2BWDA

Atomic resolution structure of achromobacter cycloclastes cu nitrite reductase with endogenously bound nitrite and no
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA02
1AS6A 1L9TA 2XU9A 3T6WA 3X1NA 1OE3A 8PAZA 3QJTB 4AKPA 3QJVB 3IEAA 1W8EA 1NPJA 4HCFA 5F7AA 4AKQA 2CUAA 2LLNA 5I6NA 1L9RA 1HAUA 2FJSA 3WKQA 4KNUA 2XUWA 3FSAA 4HZ1A 3AG4B 4GP5B 4X4KA 1WS8A 3NSCA 1CYXA 3EH4B 1JZEA 4E9TA 1N70A 4E9VA 1ID2A 4QLWA 1GS6X 2XX1A 4GP8B 3KW7A 5B3SB 1AQ8A 1KDJA 4NB7A 1NTDA 2CAKA 3NP4A 2YAEA 1A4CA 2GIMA 1ASQA 4GP4B 4HAKA 3SBPA 3GXUB 3PAVA 3ABGA 1AAJA 4DP8X 4FAAB 2X88A 3AG2B 2FQFA 2PPEA 2X87A 4DP7X 2TSBA 1GY2A 3SBQA 4Q8BA 2PPDA 1QNIA 2VW7A 1DZ0A 1GS8A 1R1CA 3T9WA 2VN3A 4UF7C 4MFHA 4DPCX 2XV3A 2BWDA 3BVDB 2AVFA 1PCSA 1ZIAA 4E9SA 1M57B 3EH3B 3TA4D 2DY2A 2MRYA 1JZHA 4KNTA 2EIJB 5LDUA 2I85A 3QJRB 4HHWA 2YXVA 4NERA 2VSKB 5AFAA 1BEXA 3CVDA 2ZOOA 1F56A 2IH9A 2Y69B 4YSRA 1AIZA 3AZUA 1JERA 2OJ1A 3WI9A 1L9OA 3NT0A 2PP7A 3EH5B 4RH4A 1PF3A 3V9CA 3IN2A 3NJGA 4KO5A 3AY2A 2QPDB 2UX7A 3S8FB 2UXTA 1AS8A 1FFTB 3DKHA 1XB6A 3WNIA 2XX0A 1ASOA 1CC3A 3FSVA 1AZNA 3DIVA 1GSKA 3FSZA 1OE2A 2IWEA 2FNWA 2HX8A 3CDZB 5D4HA 5I28A 1KDIA 1SFHA 3GDCA 4E9QA 3OMNB 4HIPA 2XXGA 4BWWA 3NJJA 4YVNA 2A3TA 1IBYA 1FWXA 1NWPA 5PCYA 6PCYA 1A3ZA 4QKTA 3S3DB 4YSTA 3MX0B 5I6KA 3FU8A 3NJKA 5I6MA 2HRGA 2FQGA 3H4FA 4CSZA 4YSPA 3ABLB 5PAZA 3NJFA 5D4JA 1AZUA 1J5DA 4UANA 1OF0A 2H47C 3FT0A 3OQRA 2P80A 2IWKA 2VM3A 4G71B 2R7EB 1IKOP 3NJIA 1GR7A 3X1GA 4TXVB 3CG8A 1KCBA 1V10A 2FQEA 3G5WA 3ZIYA 2BP0B 3ZX1A 3QJSB 3OM3B 4AKOA 1WA2X 4E9YA 4PCYA 1SJMA 3OMIB 3PPSA 1TEGA 1X9RA 2FWLB 2YAHA 2QDVA 2WSDA 3L45A 1GW0A 4N8UA 1OCZB 1KYAA 4YSDA 2H5UA 2QPEB 1JVLA 1DYZA 2ZWNA 2J56A 2BWIA 2XWZA 4KOBA 2VSMB 4KO6A 3V9EA 1SDDA 1ILUA 4HALA 1EZLA 1BYPA 1HFUA 1JVOA 2B3IA 3ABMB 4F2EA 2J5WA 1ZDSA 1AR1B 1T5KA 2FT6A 4N4YB 2J57A 1NIBA 2IDUA 2IWFA 2XLLA 3QJQB 4DP0X 1OE1A 1L9SA 3TU6A 1BQ5A 1SFDA 3SQRA 2AANA 3S8GB 4DPAX 1ADWA 4HCGA 1JZGA 3NJLA 2ZONA 1NWOA 1M56B 1NZRA 5F7BA 3CVBA 1WA1X 1E5YA 2TSAA 2PPAA 1GY1A 2YXWA 3S3BB 1WS7A 3PAZA 3OMAB 7PAZA 4YSQA 2HX7A 1OCCB 3NP3A 4W1TA 1L9PA 1ZDQA 4AX3A 1A65A 2CJ3A 1BAWA 1SF3A 3FPXA 2HX9A 2YAPA 2HXAA 1AZBA 5I6LA 1PLCA 2PCFA 2YAOA 3QPKA 1RKRA 3UABA 4DP1X 1J5CA 4YSCA 1KCWA 4L0PB 2BW4A 3FQYA 3PXLA 1V55B 5I5JA 4HHGA 1JZFA 4KO9A 3ASNB 3NSFA 3ZDWA 3ASOB 2BP8B 5B1KA 4A67A 7PCYA 1RZQA 1PZBA 1XB8A 3UACA 4YL4A 1A4BA 2XYBA 1OCRB 5B1BB 2MTAA 2EINB 3EF4A 1J9TA 4M3HA 1NINA 1NIAA 3ERXA 3S3CB 1ASPA 2H3XC 2HZHA 3GYRA 4EF3A 4GYBA 2FT8A 3N55A 3TBBA 3U25A 1SHWA 2VM4A 1PZAA 2YAQA 4F7KA 1SF5A 3FU7B 4ZK8A 1L9QA 3TASA 4PAZA 3CVCA 2XV2A 1NPNA 2ZXWB 4G7QB 3WG7B 5ANHA 4W9ZA 2CCWA 1GS7A 3SBRA 1BXVA 1QHQA 5B7MA 2PP9A 2CBPA 2BZCA 1ILSA 2GB2A 5TK2A 5B1JA 1XB3A 2DWSA 4A66A 2WO2B 1NIEA 3X1BA 1SHXA 1TU2A 4GY4A 1HAWA 4DP9X 4E9XA 1PLBA 4GXFA 2OCCB 3TBCA 1CYWA 3PLYA 3NJNA 1X9UA 1AG6A 1ZIBA 3JT2A 3QQXA 2PCYA 5FC9A 4JKNA 2BP0A 1V54B 3WKPA 3T6XA 1AZCA 1BYOA 2Q5BA 1B3IA 2BZ7A 1JXGA 1RCYA 2QT6A 9PCYA 1TEFA 2GC7C 2DYSB 2I7SA 3FU9A 2GHZA 2PPFA 3FQ1A 3AG3B 3WIAA 2RACA 4KO7A 3ZBMA 1KBVA 5I6OA 4KNSA 4BXVA 1XMEB 4FA7B 4NAJA 1M9WA 2IDSA 1QLEB 1MZZA 2UXVA 2BHFA 1MG3C 5I5IA 1ZPUA 1BQRA 1UATA 2YARA 3H4HA 1JXDA 2NRDA 3PCYA 2FTAA 1AS7A 4M4RB 4DP6X 3FYEB 3UAEA 4YVUA 1E67A 1PMYA 4AZUA 1AG0A 2B08A 2Y1AA 3OD3A 2XV0A 1PNCA 2J55A 1PNDA 1CUOA 1AANA 1KV7A 3FYIB 4BDVB 3NSYA 3FQ2A 1PY0A 1E5ZA 1SDDB 4YSAA 4WTQA 5TK4A 2EILB 2IDQA 2FT7A 3HEIB 3X2QB 2VMJA 1KBWA 2E86A 3HB3B 3QJUB 1W6LA 4A2HA 4BWUA 1MZYA 2IDTA 2IAAC 2DWTA 5B7EA 1AZRA 4DPBX 4JHVA 2YAFA 4G70B 4A2EA 1IBZA 1SNRA 2W88A 5IY5B 3FU7A 1IC0A 5E9NA 5I26A 2BP8A 1JOIA 1JXFA 3C75A 3NJHA 4YSEA 1BQKA 2Q9OA 4AI7A 2GI0A 4BDVA 1URIA 4JHUA 4BWTA 4UAHA 2QDWA 3FS9A 2VW6A 5D4IA 5AZUA 2HRHA 1A4AA 4CSPA 3JTBA 3FSWA 4HCIA 1E30A 4G72B 5A7EA 3IN0A 2WO3B 1J9SA 1PZCA 6PAZA 2CALA 2XXFA 1E65A 2I7OA 1A8ZA 1ETJA 3CDZA 4KOCA 3NYKA 1AOZA 4G7SB 1OCOB 2BW5A 1J9RA 3DTUB 1JZJA 3BQVA 1KGYE 2BO0A 2DYRB 1VLXA 4K9JA 4P5RA 1OOWA 5I5MA 2YQBA 3NJMA 4BXSV 3UADA 3NSDA 1PLAA 4A2FA 2PPCA 2DV6A 2UXGA 2PP8A 5B1JC 2PLTA 2UXFA 3X1FA 3PAUA 1MG2C 1ET7A 5I6PA 1EHKB 1ET5A 2N0MA 2UX6A 1GYCA 1NDTA 4BK5C 4E9RA 2GSMB 3IE9A 3ABKB 3EHBB 1W6WA 3T6VA 3X1EA 1PAZA 1IUZA 1NIDA 2HLEB 1RZPA 2W8CA 2AZAA 3AW5A 2YAMA 3D12B 1CURA 4YSSA 3IBOA 4F2FA 2AZUA 4DP2X 2JFCA 2EIKB 1WA0X 4A2GA 2XVBA 3RYMA 2AFNA 3KW8A 3MBWB 4E9WA 4DP4X 5B7FA 3T6ZA 3T71A 1NICA 4WKXA 1TKWA 3UGEA 4YSOA 2EIMB 1ZV2A 1MDAA 2GC4C 1FA4A 2P80D 5AKRA 3N2JA 2GBAA 1J9QA 1ET8A 4Q89A 3UAAA 4A68A 1BXUA 2JXMA 2JKWA 3WNJA 1OV8A 1BXAA 1JZIA 1N68A 2IDFA 2OV0A 1NIFA 2R7EA 2VW4A 3AG1B 3CZUB 1YLBB 5EHFA 1WAEA 1I53A 3H56A 5B1AB 4ENZA 2IH8A 2FQDA 3FPYA 4YSUA 4A2DA 4G7RB 1AACA 4DP5X 4P5SA
