3MJ6A

Crystal structure of the gammadelta t cell costimulatory receptor junctional adhesion molecule-like protein, jaml
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
b'SPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPRDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Junctional adhesion molecule-like
publication title The molecular interaction of CAR and JAML recruits the central cell signal transducer PI3K.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj6A02
1I1FA 4HG4K 2FJGB 3MZTA 2HKHL 5FA4A 1MCOH 4WHTB 3T3PE 2GITB 2IMMA 5A2JH 2YA2A 1MWAB 5ADPH 2Y6SC 5DJCB 4XNXH 2BSED 5I19H 1JMZA 3HZKA 2HH0L 4B41A 4EI5D 1DZBA 5KSBA 4S1SH 5E4IA 4HIEA 5E6IB 5J3HD 5E6IC 1NGQL 5B38A 5DMKB 4W6YB 3QEQA 3BMWA 3L3HA 4LVHB 1W72A 5C0CE 4LVHC 3BP6A 5IROC 3B83A 3DNKA 2YD8A 1KJ2B 2CUIA 1RZ8B 4W4OA 3FONA 2OR8A 1OP5H 4NFCA 4QXUH 1N2RA 1MI5E 5DK2B 3KPSD 3NFSL 2CDFB 4OUOA 2VXTH 4TN9A 1T2QH 2OP4H 1QVOB 2ZUXA 4P2QB 5EPMA 2DQFA 4MD5A 2FYYB 4OLWL 3O8XB 1R3HA 3QULB 3O8XC 4QYOA 1CBVL 4O51B 2YEZA 1WICA 1DCLA 1BIHA 1UGNA 3BSZL 3DMMD 5HDBE 3CK0H 3T2NL 2AJSH 5EG6C 5C2BL 1E0OB 5EBMB 4PJ7B 4OUUA 3LPFA 2CXGA 3LS5H 5B8CA 4FTVE 5LXGL 5EORL 3TBVA 1PLGH 4YBQC 1QFUH 5TE7H 1C5DB 4ZS7L 4XCFH 3P9MA 3V52L 2AABH 1RZ7H 5L88H 4KVCL 5IWLC 4OGXH 1S8DB 4G5ZH 5IG7B 1XGYL 2X42A 1QEWB 1RK1B 3F12A 5D9SB 4KDTC 3FZUD 3ZKND 2H26A 3W82A 1A1OA 1AGFB 3HC4H 3AC0A 3ILQD 1PZ5B 5DA0B 2DICA 3FQXA 2B2XH 1OAYH 5CGTA 4YHPA 5C0BD 3IAQA 2WINB 3E3QC 1G6VK 2F53A 5EA0L 2A9MH 4OCXH 1IGFL 1Q1JH 1XF2B 4LRNL 3F5WA 2VRAA 3I9GH 3MRPB 4ODSH 4NKOA 1KPUA 1GRWA 4GQPH 3STZA 2NNAB 3MYJB 3QHTC 4G8IB 4LNVA 3R0NA 5C0DB 4WDIA 1LK3L 1DQJB 1QRNB 3QUYA 4G6FD 4ONOA 5IBUG 5IQ7L 5GRZA 5DR5H 4X4XB 2C3GA 3UTPD 2HWZL 1PG7H 4L29A 3DYMA 4H0GA 2FO4B 3MRJB 2BSSB 1FRGH 4WU5A 2E9JA 2F5AH 4NM4H 5F3HB 1K5NB 2NY4D 1XIWB 5C08D 1XIWC 5BO1L 4YXKH 1NGXA 2DL9A 3I50H 5J1TC 4FQJH 1KNOA 2QL1A 3QQ4A 4CN6A 3SCMA 3V5KB 2PTVA 1BVZA 3FN0H 4L3CB 4MGXA 3DX6B 2V2XB 3G5VB 1XFPA 2Z93B 5CAYB 3CDFA 4N8VG 4S2SB 1FDLL 1G7IA 3NFPA 3JV6A 4HF5L 5DQDL 3OKLB 5HI4C 3FT2B 3ZKQD 5D8JL 2C4FT 1YY8A 2J6EH 3ARDA 4UV4L 4LCYB 5JNYA 5H2BA 5IB4B 1XT5A 3UDWC 1KACB 2BCKA 5GPRA 3BEWA 4ALAH 1GGIL 1AQKL 4W70A 1PKQB 4JFYA 1MY5A 4LLYB 3OB0K 4OF5A 1DQQB 4WJ5B 3IETA 3D1MC 3VWJB 3L6FB 5E8OB 1FVEA 3CMOH 3VWJC 5BZDA 3FTGB 4G6JH 1QFOA 2Z35A 5GGSY 1A7PL 4OZ4B 4BKLB 1C7TA 1HKFA 4J6RH 5C86A 3NCMA 3MJ9L 4I9WD 4MVBC 4E5XB 5F89A 1OP3H 2W9DL 5EO1A 3UMTA 3CXHJ 3NGBC 1INEH 1F2XK 1KELL 4GBXA 5KVGL 3WNKA 2CD0A 4QRRD 2H6PA 1NDGB 4YO0B 1F3DH 3PGDB 1BD2E 1L4IA 4GW1B 5J4MA 5GXBB 1FE8H 4DVRH 4WO4A 1FNHA 2VDMH 4JRYA 2DI7A 3EOTL 5E03A 1FYTB 1Q9KB 1HXMA 1ZWIB 4XTRD 5CJOL 5D70H 5GGTL 4DVBB 1ZHNA 1T6VN 4NP4L 4X6CF 5F9JA 1N6VA 3G9AB 2C3WA 4YQXH 2F19L 2Z8RA 1OCWL 4H0HB 4ZFZB 2JTDA 3VFWB 2I9LB 2R8SH 4ZUWB 1MCNA 3VFPB 3CLEH 3FRUB 5DJ0A 5HY9B 5DTFA 1KPRA 1NFIA 1QZ1A 3ZE2E 1QA9A 4L8BB 4FQXD 2KQNA 3K0WA 5F7MC 4F3FA 2EXWD 4WFFD 2D0HA 3CCHA 4M7ZB 4M7ZC 1CK0H 2DQCH 1LO0H 2H45A 2OTPA 3WJJA 3QIWD 1F6FB 4NZUL 1BF8A 2EC9T 4ODBD 5A43C 1FSKB 1FSKC 1RJYB 3H9YA 2R2BB 3RVXD 1W0YT 2GQHA 1CFTA 3QXVA 4YBLB 2HP4A 4YBLC 4Y2DD 3D5OF 5C1MB 1IEBA 4IM8A 4XCCL 3MBXH 5D1XD 5FK9B 4NQED 2L7JA 3KJ4B 5ALBH 3EYUH 2BNRE 3KJ4C 4QXTB 5GS0H 4Y16D 1AIFB 4OQ1A 4P5TA 2ZCHH 2NY0D 1EJ6A 4MCYB 5SWZA 5C0CB 5ESVB 3OKMA 1U58A 5CJQL 3X3FH 5ICYA 3V8OA 4KKAD 3QCUH 1QLEH 2HH0H 4P2OD 4P9HH 5EDXA 3IGAB 2HAZA 3ARUA 4UTAL 1T5XB 4HLZG 4ONFH 2H32B 4YR6B 5AZ2L 2YUXA 3L5WB 2ICWI 2VYRE 4NRYB 5H94B 1MWAA 2A6IA 2FRGP 3RJQB 2LVCA 3JSSA 5EU6A 5EIIA 4X6DF 2VABA 2Y06H 3MA7B 4HWEH 2BHUA 1KTLB 3U6RB 3HPJA 5DYOB 4F33B 4DUXA 2DLGA 2BSRB 3CSGA 1F3RB 3QUMB 4OLWH 1FLTX 4MMZC 1YNLL 2DLFL 2EIDA 5LGHL 4QOKD 2XZZA 3L1OL 4NO2B 2VH5L 2V9TA 3BHBB 5DK2A 3BSZH 3FQRB 2CDFA 2CKBB 3D39D 1QVOA 2WLYA 4CW1A 5C2BH 2Q76B 3WE6B 1FO0A 4H5SA 5J56B 2EDOA 1DBKL 2AJYL 1N59B 3NABL 4JAMB 3C5JB 5KVMC 3D3VE 5DRNA 5L8KB 1LD9A 2NXZD 4P48A 4ZO8A 3GUTB 4P4KD 4Y4KD 3V52H 1JN6B 3O9WB 3O9WC 3HN3A 4KVCH 3FT3B 5DVOA 1OAXH 4XAWL 4PJ7A 2X4SB 1CIDA 5KS9B 1U8QB 3RL1B 5EIVA 4FZ8H 4IOFD 2BNUA 1IAIH 3QDAA 12E8L 3WSQL 3ARGC 1BBJA 2IANE 4E41E 3QXDA 2NY3D 3UYPA 3Q6FA 5BJTB 2UY6A 3VRIB 4HS8H 5D9SA 1V5JA 4GAJH 4KRPD 2DLHA 5JOEA 3DHMA 4PJDB 2MMXA 2FSEB 3KYOA 3SGEI 1CFSB 2GJZB 2AI0L 1LP9A 4LCWB 3IS1X 1KPVB 4RGOH 5F6IB 5F6IC 2FL5B 1BQHA 1KTDB 2IPTL 3OZ9L 3S36X 3CUPB 3QZWG 4UDTB 4X6FA 4M7LL 4LLDB 5FF6A 1T5WB 2WINA 3ZZ1A 5IQ7H 5JXAL 4NBZB 4HK3J 3BE1L 3SY0A 3PP3H 3K3QA 1A6VL 3MYJA 2AEQH 4JRXD 2HRLA 5A2IH 5C0DA 2AJ3B 5DJYA 4YGVB 1QRNA 2L4OA 3WS6A 2NTSP 3LY6A 5HHQB 4JHWL 4X4XA 5DJAA 5B3JF 1B0GA 2BRRH 1QBLH 1LO2H 2FO4A 3H9SD 4LSTH 2BSSA 4WCYL 4ODTL 1ZLVK 1XGQB 1IJ9A 3F7PC 4XMKH 3HNTL 5E2UH 5EU3A 3SPVB 3UYRH 1BREA 2D3VA 3X3GH 1X5FA 1QSFB 1GCFA 5DQDH 3QFJB 1MIEH 1A1MB 4XC1L 3TN0B 3TN0C 1ZVSA 2R1WB 3TO4D 3L3DB 3MJGX 5T3ZL 1C1EL 2JJTC 2VDQL 4LU5L 2QBWA 3C5SB 4PJBF 2V2XA 3OL2A 2D7NA 4WI3A 4Z7WE 5DD1H 3SKNB 4C57C 4XP4H 1G9NL 2FHFA 3NN8A 5H37G 4F7EB 3IYLW 5CGYC 1VPOL 2IADB 5KAQG 5IBLC 3OR7B 1KJ3L 3OKEB 3NPSB 