3MJ6A

Crystal structure of the gammadelta t cell costimulatory receptor junctional adhesion molecule-like protein, jaml
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
SPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPRDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Junctional adhesion molecule-like
publication title The molecular interaction of CAR and JAML recruits the central cell signal transducer PI3K.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj6A02
1UB6B 2AEQL 5DQDL 2CPCA 3RVTC 2A6JA 2HWZH 1PW3A 2XWBA 4XWOD 4OCWH 1AD9A 1JGUH 5JPMB 2HG5B 1XGPB 4H1LG 5JIPA 5K9KB 1TITA 1A7NH 5JPNA 4N0UE 2C3WA 4NO3B 3G5YB 2DLIA 1KCSL 1FV1A 2Z91A 3BE1H 5F71A 2MQCA 3SE4A 4J2XA 4NYLA 1N4XL 3W0WD 2AGJH 3FQUA 3QJHA 4J1UA 4J3TA 3WEXB 5IKCB 5HSFA 5C0BE 1IEHA 1DZBA 3KS0J 3MJ7A 4IMLB 4ZYKB 5FFLA 2WMPA 3S9DB 2XWJB 3DMMA 3VI4E 3U36B 1YN7A 3UTPD 5DHYB 3I02B 5F44A 4GW5B 3CFEA 5HYSA 5MENB 1ZLWK 1A4JB 4KRLB 3FT4B 5BJTA 3Q1SH 4OCSL 3ARFC 1AFVL 4U1LB 5GGVH 1MFAL 3BRGC 3O2DA 4HLJA 4BQ8A 4ZOEA 2QSQA 4EVNA 2EDRA 2BSTA 4JG0L 3DRTA 5EULV 1ZE3C 2NY6B 2OXGA 4HKJB 3BJLA 3EZJB 4IRJC 5INDA 2YN5A 3VGBA 3AU1A 5L6YH 1A14L 1AJ7H 4FFYL 3QHZL 4EIZC 2EKSA 4HQQL 2K7PA 1L9NA 1T89C 5KSBA 3MA9L 1IEAA 3TA3B 1II4E 2KZ1B 1LVEA 1RHHA 1N3NB 3CH8A 3KPSA 2X4RB 4NKOA 1OGTB 3P4MA 3WFCH 4XPHL 5DRZB 4URTB 3L5HA 3SQBA 4AQOA 4ZAKB 1F3JA 1IM9A 4ZSOE 1JHLH 3QXAA 3ZDZF 5C0RH 1I4FA 3N06B 3GSWA 3QAZB 3NCFB 1OAKL 3KPLB 3D5OF 5CEXB 3Q3GB 1INQB 4FABL 1VACA 1WZ1H 1ZANH 4FQXA 5HHOB 2HJLB 1MCWM 1L0QA 2P4AB 2VITA 3MRNA 2APFA 5FUCE 5LXGH 3AREA 2XNAA 1AKJA 4QHUB 3GM0A 3DNKA 2A0LC 2YD4A 1MCHA 4J4PA 1A8JH 3ZKMD 2D4FA 3RX5A 3IDYC 1JL8A 3EKCA 2EDTA 5C0JB 4JANA 1CU4L 3SKOA 1U95B 3BDYL 1EO8L 5BQ7A 3V6OC 3L3KA 4M03A 4XCFL 1ZT1B 5I76A 4ZXBB 4Y16A 3DUHA 4JE4B 2NLJB 2KUTA 1SMOA 5C07D 1JYWA 3IVKA 1R5WA 4DK3A 1WIOA 2I9TB 3UTSA 1LHZA 3SY0B 2ICWA 1RUKH 2F9BT 1JGLL 5H2BA 3DPBA 2AEWA 1Y0LA 1YEJH 2FZ3A 5IMKA 1RPQA 2V5MA 3BZFA 4FQCH 4TUKH 2JB6B 2CRZA 2YBRB 3MUJA 3NTCL 3JV4A 4N8VG 1SM3L 2CDGB 1T04A 1J5OL 4IDJH 3NCYP 4JZOA 3MV7A 5KZCD 2MMXA 5HGAB 2J8UB 2X1XR 2QTEA 1EAPA 1KJVA 4G8IA 2R1XB 5DJZA 4KZDL 2XKSA 3VFPA 2VAAA 3RWJA 4LASL 3AS3A 3C08H 4HIIA 2P48B 5ETUB 3L3DA 1DL7L 3OG4B 5EZIH 2XTJB 1J0ZA 1IAKB 1S7TB 5LAXB 3ARPA 1QUNA 4OV5A 2NZIA 4U05A 3C2AL 1BFSA 4NM8L 2ZJSH 1A7BA 1FNFA 2EH7H 3MRLB 2XQYG 3CSYA 4RFEB 3RPKA 5I66B 5JOPE 3AB0C 1OD7A 4E41A 1PFCA 2BVQA 4H8WC 5JR1L 1G7PB 4CN4A 1LEIA 1YEGL 1DUZB 1KB5L 4HIEB 4MB4A 4Y0GA 3FQRB 4NKDA 4F3FB 1G7MA 4ODUA 4AL8H 3VFTB 1X7QA 5DFWH 4NJAL 1GIGL 4XVSL 3K74B 2P24B 3BIKB 2ZZUT 4P2QD 5CSZA 1DN0B 4KH2A 3DIFB 1TJIL 3LSOB 2EO1A 3LKRB 5FKAA 5F96L 5IBLC 4RNRB 3U2SA 4PJEA 2I60H 5E6ID 1JZ2A 2AXFA 3VFWA 5LGJB 2EDEA 3V7MA 1PBYA 2VXTL 3ARZA 1FN4B 2VXUL 4FZEL 5E8OA 5JW5A 4LSDA 3FTGA 4R96A 1NCNA 4NQSA 3VXMB 3OSKA 3L3IB 1JWUA 1KIRB 2C4XA 4X7TB 4PJCA 2BNRD 5AYUH 5IK3B 4MNGE 4JZNB 5AG8A 4YDIH 3IDUA 4MAUL 4KKLC 1T5XA 1MCIA 3FQXA 4GRLA 1DEEB 1TPXB 4DVRH 1IRAY 3B3IB 3UPRA 5L9DL 2QJDA 2XQYK 4PG2C 3RX8A 3EO9L 4ODWA 3MBED 5FHAH 4R26L 1QKZH 2E6JA 1L6ZA 2A74B 5IWLA 2MCG1 1I75A 4HKZB 2Z8RA 4LEXL 1UM5L 4JRYD 2NW3B 3IU4L 1RJLB 5H94A 2NY7L 1DBMH 5EC1B 4WV1C 3QHZH 5DJ2A 1ZA3A 4GRMB 4B5EA 3B5TA 4TVPL 2CK2A 2F15A 1CR9L 4WEBL 3GBLA 1F2XK 2JB5H 1CZ8L 3O6LL 1KJ2B 5F97E 4P49A 1HH6A 3B83A 3G6AB 1XGQB 1EERB 3TP4A 3VDCA 5IG7A 1C12A 1BFVH 1U8JA 3PWPD 4MYWB 5DEGA 4KRPB 3CXDL 4ORZC 5GGRA 2AI0H 1VGEL 1CDGA 3B2UC 3TVMC 5EU6D 4AEEA 4DUXA 5B39B 5AUMB 4M6NH 1Q0XH 4NQVA 1HHKA 1HINL 1NAML 5BO1H 4S1DD 3S98A 1YMMD 3MV8A 1ORSB 5F7LB 4ZTOH 3VH8A 4LSPL 3X3GL 3VW3H 4XXDB 1MH5B 4Y5VB 4YE4H 1LO5B 4P46A 1T66D 2HLFC 4OZ4A 2QKIB 3K2UL 3V5DA 1TQCB 5JDSB 2D03H 3GMNA 1T7ZA 1TZGL 2XA3A 3UP1A 4YHMH 1YJDL 3MXWH 5EO0A 4F58L 1MHPH 1X6NA 3IGAB 2Y7QB 3MLWL 2BY0A 3WV0A 2WNGA 1LNUA 1TZHB 5ESQA 2VSDA 4YWGH 3ZHKA 1S9YB 1ZEAH 4DVBA 5HHPA 4PRBA 3MRJB 3M8OL 4JFEB 3C5ZA 4NP4H 1N5YL 3BRDA 1YQVL 2ILLA 3T2NH 1V3KA 1WFTA 1G7JB 4LNRA 3TIEB 4CDHA 3RVXC 4QXUH 3D39E 1YDPA 2ADGA 3WKMH 2HA1A 3QXTA 3RAJH 4LARL 1EA9C 1VB9A 1U3HC 1A6VL 4XCYB 3OJ2C 4X8XA 1MY5A 1NSNH 1PZUB 2Y23A 1EHLH 3MPCA 3TBVA 2X42A 3F65A 1M7IB 2O5YL 4IOIA 2ERJB 4TUOA 1N5AB 3FN0L 4HS8L 4R4ND 5SX5H 3G5VA 3N1PC 2YSSA 3SDCD 3PP3H 2C7UA 1V7NH 3QO1A 3CVHH 4TQEH 2HJFA 1K4CA 4M00A 2ADJB 5SV4A 3RKDD 2H2PD 3MV9E 4Z8FL 3IAQA 3HZVA 5I17B 4S2SA 5ADOL 5D7JB 3MYZA 3QUZA 4YEFA 3Q5OA 1D5MB 4IOFD 4N8CL 4DGIH 1DLFL 5LBSL 3NCCB 4RAUA 3ZL4H 2FD6L 3LEVH 1I1AB 4JFDE 3VXSD 1IT9L 3RWIB 1IGML 4JM2A 3PWLA 4R4BA 3TPUB 2GIYA 3ESVF 1MCEA 2D2OA 4GXUM 3KYNB 5IF0B 4CVWA 3KPRD 3QXWA 5IW6A 5EU5A 1Z3GH 1K8DA 1AIFA 3SDXA 1X5AA 4JAMB 1ZHLB 3MRKB 1WT5C 1A6AB 1A1NB 3W5MA 3LQAC 3P9MA 4ACPA 2YD3A 3IKCB 2DKMA 1NGPH 5E9DD 5C07B 1FVDB 5DRXA 3ULUF 1A3RH 5HPOA 2YPLB 8FABB 1WIUA 4OFIA 4MNQD 5HHQB 1D5ZA 3RVUC 1GGBL 3B9KA 2X09A 3RY6A 4RMRA 4HUUA 4MDJA 3JBG7 4Y4KD 2EDHA 4J7RA 3O2WH 5IESL 1M05B 5EC2A 4J3SA 4JKMA 3BH8B 2FBJH 4OQTH 3K46A 4E5XB 5J13C 3HC3H 3ARDA 5D6DA 2R4SH 4KKBD 1MNUH 1BIIA 1FZOB 2JK5A 2X4NB 2OL3L 3U0TA 