chains in the Genus database with same CATH superfamily
3MRFA 5KYUB 3LIZL 4G8FA 4V2CB 5DVMA 3T6WA 1CL7H 1G0YR 3OL2A 3W0WA 1A3RL 3QJTB 1U30A 2EC9U 2C1OB 4C83A 3ROOB 5I0VA 2IPKA 3BJ91 3PGFL 1HEZA 4YQXH 3RUGE 4OGXL 5F9OL 4D8PA 1PY9A 4J7RA 1VB9A 3VTMA 4JFFD 4HC1A 5ERWA 2JKTM 3RI5F 5TE6H 1A6UH 1WH0A 3ROLA 1TTGA 3IDIB 4FEMA 4HOXA 3ESOA 5GGVY 3IGAA 2VR6A 4L9LB 4L8DB 3LQAL 2AKRA 3E3QE 4ZXBC 3T3ME 3DSFL 3VB8A 4LL9A 4Y5XB 3GMMB 5ILTH 1URZA 4OLUL 2N4IA 5JOPD 3FO0L 4PJIA 2Q8AL 3UBXI 2NY3B 3QH3A 1L7TH 3Q8AA 4GP4B 3WEBA 4ZFGL 3HOGA 3MRHA 5DUBA 4WCYH 1QLFB 4HMCA 1RFDH 4KZDH 4V33A 4TM9A 4RDQF 3BJLA 4N2IA 1NMAH 2Y07H 3ZGHA 1G7IA 1EERB 1UJTA 4AGMA 5IIEA 3MUHL 3IKCB 5DYOB 4P23B 5F7EL 4Z78B 1C16B 1R1CA 4QCIA 4K73A 3DX8B 4IBZA 3P3RA 1RMFL 1KGXA 1NGYB 3W57A 1H3VA 1MHEB 2BWDA 4IDJL 3BP5B 3CBRA 4YHKL 4XPGH 1WE5A 1S9XA 4HBQA 1TZGH 3FHEA 4MTMA 4NYLA 4P2OA 4Z7OB 4NNPH 4HF5L 3GBDA 1BEXA 3T09A 3GSNL 4MSWB 1JV5B 2X4OB 1F56A 3QC5X 1WUNT 4RISL 3BZEA 1BP3B 3GK8L 4BKLA 5FB8B 2AXGA 4J8RA 3ZTCC 1RP9A 1IFRA 1NFDA 2A4EA 1A7BA 4HPHA 3PXHA 1NCTA 4NM4L 2R2BB 1KG0A 3A6BL 1HOCA 1XAKA 4ISVB 3WJLC 4FQPA 1KLGB 4OLWL 1ZSHA 2V8MA 2G5BB 2ZUWA 3CPLA 2IANA 3Q2WA 4QYOB 1O7DC 1CFVH 3GI8H 2YQ3A 4LPVA 3VXTB 4YSTA 1F11B 5KVDL 2VC2B 1ZVNA 5K9QI 3NJKA 3KLDA 4OTXL 3GXIA 3TJHD 3W9EB 2Z0UA 3FONB 4X5LA 1EDQA 5AL8A 3NJFA 4LHJB 2BNQB 4RFEA 2D03H 3FBQA 1AZUA 4PJFB 4FQXD 1MFCH 2BNQE 1BYNA 2W0FB 4N8CH 5HDBF 2WYZA 4A7QA 2DPKA 2FD6H 1JSYA 3EOBA 3P73A 3DSNA 1MVYA 3VE0A 2VAAA 1KB3A 3LZQA 3NEOA 3GHEL 4TXVB 5DEGA 3HNTH 2OJZL 3CG8A 5AVYB 1R3JA 1V10A 4OIAA 1XCTB 5DD1L 1RZKH 3LKNA 3UJIL 1JPTL 2NT0A 1EJFA 2ZSVA 4QJ3B 4UQ2B 3KPOA 4X9HA 1X9RA 4HK0B 4Q7DA 1ZVSB 4YE4L 3RGVB 2AC0A 3GTVA 2NTFB 2WSDA 4L3CA 5T1KD 4F2ME 4JFPA 2H6PB 1S78D 4YSDA 2H5UA 4OZFA 1YAIA 3CFBB 4EBQL 4L3FA 5D1XE 2PKDA 3V9EA 2EDYA 1ILUA 2BINA 1QUNA 5JPNA 3I50L 2V3FA 2CCLA 2V7NA 4FXGB 4QXUL 4ZNEA 1HINH 2J5WA 4P5KB 1ZDSA 1J8HE 3BE1L 1VEMA 4TNVK 3ILDA 3OWEA 3GMPB 3VFNA 1ZOXA 2VB5A 3SE6A 4PJHE 5CD3B 4FL4B 4K15A 4AQ8C 4WUUE 2OZ4L 4XP9H 5T3ZD 3IDNB 1XGZA 3L3HA 2H2PD 4MJ6B 2H6PA 5LBSH 5C07D 2YFNA 3WIFB 3MLWL 1F4HA 1MAMH 1YA5A 4Y4HC 3U6XS 3LN5B 3D0VA 4IHOA 5CZXC 4LSUL 2KZBA 3U9UA 5KYYB 4NDMB 3QFJD 3O41A 3KPLB 5E6ZA 3FQXB 1UT2A 3LQZA 3ARFA 3BVNA 5E2TH 1BAWA 2EZ0C 4N22A 1R3LA 1EEZA 3BVXA 4M48H 5AW7B 4OF6A 5JW5B 5IBTL 1Y6MR 1P2CB 4LEOB 5FUZH 1HWGB 4O5LH 3ECBA 5EDSA 2BIMA 2F5AH 2I26N 1SBSL 4PJ7A 2R9HC 2HTKC 3CDGA 2D7PA 3CCHA 1L0YA 3FTSA 4UDTB 1EK3A 4XXCA 4EVNB 3HZVA 1O9WA 5BOPA 3VNZA 5KSAA 3KYMB 4OIIL 1XB8A 4H20L 3KR3L 4LU5L 3TFKC 2EDWA 1IEBA 1KPRB 2RIKA 3BWSA 4BK8A 2EYRB 2FJGB 4AYBA 2OFQA 5CIPH 4Q6KA 1RUPL 2EINB 2R0KH 4XVSH 3FTXA 5D7HA 4M3HA 2B1HL 4QOKA 5D7KE 3V4PB 3IF1A 4K2UL 4PJGA 1RY7B 5CCGE 3NCCB 1RD6A 4LVHB 3SE9L 1YSOA 1EGJA 1Q9WB 1HYSD 2Y7MA 4Y19E 1UA6L 1W8OA 1AIFA 4ZK8A 1FO0H 1M7XA 4FKKA 4XOBA 5C08D 2OMWA 3KYMA 1FZJB 1NCIA 3FO2B 2V4LA 1SY6A 5KSVB 2J8UB 1WEJL 1U58B 2FX7H 5LJYH 4QTFA 5LWYH 1AZVA 5I1KL 1HQRA 2ADGA 1E8YA 1G7MA 1A9VA 2KQMA 4AYEC 3B3BA 5CILL 4LPCA 4PJAB 4ELMF 3ME0A 3C5SA 1JF5A 2AEOA 3W82A 5GS3A 1F6AB 1G7JB 1XF1A 3RIFF 4QRPB 1I1YB 1OT1A 1H3TA 2Y6SD 2ZUSA 2D7TH 3WJMA 4N0FA 5BS0B 3BKJH 3O11B 2F53A 4XNZC 5F7DA 5D1XC 3T0BA 1OQOA 2F61A 5FLVA 4ILDA 2W07B 2GT9B 3AADB 3HUJE 1AZCA 5J6SA 4KITB 3CMGA 3OJDB 1JXGA 2OX5B 3FF7A 1E5BA 3MKKA 1J0JA 3QWNA 3FT3A 1CFNA 3MOAL 4FTDA 4L37A 3C2AL 4N0RA 4NFDA 1ZXQA 4CADB 3T04D 4UM9A 2MNJB 1N0XL 2O5ZH 3DGDA 3LN4B 3HMWH 3HG3A 4JRXA 4I13B 3NABL 1JPEA 3DURB 3U46B 3ZBMA 1IKFL 5AZ2L 4PS4H 4PR5A 3UTSB 5JHDA 4D8PB 4KC3B 4M8RA 5I30H 1XF3A 3FT9A 2W91A 3KYAA 2IDCA 4HBCH 1IAOB 3AS3A 1ZPUA 2YKLH 3MRGB 4FL4C 2W07A 2MQCA 4JGMA 2XNAB 1QFWH 2V2WA 5C8JB 4OCSH 1X5JA 4I0PD 3SGJA 2FGZA 3E2HB 5E0QA 1CLYL 3UAEA 4P2QD 5IFAH 1CLCA 2J2ZA 4HUUB 5HDOA 1QR1B 3LY6A 4F1ZA 2EDDA 4HJSA 1UT9A 4N5EC 1MAML 3DV4A 4G8EB 1S5IL 1CR9L 2J55A 3KNBA 4WSGA 3TF4A 2JE8A 1YJDL 5C2BL 4FQ1L 4U1NB 2B1AL 2AJZB 3QDAA 2XHNA 5DO8A 1S9VB 2IDQA 4JO1L 5DEFB 5JHDB 4YQXL 4Y5XC 1E4KC 3QJUB 2DWXA 2VDKB 3I6SA 5T1LB 4GKOA 1ITBB 2FWOB 3IJSB 1PS3A 4Y2DD 2RCSL 4ZX5A 1AYRA 2C34A 4PRHD 1MCIA 1LD9A 3FUMA 1A22B 1CT8A 4QAWA 3IWVA 3G5ZA 1MNUL 2VZVA 1NEZA 3VFPB 1KCVH 3BP5A 3G08B 1OGAA 3FO0H 4S0TD 3M45A 5GPRA 1KTLB 1GGIH 4J23A 3U2SB 2DJMA 3P4NA 3QXDB 4JHUA 5DJXA 5FLUA 1NEPA 4R84A 2YMXL 3IRPX 1PQZB 4FNUA 4M6OH 4PBDA 3U2IA 3C08L 4OCWL 1JDDA 5I1CH 1KTDB 1FVDB 1JZDC 2F7RA 