3MJ6A

Crystal structure of the gammadelta t cell costimulatory receptor junctional adhesion molecule-like protein, jaml
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
227
Chain Sequence
SPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPRDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Junctional adhesion molecule-like
publication title The molecular interaction of CAR and JAML recruits the central cell signal transducer PI3K.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 63
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mj6A02
3OF6D 2D7TL 1FLRH 1DQLL 1OP9A 2JF1A 4NN5C 4XX1G 3AREB 5KSBA 3T0ED 1EA9C 1ORSB 4LCCA 4KGJA 2F19H 4H25B 4MSWA 3T1FB 3SKNB 4FQLL 3U0WH 5DQJB 4FQIH 4L1DA 1A6VL 4H1LG 1H3UA 2DM3A 3ARBC 4I3RH 4KHXL 1OP3K 1I7RA 4NRZA 2VDRH 2JKXA 1QRNB 4LSTL 1YEEH 2EIDA 4RDQG 1Q0YL 1WWCA 2C1OA 5MHSE 1CXLA 1Z9SA 5C0DB 1JCKA 2D03H 5ICZA 3GKWL 1WFTA 3E6FB 1KTLA 1O5DT 5EIQA 4PJDB 4O2EA 4RCAA 3WHXA 3P4NB 4QF1B 4RMWA 3VXUD 4XGZA 4JVUA 1RZJH 5B38A 1CF8L 1CIDA 3ELAT 3MRLA 4KKLD 3R1GL 5T3ZE 1N5YL 5J1SC 4GRLC 3T3PF 4U0QB 5DD6B 4XAKE 3LS4H 2MPAH 4J8RB 4ZPTB 4ELKB 1ZOXA 5DMYA 4PJ5A 1JWMB 1ZT7B 4JFFB 4KK6C 3L5WB 3WJJA 1YEGL 4JFZH 3FT2A 2ADGB 3A67H 3QDJE 4HWBA 3K80A 3BEWB 3EFDH 4OLXH 3U30C 2XWBA 1T21A 4EKXA 3U7AA 4DKEH 2XQBH 4EI5C 3ZT6A 3SJVE 1NUDA 2VRAA 3P4NA 3B5GA 4QF1A 3VXPB 3MRRB 4G6AD 4HJJL 3FN3A 2XWTB 3QXDA 4YXLL 3W9DA 4YHOL 4M1DL 1QO3A 4V1DA 1IARB 3V0WL 1KJ2H 2HFFB 1L7TH 1VDGA 2IQAA 4U1HB 5CIPB 4YNYB 4KDWA 4GKSA 1XAUA 5E00A 1BM3H 5DC0A 3CVIL 3G6AA 3CNKA 4FTVE 4LMQI 4IM8A 4Y5VA 2M26A 3UZEA 2Z8WC 1YN7B 4HAFA 4F7EB 5D70H 1XIWA 1K6QL 2JB5L 3QUYC 4EIZC 3NFPB 1I7TA 5K9JL 5C0BB 5DC4B 1SYSA 3P30L 4EI6A 1EO5A 1ZVSA 1DUYB 3SDYH 3SPVB 4GBXB 4PJ5D 5I1GH 2OL3H 4WIQA 3IVKA 4RBPK 1JWUB 1NC2D 3QPQC 5KVDL 4Y88A 1RY7B 3C6SB 2QLVB 3CXDL 2EIZA 5DD3L 1K2DB 3GI8H 4UV7L 2A6JB 4YNYA 3LOWA 4HWNA 3LB6D 4U1HA 1HK6A 4FXKA 4LBEA 4EDWH 1Q9KA 1WF5A 1JGUL 5JW4M 1WEJL 2EIBA 4KVNH 4U6VH 3VCLB 4QHKI 1RUQL 3W9EB 1QEWA 1DLFL 2APTA 2EDBA 4V1DD 5C0BA 4QHLB 4NO0A 4Z0XA 3S37L 1HINL 4QRUA 3VXMD 3ZYIA 1W72A 1BFVL 4JFYB 3TYFA 1VFBB 2EDLA 4JQIH 4L9LA 3KPMA 4L9DA 4FG6D 3SDDB 4F58H 1D5IH 3MLRH 1MQ8A 4CAGA 1DUYA 4RGNC 1FNGB 1F13A 4K71B 5I30H 4YJZL 1XIWD 2JK5A 4QCIB 4ODTL 1KB5A 4G5ZL 3QCTH 4BSJA 1NGYB 2DQEH 3DV6A 1KCLA 5F7NC 3RVXD 3BP7B 3KJ6H 2HTKD 1F6AA 4Z8FL 3SQOL 3UXFA 5HYQA 3H0TA 4IBLT 4HDIB 2APWA 5FB8B 5KSBE 1K4DB 4I77H 2FH8A 3WO3B 3W9EA 3KPNA 5C6TH 3GRWH 3KPTA 5JO5A 3PWPB 3TN0C 4QHLA 3FO9B 2P8MA 1EHXA 4YDKH 1MPAH 4R9HA 4HLZH 3GSNL 3H7BB 4NRYA 5I8CB 1AGFA 3MXVL 4NUJA 3SDDA 2H1PL 4O2CA 2V6HA 3PJSA 2BOBB 3BE1L 4NO0D 3C60C 1NGYA 1EDQA 3EBAA 1EHLH 5F9JA 3WNPA 4G8GA 5FO9A 1LO5B 3GB7A 4HV8A 4HDIA 1DBJL 3ARRA 2DTSA 4L4VB 1RUMH 1T0MA 1LEIA 2Y1VA 5L0QB 5IVNA 5FECA 4KROD 3AC0A 3GI9L 3UYPA 4LQFL 4NN6C 2IC2A 4ZO6A 1OM3H 3ULUH 3S3SA 3FO9A 3GJFB 3C9NA 5DGQA 2R2EB 3H7BA 4HK0B 2EH7L 3S97C 4MQ7B 1A7PL 3S7GA 3OKDA 4PJ5E 1BWMA 3ZMRA 4HIXH 1RZKC 2FJGA 3DETD 4LLDB 5JUEH 1FG9C 1S7QB 1YECL 3M8OH 4XVTL 2HT2D 2HT4D 1KC5H 3WS6A 5KN5A 4O51A 4NHUA 1QBLH 4LLMB 4BH7A 1LO5A 5ESVA 5CINH 3VFTB 5I8EB 3BN9D 4P3WA 1OSPL 2J4WH 1RAMA 1KUMA 5GS0H 4V1DE 3QAZC 1XH3A 1TVHB 4LL9A 1K4CA 2ADFL 3L3HB 5C0JA 2VUYA 4ZTPH 3RVVD 4G8GD 3RU8H 4PRPB 4MQ7A 5EU7C 1HNGA 4XTRD 4TQEH 3TA3A 5IJVB 3MV9D 3T4AB 5BVJB 4L8SA 4PBXA 2YZ8A 5AD0B 1ZLSH 4Z0BH 4GAJL 1AGDB 2PYED 5C0EB 1NCDH 5GS3A 1CGXA 5I15L 2P5EA 3IAPA 3D9AH 1FJ1B 1KEMH 3IFNH 3X3FL 4ZXBC 5A2LH 3NFNA 4PJ7A 5DJCA 4WFFE 1A14L 2EEBA 5DRNB 4IRSB 2IBZY 3JWNC 4K94C 1WFOA 4NQSA 4PR5A 3ARFD 1TVHA 2GHWB 2FX9L 2XZZA 1YN6A 4DJMA 4G43B 4M4PA 2B1AL 3F7YA 1TZGH 2NXZC 1TQCB 4FZEL 1KFAH 4Y16C 4R0LB 3BPOB 1GRWA 1CGSH 1A0QL 3CK0L 2Y06H 2FATL 3T4AA 3V8CA 4TSBL 5C0BE 4YQXH 5D96B 5J56B 3UJTL 3STZB 4R3SA 1AGDA 1ZWIB 5ID1B 4P2OC 5EU5B 3ARVA 2VC2L 4DW2H 2I07A 1FJ1A 3TT3L 1TETH 5CP7B 4WUUB 2C3XA 5FYKL 3TA3D 1G7MB 1UCBH 1U3HA 4ZUVB 3DO7B 4GAGL 4XPAL 3MLSL 5TE4H 2FWOA 2G2RA 4Q9RH 4GSDH 4ZOCA 3D69B 1OAKH 2DM7A 4JANA 2Z0BA 2P5ED 5K59E 4JDTH 4OLZL 1GJIA 3S37X 5FEBA 3HC3L 1A6ZB 3QUKA 1G7JA 5IMMB 4BFBD 3SDAB 4XNMB 1IQDA 1XF4B 3PGCA 4WTWA 3GMOB 3G04B 4ZDHA 4ZNCD 4TUJA 4NOBA 5F1KC 1YEFL 1ZWIA 3STLB 2CIKB 3DUSA 5EU5A 4LGPB 5KSAB 3HB3C 1SVCP 4P9MH 2Z93A 4BZYA 4HFUH 2WSKA 4WGVB 5CP7A 3O9WB 4WUUA 3SN6N 2BNUB 1FYTB 1FHGA 2YK1L 1ZGLM 2CXKA 1UACH 3VA6A 5FDYA 2DJ4A 4G8GE 2I26N 4XBEL 4X4XB 1P7QA 3RVWD 5E2VH 3DMMC 3C5SA 4XB8A 1R0AH 1Y6KR 3PABA 2Z35B 1U3HD 2B4CH 2QQLH 4K2UL 1HI6A 2SEBA 4XNMA 4GAYA 5F7KC 3HR5B 2X5PA 3MUY1 2IGFH 3PE9A 3MODL 3AY4C 3GM8A 5KSAA 1MFEL 4OFDA 1BX2A 4D8PB 5ABDE 2YD2A 2P47B 1V5JA 2AAVA 4KUZH 1FDLL 3TNMB 5I16A 1H3WM 3TIDA 1DQDL 4XCYA 2F58L 5F1IB 2AQ1A 4WV1A 2BHUA 2Y5TB 1WUNT 4MX7A 1QYGL 4JPWH 3RL1B 5D8JL 2C7UA 3QXTA 4X4XA 1CXKA 4GUPA 4M00A 5DVKA 5K9QI 1WV7T 2YC1A 1XCQB 5JW5B 4L4VE 3JZ7A 4LARL 3RDTC 1FV1A 5DF0A 3QXAB 5GZNC 5IVXB 1AQDB 2NR6C 4RRPG 4WNQB 3UJJH 4RWYL 3ABZA 2D7TH 4LP4A 1QSFB 4N8VG 4UU9B 5C0AA 3R0NA 4MYWB 1A1OB 4MGXA 1P7QD 3F5WA 3CVHA 3MC0A 3FJTA 4FQLH 4UQ2A 