4XP6H 1X5KA 5J12B 5KW9H 5BMFL 5ICYB 5B3NA 4D9RE 3OF6D 4KJWC 2B2XH 1JYVA 3TIDA 4LHUD 4BFIB 4FQQB 5BZDA 3O4OC 3EIFA 1K2DA 4J3XA 2WZPD 2KDGA 1UG9A 4LLVA 3FOMB 2QHRL 4AYFA 2UZIL 5KSUB 5IP4A 3ARTA 2AABH 3AS1A 4GMTL 2P8PA 1LO2L 3FO9B 4RISH 3DTXA 2BXYA 5E8NB 3T0BA 3VXPB 5MENE 5D7KE 2NY7H 5L7XL 4PJ8C 2Z35A 1BZ7B 1GCFA 4PJ7A 1F4WL 3LMJL 4AENA 3LRSB 5FA3B 5DO2D 4YXHL 4F33B 3P2TA 1XZ0B 3PDOB 4PREA 2Y25A 1JF1B 4OIIL 4NIKB 2FL5A 4MX7B 1CQYA 2YRZA 3L3GA 3QXVA 1YC8A 4MA3B 1ZA6B 2P8MB 1OGAA 3SJVA 5KTEL 3MGAA 3HMXL 2OR8A 4KUCF 1H8NA 3P73A 3RUGA 3G6DL 3I3DA 5BVJA 2YD5A 2J8UF 4WNQB 3RI5F 5HVHB 5DRNB 4ODHL 4BQ9A 3L3OA 4ZO9A 1ADQA 2H26A 4QRUA 1JF6A 2WINA 5C0IA 1MJ7L 1QBML 5C09B 4HF5H 3F12A 3L5JA 3IYLW 3MODL 1XGRA 1FPTH 4OGAC 5E94A 2YKLL 4NC0B 3ULVL 1KJMB 4LCIL 4UDTB 3ULUE 1WZLA 5HI3C 1CGSH 2HFEB 5C3LD 4ISVB 4DW2L 2OS7A 1FSKC 3OAZK 1JE6A 3KYAA 2D9CA 5E2TL 4P2OA 1HYSC 3S35L 4FQIH 1CFQA 5HHOE 4CJ1A 3TO4A 2R39A 2R2EA 4JFQB 2IALB 4JRYB 3L3JB 3JVGA 3BPOB 4QHKJ 3WFBL 1T7YA 4APQB 5CUSH 4K7FA 4O51A 3D9AH 4P5KB 2E5EA 4ZD3H 2ICWI 2FH8A 4N68A 4O2CB 3JSSA 3RTQD 1ZT4A 4L29A 5J8OA 3HNSH 1BQHA 1WAAA 3UBXG 1E4KA 4KKCC 4GAYB 3T65A 3HUJB 1QP1A 5E99H 3RZCD 4GJTB 3ELAT 1JZ4A 1U41A 4U0RC 5FOBA 3WO4B 1QLFA 4RBPK 4XNUL 3IFNH 5I8EA 1E4XL 3S4SB 4NKIH 4NSKB 2P5EA 1NC4B 4LEOA 5J1TC 4NO0D 3D85D 2H8PB 3UPCA 4MXVF 4JLRB 4YDVB 2C5DC 2Z92B 1L7TH 4M6OL 1MCFA 4LBEB 1JZ8A 1KC5L 3QWRD 5IHLB 3MJ9L 1YMMB 2P7TB 2GUOA 1BLNA 3QUXB 4YHYB 2R9HD 1Y6NR 1NGXA 3WS3B 4BUGA 4HWNA 2E6PA 4ZO8A 4QRRB 2QSVA 4GBXC 4GLRI 3DV6B 4LSVL 3NZHL 1MAJA 4GMSH 2CR6A 4H0HB 2QADC 4LVEA 3TYGH 3ARBD 1EEZA 1QNZH 4HH9B 4JO4L 4A2MA 1UZ8A 2BCKA 2IQ9L 12E8H 5CMAB 1U93A 2AJUL 4WUUA 3RKPA 2V2XB 1NCDL 2J8UE 3C8DA 5L8KB 3VDBA 3IETB 5DUPH 3EZ8A 3PGFH 2HFFB 2Q8BH 4N90E 5EN2A 5J9PA 5GGQL 1N8ZA 1CLZL 4KJQD 4JVPA 3BP5A 3EFDL 4WFGE 4ZPTB 2XTJE 4QXGL 1P7KA 3MNWA 2IGFL 4XZUA 1R3IH 1EHNA 4L3ED 3QIBA 1J1OH 1YEIH 3P4NB 2VZ3A 3PP4L 3SDCB 2VLJD 5JOFA 4MJ5A 1UVQB 1Y18A 2Y5TB 4LKCA 4MCZA 1M6OA 1JGEA 1KCRH 4WEUD 3UEZA 2VZSA 2R8SH 4MJID 5D6CB 2EYSB 1YYMH 5CZVH 4ZUUA 2C1PA 1KNOA 3QWOA 1FG9C 1REIA 3QNZA 4LK4A 4GOSA 1BEYH 4TSBL 4UUJB 4LPXA 1WWWX 3TV3H 3GSVB 5EU7E 3VD3A 1IAIM 3JWOC 1ZWIB 4PP2A 3VXSB 5BXFB 4JHWH 3BWUC 4CMMB 4CVXB 4Y5XC 4QRSB 3LKNB 2JJTC 4LQ1A 5F7FA 1KB9J 2WUCL 4L8DB 4XP5H 5C08D 3VXME 5I9QC 4MXVE 2IBGA 2XZCL 2VL5B 2R0ZL 4K23L 5BVPH 2UZYB 4LL9A 3KPRB 1IAOA 5DYOA 3LD8B 3TJHD 3LVEA 1H0DB 3M45A 4ZFFA 4PJBB 5SWZA 5IFHL 5I1KH 3HR5A 4Z7QF 1CBVH 2ORBH 5MEOA 5TQ2L 5E4EB 3PV6B 4ZPVB 1A22B 4PJAB 2DMBA 2DB8A 4WFED 4LLAA 4OIIH 2PO6A 5E9DB 5C0CA 1KPUA 5I1EH 3RWHA 3DGGB 4NC2B 2X70A 4MNQB 1NUGA 1TJGH 2YOCA 4LLYA 3CFDA 5E6ZA 3WMSA 3Q5YA 3TNNB 1KPVB 1EHAA 4Y4KB 3LN9A 1P2CB 3UBXB 3L5XH 3OKEA 2B5IC 4IRJA 4I18C 1QFUH 3FT2A 4AG4H 3E6FB 2A6DB 3JZ7A 3OB0K 3RWDB 4MQ7A 1O7SA 3T2QA 1QBMH 1T89A 4K9EH 5DI8B 2DQIL 4LQFH 4QYOA 1AGCA 4PGBB 4RFOH 3SDAA 1WCBA 3IB4A 5D7SH 5EFIB 5GISL 5IM7A 4UIKL 2P5WD 4BSVB 3IFLH 4NQCD 1UM6L 2BRRL 4CMHB 1NAKH 1J18A 1P7QA 4F7CB 2NY3C 3UTPE 4HXAL 3T4YA 5IB4A 3UROR 3WS6A 4JJ5A 3O3BB 3PL6A 1G6VK 4LCCB 3MLPA 3P4OB 5AYQA 3WFBH 4IJ3B 3I75B 3BQUB 1BF2A 4C56D 2QQLL 4HIHB 1C5DB 3SE3C 1H3VA 4KUZL 3OBAA 3V52L 3ARGA 5HGBB 1I9JL 3VRLF 5IB1B 4CADA 5DGRA 1FZKA 4X7DC 4RDQG 4F37K 3DXAA 5I74C 3G04B 3CVHB 4Y2DB 3Q6FA 2GQHA 4EDWH 5C7XH 4JFEE 1RZGB 5F7WC 1NCBL 3BO8A 4L8CA 4XAWL 4MSWA 1U8MA 3MRRB 3CC5B 3VD4A 1XR9B 4P4KC 2EDFA 1FNSL 3N85H 2CO7B 4UV7H 1I8MA 4AH2A 3STLB 4JO2L 2H9GB 4U3CA 2AJVH 4OT1H 4DKFL 3S36L 4HFWB 3TN0D 3BD5A 4TSAL 4H8WL 5IW3A 5ESVB 1RZJH 1NJ9A 5GIRB 1RJZA 3E3QE 5KAQG 4Z7QE 3MCLL 5I1JH 1F13A 4LIQH 5FO9B 4D0CA 5E2UL 4M6ML 4M3KB 2DQCH 3C6LA 1MQKH 3D0VB 2O5XL 5DJCA 5CAYB 5F8QC 2VDOL 3T4AB 3EYVA 1EZVX 4PP1C 2CLZB 2AJYH 3EDDA 4KDTC 2YS4A 4S1SH 3S7GA 4N9GA 3VXRD 4Z6AT 3OR7B 4JO1H 4NCC1 3SQOH 1MHHA 4JG1L 4MVBD 1WLHA 3QUML 4HKBB 1YY8B 4LP4A 3NFSH 5I1CH 1NGYB 3MLRH 2EC8A 4FN0A 5ITBL 4U6XA 1AY1H 1QFOA 3REWB 3D25A 4Q0XL 5DVNA 5ENWA 3ZE1F 1HI6B 4CRPA 3AC0A 1U8KA 5T33L 3TCLB 3GRWA 1KYOJ 5EOTA 4XT1C 4ZOBA 5L2JA 3H9SD 4FG6C 4QCIB 4R90L 4W70A 5I8OH 2FLRT 3C5JB 3BGFC 1F6AA 3ILPB 1I8KA 1DBKL 1PDKA 1BQLL 4HKXB 4QRQA 5DRWB 2UYLB 4Y19B 3D85B 4QTIL 2VMFA 4S10A 1F8TL 5C0EA 3FFDA 1MJ8L 3GSUB 4OJFL 4PRIA 5ISZA 4C54A 1J8HD 4F2MA 4N9OB 5D5MB 2JF1A 1CE1L 4NFDA 4G9DA 3D0LA 1ZHKA 5C07E 4XTRC 2YPLE 4NUJB 3VRLE 5JHDA 4BFBD 4J8RA 4X6BB 3TGXA 1FJ1B 2AXJA 1IQWL 2IFFL 3U30B 3SGJC 2AJXL 1CGYA 1FNLA 2OSLB 2PR4H 2G75A 3OX8A 4Q6IC 4Y4HA 2GAZA 1NLDL 5E2WL 3ARBB 1IZJA 1TIUA 5D93C 5I1DB 5C0GB 5D1ZA 1ACYH 5I1GH 2IAND 1DSFH 4YPGB 2HN7A 5F7DA 4WY7L 2EIDA 4QT5A 3HUJF 5IVNA 2GJ6B 3QQ4A 5GGUA 5CIPH 3OKKB 3TFKC 1XGYH 3P9LB 3IFOB 3C87A 1B6UA 4U1HB 3QEGL 5CCKH 4OTXL 1WTGT 2Z31C 3J7HA 4KVCL 2VOTA 4JFDA 1IL1A 5FDYA 4FTVD 1FVCA 1TCRB 1QSZA 5JZ7C 2EE9A 4PG2A 1OP5K 3WIFB 3JTTA 1OCWH 2DWDA 1S7SA 1GC1L 1FZJB 2VLJB 4GG8B 3PGCA 3F6IA 3EYFA 4HMEA 4PV8A 5DJXA 3X11B 3FCTB 5IIEA 2VYRE 1KN4L 3IDMA 5DS8A 2EYTB 2WBWB 4TYUA 5IEHB 2PTTB 5IHUH 1SY6A 4WU5B 5GHWL 3ZE1E 1V8HA 4GXVL 4D9QD 2EC9T 4P2QE 