ1H 2VUOA 5JW4R 2VO5A 2OK0L 2EDQA 4S2SA 4JPIB 4KK9C 1I1AB 5FO7A 4P2CG 4HKXB 3SDAB 4NIKB 1LO5A 4DUXA 4QHNA 2HYMA 4Z9KB 5L6YH 3EOTH 5DVLA 3LS4L 1M6OB 4KTDH 2HMID 2DTMH 4MD5B 5AD0B 3VXPA 1ZLWK 4JFQA 4OB5L 1RZKH 4Y2DD 4TNWK 5FYJU 3GSNL 1A7QH 2GJ6E 1BZ9B 3RWEA 5E6YA 5H2BB 3PDGA 1PG7X 4FQ1L 2O61B 5DUML 5FK9A 3H42L 3HE7C 4FQXD 3TWCH 3QHTC 3EGSB 1BD2B 3OKMB 3WMSA 5E4EC 5FHBL 1JGVL 5HYFA 5EC1A 3GSOB 1NDGB 3MC0A 4UTBH 2W0FB 5CJ5A 2PN5A 4ESKA 4ZUWB 2QKIA 4NO0D 5DUBB 3SDDC 4P2OA 5F1KC 1FZKA 1D5MA 2XQYG 5B38A 3RX8A 4I3RL 1LE9A 5ICXB 4KJWD 1UH2A 1KNOB 4BA8A 5KBNC 1IAOB 3DTXA 5CEYB 3WUWB 4NP4L 1B2WH 3MRPB 5DLML 5EU6A 3D39D 4JVUA 5T3XH 1Z0MA 1UM6H 1U8HB 3ARTA 1Q0XH 3GSVA 1QBBA 1FV1B 32C2A 3EHBD 1NFIB 4R2GC 5IW3A 1CF8L 3OKOB 4Y19D 3WNPA 5H35A 2ZUWA 5BQ7B 4F9PC 1DN2A 4E0RB 1LDPH 3WL9A 3RUGA 3ILQD 4K7PX 5I30L 4XRCB 2ATPA 3MV9D 2JELL 2DKSA 2DKMA 1HQRB 3ULUC 3TNNA 5CHNA 1N0XL 5CLWA 5I66B 5FYLL 3HPLB 3O6KL 4JY6B 4APQA 3MA7A 3U7WH 2AW2A 1T83C 4ODVH 2DQFA 2EXYD 5IB2B 4J3WA 4P23C 2Y25A 3O2DH 1ZLVK 3BXNA 4LHUA 1S8DA 3QZWA 2R29H 1CLYH 4YHZH 1OPGL 2NY7L 4YXLH 2HKFL 1LK2A 2GTWB 5DHYB 4HXBH 4GXUM 4X4XB 1JYWA 2GUOA 1Q9OA 1FGVH 2F5AL 4RAUB 5ERWB 5T5NG 1SEBA 4B7LA 1WZ1H 1UJ3C 4PJ5D 1KJ2H 5D1ZA 3G6DL 4R96B 3T65B 3UTZB 5JHLH 5E94A 1MJ8H 4OFDA 2OP4L 4R4FH 3ZTNL 3P77B 4YFEA 3UYRL 3T8XA 4Z7NE 5F7WC 1HI6B 3GSUA 4OGXH 4HUXA 4Y5YA 4M8QA 3KGRA 3LY6A 5CWSA 1FFPB 4WEBH 4UOJA 5JNYB 3KXFB 4I18A 3S88H 3D39E 4QXWA 1XH3B 3ARXA 8FABA 2CSPA 1YECL 4HT1L 3W9EA 5EZJA 2FLBT 1I7TB 3RQ3A 2VABB 4Y19E 3SDXF 1JF6A 3P9WB 1CDHA 4XMKL 3TYGH 1OGAD 3ZYJA 4K3GA 2OI9C 2AJYH 3HE6A 1CLOL 1W0WB 3V6ZA 3S36H 2AJUL 3PABA 2WBJD 1LDSA 4M7LT 1ZSDA 5C9JA 1WV7T 4GRWB 4Q9QL 2HVKB 4LARH 4N8CH 2FWOB 4NOBA 4X5XB 4H20H 5GRVK 1AD9B 1JWSB 2Q86A 1BQHG 3CFKA 4WWKA 5TDNA 1DQLH 2E7MA 3G5XA 1XIWC 2HVJA 2GCYB 2GW5A 2A38A 4U1SA 2ADFL 3F6IA 3C6LB 3BO8B 5GRJH 3L3JB 1SYVA 2ED7A 4K71C 4ZPVB 3S4SG 1FYHB 3HZVB 3MXVL 4LDEB 1IEAA 1LE5A 1FORL 1I1AD 4QHMB 3SDAD 1LK3H 2EYTA 1OSZA 4JO1H 2XPGB 4P48A 1CICC 4HQQL 2LVEA 1NGXA 5DQJA 4PJ5E 2Y5EA 3PWUA 5F21B 5CBEB 1I3UA 4OCXH 5DD5H 5B4MD 3TA3C 1MRCH 4MD0A 3MR9A 3O6LH 1LEKA 4K2UL 3VFTB 1UCBL 5IIEB 3QHZH 4OLWL 1TETL 4HUKB 2EYRB 4LGSB 1ZA3A 1PKQB 4QTHB 5J0BA 3DI3B 5BS0B 1IGTB 1BJ8A 3N9GH 4PJ7A 5AZ2L 3OR7A 2P8PA 2C7UB 1BD2D 1FNEA 4GUPA 4J6RL 1T0MB 1JPGA 4EIGB 1WAAF 5IV2A 3T4AA 1IM9B 1AFVH 5EIVA 4X6FA 1MFCL 3BEWB 4YDLB 5CUSL 1INEL 4D8PB 1OCWH 1OGAE 3VXSA 3ESVF 4IOFD 4ZNCD 1D3CA 4Z95H 1MCIA 1ZLVH 5FOBB 1FNHA 5INCB 4XNUH 1S7QB 3NABH 2NXZB 2VWEE 3LRSB 3UDWC 1FZMB 4ONOA 5I1AB 5IHLB 4MCYB 1KGCD 3RVVD 2VITA 3ULSB 4JCMA 3DROB 4JN2B 1GOGA 3MLVL 4OZIA 3SGJA 4S1SL 3SJVB 1F6LL 5EFIA 1YEKH 4N8VB 15C8L 1JRHH 4TTDD 3PWPB 5IT2L 4KPHH 4NBZB 1A1NB 4Y4FA 5A43C 4XWGH 3CX5J 3GRWA 1LEIB 3MOBH 1HH9B 3V0WH 1BM3L 4PLOB 5D2LB 2EZ0D 5KVFL 4GG8B 1OAXH 4NQSA 4LVOB 3BQUC 2G5RA 4X7FC 3OXRA 3ROLA 3EJYC 4Q0XL 5L2KB 5D1QB 4YK4B 3IETB 2HG5B 2UWEA 1NAMA 2MHAB 3QIWC 1QSEA 4HLJA 3SBWA 1DEEA 4ZAKC 4HWZA 1X9QA 2D4FA 4TRPH 