4EUPH 3E8UL 1NUGA 4NWUL 4Z7OF 2X44D 1A6VH 2YRLA 4KHXH 4OF5A 4KVCL 5AG9A 1BF8A 5MEOA 1IGIL 4P3CL 1PKQA 5HI5C 3RVTD 4HUUA 4M1CC 2OQJA 2P5EE 3KWWA 1Q0YH 3RL1A 3T0BA 5D1QA 4TUOB 3VXOA 3AGVA 2CLRB 2NX5B 5JW5A 4PJ7E 3GKWH 5DJ6B 3HPJA 3NOIA 1ES0A 3O3BB 5BXFA 3MUHL 1YMHB 5KS9F 3G5XB 3JWDC 1S7WA 1S7XB 1P1ZB 4UU9A 2AXGA 5HHOB 3MCKB 1A1OA 1CF8H 2IEPA 4R26L 3R1GH 1N5YH 2NY0D 1FIEA 4G7YH 1A47A 2BP3A 1BVZA 2F15A 4UNVA 3RY5A 5C0AD 4R2GB 5CBEB 1FNEB 4M8QB 4FQPA 5E5RB 3BH9B 1K3IA 2ADJB 2FECL 4XB7A 5IP4A 4K8RH 3JWOL 3U83A 3BQUB 4XBPB 4MXWL 3RGVA 5DRXB 4Q6IB 2EICA 1JF6A 1F11B 2F53B 4HJJH 3DYPA 3EGSB 1S7XA 4YXLH 5D1QD 3K0WA 1LWRA 4M1DH 1X44A 3V0WH 1YNKL 5TGBB 5I1DA 3TH3T 4P3DA 4YK4B 5GS0D 3VRLF 1FVEB 1TNMA 4HLJA 5IM7B 1UC6A 2FO4A 1ROWA 4OKDA 2HMIC 1K6QH 2JB5H 1WWBX 1KIRB 3BZFA 2ED8A 4WUUE 4FZ8H 2JB6B 5K9JH 1JF1A 2PO6C 2YD9A 3KYNB 3P30H 1PEZA 2VXQL 1B4RA 3BQUA 3G5YB 4XBPA 1YZZA 2O61B 5BJTA 5AZ2L 1BPVA 5C86A 4ZS6C 4X7TB 1EJ6A 4RX4D 1AHWB 5DURB 3LKRA 4KRLB 4UB0L 3EGSA 1KXQE 1S7SB 1QFUH 1U8HA 5KVDH 2OR7A 3CXDH 2FEDD 4R4ND 1NCTA 5DD3H 5HHQB 3QULB 1HXMB 1FCCA 4ZUSB 1FVEA 3MNZA 2G9HB 3RGVD 1JGUH 2Y36L 1WEJH 2UZYB 3F7VB 4H26B 2IADA 1P7KA 4ONFL 1F42A 3L3IB 5GIRA 3QI9C 1DLFH 4HGMA 1G6RL 4UUJB 1IFHL 5IFAH 2RGSA 4APQB 3S37H 1GCFA 3MJ9L 4LASL 5D1ZC 1HINH 4TOYL 3KYNA 1BFVH 3S96B 1CLYL 1L9NA 1MAKA 1OT2A 4NJ9L 4LIQL 4X0KB 5JXEA 4MAYC 4U1JB 3MV8B 4YHPA 3V6BR 3ULVD 4EQ2A 5D7LA 3DYMA 1ZGLB 5I17B 2NY5C 4ODTH 4G5ZH 1SJVA 2QQNL 3R0MA 5CMAB 2NY1D 5EUKB 3PP4L 4WHCA 1INDL 3DLQR 3LEVL 5ENWB 5IJKA 4Z8FH 4HT1L 1U3YA 2UWEB 2EE3A 3LN4A 3SQOH 5C0AE 3GSXB 2WQRA 2GITB 5EO9B 3KYAA 1V8HA 1ZGLP 1JGEA 2FCBA 4IIQA 4GW1A 3TM6A 4R4BA 2ED7A 3FT4B 3S96A 3DUHA 3MXVH 5F6HI 2J2ZA 1PKQE 2FYYB 3EKCA 2H1PH 4NT6A 5HGGS 4XP9L 4KKAD 2F74B 1SQ2N 4PJCF 2FBJL 3RL2B 1ZGLA 4YFLI 1ZA3A 1WC7B 5I17A 3S8WA 4F8QA 2BSRB 4OKVA 4PREB 1VFMA 3BXNB 3DRQB 1JGDA 4JHWL 5EUKA 3UTQA 3L7FA 5DUBB 3FZUC 1OF2B 1ITBB 4IRJA 4N0FA 5B21A 3TH2T 3RZCA 1DBJH 3GSXA 4GXVH 2W9EL 3QG6B 5T5NF 4NC0B 4FQHA 4M6AA 1MHPL 3O8XB 3OKYA 3CMGA 1MCWW 3LHPL 1UWXK 5J0BA 4H8WC 2WBJB 4CN1A 3U9PL 4ZFFA 4PP2B 3CLFL 2EH7H 3HUJA 4HLZG 4PTUA 3IT8D 1A7PH 3HI1A 2WINB 3GHBL 1DBBL 4QHMB 2ZUQB 1CZ8L 2CUMA 4ZG1A 1YECH 3IDGB 4XVTH 4P2RB 3NIDE 3BXNA 3VH8G 5IMOA 4Z7WA 5J9PA 4JPKH 1ZANH 4JJ5B 4AMKL 5SX5H 1OSPH 3QQNA 5SV3A 4P4RB 4W4NA 2ZG3A 4BQ9A 1FPTH 4M48L 5E7FA 4QTIL 3HAEH 3RVUC 4QTHA 1Q9LB 4DVRL 3EOTH 4PP2A 4IRJD 5E5MB 3MNWA 2ZOKB 3ULVE 3M1BB 3RZCD 2XXCB 3MA7A 4HK3J 1R3IH 4QHMA 1IGTA 3FFCA 3FQXB 1VERA 3QDAA 3QQ9D 4GAJH 2ADIA 5LAXA 1S5HA 5INCB 2J8UA 2HLAB 1L6ZA 5I15H 5DUML 3MMEA 4I0PB 2NTFA 2AJYL 1J05A 2JLLA 3WUZA 3MYZA 1UXSB 3X3FH 4JJ5A 1KPVA 1N0XL 3RWEB 1YPZA 5E8DL 3QUZA 1VGEH 4QRPB 5D6CA 3KG5A 3CCHA 2KQNA 3I6KB 4P4RA 5ITBL 4I2XB 1CXFA 1WZLA 3HMXL 1J1XL 1GGIL 4C57C 1QHPA 2FX9H 5FKPA 3H9SB 1HQRB 4FFVD 2B1AH 5TPWL 5EFIA 4CDHA 5IKCA 4DUWA 1DN2A 4DZBB 3REVB 5HHVH 5I73B 4FZEH 5E5MA 3MO1B 3F7PC 3CUPB 3M1BA 1JMZA 1A0QH 4OT1H 4PGBA 3CK0H 1MCOL 2FATH 1NBYB 4TSBH 5JPMA 1KPUA 1KOAA 3W39A 3Q48A 3UJTH 3MROA 1PQZA 5H2BB 2ZJSH 4HBQA 1OQXA 2VC2H 2XKSA 3C8KB 3QEQA 1KN2L 3SDXF 3J7HA 5FYKH 5D7LE 5C71A 4HH9B 4P4KB 1RK0B 3PP3H 4TRPL 3FFCD 4LHJB 1XCTB 2ATKA 5MI0B 5JZ7C 2FECI 2CRZA 3FAWA 3I75B 3MLSH 5TH2B 5BMFL 5LJYH 4P5MB 3K2UL 3QIBA 1FYHB 4UT9L 2VQ1B 4JHZA 3FT3A 4OD2B 1IC1A 1IGCL 3HC3H 3I3EA 5A2IH 1YJDL 3QUZD 2CGRH 3V5HB 1VGKB 1QD0A 3MNVA 1BECA 1FZJA 1YEFH 2A6DB 1HCFX 1M05A 8CGTA 4MXVE 3MV8E 5J89A 1KJVA 4OF6A 1BIIA 3V0VA 1UQSA 3EOAB 3I3DA 1SEBA 2H3NA 4KZEL 2YK1H 1XCTA 3KPQB 3P4OB 1DLHB 5GJTH 2ZSVB 2OYPA 1GVIA 4WW2F 3X17A 5IB1B 4XBEH 3QEQD 3CX5J 2E9IA 4HUNB 2NY6C 1HH9A 2P5WB 2C9AA 4NNYA 1T6VN 1FL3A 1RJZA 2DL2A 2A1WL 4N9OB 5JNYB 4FHBD 4Y1AB 1W0WA 4HX1B 5L8KB 5JR1L 3V5HA 4MMZC 4K2UH 1VGKA 2ED9A 3OKNB 2BSSA 1GOHA 2IPUG 3FB7B 1WWWX 1NCWL 1IM9B 2A6DA 3HUJE 3GSNA 3QIBD 4ZYKA 2W0LA 3QEUA 4O02L 1MFEH 3CX5K 3Q6FB 3OJDB 2Q7NA 1RU9L 4XC1H 1NDGA 4R7NA 2Q3AA 4X7CC 4O9HL 5FOBA 1DQDH 2F58H 5SV4A 5DJ8B 1YEHL 3RWIB 4HKXA 2JELL 1QYGH 4Z7WE 3ZDYF 5KOVC 1FNFA 1BZ7A 5D8JH 5D7JC 2VOTA 4M1GH 3SO3B 5DJ2A 1AP2A 4KV5F 4U1GB 4S1QL 1HHKB 2G5BA 4LARH 1AGBB 5IEHB 5JNYA 3LQMA 3L6FB 2OM5A 4Y1AA 5ID0B 2QADC 4JVWA 3LQAH 1ONQB 4L29B 5IBLC 4RWYH 3O6FA 3RJDA 1BQHG 1DQQB 4NM4L 3TZVA 1IM9A 3C2AL 2E9JA 1A21A 4KMQA 4RFEA 4HSQA 4X6CF 3E8UH 2W9LA 4HUWA 2GUOB 4S1SL 3FFCE 5HHMB 1OWRM 4KY1H 4MNGB 2ESVB 5BZWB 1EBPA 2AI0L 1PJ9A 3BRDA 4KVCH 2J8UE 5DJ8A 2FSEB 1UJTA 4JRYB 4P3CH 1KT2A 3MRPB 4TVPL 1MWAA 4ELMF 3L3KB 3O81A 4P23B 5DTFA 1JPTH 1YPZE 3GBLA 3MOQA 2YD4A 3H42L 4LVHC 5E2TL 1CFVL 5ID0A 2YUVA 2A73B 4EBQL 3RA7L 1DZBA 3H9HA 1CLZL 4R26H 1VSCA 2EZ0C 1AD9B 5HGDB 2GJ6D 2V5SA 1X7QA 1ORQB 2XA8H 4MNGA 2ESVA 5BZWA 3DGCR 1RIHL 1DCLA 3O6FD 5D72H 1BVKB 2HN7B 2D7MA 3QEQE 4FN0A 2E7LC 2OTWB 4IEFB 4X4YA 2J6EA 3GGWA 4QNPE 4ENEC 3BGFB 3BWAB 4TPRL 3BKCL 4E5XB 3WDHA 4R8WL 4MJIB 4UTBL 3JWOH 1A6UL 3IDNA 5CIPH 1N8ZA 2GTWB 2GSIB 4MXWH 3S5LG 2DQGL 2AERT 1NLBL 2XRAL 1EUUA 4RAUA 4WO4C 4JCLA 1VESA 1EZVY 2PW1A 2BFVH 4JZNB 1YNKH 4QYOA 1A3RL 1XGYL 1U8PB 2YRPA 