4X9GA 5KVFH 1PD0A 4YPGA 1PZCA 1AGDA 2I9LB 3WXWL 1A6TA 2CALA 3WFEH 4ABUA 3EDEA 1RK7A 2W81C 2E27L 1QX1A 3CFKA 3EYVB 3IFPB 1KB5A 1SXAA 2XA8L 3QA3A 2Q76A 4J3OC 3UG4A 3MLUH 2Q8BL 5E4IA 4XNYH 1NH6A 4Y5XA 4TSAL 2BSBA 1GSMA 1UA7A 4X7TB 3GXNA 4KK8C 1CF1A 4WV1B 1KMGA 4P2OB 1HX0A 7CGTA 4G9FA 3S5LG 3TT1H 2UXFA 4Z7UA 3CSFA 5ACZB 4TLTA 3ARFD 1FL3A 1PX4A 2WO4A 4I77L 1BFVL 4AL8L 1BWWA 3N40P 3X1EA 2ZWLT 3SDAD 3NFNB 4ZUVA 1I1AC 2CHXA 2DWEB 5GZNC 1MXGA 1PEWA 2CK0H 3AW5A 5EZLB 5IB3B 3REVB 2YAMA 2D7TL 1KTRL 4XNZB 2EEAA 3G5XB 5HHVL 3GEFA 1W16A 3NRFA 1CURA 1FFNB 4CVXB 3CSBA 2AZUA 5GSVB 3UROR 3GIVA 2DKMA 4A2GA 4WFFD 2XVBA 3RZCB 3RNKA 1HHGA 1ADQA 1OGTA 2IANE 2OMNA 1YY9C 4ODXA 4U1GB 3NCYS 4WHYG 4FGMA 2J8UE 2VXSH 3E1ZA 2YPLD 3VNYA 5G4OA 4BFRA 4YSOA 2HMID 1AQDA 4LSDA 2EDXA 1QI3A 4YHLL 5K1VA 5HDWA 3QI9B 5HY9A 1K8IA 5LG1A 4ADIA 3WFZA 2QV2A 1JYNA 1I4FA 5E1HB 1BXAA 1N68A 1NBZB 2Z91B 3DTXB 4JO4L 4E0RA 3MV8A 1AXSB 1X5FA 3MLVL 4E41B 1IQWL 4X6DE 3SGEH 4HUCA 3QAZC 2VH5L 5HYJB 2NY1D 1C5BH 5DWUH 3CFEB 4OKDA 1HSAA 4HG4K 2J88L 4BSVA 4LPYA 4KXCA 4NO3B 4UIMB 3V0JA 4J4PA 4MD0A 1HHJA 1DTUA 2A77L 1T0PB 1TZ8A 3NACL 2XTJC 3NN8A 4X7DC 5KTEL 4OJEH 4MNHA 1DVQA 1B4JH 1KLUB 4JFZH 3SGEI 2NXZD 5JPNB 2WTRB 1MWAA 2F1BA 5EWIH 4AKQA 5IHZB 5GGTL 4P48A 1L9RA 3LZLA 1Z1WA 5IF0A 4E41A 2NY5C 3ZKMD 1BV8A 1R34A 2MMXA 4NP4L 3DDGA 3LS5L 1D6VL 1KGCD 1ZK9A 2HG0A 3EFFB 3KGSA 4L48A 1N64L 4V2BA 3JWOC 4P2QE 1KENL 1E5UI 5EULV 4JCLA 4XMKH 1YYML 2VLKD 4AL8C 4FLRA 5AVSB 2CAKA 3PNWB 3MRFB 3PP3H 4WLCA 5M94B 4B50A 2P5WD 3D34A 2OTWA 4FZ8H 1JK8A 3VUAA 4OD1H 1UWXH 1AXTL 5DO2C 1MCOH 3BHBA 1B0RA 3GZQA 3NG5A 4HCRL 1N7MH 4OQTL 2YZ1A 7TAAA 4MB3A 4Y19B 3RB7A 1J1PL 43CAB 4AG4L 4M5YH 3S4SG 3TEWA 1DQQA 3PUUA 5GRUH 5L2KE 3W2DL 4S2SB 5D2LF 5E7BA 4YXKH 1F5WA 3QRFM 2J25A 2WBJB 1AP2B 2VN3A 1M7DA 3VXQB 1QFWM 2DMKA 4DPCX 2V7HA 5JPMB 4JZOB 4KTYA 4TV3A 1QTPA 4F57L 4DNLA 1MH5A 4IKKA 2G75A 3B6SA 4NUJA 4PY7B 1BG1A 1H19A 5BO0D 5EPMA 5FOJA 4MXVE 1E2VA 4YHZH 3SYPA 3I9IA 4S1RH 3D9AH 4DOHE 3ZTNH 2Y69B 1AIZA 1JERA 1Q0EA 4XCEB 2CU9A 5TH2B 4IU2B 3EJTA 1FRGL 5IQNA 3ZE2F 1O9VA 1NGQL 3BH9A 1RIUL 3P9LB 4YDVB 3LEVL 5EV7A 1JPST 2X28A 1XB6A 3QCVH 4NC1C 5F7NC 4PRIA 4GUPB 4I0PB 3CFCL 3CDZB 4OAWB 3GDCA 1MQKL 3QWOA 2G3ZA 4HIPA 1DLHB 5DRWB 3PWUB 3N43F 4DGYH 4FNLL 5I1KH 4Z7UF 4Y19D 4OM1L 2OSLB 2Z31B 2B1OA 1DJZA 2B16A 4QHKJ 1TQWA 3I3BA 3DV6A 3ZO0A 1OP4A 3PPEA 3NZ8A 4ZJ9A 5IFJA 4BKLB 5FB8A 2GK0A 4PD4K 3SBWC 2WBJD 3F5WA 3JWOL 3TYGL 4TOYL 1QWNA 1NCCL 1ORSA 3Q3GA 2YPVL 1M4KA 3ILPA 4IEFA 3L5XL 4NQUA 4EI0A 4PWJA 3QQ4B 4ZO6A 2X89D 4D0BA 5CFHA 1LO3L 1S7SB 4MJID 2G0KA 1XGTB 3ZIYA 4UDUA 3RL2A 1JGEB 1T1WA 1U8IA 1TETH 1DN0A 3QCTL 2R29A 3RI5K 4RCAA 5EIIA 4WWPA 3IGAB 5DC9B 1PSKL 1KTKE 4PWIA 4S1QH 3FCTB 1E3XA 2D0FA 3TZVB 2WLKA 3RWJA 4YUEL 5JOFB 1F00I 4XRCA 5BZZA 2FHBA 4C4KO 1QNZH 4WTXA 4JFEA 5A16A 2B20A 3C5XA 2X70B 4MAUL 3MLXL 1ZA6A 4JFVA 5I15L 3DGCR 1D7FA 4GUOA 2Z92B 5CZKA 2E9IA 4QHMB 1IGFH 3G6JF 2E4TA 4YDKL 5FXCH 2CIKB 5B8CC 1UH3A 2NSMA 3SKUD 4PJAE 3MRBA 1HS6A 2DI8A 3UTQB 3RA7L 1F4AA 5AOJA 1FN4A 2CO4A 2KQNA 3P3UA 3PV6A 3TA3B 2YN5A 1NGPH 3WKMH 4W4OA 3HG0A 3NK3A 4DO5A 1I8AA 3CLFL 3O3EB 4JDVB 3VFPA 3WFDH 3G6JB 4GRLA 4I1PA 4PRAB 4YZWA 1R3KB 5F7BA 1SEQL 5KSAD 1AR1C 5JIDA 2TSAA 3CU7A 3P77B 3TN0A 1AH1A 2B1AH 1L7TL 1YEHL 4W9JC 1PQZA 7PAZA 3A4DA 2AJZA 1UTDA 4LVEA 4AX3A 2DDQH 1JGLL 1T66C 2V7NB 1C08A 4FXGA 2X2IA 2QELA 4FP8L 1ZCRA 4OZGB 4ODBD 4RA0C 4BGDA 4C58B 1J8HB 1TOXA 1TTFA 4Z23A 1J1PH 2AXWA 2EYSA 5AWNL 2P24B 4Y2OB 1BAGA 1PYWA 5F2FA 5EMYA 5FKAA 4LKCB 3FK3A 4JR9L 4N2MA 2VDQB 4PS8A 5ISZE 4PJDF 2Y7NA 1F97A 1KIRA 3GS0A 1A47A 2AJYH 4PWHA 2ADJB 3FOLB 1IRAY 4KFZC 2A6IA 1B6DA 2EC9T 2I32A 5KAQF 5AG9A 5AW1B 1LE9A 2CDFB 1UM5L 1UZGA 2BP8B 4GSUA 3SDXF 5E1AB 3D0VB 2AQTA 3HAEA 4KK9D 1RZQA 1PZBA 5C07A 1JGUL 3P69A 1FDLL 4U6XB 1U21A 3RFZC 1NAMA 3W37A 2MHAB 3E8UH 1WC7B 4ODSL 2W9LA 5TD4A 3RUGF 4GQQA 3UGUA 4ZW5A 3S3CB 3KPRE 2R59A 5D6DA 3NIDF 4R4NC 1QBLH 2H3XC 4Y16B 2Z7WA 1J87A 2WLLB 3RQ3A 3PYCA 2DD8L 5HDQL 4Q4IA 4GFXA 3BZDA 3LEVH 2YAQA 4F7KA 1PD1A 1IAKA 4Y8AA 1GJUA 4XGZA 5I16B 5AYQA 3ASWA 2BSRB 4IIQA 1YMMA 5F1IA 4ODTL 4KPHH 4ODHH 1UD4A 3U1SH 3VFUB 3MV9B 5ANHA 4H0GA 1UWFA 3D5OF 3RGVA 4LNVA 5I1JH 5EUOA 1CFVL 2A1WL 1KB5L 3FQNA 3GI8L 3QO0B 4ODXB 4PV9B 4XCCL 3O8XA 5K33A 1ONQA 1ZEAL 2B5IB 5IJKA 2X12A 2JIXA 3V4PL 2H32A 4NNYA 3X1BA 5IQ7L 5DMJB 5FYJL 5EN3A 1RUQH 4JY5H 4XHJD 3MRNB 2YRPA 4OI8A 1HEJC 3GMLA 4MJ5B 2HVKB 5HGHB 3CK0H 3CFMA 3DYOA 3HZMB 3KXFE 5D1QD 3U4EB 3MCG1 2BFVH 1V54B 4H8HA 5IUSA 5M95B 4WHTA 2QL1A 4ICWA 5E6ID 5HJBA 1DVFB 