5EA0H 4NNXB 4NN6B 5T1LA 2YA1A 3L7EB 1G7IA 3IJYA 3RY6A 2HLAB 4YHOH 1W0VB 3IKCA 4Y4KA 3WLWC 2VAAB 4JDTH 1JGUH 4M6NH 4PGEA 4P3DB 2ICWI 2QQLH 3IDIA 1MCOH 4OT1L 1NBVH 4EUPA 2HJFA 2PO6B 2CDFA 3GUTA 3KYKL 4HC1H 4P9HH 2VZOA 1IAKA 1ZVHA 3JWDH 3MBEC 5J11C 1BD2E 4DK3A 4HWBH 5T1KA 1GGBH 2PXYB 2ZSWB 1NMCC 2GITA 5DK3A 5C86A 2WP3T 4HK3N 3VWKC 1M7IA 4ZS7H 5D7LA 1PZUB 3KYAA 4I5BB 5FUCE 5IEHB 1GXEA 1FL5A 4H26B 1A6UL 5E8OB 2BMKA 1N7MH 4XC1L 5IMLA 5CEXB 5D1XB 4JFDB 1HINH 4BZ2H 1BZ7A 4YEFA 4F2MB 3QI9A 4YDJB 1KGCE 4WO4B 5F9OH 4MCZB 4G8GA 4NQEB 4LCWA 2R1YA 1KCUL 1G6RL 4HJ0C 4G6ML 4MS8C 3FOLA 3KXFD 1K6QH 1YNKL 2FJGA 3T4YA 3DO7B 3STZA 1L4IA 4OLZL 4PG9B 3TH2T 3C9NA 3WUWG 4BFBD 3HAEA 1E6OL 3OB0K 5GJTL 3NBNA 1AXIB 5FYLD 3IXAB 3V6FB 3CLFH 5E6IB 3ARBA 4PG2A 4AZ8A 1M71B 2GY5A 1GC1L 2OJEB 2VLKB 4JLRA 5AYQA 3CFJB 4IMLA 2BNQA 2X7LB 4LGRB 3LSOB 5DURB 1CFQA 4CU6A 3OF6D 2E6PA 5F72S 4I2XA 1HOCB 4JDZB 1OW0A 5KTEH 1PG7L 1MRFL 4U1NB 3WFCL 5IQ7H 4F33A 1CFSB 2V5MA 5DJXA 4GRLB 1F11A 3I6GB 1CDGA 3D25B 4FFVC 4HWEL 2X1XR 3ZT6A 3C6LD 1HXYB 1S9YA 3B5TA 3TP4A 3JTTA 1S7TA 1KTDA 5IR1B 1INDH 5M94B 4JFHD 3ARPA 3O3EB 3HRPA 2BY3A 3ARDA 2IG2H 2QJDA 1F4YH 1U8NA 3PWJB 5SWSB 5JW3H 4GQ9H 4PRIA 5TH2A 5CZVL 2H3NB 3DVIA 4GMSL 2OZ4H 4RIRA 3PJSA 2I9TB 3P4NA 1G6RB 4L9LB 1NDMA 4XPBL 2FL5A 1FG2A 3K80A 2OS7A 4K7FB 3C8DA 2R4RL 1I9RH 2ATKB 4G9FB 1DDHA 1MELA 5IHUH 2I60L 4U1KB 1I7RA 1G7HA 1HSBA 2W92A 3QT2A 1J05B 4POZC 3CJJA 5BS0D 1F3RB 4IS6A 2QQKH 3KXFE 2C3VB 4G42B 4L1DA 1KIPB 4NCC1 4X80H 5I1KH 1D5BA 4HFUL 4M6OH 1ORSB 4U7SA 3WFBL 1IM9D 1WQVT 3O2VL 3HS0A 5FYLE 3VRLF 3IF1A 1ZHLB 4F15C 4XZUB 3RGVC 4ENEC 9CGTA 3O8XB 3QFJB 4R0LB 4JHBA 1EXUA 5EN2B 4CRPA 1AI1H 2EDBA 5DHXB 3GNML 2IBBA 1A4JA 3QIUA 1T5XA 2AJZB 2V7HB 4GRWE 4XI5C 3VD5A 5IOPA 2NXZD 3U9PH 3U4EB 3V5DA 4LEOB 2JIXA 1SQ2N 1TPXC 1GIGH 1TVHA 4HH8A 1T0NB 1NAKL 4QXUL 1CLZH 2FX9L 2MCPH 3SJVD 4GAJH 2NLJB 2IPUG 1I7UA 1KCRH 1U8LA 1BFVL 1RJZB 3E3QE 2BSTB 3PWPD 3EHBC 2XWTB 5DJAA 4PJCF 1PSKL 5ADPH 1AO7B 1OD9A 2QLVB 5D70H 4V2CB 3LD8C 2X4RB 3RPIB 3GMMB 5I15L 4JFHE 4KQ3L 1MHEB 5L2KD 3JSSA 5D1QD 5FDYA 4HEPG 2W0PA 3QEUB 2VXVL 1I85C 5HSFA 3GSWB 3ARRA 3DVNB 1S3KH 5IB3B 4ELKA 3EUUA 3QUYA 2RGSA 5GRUL 1RJYB 4DUVA 4ODTL 2Y5TB 1HQ4A 2B0SH 3QXTA 3LKQA 1G9NC 1R3KB 2RCSH 4DW2L 1MI5B 3OB0H 3GMOA 4X6DB 5C08B 4CU8A 3DLQR 2ARJQ 3EKCA 5C0JB 1PKQE 1CN4A 2PO6D 1C5CL 4PB9L 5C6PB 5BS0E 1X5ZA 3ARFB 3W39A 4X99A 4D9LH 3QO0A 4JRYB 4KRPC 3MLWL 4LNVA 4LSUH 5T33L 1YJDL 2PXYD 4MXQC 2XFXA 3NFSL 3O3DA 2BVOB 2J88L 1CGUA 1KIRA 3HZYA 4K9EL 5BV7H 1H3UA 3PNWA 5D2NC 4WENB 3NCCB 1T3FB 4OLYH 1KJVA 4KUCF 3ROOB 4M48L 4PRAB 5EBMB 4HW6A 5E2UH 1QLFB 4NUJA 3VXNB 5JPMB 4XPFL 3QP3A 1YY9C 1LP9A 4XVSL 2AQ3A 1OAKH 5D1XD 4JFDD 1GRWA 1K8IA 3GHBL 4I4WB 4YHYB 3MUHL 3TV3H 5DD0H 1OTUD 2IANB 2FRGP 1VADA 5F7EL 4WO4D 1C5BL 1IBGL 5DRNB 3SE4A 3SJVE 3CX2A 4NQED 1HWHB 2NTFA 4ZUSA 4NUGL 1EVUA 2B1AL 4UT6L 4I0PB 1IAII 3C5SB 4O00A 3PWPE 4F3FA 2V2WB 3W11D 4UQ2B 1AGEA 1A3QA 4N8VG 3G5YB 1OQOA 5D2LE 3T3PE 4U6VL 5KJRL 4O9HL 2HLFD 