2LTQC 3A67L 3DX6A 4KZEL 5DJ6B 1JTTA 3SKMB 4WI4A 1M7DB 3ZHLA 4P2RB 3EUUA 4EQ2A 4BQ6A 2XACC 3O8XC 5DR5L 3ZKXB 1K5NB 5KSAD 3P4LA 4WI2A 4MA7L 3RKDC 4Y4FD 2Q8AH 2F5AL 2DMCA 2FCBA 4CDGC 4WW2C 2XZAL 2R2BB 3QPQD 1QR1B 5C0AB 3PWNB 1AGBA 1D7FA 4P4RB 5DUBB 3JWDC 1OOAA 4M61A 2WBKA 2V5SA 1MRCL 4PRPD 4NBZB 4O5LL 2YPKA 3EYSL 5BV7H 2ESVD 3EW3B 3L7EB 4G6JL 4RAVA 1RIHH 4M48L 1QFPA 4ELMB 3AROA 4PJXA 2FGZA 4E42B 3IJHB 4XHJC 1RAMA 1XF5A 5I71C 3VXTA 5DDHB 2P8LA 2VZTA 3ET9F 4XBGB 1OAXH 4CKVX 4JRYE 4XAWH 1EAJA 1RZKH 5ADPH 5ALBH 4C58B 3CUPB 5C8JA 4OGXL 3TT3L 4YO0A 4OBRA 5JO5B 2ZG3A 5CJBA 4YR6A 5DJDB 3VG0L 4FRWA 4ZFOA 3HUJE 5D72L 3FN9A 4S0TD 3A6CH 5ESAB 4PLJD 3G6JA 2ZNWA 43C9A 5FK9A 5J7CC 1HHIA 1TETH 1JNHB 2DLHA 3O3EB 3VXUA 2P5WB 1KEGL 2G9HB 2PF6A 4V1DB 1F42A 2X4TB 4NQCB 1CXEA 5J0BA 3QI9C 1S78C 3UJIL 1JWMB 1YMME 3KPNB 1XH3A 1T1ZA 4JRXA 4HW6A 4RGOH 1W0WB 4PJBF 2BNUA 3IT8D 4XNXH 5B21A 3ABZA 5ABDE 2OQJA 4PJAF 3O81A 3QPXL 3JUZA 4MB3A 4QRTA 4C56B 4K7PX 4YIQA 4EIGB 4QRRE 1E4XI 3HFMH 4MQSB 4X4YA 3ECBA 2OR9L 1N3NA 1J88A 1Q9WB 4ZNEA 5F1NA 2EDOA 4LCYA 1A7PL 4L4TA 2Q86B 1BAFL 3P0YH 2AK4A 1MY7A 3IDGA 2XQBH 4NQXB 3FB7A 1JN6A 5T3XH 4EN3D 5JIHA 4WHYH 5J6HB 3KWWB 4XMPH 4LCWA 3INUL 1N26A 3KYMB 4OGYH 2UVEA 5IJKA 3NAAL 3V5KB 2FATH 4JFFD 1TVDA 2B0SH 4ZS7L 5FHBH 4E9LA 4F9PA 1CGVA 3IDJB 4JDZB 2DL2A 1WT5A 2NY1D 3P11H 4JR9H 1FC2D 3NCEB 4RGND 4PY8I 4W4OA 3EYOA 3FO2B 3V0WH 3S37L 5F21B 1ZMYA 3MLXL 4L1DA 4U7MA 5K93A 1TXKA 4HXBL 1IGYA 3H7BA 2ZCLL 3Q6GL 2FEEL 3RP1A 1XAUA 3RY4A 5HD8C 3O11B 4PJDB 1GRWA 5EUKA 2ARWA 5FYKU 3QUYC 5F9WC 4KMTL 4ZFZA 4ZS6C 1CLYL 3VXSE 1JRHL 1TZIB 3MTRA 5E0QA 5CEZL 4F7MA 3EJZD 4JZJB 1I7UA 1MCQA 1IGJA 4KVCH 2N56A 1BM3L 3ZE2E 5DJ0B 5E1AA 3KPRE 1R3HB 4R2GC 2BVUA 1HH9A 4DZBA 3NACL 4JCMA 4OCYL 5MEQA 5M94B 4HV8B 1G7HB 4O9HH 4WFHD 4PJBE 3WUWA 2PW1B 3OV6A 4HUXB 2PCPA 3QG6B 2OYPA 1PQZB 2BSSA 4NT6A 5DVOA 3SCMD 1MVFA 3UTTD 4L8SC 5DD1L 1GGTA 2OJEA 1NKOA 2YEZB 4PJAE 1J8HB 5FGSA 5IGXH 2X05A 4PJ8A 5AWNH 2DIAA 3G08B 5E9DE 4QXWA 2NPLX 5LGHL 1EVUA 4UTBL 3RDTC 1U92A 5CLWA 3T77A 4MNQE 1JZ7A 1I85A 1FQ9C 1S5IL 4AM0B 3A67H 2J5LC 3T1FA 1EGJA 4XC3H 1MRFH 4NNXA 4YJZL 5IR1A 4U6HB 5DD3L 4LDLB 4TRPL 3U82B 1RZ8A 1W0VA 1D5BB 5DD6B 2FHFA 4PS4L 4KROC 1SJEA 3MYJB 1FFPB 3GBML 5J6GB 2O5ZH 3NGBB 5D1QC 2X7LA 2XZAH 1D5IL 5E2VH 3O2DH 4DGYL 4P59L 3FQRA 3MRMA 3FB6B 1F2QA 3MZGB 3QA3A 4ELKB 4MJ6B 4X6FA 4JGMA 1XCTB 2AXHA 4GKZB 2W9LA 4UAOC 3MLUH 3E1F1 1QSFD 3VGDA 1BFOB 5IFAL 2EDXA 2NR6C 1MREL 1Q1JH 2MWCA 5GGRY 5T3XD 4BQCA 3HG1D 3M1BB 3O45A 3I6GB 4ORGA 4FTVB 3RRQA 2BNQA 4HIJA 2OJZH 3WE6A 2G2RA 2NY4C 4P99A 3VFMB 4GFTB 3CZJA 1X4YA 4LVNB 3RIFK 5D5MF 1DVFC 4OIBA 1FIEA 4MA8L 1MFBL 2F8VA 4MD5A 5DT1H 5CP3A 1YNKH 1A7QH 4GAFB 5MHSE 1G9MH 5DHVA 3BYTA 1NCWH 3X17A 3VJ6A 4M9OA 1AC0A 3QDGD 2HVKB 4IHOB 1P6FA 1U8OA 1U91A 5IQ7L 4WUKL 1WWAX 2SEBB 1OTUD 1KTDB 3MGTB 4OCRH 5TDNB 1NDGA 5K9OA 3CVIL 4ZTPL 3ILQD 3BEWB 3ZTNH 3MLVH 5I16B 5EBWB 5C1MB 2IG2L 3HMWH 1OW0C 4EBQL 2R23A 2H6PB 3KAAA 3VCLB 2CIIB 5EBGA 1IBGL 4IIQA 4NRYA 2HTLD 3AM8C 4U6VL 4UOW0 4I48A 5HI4C 4NZUL 2MHAB 4PRPB 2PW2B 5CSBA 2VN7A 5FYKD 1OQOA 5A2IH 4MWFB 4WO4C 3WSQL 3W0WA 4HUNB 4M4RA 4XCNB 1TDQA 3TNMA 4IRZL 3OKOB 5JMOC 2XXCB 2H3NB 1H3GA 2R2HA 1MAMH 3K4AA 4YFLF 3TT1H 3WNNA 5I1LB 3CLFL 4MZ2A 5D2NC 3VFVB 5B22A 4RWYH 4LKXB 5IFJB 3QH3A 3QIWB 3STBA 4PJIB 3SE9L 2FX8H 1QFWL 5FA4B 1EUUA 2WLYA 2XN9D 4D8PB 3JV5A 3A0OA 4ZS7H 5I15L 1MIEH 4XPAH 3HE6B 3H6JA 4ZUWB 4JPIA 1OB1B 4HMCA 4JFPB 5EDXA 3BHBA 1HHGB 2VQ1B 2ICEA 2YMXL 1NFKA 3DSFH 4Y19E 5B8CC 1DBAH 5DZOA 2XFXA 4UV4H 2NNAB 3WHXB 3D6GA 2DJSA 3V6FA 2VABA 1AXSB 4K2UL 1RV6X 2J1KA 4K07A 4MXQC 1WF5A 2FWOA 1ZLSL 1YEHL 2BERA 5JOEA 5D5ME 5CJ5A 5I1HH 4WW1B 4WHYG 1YNLL 1HXMB 4G7VH 5GS1B 5E00B 2V5TA 4KDWA 1YMHA 3VFUB 4ELMF 25C8L 3ZYIA 3C8KB 3DHJA 3IJSA 4O58L 1T03L 3KPSD 3NH7H 3GSRA 4OD3L 5IEKB 4C55A 4JQIL 4G43B 3GJFK 1CDHA 2JKXA 1F3RB 2JELL 3U0WH 1IM9D 4Y5XA 5FO7B 2JJTA 1KCUL 1PSKH 5F6HJ 2GJ6E 2P46B 4JPKH 3BH9B 4NOFA 4NPYB 2X4OA 1QVOA 4G5ZL 4FQXD 4WFFD 3TH4T 1FCGA 1RUQH 2VN4A 3ARED 4BK4A 1AKJD 3D18A 3BGAA 4L5FL 3ETBF 3NVQA 3PV7A 2D9QB 4MAYD 5FM8A 3V7AG 4UTBH 1LE9B 2NY1B 3HN3A 1NCAL 2D7NA 2QQKL 5CSGA 3KXFD 4M6AA 4J4PD 2VLJE 1S5HA 1XGTB 5H8DA 5GS0H 2F74B 2RR3A 4RZCB 1MCLA 1DQLL 4O2EA 2YK1L 2AJZB 1QEWA 3ARWA 4NQEA 1UXSA 4K8RH 5BV7B 4J23A 3OKNB 2ED7A 2D4DA 3QISA 3QAZC 1ZHLA 1CXKA 3O2VH 3TBSB 3CU7A 2B20A 4P5TD 3EFFA 4Y16D 1A5FH 2K9UA 4HWEH 1LGVA 3GK8H 2NYYD 4OKDA 3CLEL 2GEEA 4P2RE 3QFJD 5TF1L 3BUTA 4H25A 1EIBA 2OTPA 3QCTH 4RFNB 5IFAH 1KXTB 2CGRH 2AERT 1P9MC 1FL5A 2DI7A 5L88L 3UTSD 2FO1A 2AVGA 5HHMD 3BKJL 5HYEA 5C0AE 4JKKA 4IRSC 5TQ0L 3HRZB 4CVZB 1RY7B 4GS7C 1KV3A 3NN8A 4ODTH 3WD5H 4UTAL 2VIRB 3CMOH 3NFNB 3I50H 2E7CA 2X4QA 4I77H 4X6DB 5AD0A 3SCMB 1OTSD 3QULA 3MV7D 1VFAB 3UTTB 3HAEA 4ENED 3M17B 4ELME 1RURL 1FZOA 3BT2H 3DI2B 5CZKA 7FABH 3E8UH 4CNIB 2OZ4H 3RWGB 2AJ3A 4WFEE 1Y6KR 3U0PB 2A1WL 3HI5H 3DVGA 3SE3A 4JPWH 4HFUL 2C4FT 3FFCA 2VISB 5DJAB 2V9RA 4JQXC 2VDLH 3DROA 2QQNH 4FQQA 2NY0B 1G7IA 2CJUH 2J88H 3DETD 2ZCHL 4HK3N 1BD2A 3MUGB 3L1OH 