4N1EA 3ZDXE 5D5MA 3V4VH 5GHWL 1WLHA 3ARDC 1N6QL 2HN7A 1AXIB 4YEFA 1EHAA 4UDUB 2OTWA 5J4MA 3HE7A 1RZKL 1B6DA 1OOAA 2A38A 1MH5B 5ESQA 1GZQA 1T7YA 4MJIA 3V7AE 2YOCA 1INQB 5GPRA 3O41B 3PWJB 4UB0H 4YPGA 2AS5M 1C12B 3QWQB 1NGZB 1ZV5A 1IKFL 4N9GA 1HH6B 4JZNA 3GMQB 3QNXB 1OT1A 4KI5D 3CMOL 1TPXC 2VLJD 2PYFA 4EOWL 3JVGC 2O93L 2Y36H 4XCCL 2ZSWB 5TF1L 2X4SA 3IXAB 3JV6A 1HZHH 3GIZL 5H37G 2ICWI 1IFHH 1OCWL 3O6ML 2HWZL 3MJ9H 4LASH 1LE9B 4TOYH 1CLYH 4NJ9H 5CCKL 3D18A 4GXUN 3QPXL 3FQUB 1BWWA 1I1AB 3L95B 3HN3A 2BMKA 3PWJA 2AJ3B 2I60L 3HE7D 5L88H 1C12A 3MLXH 4OV5B 4U1NB 4XPBL 2QQNH 1E4XL 3CDGA 4MD4B 5FYKD 4Y1AE 3QNXA 2ITCA 2X42A 3PP4H 3FMGL 2CRMA 4H5SA 1INDH 3BP6A 4K07A 3I3BA 1ZKAA 3WHE1 5M95B 1BD2D 3E0GA 2XYCA 4WI2A 3IXAA 1L9MA 1R3LB 3FB8B 1A1NA 4UILL 5TFSL 1QLFA 2X40A 3PP3K 2LV4A 3WCYA 1P9MC 2F54B 4XNYL 3DVGB 1TQBC 3SE4C 3BT2H 4XP9H 5BVPL 1YQVL 3L95A 3VFVB 3KPLA 2AJ3A 2FBJH 1MJ8L 1FBIL 4JY6B 3SOBL 4NBXB 4RNRB 2FJHB 4U1NA 1TENA 4JDZB 3NGBB 3L5HA 4JHWH 3T08A 3GJFH 4IOFC 4K23L 4JFPB 4MLIA 1J5OL 1E27B 2W9EH 4G9DB 4OCXL 2YUXA 1MHPH 1CT8A 3O2WL 3LHPH 2HJKB 3BDBA 1QSVA 3Q3GA 5DJ0A 4XWGL 3FB8A 5HHME 1HSAA 1NSNL 5F96L 1MHCA 4MNGE 2ESVE 3HRPA 3QZWG 4MCZB 3AB0B 3U9PH 3CLFH 4H0HB 2I24N 4KJYA 4XH2B 5T5FL 4Z77A 1DBBH 3RI5F 1H9VA 1T3FB 5E8OA 3BH8B 4JY6A 1CZ8H 5D6DA 2FL5B 4NHCL 5BW7C 4AH2B 4KI5E 1PLGH 1U58B 3MLPA 3RWHA 1S3KL 1WBZA 4UV4L 3UAJD 1NKOA 5DJZB 4CJ0A 4YXKL 1A22B 3FO1B 4I0CC 2P42B 2R2BB 4AMKH 2AJXL 4ETQB 3VWJA 2VTFA 2BY2A 5CGMA 5JHDB 3SY0B 3MLTA 4JQVA 3T4YB 4D94A 4M48H 2HLFD 5DEGB 3VFPA 5CEZE 5D5ME 4RSVA 1QLEL 5JORB 5IGXL 4XH2A 5DJAA 3MRIA 5DRZA 4E0RB 5E1AB 4XP6L 4C4KT 3B83A 3C09C 4MJIE 3I84A 3TFKC 2V7HA 1UXWB 3DIFA 3RIAK 2VDPL 3BO8B 5DUMH 2AJYH 4RGOL 3RNKB 3L3DB 3FO1A 5F7LB 3DXAB 3MRQB 3BGMA 2R2BA 3FB6A 4J4PC 4R96B 3U9UA 3V4PL 4OZIF 1N0XH 2C1PA 4ZTOL 2ERJB 5E8DH 4K7FB 5GGVL 1LO0H 3NA4A 1F4YL 5FM4A 5HGBB 3T0EC 1KNOB 4RISL 3AAZB 4OZFB 1N6UA 3HMXH 1J1XH 1GGIH 5DEGA 1JNNH 3DUUA 2QQQA 3HLAB 4I5BB 1F3DJ 4I0KA 3WFDL 4FQXA 3HA0A 4JO3L 2EH8L 3SCMA 1A4KA 1MCOH 2Z8VC 1S9VB 3WS3A 2OR9L 1RZ7H 3PUCA 1ZS8A 3ZKNC 4CGTA 4MDJB 4QY8A 4DAGL 1KN2H 4Y8DC 3ZE2F 5EOCL 2C3VB 1C08B 3MLZL 4K7FA 3QIWD 4TRPH 2J8HA 2FIKB 3DJ9A 3OKMA 1CDCA 5BMFH 4KKLC 3AAZA 5HYSA 2R9HD 1VADB 2A9NL 5I9QB 4HGWA 4PJFF 1MCDA 4L8DB 2ID5A 3K2UH 1OAQL 4X4ZA 4UT9H 4G80B 4I5BA 4Y7MA 3ARPA 1IGCH 3TPKA 4ZFOL 4WDIB 2FHBA 4GMTL 5FIEA 4ZD3H 1YJDH 4Y4FB 5C0GB 3IDXL 3FO2A 5ADPH 4GG6F 3WLBB 1G6RA 3OAYH 4PBVC 5DJDB 4CVXB 3FQWB 5AG8A 1OTTD 3RWCB 3L9RB 4FQXD 4CJ1A 3KYKL 2DLTA 5IOPB 2BY1A 3SCMD 4G6AC 4ODWB 4KZEH 5D7KD 5I19L 4ODXB 4D9QD 4CUCA 2FIKA 3W2DL 2YA1A 1T4KA 2APBA 1NGXA 5DEZA 1KCVH 1KIPA 4HUVB 3O4OB 8FABA 2CD0A 1T1YA 1D3CA 3S9DB 2QKIA 4TNWF 4ZO7A 2UZIL 2A1WH 5DMJB 3VI4E 4ODHL 4M7ZB 4Y4FA 5C0ND 5JR1H 3DI2B 5K9KA 2CSPA 3EW3B 4YHIB 2BSED 2NY4C 3AM8A 3U6RB 2F54E 5A43C 4RDQF 5DJDA 1WIPA 1KGCE 2WWMD 1RHHB 3MBEB 1G7QA 5JOPD 2Q8BL 2BOCA 3CZJA 3JV5A 4O02H 4NKMB 1ZLVH 3KPRD 3RWCA 1RU9H 4OB5L 4LPUA 4JM2B 5AYQA 3MX0A 1MLBA 1J0ZA 4ODWA 5F88A 5FO7B 1J0HA 4O9HH 3TBTB 4LLYA 1TFHA 3MRJB 1YEHH 1M7IB 3QRGL 5C08A 3P0VL 1DE4B 2ZNWA 4H1LB 3MRBA 4HUVA 5F8QC 3LB6C 1WIOA 3TCXA 4PGDB 1AH1A 4P46A 1T66C 4POZD 3LN5A 5I2IA 1A5FH 1IGJA 2LQRA 1I8KB 2OTPA 1Z5LB 1TIUA 3OR7A 4ZAKA 1E4XI 3PWPD 1MRCL 4UI2A 1I1YA 2X4RB 3P9LB 1NEZB 5J13B 3W11D 4NOFA 2CDEA 1GGCL 4FG6C 3DTXB 3T3PE 3PL6C 1AD0A 4S1SH 3EO1B 3F12B 2YPLD 5GRXG 1LD9A 4PJ9A 1VCAA 1BMGA 3B5TA 2A77H 1JYWA 4Q2ZB 4TVPH 4ZQKB 3QIUD 2W0FA 1DE4A 4HH8A 3RVXC 3CFDB 5JIIA 3VFNA 3GUTB 3BDYL 1JHTA 3PF2A 3VG9C 5DK3A 3RX5A 3NIFF 1QSEB 3H3BC 4N0CD 3DYOA 4YBLC 4PLKD 4Y89A 3H42H 5E2TH 1CFVH 2JIXB 3MLUL 3B9KB 4P0DA 4EBQH 5C08D 3NFSH 3U0TA 5DQ9B 3MGAA 4BELD 2O5ZH 3RY6A 2HKHH 3U4EB 4P46D 5I1KL 1IMHC 1AR1D 4KPHL 1NL0L 5ACZB 3MCLL 2NLJA 4D9QE 1T1ZA 1D5BB 2IALA 1RIHH 4XHJC 5C09B 4ZAKD 2IANB 5FM8A 2O5XL 3GJFK 3MJ7A 5I1IL 1UKSA 2DBJA 2A2QT 3NA9L 4L9LC 1SY6A 2E8YA 2QQKL 5E94A 5FHAL 3MGOA 3BKCH 3CSBA 4Z7QF 4UZGA 4J3UA 5DRWA 4R8WH 1R5WA 2E3VA 1A6UH 1WT5C 4PJ9D 1WZKA 5I76B 4NFCA 3ZTNH 2DF3A 2X4OB 1NLBH 3BHBB 5JOPE 2XRAH 1SEQH 4C83A 4IOIA 4QRRA 5JPNA 1A3RH 1DUZA 1XGYH 5LGJB 3DETC 3CFBA 4YAQB 3DPBA 3ARBA 5GHWH 5C09A 2IANA 4AEFA 1S9KC 3SKMA 3FOLB 1YDPB 1F6FB 4LIQE 4BQ8A 4M93C 4P5KA 1MCJA 3OKOB 4O2FB 4HCRL 4PV8A 2P4AB 2Z92B 3TP4A 4TTGA 3BN9C 2DIAA 1NUNB 2R29L 4OCSH 2XNAA 3KPSA 3LCYA 1PZ5B 2BRRH 1GC1C 5DZNA 1CGWA 4Y19B 3UTZB 3E2HC 3FN9A 3QH3A 3RVVC 2VXUL 1JFQL 5HYEA 1IKFH 5I0DA 5DVLA 5LXGL 4G6ML 4XTRC 3INUH 4QHNA 4Z5RA 4GRLA 4HW6A 4YO0B 5EZOH 5ICXA 2HFTA 3CMOH 4EOWH 5HDBE 4RGMB 1Y0LB 2DYPD 2NYYD 2R4RL 1CD1B 4XCCH 3BKJL 1I75A 5TF1H 4CN4A 3TPUB 2ICWJ 2RAMA 1YDPA 5J6GA 4AEIL 3GIZH 3QUYB 1OCWH 4QRRD 3O6MH 5AAWA 1CXIA 1OARL 2HWZH 4IHOB 2Z92A 3QXUA 3BMVA 5JW3L 1Q0XL 5LGHL 3ARBD 3QPXH 5C08E 4EI5A 3WUWB 4GMSL 4I3SL 1P4IL 3ARFC 4NYLA 5E2WH 4YX2L 2I60H 4D9LL 5EB9A 2EYSA 1WBXA 3QFJB 4H0GA 1UENA 4KQ3L 4WJ5A 2Q6WA 1XF2A 1E4XH 3EOBA 5CEYA 4PJEF 4OLWL 3TC9A 3SO5A 3FMGH 5SWZA 3NCEB 5EBMA 1RZJC 3KPSD 5JQ6H 4J1UA 4KAQL 5DD5L 2I9LA 3I50L 