1A7PH 3NPSC 2OQJB 3MJ9H 4JQIL 3BN9C 5D1QB 5D1QC 5T33L 4M6MH 4DTGL 1PKQA 1HILB 2W9DH 1IGIL 5K59E 5EZIL 2GY5A 1LO4H 3LV3B 4RNRB 2BJMH 1U41A 4PRPE 3P0VL 5KVGH 2H2PC 2R56H 3VWJA 4LAQL 3RU8H 5I73B 5I73C 1CDUA 1S7QB 4OZ4A 4NNPL 2AW2A 4M8QB 1YC8A 3QCTL 1Z9LA 3W5MA 3O4LD 5CZXD 5GGTH 5CJOH 4JJ5B 2X70B 1BECA 4R3SB 5HGDA 2J88L 2P45B 4NP4H 25C8H 5L2JB 2R2HB 2JCCF 5IVXE 3PGDA 3QI9A 4KQ4H 1OCWH 3CSPA 1S9WA 4GXVL 3PXHA 1FYTA 2V7NB 4UT7H 4GAYB 1Q9KA 2VZ1A 4YIQB 5J12B 3RHWF 5J12C 4DFIA 4DVBA 4LPCA 4XRCB 2VJXA 3A6CL 1JF1A 1CVRA 4R90L 2ICWA 4ZXBB 3VGDA 4DN4H 2EICA 4ZXBC 4AMKL 1M7IB 1IGYA 4NIKB 2BNQA 1RJCA 4ZFZA 5J9PA 2I9LA 1KCUH 2X4UA 4ZUWA 3QDHA 4XBEL 3QA3B 1SMOA 5E9DD 4FN0A 3RUGA 4NZUH 4ZS6C 2BNRB 4DKFL 3ULUD 4HWNA 1QSEA 2Q6WB 3U2SB 2OX5A 3OKOB 4L8BA 3FB8B 4PBVC 5TDOB 4EZMA 3QJFB 3I84A 3DXAE 1O0VA 4PJ8B 2JJSA 4PJ8C 1JGLL 2BHYA 3MNZA 4KHXL 1HQRB 4PR5A 4EUPH 3RVVC 3D18A 1PZUB 4OZHF 1YPZF 3N85L 4N0CD 3LSOB 4RIRB 5CEYA 4ELME 3ARBA 4Z7UF 3VXSD 5F44A 5BRZA 1NFKA 1YMME 4U1SA 3FN9A 5DJXA 5L2KA 5CJQH 3GGWB 4KQ3L 1QD0A 4JG1L 1EERB 5J1AA 5FK9A 4NNYB 3CFEB 1J7VR 1CD1A 1FN4B 3LEYL 1MFEL 2YXMA 2ZOKA 4KKLC 5AZ2H 3GJFB 4MCYA 4Y5VA 5DS8A 4JFPB 5C0CA 5AYQA 5ESVA 5E5MB 2G5BA 2EECA 4WWKA 2QR0B 3QEQD 2XYCA 4Y4FD 5FO9B 4JO4H 3SE9H 1MI5A 4RWHA 5D71L 3C6LA 3DROB 1RPQA 4NCDA 3STLA 4ACPA 1EJOL 2DYPB 4F2MB 1T5XA 5K9QI 2H32A 5I1LB 4JGMA 4YR6A 2Y72A 1VACB 3PQYD 4NRYA 4HFUL 3MV8B 3G04A 1YNLH 2DLFH 1CFVL 4HS3B 1UYWL 3CFKA 3MRKA 3D3VB 3MBED 5E5RB 4C4KO 2C7UB 1DFBL 1KTLA 3OJ2C 1QFHA 3U6RA 2OK0H 1QPXA 5FKPA 5GS0C 4M62L 4D3CL 1P84J 2NTFB 3P77B 3S37X 3D6GA 1Y0LB 5JDSB 1DBKH 1BBDL 4YPJA 4X4YB 4M48L 4HHAA 4FTVA 4V1DA 3NABH 3LQAL 1HHJA 1FC2D 3AREB 3AREC 4ODUA 3WCYA 4M7KH 5EU4A 3RPKA 5C0AE 5IMMB 3HC3L 5DLML 4IRSC 2UVFA 2HT2C 2FEDC 4XB7A 2YD1A 2BP3A 4S0SD 1MAML 1JWUB 4X7SL 3VFVA 4XAWH 1TXKA 2IANB 4X5XA 4E41B 4XPAH 4J8RA 2GTWB 1OPGL 4UIMB 3RWDA 3F65A 5DJ8B 5F7WC 2V9QA 5T1KD 4NGHH 4YHZL 5BXFA 12E8H 4GRWF 5FDWB 3GBNL 5JR1L 2XZQL 2F58L 3U79A 1R24B 1MCKA 1X5AA 1KIUA 2ORBL 1HYSD 5FV2A 1N5AA 1G7PB 3GMMB 4R7NA 5C0RL 3OAZK 1KIRB 2XWJB 4Z0BL 4DK6A 4N1EA 1N6UA 2Y1VA 1I3GL 1SBSH 4U1LB 4IDLA 1V3MA 4K3JH 1VGKA 3CVIH 1F3DJ 3RGVD 4OZGB 3OZ9H 3O45B 5IJKA 4M7LH 1R5IB 3MUHL 5BJTA 3TH2T 2WIMA 2YPKA 5JXAH 4NZTL 2FSEA 4NT6A 4HUXA 1CFSA 2P24B 4Z7QF 3KPPB 2X4NB 3ULUF 1A6VH 2FL5A 4KRMB 3TZVA 1GZPB 4HZAA 4LLDA 2YN5A 1T5WA 5KN5A 4YHLH 3FO9A 4QRQB 4X4ZA 3VWKA 2NZ9D 2QQKH 4HK0B 3ZMRA 4JHWH 5CEZD 5L9DL 1GXEA 2YK1L 3LN4B 4CVXB 4KWUA 4OGZA 1S7RB 4WCYH 1ZSDA 4PJAE 5I15H 3SCMD 4S1QH 3DUUB 3VG0L 2A83A 1LEGB 4Z7WB 4LCIL 1L7IL 3A0OA 4YGVA 5E6YA 1E27B 4QRTB 1U95B 4I18B 1IRAY 2ZSWA 3EO9H 4I18C 5MENA 2VAAA 3MOQA 1C1EH 3EJYC 4LU5H 2VDQH 3K2MC 1XF3B 1YMHB 4L3EA 4U1MB 1H3PL 3V5HA 3P0YH 1RMFL 3SPVA 4RMTA 4AQ1B 4JM2B 2EO9A 4JM2C 4LMQI 4RX4A 5TQ0L 4NN6B 5KTEL 1JWMB 4NN6C 1NBZB 2CUMA 1IM9D 3ARDD 1A1MA 3MFFA 4K7PL 3RWCA 4CDGC 4J2XA 4LFHD 1VPOH 2DJUA 5JIPA 3C5SA 3SKOB 1TCMA 1QOKA 3FT4B 2CIKA 1FBIL 1CGUA 5FGCE 4XC3L 5C0GA 3BKML 1F4AA 3EHBC 3IU4L 4OFDA 3SGJA 4P23D 2EH8H 5IK3B 4DTGH 1IGIH 3MQIA 1TJGL 1LWRA 4LLWB 3LKOA 3QBTB 4P3CL 4HIJA 4U1GB 1XF4A 5IESL 1MCWW 3IKKA 4U1GC 4LAQH 5FYKU 5HDOA 4LEOA 5LCVL 5C7XL 4NNPH 1BD2A 2HA1A 2CJUH 2G75A 2WQ8A 4HT1L 1LO3L 3P4MA 5EBLB 2ARWA 2WBJB 1DR9A 2OTWA 2WBJC 1DQMH 1AGDB 4NQSA 4OIIL 5K9OB 1G9ML 4RNRA 2BY2A 5HGAB 1F8TH 2EYRB 3L3GA 4Z7OF 1AP2B 4JLRB 5IFHL 2J88H 3MROA 1KT2A 4JRYD 3MRDA 4U49A 3VCLA 2VLJE 5B38G 4Q6IB 2XWTA 4DW2L 3QO1A 1S7QA 1XGPA 3E8UH 4KKCC 3TVMC 2HT3D 2EYSB 1AFVH 4GXVH 2XTLA 1TZIA 5JHLL 3R1GL 2EEBA 3MGTA 1H5BC 4NKIL 3VU2A 3A6CH 2NR6D 3UPCA 4MA3B 4OCNC 4R90H 1YN6A 3DXAB 2OXGA 5DO2C 4ZQKA 2O61A 2PXYA 4LDLB 4XBEH 1KJMB 4MJ5A 3RHWK 1MHEB 1DBJL 32C2A 5CBEB 4YIQA 1OB1B 1I7TB 2PCPB 4RCAA 2CIIA 1VCAA 1F3JB 3SDAB 3SDAC 1IAOA 1JGLH 1HWHB 4NKDB 3HG1A 1U93B 4JHZA 4KHXH 3ULVD 1EPFA 1EH9A 3HZYA 3N85H 4PP2B 3QA3A 4UTBL 4W4NA 1YQVL 1A3LL 4WEBL 2X40A 2Q6WA 2X4OA 3OKOA 4RRPG 3FB8A 5HJ3B 5TDOA 1IKNA 1GC1L 1UM5L 2WBKA 4LLUA 4KK8C 5I1HH 1BGXL 4P5TD 2GTZB 1DUZB 4WW2F 4JG1H 5FM5O 1HQRA 1HHKA 2Z31C 1G7HB 1RULH 5CUSH 2ICES 4KROB 4KROC 3D69B 1BVKB 1EFQA 4PRNA 4WI7A 2PYEE 1CD8A 3B2VL 3TT1H 4CAGA 5IFAL 5DD6B 5DEFA 5D7KE 5JXEC 5CFHA 3QUXB 4IRZL 3QEUB 3QUXC 2Y6SD 4NNYA 5D71H 1ZHBB 5T5FL 4HKBB 1A5FL 1EJOH 1AGCA 1FN4A 4KJQD 4NUGH 3D9AL 3KWWB 4YC2B 3BP4B 4YC2C 2A6DB 1MF2H 2CMRL 4U1NB 3QCVL 2AGJH 4KI5C 1U8OA 4JFPA 4NYLB 5CSZA 1FFQA 5E5MA 5MHSE 2G9HA 1UYWH 3WO3B 5I76A 3AB0B 3PXJA 3AB0C 4BA8A 1CE6B 4A2LA 4EUPB 4TYUA 5IEHA 1DFBH 3VDAA 3DUSA 5C0AB 4XHQA 3VW3L 1P4LB 2DYPA 3NCJL 4M62H 5I1LA 4LSVH 5K33A 5FO7B 3F6IA 1BBDH 2FX8L 4M48H 2ZOLB 3HAEH 4P2QD 1HYRC 3LQAH 1FAIL 2EDYA 3O8XD 4G8GA 3KYNA 2Q7YB 5DLMH 2EDWA 3BH8B 3CFBA 4HW6A 1F6AA 3W81A 1HSAA 4WHYH 1P7QB 5IW1A 4YHZH 1VADA 4ZO9A 3AGVA 3JV4A 4KZEL 3GBNH 4YBQD 5FYJL 3DARA 3C09B 4WRLA 4KJWC 3C09C 4R96A 4YEEA 2ORBH 4S1DD 1P4BL 3T0EE 2IANA 4WEMB 5I66B 3MRLA 1NUDA 4LFHG 4UIMA 4F80A 3HMXL 2EC9U 4GOSA 1SYSB 1KC5H 2XKUA 1A14L 5F9DC 1AC0A 1LEKB 3BOVA 3RPIB 3BRDA 4PJCF 3CPLB 