4TTDC 2WM0A 1XF1A 3QZWG 4XBPB 3RHWK 2OI9B 1BP3B 1ZSDA 4P3DB 2V5YA 5JW3L 4PJDF 32C2B 4P4KA 4BFGA 4E41D 4Q2ZA 4ZUSA 1IGIL 4YHOH 1EXUA 1FG2B 4D3CL 1HHJA 5SX4I 5JXAL 2W60B 3ALWA 2P5WE 4V1DE 3SBWC 1S7XB 3MZTA 1NUFA 4NQCE 4WTZA 2VXQH 1RVFL 1QSFB 2EXYD 1CVRA 5D7LD 4XCEB 4ZODA 1RK1B 4R0LC 2VC2L 3GJEA 5KVGH 2QSTA 4P2QA 3HG1B 4IRZH 4XMKL 3V4VH 3BUYB 5LWYH 3W82A 3IJYB 3JTSB 3QQ3A 4U1NA 5E6IA 2OBGA 4M5YL 3LKQB 2GY7B 1K6QH 4C56E 4GKNA 3HC0A 2KQMA 5AZEH 5IHZA 4GQ9L 4NZDA 4LGPB 2GJZB 3L95B 5EU3B 1X5JA 4GUPA 4NN5B 2BNRA 3QDGB 1MWAA 4X4MA 3UMTA 2V7HA 1JGVL 2KKQA 5GS0D 1Z9LA 3HB3C 3TO2A 2A73A 2BVOB 2C26A 3S8WA 1IMHC 2BVPB 3CXHJ 3QNYB 4M1DL 2FGWL 4HGWA 2CDEB 5GGTA 4LHQB 2VR4A 4ISVA 5EPMB 4C57C 4TSCL 4ZO6A 3GSNL 1WISA 3BWAA 4DGVL 3MBEA 1L7IH 5ILTH 3RU8H 2Z8WC 2A6JB 5EU7C 1FLRL 2IALA 2XWBB 5KJRL 1BZQK 3TH3T 1AD9B 4BFEA 1MIML 4Z7WA 5IBTH 2BRQA 1RK0A 2YPVH 3P30H 1CS6A 4YDKL 5JPNB 3FMGL 4KV5F 4OI7A 3GI9L 1N0XL 1D9KD 4JFZH 3QNXA 3QFDA 2EH8L 1YYLL 3HPLB 5CILL 1FV1B 1H8SA 2Z91B 3LKOA 5HYJD 4NYLB 4IS6A 5GZND 1J8KA 3MRDA 3PWPA 3FQUB 3QJHB 4J1UB 4D9LH 3MJ7B 3SDDC 1QHOA 4Q6IA 1X5GA 5EU6A 1R0AL 1WGOA 1KTRL 1T6WA 4NZRL 1JF5A 4PJDE 5GRJL 3DMMB 4JFXA 1QRNA 1YN7B 5HTSA 2HRLA 3U83A 2DTML 2EDDA 5DMIH 1G6RL 5J56B 4G7YL 2IC2A 3JWDL 4KJPD 3CFEB 1RI8A 5GS2D 4P46D 1NANI 5HYSB 5F7EH 3MRQA 1U8PA 4I9WD 5H37G 3WJJC 3K1KC 3H9SE 4JEGB 5BJTB 2GI7A 1HZHH 3DX8A 2IAMD 3AS2A 1UYWH 4NUGL 4YQXL 4NGHH 1Q94A 1ZKAA 2QR0A 1AQDA 4ODVL 3BAEH 1TENA 4LHJB 2F5BH 1NKRA 1OAQL 4R4FL 4EVNB 2BSTB 4KRPC 3DRTB 2NXYD 3IAGC 1JRHI 1J8HE 1ORQA 5INDB 4HCRL 5DURD 3D3VD 1DN2A 3AU1B 2VDNH 2CDFA 4GKSA 3UYRL 2AW2A 2Y4SA 1IJ9A 2EKSB 3REVA 4UBDD 1IEAB 4TVPD 1G1CA 1RD6A 3SOBH 2YC1A 1RHHB 3PIQA 4XPGH 5I0ZA 5TF1H 3PHQA 1AE6H 1Z6JT 3KPSB 2FJHA 1NBQA 4NKOB 5TGBA 1SHMA 2MCPH 1X5ZA 3P4MB 1HOCA 4XXCC 4PJIF 3N1MC 3K80A 5IVXB 1F3JB 3T1WA 3RA7H 1IM9B 3UZEA 3OG6B 2DQGH 3B2VL 3QXAB 5DA0B 2EDYA 4WCYH 1I4FB 1NFIA 3GSWB 5DJ8A 1FORL 4WW2A 1VACB 3F58L 1QA9A 4Y88A 4FQXB 4DKEL 4KV5E 3MRNB 3DX7A 2VDQL 3AREB 5DMGD 2XNAB 1AKJB 4GAGL 2VXSH 1UWXK 1ADQH 3EJYD 3RBGA 1OWRM 4FTVE 4JY4A 5J3HC 2QLVB 5M7QA 3FB8A 1W72L 2BMKA 2ZCHH 3E3QC 1HDMA 4LIQE 1ZLVK 1CXLA 5J11B 2ERJC 4KQ3L 2R0LH 5E5RB 4JANB 1ZT7A 3BI9X 1OPGL 3SKOB 4GAJH 2BXZA 2KZWA 5BQ7B 4OZFG 4HIXL 3CCHB 3L3KB 1EV2E 2CMRH 4YUEL 4AMKH 4D9QE 5I76B 4Y16B 4M7KL 3WXVL 2E27L 1UM4L 5D7JC 2YXMA 4PJAA 1X3DA 1UA6H 3CK0H 4M1CC 3IVKB 3MCKA 1R5WB 3T2PA 1I1AC 1U0QA 2OMBA 1YC7A 3UTSB 2O93L 1F90L 2ICWB 2CR3A 3TNNA 5HHMB 5H2BB 3DO3A 1Y0LB 5HHXL 2FZ3B 3GNMH 5IMKB 4JO3L 2WWKO 1KT2A 3BZFB 1A9BA 3PGDB 4PRPE 3JV4B 1T04B 3HC4L 1J0JA 1AXTH 4JZOB 4TVSa 3MV7B 3ARDD 5FUOH 1RFDL 1KLUA 1EX0A 3QYCA 5DI8A 1A6UL 2H32A 1L9MA 3GM8A 3MQIA 1EAPB 1FAIH 1KJVB 4G8IB 2CXKA 1I9RH 5D2LA 4Z0BL 2W9EH 5DJZB 2DM3A 2N7BA 4LHUA 1NC2D 3VFPB 2VAAB 4UT9H 4XC1L 3O0RL 3RWJB 1OAZL 1N64H 2C4FU 3IS0X 4PJIE 4HIIB 5GS3A 3L3DB 4GQPH 3MOBH 4OV6F 4R3SA 3QCUH 3PHOA 3V4UL 4NM4L 4OCXH 4OV5B 2C3XA 4PB9L 3ZYOA 3HZYA 2DD8L 1AD0A 3LS4L 1UENA 1MPAL 3IDIA 2Q3ZA 3CSYB 2GKIA 2CIKA 1WC7A 2NY2C 4E41B 4K94H 2BVQB 2K7QA 3UC0H 5EO9A 1LEIB 4MCYA 5HGBA 1F3DH 5KANG 3FMGH 5CGMA 4NKDB 4XX1E 1A7OH 4Q9RL 5IB1A 3ZT6A 4ODUB 1X7QB 3UJJH 4JB9L 1X5XA 4G8EA 1HEZA 3NCBB 1QFWI 3O4LD 3LHPH 3WXWH 3X14A 5CSZB 3FO1A 3D69A 3BMWA 3HI6H 1VADA 3KJ4C 3BGMA 5FKAB 2X89D 5HDOA 2BFVH 3SO3B 4X6DF 3U2SB 35C8L 1UGNA 4PJEB 1A3LL 2AXFB 3VFWB 1RIVL 2XXMB 3OJMB 4LOUC 5E8OB 5FECA 5JW5B 5TE7H 3FTGB 4R96B 4NQSB 3S35X 4LRIC 3OAYK 1JWUB 2FIKB 4EQ3A 1SBSL 2C1OA 4PJCB 2FB4L 3QUYA 4P48A 2A6KA 4ZFGL 3I6KA 5HI5D 1T5XB 3FQXB 4A6YL 3AAZA 1KEMH 3BFOA 3O6FD 4GRLB 5IMOA 4NJ9L 2RB8A 3BKCL 1E27A 3UPRB 1FRGL 2CLZA 3BDXA 1FGNL 4ODWB 4P2OD 4IBLT 2E7LC 5DEFB 3TO4D 1PLGL 3QQ9C 4JFFE 5H94B 3BISA 1JHKH 5AZ2H 4WTXA 3ALXA 3W11D 5HVHC 5DJ2B 5LJYH 1ZA3B 3RTQA 4R8WH 1IKFH 1M4KA 4MJ4A 5KSVB 4W4NA 3MBXL 4Y8DC 2DIJA 4QGTA 5FUZL 4FZ8H 4OFKA 4QY8B 3RZCA 1HH6B 1PYWA 2AK1L 5IMMA 5LVEA 1E6JL 1MCCA 1C12B 5IG7B 1RMFL 5GJTL 1RQ5A 4W81A 1U8JB 1Z2KA 3MUZ1 5DEGB 5GGRB 1ZVSA 2P5ED 1NUNB 3OPZL 4NO0A 3ULSA 1HK6A 4KI5C 4MLSA 4YDJA 4NQVB 4TNVK 1HHKB 3QWRA 1JWSA 5DF0A 2H2SC 1U8QA 5D1QA 5DSCA 3MV8B 1JNNL 3RQ3A 3VH8B 3BPOC 2F58H 4APQC 3B9EA 3PQYD 5BS0D 4P46B 3U7WH 4OZ4B 3V5DB 3W39B 1OTTD 4PJFA 2HRPH 5EO0B 4POZD 3LN5A 1W72H 4OAWA 5E03A 5T1KA 2FX7L 3FQNA 1LNUB 5ESQB 4M7ZB 4X6DE 4KU1A 3V9FA 4DVBB 5HHPB 2X2YA 4KTDL 3UTTE 4PRBB 2NXYB 2B8OT 2Q7YA 4UNVA 5GSVA 1ZHNA 4MMZC 4OD2A 1DVFA 4XVJH 4EOWL 4Q58C 4LNRB 1CFNA 2EDNA 4P0DA 1JPGA 3DGCR 1YDPB 2ADGB 4OSUL 2VLKA 2YA0A 4QXTA 4M7KH 3QUXC 4FQJL 1RU9H 2X1WL 1N6QL 4QNPF 5EZLB 1H9VA 5E70A 3VXQB 2R29L 1UACL 5KG9A 4L4VD 2DQDH 4YBLB 3TBVB 1KXQE 4J12A 5TE4L 4X98A 4IOIB 3PUCA 4L3EA 1G84A 3QRGH 4WENB 3O9WC 1KOAA 2HH0H 3QIBD 4RRPA 4TUOB 4FFZL 4HULB 3CFKA 4PLKC 3G5VB 2YSSB 4LLDA 1BBDH 4PLNC 2C7UB 3QO1B 2J7LA 3RVTD 3U7YH 2HJFB 1K4CB 4MJIA 2RCSL 4DN3L 4XPTL 4DTGL 1QBLH 3BIBX 1LMKA 3AM8A 2LU3A 3HZVB 4FQ1H 2H41A 3OJDA 4S2SB 4F7PA 1QSFE 3QUZB 4YK4C 1YUHA 4LPTA 4P3CH 4X80H 2W0KA 2Y06H 5T3XE 3HG1E 1HQ4A 5DJ6A 1KIPA 