1U42A 2DAVA 4LSPL 3TPUA 1TCRB 2LTQB 1QA9B 5J1AA 1K8IA 4UILH 1U8JA 5TFSH 3VFSA 4GRLD 1ERNA 2IMMA 2BVOB 4LLWA 1IT9L 1FNHA 3WUWA 3O4LA 1I7UB 3EAKA 1YQVH 4I18C 1JGLL 4N90D 1WAAF 3QWOB 1Q94A 3RTQB 3SOBH 1FBIH 5ACLA 1X5HA 2E7CA 1BZ9B 2LVCA 3BW9A 1DBAL 1SJHA 4JG1L 2FX8L 4PJGB 1HNFA 4JR9L 43C9A 1G7PB 4MMXC 4K23H 4F15C 4EI5D 4AIXA 1J5OH 4MA1C 2V5MA 2L4OA 3B8YA 4PJIB 1B0GA 4OCXH 4XBGB 5FHBL 2GIYA 3O2WH 4DGYL 1EJOL 4XWGH 1NSNH 3TN0B 5F96H 3WO4C 3ILPA 5SWZD 4HKZB 5I66B 3QYCA 5D1XC 5FFLA 2MNUA 2VL4A 5T5FH 4FQQA 5KANI 1I7UA 1QBBA 5CD3B 2ILLA 1JPFB 4KMTL 2VH5L 3OG6B 4Q0XH 3RVWC 4NHCH 1V3JA 4JJHA 1FZMB 3C60B 4UV4H 5ECJE 2WBKA 2NY3C 3O4LD 4V2BA 2YD3A 2AJXH 1XGQB 4QXTB 2R23B 1ZLVK 1R5IA 1S9XA 3D87B 4QRRE 5BQ7B 3QPQD 4XAWH 3RUGB 4L4TB 3MRFB 4XPFH 4K3HA 4N0UA 4AEHL 3KHQA 2DM2A 5C09E 3FQNB 4JFXB 5D4QA 2IANE 4OQTL 4HHAB 1NFDB 1Q9OA 5CD3A 3GBNH 5GGUB 1MCRA 2NCMA 2X4UB 4F9LC 2K9UA 1T03H 1VFAB 1VEOA 5LCVL 1WITA 3GSUB 1FZMA 2Y6SC 1KF9B 2VDPH 2CO6B 1HOCB 4LVNC 1J10A 1HSBA 1HHJA 4RGOH 2AJZB 3GK8L 4TVPD 3V4PH 4YZFF 4RGND 3WYRA 2X4PB 1XGQA 5GGVH 5I1EH 1F4YH 2NY2B 2MCPL 4RISH 3QAZB 4LVEA 1AKJB 3MRFA 3R4DA 1OPGL 2BK8A 3CXHJ 1NGQL 1T7XA 5JHLH 5JOFB 4HHAA 1NGWA 3RVTC 4F80A 4JO3H 1NH6A 2EH8H 4OFIA 3ZYJA 2OR9H 3I9GH 4Z7VB 3QUMA 2BVQA 4PJBB 4JKKA 2D9CA 2Q76A 3D85D 4ZUWA 3GSWB 4DAGH 3E6HA 32C2B 2AJZA 4JLRB 5EOCH 4ZXBB 3MLZH 2EDHA 2EE6A 1KTDB 3WKML 2A9NH 2NY0C 5SWZE 3GMMB 1OAQH 2I5YL 4ZOAA 5E99L 4HMEA 4Y16B 4GMTH 3ULUC 3BP5A 4OTXL 3P77A 4NO3A 1NJ9B 4BQBA 3IDXH 2X10A 4K3GA 4LCIL 3UO1L 5E4IA 2CR3A 1MHEA 4P2OB 5FDWA 3LPGA 3O4LE 5MEPB 3SKOB 32C2A 3KYKH 4V2CB 4ZXBA 2C5DC 3FONB 5EN2B 3OJMB 4NO2B 1S78C 4KGLA 1DBML 2FZ3B 1KTDA 3T0DA 2MCG1 3IJSB 2G5RA 5GS0C 1UM4L 2Z91B 4G8FB 4XNZC 4F57H 2DQIL 2QTEA 2UZIH 4W70A 4ODHH 1MRDL 1T0NB 3S3JA 3F7QA 2VZUA 2FLBT 3MJ8A 2PXYB 1ETZA 5C3LD 4HUXA 1A2YA 5IESL 1HWGB 4HIHB 2Q8BH 5C0CA 1FFPA 4UT6L 5FYJU 4OGYL 3UTPD 1LO4L 4OB5H 4RGNE 4N8VB 4Z7OE 4PY7B 3FONA 2AV1B 1HN1A 4A6YL 1ZVYA 4NO2A 1T20B 1V7ML 5GS1A 3KLAB 3QRGH 2FEDC 4R4NC 1K8DB 4FOMA 3KYMB 1A6TB 3D39A 4PJCA 3KDMA 5E4EC 4G8FA 3UTSA 3CC5B 1BZQK 3O3EB 1JK8B 4OAWB 3GSRB 3VD7A 1T0NA 4L8BB 2DMKA 4Z7UF 1IL1A 1D6EB 3N06B 4J2XA 4N0UE 1EEZB 3C5JB 1MRCH 3PGDB 4BQ6A 1XR8A 2VR4A 4HIHA 4JPIB 4KK8D 1GGCH 3WFBH 4IDJL 5IB3A 2NXZD 1KSRA 3ZLQC 3L1OL 3U1SL 4JFOA 4NQDD 2NNAB 5HYJB 2DICA 5ERWA 3V8OA 4LVOB 1CXEA 5C0CD 1A6TA 1NBZA 1NKRA 2Z31D 5DYOA 3DMMA 5IK3A 4E41B 1JK8A 3PWUA 1TITA 4L8BA 1BOGA 4M3KB 3MLUH 3WEXB 1D6EA 3IU4L 1LILA 1CQYA 4LSRL 4LDEB 3D39D 1DVFB 4JPIA 4D0DA 5FM5O 3V4UH 4Z7NE 5LQBH 4B50A 5HTSA 2H32H 5FK9A 4KPHH 1NL0H 3VRLE 4BSVA 4RWHA 4JFDA 2EDKA 2O5YL 1C5DB 3C8HA 3MCLH 3VRJB 3OGOE 1UZ8B 2IFFH 3VXTB 2D31B 5D7SL 4M9OA 4P2RD 5HYJA 4NQTA 1PG7L 2O5XH 3MV7A 2IPKA 5I1IH 3TIEA 1FO0B 1BBJB 1TLKA 2QQKH 4YHKL 4JRXB 5FHAH 3O2DL 2QEJA 3RDTA 3GJEA 3UPAA 1TTGA 1C1EH 2YUWA 1TJHH 4L8CA 4U6TA 3UPRB 5JOEA 2B4CC 3MRGB 1WCQA 4FXGB 1V3KA 2E6PA 3UTPE 5DDHA 4ZSOA 5IJKC 4Y5YC 5EU7E 1OSZA 1X5LA 1A9BA 4X7SL 2X70A 3DMMD 1P5UA 1RZFH 4M5YL 1NCBL 5F7WC 4RZCB 1K3ZA 1UZ8A 1P53A 3OKLB 3MA9L 1S5IH 4Y2DB 3VXTA 5J12C 4HK3N 3T2OA 4U1IB 5IIEA 4WENB 1WFUA 5BV7B 1U8IA 1GGTA 2R0KL 5D2LB 4JRXA 4HCRH 4JFDD 3LRSB 2R29H 2ZCHL 1UKTA 4NM8L 3LKQB 3S88L 1I3UA 2YPKB 3BISA 3G5VB 4PG9B 2WZPD 3SDXA 3WJLC 3TLRA 5C3TA 2H9GA 3X13B 1U93B 2DQUL 3MOAH 2VXUH 4XP5L 1JFQH 4IRJC 5LXGH 4G6MH 1IC7L 2BSTB 5IHZA 4I48A 2R69L 5FUCC 4AIZB 4IOSD 2R4RH 3DHMA 3ALWA 4DCQA 4QLRA 3QDMB 4JZOA 3BKJH 1DEEB 3KHOA 4F2MB 5C0CE 4K3DL 4U1IA 2H8PA 3BPCB 1B0RA 4AEIH 4S2SB 1NMAH 1S7UA 4PRHB 5ESAA 5FCUL 2IPTL 2OK0L 1Q0XH 5JDSA 4O58L 5LGHH 1MUJB 1AXSB 2FH6A 4PG9A 3X13A 3VW3L 4XRCB 1P4IH 2IH3A 1X4YA 5DR5L 3D39E 4HJGB 5HI5D 4PJCE 4YX2H 4M1CD 4D9LH 1ZMYA 1ZK9A 4LNVA 1N59A 4AJ0A 3UTSE 3DX6B 1FAIL 4POYA 3BFOA 3LMJL 3PHQB 5CGTA 4KQ3H 1T04A 4OLWH 4RFNB 3I02A 4WW2A 3TVMB 4UTAH 4KAQH 2IBBA 5DD5H 2QV2A 3FB5A 4YR6A 2Q8AL 3QDMA 4YHYC 4LSPH 3WNMA 1DEEA 4U0RC 3RBSA 1A7OL 2NZIA 3UPCA 3BPCA 2W0PA 1U95B 3C6LD 1H5BB 3D2UA 3AU1B 3VG0L 5DEFB 2KZWA 2ZP0T 2Y7QB 1VACA 4M8VA 1RUPL 1P4LA 5F1NB 1TZIA 3ROLA 1I8MA 2PO6A 5D1ZB 2OP4L 4UIMB 4CDGC 2GFBB 3S4SB 2D9QB 4MD5A 4OCMC 4NQEB 4NQCB 1IT9H 1BHGA 4XNQB 4U4BA 3H9YA 1D9KB 4Y4KA 5C2UB 1XFPA 1SBSL 4K8RC 1TJIL 4XRCA 5E95B 4LNRA 1JGLH 1GSMA 2ITDA 3BZ4B 3O0RL 4YGAB 3IXTA 5IW1A 1T2QL 1XF3A 1DBAH 4JG1H 1YMMA 3ULUF 4XI5C 1D5ZB 4RIRA 4WCYH 3DVFA 2CKBA 3VH8B 3VDAA 4F7MA 4NZDA 4PBWD 4PD4J 2HRLA 4CVZB 5FHBH 3CU1A 4EDXA 4NKIH 2BNRB 3QI9A 1EVUA 4KUCF 5GGTL 5IROC 3KVQA 4ZO9A 4GRWF 1EJOH 5DEFA 4JFDE 2Y7QA 3QEHA 1OVZA 5HDQL 5ISZB 2DWDA 4UIMA 4E42B 4JM4L 3ORJA 3S4SA 4X5XB 4NQEA 3PWLA 5HYJE 1GYAA 4Q9CA 3MV7E 3DX7A 4MAYA 4X6CA 1U8QB 5E70A 4PD4K 4RAVB 3L7EB 1A7NL 3DVNA 4KMTH 4PV9A 2VH5H 3ZHLA 3D2UD 3D0VB 3IGAB 3VMPA 5T1KB 5IB4A 2D0GA 2P49B 3BESR 2PO6D 5HGHA 4ELMA 2F8OA 5EZLB 3GBMH 1FFOB 2V9TA 4HGKC 2IBZX 4Y4KD 3N0PB 4ZS6D 4M6NL 2J5LC 2QL1A 4Z76A 2AEPL 2HJLB 4LSSL 4ZSOE 4LFHG 3TBWA 1C5BH 15C8L 2NPLX 2H32A 2XQYK 4LKCB 4U33A 1YMMD 3NMEA 4JZJC 2AK4A 4AEHH 1I7ZB 3HI5H 2N7BA 4KRPB 5CS7A 