4JO2H 4TNVF 1KN2L 1XGRA 3LQAL 3G6AA 5E6ID 1G7JB 5BXFB 3M1BB 5L2KE 3ABZA 5DT1H 4CKVX 5E03A 1YPZA 4ELMF 1E4XL 1Y6NR 1DQJB 3E1F1 1G9MH 1FH5L 4RFOL 2VB5A 4LSSL 5DURD 1BREA 1RVFL 5D7IB 1F8TL 1R5WA 5D6CA 4ZTOL 1U93B 1L6ZA 2XWJB 4YHNA 3SE3A 3WNLA 3DHJA 1MFAL 1NCWH 5I8OL 4X8JB 2VDQH 5D5MF 1P69B 1IGML 3DUSB 3S3PA 1OAQL 1RZIA 4U1IA 1BOGA 1UM5H 5CIPH 2BC4B 4GRLD 4LHJB 3QUMH 3QJHA 3Q2CA 1CFBA 2F8OA 5IB5B 4EI6B 1PYWA 3TPUA 3F7YB 1I1AC 3V4PL 4I0KA 3SDAC 3LN5B 1NCUA 1T5WB 1C7SA 4AMKH 3H7BA 2EO1A 1FZOA 3R4DA 1I1FB 1V05A 5C7XH 5C3TA 3O45B 4Y16C 2AXHA 4JO3H 4BSVB 5SWSD 1L7IH 5E5UB 2IGFH 2AV7B 2H26B 4JJHA 1NQBA 4M00A 4PJIF 5K9OA 4EI5B 4RA3A 1YYLL 1D5IL 2UYLB 3IJHA 5I8EB 4OZ4A 3Q5OA 4JFDE 4M43H 4XVJL 3RVWD 5C0CA 5KVDL 4M5ZL 5DDHA 4G9FD 1T6WA 3R1GL 1ULVA 4NQEE 5AG8A 1QRNA 5GZOD 3L7FB 3DGGB 3BYTA 3D18B 4Z78A 1UEMA 5ABDE 1UVQA 4KHXL 3T2PA 1XGYH 1YEEH 3TNMA 4K3DL 4QNPE 3VH8A 5EUOA 1JK8A 2V2XA 4A6YH 4NJ9H 3HI5H 3V2AR 1ROWA 2GIYA 4LPYA 1R0AH 3QFJD 1CGXA 5TQ2H 5LGHH 2ICES 2VLKE 1A02N 3DUHA 5D72H 5JIKA 1WUNT 4FNLL 2PTTB 1U91A 4N9GA 5KANI 1QFUL 3DETD 4TTDC 3O0RH 5E6ZA 4NZRH 5HI4D 4U1HB 4XC3H 2OJZH 1DVFC 4NZUL 2B4CH 1LO4L 2Y6SC 5IB1B 3OGCA 1YC8A 5DTFB 3SGDH 3WFEH 1INQA 1A6VL 1AO7D 1TCRB 5GGQL 4I9WD 4M4PA 1EFQA 1BGXH 1UWGH 2HH0L 3ULVL 2IBGA 2DQHH 4ZFZA 4RMRA 1VFMA 5IHBA 1TJHL 4Y5VC 5SWSE 2BRQA 4XP5H 4XNYL 2V17H 1TZIB 1D9KA 2JB5L 1RULL 1YDPA 2FJFB 3LQZA 4H5SA 3FB6A 4JPVH 1BBJB 5E8NB 1OP3K 5GGVL 2PYEA 4PV8B 1MCSA 1X6LA 2W9DL 3OMZA 4KRMB 1YMHB 1MI5D 1RUQL 4X9HA 5DQ9B 3OKKB 1SYSA 5C08D 5FM5O 2IH1A 4G9FE 4YHKL 3S5LA 4PTUB 4KROC 5TF1L 2I5YH 2EECA 1YEIL 1S7SB 4BZYA 1JHTB 2OTWB 3ARFD 3RZWA 2W9EH 4JRYD 1B0RA 3TZVA 1B0WA 3VFWB 1FFQA 1QYGH 3BE1L 2Q76B 4MHHG 2AV1B 1C7TA 3HMXH 4IDJL 1EHXA 5J12B 4PJ7F 3T0EB 5JMOC 2NY1B 1ES0A 4R8WL 3S34H 3QFJE 4PJ8B 3QEHB 4PFEA 5EOCJ 1AJ7L 3ARQA 3BDYH 1VGKA 5SWQA 3WS3B 3P0YH 5IVXA 2C3HA 2B20A 2IAND 4OF7A 3ZE0F 1QLEL 4CAGA 4Y89A 1MAMH 1U42A 2D9CA 4XXDA 1KBGL 2HRPL 4LL9A 5I1JL 4YXHL 4I0PD 1C08A 4WJ5B 3ZKNC 3WIFA 5E95B 1MCRA 1G7QB 4OZIF 2HJKB 1AO7E 4WU5B 3EDJA 5I1GL 4DZ8A 3UYPA 4I9WE 4XPTH 4JG0L 4TQEH 1F3JB 5JORA 4JFZH 3TJHD 1F4WH 2DDQL 2LAAA 1CD8A 3BSZH 3E6FA 2H9GA 1LNUB 3P9MB 5EG6C 5TGBA 5L2JB 3QDJB 4OZFA 5JOEA 3ECBA 4LMQE 3FAXA 4TNWF 3S9DB 5EU4A 3LPWA 4WFFD 1MHHB 4KV5F 4QRRA 4LQ1A 3N1MC 5EPMB 3LRGA 2XKUA 2WIIB 3MREA 4KTEH 5F9JA 1XEDA 3WHXB 3DARA 1MI5E 3MLZH 4TUOA 1H3XA 4LU5L 3KPNB 4X6DE 3MMEA 5C08E 5I1HH 1WT5C 1XR9A 4UIKL 2GJZB 3BHBB 1QOKA 4X4YA 3BN9D 1I3RB 3GHEH 3J7HA 4P3CL 2ZUXA 4PUBH 3F7PC 4N8PA 4JRYE 5EZOH 4OBSA 4ETQA 4NJAH 1CXIA 5CGYD 4GXVH 2ADIB 5IGXH 3QDHA 1W0YT 2ZUQC 3T0XA 4YDIL 4JFFB 2K7QA 3O41A 3TO4B 4MSWA 3JTSA 5ACLA 4OSUH 3A6CL 2W0KA 4IRZL 2CD0A 2VDKH 1MCPL 3PUCA 5GGTA 3SPVA 3PWNA 1MLBA 4N9OB 5F7FA 4UILH 1M7XA 4EI5D 2CLRB 1FE8H 2NPLX 3PL6C 4NQTA 3MRHB 1HE7A 3F7VA 3MV7B 5IESL 2M2DA 4Q6IB 5J9PA 4I77L 1XF2B 4NQUA 3NGBC 1HHIB 2IANE 1ADQL 2PKDA 1BZQK 1GZPB 2GY7B 5FYJD 5L9DH 1P6FA 4RMQA 2O5YH 4EDXB 5DHVB 5GGSA 2EIBA 1XF5B 5JMRA 