1R24A 1JZ8A 4XNMA 3WIIL 1G7PA 5HHNB 3GJEA 3TPUB 1G6RL 1OP9A 4O02H 2XWJA 1KIRA 1MCCA 4NHUA 4NZTH 2UY7A 5IGXL 1P5UA 1FAKT 3RDTA 1A6UH 3CFDB 3OGCB 4U1LA 2D7PA 2X6MA 5MERA 4PJAB 1VFMA 2K1MA 3WXWL 5FUOL 1S78C 1A3RL 4NO3B 2FBJH 3H3PH 3NCCB 1KENL 5L9DH 3ULVF 2I5YH 2UZIL 1FNAA 1QRND 1UM4L 3KPPA 5FOBA 3N1MC 4HKJB 3MMEA 1G7JB 5JORB 3MLVH 4PJ9B 5F21B 4PJ9C 1V05A 3W11C 4LCIH 1E4XH 5JIIA 5JO5A 2H1PH 5FECB 4HKXB 4QRQA 1MH5B 1XIWD 3MLZL 1WJ3A 2I25N 4NN7B 1G7LB 1W0VB 1KCVL 4NN7C 5ITFB 4HPYL 3ZDXF 5D96C 3UTOA 2WZPD 3N1GC 1D6EA 15C8H 1KJVA 3DUUA 1ZLSL 5C0EB 4Z7WA 2DQIL 4L9LB 5FGCB 3T4AB 4L9LC 1NCCL 1E27A 2I9TB 1CR9L 2HTKC 3D48R 5MP6L 4RGMB 4K7PH 4RGMC 4JFZL 1OOAA 3LCYA 3HMWL 3QQ3B 3PGCA 1UZ8A 4NSKB 4G80A 4UDUB 2DBJA 3OAYK 3LRHA 3NIGE 4U1MA 3FOLB 4XC3H 3B3IA 1OAZL 3BKMH 3IU4H 5MEOB 2PO6B 4UBDC 2PO6C 2O5XL 3F7VA 4DKEL 5I1IH 3SDXE 3C5ZC 4H20L 4K7FB 4NPYB 3X11A 3GHEL 4P3CH 2IC2A 5IESH 4PRIB 4PRPA 3MV7E 5I8EB 3ESVF 1T7XA 3JWNC 1R3JB 1GIGL 4HZLB 5C7XH 1YEKH 3JVGC 5ABDE 3AU1B 3VWJD 4GRLA 2VXUL 3HE6B 3HE6C 5AAMA 1MNUL 1II4E 3IFPA 3VGBA 3AM8C 4LLWA 4OIIH 4MVBD 2EH7H 2IWGA 4WFGD 3OAUL 1MCEA 5IVXA 1MLBB 3DETC 2MPAH 1JFQL 1T20A 3B6SA 4G9FA 3ZT6A 1JNJA 3QI9D 5E2WL 5CZVH 2DIBA 1RZIB 4PJ7F 1G9NC 2DDQL 1AP2A 1J8HE 4ZAKB 4ZAKC 5HBBA 3B9AA 1FYTD 4Q6IA 5EOTB 1JPTL 1EAJA 3EDFA 3PJSB 1H9VA 5C3TA 2MQCA 1UQSA 3I3BA 2D7OA 4GW4A 4LSPH 1DBJH 5I1CL 1FG9C 3QPQC 4PRDB 4XWGL 5J0BA 4EXKA 3MLWL 4N5EC 1TFHA 3MLXL 5ANME 1LE9A 4HXBL 4U3XA 3L3IB 2BOBB 4FFVC 2DI9A 2CLZB 1LE5A 1GVIA 1LP9F 1WZKA 4MJIE 3V4PH 1P2CA 5FYLH 1CDGA 2P1YA 4ELMA 4JANA 3RZCB 4WEBH 3RZCC 4E0RA 1NMBL 4ZFOB 1GC1H 3UPRA 2PCPA 3U9UA 1YMMA 3CVHH 5F7FA 2EYTA 2PYEB 3STBA 3T65B 4PD4J 1T1XB 5IM7B 3QEHA 4OI8A 5DVMA 1UWXH 4G8FA 2CGRH 4K55A 3VH8B 1NCWL 2GCYA 5DD3H 3T4YB 4PRHE 4RMRA 1U8NB 1Q72H 4IMKA 3NAAL 4APQB 4APQC 5HJ3A 5BS0B 4U1HB 3QEGL 4WEUD 4JDVB 4ZSOE 5MI0B 1T1YA 5MI0C 4G7YH 3UZQA 5C07E 3O41A 2J8UA 5BQ7B 3TNMA 2GTZA 5KBNC 1OAUL 1IC4L 2FH8A 5IVZB 3NOIA 4IRZH 4HXAL 5C0CD 3KGRA 4XPHH 4J7RA 4WWKD 2VZTA 1NC2A 3UCRA 2FATL 1WTGT 3TBWA 1BQHG 3PIQB 1D5XA 1KYOJ 1MI5D 3TA3A 1JZ4A 2CRIA 2EC8A 4ZNEE 4WVRA 2C1PB 4WW1B 1RIVL 1UB5A 4OF3A 1SM3H 3QEUA 1ZHBA 1I9RH 1LQSR 3VW3H 5ACMA 3NCJH 3KWWA 5I1JH 4JFEB 3SDYH 2FX8H 1ZAGA 4UUJB 1FAIH 4PJIB 4FMKA 4JHBA 4CU6A 2ZUUA 5DRXB 1O7SA 4OLZL 5FYLE 4JFDE 1SJVA 3L3JB 3MRIB 1QUNA 4FTVD 5C0AA 3MXVL 3WBDA 3SDCB 1BFOB 3T0EB 1PD6A 1DVFB 2E6QA 1DVFC 3SGDI 4Y89A 5C0FA 1WISA 1X7QA 1HHGB 1CL7I 2RAMA 4KZEH 4MNHB 4NBXB 4XPGL 3LHPH 5J57B 1JZ2A 4OAWB 3CMGA 4R4NC 5GJSH 1MJ8H 2XN9A 5E00B 2PW2B 3OJDA 3O9WD 1NLBL 4BZYA 3DTXA 3DWTA 1JRHH 1U8IB 3HMXH 2GJ6E 5GGSB 5D6DC 4IJ3B 3WHXB 5E94A 1T7YA 2OZ4L 4FFWC 1HE7A 3MC0A 3U0TB 3SOBL 5D7IE 1ETZB 3U0PB 1IAIM 3WIIH 5I66A 4WI9A 4HJJL 3SE3C 1BWWA 5EO9A 1SYSA 3LQAC 2GK0A 1D5BA 2DB8A 1NGWB 4GUPA 4WGWB 4OCRL 5FUOH 5GGRA 4L3AA 3X13B 2JIXB 1PQZA 3S96B 2VITB 5LQBL 4EN3A 1KENH 4YFLF 1BX2B 4GXUN 5KVEL 2UZIH 3DVGA 4MAUH 4S0TD 3CFDA 3AFLA 3OGCA 3QDJB 4UOW1 4RISL 3VXNB 1F5WA 2BFVH 3FFCA 4L4TE 3U1SL 4PB0L 1EFXA 5JTWA 2QQLH 4NHCH 4JN2B 2VN4A 4X80L 2N4IA 2FR4B 4O9HL 3FHQA 2FJFB 2VR5A 2AQ2A 3T3PF 3WNPA 3SKMA 5TH2B 5I75B 2APXA 5I75C 2W1NA 1HIML 1UWEL 4AL8H 4NQXA 3K4DA 5FHAL 4OQTA 3LQMA 3KPLB 1UCBL 1J0HA 5EH1A 1AHWB 4HMCA 5EU5B 1CR9H 4HKXA 4B53A 5HGHB 4BQ8A 5C0NC 1CD0A 3QWRD 4M61B 1QSFD 3QFJD 3MV7B 1XGUA 3RVUC 2B1AL 4OFYA 3TN0D 2QADB 2QADC 3PV6B 3TP4A 4YAQB 3V7AE 1QLFA 1JV5B 3LEVH 3U7YL 3TIDB 2BX5A 2O5XH 2I9TA 4GLRI 4V2CB 2WIIA 3CH1B 5TF1H 4H20H 3QIUA 1C16B 1QNZH 4UNUA 3P0GB 4AT6B 2RIKA 4UDUA 4FXKB 4HQQH 1F6LL 1T6WA 1K4DB 4JR9H 4LKCB 3GKWH 5IF0B 3MRGB 1ZLVH 2CPCA 2VXUH 5HDBF 5MEOA 5IBLD 3F7YB 1U9KA 1BD2D 4TPRL 4WGVB 4NPYA 2M8XA 2X1XR 1A0QL 5D1QD 2ICEB 2IPUG 3V79C 1ACZA 5DZNA 2VLJA 3C60C 2E8YA 4F7MB 2R29L 2LQRA 3C9NB 1RV6X 1NUFA 1MCFA 1N6QL 2QSCH 3R8QA 1LDPL 3QNZA 1EVTC 2V2WA 2DDQH 1Q38A 1JIBA 4LASL 3HRZB 4Q9QL 1G7QB 4X8JA 4XB8A 5ANMB 4X6EA 1MIML 4QRUA 4AH2B 4J3XA 4ODXA 1BM3L 4HG4J 1JPTH 1MLBA 4RDQF 3QRGL 4M7LT 4PREB 3N1PC 3U4EB 2J7LA 4RMVA 5I1CH 2XNAA 1RZIA 5FCSH 5GHWL 1N7ML 1WEJH 3CGTA 5T3XH 3MLWH 3VRJA 5ACZA 5KS9F 3VE0B 1VGEH 4LVOB 2K3TA 4EOWH 2R69L 4X5LA 4YHNB 3RAJL 5SWQB 2YBRA 3CXHK 4ZXBD 2XPGA 3VGFA 4WWID 2D7TH 4PLKC 4YFDB 3RA7L 4PRDA 4PRHB 5DWUH 1G9MC 1KCRL 3Q2CA 3L3IA 3IDGB 4PJDF 3PHOB 4ZSOB 2BNRD 3QFDA 5GSVA 3U46A 2CLZA 3A6BH 5IMOB 4ZO7A 5HYJE 5T1MA 2WWMC 5E2VL 1S9VA 3Q1SL 1NCWH 2XT1B 4PJ8D 4GH7B 1YN7A 2HJKB 4UB0L 3W0WE 3MRHA 1KULA 2VLKE 2DMBA 3FO1B 4IIQB 4Q2ZB 4IIQC 5HYSA 2AXFB 3QXWA 1MCSA 3TNNB 4PGEA 4BQBA 2XA8L 4AEHH 5GS1A 2BC4B 1HSBA 1UXWB 1DE4B 4FQ2L 5ESQB 3BWUC 3DBXB 2XZCL 2FATH 4FQHB 4M5ZL 4ZPTB 1D9KB 1D9KC 2F74B 5JW4N 3GSOB 4WI8A 1UVQA 1RQ5A 2NYYC 4LSUL 2OJZL 3BESR 4NQDA 1IC5H 2ATPB 4KKLD 1DBAH 2LAAA 1L0YA 2KPNA 4K2UL 4HGWB 4JFDB 1F4XL 4N9OB 5DT1L 1WC7A 1KLGA 3QNYA 2R0KH 3HNSL 4XCNA 5T3XE 5DF0A 3WS3B 1SJEA 1GC1C 3CVHB 2DYPD 4OV6F 1NAMA 3VXRE 4JVWA 1JNHB 3MV8D 1J0KA 1XGTB 1S7SA 5DJ2A 3MXVH 3D3VD 1J87A 3U83A 4XI5C 3P9LB 4YJZL 4KUZL 3ZL4L 1U8JA 5GS0D 5I17B 2X05A 2ADJB 