4JB9L 2ENSA 4OQTH 3CSYB 43CAA 5C8JA 5E6ID 4KTEL 3HZMA 2WANA 4ESKA 1A6AA 2LE9A 4MJ5A 1JNJA 3L7EA 3QDGD 1NC4B 2ORBL 3QI9D 1JZ5A 4H20H 4JRXE 4I1NB 2OJEB 3IGAA 1MELA 4OZFH 4BFGA 5T1KA 5FCSH 4CU6A 1MNUL 4AT6B 3QO1A 1E28B 5IW3A 4CADA 4G6FD 3BAEL 3SDXE 4JO2L 4OZHB 3R06B 1FFOA 3GK8H 4MAYD 1UH3A 2GI7A 1MCWM 2HJFB 1ZHKB 1OB1A 5I71B 3QISA 2BZDA 3DARA 2MCPH 3ZE0F 4LHQB 1MIML 5I1LB 1JYXA 2Z4QB 4MNQB 4G3YL 1I7ZA 1JHKL 1OPGH 4LDLB 4X98A 3TNNB 1H0DB 3CSYA 1NGQH 2I9TB 4HZLB 1NC4A 2F5AH 4P5TB 5T1LB 4YFEA 2KZ1B 1F3JA 1EGJL 4HCRA 5FYJE 2J3SA 2AK4D 4AT6A 1N5AB 4XP1L 3HNTH 3OGCA 4DTGL 4GW5A 2JTDA 1RSFA 5EO1B 3IJYB 2BC4A 3I6LD 4NO5A 1QFWL 1MFCL 2HJFA 2CJUL 5CSBA 4D3CL 3CH8A 3DOSA 4MCYB 2NXYD 4PJ8B 3WKMH 5I74B 2H45A 3FAXA 2Q7YA 4URTB 2W9DL 3TO4D 4S0TD 1LP9B 1KENH 5FF6A 3FZUD 1PGRB 3QDME 1H0DA 5E99H 3O6FC 1J8HD 4LCWB 4OBSA 5KTEL 3MYJA 3HE6B 1GZPB 3QQ3B 4OTXH 3JBG7 2XFXA 2DLFL 4N8CL 5EBLB 3OHXB 5EUOF 1UADC 2ZG2A 2VABB 1M7DA 2VLLA 4LCIH 3UO1H 1GIGH 4LSQL 2Q86B 3U4AA 4RMQA 1I3GH 2YD1A 1GPOH 3LIZL 2ZOLA 4ONHA 2JJTC 1G7HB 4UOW1 3LKSB 2FJFA 2H26A 5EO1A 3EFFA 1MVUB 3BKYL 2OTUA 1GOGA 2AABH 3NACH 1FL5A 3RKDC 1YMME 2R8SL 4X6FB 1H3TA 3ZDYE 4TULL 4KFZC 4KZDL 1UM4H 3WSQL 4JAMB 2AJSL 1LP9A 4KV5E 2HVJA 4IS6B 3MV01 5F72S 2DQIH 3UTTB 3C5ZB 1HKFA 3GMLB 1GZPA 1MRDH 2FRGP 3OHXA 2E8ZA 2R2HA 1A4JA 2YEZB 4IMLB 5IESH 1K5NB 4NQEE 1FFNA 4H1LH 5E2UL 3EYFA 5DK0A 4F7TB 5IEKB 4LCUB 4UT6H 4LEXL 4X6CE 1LO4H 3QXWA 1Z9LA 5L6YL 1QPPA 1MI5B 3EO0B 3L3GB 5D71L 4A6YH 3EZ8A 3OKEB 2UYLA 1AR2A 3F62A 1ND0B 4BSWB 3OL2A 5DUPL 2V2XA 4ELME 2AXJA 4G9FB 4ZOBA 4KI5C 2MQ0A 3SE9L 4DVBB 5GRVL 1S9YA 2QR0A 3UBXB 3GMLA 3IKCA 4HWEL 1FP5A 3B5HA 5T1MB 3WFEH 3EO9H 1CTOA 3DBXB 2AK4E 2F19L 3U0WL 2QSTA 1IQWL 3PQYD 1UJ3B 1I9IH 3A6BH 4EVNA 4LCUA 1AO7B 3I6LE 3WLWD 2GJZB 1R24A 4JN2A 2OSLB 4F9PC 3BIKB 3EO0A 25C8L 2UUDH 2XQYG 4HWZA 3L1OH 3U1SH 2B0SL 5CSGA 3EIFA 4HAGA 5GZOC 3D25B 3LQZB 1IM3A 5HPMA 2D03L 4MJ6B 1AXTL 1T5WB 5D7JB 2WP3T 4D0BA 1CBVL 2VISB 1XZ0B 3UBXA 4U1MA 4WFED 4EN3B 5SWSA 4HS8L 3N50A 4MA3A 5T1MA 2QADB 4C59B 1RZJL 1YEKL 1HHHB 3IU4H 3MUJA 2IMNA 1GL4B 5MENA 4LSRH 1Y18B 1FO0L 3TGXA 1BQSA 1AO7A 1CYGA 5J6HB 1BBDL 3BIKA 2O5YH 3BUTA 5CJXC 3DGGA 4AQ1B 1E4KC 5D7SH 4ZPVB 5L2KA 4MQXC 1C8PA 1PG7H 1RQ5A 3FKUS 3V5KA 1KPRB 2A74B 3B9VA 4J3VA 3MRNB 4HKBA 4YHKH 4WGWB 3O2DH 2B5IC 2CRYA 3VFMB 5GS2H 4Z9KB 2D7NA 4PG2C 4PJHB 3IU3A 1G9EA 4S11A 3HTLX 3D3VB 1T89A 1I1FB 4NGHH 4OZIA 5BRZD 2FGZA 4AENB 2EDDA 4AQOA 5I1AB 5BV7L 2NY6D 4GRMA 2FIRT 4PJAF 3T8XA 5E24E 2DQHL 4X7SH 2GTZA 1CCZA 1I85C 5J6HA 5SWSD 1NCBH 5EC2B 5ALCH 2A83A 5M94B 1Z2KA 2H2PC 1L0XA 5MEND 3AMKA 1KPRA 4MDIA 1OWWA 4NQVA 4LF3B 5CJ5A 2EDTA 2ZCHH 3AREC 2WIMA 5KVGL 4NM8H 5GGRY 5LVEA 3S88H 1NFKA 5L2KD 2XG4A 4ONGL 5LBSL 5HXMA 4AY0A 2DQUH 1DANT 2VDLH 3VXRB 1LP9E 3TV3L 4LPCA 4QRTB 4XP5H 1GGYA 4X9HA 5FA4B 1YNTA 4EDWL 1IC7H 3SE3C 1J0JA 4PJFA 2R69H 3FQRB 5GSVB 3VXSA 1LK2A 2P24A 1LO2L 2YHGA 5LGKA 3ARDB 1R3HA 4Y4HB 3ES6B 2NW2A 4K3DH 5C2BL 3IDUA 4JQIL 4GG6A 5FCUH 1SJXA 4F58L 4WFEE 4XVUC 2IPTH 1W8OA 1EEUA 4O58H 4LLVB 3Q6GL 3VW3H 5L2JB 5EC1B 5EBWA 2B8OT 5JIKA 1FAIH 4WO4A 3RNQB 3LMJH 3KYOA 1JF5A 4ZMAT 4JY4A 3N1MC 5F3HA 1C7SA 1TPXB 3ARGA 5GSVA 2WW8A 3KLDA 4OF7A 4JQVC 5D7IF 2Q8AH 3GRWL 5A3ID 2HTLC 3ARDA 3FQTB 1A7OH 2OZ4H 1QVOA 1H15A 3ES6A 3MUGB 3GMNA 3VG0H 2WUBH 1RJYB 4A6YA 1IEAB 3QIWC 3VXSD 3KLHC 5HSFA 1SBSH 1TJIH 1V3LA 2P7TB 3JWOC 4ONOA 3PNWB 1EHLL 1E6JL 1JGVL 3UZVB 3O0RH 4NCDA 4ENED 4LHUB 4P2QB 2W60B 5SWSE 4Q9QH 1J1OL 2FGWH 1FC2D 4PRIA 4HD9A 4BZ2H 1HXYB 4JG0L 1QFPA 2N7AA 5DZOA 2XN9A 1OM3L 2RJMA 3E3QC 1RPQA 3ULUL 1U92A 5EU4A 4WO4D 3KPOB 1OTTC 5GGTH 1AO7E 4U6YB 5CBAA 1IEBB 2YSSA 4FQXC 3B9EA 2H2SC 3EDJA 4CMMA 2XKUA 5HDQH 4HIXL 1IZKA 4JM4H 4PPTA 2XPGA 3ARGD 5L2KE 5DZLA 2H6PB 2V5RA 3BVNA 1R3JB 4YXHL 5F7UA 1U8LB 3GO1L 1TVBB 1A7NH 1YUHB 2JE8A 3CFCH 4OIBA 4ZUUB 2XICA 4Y5XC 1A3QA 4PFEA 3LRHA 3CGTA 4LHUA 1JWSB 5JMRA 5E08L 4K9EL 3HHRB 1NAMA 3L5XL 3IDMB 4OZIE 5F7FA 3VFUB 3VWKB 5C9JA 1FAKT 1VKXB 4M6NH 4C56A 5SWQA 2AEPH 1C5CH 4LSSH 3UMTA 5DK2B 2ICEB 3LZFL 15C8H 3K2MC 3MZGB 4GKNB 1BEYL 1IEBA 2HFEB 3OAZK 3SDCD 2CK0L 3BIAX 4YDLB 4K71C 1P9MA 4QT5A 1G7LA 1KCSH 3EDFA 1ZSDA 5MERB 4DK3A 1JV5B 3HPLA 4PRID 4JB9H 2PTUA 1FVCB 5GGSB 2H6PA 1EFXA 4CNIB 3SE4A 3KNBA 4KTEH 1KACB 2XN9D 1WWAX 3LKNA 2CIIB 3IFPA 2HAZA 4DGVH 4PRNB 3L3OB 1WVZA 3OXRB 2EEDA 3D9AL 4I4WB 1MNUH 1UFUA 1UB6B 3Q1SL 1DN0A 3T77B 1RJLB 2JJSA 3BAEH 3ZE2E 5T3XL 4OZGF 2DI8A 5KZCB 1AC6A 3SJVB 2IAMA 1CU4H 5C0FA 3P73B 3W11C 2X2YA 5DK2A 5F9DC 1MIMH 1ZT1B 3U46A 1YY8A 1I3RA 3X11A 2UUDK 4KKBC 1TZGL 4PJFE 3VXSE 2PKDA 3HR6A 1JHKH 4JFEB 1JV5A 5JW4R 3AM8C 3DV4A 4YEEA 1QFHA 4C56D 3RBGA 3QIUC 3GSOB 5J11C 4GG6E 3W82A 2PTTA 3WL9B 3HMWL 1T5XB 5AUMB 1EGJH 3O3AA 5CP3A 4AM0B 5BW7A 3BP4A 3C09B 1TETL 5DHVB 4OZFG 4YHML 4M7KL 4N0CC 3T77A 3RPIB 1HHIB 1WCBB 3EYVB 5L0QC 4ISVA 4DTGH 1EFXD 2VLRA 2XWJA 1QFWH 1MFCH 1VEPA 2CJUH 1OAKL 1KB9K 4D3CH 2L7JA 3T0EB 1CE1H 5HGAB 4XX1E 4J3XA 1KXVC 1AR1C 3U48A 2W9DH 5F9WC 3QNYA 5HVFB 4TSCL 4YFLF 4JFEA 5HHXL 4GOSA 4OI8A 1CGUA 4ZAKC 2MKWA 5KTEH 1TNNA 