3GHBL 4JY5L 1JPSL 4JM4H 1PY9A 4WO4A 4I0PC 1EMTH 2B1AL 4JM2B 3MSPA 3OTTA 3PWLB 5HGHA 5KN5A 2ZOLA 1YEDA 3BSZL 4R4BB 3KR3H 1EEYA 5E56A 3R1GL 3MLSH 5FGBC 5C08A 1MVUA 4EUPG 5DC0A 1P4BL 1OLZA 3QDGE 1GAFH 4AEHL 1K3IA 2P45B 2X4PA 1KFAL 5IW6B 5DFVC 5EU5B 2YD6A 3EHBC 1K8DB 1AIFB 3QHFH 4MAYC 4WIQA 2IH1A 3DECA 3P9MB 5IVXF 3JV6A 5DRXB 1LE5A 4FQHA 3R0MA 1RIUL 2B4CH 1D5ZB 3ARFD 4WI7A 3B9KB 4FQLL 5ERWA 3DX9A 3V7AE 1CFVL 5B8CA 4HUUB 4MZ3A 3GRWH 4MDJB 5IQ9A 2DQUL 3ULUL 5EC2B 5GRZA 2GSIA 4IRJD 5J4MA 5TE6H 1O5DT 5FYKE 3MGOA 5C6TL 2Z4QA 4WI3A 3ARDB 4G6FD 1HWHB 4MD0A 1WBXA 1KBGL 3LD8C 4F7EA 1BIIB 4OLVL 1SBSH 2BJML 2JK5B 4LU5H 3U0TB 3WFEH 1JI1A 1B3JA 4QNPE 5ACZA 1FP5A 4S1QH 2LQRA 1LDPL 3GMPA 3KYKH 3TIDB 3RNKA 4C4KT 3RGHA 5BZDB 4OLEA 1K2DB 1FYTA 4LLVB 1JWMA 1P7QD 15C8L 5DLMH 3CX5J 2P8PB 1LDSA 3DTXB 1QO3A 2ZKHL 3WIIL 1HILA 1IGCL 1C5BH 3OHXA 3NABL 2Z35B 2X1OA 2HT2C 1U3YA 2P49B 2GTZB 4AENB 1JZ6A 4KKAC 4HUVA 4NRZB 3DETC 4PREB 3S36X 2A0LD 2EICA 2FL5B 3P77A 2AK1H 3L3GB 2MPAL 4OZIB 3O4LB 4HWBL 4MNHA 2V7NA 1OGAB 3SJVB 4Z7VA 2NX5D 4CMHC 3P73B 3RUGB 4OF3A 1NMAH 3GMRA 5BVJB 4S1RL 4DOHB 1T2QH 3TN0A 5L2KA 3L3OB 2FX9L 2H26B 4JFHD 1T22A 4PUBH 4QRUB 4M9PA 2WINB 3KPSE 4LSTL 2JJSC 3F12B 5SWSA 3PWJA 2OL3B 4X4ZA 1XGRB 5IVXE 1IEBA 4RGMC 5E94B 1IC4H 1I1RA 4G6MH 4M43H 1GOGA 4LRNH 1MUJA 2Q7NA 4Y2DC 1P9MA 1SMAA 5D70L 3MO1A 3P0VL 4P2OB 3VGFA 1OAUL 1CFQB 1RULH 2RFXA 2R1WA 1LD9A 3VXRA 2JIXD 4IRSA 4WFFE 3MUY1 3N1GC 4HWZA 3TO4B 5E08L 1ZGLP 2R2EB 3DUSA 1MCPL 3K0WA 4POUB 3FONA 1GGIH 1I3UA 4K7FB 4HUMB 4N5UA 4O51B 5EIQA 5EO1A 3CFJA 3EYQC 1ZT4B 3X3FH 3FQWA 4QF1A 2X10A 1FE8L 1FDLL 1BQHB 1MCOH 3T65B 3EOTL 5D71L 3U4BL 3BMVA 3H9SA 4JQXA 4U1KA 5FOBB 3DV4A 1QLFB 3VA2C 4HJJH 4PJEF 1HCFX 5TJWK 5I8EB 1CDBA 1OL0A 1PEZA 4GRWB 2P5EB 1QLRA 4LEOB 5F3HA 5I1AA 3IF1A 4H1LA 4OM0H 2F19L 4PJCF 1PZ5A 5ISZD 3V0VA 2A83A 3ARXA 5E6YA 4I13B 3TJEL 2PTUA 1OT1A 2PYED 2GUOB 1FVEA 1BLNB 4QWWC 3S5LG 3V79C 3MNVA 1NGXB 2DYPD 2VZUA 3LZFH 2HT4C 4HUWA 5JHDD 3RNQA 3UTSE 1MI5A 2NY5L 4HAFA 5HHME 1P4LA 1LK3L 1JPSH 1OAYL 4U1GB 4LLWA 4OUUA 4U6HA 2J8OA 2B1AH 1GPOL 4L3AA 3OKLA 3SKNA 3BSZH 1Z5LA 1EEZB 4LSRH 3EJJX 3C8HA 3V8OA 1UZ8B 3MV7E 2BCKB 5IBLD 4X7SL 1U93B 4WUUB 1FBIL 2IANA 1U8NA 3X12B 2FJGA 1ETZA 1KB9K 1RZIA 5EN2B 5J9PB 3K8LA 2ZUXA 1N8ZB 5EOQL 1TTFA 3BP5B 4PJ9C 2RJMA 3O6KL 3UTZA 1FHGA 2F53A 1X4XA 4OLXL 1NPUA 4KKLD 3RVVC 2UWEA 2GYSA 3GSQA 1P7KB 1KJ2L 1A3QA 3U4EA 4XZUB 1P69B 5EZOL 5GJSL 1B4RA 3QIBB 1CFVH 4E41E 3LQMA 1DQDL 1TFHA 4UT6L 3TZVC 4MJ5B 1LO4H 1Y18B 4MCZB 4LKCB 4D0BB 1KTLA 5JOFB 1M6OB 5D4QA 1JGEB 4JCLA 4TUJA 4OZHF 3S3JA 1MF2H 4I3SH 5HYQA 4H20H 5SX4H 2IFGA 4ZUUB 2C1PB 5C0FA 1UWEH 3QWOB 1SEQL 5DK2B 3QNZB 2KL6A 5C6TH 3T0AA 4JQVC 1INDH 2VH5L 2IPKA 2DQJL 1Y6MR 4RCAA 5FYJH 1B2WL 5A2LH 3VFGL 3EYUH 3ROLA 2IWGA 1B4JL 4PP2B 2R4RH 1CL7H 4G8GD 1IGFL 1JBJA 4PJEE 4Z5RA 5FM5M 5JNYA 2VZOA 4OF6A 5KSAA 3S88H 4DAGL 1IFHH 4Y4FA 3SDDA 3FQTA 3FZUC 3MXVL 3B2UD 3TVMD 3CH1A 2HKFH 1HKFA 1UEMA 4EKXA 3DI3B 4PJCE 5KVMC 3IFPA 4HD9A 2MKLC 4JKPH 4HS3A 1IAOB 3LEXA 5DYOB 3CPLA 1HSAA 1QBBA 4ZFFB 2ESVA 5IVOA 2XA8H 1HQRA 1AI1L 5SWZB 3WFDH 3UTQA 1S7QA 3HR5B 4WWKC 1IKNC 5MEOB 5EBMA 1UCBH 2HLFD 1YJDC 3WJJA 4PB0H 3MLZL 3ZLQC 5JXEC 2GITA 2VDRL 3SKJL 3KYOB 2PO6B 5C0CB 1KPUB 3RWHB 5C2BL 2EZ0C 3BIAX 1FFQA 2X70B 4LLYB 3FO0L 1S7VB 1A9EA 1E4WH 2D0HA 3BEVA 3CFDB 4KDVA 3ZKXC 5CEYA 3GKWH 3RPIA 4M8VA 2J6EA 4IRJB 3OKEB 3FT2B 4OM1L 1YECL 4DWHA 4OLUH 3BPCA 4OF7A 4G6FB 4MQ7B 1CGWA 2HFGH 3RVXD 1NMBH 3VU2A 4JM2F 1HNFA 4QYOB 1AGCB 4G8FB 3SDAB 4DQOL 3EO0A 5JA8B 1WCBB 1U3HD 4N1CA 5HDQH 1EBPA 5IM7B 3T08A 4NWTL 1KELL 5MEPA 2I07A 2HWZL 5D70H 2C3HA 1P7QB 4OCWL 3VWKC 1JGUL 5E8DH 1F6FB 4N8VA 4JRXD 4OKVA 3T0EC 3T4YB 4OZHE 5IB4B 1EGJH 4JJ5B 1A7NL 5KAQF 1AGEA 1D6EA 4I9WE 3LOWA 1EVTC 3S97C 4DFHA 3ZSSA 3HE7C 3O3DA 3BE1L 3HZMA 3ARGB 4FS0A 1LO0H 4ZO7A 3ISWA 2AGJL 4CADB 1FZKB 4KMLB 3DXAB 5FYLH 5SWQA 5D71H 4FQ2L 1ES0A 3Q6FB 4NKMA 4L4TD 3OKMA 1MFCH 4KK9C 4PGZA 3BO8B 4L8CB 4MSWB 1U8MB 3D3VE 4PR5B 1KYOK 3ZHDA 4CVUA 4EN3A 1I3RA 3S37X 5FYJD 1I8MB 5B3JF 4AH2B 4HC1A 4TVPE 1NL0H 3FRUA 4HHAA 5T1DH 4HK0B 2VDKH 4JFFA 3AFLA 1NJ9B 1RJZB 3Q1SL 2CQVA 5CP3H 3B9DA 3WIHA 5DHVH 2NY5H 1NGQH 3C6LB 5DJCB 5I73B 1HHHA 4WRLA 2A2QT 1EDQA 2CKBA 3KPQA 4KK6C 3WNOA 3RVUD 3EYVB 5LKNA 4H5SA 1X5FA 3NPSC 3MFGB 2DLFH 4Q9CA 5L6YL 1K9TA 3QEQA 4N9GB 3UDWC 2XKNA 2DQHH 1MHHB 2PXYC 2BSED 3Q0HA 1U8IA 5EOQH 4U6XB 3QSKB 1I3GL 3D25B 4OZIF 2X9XA 5ACMA 2E8YA 1U8KB 4WDIA 5IT2H 3WFCL 1SJVA 5EOTB 1EJOH 1WEJH 4LGSB 4KJWD 4YHZH 4PRDA 5L2JB 3THMH 5DQJB 1JHLL 4F57H 4MQTB 3RUGF 5C0RL 2BC4A 5EH1A 2R1YA 1F6AB 5BCAA 1I8KB 1UH3A 2W65A 3OAUH 4QRQB 4OB5H 2DKUA 1FIGL 1ZANL 5C0EB 4PRIB 5ISZB 1DANT 3AB0B 5LXGL 4F2MB 3HZKA 4PJ8D 3BN9C 3BPLC 4G9DB 3D0LB 1ZHKB 3O6MH 2LVEA 1KLFA 1I1FA 4BELD 4WU7A 4U49A 5JHDB 4J8RB 3GBNH 1MJJA 3TEUA 4NC1E 4X99A 1KENH 3ZSTA 3QUKB 1DP0A 4Z76A 3WDHA 3OX8B 2G75B 4Y4HB 2A9MH 2GAZB 3AY4C 3L5WA 4U1MA 4M7LH 1BOYA 2EIBA 2MQ0A 1QD0A 1OP3H 3LIZH 1MHCA 4U1JA 2E8ZA 4HPOH 5D1ZB 5B3JE 4AT6A 1R3KA 3FRPG 2E9BA 2V2WA 1JV5A 2HN7B 1WAAF 