3K8LA 5DJCA 3BKCL 2AJ3A 2DLHA 4MD4A 3PGFH 3ALWA 3RNQB 2NZIA 2D3VA 5DYOA 2E27H 3EYQC 5F1IB 4RAHA 5GRYA 1S5IH 2UV3A 1BVKA 4RDQG 1OP3H 3WE6B 1CDJA 1T0PB 5FM8A 3P40A 2R2BA 4Y4HA 3BESR 2NXZC 1G1YA 3FT4A 4YNYB 1ED3A 1I9IH 1MFEL 2VL5A 3RGHA 4G80A 1IGJB 4WFFE 5HDBF 4QRUB 4YQXH 5D7IE 5FEBA 5F3BA 3HC4H 1R3LB 4TUKH 1UG9A 3WCYA 3DRTB 3OJDB 3IFOB 4OAWB 1KULA 3LKPB 4XP4H 1FSKB 2I07A 2VR5A 4UDUB 1XF4B 1N6VA 1QR1B 3ARYA 3LB6C 4JPWL 4YK4C 3CFBB 4OLEA 5I16A 5F96H 4MXWH 1L7TL 4HS6B 4OQ1A 5CKAA 4HPYL 1HKFA 5DJ0B 5JDSA 3KPSA 3VXMB 3C6SA 4O02H 1GCFA 1FNGB 1EEYB 3SOBL 3QQ4A 5CGMA 4RISH 3QIBC 1EJOH 1HSAB 1UJTA 4OKVB 4XBEL 2PO6C 2JE8A 2V2TA 2HJLB 1N4XL 5DJZA 5DD3H 4NCDA 4PP2B 5FYJE 5HDQH 3WNOA 1DUZB 2FNBA 3TYFA 4XH2B 2CKBL 1RI8A 4RGNB 2EEBA 4K8RL 1KJMB 4G5ZH 2QSCL 2Z91A 1RAMA 4RWYH 4XAWL 1OAUL 2CK2A 2VERN 2VDNL 4PJDF 1JNJA 1R3JB 4NM4L 3PGCB 3HHRB 1W72H 3T0ED 3FQWB 4LDOB 1QP1A 2NY1D 4UTAL 1F4XH 2YKLL 5FF6B 3U30C 1DL7H 3X3GH 4PJ8D 5HDOA 4XNZC 2X89D 1DANU 4L29A 3SO3B 4MB4A 1KT2A 4LCCB 4XBPA 2HN7B 4DKAA 5BCAA 1FAIL 3MV11 1MWAH 1IQWL 3ILPB 1E28B 4ZUUA 5B8CB 3MOQA 4KKBD 3FT2B 2ZJSL 4P57A 3U36A 3W11C 1S7WA 3Q5TA 4JZNA 3ULVD 2NNAA 2YBRA 4ZSOB 2QSTA 1YEHH 2FIRT 4HLZH 43CAA 5C2BH 1Z6JT 3DURA 3L5XH 3BRDA 3AREC 3SDXB 2OL3L 2C3XA 3J8F7 5HHNA 1ZTXL 4Y2DA 5GGRY 2P8LB 3PHOA 2DQUH 3O2WL 4GKNA 2ERJB 3IRZA 3VJ6A 2CLVB 1SJHB 4P5TC 1A7NL 4XVUC 4IHOB 3DPBA 3QDJD 2DJ4A 4FQXA 3T1WA 1JRHI 3P30L 3WEXA 4LIQH 4MNHA 2A6KB 5C8JB 1HYRC 4GBXC 4OCRH 3DX8A 5I2IA 2Z4QA 4OM1L 1CZ8L 1RJLA 2CKBB 1HHJA 2FIKA 2YPKA 3CSYB 5J1SC 3QNXA 2OM5A 2HFEA 4HK0A 4NDMA 4UOW0 3LN4A 4LCIL 4H0IA 2YMXL 3CVHB 3KDMB 3VG9B 5FA3B 5FA4B 3P73B 2OQJA 4OD3H 5D6DC 5E8PB 3BZ4A 5DMGC 3T2NL 5IHZA 4Z8FH 1NLBH 2XTJC 4OGAD 5HHOB 2DM3A 3C60D 3ZDYE 4F80A 3QWOB 2DLGA 1T2QH 2XKNA 5F1NB 2EEAA 3E0GA 4JFFD 2ICWB 3BRFA 1GAFH 5FUOH 3TO4D 3T0EE 2FO1A 3CH8A 1DUYB 2P24A 5HGAB 4NRXA 5FXCH 1UXWB 3I84A 1QFWH 2BZDA 1KB9K 3V8CA 3RWIB 3DVGA 5CZXD 3Q1SL 4XPGL 1T22A 2GSIB 3G6JA 4MAYC 4GMTL 1A1MB 5IBUB 1FNSH 2GI7A 3BKJH 5E1AB 2JCCF 1MY5A 1FO0B 2GTZB 4NFDA 4G3YH 2QHRL 2OL3B 3HUJF 2KBGA 3MV9A 1LP9F 1GC1C 3DHMA 2BXZA 3QULA 3O4OC 3ULVE 2EYSA 1Q1JL 2HTLC 1G7MB 2DQEL 2X4NB 4PRNA 5ESVA 1BQHA 1MCWM 4CVWA 3INUH 1KFAL 1U8KA 1E6JL 2CMRH 4MAUH 2DB8A 4Z0XB 3O8XC 4BZ1H 3KLAB 1EGJL 2QQNL 5DZOA 1NCCL 4S0TD 3S4SA 3FZUC 3RBSA 1FRGH 5MENB 4UUJA 1CR9L 3QDJE 4ONFL 3I2CL 4GAGL 5SX4H 1K8DA 2F54B 1FAKT 1IKFH 2C5DC 4XP9H 5F8QC 5A2KH 3MGOA 1GPOH 3WN5B 1S7VB 3E6HA 3FO2A 2JB6B 5E5RB 3IGAA 1T1WA 3KPMB 4C83B 2DBJA 1QTYT 4PJ5A 1GGCH 3NZHL 3SQBA 1RHFA 2XQBH 4NWTH 1U8MB 3D2UB 4U1LB 1RZFH 5DJ6A 5I76B 4KKLC 5EO0B 2LU3A 3LCYA 4ONGL 1HYSC 2AJVL 2BK8A 5EIIA 5ADOH 3UJIH 3CMOH 1QEWB 1EFXB 1OARL 2ENSA 1CL7H 1MREH 5DFVD 4J4PC 1A6AA 4KK6D 3VXMD 4JFFE 4PLKD 4NHCH 3D3VB 5E2TH 4ZO8A 3TIEB 3L3HB 1UYWH 1C12B 1TQBC 4KDTA 1OLZA 5H94A 1QFHA 1D6EB 3DV4B 4H0GA 5GS0H 1T89A 3MRGB 3MV7E 5CJQL 1I4FB 1ZS8A 4QRSA 2WAHA 2UY6A 2Z35B 1PAMA 4FQLH 4G6KL 4P99A 2VOTA 2AQ1A 2WBJA 4RGND 2DAVA 3HMWH 1V3LA 