1P7KB 4UUJA 4TVPH 5I1EL 4JY4A 3O6LL 4CVUA 4J3VA 4F9PC 1CGYA 2ITCB 4CN1A 4MD0B 2BVEA 2X7LB 2BDNL 1XR8B 3DSFL 1F42A 3SDCA 1YJDH 2R0WL 3ARED 4LSRL 1PG7X 4PJHB 4XPGH 3LDBB 3LDBC 3T0EA 5D7IB 1NUGA 1NCAL 2R39A 5LAXB 5JLZB 2W0FB 2FEDD 1A9BA 3LKPB 4Z5RA 4D8PB 5KVFL 3ARWA 2IAND 4E41D 3FN3A 3G6AB 1YUHB 1DEEB 3LMJL 1WIUA 2OZ4H 5EBWB 5E8DL 1FNLA 3DRTB 3SOBH 1LGVA 4OAWA 3S6CA 1E28A 5AG9A 4W81A 2V6HA 4ZUVA 2MNUA 3ZE2F 5GGSA 2NY6B 3BEVA 2NY6C 4GQ9H 3LD8B 1WCBB 3LD8C 4X0KB 2VDNL 4Q0XL 5J7CC 1C5CL 1KEML 3VGGA 4OCRH 3PL6B 1CLOL 3HKFA 3PL6C 1MHHA 3PWLB 4L4TB 3RDTD 5HHXH 2Q7NA 1X4YA 4MCZA 5LQBH 5F1KC 3BGFB 1YYLL 4UT9L 3CLFL 3HAEA 3BKYL 5KVEH 4J1UA 4XHJC 3QISA 5IVNA 3QUZA 3U1SH 2JIXA 1NL0L 5KVDL 4XCEB 4PB0H 3ARRA 2VITA 4D0BB 2DRUA 2HG5A 4DJMA 1S7TB 4TVPE 2MKLC 1T2JA 1IQDB 3KPOB 1MSPA 2AV7A 5CEXA 4NNXA 4H25B 3LS4L 1HOCA 4U6HA 3WFEH 1UWEH 2JJWA 4EJ1C 5FHAH 4O4YL 2BSTB 3D85A 1UCBH 5GGVH 1EV2E 2KZ1B 2UUDK 5DJZA 2YWZA 4Y1AE 4JN2A 4RMQA 5TFSH 1HHHB 5IR1B 1KF9B 2P5WE 2BK8A 3OX8B 3RIFF 3V6ZB 5TH2A 3REWB 3OHXB 1BQLH 4RFNB 4EKXA 4F7TB 3BIBX 4RFNC 1M71B 4HUVB 3B2UC 5DQ9B 3M8OL 3RNQA 4EVNA 1KOAA 3U7YH 1FJ1A 4I77L 1CQKA 2GUOB 1AHWA 4NO5B 2ZNXA 2FZ3A 4FHBD 4HKZA 4M03A 1B6UA 2FECI 3SDXA 4JM2D 3DGGB 5DFWH 4M61A 5GGUB 2BOCB 1F4WL 1MRCH 4D9QE 4CNIB 3MV7A 3VFUB 3DOSA 4BZ2L 3M1BB 4EDWH 1T83A 3VFRB 3BQUB 3TIDA 3BQUC 5IHUL 8FABA 2X5PA 4Q9CA 1ADQA 1BOYA 4LHUB 3CH1A 3WFDH 4KZDL 3GSRA 5KSAA 1HDMA 3L7EB 2EDRA 3BZFA 5IP4A 2HKFL 4PJEE 4LKCA 3UJJH 2R29H 4OCSL 3MRGA 1HNGA 5C6TL 1N0LA 3IVKA 2HFFB 4YLQT 3O3UN 1ZT1B 2Q8AL 1J8KA 3PWPE 3F7YA 2KDGA 2Z0BA 4EIZC 2CR6A 3T8XB 5L0QB 1FH5H 5L0QC 4F7CA 1PDKA 4Q9QH 1J8HA 4LK4A 2NQCA 2WBJD 1ZLUH 1MIMH 3QHZL 4LEXH 1BM3H 2H8PB 3O6ML 2GT9B 4FXGB 4KGLA 2HTLC 3C9NA 2P8MB 4G9DB 4NRXB 3L9RB 4YPGB 5LKNA 5ADOH 1YEHH 2Q3ZA 5KOMC 5I1AB 4KK9C 1FVDB 3GNMH 3H9HB 3TBTB 5DJ6B 5FYKL 2P5EA 1PY9A 1BAFH 5ANMA 4AH2A 2K7PA 4EEEA 4Q74A 4O2FA 1RVFH 2R69H 1WVZA 3T0DA 2A73B 1PSKH 2PYFB 1T1ZB 5SX5H 4KJPC 2WK2A 4UQ3A 5HYJB 4MJIA 1GH7A 3U4EA 1I3RB 3DXAD 5DO2D 4WFFE 5HVFB 1I4FA 1G7MA 3HI6H 3WN5B 5BVPL 3WN5C 3VXQB 2VLKB 3VE0A 1KCRH 1YQ2A 1MJJA 1OGAB 1OP5K 1KIQA 3LKSA 1R3LB 4P99A 1CICB 1CICC 3MLTB 1C12B 2VXSL 3Q1SH 1YMMD 4XCYA 2MCPL 3SDAD 4OZGF 5CWSB 4HD9A 1ROWA 4UB0H 3WKNA 3CC5B 3QAZB 3PHOA 5FCUL 5C07A 4LKXA 4WU7B 4YX2L 2XA8H 4XBGA 1BJ1H 5DUPL 5DQJA 2B4CL 4FQ2H 2DQEL 4X7TB 3WXVH 3TT3L 5C2UB 2XZCH 4FQQB 3W39B 3FO1A 5HHPB 4GS7B 2FEEL 2IFGA 4GS7C 1QTYT 1V7ML 4XVTL 4ZUSB 4KROD 1A6WH 2VLRB 1UXWA 3CX5J 3GIVB 2IBZY 2PTTB 1F4XH 4QO1A 5JXED 4Z7WF 1HH6A 5DT1H 1RAMA 4PJGA 3HNSH 1UWGH 1NEZB 3QUXD 2F74A 3IJYA 3MJ7B 1ZGLA 4N5UA 4R97B 2KZWA 4R97C 1W8NA 3K1DA 3GMPA 4JB9L 1WK0A 2JB5L 1IMHC 2VL4A 5D5ME 1KN2H 4JFDA 1A7RL 4U1JA 4JM2F 2PTUA 4QOKE 1RZKL 1FZOB 3HLAB 5ICZB 5C0AD 1S9KC 4IMLB 1VSCA 1TTUA 1LO5B 1PX4A 2AJXL 5F6HI 4PB9L 3H6JA 1OAKL 3IU3B 3NCEB 4Z78B 2V17H 2G60L 3DSFH 2R0WH 5DURD 5CJXC 1VEMA 2WWKT 3P9LA 4NQVA 3TO2A 3BH9A 4NUJA 2ADGB 3VXME 4NJAH 4ENEC 2JCCE 3V4VL 1R3IH 3GMNB 1OW0A 5KVFH 3LB6D 2FO1A 5IJVB 2GJ6A 4F9PA 5IVXF 1ES0A 5E0QA 5F7YC 3G08B 4MD0A 1MCLA 1A6ZA 1P7QD 2FX7L 4NWUL 3HCVB 4EQ2A 1MY7A 5C3LD 2WLZA 1F4HA 3BZEB 4YDIL 4YBHA 4KJWD 4D8PA 4TUJA 4OD2A 4L4VA 5IW3A 2VR9A 2VDNH 3P30L 1INQB 3G6AA 4RMSA 2V5MA 1LDSA 2WSKA 1C5CH 1KEMH 5FHBH 5ISZE 4XMLL 4G6ML 1CLOH 2G2RB 1J0IA 5FFLA 4PV8B 1X5GA 1YYML 3RX5A 2X1OA 3SQOL 5I1DB 3CLFH 3OMZA 2WMPA 3BKYH 5HYQB 1CE1L 1A47A 2QSTA 2RHEA 3K2UH 3D25A 4OZHE 4PYHA 1YPZE 3E6FB 1HI6B 1G1CA 3NIFE 4U1IB 1EMTH 1M7XA 1X6LA 2NLJA 3PWLA 5HPMB 5KVDH 4H88L 4OV5A 4M3JA 2DM4A 3IB4A 1Q94A 1I75A 3MR9B 3ULSB 3DO7A 4MXWH 1S78D 2P5WB 1EFXD 1UJ3A 3OXSB 1MHCB 3VGEA 1RURL 1SY6A 3LS4H 4PP1D 1YECH 5EBGA 3GSXA 1DBML 4OFIA 1OP3K 4RFEA 5ESAB 3WKMH 2AP2A 4XCEA 5INCA 5JW3L 1KFAL 1CGSL 3VMNA 4AENA 4MWFB 4PJ9D 1FNSL 3IDJA 3W11D 3KPOA 1TVBB 1HQ4B 1RHHB 5E4EB 5E4EC 3OBAA 1WBZB 4XNZB 4XNZC 4PBXA 4RZCB 4LSQL 4Y4HB 4Y4HC 3M8OH 2ZUWA 2A0LC 1FFNA 4JFXB 2H2SD 1TJIH 4LSSH 1KXQE 3QR2A 4U2YA 5JQ6H 3RIFK 2WUCL 2BHZA 3RI5F 3UTTB 3LOWA 3V6ZA 2HTKD 1JZ7A 5IHBA 1QQDB 1JPSL 5HI3C 2LVEA 3OB8A 4WUUE 3NCFB 5EFIB 3EYFB 1VDGA 5CKAA 4YHKL 3AS3A 4UV7H 3C08H 3GJFK 5SWSB 3PWPB 4HV8B 4KZDH 4M7JL 4KI5F 1N4XL 1ZK9A 1FORL 4HH8A 4GAGL 5E1AB 3UO1L 5D7SL 1QRKA 2APWA 1KN4H 1DEDA 2FECL 3IDNA 2NW2A 2VLJD 4LHJB 1H3UA 4N0YL 1JPFB 2EZ0C 5BMFL 3GSUA 1UZ6E 5SX4I 4HC1L 4N9GA 4U6YB 3T0VA 1CN4A 1CXKA 3HE6D 2GYSA 3QHZH 3L95B 2FH6A 4GRWE 4JQVA 3O6MH 1FL5A 5CD3B 1AI1L 4QY8B 2PN5A 5E8NA 5FEBA 5EULV 1MPAL 3EOAB 4XPBH 1L0QA 4ELKA 1KSRA 1IC7L 2AV1B 5FYKH 4PS4H 1NBYB 2KKQA 3GI9L 4MNQB 4ZODA 4MYWB 1KBGL 4PJFB 5DHVH 4PJXE 2IH3A 1KCKA 4ZAKD 3DV6B 4P2RE 5EUKA 3BIKB 4MXVE 2C26A 1VB9A 2ZCKL 4NRXA 3S3JA 3L9RA 1QR1B 3V6FA 4EUPG 3PP4L 3FB7B 5A16A 5F70A 5DD5H 1U3HB 1U3HC 4DGYL 4RBPH 5BV7H 4O5LL 3QPQD 5F71A 5I9QC 3ULUE 2A73A 4N5ED 5C8JB 2VE6A 1T1ZA 1JHKH 4NO0B 2VXSH 2MCPH 3ARSA 5IIEA 4FFVD 1YEDB 3WMSA 3WIHL 3W0WA 4N0UA 1JNLH 4X6BA 1I1AB 2GSGA 3QPXL 3ZYIA 3UAJC 4YX2H 4OLXL 5EZLA 4Q9BA 1LNUA 4XMPL 2NY1B 5DUPH 2NY1C 2B4CH 4PJAF 1C12A 