1A02N 4K9EC 5F7DB 4JY6A 3I6LE 1HIMH 4QT5B 3ULVC 3QQ4B 5GGUB 2WW8A 1TQBB 4XVUC 2W07A 5CEZD 2A9NH 4U6YA 4OGAD 3CFCH 1RUKL 1UC6A 1JGDA 4XNQA 1BQUA 2ATKA 4GRWF 4YZFF 1MFEH 5HI3D 5D7IA 1IL1B 3ORJA 1FVCB 4PRHA 5AG9A 4FQCL 3JTTB 4TUKL 5FIEA 2DWDB 1S7SB 1HYSD 4IDJL 5TDPA 3JWOH 2E7LA 2Y07H 4PV8B 5DJXB 1HNGA 5IIEB 3NGBC 4BZYA 3V6ZA 3IDMB 1YECH 5DS8B 3I2CH 1CIDA 4YXKH 4GT7A 4R7NA 1MOEA 4OZIE 3O4LE 2GW5A 1FO0A 3IKKA 3MJ6A 3C08L 4KKCD 3DX6B 4DCQA 3GDBA 5EZIL 2O61A 2RGSA 5H35A 2YHGA 1Z0NA 5E4IA 2ZCKH 3RUGE 1KELH 3ZDXF 2ZPKH 4DOHE 2ZJSL 2EH7L 3SDYH 2O26U 2XRAH 1BOGA 3MCG1 3TVMB 3VWJC 1JPTH 2EYRA 4LVNC 3WJLC 3QEHA 1AGBB 2GK2A 4M61B 3KLSA 3PE9A 2YPKB 2J4WH 3GIZH 4AL8L 1S8DA 3G5ZA 3HPLA 4RAVB 4PJXB 1XF5B 3VXTB 3H2WA 5K9QG 1FL6A 4FQ2H 2P8LB 3KNBA 4GBXD 4JFOA 2I60L 2QADD 1QFWM 3DWTA 4KRMB 4PPTA 3MRBA 3TLRA 1L4IA 5C8JB 4YO0B 4ZUTA 5KVEH 1YEFH 2LAGB 3Q48A 4RMWA 5K9QI 1G7LA 4YR6B 1WAAE 4X9IA 2VE6A 5AYUL 2XN9A 4ZFOB 2OTUA 4YDIL 1ZHBA 3WFHA 2YD8A 4DVRL 1UT9A 5JW4M 3G6JB 1U3HB 3ROOA 5FK9B 43C9B 3ZTJG 1HHIB 2GFBA 1WQVT 2VB5A 4OZGA 4YZFE 4GRWE 2P5EE 4HPYH 5DWUH 3VXUB 3NCYS 3VFRA 5FHAL 1QKZL 3FKUS 3LPFA 3O9WA 3UYPA 2WIMA 3C60C 1JPFA 1XH3B 3QIUC 1DBML 1T1ZB 4JRXB 2BNUB 3QIWC 2VLRA 3LEYH 3OXSA 2OQJB 1I7ZA 4MQXC 3GSOA 4CBPA 4QRTB 2WLZA 2JB5L 4YIQB 5ANMA 2R0KH 5F89A 3PJSA 1QZ1A 4X4YB 3ECBB 1I3GH 4CGTA 2WP3O 3HE6C 5F1NB 3NCJH 1T7VA 1BFVL 4K3HA 4LCYB 4G42A 3L3HB 5IVXA 3QO0A 3WHE0 2AI0L 3ZDXE 3PXJA 4I0PA 4L4TB 4WUUE 1Q72H 4OLZH 4L9DA 1ODAA 4M6NL 1Q0XL 4D2NA 3RWFA 2AK4B 3IDGB 5TPWH 4FFWD 4GW1A 5FGBA 2HYMA 5HGGS 4CU7A 5BO1L 3FB7B 1JN6B 3B43A 5JHLH 4L8BA 1C1EH 4ZTOL 4LCWB 3VW3L 1FIGH 4JHAH 4I3RL 4YE4L 3H3PH 4LDEB 1H3WM 1MRDH 2D03L 4MAYA 1QBAA 2ICWJ 3T04D 1M1SA 4YHML 3TBYA 3MXWL 4G3YH 1MHPL 4PJ5D 3KXFA 1N7MH 3MACH 3EYOB 4YWGL 1ZEAL 1YEKH 3MR9A 4OFYD 1JNLH 1IGYB 3H7BB 4NP4L 5GGTH 2A6IA 4NQED 3T2NL 4PTUA 3RIFF 3CCHA 4QXUL 3WKML 4P5TA 5B39G 3RAJL 4LVOC 5EUKB 5J13B 2WK2A 4ZFZB 3ZKNC 4TOYH 3QFJA 1NSNL 1EHLL 2G5BA 4F7MB 1ZLUH 5IVZA 4JDVA 1W2KT 4PG9B 4J3UA 1I7UB 1WICA 1IGJB 3LY6A 5GRXG 1V7NL 3O4OB 3CVHL 5HJ3A 4TQEL 5E1AB 3HLAA 1HH9B 4BM7A 1MFNA 4DZBB 5MEQB 1FNGB 3PGDA 2NY3D 5IB2A 3QHTC 4ERSH 3WUWB 2PCPB 2X4UA 5SWZE 4XMLH 1ZXQA 3SGEH 2BSSB 4NT6B 3SN6N 2OJEB 4KQ4H 5DD0H 4DGIL 5K9JH 4PJ8B 3NFPA 1DANU 4KY1H 3ZL4L 5C0CE 1VENA 3LEVL 2AXGA 1U92B 3FFCD 1CG9A 5D1XD 4NNYA 1AC6A 3T77B 3DRQA 5INCA 4PTTA 4DZ8A 3K3QA 4PD4J 1QSEA 2HJKA 1E0OB 1BD2D 4I2XA 1RZKC 3T1FB 4RFNC 1S3KH 4NNXB 5IR1B 1UJ3A 4JDTH 1KIUA 3ZDZE 1RZ8B 5IROA 1W0VB 3HKFA 4AEIH 1Z3GL 4P4KD 1SJEB 2X7LB 1ZTXH 4N0YH 2ZG1A 1RZ7H 2GT9A 1YPZA 3MRMB 2D0FA 3QA3B 3AMLA 2VQTA 4X6FB 3BZEA 2RBLA 3GUTA 1X5IA 1NGPL 4R6UA 2XWTA 1LEKA 1BF8A 4PYHA 1A3RL 4XWGH 1J11A 2ICES 1U6AH 5D7LA 2GTWA 4NCDA 3EO1A 3S34H 5LGKA 4R97C 4MB5A 4I4WA 1CICC 4ONOA 4H88H 4BSWA 4X6CA 5EORH 5GXBB 2NY0C 3O45B 4ORGB 1A7RH 1BWWA 4W6WB 2BNQB 4HIJB 5FV2A 3WE6B 2G2RB 3O2WL 4TULH 5DMJB 4PP1D 1SVCP 2OI9C 2FBJL 4UB0H 4OQTL 1WK0A 3P0GB 3HC3L 4MD5B 1MJUH 2R4SL 3U1SH 5B38B 1PKQA 5DHVB 2FIKA 1MNUL 3VJ6B 4FQPA 3HCVA 5KW9L 1XF4A 4XP6L 3R8QA 3IU3A 1U8OB 1U91B 3DXAE 5I18H 5FCSH 1KLGA 4Z95H 4NZTH 3CU1A 2B2XL 4HEME 4RMUA 2NTFA 3GO1H 1NDGB 5K9OB 4X9BA 4YFEA 4OFVA 1H3PH 4GXUN 4ODXB 3HI1A 3MOAH 4FG6D 2AABL 1NMCB 2VR9A 1KXVC 4W68A 4RISL 2R23B 5DEFA 2IPUG 4YGAB 4JFHE 4IIQB 4NRYB 5F6HI 4Z77B 2EIZA 3H9ZA 4I48B 1T5WA 1KB5A 5KSVA 1S7RA 3LN4A 3F7YB 1D9KA 4XTRD 1JZ3A 3AVEA 4QY8A 4DKDC 5HYJA 3VI3F 3W0WB 2JJVA 2D7TH 4Q7DA 5DA4A 1A6TA 4WHTA 3DBXA 3OXRA 3TNMB 4YHLH 3MROA 5IUSA 1V3LA 4M93B 2D31B 5FB8A 3D87B 4J3WA 2R2HB 2E7BA 3IXTA 1HKLH 5ICXA 2QADB 1OSZA 3CDGA 3QH3B 1OVZA 1RUAH 3F5WA 3L7FA 1QRND 4L1HA 2D3VA 4KGJA 1NBVH 4FNLH 4OZHA 2B7DT 4I3RH 3BZ4A 4HF5L 1VPOH 1A0QL 3IDXH 1FPTL 5IJVA 2FEDC 3W39A 4H0GA 4HBCH 4NHUA 2IAMA 4JPIB 3TFKD 4PJ9A 1CGSL 1NFDA 3BHBB 2ADIA 3O3AA 3OR6A 2ICEB 3SE4C 2Z31D 2H32H 6CGTA 5TFSH 4FQIL 1GOFA 1GC1C 1T83C 2XFXB 3MRCA 5FGRA 1AQKH 1C7SA 3DUUB 4PRIE 3V6FB 5JZ7D 5ISZE 2VABB 2FWOB 4Z9KB 3D3VA 4BZ2H 5CUSL 3TZVA 2ID5A 3D9AL 4NFBA 4ZD3L 3CDFA 2DWEA 3DMMC 5JHDE 5C9KA 4PRAA 1YMHB 4BH8A 1WSST 3HNSL 4PJXF 4HJ0C 1FGVH 4LSSL 5EZLA 1J1PH 3BKMH 4FXLA 5E99L 3VXQA 3IJSB 4A2LA 5DVMA 3GSRB 2M1KA 3IFNL 1MLBA 5CHNA 3L6FA 4NKIL 4P9MH 2P44B 3O8XD 4Y5XB 4HK3J 5F7KC 3RHWF 1S9XA 5HHVH 1L7TL 3U7AA 1J86A 2Y36H 2WUBH 4UDUA 4RIRA 1NAMA 4LLQA 1TTGA 4C83B 3R0NA 4UILH 2X4OB 1NQBA 1QVOB 3QXDA 5F7UA 4KVNH 5F88A 1MEXH 3OGCA 4KXZI 4Z7UA 5TF0A 3G6JF 1FL3B 3D18B 5HXMA 1B0WA 5HY9A 1Z9OA 5GRWA 5GRYA 4WWKA 2APBA 4XPFH 1IKNA 3VI3E 1ZAGA 4GMSL 4B50A 4PJ5B 3WN5C 5I1IH 2I27N 3C9NA 3NA9H 4XHJD 3TYGL 2FECI 1K8IA 1S5HB 1QNZL 1JFQH 2CRYA 1IC7H 12E8L 4O2EB 1QEWB 4NQEB 1UXSB 5DUPL 2AJSH 2RQ8A 3PGFL 2Q8BL 4XP4H 2Q6WA 3QG7H 4M1GH 5E7BA 3S4SG 5I30H 1J7VR 4IDLA 4NQUA 3EFFB 4HGMA 2X9WA 5JORA 3BN3B 5IB3A 4QRPA 4PBXA 1Q9OA 5L0QB 4H25B 3VRIA 1R3IL 4NNPH 4X5LA 2K1MA 4F9LA 3HPJA 1FL5B 1J1OL 4KHXH 4N8PA 1YEIL 4K3DH 5KVDH 1KCRL 1M7XA 5GRVL 3QI9D 1YNTA 5CP7A 1S78D 2R8SL 1B90A 2EXWC 3NN8B 1VEOA 3VWKA 1YYML 5CZVL 3T0EA 2X4QB 