1LVEA 3C5ZC 3QNYA 1RK0A 4OLUL 4CADA 3LKOB 2P7TA 5HYSB 4XCYA 4V1DB 3H9HB 4DGIL 2ZUUA 3HNVH 4OD2A 1ZKAA 2AEQH 4LSVL 3LAFA 1MHPH 1NBZB 4J3VA 3IDXL 1EVTC 4XP6H 5FGBC 3FQNA 4JANA 5ETUA 4YHYC 5BW7A 1BEYH 4MA8H 3V8OA 2CXKA 2A6JB 3CU1A 1JGLL 3PDOB 2W60B 3SDYL 3MXWH 4HKXA 1CFTA 2EXWD 2C1PB 3O6ML 1JHKL 2C9AA 2Q6WB 4OCWH 2A1WL 3LN9A 4F37K 1I7ZA 5A1AA 4DK6A 3FQXA 2FZ3B 3S36X 1H0DB 4YR6B 2Y72A 3ESUF 2ADJA 1M6OA 1IL1B 2DF3A 3TJHC 1PVHA 3QDAA 2H2PD 2FGWH 3QRGH 1ZVSB 3V5KB 2VIRA 1MCJA 2WUCL 1N0LA 5F8RC 6FABH 4YZFF 5H2BA 3C2SA 2APVA 4MLSA 3P4LA 1WVZA 3VXME 2O61A 4OKDA 5TE7H 2Z9TA 1VSCA 2A9ML 3T2OA 5L88H 4U2YA 4DGYH 1A64A 3MRNB 3JWOH 1YEGL 2Y4SA 4K8RD 3T1FB 1A14H 4Q2ZB 1L0XA 3HA0A 5C0RL 1YJDC 5JLZA 3GSOA 2E5EA 5IBLC 2F58H 2W0FA 2EDNA 5F7DB 3MLXL 5T3ZL 5ACZB 5FO9A 2AXJA 2GYSA 2NW3B 4JKKA 2R56H 4HPOL 4RGNE 4P4KB 5E7FA 1YQVL 5AZEH 2YD3A 5DK0B 2YRZA 5HHOD 2YPVH 5ICXA 4KKCD 5KSAC 4DFIA 5I1IL 3O11B 3VCLB 3M17B 5CEYA 2X4TA 3MRPA 1XR8A 2AJSH 4CN4A 1HKLH 1LO3H 4PPTA 2A2QT 4R97C 3ISWA 4YIQB 3BPCA 1P4BH 1U8HA 5C0ND 2HFTA 4M62H 1FV1A 4NQXB 4XGZB 2CLZB 1Q0YH 1ZT7B 5BQ7A 1EV2E 4N1EA 1K5NB 5I9QC 3LQAC 3F58L 1V3MA 1RHHB 1MFBH 1F6AA 4XRCA 4KFZC 1A6ZB 1HQRA 5D9SB 5I66A 5IVXF 5DGQA 3S6CA 5CEZH 1EEZB 3HPLA 4ZSOE 1EERB 4YE4H 4L8SC 5BOPA 4HKJB 2BVUA 1EX0A 3GKZA 3W81A 2IAMC 3LIZH 3SDXE 4LASH 1QO3B 4XWOD 4D94A 5ESQB 4N0CC 4WVRA 4RAVB 2B1HH 3AMKA 3UEZA 1OWRM 3QQ9C 5MEND 4UV7H 4X5WB 1J12A 1P9MC 2DQTL 5JW5A 5DHYA 2F54D 3HLAB 1KPUB 3C2AL 4X4XA 5IBTL 2XNAA 5JTWA 4O5LL 3IU4H 3H0TA 3WNMA 2X4UB 4FFWC 1SY6H 4RAUA 3UPCA 5CLTA 5M95B 4G6AD 4DTGH 4PJCB 2SEBB 3O3AB 4R96A 4IRSC 3FO1B 3D2UD 3VDCA 3TFKD 3LEVH 4JM2F 3X3FL 1EAJA 2X4OA 1HI6A 5HHOE 1R3HA 4ERSL 3MRKA 1EFXD 5ESAB 4WUKL 4FXGA 4YPGB 3SE8H 1AD0A 3DV6B 3QG6A 1Q72L 3SN6N 2UUDK 1CD9B 3D3VD 1BBDL 3DGCR 3KXFA 1IGFL 1RMFH 2D7NA 2D7PA 2XA3A 4NNPL 5J1AA 5JNYA 3AM8A 4X9IA 1XH3A 3E8UL 2MPAL 2P42B 1LO5B 2D2OA 4CMMA 2VDOH 4TSCL 3I50H 1A1OB 4AEHL 3QPXL 2EIEA 4GS7C 5ELIA 3D9AH 3D1MC 3DUUB 5IBUG 3VXPB 4OM0H 3BH8A 5DFWH 3Q6GL 3OF6A 1WAAE 4KUZH 1OTSC 4FQIH 1SEQH 5FK9B 5FFLA 3HC3H 3S35H 1GH7A 3DX7A 4V1DD 4QYOA 4K94L 5KSBF 2NY6C 4DKEH 3QCTH 3GI8H 2GCYA 1MJJA 3C6LA 3BO8A 2ESVB 3L3JA 5FUZH 5MENE 4OFIA 3VDAA 4Q9CA 5EC1B 4Z0BL 2Y9RT 4ZPVA 2F54E 4HS3A 1X5AA 1JNNH 5IW6B 2CUIA 2BX5A 5ALBL 3FT3B 1KUMA 1T7YA 2GSGA 2W38A 5DS8A 2DJSA 2BDNL 1D5MB 1JYVA 4CDHA 1DEDA 2EO9A 2MQ0A 3KS0H 5JW4Q 5DRXA 5B38B 4P9HC 1CK0L 5CBEA 3P0VH 1LE9B 5T1MA 3MBXL 3PGDA 2VSDA 4NKOB 3QUXC 3LZFH 1MIMH 3DO3A 3VFTA 1M7DA 2QEJA 3L5JA 1CU4L 2EYRA 4JHAL 4P5KB 3GSVB 1WWBX 2JJVA 5J06A 4PRBB 1XAUA 4FABH 5BS0A 2EDEA 3D3VE 5C0AA 1KOAA 1ND0B 4R26L 1A4KA 2VJXA 3SGDI 4OIIL 2CO7B 3KLHD 5D5MB 3TNNB 5CHNB 1IT9L 4OQTA 3BEWA 4DAGH 1DBMH 4RFNB 4APQB 2E8ZA 3MA7B 3SKOB 5AYUH 3FHAA 3B9KC 1QA9A 4P4KD 1S7QA 4DQOH 2XIDA 3T0DA 3LRSA 2K3TA 2YWYA 1DFBH 1FZMA 1S8DB 2X1PA 4K3EH 4MCYA 2VLRA 5I1AA 1X6NA 3IFPB 1MSPA 3DROA 1K9TA 4JN2A 1B2WL 4TULL 3SJVA 4V1DE 3LS5H 1WLHA 1F4AA 4HDIA 4JQVC 4HBQA 2HFFA 4PJIB 