1ML0A 5ANME 3V5HB 1X5XA 4O2EA 4B9YA 4IGBC 4NO3A 4UIMA 2CA4A 2NY6B 4I5BA 5DJZB 2GC7C 2OI9C 4B5EA 5IGXL 3MJ9H 1UM4H 4P4KD 4V1DB 2RACA 1HQ4B 4YHOL 1EFXD 4WUKH 4IRJD 1YNTF 1P7QD 4P3DB 3O6FD 4NUQA 1LO5B 4GAGH 4J5VA 4R2GC 4RIRB 1P6WA 5DI8B 4G6AD 1SMDA 5DF0A 1JF6A 2OMYA 2G5UA 2O6CA 3ZZQA 1JXDA 1PL3A 2WWKO 4UZUA 2BOBA 5FW8A 4A38A 4QTIH 4PJ9B 1ZA3A 3LXAA 4YBQD 2F5BH 3NZHL 1UA3A 2ED8A 2MOGA 5DSCB 3RVXC 4G7VH 4N9GA 1PNCA 4BIKA 2OTWB 1CL7L 4A6YH 4DFHA 1Z3GL 2DN7A 3T08A 5GRWA 4XI5C 1QQDB 2J5LB 3FFDA 5C0CB 1SLVA 2Y1ZA 2BM3A 3VI4A 3K8LA 1QD0A 2E86A 3HB3B 5BJTA 4GG6A 3M46A 4D0CB 2PUQT 1XF4B 3H54A 1DVFD 4KRMB 5IBTH 2IDTA 3SD5A 2IAAC 3MNVA 4JR9H 3T2QA 1PTZA 5IKCB 2CUMA 1XGUA 2X4NB 2QTEA 3BGAA 5J12B 4F9LC 1AJ7H 5EO1B 4D0DB 3TEXA 3VH8A 3VU1A 5DA0B 2YO3A 1JK9A 3W56A 1XWVA 1E4XH 1YVLA 1ES0B 1LJMA 2GI0A 3M8OL 1KJ3L 4FQXC 5C0AE 3W9DB 4OZIF 3FTVA 2HMIC 3VXUB 1S9VA 4UAHA 5DEFA 2VW6A 4OI7A 4ODSH 3KPLA 5JIQA 1QRNA 1F8TL 3PHQB 1XMWA 3FSWA 4HCIA 4WFED 5BNXD 3B2UC 1KXQE 3VWKB 4HUNB 2VERN 4OCXL 4PCKA 3LX9A 1NGXB 4BZ2A 3WNLA 3TNMB 3D48R 3UJJH 2XPYA 4XP1L 3RWEA 2BY0A 3L4CA 3L5WB 4NQCD 1MFNA 4Q74A 1HILA 1NCBH 5J56B 1XF2B 1WZ1L 3M1BB 3V5KA 1M2VB 4M6MH 1NLBH 1A9BA 2OMUB 1BBDL 3MBEC 4UOW0 3RWFB 2BW5A 2UY7A 5CEXB 1WTLA 4ATTA 5DK0A 5KVEE 2YGNA 1U8NA 3B7YA 5EC1A 1FH2A 2VLKE 3UTTB 3VXUA 3WS3B 1B0RB 3NVQA 5A2AA 2BSTB 3HC0A 3MLZH 1JV5A 2X4OA 1O6TA 2A74B 2V8LA 2XTSA 3WCYA 2BNQA 3TO4D 3LV3A 5L8JB 1AQHA 4S1SL 5FYJH 3T77B 4I48A 1EEYA 4WI5A 1NCNA 3B5GA 2QHRH 1S6NA 1O6SB 2FHFA 4M7KL 1RPUA 3CFCH 3IJHB 5FO9A 3RL2B 3SE8L 5B38B 3SO3B 1N6QL 3SDYL 4XHQA 1CFSA 1MIMH 4G80A 4R7DB 2JFCA 1MFVA 1CLOH 3MRJA 3HMXL 2GJ6E 2EDJA 1BMWA 4OV5A 3ESNA 4U1GC 2H3NB 5HI5C 2CCVA 2BZDA 3AT8A 4M1CD 4G5ZL 4G8GA 4X50A 2AQ3A 4PRBB 3D3VE 3VG0L 5J89A 1EFQA 2OW6A 3NBNA 4M62H 5BO1H 4N2EA 3NABH 3VFRA 1DSYA 5BUPA 3KWWB 4XB3A 1TF4A 3SYQA 2ENSA 2FD6L 4FG6C 1J9QA 5D7IA 5IB1B 1EXUA 1OAUL 4PJ8C 2IDFA 2OTUB 4GQRA 1EWHA 2AJSH 4LGSB 2UVEA 2GAZA 4FA6A 3CIAA 4OAWA 2ZKXA 5H8DA 5E9DD 1KLGA 2N56A 1HI6B 3MRCB 5BV7L 1FQ9C 2IH8A 2FJHB 3BGFC 4YE4H 1FYTE 2FQDA 2Y24A 4Z95L 5AOMA 2IGTA 3Q13A 5JORB 4L8DA 1UFGA 3L2NA 2OX5A 1U8LB 4M7ZB 1CGVA 1BSIA 1XGRA 5C0NC 2QZQA 1IAIL 2ADIB 3FFCA 1MEXL 2WGNB 1FG9C 5FAAA 2NX5D 2GK0B 3LHAA 4AYFA 5I15H 4FQ1H 3IFLH 3MYJA 1Z3GH 5DJ6A 2H9GB 1SJHB 2X5PA 4YC2C 1MAKA 2J4WL 3WKQA 3FSAA 3BVVA 4D0BB 1EZUA 1R3IH 2VDLH 3ES6A 4OT1L 3ZR5A 3DIFA 3EH4B 2UVFA 5EZIL 2FX9L 2PYEA 3PL6A 3VA2C 5C92A 4LQFH 1C16A 1KB5B 2AITA 2EP6A 1EDHA 4KMQA 2WBWB 1EO7A 4RWYH 2ADIA 5IOKA 1WCBA 4KDVA 2C3XA 3MZTA 5GGQH 4AYMC 4JDEA 4NDMA 3MYJB 5BW7C 2G3NA 1QUNB 4JCWA 3HG4A 1AAJA 3R06A 1TTRA 4P4KC 2JI3A 1GHFL 3FT2B 3QHZH 4PRPB 2BFGA 1C1EH 4DP7X 3SDAB 2TSBA 1R0AH 3LJ3A 3MRIA 4XX1G 1U33A 1P1VA 2LV4A 2PPDA 4D94A 3OZ9L 4YAQA 3P1VA 1YN7A 2BSRA 1QAWA 1H6EA 3MO1B 4QKXB 3F6JA 5EU6B 2Q8BH 3U7WL 3BRFA 1Q8MA 2DQFB 3E6HA 4AYID 4MDRA 3P77A 1VFMA 3LSOA 5DMIL 5C07B 4OR1A 4Q0XL 3FB6A 2BCKB 3QO0A 2EH8L 4HJIA 1RUPH 4PV9A 3D7PA 4PY8I 3X13B 2VMDA 3N91A 1V7NL 5FYLE 2W0PA 3HN8A 4WKZA 4U31A 4WGVB 1CFTA 4X6FA 3NIFF 1VEOA 1VJSA 5D7IE 2L0DA 1K6QL 2PP7A 4NP9A 3TFKD 4KO5A 2WBJA 4C56E 4S1SH 4AEEA 2CKBB 4M9OA 3P3TA 3GUFA 4HPYL 1SOSA 1AZNA 2F15A 4ODTH 3AQXA 2JJVA 2G75B 3U4BH 4JN2B 4JJHA 1KPVA 4HIIA 4N28A 5I28A 3PREA 3U1SL 4IS6B 3O4LD 3QDMD 5FCUH 3WHXA 4B6ZA 5I18H 4WY7L 3PQYE 3BFWA 3KPSD 1NWPA 4BHUI 1OAJA 1TNNA 2NUTB 4YHNA 3ARBA 3BPNB 4L23A 2HKAA 2Z64C 2HTLC 3GZPA 1GIGH 5C7XL 1SJEA 4XP5H 4Y5YA 1U8KB 4LESA 1I1CA 2MQ0A 3DIDA 4NLHA 5FKPB 1USZA 2P80A 2A9ML 4KK9C 3UG3A 3N04A 1I1AA 1AIFB 4G71B 3VXSA 3OSKA 2FSEB 2QQKL 2R7EB 4GMTL 1FFQA 1T1YB 4OGQC 5L7XL 4W4OC 2BFVL 2EUZA 4U6HA 4ZUSB 5ADPH 3G5XA 3UX9B 1URLA 2WXGA 3FOMA 1PZ3A 1PX8A 4PG2C 1WWAX 4PW4A 3MV7D 2NSQA 5DJZA 1OCZB 4N1HB 3NPSC 2QPEB 3QW9A 1DYZA 5KYXA 4GAYB 1XFPA 1V3JA 4DW2L 4GMSH 1KNOA 5I8KL 2LU3A 5JW4R 2F8VA 4D9LH 1YEGL 4JFQA 4LCUB 1T83C 3UMNA 1F58L 3QDJA 3QPQC 4O00A 3MBEB 1I9EA 3CZJA 4MJ5A 5DMGD 3EZJB 2QQLL 4CW1A 4P9HH 4HBCL 2WVUA 4JO8A 4C56B 2OMYB 1OL0A 3EJRA 4HHAA 3IKCA 1AC0A 4HS8L 1TJGH 3TU6A 1BIIA 4GSXA 1SFDA 2NDGA 3MGTB 3SQRA 4G9FD 4F7CA 5T1MA 1JI1A 4GNKB 4AQZA 5C0AA 3DJ9A 5TPWH 3UTTD 4U1MA 1E4WL 4B9PA 2YHGA 4YE0A 2FSDA 4G7VL 1YEFH 4EI5C 5K5YA 5DA4A 5ESQA 1OO2A 2EJ1A 2VXQL 4LHUB 1W0VA 3AT9A 2GTQA 4KX8A 3WY2A 1U8OA 4YSQA 5E5MB 2EICA 4B7LA 3MRHB 3KPQA 1E5CA 3U4KA 2OXHA 4PJEB 4M8UA 5D7JD 5TDPA 4UQ3A 5KJ4A 2QPFA 1XTLA 2QVFB 1BQLH 3JYBA 3EJYC 2Z8VC 4ZUTB 3ZDXF 3NIGB 3MOBH 1PG7W 3QJZA 4CSSA 1KXTB 1YECH 3K46A 2OS7A 3NCEB 3O2DL 4IBSA 5AD0A 4U1MB 2YN3A 2ZCKL 