4QHLA 2MNUA 5AD0B 5KZCB 4LMQI 3QULB 4RMSA 3HAEB 1BEYL 1S9WA 4PJXE 2AJ3B 1PEWA 1E6OH 3TV3L 2ZUUA 3DVGB 4EI6A 3FFCB 4JHWL 1NC2A 1VFBB 3DROB 1G7IB 3LRHA 1G0YR 3RL1A 1WFUA 2EE6A 5I74B 1BD2B 3CXHK 3KJ6H 4XP5L 2UUDH 4PGDA 5ID1A 1WBZA 1ZSDB 5C6WH 1NCTA 3V8CA 5BVPL 3L9RA 1A21A 2XI9A 4P4KB 1Q8MA 3DO7A 5ITFA 3IXAA 4Q2ZB 4ZUSB 3GMOA 1U58A 1EXUB 5I1KL 1CBVL 2GTZA 2ORBL 1HHJB 3G6JE 2DQTH 3VXUE 4WEMB 4NRZA 5J1AA 5CZXC 1WZKA 3F7VB 2HMIC 4N0CC 1NCUA 3VXOA 5I1EL 1MLCA 4OZIA 3O4LA 1TJGL 3GJEB 4P2QB 3MV11 4JRXE 3C5SA 2X89A 1CD9B 4JPVH 1QLEH 1S9VA 3QQ3B 4U1NB 3MRPA 4O4YL 5E6IB 3TCXA 2G60H 4ESKA 4I8DA 2X6MA 2VO5A 3L5XL 3ZDYF 4LVHC 3MRGA 4AG4L 1QFUL 4GKNB 3HC0B 5IHZB 5GPRA 5CJOH 3LCYA 4XNZB 5HD8D 2W9DH 4ZNEE 4GUPB 2FR4A 2BNRB 2PXYA 1MWAB 3PF2A 4K9EL 4LQFL 2V7HB 1A0QH 2OL3A 4RFOL 5T3ZD 1ZV5A 3TO2B 2A73B 2VR5A 3QUYD 3HS0A 4ZS6D 4L4TE 5D7SL 4PGEA 4HGWB 2JJUA 4YH6A 5JIKA 3IFLL 3O6FA 1UFUA 1KGCD 2AK4E 2I9LB 2JTDA 1N59A 5D8JH 1ZGLA 2EDBA 1NAKL 3BWAB 3MBEB 2XKUA 5FYJE 4QTHA 4LCWE 4G6AC 1DBBH 3MC0A 1P1ZA 4R2GD 5HVGB 1BVKA 1DFBH 4MS8C 3SO3C 4Z7WB 2DLGA 4BJLA 5C0NC 1RK0B 2BHUA 1B0RA 4ZOCA 1EZVY 3V0AC 4LSSH 5JUEH 3QNXB 3QFDB 3RDTD 4EDWL 5C7XL 3LKOB 5K59F 1BJ1H 2YRLA 3BVNB 4IS6B 1F3DJ 3MRDB 1QHPA 3PWPB 1CLOH 1CDUA 1KIQA 4GRLC 3DARA 4K8RC 1G9EA 2XOTA 3UBXI 3HMXA 3N85L 4Q6IB 5EU6B 3ARSA 3BXNA 4UV7L 3LQZB 4BKLB 2ATPA 1TVBA 3MOQA 4XAKD 2AJVL 4OT1L 4JFXB 1QRNB 4KROD 5D1QD 1RZJL 1CLCA 4XH2A 5I1JL 3PQYA 4LIQL 1MSPA 5BS0A 5F7NC 1YA5A 4N5EC 5IB5A 3MJ8A 2K3TA 4KWUA 3MRQB 1U8PB 2DQCL 1MQKL 3P3YA 3J8F7 4DEPC 4ETQA 3DX8B 3C2SA 2DDQH 3RGVD 4HG4J 4IOSD 1KCKA 1Q94B 2QR0B 1AQDB 2NR6D 5FEBA 1YY9C 1N2RB 4OD1H 2AJYL 5T1KD 4F15C 4HSQA 3QCVH 4YHPA 3JXAA 4S1SL 2EECA 4XBEH 4JO1L 2NY4D 3SQOL 3X12A 2EE3A 4GW4A 1ORQB 1Z9MA 5GGSA 1DVFD 3NFSL 1T3FB 1IAIH 2R56L 5I1CL 5CINH 2CDFB 4GKSB 3MLRL 2YR3A 1AY1L 2ADFH 3REVB 1F4XH 2VLKD 1I7TA 1Q0YH 5F1OB 4HGKC 2VDMH 3MX0A 4EEEA 2YC1B 2PYFA 3PIQB 4LAQH 3LB6C 5CBEA 1AO7A 3PHQB 4L4VA 5I8OL 2FJHB 2JE8A 5TGBB 1BQSA 1XR8A 2Z8VC 1HOCB 1UKSA 1BIHA 1T6VN 1AHWC 1LP9B 1PVHA 2LFGA 4ODBD 4NWUH 2ZUYA 4D0BA 1XF3B 4XNYL 1T1WA 1JVKA 5FYLE 1NFIB 4HLZH 1AGDA 3B5GA 4KKNA 5DJ8B 3C5ZC 3VWJA 2FHCA 4WW2B 3MJ9A 4HJGA 4JVUA 5DK2A 5LG1A 1CVSC 3U46A 1QA9B 5HI4D 2V17H 3EBAA 2PKDA 3DX7B 2ZNXA 4NHCL 2BY1A 5SX5K 4PGCA 5CWSA 5K59E 3PP3K 4JY4B 2BNQE 2A77H 5IOPA 4WO4D 5F70A 2PR4L 1DEDA 4LFHG 2FNBA 3FB8B 5C86A 2R69H 4PV9A 4W6XB 2MFNA 2BMKB 1T1XA 4YBLC 4FFWC 1HDMB 1ACYL 4PRNA 5I1GL 4P57A 3AXLB 4Q97A 5ECJE 1ZT7B 1DSFL 3ARYA 1J87A 2EEDA 1MFDH 2IH3A 4QO1A 3TM6A 1A6WL 3EOYG 2Q1EA 4NQDA 5T1MA 1XGYL 2EDWA 5I2IA 2ZUTA 1F6LL 3WNMA 3JWNC 3QUZC 5CCKL 1C7TA 1NEZA 3BX7C 5B4MC 4UT7H 2ZUQB 4AZ8A 3KYOA 5GRUH 3MCKB 4MMXC 1OARH 3BW9A 3NA4A 3ARFA 4OLYH 1S7VA 1OCWL 3D1MC 3DJ9A 4JM2C 1PX3A 4NO2A 4M5ZH 3IAPA 1ZLWH 3RJQB 1QQDA 4O4YH 5D96B 5KBNC 4MXQD 5EIVA 4D9RD 1KT2B 4ODSL 3C60A 3N9GH 1A9BB 3H42H 3SPVA 3QIUA 5CKAA 2ZSVA 3BP7A 1R6VA 2VXVH 5HGDA 2WWMC 4MXWH 3NZ8A 5IHUL 1CCZA 3W0WE 3BKYL 1KLUB 3KHOA 2H32B 4H1LH 4H26A 4G8FA 5K33A 5D2LB 3MLYL 4ONHA 2AKRA 4LHUB 5D7KD 5C9JA 5DUMH 5EWIH 4U1IA 4KAQH 4L9LC 2BX5A 1FYTD 1QOKA 4R3SB 2Q8AL 2YD2A 3PHOB 4NRXA 3MRHA 5J06A 3B9KC 3TH2T 1SEBA 3HZYB 4NC1C 1AD0B 5I8KH 5JTWA 3RY6C 2R15A 3IDIB 1OP9A 4TNVF 2CIKB 4Y1AA 1WC7B 5BV7L 4RRPG 5I19H 3TBTA 3CFBA 3P9WB 3QP3A 1T0NA 5EO9B 5CIPA 4MCYB 5D1XC 5HYIA 5IMLA 1RIHL 1OT2A 2AV1A 2NW2A 5ELIA 2HTKC 1HYRC 1RZFH 4G8EB 1HEZB 2XIDA 1K4DA 2M2DA 5JA9A 3R8BB 1OAXL 3MLTA 4U1SA 4K7PY 4WI8A 1RZKL 2J2ZA 3X14B 4KJYB 4PR5A 3FO1B 3D69B 5ADPL 1VADB 1CE6A 5ALBL 4WJ5A 1CD8A 2NX5A 3BGMB 5IV2A 3BJ91 3BZDA 5DEZA 2VDPH 5F7MC 5FECB 4HK0A 5L2KD 1I1CA 3V6OA 2RHEA 4YBQC 4I0CC 4KGLA 2C1OB 5SWSD 3LH2H 3A6CL 3QUYB 5GGVY 2A6KB 4YFDB 1TETL 3I6KB 1TVHA 4LSUH 3AAZB 3EDFA 5F9JA 5IMOB 5BRZA 4D94A 1GGCH 1E27B 3SEPA 1KN2H 4RGOL 4TPRH 2JIXA 3CX2A 1XIWC 4XNXL 1V7MH 4IRSD 6FABH 3KLHC 4KHTL 2OK0H 2XZQL 1F5WA 4P23C 4RA0C 4LSQH 5T5NF 2R56H 3SGDI 4K3EH 3RTQB 4L8SB 3HFML 4OCLC 4QOKA 4OFDA 4PJ5E 5BZWA 1T20A 1QFHA 1CXHA 1LEGA 3BOVA 4QLRA 3RZCB 1PYWB 2E9JA 1NCCH 5DQJA 5IMMB 2ZWLT 3P0YL 1FYHB 3VGAB 4NQEE 2XQBL 1TNMA 3FOLA 2J5LB 2FYYA 4TTDD 1ZVSB 3BP6A 1OSPH 5T3XL 4NO0B 4JREB 3ULSB 5HYFA 2DAVA 4XMPL 4XNYH 4YDJB 4GG6F 2YA1A 4OGYL 1T1YA 4KROB 2FATL 1JWSB 5FHBL 2B0SL 5MERA 2PYEA 1P4IH 1U8QB 5D1QB 5DSCB 5F93C 3JVGC 2NQCA 2DYPA 3BPNB 4KUCD 3QEUA 3X13A 4FXKA 3P11L 4JR9L 4NHCH 1MI5D 2J6EH 1QR4A 3V0WL 3KPPA 4PJFB 2H1PH 3QUKA 5JQ6H 4A6YB 1UCTA 2WBJC 3QR2A 2D7QA 4N90D 1CICA 4YAQA 3LN5B 1G7QA 4E0RA 4OAWB 5T1KB 3G5XA 3GJFA 3FQNB 5CGYC 4AIXA 3CSBA 4Z7WF 2VKWA 2Q7YB 4KK5C 2XTJD 5GSVB 1GZQA 4MJ2A 1ZHNB 3QUMA 4OD2B 4AJ0A 1DVFB 1A6WH 2CUMA 1QACA 5T5FH 1A6ZA 1CFNB 3FFCE 1JPGB 3CSPA 2VLKB 2CXGA 4M7JH 4QXTB 2HT3C 1T0MA 3HB3D 1BD2E 2F53D 4X6EA 2ITDA 1IC5H 4MDIA 4NBYB 1BGXH 1J05A 1NGZA 5KG9B 2FSEA 5FYKL 2DJUA 1O7VA 4NCC2 4X98B 4P9HH 1Q9LB 4L3EB 3F7PC 2ENYA 4U1GC 4O9HL 3CFKB 3U6RA 1CF8H 4LLDB 1I3VA 4N1HB 4LLMA 4K94C 1NLBH 8CGTA 1G9NL 1RUPH 4MJIB 3MRIA 4ODSH 5HVFB 5IGXL 2ITCA 4M62H 5AWNL 4WV1A 3W2DH 