3FOMA 2IAMD 3HC0A 1A3LL 1OGAA 2DLFH 4N8CH 5IFJA 1QLRA 1U8NB 1G9ML 1FNAA 3JV4A 1T5XA 4LSQH 4PGCA 1N2RB 1UVQA 4OLEA 3T65A 1HHIA 4PJ9C 2QSCL 2ZZUT 2DLEA 3MR9B 5HVHB 5D9SB 1QQDB 3OF6A 4J4PA 5IR1A 3BKYH 1W0VB 3QG7L 3CSPA 2V2TB 2R8SH 2BCKA 1UB5B 2I25N 1A6WL 4PRIE 4IMKC 3WSQH 2B4CL 2AJSH 1CFNA 2VLRD 5IT2L 2DLHA 2XN9E 2DKSA 4PJEA 4DFIA 1JRHL 5KSBB 1X5AA 2IGFL 2HRPL 1FH5L 1JBJA 4MSWB 4OFPA 2EDEA 3IAGC 4GJTB 3BUYA 2R39A 5E2UH 1CVRA 1RZIA 4LEXH 4GKZA 1L0QA 4JHBA 1I7RB 5L6YH 3VXUA 1OGAD 4M3JA 1QR1A 3RIAF 2WV3A 4TNVF 5DUPH 3BOVA 4R0LC 3BPOC 1UB5A 5ICZB 1KTLB 1WAAA 3SE9H 4O2EB 3WHXB 2NYYC 4C56E 3NIFE 1JHLL 4J4PD 2JJWA 4XGZB 2BXZA 4HWEH 4XMPL 2XA3A 4PJDF 1MAML 5B38B 3MRLB 1BVLB 3ARWA 1X5JA 3F58L 3UYOD 1IQWH 2WM0A 3MRKA 4RMVA 1ZT4B 3QR2A 1XR9A 3OXSB 1IAKB 25C8H 4PJ5B 4JDVB 4UIKL 2B0SH 2DM4A 1NC2B 2FR4A 3FT2B 5CJ8A 3SE8H 3ZT5A 3Q5OA 4MB5A 1AXTH 5E03A 2XWBB 1T21B 3ZKND 1CBVH 1B0WA 1FZOA 3VGGA 1NEZG 3EYQC 4HULB 4Z7QE 4LGRB 2R0WL 2MWCA 1JI2A 3QXDB 3UYRL 4HS8H 5GRWA 3W9DB 1YEKH 4MNHA 1QO3B 1DQTA 4V1DB 3MXWL 1BVLA 3O9WC 2BVTA 4HC1L 1YJDC 4OCLC 4BZ1L 4N5EC 2DKMA 4EEEA 2IQAB 3VXMB 4G7YL 1FO0H 4GKSB 5E00B 1B90A 1ADQA 3G6AB 4YDVA 1PZUB 35C8L 1ZT4A 4J3SA 4Y5VB 3GZKA 1BBDH 2X9WA 3OXSA 1IAKA 3O2VL 2P1YA 4JDVA 1XIWB 1YQ2A 1MJ7L 2EEAA 1NC2A 1I7TB 1IVLA 2MKLC 1I8IA 4HQQL 4K8RL 1SYSB 4EI6B 2VLRE 3K7UA 1F8TL 1ZVSB 1KLGA 1OAZL 3CAFA 2PF6A 5ALBL 4YBLB 6FABL 3IVKB 1LDSA 1YA5A 3QUXD 2VIRA 2Z9TA 2EIZB 4UNUA 3NCJL 2VZ3A 4HS3A 4JFEE 1G0YR 5E9DA 3VXMA 2XZAL 3QO0B 4FXKB 5BV7H 4LBEB 2VL5B 3BKML 1JTPA 1Q9KB 3JTTA 2DQHH 1OGAE 2QSQA 5IW6A 3VGHA 2W07A 2XZQL 2AKRA 3PL6A 1YC8A 2ATPA 2P48B 1QEWB 4GQPH 4OLUL 3HZKA 5FYLL 1PD6A 2NY4D 4FZ8L 4NO0B 4Z0XB 2J8OA 4PRDA 5DA0B 4QRUB 3LEXA 4XWOC 1W72B 1C16A 3TYFB 4L9LB 3KPMB 4BKLA 3PV6B 3LSOA 5GRUH 1T2XA 4XCEA 3GKZA 3JUZA 3C87A 3T0EE 3ZE1F 4B7LA 5KVGH 5HY9A 2JK5B 1QFUL 1UEMA 5LBSH 3MOBL 1KB5B 4KROB 4ONGH 1EAPA 4JKWA 5E8PB 3DV6B 3F6IA 4EQ3A 3TV3H 3GMPA 4G8EA 3O45A 3G6JB 3KXFA 3QO0A 5C9KA 4JO4H 1F6AB 3IFOA 2VL5A 4PJEE 5HYQB 3H0TB 4DEPC 5DFTA 1T66D 1PEWA 3RY4A 3KPNB 2AV7B 1CGYA 4YE4L 1LO2H 5DJYA 5JO5B 4MAUL 1CS6A 5IFAL 5BOPA 1YYLL 5D93C 4DOHE 3BIBX 2P8MB 5C2BH 5E9DD 2OBGA 4X5LA 4NRYB 1AGFB 4NUJB 3O6LH 3VXUE 3PV6A 3X12A 4OLYL 2HVKA 1D7FA 3PL6D 5IFHL 4O2CB 2JJUA 1WT5A 3Q6GH 3PJSB 4GG8A 1WAAE 4MQSB 5E8PA 5KW9L 1WJ3A 5F9JB 1WZMA 2HT3D 4G8GB 4JN1L 2AJVL 3G6JA 5FO9B 2CR6A 3GB7B 4HV8B 3U0PA 2PW2A 1T0MB 1VENA 1LEIB 4XVSL 2W1NA 5FECB 2AV7A 4QXUL 1W2KT 2W65A 2RFXA 3A6CH 1N3NA 3WUWG 2PYEB 3WFHA 3C9NB 2VAAA 3KXFD 1H3PH 4B53A 4X99B 5BZDA 1OGTB 2QBWA 3OKDB 1O7SA 4Q6IC 4D0CA 5KVFH 2FJGB 4DFHA 3SKUD 4XHJD 1E6OL 4OGXL 2GYSA 3ARFB 5KN5B 4YK4C 1DSFL 4O51B 4NHUB 1E6JH 1JGVH 1CLCA 1RJCA 1YNLL 3BPNB 1BJ8A 1BJ1H 1TTFA 5ESVB 4BH7B 1SYVA 4GXVL 4U6XA 4PTTA 3MV9A 2YN3A 4HXAL 1J1OH 1OD7A 4JG0H 5F6IB 1M6OB 4A2LA 3GNML 1XH3B 2X1PA 1UGNA 5JXAH 1K4CB 5I1CL 5C0JB 2PYEA 3GSVA 4Z7UA 5KBNC 4PYGA 4X99A 5CZKA 1OGTA 2KPNA 4KK5C 4M5ZL 3HG1A 1AHWC 3TA3B 1JRHI 4FABL 4L8SB 2R15A 1IAOA 3BSZH 2GY5A 1YEJL 4GRWH 4YXHH 4M7JL 3PDDA 3TWCL 3M45A 1J11A 3ARFA 4I18B 4F7CA 3GO1H 2P5EB 1OAXL 3ZL4H 2EO9A 4JPKL 1ZANL 5E08H 1CN4A 4K9EH 3NFNB 5T3ZL 4PJ7B 5DJCB 2APFA 5FXCH 1CFQA 2R56H 3L5XH 5GGQL 3QQ4A 4YZFE 4NQSB 2E9WA 1FPTL 4PR5B 1M6OA 4APQC 5E9DE 1KJ2B 3VXME 1YN6B 3LZFH 1SHMA 3F7YB 5CZVL 1I9EA 3EOTL 3L5IA 3ESVF 1E4WL 4Q7DA 1BEYH 3JTSA 2NZ9D 4GFTB 4I8DA 5F9AC 5BS0A 5JA8B 2CK0H 4UT7L 3N1QC 3VE0A 1EO7A 4KHTH 1R3IL 2R4SL 3AUVA 5K9OA 5ICYB 4R3SB 1B2WL 4I18A 5GRVK 2G75A 3K81A 3T3MF 4XPTL 4JGMA 3VXNB 2I07B 4FQ2H 3V6OC 1DANU 5IVZA 4S1RL 3HG1D 3Q1SH 4JREB 1Q8MA 2OL3B 1U3HB 1VGEL 4ZFZB 5E8EA 1IAIM 1AGCA 5T3XH 2C3WA 4RA0C 2FWOB 2G2RB 1KCRL 1KJ2A 3KXFE 3JXAA 4JANB 1MCNA 1MCKA 4KK8C 4X6DF 3V5DA 4YHNA 3QWRD 5CEXA 3RWDA 3HS0A 5TDNB 2XTJD 5HHVL 3QUKB 2H41A 1G7JB 1Q9WA 4OT1L 5D1XA 2GSGA 1IQDB 1D6VL 3LKOA 1AC0A 3PGCB 4L3EA 4ZDHB 4QGYA 5ICYA 4NRXA 4TUJB 4X7DC 2ZJSL 4HIEA 3DUSB 2NW3A 3HMWH 5ETUA 2Z93B 5EDXA 4PY8I 2Z31C 4QHUA 3VXNA 3UJIL 1OTSC 4B41A 3TYGL 3P9MA 5BS0D 1S9WB 3DX8A 4YHMH 3LV3A 1MLCA 4M7KH 2XTLA 2YD7A 2OL3A 3O8XC 4WW1A 4ZFZA 3MGTB 2W0KA 3THML 1QP1A 5GS1C 1PAMA 4DZ8A 3KGRA 2WBJC 1MY5A 3G6JE 1P7QB 3VMNA 1LEKA 2G60H 3C5SB 5TDNA 4KRMB 3PABB 2UZXB 4TSCH 2CGRL 5HHXH 3LRGA 1HI6B 2SEBB 2X1WL 1UH2A 4GAYB 1DL7L 1A3LH 1NDMA 3V0AC 4OV6F 1G9MH 3F8UB 4F9LA 2YZ1A 1A02N 1BX2B 2MHAB 1MHHA 4QOKA 1S9WA 4XXDA 5I16B 3TIDB 5D1XD 2QSCH 1G9NL 3MGTA 4XCYB 3BZEA 4L3ED 5GJTL 4WV1B 3ZHDA 4Q97A 3TJHD 4MX7B 2C7UB 3QG7H 4GUPB 2E9BA 4OD1L 4D2NA 2YC1B 1VB9A 2BNQA 2NY0B 3MV9E 1FV1B 4UOJA 3TESA 4DN3L 1A6WH 2CLZB 3F7RA 4NZUL 3BJLA 3QJFA 3H3KA 5IT2H 1OAYL 2NY3D 3GRWA 5B4MD 2CDFB 2PTVA 2PYEE 4Z7UE 5C0AB 3KLSA 1JRHH 5F21B 4HIIA 5IVXF 2HRPH 1FH5H 1S7RA 3F5WB 3CVHB 1A7RL 4Z6AT 3HG1E 2MHAA 4UQ2B 4XC1L 1BF2A 3VI3F 1VHPA 1ZAGA 4P57B 3IAQA 1WBYA 3U7WL 2XY1A 3PWVB 1OL0A 1RUAL 3WIHH 2MQCA 5MEOB 1PKQB 3PIQA 4HUUB 2OQJB 3KWWB 5I75B 4LCYA 1F3RB 2VQUA 3AXLA 5IMLA 5EU6D 4M1GL 2XTJE 5D1QB 3VXOB 1KCUL 3PV7A 4QOKD 4F7PA 5TDPA 3HPJB 2Y6SD 1ES0B 5BXFB 2CLZA 