3U82B 1T21A 4LPUA 5HYSG 5BVPH 1A1NA 4LNRA 5D93B 2A6DA 4Q6IC 4XTRD 1LEIA 2BFVH 3FQRB 3ARGA 1HH9A 4Z7WA 1SEBB 3MRBB 5D2LA 3E2HB 4GG8A 3LEXB 4FOMA 1NEUA 1S7XB 5D1ZB 3VMNA 3FMGH 3UC0H 5D1QA 2AVGA 3IETA 1UM4L 2HG5A 3NVQA 2MHAA 5HPOA 5EOQH 3BMVA 3VG0H 4G8FB 1OT1A 3G04B 4LVHB 3U7YL 1AP2A 5GSVB 2ZOKA 2UUDH 4M8QB 3MCKB 2YA0A 4Y5YB 2YD9A 2YD8A 4J8RA 5HY9A 4PBXA 1VFBB 1RUPH 5EU3A 2IFFH 4I18B 3VGGA 1IAIM 1MCNA 4OF0A 4PREA 1U6AH 2VAAA 4N0YL 12E8H 4P3DA 2ICWJ 1MQKL 3W9EB 3N85L 1WBZA 1WF5A 2IF7A 1SBSL 1IGIL 2E6JA 5CCKH 2FATH 4QGTA 4EXPX 3TLRA 4UT7H 5EZIL 2PXYA 1X5GA 3QCVH 3QUZB 1D6VL 2DI7A 2QHLA 3IAPA 3CUPB 4I5BA 1IKNC 2IWGA 4ZO9A 4H26A 3GJEB 5E8OA 1B4JH 5LXGL 1AGBB 3CFKB 3C8KA 1B0GB 1X5KA 4X8XA 4JFDA 4PLJD 3KAAA 3G5XB 4F2MA 2X1QA 2QR0B 4YDJA 4WO4A 3ULUH 4KK8D 4MCZA 1EDQA 1SYVB 1JV5A 1I1CA 4QT5B 2XA8L 1IEAB 4HGMA 4D0DB 4JN1H 3HNTL 3ZL4H 3NTCH 4LLMB 1OSZB 3GRWL 3EO9H 4PG9A 1SVZA 2VDRL 3SE9L 4MMXC 5HPMB 1Y6KR 1RV6X 4KVNH 3IXAA 1JN6B 4M61B 1G0XA 3V6FA 5E6IA 4NQCB 1HH6A 3RPKA 4WFED 4MD0B 1CIDA 1M71A 3MRFB 1NAML 1LEKB 1X5FA 3BIAX 1ZHKB 3CFJA 3G6JF 2N7BA 1TTUA 1Z3GH 3LSOA 2Y36L 5CAYB 3K46A 1HOCA 4FQPA 4JDZA 4ZFOA 3A6BL 3WIHA 3VRLE 4PJ7B 4F8QA 3OR7B 3NA9H 1CFSA 4GUPB 1FNEB 4ZO6A 4KUCD 1HXMB 3SO3C 4GRLA 1KJ2B 4LCCC 2IBZX 1FBIL 3P3YA 2LTQC 1HXYA 2ESVD 4OZHA 4RNRA 3M8OH 2ICCA 1MNUH 1B88A 2A83A 1I9JL 4G6JL 1IGCH 3O3EA 1E4KA 5GRZA 2GK0A 3K2UL 3B2VH 4O58L 5HD8D 5HBBA 4UNVA 1H3PL 4PJCE 4OZIB 4LOUD 3SDDA 3CFDB 2I9TA 4I0CC 4U1JA 3GKWH 4XMPL 3LMJH 3I3EA 3CAFA 3VW3H 4K7FA 1OAZL 4G9FA 4LVNC 2AK4A 2WINB 4OCSL 4P59H 5GJSL 4GKZB 4NQSB 3I9GH 4RRPA 1J05A 4CUCA 4EZMA 2C3VA 3SGEH 2BJMH 3R0NA 2OLDA 1N8ZB 4AM0A 1KIPA 4TVSa 2A0LD 1NAMB 2NQCA 3K1DA 3VGAB 2G9HB 3OWEA 4HWZB 4BH7A 5H37G 4CVZB 1EK3A 2VKXA 4XZUA 4XBGB 4WFEE 1G7IB 1ZANL 4APQD 4CNIB 3TIDB 2R1XA 3EDKA 3BD4A 5CSZA 3IKCB 4Y4KB 4LLYB 2EDYA 2AJZA 1RIUH 4X4ZA 3IDIB 3U4EA 4HCRA 1FDLL 4LEOA 4IJ3B 3A6OA 4EUPB 3GUTB 1T83A 3PIQB 4GW1B 4HXAL 4Y5XC 2H6PB 3VD7A 2NLJA 2XQYK 4WCYH 2WUBH 4EDWL 1QKZH 3U1SH 5JXED 1RJZA 5TE4L 2BSTA 3R0MA 1YZZA 4FXKA 3BZDA 2XWTA 4LAQL 1NGQH 3EYOA 2CIIA 4JREC 2ESVE 3TT3L 1AO7A 1QUNA 3CC5B 1UC6A 5D7LB 3RPIA 2RFXA 3GMMA 4OFYD 1DJSA 4FMKA 1K4DB 5D1ZD 1MHEA 1DLHA 3VFUB 2BMKB 4N68A 4KJQC 4PP1C 3QBTB 5MEOB 4DKFH 2P5WD 3QEUA 1WTLA 3MUGA 4HIXL 2R2EA 3DVNA 3QI9B 5SV4A 4Z7QF 1HDMB 2NXYD 5FCSH 2Y5TA 3BKML 4G8GB 4M7LH 1ZT1B 4LCWB 2R1YB 5B38G 3BGFC 1R3KA 1A7RL 3I3DA 3ETBF 4M93C 4YHMH 5BO1L 3MCLL 4HMEA 3T4YB 1MI5A 2R9HC 4HD9A 3STZB 5KOMC 4X6DA 3GIVB 1F45A 5J89A 4J7RA 2ZG3A 4F57L 5C0JA 1CVSC 5KANG 2NZ9C 4HWBL 5HHXH 5HXMA 2FD6L 3NAAH 3WN5C 3ARFA 4JRYA 1SM3L 4CMHC 3MLUL 4RQQA 3U9UB 3VFOB 3WKNA 4JLRB 1NCAL 3OAUH 4ZD3H 3RFZC 4ALAH 1UZ8B 4IMLB 2BNQB 3QUZD 5HHMB 2BVOA 5D5ME 3QXVA 4MQXC 3VMPA 3RZCC 3GO1H 1A6TB 5MI0C 1T3FA 3VXTB 4MDJB 3VGHA 3ROOA 2B2XL 3VGFA 4UQ3A 4YPJA 2LQRA 3CX5K 3IDUA 5EBMA 5GXBB 1NGYA 3VXNA 2HKHH 2QADB 5D7JC 5T3XD 5FIEA 3MJGX 4GG6A 5ILTH 3EYSH 5DJXB 2VXSH 4LLQB 4I4WA 3MZGB 2AEPH 3TN0A 5E4IA 4XHJC 