3OJDB 4YNYA 5LCVH 4F7PB 3I3EA 5A2KH 1YUHB 2KPNA 4JKWA 1P84J 3BKYH 4KPHH 3VXMD 2VAJA 2DRUA 4HC1H 1HQ4B 4CUCA 3MLYH 1KIPB 4AY0A 4XC3L 1MRFL 5FUCC 2CLRA 4G8GA 2H45A 3C6SA 4WO4B 1D6VH 5E8PA 5GRVK 1KJ3H 1GJIA 2KQNA 5HGHB 5KN5B 2ZOLB 1YEDB 4KK8C 4Z7NF 1EEYB 3WIHH 2NZ9C 2Y6SC 5C08B 1MVUB 3SDDD 3GMLA 1FFNA 4ONFH 4EI5C 3TVMA 2O5ZL 4GG6E 5E2VL 3O2DL 2BNRE 4X4ME 4XGZA 2C3VA 2BDNH 2X4PB 2CKBH 1BREA 1A2YA 2NXZC 1DE4A 1J1XH 4X5WA 1B88A 3CX5K 1E28A 1F58H 5MP6H 3MLUL 3KLAA 2IH1B 3QDMA 2VERN 3VA6A 5DTFA 3HNTH 1Q1JL 3GI8H 4UQ2A 4N0FA 1LP9F 4WGVB 2R0WH 3JV6B 2YN3A 1YN6A 2AV7A 1LE5B 4FQHB 1KCLA 2OJZL 3M07A 4ZQKA 5DZNA 4BH7A 5ERWB 3DX9B 4Z7WE 1T83A 5B8CB 4WW2F 5DT1L 5MI0C 1YNKL 1A7QL 5IQ9B 1G9ML 4KRPD 4FP8H 1NCWL 1VFUA 1HSBA 2GSIB 1HWGB 4NN7B 3RBSA 3V4PH 3MGOB 4OIAA 2Z4QB 3N0PB 1C5CH 4K7PH 1WBXB 4MD0B 4OCRL 4F7EB 1JK8B 3PWPE 1CFSA 4DFIA 1U3HA 5ACZB 3ZTNL 3MLVL 1DBJH 5FGCB 5KVFH 2OX5A 5DD5H 5EU6E 9CGTA 3GMPB 2X44D 3RNKB 3HMWL 2B1HH 4GSDH 3AMKA 2PO6C 3T09A 1QRNE 3KVQA 1FYTB 2L4OA 2OP4H 1MCBA 4YHKH 4RX4A 5JLZA 5CD3B 4KHTH 4RMTA 1QO3B 3GHEH 1AGFA 2XZQH 1HILB 4JFED 4UINH 4BZ1H 3OHXB 3D2UA 4OCNC 4F80A 1C08A 4HUVB 2BZDA 3R4DA 5KS9B 2CKNA 3L3HA 4WI9A 1UWGH 3SDAC 5J3HD 3P77B 3VMNA 1MAML 5CJXC 3TT1L 3QZWA 1NGWA 5CJQH 3WN5A 4MNHB 2V7NB 4Z7NE 4RWYL 4P2YA 2FX8L 4Z7VB 1VKXA 1BBJA 3GMRB 3TN0B 5L2KB 2HVJA 3WS6C 1INEH 2J12B 3E0GA 3PL6C 5D2LF 1NBYA 1MIEL 4XPAL 1T22B 3FJTA 5EA0L 3S3SA 3WLBA 4DJMA 1AH1A 1XF2A 5SWSB 3PWJB 5D7JD 1KTKE 2CK0H 3QBTB 1YEEL 1LP9E 4K71C 4S11A 1IEBB 2EDJA 2ZSWA 3ARGC 3DSFL 4QGYA 4M1CD 3CD4A 1DBAL 3C09B 1ZK9A 4UV4L 1MUJB 5LQBH 1NBZA 2DM2A 4KTEH 3WFZA 5DZLA 1I1AD 1PG7H 1FO0H 3MO1B 5I1HL 3B5HA 2RFXB 1XGUA 2R1WB 1LD9B 4G7VL 3VXRB 3QEQD 1KCVH 4IRSB 5CKGA 4HWZB 4GS7B 5I8CA 4BYHA 5EOCH 3DUSB 1XT5A 2AQ1A 4KXZH 2APTA 4ALAH 4LPYA 3FONB 2FJFA 5E5MA 1B6DA 5EO1B 1R3JA 2OTWB 3CFJB 1RJYA 1RSFA 3FQWB 4QF1B 3NH7L 1H5BC 4YX2L 4PG9A 4XCCH 4LPUA 3U0WL 3H9SB 4U1KB 2E7MA 4D0DA 1GGYA 4OF0A 3C6LC 2GJJA 1DQJA 3DV4B 1PG7X 3FB5A 5FYKH 2XPGA 5I73C 3EDEA 4R7DA 3U9PL 1FNGA 2YPLD 4PJHA 1PSKL 4Q74A 2DQFA 1QLRB 3KDMA 4XX1G 4JPKL 3ZMRA 4Z18A 5F3HB 5I1AB 3IF1B 1G9NH 4H1LB 5JDJA 1PZ5B 1WFNA 2W0FA 3V0VB 1RUQL 2A83B 4Y5YC 2NY2D 1FVEB 2AEPH 2DQEH 3MNVB 1T0PB 1RUMH 4QHMA 1LK2A 4WVRA 4HUWB 1WIPA 3RNQB 1MI5B 3UAJC 2B4CC 5GS0L 5C0DA 1WBYA 1P4LB 1U3ZA 4K3GA 2BVTA 4FFVC 1I9IH 3HNVH 3I9GH 4LLWB 4OUUB 4R0LB 1HXYA 4X0KA 3OKLB 3SKNB 1Z5LB 1CT8A 4K8RL 4JN2A 2VUOA 2LU4A 5HHNA 5DXWA 2IANB 3ZYJA 1U8NB 3O2VL 4YHNA 2FJGB 4LOUD 2AEQH 5DQDH 1A5FL 1ETZB 3NOIA 4HWEL 3GK8L 1RZIB 5D2LE 1JUFA 4AIZB 3PNWA 2WIIA 5FDWA 4HDIA 1X44A 3ZT5A 2I5YL 4NBXB 4X4XA 3RGVC 3QCTL 3UTZB 1Z9SA 2F53B 2CGRL 2ZOKA 3SHSA 2UWEB 3GSQB 1UXWA 3DYMA 1KCSH 3U4EB 2OMNA 4PRHD 4CN6A 4ODTL 3WD5L 1N4XH 3CMOL 4Y4HC 3E2HB 3I50L 4I77L 1KTLB 1DQML 4TUJB 4MA1B 2AEIT 5B38A 5HYQB 4O02L 2P43B 3BT2L 7FABL 3QQ9D 3E8UL 2OZ4L 5D1ZC 5C0FB 2XG5A 1R5VA 3HI5L 3IRZA 4JPWL 4PJFF 3OAZH 1PJ9A 2IPKB 3I85A 4Y7MA 2VDLL 2QQNL 4X7CC 2CJUL 2J88L 4Z0XA 5CBAA 3ROLB 5C09D 2PN5A 1TQBC 5CD5C 1T80A 3L1OL 2EC9U 3MRFA 4ODXA 4YDLC 4Z5RB 5JNYB 1TJHL 5KSAB 4OCSH 3VE0A 4Y4FB 4EXPX 3SDDB 3FQTB 5A3IC 5C2UB 5D9SA 4KI5D 3CH1B 1AFVH 4Z77A 3T0VA 1MFAH 4YHOL 3IFPB 2LVCA 5T3ZE 4HS3B 3LEXB 5FAAA 4JG0H 4Y8AA 3CPLB 1HSAB 2H2SD 4RBPH 2ESVB 3F7YA 1GL4B 1HQRB 2DBJA 1KGCE 2VXQL 4APQD 1ROWA 1IM3A 4RAHA 3UTQB 1S7QB 1JTPA 5ALCL 5E8EA 1R3LA 1A14H 2D7MA 1CD1A 4FFYH 3QJFA 5EBMB 5KVGL 4HQQH 2GITB 3MA9H 3V4VL 3CAFA 2D31A 1XCQA 4GBXA 5LWYL 2EO9A 1EJ6A 2ZG2A 4JFYA 4WI6A 1A9EB 3BEVB 5ICZA 1OM3L 1K6QL 2F54A 3GMQA 3RIAF 5AZEL 3MNZB 5CEYB 4OZFA 4XPHH 1VFMA 5HDLA 2YA2A 3RPIB 1D3CA 1NC4D 2OZ4A 4IMKC 3BPCB 5EA0H 1H3UA 1BVLA 1OAKH 3TBWA 3U4AA 4FABH 4HH8A 3QUXD 3G9VA 1S7WA 3EO0B 1YEEH 1L7IL 5ILTL 2CLVA 1B0GA 5MEPB 3KPOA 3RU8L 4XAKE 5A16A 3DUUA 2I07B 4QRRD 1AHWA 3O9WD 4EJ1C 4PLKD 2P42B 5IBTL 4N8VB 4OKVB 2YPVL 3P30L 1LWRA 3B8SA 1AGEB 2VLRD 1D6EB 4DUVA 1CXFA 3MFFA 1C16A 1CU4H 4PJFE 4JFZL 3BDYH 1EO8H 4LAJH 4CW1A 3O3DB 3HZMB 4GLRH 3T3MF 4QKXB 1M71A 3O41A 4XCFH 4YX2H 4D9LL 5SWQB 1ES0B 4NKMB 4I0PD 3RX7A 3OKMB 1T7WA 3T0WA 3V2AR 3U9PH 2L7JA 4G9FA 2X4SA 4L3CA 3WCYA 3WO3B 2NY6C 4EN3B 1I3RB 4C83A 1JGLH 5DMIL 1XEDA 2BVEA 2VLKE 3W9EA 3WBDA 4OI8A 3FRUB 4HHAB 5DFVD 5F7EL 4JFFB 3EHBD 1FL3A 4IM8A 1ZOXA 1HZHL 3NTCH 1SM3H 1J5OH 1UYWL 4AIOA 1G1YA 3TA3C 4L3EE 4NGHL 4PJ5A 3BAEL 4RGNB 2F5BL 4U31A 3VG9B 1HHHB 1OY3B 2VLLA 5FO8A 4OFYA 2CO6B 2CKBB 4KZDH 4MJIE 3KPQB 3H9HA 3RY5A 4ZAKC 4H5SB 1TLKA 4BUHA 3ULUC 4HZLA 3VD5A 4LASH 4FHBD 3CZFA 3UPAA 2VDNL 4M02A 3QEQB 1DL7H 1FNHA 2WQ8A 3QDHA 2XKNB 5BOZG 3QDJA 4I18A 4XI5C 3C2AH 4NM8H 5JW4Q 1V3MA 1U8IB 3SOBL 5KS9F 3R06A 4XPGL 5IJKC 1GSMA 2I5YH 1AE6L 4HS6B 4F9PC 5JR1H 1YEGH 2MCPL 3GGWA 1OF2A 4WDIB 1KB5H 5C08E 4Z7VF 5HYSG 4X9HA 4PRDB 3L5IA 3RA7L 1HCVA 5D2NE 1IQDA 2DQGL 4YLQT 3OB0H 2BC4B 4FOMA 4W4OC 2R1YB 5EUOB 5IBUG 4WCYL 1GZPA 4L9LA 2W65B 4NJAH 3WLWD 1GIGH 4XVSH 3BESR 1DQMH 1KPRA 1TJIH 1U8LA 4RMVA 5F96H 4O02H 3BP4A 5E95B 1WUNT 2NY2B 2DM7A 2VXSL 3HZKB 4ZXBC 2B39A 2DICA 2Q87A 1I1YA 2VXTH