1NGYA 3I9GL 4PV8B 2UY7B 2A6KB 3VFSB 3DOHA 4GW5A 1LP9A 1KN2H 3NMEA 2LVEA 3FN3A 4J3OF 1DDHB 3C5ZB 4JPVL 2WJ7A 1QTYT 4KDWA 2EAEA 1A7OH 5JW4Q 1QPPA 1H5BC 3SYAA 4JUTA 1T7YA 4P99A 4AENA 4L8CA 2XFGB 2ALWA 4NGHL 2FEEL 1ASPA 1T0NA 2DQTL 2H2SD 3F58L 2ODHA 4AE0A 1BECA 2VNCA 4IBYA 3HNSH 4KRPD 1NOLA 3MXWL 2Y36L 3WNKA 4PYGA 3SOBL 2O1AA 3IETB 3G5ZB 2Q76B 2FATL 5ICYA 2X53A 3GXMA 3CVCA 1NLBL 4Z0BL 3ABZA 5EU3A 1PZDA 1PGRB 1ZANH 3WG7B 2QBWA 3D39D 3K1KC 5BUAA 4MMXB 4ZO9A 4NKIH 2COVD 4YXHL 3F7RA 1BFOB 4R4ND 2VCOA 4ZT1A 3K1DA 1FPTH 5JR1H 3S36X 1EBAA 2MKLC 2RQEA 2CLVA 1WHPA 1Z9MA 2C7UB 5GJTH 1M3JA 5E00B 1NIEA 3FRPB 1DO6A 1TU2A 4JREB 3B7SA 3JWOH 2WLLA 3RTLA 1QTSA 4KJYB 3AJ7A 4EKXA 2C4XA 2LVCA 2QKIB 1EXUB 4HEME 3P0GB 4POYA 1RLWA 3C09C 3LZRA 2C3GA 3OV6A 5F1IB 5FYKH 1M2VA 1IX2A 5EU3B 4X5PA 4MNQE 2BY2A 2DQJH 5HYSA 4LLVA 3MRGA 1J48A 2QR0A 4XWGL 4HIXH 5E94A 3Q6FA 3QQ9C 2VR8A 2MTPA 1KFGA 4PRAA 2DYSB 2HFTA 2P5ED 1SXCA 4G43B 3L54A 2NNRA 2AJUH 3QRGH 4LSTH 3TH2T 4LNRA 3GM0A 4RAHA 2QV4A 5TDNB 5B38G 5EH1A 5I6OA 4WJ5A 1K2DB 5C09B 4GRWH 4ZFFA 3OKDB 3VSTA 1N0LB 2X89A 4QXGL 4RQQA 5HYIA 4QNPE 4LCIL 1K8IB 4AYSA 1IE5A 4JKKA 2UXVA 2Z91A 5A2CA 5I1EH 4HDIB 4LCVA 1IZKA 3W11C 4JGNA 4P5TB 2BDNH 2BJML 4HS8H 1TJGL 2R0WL 4UQBA 4UTBL 1OP9A 3ULVC 4ONGL 2A9BA 3MJ8A 5BQ7B 1E67A 2B08A 5E9AA 2G3XA 1LVEA 1JF1A 3HG1A 1XAUA 4G7YL 5JOFA 1A3RH 2BVEA 2EYRA 4YFLF 1B4JL 4JFZL 2DH3A 2HRPL 1YN6A 4JL1A 5TK4A 4I7ZC 2NY0C 1N18A 3HEIB 5EWIL 2A74C 2IV8A 2CBQA 5DJ2A 4A2HA 1ACXA 4GIAA 4M48L 1FH5H 1H3PH 4TMPA 3D51A 4Y5VA 5CF3A 3QXTA 3LS5H 4F3FA 5FUZL 3QR2A 5EZIH 1T5XA 5HDBE 2DTSA 4M4PA 1AZRA 1K9TA 4NM8L 2W88A 3CCHB 4UMGA 2A6DA 5JZ7D 3ZE0F 1HCVA 2L4OA 3FFCB 3TWCH 3ARQA 3BWAA 1WTGT 2DLGA 1SJVA 5JIPA 3ZQWA 1K4DB 5J6GA 1IO4C 4J27A 3RVTD 2Y5EA 3QG7H 3HBZA 3DO7A 2IQAA 4PCTA 3H7LA 1X5GA 3UZQB 4S2SA 1I82A 2ZOKA 3QUKB 4ZFZA 2XXFA 2WTOA 3OZ9H 2C5DC 3F62A 1SM3L 1UYWH 2YPLE 1CF8H 1U3JA 2V9UA 3EJQA 1HWWA 5H2BB 1ETJA 1YDPA 3GSXA 3CDGB 5TGBB 3UG5A 1L6PA 4R0LC 1KCKA 3TBSB 1JZJA 4KZCA 2X6VA 4CU6A 3D39E 2R8SH 1G6RH 4Y5VC 5HVGB 5IFHL 3OKOB 1VADB 1VLXA 2FX7L 2B0SL 3C6SB 4GH7B 3T0WA 2LAGB 4NNPL 4AEHH 2FJGA 3DI3B 5FDWA 2WZAA 1G6RA 3FBKA 3FW6A 3IS1X 4JFDD 4N3UA 1SOQA 5I66B 2WAHA 2WWOA 5CN2A 3GIZH 2VDMH 3IXAB 3GK8H 1GYCA 3P3YA 4JREC 4FN0A 5FFOA 3TPUA 3BPLB 3ABKB 4CC4C 2G9HA 5CEZE 3A4AA 3CC1A 4U2ZA 1OGSA 1W6WA 1RIUH 5C0RL 3QNXA 5EOCJ 3WLWC 4CGTA 3T3PB 1CE1L 4W9GC 4BFKA 1ZLWH 5HYFA 1FNEB 4YSSA 3QFGA 4XMPL 1WLHA 3TNNB 1MW1A 1NC4A 1BZQK 4H2AA 3CVHH 3BEVB 5KVDH 1XV8A 1CK0L 1VF5C 2VZTA 2WUCH 1DBBL 3ARBB 2WVTA 4HOMA 5FFLA 2OXGA 2P5EE 3BQUC 3UL4A 1T66D 2OMZA 2P8MA 4XE5B 4X7CC 4JPWL 3T71A 3DOSB 1O9ZA 5KYUA 2EIMB 1D9KA 5DHYB 3ARZA 3T77A 3GJEB 4X6BB 2K0RA 1P5VB 5FKPA 3T0EE 1GTNA 4IMKA 1VFAA 2YEZB 5IHZA 4DAGL 2XZQH 3UC0H 3RG1C 1JZIA 4G11A 2OJZH 3WXVH 3PL6C 4TULH 3BLPX 4KKLC 1CB4A 1J1OH 2VN6A 5EHFA 1MF2L 4FG2A 5I74B 3QXAB 1FP5A 3EFOB 3S7GA 4XVOA 3G6JA 5MP6H 4Q6YA 5EBLB 3VFGL 5A6MA 4A2DA 2FLMA 2IGFL 4LLWB 32C2A 3QZMA 3GXFA 3KNBB 4HAFA 4Y9BA 4EQ2A 1MFEL 2H1PL 1N2RA 2NXZC 4G1MB 2KT6A 4AMKL 4G8GD 3W1ZA 1NKRA 4QJ4B 1XQ4A 2C3VA 4GQ9H 4QHMA 3FCBA 1TG8A 1VFAB 3QZLA 2QQLH 2WLYA 4EI6A 1XL4A 4H2CA 3TCTA 4DOHB 4PJDB 1FN4B 3ARYA 2F74A 1U6AH 2DIEA 1E4HA 4HETA 2Y0SA 3P4MB 5LBSL 5F6IC 3PGDA 1UT1A 4M1GH 5I5RA 5DFWH 1A1NB 3AY4C 3GF8A 1M6UA 4RGMC 4JRFA 4FNPA 4R2GD 4F7PA 2VXQH 3SQOH 4EUPB 1ZHKA 1DVUA 3TN0B 2Y7SA 4GRMA 4LCYB 1NM4A 1FNHA 2XIDA 3D30A 3Q1SL 3VD0A 1JGLH 3N44F 1F8TH 4ES9A 1JNLL 3MBEA 4YXLL 4QJ5B 3S3PA 1VGEL 2EVIA 4XT1C 1WBZA 3C5ZC 2WNGA 1CI3M 1MRCL 1DJSA 3C6LC 3ML9A 4UQIM 3S48A 3KLSA 2DWEA 5F6HI 4EXKA 4KNQA 1UOKA 3N6YA 3M1OA 4LF3B 4QGYA 3X11B 3Q7JA 1OF2A 1JHKH 4L5FE 2IOIA 3L7FA 4LU5H 3LD8B 4TQIA 2J73A 1JGUH 4C8XA 4WV1A 1UM6L 2WXOA 2H6OA 4MS8D 3HE7C 3L3JA 3KDMA 4C55A 2P4AB 1K85A 4PIRF 4H8WH 2AQQA 4N86A 3GM8A 1JPGA 4YSRA 2A38A 2GSIA 4K2UH 2L7JA 3FJTA 1NQBA 2GK2A 4L1BA 4BYHA 3VFRB 2R2CA 4PY8J 3HI6H 1OD9A 3T2NH 3MRNA 1FHGA 2WGXA 1ULVA 2QPDB 5JIMA 1R46A 2VE6B 1FFTB 1JG9A 1CC3A 3Q3GB 5IB1A 1RJYB 2UY6A 2XV6B 1DR9A 3D87B 1ZT7A 5IW6B 2FNWA 3RDTA 1JTPA 4AZ8A 5GGRA 4NQCA 3FUEA 4JUSA 2AEPL 4S10A 2OCJA 4R7NB 5HHNA 4M00A 4R9HA 1JS4A 1G9NC 5DJ0A 5INCB 5I0WA 2NTFA 3ZYOA 2P8PA 4PJBF 3QIUD 5GJTL 4UB0H 4CSZA 4Z7UB 1OT4A 3HC0B 5KG9A 4B41A 3OKYA 3BVWA 1QVOB 2R4RH 3CZNA 3HZYB 3PY9A 4AY0A 1J5DA 2F53E 4K94C 1OF0A 3OLGA 1IGIH 4ORGA 5D7KD 3V4UH 2APSA 2HVKA 4JKMA 4JM2A 4OGYH 4N8VB 5IEKA 5EBWB 1OALA 5B22A 2ZXCA 3V0VB 1D5MA 2JJTA 3MLVH 3T0DA 4KVCL 4NPYB 2IALA 5CZRA 2XETA 3L45A 1R3KA 4WO4B 3KCPA 3L7EB 2FHCA 