1XGRA 4PRBA 4W6XB 3D0LB 5DXWA 3LQAL 4XNZB 4W6WB 3CIQA 3TBYA 1JHLH 1TDQA 1T0PB 2CDFA 1S7WB 3NIDF 4XHQA 4XMPH 2AXGB 1MAMH 2VLKA 3WDIA 2VWEC 5I8OL 1F6LL 1KULA 5BS0E 2VDOL 2Q3ZA 2BNQD 3F58H 4P4KC 4P57A 4PB0L 5CJOL 3UROR 4KY1L 3RKPA 3PWVA 4NQCD 3T09A 4HFWA 5MI0C 4MA8H 1D9KD 1KN4H 4BFIB 4UIKH 3CDCA 1XGPB 2OCFD 1Y6NR 1JPTL 1FZKA 2YBRA 3M17A 4KXZI 2DQTH 4NQXA 3QT2A 5M7QA 5EU3B 3UP1A 2R1XA 2Y23A 5E4EB 3CD4A 3D0LA 3RGVB 1M7XA 1JP5A 5IQ7H 1CFSB 3S35X 3FFDA 2R0WH 3EDEA 1JZ7A 2NY7L 1BJ1J 3UYRH 4S1DC 3C6LC 1N6VA 3MXWH 1A1MA 2VKWA 5I1DB 4HC1H 3Q2CA 4P3DB 4BZ1H 1CDBA 1T7VA 4KRNA 5ISZD 4KJWD 4L4JA 2DOCA 2XA8L 2FD6H 2CLVA 4L3EE 2ZUYA 1GGUA 2DQCH 35C8H 2FO4B 5DHYB 5D72L 4BFIA 1WIUA 3ULUD 1ED3A 3O2VH 4RX4A 1XGPA 2VLKD 3IB4A 1MJ7H 3BZFB 4HS6A 1JZ8A 4UDTA 1JF1B 4HQQH 2NY1B 5DD1H 3OBAA 4GAFB 5EU3A 2BVPA 2WWKT 2XACC 1F8TH 3B4NA 4LEOA 4KUCD 1CE6B 1ZEAL 5BJTB 4ZNEA 1OAZH 3Q5YA 1JN6A 2CXGA 5DHXB 1CFSA 3LKRB 5ALBH 6FABH 5EIVA 1U8HB 4DKAA 1S78D 2AEQL 5CGYC 2BFVL 3V9FA 3NCJH 3X14B 4ORGA 4OUOA 4WW2C 4WI9A 2XZAH 3MNZB 3BKMH 3V4VL 5C92A 1FG2A 5DHYA 2JCCB 2V7NA 2XZQH 3SGKC 2IADB 1P7KB 2WNGA 5GIRB 4OLUH 5H37H 3SO3C 5FGCE 5FYLH 4U1GC 2YD8A 3RGHA 4CN6A 1TMCB 3PG2A 5EUOB 1KIQA 4S0SD 2GAZA 1CE6A 4Y4KC 4YHPB 5KSVA 3EYOA 5D7LB 3BJ91 1FIGL 2C4FT 2BNQE 3MOBH 4RQQA 5IB2B 5C07A 3ULSB 1B9ZA 3X14A 1ZLWH 4OD3L 4R7DB 1JUFA 3LN4B 4QHKJ 5E6IC 2JCCA 3RZWA 4GT7A 1HE7A 2EXWC 2N4IA 4P23C 5IWLC 1CQKA 1JGEB 5E6YA 1HZHL 4YE4H 3TCLB 4CRPA 2UWEF 4MAUH 4IIQB 3IDYB 5J12B 4GW1B 1YYLH 4FRWA 5IHLB 5FKAB 4N0YH 4R4BB 3HFMH 4P49A 5EUOA 5KOMC 1AIFA 3MLWL 1F4XH 4DKDC 5D2NA 4OLYH 5HHPB 4NT6B 2LFGA 5IFHH 3EJYD 3NN8A 1QHOA 5L88L 1ZA3B 3MLXL 4PJ8D 4OKVB 5IB2A 5IHUL 2A6KA 1JE6A 3QCVL 3X3GL 1JGDB 3ULSA 1CG9B 2OMBA 3WBDA 5KW9H 1I1RA 3UTQB 1R6VA 3AFLA 3L7FB 4JN1H 2AJVH 4R7DA 3KJ4B 4IRJB 4N0FB 4Y5YA 1BQHA 1A8JH 1NBVL 3SGJA 4NP4L 3ULUE 3RZCB 5IG7A 3WE6A 4ZFGL 4FA8A 4CMHB 4XVSH 1UM5L 4FQHB 1BFOA 2PCPB 4QXUH 1S7VA 4WWKA 4CU7A 4PJXF 3TCLA 2ZUWA 3FRUA 3BGFC 3D1MC 4EUPB 5C07D 1U3ZA 5FKAA 1AGEA 3LVEA 4ZFFB 4KXZH 3HUJB 4PTUB 3HI1B 4MS8C 3BT2L 1G84A 5HHPA 3T0XA 1JYVA 1ZHBA 2NXYC 4FNLL 3T0WA 2Y5EA 1E6OH 3WJLA 4OGXH 3W0WD 3BYTA 1CG9A 1DSFH 2CO7B 5IMOB 3TO4C 2VERN 1MCLA 4Z7WB 5J9PB 1Z3GL 2IPUK 1YNLH 4LMQE 4PLOB 4M61B 4PGJA 4P9HH 2DLIA 3WDJA 2QHLA 4HXAH 1NFIB 3S4SG 2PCPA 2DLGA 3GNMH 2XZCL 4MD0B 5F89A 4EUPA 4YHYB 2R1WA 4QTHB 3DX9A 5I1CH 5IV2A 2XOTA 1BP3B 3WV0A 3WXWH 4AIOA 3MNWB 4M5ZH 4LPVA 3MA7B 1CDJA 4BM7A 4FABH 1IGTB 3FFCB 5HJ3A 4WWKD 3BDXA 5B8CA 1YEJH 4K7PL 2WLZA 4M7JH 1DQMH 3TWCH 2ADIB 4UQ3B 1S5HB 5LAXB 2J8UB 4YC2C 1PLGL 4M7LH 3S5LA 1OAXH 4AEEA 3MMEB 4ZNEE 2NTFB 1J05B 2EDRA 1KCKA 4M61A 2DKUA 1PDKA 1KPVB 1GOFA 1YPZB 5T3ZH 4JVPA 3QUZB 5D6CB 1NFIA 3CCHB 5DWUL 5GGQH 5KG9A 2V17L 4QNPF 5DQDL 4MD0A 5GGVY 3P11L 5FKPB 3ZE0E 4BUGA 5CZVH 5EFIB 5IKCB 2ZUSA 3ARQA 3OV6A 4WWID 1E4WH 1KLUA 3HI6H 2IH1A 1I1AC 4UT7H 4PGBB 4H0IA 2BHYA 4HBCL 5JPMB 1KPUB 2R4SH 3W39B 2B7DT 3MROB 3LD8B 4UQ3A 1PQZB 1B2WH 1DTUA 5CFHA 3QEQB 4XPTH 4XCNA 3NH7H 4S1RH 1EBAA 3TBSA 4NSKA 3VFWA 1LO0L 4IJ3B 1AFVL 2ATKB 5C07E 4S10A 1XT5A 4EJ1C 1KCRH 3G08A 2J5LB 2EKSA 1JNNL 3QIBB 3U36A 3FT3B 2P8LA 5IROA 4DN4L 2JCCE 3WLWC 4WHDA 2VLMD 4JZJB 3IETB 3NZ8A 1T1WA 5DHVH 2R0ZL 2HG5A 1D6VH 3MNVB 1RZ7L 4JHAL 4ODUB 4Z95L 1FZJB 5EUOE 3MFGB 1M05B 5D2NE 2VSCA 4GQ9L 5GGRB 3VGAB 2BERA 3UJIH 1UM6L 3TYGH 1QG3A 3LS5L 1KJVB 1BIIB 3V0VB 1UQSB 3V52L 3BD4A 5C70A 2IFGA 1OD9A 1SEBB 2H3NB 5EOTA 5TJWK 3THMH 3VD4A 3H7LA 2GT9B 4K8RD 5GISL 1RD6A 1HH9B 4NNYB 1FL3B 1RJZB 1JNHA 1LE5B 4N68A 3VFRA 2VE6B 1EAJA 4JZJA 3IETA 4ODBD 5AYUL 4ZD3L 1W0WB 4XI5D 2DQFB 5ADPL 2BSSB 1OW0C 5EWIL 4Z18A 3MRHB 1DL7H 3VFOA 4ODUA 4NDMA 4ZYKB 1F2XK 3GSNB 3QEUB 5FYKU 1CICA 3HZYB 5GGRA 1KG0B 5I1HH 1NDGB 3ECBA 4R7NB 4DWHA 5FOBB 1G9NH 1PG7W 5FYLD 4HKXB 1BQUA 2GT9A 5DI8A 1HKLH 3E1F1 1BZ7B 2VO5A 1KCVL 4OFYD 1CFTA 4OD1H 4WI8A 5DJ2B 1AP2B 1U3JA 3RWJA 1ULVA 2GJ6B 2G5BB 1LE5A 4OCYH 2VE6A 5FUCE 1HWHB 4DN3H 2K7PA 2X4NB 4NZUH 3H3PL 5TQ2L 3RWGA 2DQFA 1OAYH 4K55A 3O6FB 1ZA6A 4Q58C 4F37F 1NMCB 3MRHA 3HZVA 3QZWA 3O3DA 4Y4HD 3TZVB 4WU7A 4RFEB 3IS0X 1A7RH 3HZYA 4M6OH 1KG0A 1I4FA 4MXQD 4HUWB 3GDBA 4OZ4A 2ERJC 2RCSL 3U7WH 1RUAH 1XF1A 1KT2B 1MWAB 2EDJA 5DFVD 4LP5A 5DTFB 3QHTC 7CGTA 1CICD 1KCUH 2B1HL 4WFGD 4YDJA 4JE4B 2GJ6A 4NKQB 1A5FL 2X4NA 1Q38A 2DDQL 1T89C 3FRPA 2YXFA 5KVEL 3W81A 3VGBA 1QZ1A 5I8OH 3H9HB 4K7PX 2X4TA 1XGTA 2VDOH 4F3FA 1KTKE 4HWBH 1MCEA 4PB0H 1X7QB 5CJOH 2JJTA 1S7TA 3K4AA 2A77L 5IF0A 5HYIA 1YEDA 2HA1A 2Q1EA 4C4KO 4CL7A 3UBXG 4X4YB 5EZJA 3DURB 4I9WD 4OLVH 3GGWB 2BXYA 1BOYA 3SQBA 4WI7A 5GJSL 1IILE 3IDNB 1N8ZB 3TBVA 5EZIL 2V9QA 5C0IB 5I6XB 2VLJB 3BGAA 3B6SA 5EO0A 5A3IC 3HAEA 5TQ0L 3NFSL 4RAUB 2NY7H 5H94A 3ULVL 2D7OA 3EJZD 2O5ZL 2HKHL 2PW1B 3PWNB 4QYOB 1RZGA 1FSKB 4BFEA 4OCNC 5D5MB 4QRSB 3HCVA 4PRAA 5IBTH 4X5WA 1I9JH 3HE7B 2APVA 3DURA 5JA9A 1VFOA 5ESQB 1GZQB 2VDML 1DJSA 1MCFA 1X5IA 2DRUA 5LKNA 5C0IA 1ZEAH 5HYFA 2VLJA 1C7TA 3ZTNL 3VDBA 2D4FA 1HCVA 2FX7H 1BD2B 4YPGB 1SEQL 3MBEC 3LPWA 1OAUL 3DHJA 4N9GB 2AEQH 3PWNA 4ZUTA 3RKDD 4OZGA 