2DQEH 2PYED 2E6PA 1X4ZA 5D7KD 1H8OA 3NH7H 5DJDA 2YSSB 4L1DA 4M1CC 1I7ZB 3EZJB 1I85A 5SV3A 1PFCA 5BS0D 3ILPA 4MAYB 4MAYC 3SDDA 3DSNA 5HHOB 5D5MB 4AIZB 2C9AA 1KLFA 5MHSD 2CQVA 1PAMA 1HZHL 2ZKHL 5IB1A 4LDOB 5FA3A 1PY4A 3IT8D 4QRPE 5FYKE 4L8DB 4FG6C 5ILTH 1NBQA 4EIGB 4ZNCD 3SJVE 5I1GH 4D0CB 4OM1L 1IGTB 4ZUSA 3ZKMC 3UPAA 4LVNB 4JB9H 1MCPL 4LVNC 1QFWH 3VXRA 4PPTA 1HEZA 4YDLB 4YDLC 3MRCB 3O3AB 1A7RH 3PWJB 4OB5H 3WJLA 5TDNA 3HPLB 1EAPB 2EE9A 1RZKH 5F96L 3IDIB 3L3OB 4FNLL 3FQWB 3MJ7A 4GSDH 1YEIH 1KGCE 3VXMB 4J3WA 1J05B 3AXLB 5J11B 5J11C 4JFED 2AJZA 4FQ1H 4OIBA 2X1WL 3ALXA 1FZOA 4HBCH 3C8KA 3HLAA 4G6AD 1B6DA 1FZMA 3AY4A 1INDL 1S7XB 2R1XB 4NFBA 4X6CA 3LN5B 3KPRE 4I3RL 4IMLA 2RBLA 4NQTA 4UT6L 3SDCD 1EEYA 1TITA 4BH7A 3T0ED 5IKCB 5FKAB 1DVFD 3LPGA 2AJVL 1J1XH 1JK8A 1GHFL 1S9YB 1SEQL 4WV1A 3HB3C 4YWGH 4MHHI 5ISZB 2X41A 4NWUH 2CSPA 2ADGA 4YDIH 4ONGL 3VJ6A 1A9EB 3BZ4B 4K94L 2YC1A 2MQ3A 4R4ND 3KPQA 5IJVA 5JOFA 3JV0A 1XCQB 3P9WB 4CL7A 1VFAB 1E6OH 3IJSB 1FYHB 4XMLH 4G6MH 5IHLB 1RUKL 2W9LA 1E4KC 3K1KC 4JZJA 4XH2A 5BOPA 1IGMH 3WFZA 4LCCC 4XXCA 4AY0A 1U3JA 4H26B 3O3DA 1ZMYA 1NBVH 4ZUTA 4FFWD 5D7JC 2CK0H 3ECBB 3EOYG 2VL5A 2W9EL 1INQA 5GRVL 1S3KH 3MRFB 4NKMB 3UTZB 2NY2C 3QXAA 1BQUA 2G2RA 1AXTL 1H15B 1CF8H 1TCRB 4FP8L 4Y5XA 1FL6B 2D31B 3HE7A 4YDKH 3IXTB 1ZEAH 5GS2H 3TCLB 5I1DA 3VFNB 2JIXD 3V4UL 3MJ6A 2ZSVB 3GK8L 3LKQA 1OQXA 4PUBL 4KXZI 5CEZE 1OSZB 1LHZA 2IPKA 3S8WA 3MRMA 2Y7QB 1Z9SA 2QHLA 3QDJD 5JW3H 2FLRT 4OCYL 3GMRB 4TOYH 1CGSH 1R6VA 3MR9A 1C08A 1RZGB 1V3KA 3QDGE 4Y1AA 1T89A 1FNSH 3D85D 1I8MA 4HWBH 1UKSA 4DQOL 3BT2H 3OQ3B 4WTZA 4HWZB 1MVUB 1KG0B 4X6DA 3PWNB 4OGYL 4YHML 3SGKC 2WWKO 4MD4B 1WFUA 4GKNA 4KRLB 4CMMB 2VZVA 3O3BB 1AGEB 2A6JA 5INDB 3RQ3A 3MACH 1RHHA 4IRJB 4PJ5B 4IRJC 3LRSB 3WLWC 2AEPL 3H0TB 1PVHA 3MNWB 3F58H 5JW5A 2DN7A 5C0ND 5FB8A 2QJDA 4JE4B 1BJ1J 3MV7D 2ZUVA 3S5LB 1JTOA 2DQTH 5E99H 2QADD 3RI5K 4MNGA 3MGAA 3WEXA 3BN3B 3EIFA 1AE6L 1T7WA 4KKBD 1MFDL 1FORH 43CAB 1BVLB 4WUKL 1FL3B 1ZT7A 1IAKB 3BVNB 3QZWA 4PJEA 2CO7B 3QSKB 2F8OA 1B4JL 1FIEA 2X4RB 4WIQA 1O5DT 3MA9H 3LH2H 4QRRA 1D5MA 1JP5A 4ETYA 3RVTD 4HC1H 4K8RL 5C6PB 5JOPE 4JM4L 4ZOEA 1XF5B 5E1AA 4PJXB 7CGTA 4H1LA 1BP3B 3E6HB 1U8HB 4LQFH 4QCIB 4QHUB 4OZIB 4F37F 4U6YA 1IC7H 4Z7VE 2E7BA 3UBXI 1TPXB 2DS4A 1TPXC 1EXUA 4JZOB 4NWTL 2CLVB 3CDGA 3V8CA 3VDCA 3EDJA 4TVSa 1AXIB 4PJCE 3QJHB 5A2LH 4FQXA 2ZCKH 3EOAA 4KPHH 4MA7H 1OVZA 3PP4H 5C9JB 2HMIC 1JYNA 3K81A 4XVJL 3FB5B 2RCSL 4MJID 1BOGA 4DGYH 5DMYA 4TSCL 5GJTL 1BFVL 1AKJB 1CD9B 1MUJB 2EDDA 3N9GH 2VQUA 3IDMB 4JCMA 1GPOH 3NIDF 4YHOH 4AG4L 1EHNA 1CU4L 2MJWA 1CG9B 3K74B 3FB7A 3EJZC 3JZ7A 4Y2DA 3FB6A 3ULVE 5D6CA 4MZ3A 4PRBA 4XX1E 2HJLB 5D1XA 1T03H 4PLKD 2KH2B 2ADIA 5KZCB 4PRHD 1QSZA 5IB5B 2R4RL 1ZHKB 5I0ZA 3BP7B 3OG6B 1EVUA 1KCSH 5C8JA 4XMPH 3W2DL 3VXUE 1MCHA 3RY6A 4NDMB 3PGFH 4YGAB 4M6OL 5GIRB 3LEXB 1HXYB 2UYLA 4LLQB 1SVCP 3EFFA 5JQHC 3DIFA 2IAMB 2IAMC 2BVOB 1EZVY 1FFOB 1I1AA 4M00A 4QRPB 5SV4A 3SKUD 4P2OA 1EGJL 4G43A 5DHVB 2ESVE 3FO2A 3SJVB 5I74B 5I74C 1EHAA 4CJ0A 3NCYP 3NZHH 4PLJC 5IVOA 1M4KA 1MCQA 3HS0B 2AXHA 4FQCH 3S34L 4U6VL 3PABA 1HZHH 2DWDA 2ZKHH 4QTHB 3EYQD 5CJBA 4LF3B 5JZ7C 4Z77B 5BV7B 5BV7C 1M05B 1XGRB 4OM1H 1H3XA 4JFQB 1S7WB 1MCPH 3VFSA 1D9KD 3HAEG 3S36L 2GEEA 3IKCA 3OSKA 3K8KA 3NIGF 2NYYD 5DEGA 2V5SA 3M17B 1C5BL 5D5MA 4C55A 1F4YL 1FZJA 4XP9L 3THML 2XKNB 3KDMA 2BXYA 5F96H 4KGJA 4QOKA 2HLAB 3C87A 4L8DA 5FYLD 4JFDD 5DRZB 1SVZA 2P8PA 43C9A 2JK5A 3R06A 1IGTA 4KU1A 1BZ7B 4NC2B 3D39A 4GMTL 1BF2A 2B4CC 3QH3B 2W60B 4WHYG 1UH4A 3O3AA 1IKFL 4P2QE 4NOBA 1NGPL 5DK0B 4TUKL 1ZE3C 1KB5H 2WBWB 5HDQH 4ISVA 3FQWA 1NQBA 2C3XA 4P4KA 1GGCL 3K4AA 3VXOA 2QQNL 1J05A 3C8HA 3O6FB 3O6FC 4UT6H 3AXLA 4E9LA 3OKKA 2IALA 2JCCA 3ZTNL 1K4CB 3SBWC 5DXWA 3EDEA 3OKDA 3EOBB 4EBQH 1JGVH 1F02I 1I9IL 2MCG1 2O5ZL 1FFPB 4ONGH 4UQ2B 5CCKL 4TSBL 5EZOL 2B1HH 4K94H 4P5KA 5IKCA 2HFGL 1TJHL 5E8PB 5F8QC 3TCXA 1EO7A 4KKNA 4XWOC 4UIKL 1RUKH 2X89A 3V0VB 4Z76B 1RZKC 1TVHB 3TJEL 4YDVB 5TPWL 3HZVB 5HVHB 3I85A 3BAEL 5JIHA 4RAVB 4WNQA 1KLUB 4X83A 4OZHA 1ZXQA 1YPZA 2NY6D 1AXTH 3MYZA 1WQVT 4Z7UA 3E3QE 4H26A 4OF0A 2NXYB 2NXYC 2DF3A 4DOHE 3PL6D 3QO0B 2X2YA 3Q5OA 4L4TD 3QDGB 5I8OL 3DGCR 1NANH 1AC6A 3TJHD 2Y07L 3HNVH 1T2XA 2VERN 1ED3A 2ZCLL 4XHJD 5KANG 5AUMB 4OCYH 5GZOC 4QHNA 1HCFX 3TCLA 1EO8H 4HIHB 1YEEL 3W9DA 1UH2A 3H2WA 3VXTA 5E24E 4BH8A 4V2BA 3UP1A 4IDJH 4OSUL 1A8JH 2GK2A 1U0QA 3QXUA 1WAAF 5GQBA 1A6TB 2LU7A 2ZJSH 4GKSA 3TO4A 4CKVX 1DUYA 1L6XA 1JL8A 2I60L 5I1KL 1WTLA 4BFGA 4UINH 1CLZH 4Y5YB 4DUVA 4HWZA 4Y5YC 3UBXA 4WTWA 4MD4A 4WUUA 2AXGB 3TFKC 2ZWLT 4XXDB 2JLLA 3IDYC 3B2UD 3O3BA 2UWEE 5INDA 4HLZH 1RFDL 2ATKB 4YE4L 3QQ9D 4DUWA 5I16B 1RK0B 4WUKH 3B9VA 5H8DA 4XBPB 2QHRL 2YD3A 5HGBA 3U7WL 3JXAA 4POZD 4X5WA 4FABL 2DJSA 2I07B 2UUDH 4OM0L 1A1NB 1CFNA 5CLWA 1K3IA 2X1QA 4K8RH 4FRWA 3BQUD 5D7LB 4Z7VB 4ZTPL 2PNDA 4LHUD 1JF5A 1AQDB 2XRAL 3UJTH 1HINL 3AAZA 3BVNA 3O4LA 3H42L 3TV3H 3REVA 3FQNB 1MREL 2BY1A 3HA0A 5DRWB 4JVUA 2WNGA 3P40A 4BZ1L 3ARFA 2Q1EA 5DZLA 1JGEB 1XF5A 2F9BT 5FGBC 4NWTH 4LPUA 1T7ZA 3O81A 