1S9WA 2FJUB 2KHAA 3Q2LA 3SE4A 1NL0H 4EIGB 5MEND 4HFUL 3GGWB 1MFDL 3V8CA 4L3EB 4H26A 4GXVH 4WUKL 2QMJA 2JVUA 2YSSB 3GXTA 5CJ8A 1FG2A 3QUYD 3H3BC 4HJ0D 3EOBB 3BDBA 1HK6A 1G9MH 5L88H 4ZQKB 5IW1A 4PM1A 5IMKA 4F8OA 4GKLA 3QUMH 2XLLA 4PJ8A 4AIZB 4AUYA 3FH8A 1EAOA 4NP4H 2R0WH 2PTTA 2ZUTA 5HI3C 3RTQB 5DRNB 3SOTA 1IT9L 4L1SA 2J72A 1KIUB 3CXDH 4OJDH 5ESVA 4KY2A 1JK9B 1JHLL 4HCGA 1ED3B 4G1EB 4LOFA 1YYMH 3REWA 3KVDD 2IFFH 2MJWA 1E5YA 4N2DA 1GY1A 2ZICA 5AOZA 5FGRA 5C9KA 1QACA 2GG1A 4H26B 1L3NA 4GSRA 1T03L 2WCGA 1P7HL 3OKDA 2HTLD 1G1KA 4QXWA 3W0WD 3BXNA 4PTTA 1A1OA 3RY5A 4BUGA 1IBGH 4IGBB 1U2YA 1NGXA 1DSFL 1WSST 1HZLA 1DUYB 3K6NA 1VFUA 4MMZA 4PJGB 1QW8A 2OMVA 1S3KL 1U8QB 1RKRA 3C8KB 3MNVB 3RTQA 1HKLH 3JYCA 3BAYA 1KCWA 3KJ4C 5JHAA 5TGBA 5L4MA 1V55B 5KVGE 5BPPA 3F84A 4KO9A 3L95B 2Y4SA 3ASOB 3ZKXB 1BVLB 5E94B 5J5EA 3PDOA 5DSCA 2VDNB 2WIIB 3DJRA 4XWOC 2CZNA 4GUCA 2EIZB 1F6FB 1T6VN 2EKSB 3VDBA 1DFBL 4UV4L 5E2VH 4FF9A 5J06A 2HKHL 4K3EL 3VXSE 1WG3A 4YX2H 5K1JA 4UQAA 2HZHA 1NCHA 2OMVB 4NCC2 2AQNA 1FO0B 2J1XA 2Z9TA 3FUHA 3TBBA 4PJ7B 2JB5L 1UD6A 3KPPA 1PZAA 3VFMA 4XN4A 3VD4A 2WLMA 4TSAH 2R2EB 4FQHB 3HZMA 1NPNA 3BKYL 5KVFE 1TSRA 4WY7H 5LVEA 3O2WH 3QEUA 1GS7A 4O2EB 4WI2A 1BXVA 1DQML 2BCKA 3UTPD 5JMOC 4KV5F 2CDEB 3QJXA 4IJ3B 3MLZL 4JGUA 3NEEA 4PRNB 3GUTA 5DU7A 2ZP0T 1CICB 3WNMA 2J43A 1BZOA 1GGCH 1SN2A 1X5MA 1SHXA 2WO2B 3APCA 4GAJL 4KY1H 2VXVL 3KWWA 5B39A 4J1UB 3HLAB 4L9DA 4HAGA 4E41E 2QPSA 5BZWB 2EVHA 1S5HB 2ICWI 1MJJA 3FKUS 2WUBH 4OV6F 4AJVA 4OGYL 4CMHC 2Z31C 2I24N 4JLRA 5C6TH 4NJAL 3T6QC 4X80L 2I07A 1UHVA 2R9HD 5CN1A 5JORA 4Y4FD 3S2CA 3UCRA 4R7DA 1OOAA 1V5JA 3B8SA 4PJ9A 2NR6C 4OCRH 1GOHA 3K74B 4A7TA 5F9DC 3RX7A 4YUEH 4HWBA 5J1AA 3FQUB 1F4YL 1OK8A 4AJ0A 2AQ2A 2MNWA 1A4JA 4FZEL 2VO5A 3VXRB 4D9LL 5GGUA 5LAXB 1FSKB 3U82B 1XO8A 3BGMB 5G4MA 1QLEB 3EHBD 1NFDE 3QP3A 4UINH 4DQOH 4P3CH 2X7LB 3RA7H 3QEHB 5B38A 2FWOA 2QR0B 2QJDA 3I6KA 5LXVA 3Q06A 2FTAA 3OKLB 3QXWA 4K3JL 4Z1PA 3PGDB 1FIGH 3IMUA 3WBDA 3D69B 2YSTA 4YVUA 1JWSB 2WQSA 3D85D 1U36A 1LE9B 5CSZB 2JQZA 2E75C 4ADGA 5E8DH 5GSRB 2Q7NA 3OD3A 3QUYC 4MNGA 4ALAL 3AU1B 1EMTH 5ISZA 5GGVL 3INOA 2NZ9C 3FT4B 2X6UA 2E9BA 5FK9B 3GJEA 3P0YH 4IHBA 4PLOB 5DEZA 3PGFH 5DD6A 1YY9D 1U3HA 3GTTA 1WAAE 2AQSA 2J5LC 3LB6D 4PYHA 2MPVA 1W6LA 2P24A 4Y2OA 1VFBA 2OR9L 2OTUA 3GTNA 3THML 2V5RA 4LBEA 5GISH 2RMNA 4XN8A 1T20B 2ILLA 4LLUB 4P3WA 1V3MA 3TT3H 3KLKA 4BFGA 5I8EA 3QISA 4HT1H 4JHVA 5ETUA 4A2EA 1HILB 1IC5H 4XC1L 4D8OA 3DSFH 4PB0L 4AQ8A 3EOAA 3EBHA 2Y6SC 1I9IH 1C12B 3V5KB 4GLRI 5SWSE 2Y06L 6TAAA 1MUJB 4NN5C 2FUTA 3FDWA 4OGZA 2CNZA 5CP3H 5HDRA 2YGQA 2XACC 3ZKND 3T5WA 5D1QE 5CXPA 2VUKA 1W0VB 1H8OA 2WXPA 3BQUB 2X0WA 3CDFA 1BEYH 5E70A 3NCFB 4ANVA 2WNXA 1CFTB 1I8LA 4AG4H 3SCMD 4K3EH 1HL5A 1R0AL 5E00A 3UPRA 1YPZE 1E4JA 3NCXA 2EYSB 3LYRA 4Y1AD 1OD7A 5F7EH 1Z9PA 5JO5A 3CLEL 1YMHA 4IKJA 1KYDA 3ZDYE 4Z5RB 1BM7A 1DLFL 1KV3A 2P5PA 1SOKA 1NGZA 1TTCA 2PYFA 4H8QA 4OD3L 4R0LB 1IJ9A 1WFMA 3BYTA 2E0PA 2O61A 4KPHL 1Q9OB 1CD9B 3LXBA 4GT7A 3VWJA 1IC7L 1KACB 5DJ8A 1KZYA 4WK2B 3ILQC 2E76C 5I5MA 2YLHA 3ENEA 1OGAE 4KJWD 4XP6H 3D9AL 5B1JC 2NYZA 1EJ8A 3MJ6A 4FFZA 5I6PA 3NIFB 5F0MB 4N1CA 4MS8C 2ERJB 2HFGH 3T6VA 3WN5A 1AQDB 4P2YA 1D9KD 1NKOA 4P49A 3DX9B 1I7RA 5AVVB 1TVHA 4PJXE 1MQKH 4HOWA 5I73C 4P5TA 3ATEA 3H9HA 5DT1L 4XWGH 1DVYA 3QHTC 4R7XA 4FXKC 4CN4A 2F7IA 1UG9A 3KW8A 4RAVA 5GS1C 4B9GA 3KDMB 3BEWB 2R29H 1GTFA 3T4YA 2NW3B 5GQBA 1N0XH 2A9NH 3EDFA 4AOFA 2JKXA 3T6ZA 1ZHBA 3QRGL 3BO8A 4WW2A 2NLJA 3BKMH 3RVTC 2WLZA 3HUJB 1MDAA 2AGJH 1KCUL 3NFNA 4PJFE 4L4VA 5CEYA 2H0PA 4Z7WE 3P54A 1GGBH 4EUPG 5FECB 1SJHA 2JXMA 3L1OH 4I9WD 1N4XH 3PDGA 5BJTB 4GG6B 2Z4QB 4UINL 3ZL2A 1NBVL 5DD0H 1JZ7A 4PHZA 4KKPA 4ZUSA 1TITA 3OZLA 3QEQD 1GGYA 1QBAA 4MD5A 5AZEL 3FU3A 3ARSA 3KPOB 2JCCA 4I3RH 4AWJC 2JELH 1T0MB 5D72L 5DVLA 2NW3A 4N9GB 2V9QA 2E6QA 4Q8BA 2HLAA 4FI6A 4QMEA 1AS6A 3H9SD 4Q9BA 1MFDH 4XAKE 5EORL 4K3DH 4LSPL 4OJFL 4DGIL 5LGHL 2H26B 4XAWL 1IGFL 2RA1A 3ATFA 3IEAA 3DXAD 5I82A 3Q0HA 3PE9A 4GFTB 4ZUTA 4TVUA 3RUGB 4B9CA 1XH2A 4KNUA 4N2NA 4CVUA 4PGZA 2NYYD 2YRLA 3AG4B 2FGWH 5DTFA 5FYLD 1FNGB 3VTAA 3OAWA 1S7WA 5IESL 4YEEA 4M6AA 3BUIA 1CU4L 5D1QC 1JGDB 1A6WL 2VYRE 4M5ZL 4F92B 1BVLA 1ZS8B 1AKJB 4LSRH 4F80A 4KHTH 2LU4A 3LPFA 2CRIA 2VM9A 4NCDA 5IJVA 4FG6D 5CU5A 3CFNA 4IOIB 4P2QA 4G1MA 1A4KB 4FFVD 2X2JA 4FXLA 2ZXGA 5KYYA 3UEQA 5IMMB 3QCUL 4XH2B 2W38A 2E7LC 2CM5A 1Z9SA 5JW3H 1TO4A 4FP8H 4UYPA 1COBA 3QVAA 2IC2A 3HG1D 4L8SA 2WVSA 4E41D 2A74A 5JUEH 2PPEA 1XR8B 1FIEA 4LFHD 4UM8A 1IAII 1Y7VA 3M17B 3ECBB 3MCKB 2WINA 3Q2VA 2AJYL 2F54B 