3VXQA 1HILB 3IRZA 5T3ZD 2VITA 4JM2C 3VDCA 1GHFL 2B39A 3CPLB 2F8XC 5E8NB 3ARGC 2CMRL 3OKKA 2EE2A 2PYFB 4QRSA 1ITCA 2EO1A 2X4SB 4K3JH 4F9PA 3JV6B 4JGJA 4WHYG 5SX5K 2WIIA 1KB5H 3HNVH 3LKPB 5JLZA 3RQ3A 1MJJA 3QDJD 5H35A 5HDLA 4OCSL 1I8LA 1UH4A 2M8XA 3D18B 4PLJC 2GCYA 3JSSA 2BRRL 2BMKB 2B5IB 1BD2A 1WQVT 3B3IA 5J13C 2GK0A 1FIGH 4WTZG 3P4MB 4OCRL 3CDGB 2A6IA 3SDCC 1HILA 3INUL 3VJ6A 1MFDL 2ITCB 5EZOL 3CPLA 4OD3H 4H5SB 5E8NA 3BP6B 2VQTA 3OJVC 1U2CA 3RWFA 1OLZA 4FTVD 5J57B 1B4JL 4I9WE 5AWNL 5CJXA 3CFJA 1E4KA 1JNLL 1A1NB 3LKPA 1QLFB 4G8IA 5DSCB 2DB8A 3ARSA 3MRMA 2VZTA 1EEYA 5I1JL 3MLWH 5GSRA 3B9KC 1HDMA 1LNUA 3KPLB 4ERSL 5E2WL 4PG2A 5GZOD 1U91A 2GJ6E 5IHUH 3P4MA 3GIVA 3QCVH 3B2UC 3X3GH 4Y0GA 5FO8A 1I3VA 5JQ6L 1KJMB 1NBVH 1AQKL 1JZ2A 4NP4H 4AYFA 2E7HA 4ZFGH 1I85A 1PYWB 4AG4L 1JZ6A 1UM5H 1CT8B 4WI5A 2KUTA 3Q3GB 5DJ0B 4H88L 1HSAB 1MHCB 5DSCA 1T1XB 5F6HJ 4QWWC 1RZ8A 3MFFA 3NTCL 4LKXB 4KJYB 2DI7A 2X6MA 4Z77B 2NTSP 5FV2A 4HMDA 5E8OB 3AREA 4FNLH 1I9RL 1ORSA 1YY9C 1R5VB 4H25A 4MQXD 5ILTL 3T1FA 3SKNA 1PBYA 3RWHB 1WBZB 2JJSC 5DQJA 1Q1JL 1Z3GH 1KJMA 3ARUA 4DUVA 5LG1A 2M2DA 2IAMC 2PR4L 3SE3A 5KJRL 1QRNA 3VWJB 1PYWA 3KPPB 3MLTB 5C0DA 4OIAA 2XZCH 2F5BH 2GW5A 1J0YA 3VFPB 1T1XA 3E6FA 2YWYA 4PJDA 4LKXA 5DJAB 3KR3L 3MRIB 4LHUG 2E5EA 5DRZB 3AS3A 1CI5A 3QIWB 5AAMA 4Q0XL 4K7PH 1R5VA 4I3GA 2H2PD 2V7HB 3DIFB 3VGEA 5DD6A 2VLJE 3PDGA 4PUBH 4RGMC 4J8RA 1UZ6F 2CKNA 4ZPTA 1PX4A 3BGMB 3FB6B 3U9UB 4ELKA 2C1PB 1FORL 5T33L 2VJXA 2OJZL 3Q0HA 1JWMA 1ZT7A 4JFFA 3ARED 3KPPA 3L5WA 5DWUH 4OZGE 1BQLH 1NMBL 2V17H 4XAWL 1PVHA 5DQDH 1RVFL 2ADGA 3DUUB 4XPFL 3P11H 3BEWA 5J8OA 2XV6B 4LSVL 4FQXB 1H8SA 1QRND 4L3CB 4Q9BA 3SCMB 5DD0L 1X6NA 3MRRA 3VXPA 1A4KB 1E4JA 3GBNL 2XWTA 3QIWA 3WS3B 4KJQC 4HBCH 1IC5L 1T03L 5FYKE 5FAAA 1IC4L 1ZS8B 2HFFA 4YBHA 5CIPA 4QY8B 2C4FU 2YMXH 1CVSC 4TNVK 4Y5XB 1X4XA 1BD2E 4G7VL 4XVUD 2LTQC 4DQOL 2XXMB 5I1EL 1YN7A 4LPTA 4X9FA 1AFVH 4F7EA 3OKMB 3NFPA 4NBZB 5HYSB 2AK1L 4HGWB 1MFBL 2C3HA 3ZTJG 1T22B 2HFGH 4X8JB 2ARWA 4DN4H 5IVOA 3NPSB 3KPRB 1CFBA 4O5LH 2M1KA 3DVIA 3WN5C 3SPVA 5JHLL 3SGEI 4GBXA 4L3CA 2R0ZH 3RTQC 4JFFD 3MACH 2BVEA 3FO2B 3OR6B 1JWUA 1G6RB 5JXED 2Y72A 3I9GL 1WFNA 3BRFA 2HTLD 3C6SA 4JHAH 3Q5TA 4Z95H 1FC1A 1K2DA 2A6JA 1HYSD 1B6UA 4GQ9H 1G0DA 4Y5XA 1UM6H 3TJEL 5HDBF 3MLYL 4Y8AA 4JKLA 3LS5H 3V52H 2ZNXA 1P4BH 5CAYB 3VCLA 5EOQL 3KLHD 1IAII 1NAKH 1H8OA 4WFFD 3B43A 1T4KB 5GISH 1NGXB 2YR3A 4ZO8A 1KIPB 4TTDD 8FABB 4JFYA 1T1YB 1T22A 1VFBA 4X8JA 2QKIB 3FL7A 5EULV 3KPRA 5CD5C 3EZJB 1OP5H 5TE7L 4GH7B 4OI9A 5AYUH 2YPLB 1FNGA 5K9KB 1NCNA 3OR6A 5EWIH 4QCIA 5C0BD 3MJ9A 3QIUB 1G7QB 5J11B 2BOCB 5JW4Q 3BP7A 4ETYA 2DBLL 1V7NL 3O11B 2H2SD 4GBXD 5EA0L 5FB8A 1MLBB 1K4DA 5F88B 5IBUB 2YRZA 4LLYB 4U1LB 3QUXC 5C08B 4A2MA 3PWPA 3OPZL 4JM2F 1LHZA 3MRBB 1T83A 3QDHA 3LAFA 2DL9A 5C6PB 5I8CA 1F2QA 3VU2A 3CVHH 1QRNE 4P46B 4F57L 3LN5B 2RR3A 5I2IB 1IGJB 5E1HB 2YPLA 5F9WB 3H3PH 5TQ2H 3OR7B 2BHZA 4J23A 4ZAKB 2BOBA 1AJ7L 1E0OB 1MWAL 2VDQL 3QIUA 4PJDE 1I1YB 2HYMA 2CDEB 3SDDD 1AD0B 3O11A 4TYUA 5K93A 2RCSH 4L4VA 1RFDL 2NY2C 1LD9B 4PJ9B 4U1LA 4TVSa 1J1PL 2W0FB 2K7QA 3U82B 4JPVH 3GJFA 4BYHA 3OWEA 2AQ3A 2R2EA 2VZVA 3VFNB 2B1HH 1JHTB 1QFOA 4HK0A 2EXYD 5GRZA 4JFFE 1MCSA 1TCMA 4LLDA 2DDQH 1S7QA 5A40E 5KVEH 2ZCKL 3U0TB 4ALAL 2BVUA 4LLMA 3C08L 3K4DA 2J6EL 3WFBL 4C58B 4KKBD 3ME0A 3VFTA 5I8EA 3TH4T 3QFDB 2NLJB 1T1ZB 2IALB 2UV3A 4QEGA 4U31A 2LAAA 2ICES 1UCTA 4NWTL 3MJ7B 4NNPH 3L3HA 4HMCA 2HT3C 3OZ9L 4Q6YA 5E94B 1KYOJ 3MGOB 4PRPA 1F90H 5B38G 5DRWB 4FXLA 5GJSH 1BJMA 1R5WB 4FFWD 3FO0L 4L4VD 3WHE0 5IJVA 3ZKMC 4J3WA 4ORZC 4IMKA 5EZIH 5BVJA 5CEZL 4HJ0C 2DYPB 5AD0A 3E3QE 5TQ0H 3SGEH 4NN5B 5C0EA 3ULVH 4C83B 3V4UL 2VKXA 2ICWB 5LQBL 4IOIB 4QRRB 2LAGB 5JPNB 1KYOK 5KAQG 4X83A 2YPVH 1GH7A 1A9EB 2V9RA 1DUZB 3K46A 1IGFL 4N8PA 1QKZL 5D7KE 3CFBB 3QFDA 4X6DB 4R97C 2IFFL 5DRNA 3ARBB 4IRSA 5BOZG 2WMPA 5CJQH 3SKMB 5C7XL 4W4OC 1IAIH 1WZ1L 4ODVH 4G43A 4P5KB 2AQ2A 4PV8B 2BDNL 4R0LA 2VDMH 1F4WH 2XNAB 3KPSB 2PXYC 1C1EL 1TXKA 2DYPA 3HMXA 1TJHL 3STZA 3ZE1E 5ID1A 1OAUH 3QH3B 3KPRE 2ICWA 4PRPD 4QHNB 4Z5RB 1A9EA 1W0YT 4GRLB 5DC9B 1GHFH 1UWXH 2DQDH 5GRYA 1G7MA 5ICXB 1RZFL 2MJWA 2CMRH 4ZUVA 3QXVA 3DO7A 2AEIT 4X6DA 4WUKL 1S5IL 5ACMA 4OJFL 1TJGH 5BO1L 3D69A 5J6GB 4KDTC 5I8KL 2KDGA 1A6ZA 5IMMA 3U30B 4N1CA 1CGTA 2BVYA 4EI5B 1O0VA 4IRSD 3SDAA 3PWPE 1XF4A 3GMOA 3MOAL 4NYLB 3G04A 4XMLL 1UEYA 2EYSB 1WBXB 3STLA 2CIKA 4UMGA 4P2CG 5EBGA 3T04D 2Q6WB 1XF2B 4UINL 4WJ5B 3T1WA 1U6AL 1M1SA 4OCRH 3EOBB 4R90L 5DVNA 2NZ9C 5CEYB 2YPLE 3O9WA 1MFDH 2COQA 3PHOB 1EX0A 5SWZB 2BNUA 4O4YL 5EBMB 1FYTA 3WD5H 4JO1L 4KTDL 4J1UB 2I9LB 2DS4A 3N1GC 3P2TA 2YA0A 1KIUA 1B4JH 4LVOC 5AWNH 5J1AB 4GW4B 1NMAL 1JNLH 1K8IB 5L7XH 1U8JB 3VFSB 4WUUD 4OFKA 1XGUB 2Z35A 4LLWB 5I1JH 4U7MA 1UWGL 3O4LB 4OF8A 3MV11 4WRLA 1DQLH 1A64A 2YXMA 4ERSH 1Q94B 2DTML 3HR5A 1DVFC 4OGAD 1CLOL 5JTWA 3BW9B 1SJHB 2XTJC 4D8PA 3VA2C 4LSDA 1X5YA 4MVBD 3PHOA 43C9B 3TNMA 4BK4A 4UTAL 3SDAD 3ZKSD 1AQKH 3EYQD 5F1IA 4DEPB 4NFBA 4LSTH 4PJGF 2R2CA 5ELIA 2Y5TA 4AG4H 1B0GB 4QXWA 5IHBA 5KSAD 1MEXL 3OQ3B 4GW4A 2WLYA 1XCQA