4PJXA 2ZG2A 5J6GB 1T04A 2Y5TB 4RWYL 5IMLB 1ZS8A 3O2DH 4P2RA 1WT5A 4KAQL 3WV0A 4R0LC 4IS6A 1SJHB 3G5XB 2XQBH 4PJHF 4QHUA 4F37K 4M1GH 4XVJH 1F11B 2HTLD 3QG6B 5D7IF 3QG7L 4POYA 2RCSH 1TTFA 2W92A 2H3NA 1I8LC 4JN1L 4TSCH 4L1HA 4PTTB 3UX9B 4KK9D 3RWJA 2CLVA 1NFDE 5CP7A 4JFOB 3VXUB 1P69B 3MRQA 1KEGH 3S37L 4HX1A 1Q9OB 2R4SH 3ES6B 5H35B 2YXFA 4KJPD 2X4TB 3DURB 3KNBA 5HYJD 1NH6A 1EBAA 1MCWM 1P9MA 4JCLA 1H0DB 3ETBF 3ALPA 5IB3B 3DX8B 3NVQA 4HIXH 2ESVB 1N64L 2VDKL 1A6AB 2VLKD 1XAUA 4M6OH 1OGAD 4ZYKB 3MREB 4OJFL 2CKBH 3ROOA 1U8MB 1T1WB 1CICD 3BKJL 1MOEA 1S7UA 1QKZL 4JRWA 4PG9B 2HJLA 2Z91B 4A6YH 5FO8A 2W65B 5DMIL 1FGNH 5GISL 4NN5B 3BP7A 1MQKH 1TZHA 4NN5C 3KLHD 2FIRT 1Q9LA 1CS6A 4NQCB 4OIAA 5DC9B 2C5DC 3Q5TA 2O5YH 4OZFH 1T80A 3WIFB 1L6ZA 3BW9B 3I02A 4U6VH 1TZGH 4LLQA 2W0PA 1Z0MA 1TETL 2IAMA 4P46B 3SDDD 4Y4FA 4P46C 3MUJA 3A6OA 4LRIC 4PTUB 2WANA 5DHVA 4UU9B 1DL7L 3ALWA 3MLUH 5T3XD 1BMGA 4JJHA 3S36H 2HFEB 4I4WA 3PQYA 3HS0A 3TBSA 3DX7A 2EIZA 5FYJU 4XP9H 4QHMB 4LARH 4QHLA 1HKLH 2IGFH 5ALCH 4CADA 3VXRD 4HUUB 5T1DH 2DD8H 3D2UB 3GB7A 3MBEA 3W9EB 5BVJA 5GZND 4N0RA 1XGRA 3RWHB 5HXMA 4J4PA 4Y88A 2PW1A 1AD0B 3FQUB 5J6HA 4EI6B 5EIQA 1XMWA 1V3JA 2VSDA 3I75B 4D2NA 4HFWB 3PUCA 1P1ZA 3RTQB 4BQ9A 3RTQC 4BSVA 2F8VA 6FABL 4M43H 4TUKH 1OHQA 1TVDA 3FOMA 2EIBA 5IBUB 2Y9RT 4MXQC 2YZ1A 4LAJH 4P4RA 3KPRA 1IGJA 4NCC2 3QIBB 1NCNA 1UXSB 3QIBC 4JFFB 4MQTB 3ZTNH 4ETQA 4R7DA 3QH3A 2W60A 4NRZA 1GGYA 3F7QA 5CMAB 1CVSC 4RRPA 1D5ZA 3NPZB 5DC4B 1I9IH 5T1KA 1UKTA 4GMSH 1F90H 3RKPA 3V7AG 3G5YB 1JPGB 3Q48A 4OLUH 1B0WA 5T5NF 3B5HA 5C0JB 3B9KB 5E8EB 3B9KC 1JGDB 5CILH 2UZYB 3BZDA 3TYFB 1K4CA 4OCMC 4ENED 3S4SB 4S1RL 5LWYL 3EOBA 3DV4A 4ODVL 1QO3A 5I2IB 3D0LB 3P4OA 3WFHB 4UIKH 1KIPA 3IFLL 2A2QT 3OXRB 4N8VB 5KS9E 1M1SA 1FVCA 3K80A 4DOHB 3KLDA 3RGVA 2HJFB 3GSQB 1S5HB 4RSVA 4MZ2A 3EDDA 2JB6A 3PHQA 1A7OH 2W0LA 1VENA 4N8CH 4PV9B 1R5WA 4P57B 4GKZA 3VFGL 1W72L 3MUGB 2V2TA 3GSNH 5DVLA 1T66D 1KB5B 3QXTA 1AGBB 2H9GB 3OR6B 4X7FC 4PJDE 2VC2L 4JQXC 3MLRL 4LHUG 4P2CG 4LCWE 4WW2A 3QNXB 1X5XA 5EB9A 4RAVA 2LU4A 5T5NG 3HE7D 1JYWA 4M9OA 3CFJB 5EC1B 1NCBH 1E4WL 4TVPD 4YXHL 3EGSA 1SYVA 3B9EA 1VFBA 4KMTL 4JO3L 3MOBL 1ONQA 3BDYL 4JPIA 3VI3F 5FUZL 2GAZB 3QO0A 1SEBA 1TNMA 3GI8L 3RIAF 3RWIB 5CD5D 4K94C 5BCAA 1XCTA 2QLVB 4Y1AD 1ZTXH 2P5WD 4RFOL 4EI5C 5HDLA 2NX5E 3FCTB 5LVEA 5J3HC 3MRBB 1WZMA 3MGOB 1BIIB 4HIHA 2UWEB 5DHYA 5I1KH 2WUBH 3GSWB 4P3DB 1EHLL 2ED9A 4U7SA 3CNKA 1AJ7L 2C3VA 4DZ8B 3GIZH 2YN3A 1IM9A 3BXNA 4LDEB 1AD9A 4GFTB 4E42B 1M6OA 3KPSB 4CDHA 4OGAC 3FO0H 5D72H 3WLBA 1QSFE 4N90E 3H7LA 3QFJE 4D9QD 4XNUH 2R23B 3UJIH 1BZ9A 1UEYA 3ZYJA 5F7UA 4Y4HD 2VISA 2FB4L 2XXCB 3X12A 4G3YL 1RFDH 4JY5L 3MZGB 1MLCB 2Y4SA 1AXSB 4HIIA 4G8EB 3PG2A 2DTSA 3MODL 4IEFB 4P23A 4QLRA 5KG9A 3IFOB 1FZKA 5IUSA 2DAVA 4I0PB 1NC4A 4I0PC 5F7DB 3CU1A 1U6AL 2EIEA 3DMMC 3MTRA 2R15A 1GOHA 3LZFL 1GGUA 3GBML 4OT1H 1JWSB 1DN0B 4FABH 4N0FB 3S9DB 4OM0H 3TIEA 3NGBB 3O0RL 5AYUL 4DCQB 2XICA 3CSYB 3P11L 1JUFB 2ED8A 5SWSD 1RK0A 3PWPD 3HZMB 1WZLA 2DWEB 2XRAH 4JG0L 3U0WL 2AJUL 3CZFA 1QHOA 4L5FH 2YZ8A 1CFQA 3BRFA 4HCRH 4P49A 2XG4A 5EOQH 2BZDA 4HWBA 5IFJB 5ERWA 1M7DB 1PG7W 4BZ1H 4C83B 3MOAL 4YHIA 3PNWA 2EZ0D 4ODHL 1UWXK 4CGTA 3ILQC 2OL3H 4RWYH 1NFDB 4PJCA 1FNEA 3U30B 3IJHA 3U30C 3FAXA 4C4KT 1V7NL 1LEIB 3O11B 1NSNL 3FRPA 2E27L 3QG7H 2X9YA 3GJFH 4JN1H 4MDJA 1JGEA 1RIHL 3ZSTA 1NEZG 5ITBL 5AZEL 2FBOJ 5D2NB 1DDHB 5D2NC 3MLSL 3HFMH 4MNQD 4NZJA 5DDHA 1BJ8A 1YDPA 3IFNH 3PDDA 3S37H 4GG6E 5EO0A 4G6FB 3QG6A 3RL2A 3V6OC 3GRWA 4F9LA 4P9ML 2IG2H 1B88A 4K8RC 2FIKB 4GT7A 4ZD3L 2V5RA 2AK4B 2XY1A 3G5ZA 1GAFL 3RWEB 4QF1A 3ZDYE 4LVEA 1U3HD 1N5YL 3F7RA 2VDKH 4EDXB 1OSPL 3MV9E 4JKPL 2VLLA 4ZUUB 3IRZA 5DSCA 3VXUA 2AXJA 4UMGA 3WDHA 1U8LB 4PYGA 4CVZA 4QTIL 3X17A 1ZGLP 2XI9A 5IW6A 4YUEL 4F7PB 3O3EB 3NTCH 1MCBA 5FUCC 3ES6A 4I5BA 1OTSC 2I24N 2X4TA 3DURA 2A9NL 3TBYA 3BGMA 1QKZH 4NO0D 5I8CB 1HHIA 2HKHH 1JMXA 2Q86A 4YNYA 3ZHLA 4RQQA 4XP5L 5DMIH 2ITDB 5GISH 3LQZB 2ESVA 1U8KA 4BSWA 3ESUF 1J88A 2R2EB 3FKUS 1I1AD 4HS6B 5JPNB 4TTDC 1K85A 2NY5L 3UAJD 4ZFFA 3V0WL 4D0DA 1U8MA 1OY3B 1NGQH 4PG2C 2FJGA 4WHTA 2GITA 1DL7H 2ARJB 5DJCA 4CJ1A 1AH1A 4HBQA 5TE4L 3JTTB 4M1CD 3NFSH 4MQXD 1A7QL 1BEYL 5E6IA 3GO1L 2NMSA 1QP1A 4YFLI 5DMKA 1EX0A 5HHOD 2XFXB 1NPUA 5IROA 3DX9B 4K7PY 4XGZB 4UU9A 1CBVH 3WNOA 1KJ2A 3S35X 1RZ8A 3BO8B 3EZ8A 5ID0B 4FG6D 5EC2B 4QT5B 4KK6D 3T2NH 3I6KB 4P2QA 1F2QA 4I48B 4HUUA 1QFWM 3D2UA 1ZA3B 3MV8E 4BYHA 2FYYA 3O8XA 3QULA 4A6YB 1Q0XL 5LXGH 5EORH 4O51A 3RWHA 4PY7B 4LOUC 3QUKB 1U2CA 4ZS7H 3MRNB 4PJEF 3RVWC 3VXMD 4OZFB 4ORGB 4WTZG 2HYMA 4P59L 3TWCL 5GSRB 5EBMA 4WFHD 1XGYH 4LL9A 1IEAB 2D0GA 3CX5K 1UH3A 1KCLA 3ZKXB 3ZKXC 1C5DA 5AWNL 2KUTA 3ARGB 4YEFA 4S1RH 5LWYH 4ODVH 5IWLA 3HR5B 4KJYB 4R26L 1S8DA 5IG7A 2LAGB 3IFLH 3G6JE 4ZPVB 1K6QL 1N3NB 4C58B 3G5YA 1QEWA 3HB3D 1RK1A 4WY7L 5EA0H 5ISZD 4KDTA 1X5KA 1IGFH 2X89D 5L6YL 3P4NB 4LRNH 1AGFA 3KXFB 3X14B 1C8PA 1ZA6B 4U7KA 1PZ5A 3S4SA 2FHCA 5HVWA 3G6DL 3PDOB 4LLMB 5I2IA 1S7VB 1MWAL 5KW9L 3QIWB 3QIWC 4OKVB 1LK3H 3N1FC 3E2HB 3E2HC 2VC2H 4EQ3A 2HWZH 