1S9YB 4P3WA 3PWVB 5FGRA 3L9RA 1HN1A 2EE3A 1JFQL 3V95A 5HHPA 4K07A 1T03L 5GHWL 2Z31A 4Y2OA 1J1OH 5TQ0H 2HFGH 4I0PA 4PJIE 4R7DB 3C5SA 5CKGA 2YXMA 4FQJH 1LO2L 5CILH 3PP3K 1AR2A 2ITDB 2C4FT 4DWHA 3G5YA 5TH2B 5FECA 4M6AA 5EUKB 3FRPA 4NQCD 1G7JA 5BXFA 3M1BA 4RIRB 3TC9A 1JZ6A 3QSKB 4AL8H 4AIZB 3ARVA 1NDMB 1DBBL 1FG2B 4EVNB 2X4SB 1A3LH 1QFWI 4KHTL 2FX8H 4UI2A 2ZPKL 4PGJA 3TA3A 1I7RB 3RHWK 1JPTH 2HTKC 2XWJA 1G7HB 2OTUB 4X8JA 3DUSA 3AB0B 1U3HC 2PNDA 1D5BB 2OCFD 1P1ZB 5IB5A 4P9MH 4EI6A 1YEFH 2WLYA 3F7YA 3QAZB 3EFFB 1T5WA 3CVIL 4MNGB 4ACPA 2DQDH 4D9QD 5BMFL 3DXAA 3O45A 1KG0B 4NC1E 1T5XB 2OZ4L 1ODAA 2CKNA 4M03A 4BSVA 2AV7A 4JPKL 3RL1B 5FM5M 4EI5A 4XNXL 1TVHB 3FQTB 4HG4K 3MACH 5SX4I 5T3XE 2CJUL 2VN4A 5I8EA 4M5YH 2OR9H 2P1YA 1TQCB 3AS1A 3DI2B 3UDWA 1DQML 5DJAB 5JXAH 2WM0A 2X6MA 1AH1A 1DBAH 2J8HA 4HS8L 4PJAA 3QEGH 3L7FA 3DGGA 3RY5A 3D18A 2ZCHL 1OSPL 5I71B 2FX7H 4NN7C 2QSQA 1VKXB 3L5WA 3RJQB 2IBZY 5FCUL 4K23H 4UZGA 3RDTC 4U7KA 2XRAH 3TBVB 1CL7I 4NQCE 5SV3A 1J1PL 2NTSP 4OCLC 2YUXA 4Y4KD 4LCYB 4LSPL 3GK8H 2XKSA 2PTTA 3IXTA 4LF3A 1XCQA 1BMGA 4DN3L 2VH5H 3RKPA 4PJ7E 5GS2H 1KN4L 3QO0B 4WI9A 2ZSVB 5DSCB 4KDWA 4U1HA 1FIGH 2AK1L 2PR4H 1HZHL 4TTGA 2XFXB 5IB1A 5DTFA 1RZGA 4XCNB 1TCRA 1PQZB 3T09A 2DTSA 1T1ZB 3MBEA 3REWB 5D7LD 3ZE0E 2JCCB 4D9QE 3HUJB 4L3EB 1LP9B 4WTWA 2NY4C 1K8IB 3VWKA 4LPWA 5FKPB 1FPTH 1TZIA 4FQCH 3QI9D 5D8JL 1F58L 4OF8A 4OZIE 1BBJA 1BJ1J 4G8GD 5E8NA 4HJJL 4LCWD 1A2YB 2R1WB 4PV8A 3PP3H 4KI5C 5DD1L 5LBSH 2VXTH 4F3FB 5DQ9A 3OKKA 1AGEB 3OV6A 4NQDB 5JIHA 4R4NC 4FZ8L 4PTUA 3CIQA 2DM4A 4YWGH 1S7SA 5DQDH 1XGRB 5L0QB 4U0QB 4KV5E 3WXVH 1WBXB 3EFDH 3VFWA 2FEDD 1JGEA 4KQ4H 4YHPB 1YNTB 4X6CF 4LRNL 5HHMD 4QTIL 5E9DB 2AV1A 3MRDB 4V2BA 2OX5A 1JZ5A 3N1PC 3EYUL 5D6CB 1P84K 5E2WH 3VXRB 3RAJL 4YHNB 3BKYH 3AS3A 5KN5A 1U8PA 3QEHA 2DS4A 2QADD 5FHAL 2EDXA 1GOHA 1RZIB 4U1IB 4PBWD 1BOGB 3GMNB 3ZHKA 2R0KH 3WS3A 1CXEA 4S11A 3STBA 3MJ6A 4C57C 3QJHB 4W6YB 1AC6A 5HGGS 2DWDA 5E8DH 1ZK9A 4XCCH 1PYWB 3MGAA 3ZDXF 1G0YR 1UZ6E 2Y07L 4EUPG 3TH4T 4Q9RL 1WIPA 5DWUH 4K55A 1G9NH 3TT1H 1I3VA 4YEEA 4WJ5A 5HJ3B 1BQLL 2XZQL 1G7QA 1YMMA 4G7YH 1JTOA 4YXKL 5ISZA 3IFNL 4DN4H 5D7LE 5K9OB 2ITCB 3D87B 3FHQA 4ODHH 1KB5H 1LNUA 3P9MA 5L2JA 3QDJA 3WKMH 2DBLL 5LAXA 3VRJA 3BWAA 3RVTC 1RY7B 3VFRA 2WBKA 2H41A 5DDHB 3VFGH 1DBKH 1MHHA 1C16B 2EDWA 4E41A 1AHWB 3OAZK 4G8GE 4LCWE 1QRNB 2WIIA 1MPAH 2W59A 1UVQB 3WHXA 5BV7B 3V4UL 3ZSTA 1PLGL 3BUYA 5I18H 2C1OA 5AEAA 3TNMB 3RVXC 2GJZA 1FQ9C 2VXUH 1KEGH 1H3TA 4YBLB 5D71L 3VH8B 3F12B 1JK8B 1I3RA 2J6EA 1ZOXA 3BEVB 4JHWH 4P2OC 5HDBE 4WFGD 3S98A 2QQQA 3C60A 2LU7A 5J3HC 4OI7A 2AI0H 4H1LH 4JO3L 3U6RB 3GJFA 3WD5L 2D7MA 2BNQE 5HHME 3TO4A 5I73B 5GS3A 3RGVA 5EORH 1ACYL 1U91B 2FB4L 2CIKA 1YEJL 2CLRA 3TJEH 1AR1C 2BXYA 1AGDB 4X6EB 1J8HB 4UNTA 3B2UC 3B3IB 1XF2A 2EIZB 1XT5A 1HHIA 4ZNEA 4LLDB 3WXWH 1INQB 1AGCB 5TPWH 5EOTB 4ZYKA 5ICZA 4BUHA 4WHYH 4MA7L 3U83A 4ZFZB 1XF5A 5DMKA 3W82A 1II4E 3RNQA 1P4IL 3DMMB 4NJ9L 5JZ7D 3F5WB 2BVPB 4RFNC 2CR6A 2AP2A 1D9KB 1YDPB 1MCDA 3LQZB 