3LEXB 3WFEL 4JHAH 4QOKE 3LIUA 1J5HA 5SV3A 3GLZA 3MUGA 2KLRA 2DJSA 4OD3H 1ED3A 4G1EA 5E4AA 3DRQB 3BVDB 5C0JB 3QFJB 5EO0A 2ZKWA 2NQ3A 2WYIA 4I2XA 4WGKA 4DO4A 5LDUA 3EG9B 1XGPB 1OCWL 4WI3A 3MV8E 4OCNC 5FGSA 5EC2B 1OAZH 2NY7H 3KXFA 3EYFA 3QEQE 1XZWA 2OMZB 3KG5A 4UMSA 3APDA 1LWHA 2VDML 1CTOA 4R83A 5AW9B 1BFTA 3VWKA 1ZT1A 4D9QE 3MLTA 4MA1B 4GBXC 4GQPH 2NX5E 4KUZL 4ETQA 5AUMA 4EDXA 1OAKL 2OP4L 1J1XH 2I07B 1OE2A 2ZX7A 3B9KA 3GSXB 5FFGA 3LDBB 5GZOA 4JM2D 1A1MA 2ITCB 5IB4B 4E9QA 1WEJH 4YVNA 3PAYA 4ESKA 3CE1A 3DX7B 1FWXA 3JT0A 3IDMA 5F21B 3RFRA 4A7VA 1DBKH 2HRGA 1ZRUA 4PHXA 1E0OB 3DMMD 1J0HA 3SGJC 4X9BA 2C8NA 2DBJA 5HGAA 4JY5L 5DJ6B 4EI5D 2DQDL 2RB8A 4UOW1 2H47C 1TVDA 1YEIH 3FT0A 5TJWK 2DI7A 1HNYA 3CVHA 1UWXK 2VXUH 4ZNEE 1GR7A 1J9CT 3QQ3A 5FHAH 3RDTB 4FQHA 2KBGA 1E3FA 1T80A 4R4FH 3JWDL 4W9IC 4NQCB 1NANH 2ID5A 3JV4A 4PJCE 1ZHLB 4NQSB 2X1PA 1TXKA 5CZVL 4DN4L 1KYAA 1MFMA 3L3IA 3TPKA 3U79A 3QH3B 1SVBA 5ESQB 1ZHKB 2D4FA 3UDWC 5I23A 2ODIA 1S7UB 3SKNA 4Y1SA 3ZHDA 5C86A 4K3DL 1OP5H 4O9HL 2RFXB 4FQQA 4L8SC 2D73A 3BD3A 3MRQB 3RU8L 3EYUH 3DXAE 3QUYB 4Y4HD 5EZPA 5GGTH 1AR1B 2XJLA 4N4YB 4GKSB 2EDEA 1NIBA 2KKQA 4RRPA 3A47A 3HNVL 3LXCA 4KXZI 4XN5A 2UWEE 4ZSOB 3EDDA 2QADC 4JJOA 4HVBA 3EGXA 2WWMC 4Y7MA 3HZKA 5F3HA 5FF6A 5FW7A 5J13B 1GKOA 1OF2B 3MR9B 4NZJA 3WV0A 5E8DL 4X83A 2FK9A 2HKFL 1DJHA 1MWOA 2Y7OA 4OZFB 4ECNA 1MUJA 4XRCB 4LLWA 1WA1X 4JANA 5E24E 2ADYA 1JTOA 1Z5LA 2CXKA 1CDIA 2JKNA 2YXWA 4JG5A 4A6YL 4G42B 4Z3IA 3UTZA 5C0FA 3B3IB 4WUUA 5DHXB 5I24A 4U6XA 2J6EH 3QCUH 2LAAA 4UTAL 3QIUC 5IZ7A 1XSIA 1E2ZA 5KSBE 3DO7B 3BIAX 5JDSB 2CA3A 4A1RA 3QT2A 3GDBA 1H6TA 1VFBB 4F7TB 5EEVA 8FABA 2QEJA 4Y16A 3BMWA 3QPXL 3FRPG 4RMBA 3L4TA 4OLVH 1AJ7L 4TLUA 4L0PB 5IROA 4UUJA 1D6EB 1YNLH 4PRID 4QTHB 4PB0H 4WHDA 2BNRB 2A9CA 4KKQA 3LNFA 4R3SA 4IHOB 1KPVB 2WW8A 4HIIB 3E8VA 3LZOA 1P0SE 4RBPK 1Y0LA 4U0QB 3X3FH 5AB2A 1AMXA 3WAKA 1NDGB 4Q0XH 2O72A 2XYBA 1MVUB 3EH2A 3PJNA 3TFBA 5JHDD 3FQTA 2A99A 1CLZL 2PW1A 2Y6TE 1BFOA 1C08B 3BSZH 5SWSA 2NUTA 2DI9A 3DMMC 1NINA 3ZE2B 3R06B 4PGCA 3CC5A 2VT0A 4MCNA 1XH3B 4X6FB 4XXWC 1MREH 2EO9A 3N1MC 2E7CA 2ZJSH 4JCMA 5F7FA 3MRLA 3X3GL 5IB2B 1IV8A 1UXWB 4Z76A 1GAFH 1MW2A 1CF8L 3PHOB 1QABA 3EJPA 4M3JA 1EV2E 1K5NA 4NN7C 2PNDA 5KANI 2KC0A 3FU7B 5GGSY 4F27A 1A5FL 4P5TD 1T1YA 5FDYA 3RTQD 3CX5K 3HI5H 4Z7NF 1R5WB 3ET9F 4NQDD 4NQQA 1KCLA 3L7FB 4JQIH 4JFHE 5FCUL 1KIPB 3FHAA 3H6AA 3LH2L 2PW1B 2XKSA 4NO0D 4NAQA 4ERSL 3VFOB 1G6RB 5B7MA 2EDKA 2CBPA 1KYOJ 2YGPA 1E2WA 4A66A 1TZHA 4MJIE 4RWHA 4F15B 4DP9X 2VLLB 4JO3H 1UUSA 4QRRD 5DHVA 3TBCA 3DETC 1EJ6A 1WBYA 4NN6C 3B9VA 1X9UA 1AI1H 2R0LL 3DVGB 1LE5A 4YR6A 2Z4QA 5L6YL 3EIFA 2F68X 1GGTA 5ID0B 1FZJA 4LMQI 2FR4B 4Y2DA 1O5PA 4YGVA 4PIBA 4JFOB 3SDXA 5F96L 1T3FB 5T33L 2IMMA 4L8BB 1VADA 4DGWC 1G6VK 4HJGA 3B2VL 4IBUA 2PXYA 3ARDC 3HS9A 1IGTB 2FB4L 2R29L 4CMMA 4F91B 1TEFA 5HI4C 4X6CB 1GZQA 3VXTA 5J11B 2FIRT 3T4YB 5D8JH 3HG1B 3AG3B 2OSXA 4HJEA 2LU7A 3IGUA 1U8OB 1JRHL 1WIOA 4NZRL 4UV7L 4YHLH 2WP3T 4QRPA 4ABQA 2Y1VA 4FA7B 1F58H 3GHBH 2HFFB 3HKFA 4Z7WA 3WXVL 4HWEH 1NBVH 2BHFA 3AQDA 1SUJA 3HS0C 5DD0L 2YARA 1K3ZA 4NHCH 5L8LB 4DERA 4YHPB 4QDGA 1NDMA 3H3PL 1RZIA 3W11D 4YFDB 2E9JA 4OJYA 1X7SA 3ZQXA 5MP6L 3HN3A 2WMPB 3FT3B 1MCCA 4L37B 4RFNC 3BPLC 3CN0A 2EACA 1SMOA 4D3CH 4I18B 2QKSA 4RX4A 1ZSDB 5KTEH 1B2YA 2QSVA 3US9A 1CUOA 4APQA 5KYXB 4XCNA 4QRTA 1T04A 1BDYA 1T03H 1SY6L 3DMMA 5A2IH 4P3DA 5DRZA 1SXZA 2VLJA 4XVUD 1G7HA 4MNQD 5CLZA 2K6ZA 4OZHE 5FECA 2HFFA 3B1UA 3CZEA 4PG2A 5CKGA 3BDYH 2YEQA 5BRZD 4YK4B 3R8QA 2ARJB 4ZOCA 5F71A 5DYOA 2NY1B 3PWPB 3CH8A 3SGDH 2CUIA 3GQFA 1MFAH 4KTEL 4P46C 2C9SA 4XPFL 4HLJA 5KBKA 3FZUD 2MIZA 1T83A 2H6UA 1D7CA 2P8LA 3HPLA 3I9GH 2LGNA 4PJ8D 4YHIA 2F7QA 4GSDH 4YSEA 3OXRB 1KB9K 4UIKH 4KUCD 5E8EB 3RFZB 4KZEH 4HU2A 2EIEA 2L8AA 4ANKA 5F88A 5JW3L 1A7NL 4DHLA 4KZDL 2ICWA 1Q9LB 1E30A 2IPKB 3N41B 3DOIA 2OXHB 1C1EL 5K93A 3BXNB 1PKQB 1NC2A 2WO3B 3QUMA 4JW3A 2BSSB 4LBEB 5K9OB 2PN5A 1VFOA 5EN2A 5B3JF 1IZJA 3ARVA 6PAZA 4Y9FA 2F74B 4KJYA 5I8EB 3VA6A 3L3GB 2WAQA 3WFCH 1U8QA 4XC3L 4L29B 1U91B 3WE1A 4JFFE 4I48B 1A8ZA 4JPQA 5E2UH 3D8MA 1UASA 4N6RB 5E0FA 3NYKA 1P4LB 1DEEA 4ORZC 5K9KA 2B15A 3FF8A 2JCCF 5DMIH 3VRLF 2GT9A 3OZKA 4UBDD 1RI8A 3LKOA 5DJ0B 1RZJC 1L4IA 1RU9L 1T1XB 2DQHH 4P4RA 1TQVA 2EVFA 2VDKL 4YXHH 3NSDA 1RZJH 2CJUL 3GSNH 3CUPA 2P52A 3W9EA 4G8GB 3DUSA 4JDZB 5C3TA 1EHKB 4HEPA 3IJYA 4DCQB 4KY1L 4R5TA 3MFGB 5C7ZA 3MDJA 1A4JB 5JPNC 5I2IB 3QWQB 2JQMA 4FMKA 4PP2B 4XMLL 4Y4KA 3L4WA 4Z7VF 1IUZA 3ULSB 1X5KA 5AG8A 2PW2B 3P40A 1J0KA 2YEZA 1YNTA 4M7LL 5T5NF 5TQ2L 4A6YB 