3MLRH 3U9PL 1NCTA 4PY8J 1XF2A 4PJFF 5HYFA 3MRPA 2XTJE 4ESKA 3KR3L 4P57A 4Z0XB 5MEQB 2VXQL 4F8TA 4OZGE 2NNAA 3KVQA 1E4WH 4G8IA 4NQEB 4YXHH 5BO1H 2NX5B 1KB5A 4JO3H 3MOBH 1DQJA 5IHZB 4DAGL 1WWCA 1B2WL 3BDYH 3G9VA 5FUZH 3SE8L 4H1LG 4I3GA 1K8IB 3MRJA 3QNXA 1FO0L 5JW4R 3BKCL 4KKAC 5LGJB 3VA6A 5F3HA 1K5NA 5BOZG 1XIWA 3I2CL 1Y6MR 5DA4A 1FDLH 5DMJB 4HF5H 4N8PA 5C0IB 4PJBB 3DRQB 5EUOE 3RIAK 2GFBB 1CGVA 2GAZA 1WBXB 1X5IA 3V5KA 3RWIA 5D8JH 1AJ7H 3BD5A 2XWBB 4L3CA 1JTTA 3DX6A 4UV4H 1JGUL 3I6GB 3BPOB 3G5VA 3BPOC 2CDGB 3GSNB 2A74B 2DKSA 2Z93A 3ZE0E 4S2SA 1GGIH 2DQDL 1AQKH 1TQBB 3OKLA 1TQBC 3FT2A 3PWVB 3TH3T 1ACYL 3HI1B 2VDRL 3T1FB 3MRRB 2FB4H 3NZ8B 4W6XB 1CLCA 4WUUD 3E0GA 1CTOA 1OM3L 3MODH 4LCYA 1O7VA 5IB4A 1I7UB 2DQGL 1Z2KA 3UDWA 4MQ7B 1U6AH 4IRJD 5D5MF 3OKYA 2J8HA 5FV1L 2ZNWA 3WLWD 2FWOB 5IEKB 4C56E 2YPLE 2QSVA 3O0RH 5EWIL 4LLYA 1DQQA 4WJ5A 3VD3A 1KELH 4QGYA 3IDXL 3L6FA 5E8OA 5B39B 3FTGA 5AD0B 4JG0H 4BKLA 2NXZC 4I1NB 2OTUB 4AK1A 4AJ0A 4Y4KC 4JPVL 1DQLL 2L7UA 1I9JL 1IL1B 4E5XA 3LIZL 1AR1C 1H3VA 3EOTH 3CFIC 4M5YL 3ROLB 4DCQA 3LN9A 3R4DA 1PKOA 1A3QA 5HI5C 2HVJB 4MHHG 5C09B 4YO0A 1NDGA 2DMKA 1ZT4B 4GW1A 2F19H 3HC0B 5DFVD 1RZFL 3IXAB 3WUZA 1AO7E 3ARFD 4LPVA 1V3LA 3Q5YA 2FJHB 4GG6B 1T0MB 2YS4A 1V7NH 1ZWIA 5F88B 1CZ8L 4TRPL 2DQHL 2EEAA 4P2RD 4X98B 4KRPB 3S3SA 3RRQA 3OGOE 4KRPC 2LFGA 4HJGB 4LPXA 5ITBH 3O2WL 3VFWA 1BFTA 3MLSH 1NFDA 5F9WB 4OD3L 5DK3A 5F9WC 2DQUL 1N8ZB 3MV9B 3L3KB 4IOIB 1T0PB 4M6AA 3VFPA 3FRUA 5HY9A 2RJMA 3O11A 4I0KA 2E7CA 4BJLA 3EFDL 3DVFA 1I1YB 1QLRB 2AQ3A 2CH8A 5IMKB 4NZRL 4PGBB 3V5DB 2VQ1B 4HUWB 4ZFGL 2F53E 3O6KL 1N5YH 4LNRB 4AIOA 2GIYA 1OSPH 1A2YB 4JKPH 3KLAB 4XCCH 4JRXB 1JYVA 5DUML 3NIFF 4YUEH 4RA0C 1YY9D 4MSWB 2IJ0C 1A6PA 3TYGL 1CLYL 1RJYA 1KTRL 2R2BA 2A9NH 1WBYB 5JA9A 1Q0YL 2FIKA 4J12A 4XP5H 3EJZD 2AK1L 2BERA 2E9BA 5J13C 2D03L 4G7VL 1YZZA 2OL3B 4ZUUA 2YKLL 1B3JA 5KZCD 5HD8C 3V0WH 4F7PA 3O3EA 4QXTA 4WFEE 3FQTB 4UTAH 4L8SB 2I26N 1AIFA 4L8SC 1NJ9B 4HWUA 5A3IC 3GKZA 3ORJA 3O4OB 3O4OC 3KPTA 2WW8A 2IAMD 4J3OC 4PLNC 1CGTA 3ZDZF 5FYKD 4QRPD 3KPMB 3O2DA 3BPCB 1BEYH 3SJVD 1LK2B 5C9KA 2X4QB 3IGAA 4LGRB 4PLJD 4G6KL 3L5WA 3T0WA 4O2CB 3V0AC 5H94A 3JTSB 4IHOB 3HTLX 2FGWL 2VKWA 2BVPB 5LGHH 4JY6B 3L1OH 5JZ7D 2VH5H 3MA7A 1KGCD 4J4PD 5DYOA 4F33A 1K3ZA 2DJ4A 2O26U 2BSRA 4KI5E 3CFCL 3QUMA 4Q9RL 2AJYH 1Q0XH 4XGZA 1I1RA 3P73B 1YEGL 2VIRB 4NO2A 1N26A 3BHBA 4QT5A 3FQRA 1H8NA 4IRSB 2CKBA 3KPRD 2ZUQB 2ZUQC 2Q76A 2HVKB 3MJ8B 3NA9L 3J7HA 4I48A 3WE6A 4U4BA 1YA5A 1ZA3A 3G6JB 4A6YA 4R8WL 1N59A 1F13A 5KSUB 1UZ6F 4UNTA 4PY7A 4JAMA 3C5JA 5AWNH 3DYOA 3GUTA 4QRSB 2BVQB 2IMNA 5FM5M 1YEJL 3QWQB 1JN6A 3O6FD 3O9WA 2FLBT 3WSQH 3FT3A 2GW5A 3UBXG 4R26H 3ZYOA 3GMOB 5D1ZB 5GSRA 1K6QH 5TJWK 5D1ZC 5EU7C 4CUCA 2X4SA 1IEAA 5KS9A 4WY7H 1U8QA 2XY2A 5E7BA 3RL1A 4X99B 5CBAB 1IM3B 1FG2B 2AI0H 4PJXF 2XTJB 3ARGA 2XTJC 3RX8A 1L9MA 2C1OB 3ZT7A 4MXVF 2IPTH 3ARTA 3P3YA 1DP0A 2VDPL 1DANU 2CLRB 5IB2B 2YD4A 3VRIA 4OZIF 3GSVB 3S5LG 3D0VB 4PJDA 3U9PH 3P4NA 3QWOB 2IFFL 3BE1H 3X14A 2OS7A 1ZA6A 2GJZA 4Y8AA 3L5IA 4YZFF 4LCWA 4D9LL 1KPVA 3J8F7 5DFTA 5TQ2L 1KTDA 5GRJL 1T21B 4OKVA 4RGNE 3CUPA 4UDTA 2VWEE 2D7MA 3SKJL 1KXVC 1RSFA 1S9XB 1XH3B 5EUOB 4ZG1A 3KS0H 1MVFA 1RY7B 4OTXL 2NXYD 1FO0H 3BKCH 4ODTH 1MRDL 4XP1L 4OBRA 3HNTH 5FA4B 3QDGD 3KPNB 2AJ3A 3WNNA 4F58L 3HZKB 4XC1H 3A67L 5HHQA 5E7FA 2X9XA 5KSBB 4IBLT 4HIEB 3PHSA 1I3UA 5T3ZH 5B38B 3VI4E 5LGJA 1XGQA 1JGUH 1MCOL 4NCC1 3BP6B 3DJ9A 5ADPL 2MTPA 3QWRA 2DQDH 1QSFA 4W4OC 4XNXL 3QFJA 1K8DB 1G9NH 1J1PL 1N2RB 2GFBA 2OJEB 4C56B 3TN0A 1ZLUK 4S1SL 4FQIL 2EDLA 2Y36L 1WBXA 2YPLB 2R1WA 3L3DA 2JJTA 1RJZB 4M1DL 1OM3H 3C8DA 2DQFB 5EPMB 4MD5B 2K7QA 1KJ3H 1R3HB 2CDGA 3GSNA 2A74A 2BVTA 3SKNA 4JQIH 5EU6E 5T33H 2YEZB 3KLSA 5EZIH 1NC4D 3T1FA 5M7QA 1CXLA 4F7EA 3TFKD 1MELA 1T2QL 2WQRA 4UILL 3P0VH 3IDXH 2IADA 2P47B 4F8QA 3OR7A 5SX5K 3P2TA 3OKEA 4OCLC 4OUUB 5GS2D 1MJ7L 2OQJA 5B8CB 1I7UA 5B8CC 2LABA 5K9KB 5D1QA 4HMEA 1I9JH 1AO7B 5JOPD 3QCTH 2COQA 1RU9L 3LIZH 1LVEA 1HILA 3P9MB 3GHBL 1WCQA 3ZE1E 1IAMA 2CXKA 5JA8B 3LV3A 4PRIE 2E9IA 1IAII 2AJSL 5B39A 2QSQA 4I0CC 3F12B 1PLGL 1RZFH 5F1IB 3TVMB 2H26B 4M8QA 4BQCA 1A1OB 4XCFL 1ITBB 1H5BB 4JJ5A 2X70A 4R3SA 2DQHH 5MEPB 3FQXB 4OGXL 5T3ZE 5L2JA 2R2HA 4AMKH 1MCRA 2J6EA 3HC0A 3QT2A 2F53B 3IXAA 2DQUH 5DGRA 3TESA 2XG5A 3N0PB 3HC4L 2V7NA 3F5WB 4GAYA 3KYAA 1T0MA 1KPUB 5F88A 4LBEB 3EFDH 4DKFH 4XRCA 1OAYL 5AAWA 4NZRH 4AM0B 4ZXBA 5M95B 2OR9L 1M7IA 3QUYB 4ZFGH 1FLRL 3QUYC 3O6KH 2A9ML 1N8ZA 2JE8A 4OCXL 4QHKJ 3L3KA 1IZKA 4L29B 3MLPA 1JI2A 3MO1B 4ODSL 4WU5B 2BNRA 3TYGH 1CLYH 1QLRA 3U2SA 3VXUD 3WHE0 5CIPH 3QJFA 4MS8C 1NGXB 2AK1H 3MCKB 2UV3A 4HUWA 4PJ8A 4W6WB 4KQ3H 1IBGL 1KNOB 1A2YA 5DR5L 1JYXA 2YRLA 1PG7L 3SCMB 3SCMC 2Z31B 5C70A 1RHFA 3LSOA 4RIRA 4MSWA 2ESVD 4HCRA 3F62A 3LEYH 4NM4L 2EDTA 1MFEH 2J8OA 2YRPA 1CXHA 1G7IB 3NFPB 3JV6B 3GGWA 4FQJL 2OL3A 4LPWA 3FJTA 2D9QB 3FN0L 1YY8B 3CFEA 3FQTA 3ARDB 5GGVY 3ARDC 4NQCD 3WO4B 1NJ9A 3ZHKA 3WO4C 3JUZA 4G6KH 4ZOAA 5H2BB 5BS0E 5JNYB 3GJFA 4HFUH 2BCKB 1S5IL 5E6ID 1CFVH 2FGWH 5B21A 1OL0A 2EDJA 2QR0A 4JFYB 