3WE6A 2YS4A 1T2XA 4FQQB 3FB6B 5CIPB 3BZEA 3MRIB 4QWWD 2PYEB 5IJVB 1FC1A 1N2RA 3HRZB 3QUMB 3B8YA 2J12B 3N1GC 5KVGL 5K59F 1SYSB 4QRUA 5DRZA 3S5LB 3SKMB 2OR8A 1A0QL 5ALCL 4W68A 3MX0A 3QHFH 3DRTA 3MV01 4NN5C 2L4OA 3OJDA 3IFOA 4OAWA 2Z0BA 5D93C 3LKPA 1IC4L 3E2HC 4YGVB 1XGQB 1QBML 4UDUA 1XF4A 1I8IA 5D1ZC 5LCVL 3LDBC 4ORZC 2IPUK 4WFGE 4EBQH 1U3ZA 4HS6A 4MNGE 1O7VA 1QLRB 1RQ5A 1J7VR 3VXMA 1Q9WB 4FMFA 3PP4H 4L3ED 1VGKB 4Y5YC 5IVXB 1FNGA 3S37H 1EEYA 5I8KL 1RUMH 4JGJA 4PS4L 2KPNA 5GGTL 4XPAL 4I18C 2X4QA 5GZNC 4NKMA 4ZXBA 1PGRB 4OKVA 2AGJH 2HJLA 3WIFB 3GSQB 2X10A 3OBAA 3D85B 4PP2A 2OXHA 4NQDD 4DZ8B 3MGTB 1KJMA 4CW1A 3C09C 3P4OB 3HE6C 2OK0H 2KZ1B 5JORB 5GISL 4WV1B 2PCPB 4FTVD 4FG6D 4NC1C 1DANT 2KQNA 2G75B 1AXTL 2R69L 2NY5C 3ECBB 1BECA 4HIJB 5I8CB 3KJ4B 5EU4B 3OAZH 5E9DD 3WUZA 4L3AA 3W9DA 1UQSB 5FF6A 3LS4H 3VXRD 4WWKC 4JM2B 2BY0A 4OB5H 4TUOB 3GSNH 2O5XL 3BVNA 1KCVL 3ILPA 1UEYA 1E28A 1NLDH 5B8CA 1TVDA 4FQ1H 5JO5A 5DUMH 1MRDL 3H42H 4X4YB 3VD3A 4G7VL 3ULUF 5CFHA 1ZT4B 4QCIB 3BPOB 3FTGB 4CDGC 4XPTL 4ZSOA 1QBLL 5FHBH 4FN0A 2BHYA 1WFNA 3O41B 1JGVH 1ZLSL 5CD3B 3BJ91 5CP3A 3SDXA 4XB8A 3SPVB 3EO1B 2P8LA 2JCCE 2NR6C 3QEQA 3AY4A 5CJOL 4HUMB 3FRUA 3HUJE 4L3EE 2N7AA 1LP9E 2NY0C 4Y16A 4XT1C 3W2DL 5J9PB 2FECL 2J5LB 5HGDB 5C8JA 2A6KA 4I3RH 3UO1L 1JNLL 1A9BA 1U8OB 1U8JA 1JP5A 4KVCL 4U33A 1QRND 2NX5B 4BUGA 4NP4H 2B8OT 5GGSB 5KSBB 2XZCL 3LH2L 1DBJL 1KLUB 4MZ3A 5DLMH 4AK1A 3OJMB 1S9KC 4FS0A 5FO8B 1J0JA 2AJ3B 3LKNB 4NQDE 3CVHA 5DYOB 3KDMA 2BSSB 1JPFB 5FA3A 5FA4A 3P73A 1CF8H 5E8PA 3FB7B 1FGNL 1S9VA 4MMZC 4JKWA 2E9JA 3VFVB 5HHOA 4Y4HB 3GGWB 2R8SL 2F8XC 4PRPA 1IQDB 3QWOA 2XZAL 1U8IB 2JELH 5F1NA 4JY4A 2NY3C 1N0XH 2ICWA 4UILL 1UCTA 2R2CA 5E9DE 5FYLH 4Z5RA 4DGVL 2FEEI 3SGJC 1VGEL 1U95B 1NFKA 3O6KH 5I17B 4ZS6D 3VXRE 2FBJL 4KZEL 4Y4FC 3ZKSD 4S1DC 2GSIA 1J8HD 1U58A 2FJHB 4TUJB 1IAMA 3GEWB 4EJ1C 4EOWL 5E1AA 3WHE0 3H3PL 1FO0A 2GTZA 3QO1B 5D7SL 1VPOL 1OPGH 2NY7H 3B9VA 4GG6F 3UJJL 2HKFH 4JEGB 1NC4B 2VXQL 3SBWC 4BK4A 1CG9A 2X4NA 1HNGA 2BSRA 5JDSB 3KPSB 1WAAA 2X9YA 2F5AH 4NYLA 3DMMD 5JQ6L 4Z0XA 3WFZA 3KLAA 4KKNA 3RY6C 1D9KD 3CZFB 3G6DH 4P5MA 4U0RC 2R0LL 3N06B 2OP4H 5MENA 3ZTNH 2PYED 2X70B 4PV9A 2MJWA 2VQTA 3UYRH 4PY7A 2V5TA 3LKRB 2V2TB 2F54A 5DJZB 2OMBA 3B9AA 5M7QA 1QRKA 3OB8A 2JB6A 5K9KB 1QRNE 4MQSB 4C83A 2WWMD 4OCYL 3IYLW 3L1OL 3OJ2C 1YECH 3B5GA 3BW9B 4HT1H 1VB9A 1BX2B 3VWJB 4NO3A 4U1LA 5I76A 3FOMB 4NSKB 4XMKH 4XNMA 4MXVE 3T04D 1QEWA 2D0GA 1EFXA 2ADGA 1JJUA 4UB0L 1CLOH 3VH8G 3MLTB 4OLVL 4L29B 1KXQE 2AJUH 3CPLB 5CSBA 5I75B 1H3VA 1R6VA 4BQCA 1U36A 3RA7L 5ID1B 3D3VA 4Q9QH 3O6FB 1UA6L 3LPGA 1C12A 1TJGL 2PETA 4QRTA 5C0FA 3U36B 1BFSA 3CDFA 1D6EA 1IC7L 4YAQB 4JZNB 1J8HE 1JI1A 1ZMYA 3MRGA 1I4FA 2NNAB 3BRGC 1M1SA 2YBRB 4YZFE 2ADFH 2Z35A 3D85D 4JO4L 3ARBC 3DURB 4PG2C 5DEGA 1KIQA 5A2FA 1WEJL 3MXVH 2E7CA 1YY8A 4HHAA 4OJFL 3PHOB 3SGKA 5DJYA 3SHSA 1MH5B 2B5IB 1FORH 3VJ6B 1EO7A 2J2ZA 3LKOA 2EEDA 2F5BL 1I3GL 4HQQH 5HYSA 4V1DA 1OW0C 3H9HA 2CR3A 1RU9L 4UDTA 2XG5A 3PE9A 1RJLB 1HHJB 2RQ8A