4U05A 5FO9A 3IETB 3DROA 1FVEB 4F2MA 2Z35B 5HGGS 4D3CH 3E1F1 1VACA 3CFCH 3MV8A 2BRQA 4ALAL 5F89B 4HS3A 3WNLA 1Y6NR 1YEGH 5EO1B 3D2UD 4JY6A 4XVUC 3D3VA 2X44D 2C7UA 2OI9B 4GBXB 3U7AA 2OI9C 4GBXC 3HC3H 3CMOL 3V2AR 4G6JL 2H6PB 3NA9H 1MAMH 2GSIB 4JFEE 4X7SH 2NTFA 3P77A 4J6RL 4WO4B 1Y0LA 5JDSA 4WO4C 1ZVHA 4R8WH 4X4YA 1OPGH 3RTQD 1RUML 4PJIE 1HXMB 3AREA 4MXQD 1ZHNB 1INEL 1YEJH 5IMMA 5F9JB 4IRSA 4AEIL 2XZQH 2F58H 5JR1H 3QIBD 3EO0B 1JWUA 2J3SA 1FE8L 4E41A 2GTWA 2VDML 5LBSL 5C0RH 4Z0BH 5DJ8A 1NDMB 1I3GH 3AROA 4Z7VF 5DJ0B 1KPRB 1NFIB 3WFCL 6CGTA 1U2HA 5FDWA 4U7MA 3IAGC 3B9KD 4F3FB 3CCHB 4RGNB 4RGNC 3GMMA 2VWEC 5E95B 3WJJC 3R0MA 3T2OA 4OBSA 3NIDE 4PIRF 1CFTB 4NQUA 1NMAL 5GRJH 4OZGA 2WM0A 3T0BA 2BNQE 2CR3A 3O45A 1IEBB 1PYWB 1R5IA 2DQCL 3SKJH 4MJ6B 3SGEH 4KTYA 3RUGE 3VRLE 3HRPA 4DEPB 4DEPC 2YK1H 2YOCA 1QSEE 1BFSA 1QSVA 2P24A 4P5TC 2YD6A 1MRDH 4XP1H 2X4NA 4XAKE 5C92A 3ZO0A 3CXDL 5SWZB 5HSFA 3VG0H 1GZPA 3OKMB 1L7IH 4LIQL 3MBXL 4HK0A 4DK3A 1XH3A 5ALBL 3EYUL 4CVXA 3LN4A 3QDJE 3FRPG 4WHDA 1S7RA 5D96B 5BRZE 2ZPKL 2ZCHL 2A1WL 5L2KE 3VFTB 1H3PH 2UVEA 1RMFH 2A6IB 3KPNA 1LEGA 3X3FL 4AQOA 2F15A 5TQ0H 5KTEH 4QNPE 5EU6B 2YA1A 4KJQC 5EIIB 3QCUL 1QLEL 1U95A 4QRTA 2FD6L 2VABB 1J1PH 4I18A 4K3GA 1CXFA 4FQIH 4P9HL 2Y36H 3AMLA 2FGZA 1JCKA 3HPJB 2DLEA 4M1DH 4ONFL 5HI4D 1XF3A 3L7FB 3T2PA 4ZO6A 1YMHA 4XX1G 1FBIH 2VDOL 5ECJE 4JM2A 1JWMA 3ARVA 1NBZA 1K8DA 3C5ZB 2Y06L 2OJEA 4M02A 1TJGH 4OGAD 4HWEL 4C56A 1H8SA 2YPLA 2AAVA 4UILH 4CW1B 1RJZA 1FO0B 4H5SB 3SKOA 3S7GA 5LCVH 3T1WA 1MJ7H 1MRFL 3FT4A 4HT1H 2VZUA 1LO3H 3T2QA 2ZZUT 3OKNB 5IK3A 1I9EA 5DRNB 1RU9H 4LP5A 5LG1A 1LD9B 1QBAA 3GHBH 4I0PD 5ICXB 4RBPK 1G9MH 5IFHH 3NA4A 1CDYA 4DW2H 4M9PA 4V1DE 4HLJA 2DQJL 1AO7A 5EBLA 2BNUB 2WBJA 5JHLH 4S1DC 1AGDA 3R1GH 5K9OA 5HGAA 2EYRA 1BBJB 4JLRA 4NKIH 3M45A 1OAXL 3QXDB 1EK3A 4FA8A 3Q6FB 4K07A 5F1IA 3TVMA 5GRXG 5KSVB 2EYSA 4FZ8L 4MB5A 3KYOB 1IAIL 1Y6KR 5HHME 1LP9B 2HLFC 1H5BA 2YD2A 3WDJA 5MEPA 1BQHB 3CH8A 3MXWL 2GHWB 2V5TA 2YMXL 4MA3A 1U91B 4X6FB 1EUUA 2OR9H 3DXAA 1FLRH 1GGBL 5FF6B 2PF6A 4HS8L 4GAJL 3MJ9A 3B9DA 1KJMA 5CBEA 1MHEA 4UTBH 3SY0B 5JIKA 1WFOA 1OB1A 1K9TA 1I7TA 1YQVH 4LBEA 1A3LH 4RGOL 1RIUL 1ND0B 1UM5H 4AM0A 4CU7A 1F3JA 5DJYB 3SDAA 1UG9A 1BGXH 4NKDA 3WS6C 1IBGH 1U93A 4K8RD 3ULSA 5DJAB 5B4MC 1B0GB 2AK4D 4PP2A 4N68A 1MFCL 3MO1A 3K8LA 2X09A 5GGTA 1CQYA 4U2ZA 2AEQL 2V7HB 2GKIA 5EU3B 1GSMA 4LLVB 3MCKA 1OTSD 3B2VH 5IFAH 1DUZA 1WAAE 2BRRL 2Z31A 1QBLL 1ZVSB 1LO2L 5FGRA 4LSTL 5T5FH 1G7HA 1A5FH 3S4SG 3CAFA 2QKIB 3D9AH 4XMKL 5E2UL 1NKRA 4TTDD 3D69A 2CMRH 3QCVH 1BVKA 4HUKB 3UYRL 1S5IH 5FGSA 1CFBA 4X9GA 2MFNA 3X3GL 4U0QB 1TNNA 5DD6A 5JXEA 1MIEL 4MDIB 3KS0J 5MENE 3NN8B 2EXYC 4XP6L 3QUXA 3UROR 4HKBA 4D9RE 4X9FA 3FL7A 1MQ8A 3INUL 4L3EE 3BP4A 3LVEA 2A6DA 4U1NA 5DD1L 5CIPB 2UWEF 4NYLA 5LGKA 3KJ6L 4R2GB 4XP4L 4R2GC 4GW5B 1EA9C 1ZVYA 1CE6A 4EUPA 3LPWA 3IDUA 2Z9TA 1P4LA 1IT9L 3ISWA 3P4LA 5FO7A 3RY5A 2ZOLA 1RUMH 4M6ML 1LO4L 2BJML 4BK5A 4KV5F 5HGDB 2Q7YA 2R56L 4LOUD 3BYTA 5FYJH 3RU8L 2ENSA 4AEIH 4ZTOL 4YDJB 3BH8A 3QI9B 2GSIA 2OLDA 1P4BH 3QI9C 3FFDB 3RVWD 2B20A 1S9WB 5LBSH 2V5YA 4MA8L 1P7QA 1A14H 3WFCH 1J0JA 1CYGA 3NACL 25C8L 1GOFA 1JF1B 2ICWB 4PJHE 1TENA 1IGYB 3EO0A 4KQ4L 2BNQB 3Q3GB 3DECA 5J9PB 3ARGD 4LCUB 3S97C 1G6RH 3T0XA 2X4UB 2IBZX 1NDMA 1JE6A 4UT7L 5IGXH 3RUGB 2VAJA 3T08A 1QSEB 4JVPA 1LEKA 1NFDF 3RPIA 1NMAH 3WXWH 3CPLA 3DI3B 4DN4L 3KXFD 3ZT5A 2JJSC 4LCWD 1A3RH 3MNZB 5HHNA 2EKSB 5E70A 4HAGA 3TPUA 4PR5B 1KCUL 3D18B 3S98A 5EZJB 5CEYB 3ARBB 3VD4A 3ARBC 1UM4H 5BRZB 4PJAA 3CXDH 4U1SB 5DJXB 5L2KB 1T0NB 3HG1E 4Y2OA 1PYWA 4LIQH 4NO3A 5J1AB 4MJ6A 1P5VA 1QACA 3MLZH 1UADC 2NX5D 3QDME 4GO6B 1CD1B 1KCVH 1ZANL 4HPYH 2ZPKH 4HKJA 2A1WH 2ZOKB 1G7JA 4Y5VB 5FYJE 5JORA 4Y5VC 5DS8B 4PJ9A 1ZLSH 2G5BB 2DQIH 4WWKB 4WWKC 1NCCH 4HPOL 5FECA 1EDQA 3UTQB 3FAWA 2FD6H 5MP6H 1MH5A 2RQ8A 1RI8A 1MI5B 4JFZH 3C6LB 5GGQL 3C6LC 3STLB 3HMWH 1G7LA 1W0VA 4N90D 5ITFA 4MMXC 1XR9B 3VFTA 3G04B 2VDOH 5M94B 5C0EA 1OAZH 4L9LA 3T4AA 2DL2A 3CFKB 3MRKB 1JHTB 4DKEH 4JO4L 3SE9L 1B90A 4HMDA 3GHEH 3QQ3A 5FKPB 1EUTA 2XQYG 4NSKA 1OWWA 2HN7B 3L7FA 3ET9F 1GIGH 1MRFH 3FOLA 4K3DL 5CGYD 3VXPB 4HHAB 4FTVB 4V1DB 4X7CC 1SMAA 2PO6A 1HHJB 4OFKA 2P44B 2YA0A 1MNUH 4M93B 4ODUB 3C5ZA 4M93C 5EU4B 4K7FA 5A1AA 3BN9D 4B50A 5DMGC 2OK0L 35C8L 4PRIA 5I8EA 4ODWB 3OAUH 3FHAA 3C60B 1RUPL 3VFVB 1R3JA 4X5XB 2BY0A 4HZLA 4J8RB 3JVGA 5CSBA 2H2PD 3AU1A 1JFQH 3RWDB 2DQJH 3OKNA 4LIQE 3HE6A 4RA3A 4OFVA 3GZKA 5BXFB 4G8GE 5E2WH 3AM8A 4M7KL 4NM8L 4QXWA 5ICXA 2ICWJ 2J4WL 5HHMB 1KB9J 1AR1D 1N5AB 4L8CB 4XPAL 4R6UA 4LP4A 4R7NB 2VOTA 5HI5D 2EDBA 5C09D 4NGHL 2DI8A 1C7SA 4XWGH 1VGKB 1CWVA 4OQTL 4ZAKA 1XF1A 3MLXH 4HXBH 3MXWH 4B0MM 2YMXH 1U92B 2FDBP 4X8XA 5EOTA 5IJKC 1GGBH 2YPKB 1ZLWK 3PJSA 5KSVA 4ZOCA 2H41A 4NT6B 1SBSL 4OI9A 4HUXB 3HI5L 3GBLA 3CDYA 4BELD 2NZIA 4K3JL 3CVIL 3MV9D 1NMBH 4PRAB 1RIUH 3TZVB 4DKDC 3TZVC 1U91A 4ZS6D 2XZAL 2BOBA 4LMQE 3MPCA 5KN5B 3FO9B 3VWKB 3VWKC 1E4XI 4JPKL 1MFCH 4RDQG 3VI3E 1ZSDB 3RZCA 4OZFG 3NAAH 3RVVD 3UEZA 2XOTA 4KH2A 4X9HA 4ZFOA 1ND0A 2A83B 3QEGH 4J3TA