5JLZA 4K7FA 4OZFH 3TYFA 1C7SA 1DVFC 5KSVA 1T1XA 3L5IA 1G7QA 3FH5A 3RX9A 4MMXA 4ZO8A 1HIMH 2VDQH 1U8LA 4OCRL 1MJ8L 4NQXA 2Q2EB 2JIXD 2DJUA 1KJMB 5KS9E 4TVPL 3HZYA 4H13C 4Y4KB 4J1UA 3IDJA 5DR5H 5CZXD 5AZ2H 1SMAA 5BZWA 1X5LA 4K94L 5I9QB 4A68A 3JQOB 4FADA 4JM2B 3HS0B 2R51A 4Y4FA 3ES6B 4DQOL 3V0VA 3FB5A 1XGTA 1FV1A 1JV2A 4XAKD 3TONA 3G5YA 1IM3B 4MMYA 4FJYA 3Q9PA 4Z77A 3IFOA 5I74C 5ENWB 1A3LH 1JN6B 2Z8SA 2OR7A 1JUFA 2ATKB 2FLBT 2OPCA 5GZNA 1D5XB 1K4DA 4DW2H 5CEZL 5MI0C 4GXVL 1UZ8B 3S88H 3ARFB 3BVNB 4O9HH 3BH4A 3L1FA 3L4UA 4L4VB 4X98B 2GCYB 5DDHA 2RJMA 2RFXA 5CBEA 1IFGA 4HIJB 1N0LA 3ZRFC 4QRRA 3FUIA 2F58L 1M05A 5I1DB 4TNFA 3GBML 2GAZB 1WBZB 3WKYA 4OB5L 5DZPA 5E2JA 3QUKA 4ZFZB 2CR3A 3QR1A 4LDCA 1RIVL 1UD8A 4PJIE 3ZT5A 4QLWA 4FQ2H 1JHLH 4GEIA 1ZAGA 2BVUA 3HZVB 3KW7A 4XC1H 3PDOB 3WIFA 4XNXL 1B88A 1S2EA 1DJGA 4OVUA 2NY3D 4R4BA 4XCYA 3RGVD 1E4XL 3A4FA 1MCBA 2BPBA 2YAEA 5J6GB 2CWRA 3OKOA 3KCWA 4UILH 4HAKA 2OMXA 1N5YH 3QYMA 1OZUA 1DQDH 4B9IA 4I8DA 3KLLA 3H42L 3T4AB 2CNYA 3LKRA 3QIBD 3VWKC 1JZ8A 4HLZG 1OLZA 2X88A 1A1OB 3A5VA 4M1CC 3VI3F 5LQBL 2YXFA 4GAFB 2MPAL 2NXYD 5T5FL 1S3KH 3OSVA 1NJ9A 1EO8L 2YA1A 2VDRH 3V7AE 4F3FB 3W38A 4E36A 3NDYE 5AVWB 4N20A 2E27H 1D5ZB 2IWGA 5H2BA 1SDAB 4OKVA 4MA8H 1LEIA 4NNXB 4EZMA 2DQCL 3EOAB 4KK5C 3WUWA 4HIEA 4XPBL 5B4MD 2Y1YA 3C12A 2WIIA 4X4ME 1RJZA 4DK5A 3UTTE 2C9QA 3IS0X 3S3JA 1A9EB 4YWGH 4G9DB 1BAFL 2LLLA 5J57B 4AEHL 3SCMA 3P4LA 4OIFA 1JZ6A 3DPBA 4P9MH 4BH8B 4APXB 3JV6B 1FVDA 3AZUA 3VXRE 1P69B 3F58H 4RH4A 4PQXA 4YPGB 1FFPB 2HFGL 4WWKC 5DJDB 5MENE 3BAEL 4O58L 1IGJB 2M2DA 5JPMA 2XIIA 3V5DB 1MCEA 5I16A 4GUQA 4OF7A 5CLWA 2K7PA 2QSCL 3TJPA 2Z0BA 1XR9B 3WFBL 2PXYD 5B1CA 4EDWL 3EG9A 4K9EL 4LAQL 1IBYA 4ERSH 4PTUB 2XBZA 4WK0B 5T5NG 4QKTA 4JRXB 3HHSA 4O51A 3LH8A 4Z0XA 4NS0A 1MCHA 4YDLB 5J3HC 1SLUA 1ZT1B 1JL8A 2B4CH 3CDYA 5DHYA 3QZNA 3ZDZB 3GSRA 4J2XA 1EBPA 2JMRA 5TFSH 4LHUD 4I0CC 1BA9A 1XF3B 1G0XA 1IGCH 3JUZA 1BPVA 1FG2B 2IWKA 3V5DA 1RZ7L 2BHZA 4JAMB 3FCUB 1N59A 3WJMB 3KDPB 2YLKA 4JN2A 3REVA 5TDOA 4HUVB 4KTDH 2G0LA 4IIQC 1WWBX 3TBVB 1ZJAA 3EFFA 3WHXB 4HKBA 3ARUA 3OM3B 5JOPE 3OMIB 4M7JL 4HQQH 4DVBB 5AKTA 1V7ML 4GJTB 4F7CB 4I3RL 3R4DA 3AGVA 4FX5A 3FQRB 1I3RB 4YO0B 1I8IB 1NCUA 3OVUB 7FABH 2IMNA 4PN6A 3JTTB 4PJ7E 4CJ1A 4N2AA 1IBDA 4MHHG 4NZRH 1PG7H 4PCSA 2OMBA 4WUUD 3O0LA 3O0RH 4WW1A 3GEWB 5LGHH 4RBPH 4DGIH 3UFIA 1QSEB 3VFVA 3LMJH 2X3AA 1HHIB 1TQBC 1X5HA 4IKIA 5KSAC 3IK2A 4HXBL 5FEBA 1S7SA 3KBFA 4KQ0A 2G4GA 3QJFA 3L6FA 3QFDB 5C0BB 3H9ZA 3W5MA 5IROD 2AK1H 2RGSA 5C08B 4ZTPH 3HPLB 4YHIB 4DH2A 1J5IA 5HHOE 4YK4C 5HHMD 4LSRL 5DJCA 1GCFA 3MCLH 4JFEB 3L9RA 4IRJC 1CXKA 1HHKB 3OHXB 4HMEA 4HWNA 3HVDA 2X70A 3T0VA 1DDHA 2P46B 5JHLL 3TJHC 3Q1SH 1F4XH 1UACL 3NP3A 4MVBD 1MXDA 1RFDL 5ICZA 1G7HB 4HKZA 2CMRH 3QXUA 5CM1A 2VUYA 3THMH 4AJYV 4LSVH 3DK0A 2X7LA 5CUSH 2AEIT 3L6FB 2ZSWB 1YPZF 4X42A 2BVOB 2PYED 4YDVA 4N2OA 2XQYK 2OL3L 3NIFE 1T2JA 5F9WB 1IEAB 2XKNA 1ROCA 4PRIB 3DO4A 4YDJB 3L16A 1BF5A 4AQAA 4X7TA 5LNGA 4JANB 3LPOA 2ITCA 4XN7A 2ZXAA 4ZMQA 3GLAA 1IL1B 4V11A 2R27A 4YHYC 3C6LB 4LCYA 5EEXA 3DMMB 2C9AA 2OI9B 4RZCB 3SJVE 4NC1E 3UCQA 1YQVL 4P9ML 2VZ1A 4W6WB 4Z7VE 5A40E 3PGCA 4PGEB 3FU5A 2DWDB 2XN9A 2PCFB 3GYRA 2D9QB 3CN2A 2FT8A 1K6QH 2H1XA 3IRZA 4PREB 3T65B 3L1GA 4J2QA 1OIOA 1HZHH 1NFDB 2H1LM 2Q3AA 1GC1H 3FB7A 4IRJA 5CD5D 5DD3H 2XA8H 4PVLA 1Q72H 5AD0B 1WZ1H 3IGFA 3WY1A 5EF2A 2GUOA 3IJEA 2GVYA 2HJKB 3L3KB 5GS2H 2JKSA 2V33A 4XX5A 5SWZD 5C0JA 1OEZW 1MCSA 4QHLA 2CR6A 3MNZB 1HJBC 5DJ8B 1QFUH 3D18B 2AEPH 3KL5A 2XWJB 4FNLH 1OPGL 5SWSB 1QHQA 5D2LB 2ZUQB 3QIBC 4FYTA 3VWKD 3WD5H 4ANUA 3CC5B 3EYFB 3PJSB 5IHWA 2X4RA 5DMKB 3UPRB 4P57B 4WTZA 2FNBA 2WKOF 1HAWA 3MV01 2OCCB 2R1WA 3RX5A 1LMKA 5EO9B 3HE7A 3RWIB 2LFEA 5GJSH 2EADA 3NPZB 5F0JB 4JKWA 1CXIA 4RESB 1FE8H 1VEPA 3FQWA 4GW1B 3IJHA 5FO9B 1GYUA 1MCWM 2IEPA 1VKXA 4G80B 5DD1H 5MHSE 1B3IA 2EQDA 3DX7A 2QT6A 1G7PA 3KEDA 2D2CC 3HPJB 3BIKB 1CVRA 4HIHB 4MLSA 3V7MA 3FU9A 4AGOA 3GMOB 5FR3A 3FQ1A 2X4QA 3TO2A 1MWAL 2NZIA 4HH8A 2CG9X 4U6TA 1KCUH 3E6FB 1QLEL 2H32H 5LLIC 4BXVA 1XMEB 2R0ZL 3O0RL 3I50H 3ZE1E 2DZEA 3RPIB 3RGVC 4DAGH 1N12A 3FQWB 5BRZA 1ECZA 1CE6B 1ZHNA 3DYMA 1AGEB 4Q4EA 2ZOWA 2K9UA 4P46A 4IBQA 4PJIF 2QVKA 2VC2H 2E9GA 4DP6X 1FAKT 4EQ3A 5EOQL 5IJVB 1NLDH 2GUYA 5MEOB 4AZUA 3HFMH 4NO0B 1HH6B 2ZXEB 2XV0A 4L4TE 3LIZH 4V1DA 4WO4A 2JJWA 3QUHA 2WD0A 3GRWL 3UDWA 4PJ5B 4M29A 3FQTB 4Q2ZB 2X05A 2IFGA 5CEYB 4UTAH 4PI0A 5LBGA 3ALWA 3ZMEA 4AH2B 3K71A 3KPNB 3VQMA 5DI8A 5KAQG 1BQLL 1U0QA 2BNQD 1GYWA 3TO4A 2FE0A 4QO1A 4ELDA 1PAMA 1ETZB 5I1IL 2FX8L 5H37A 4DPBX 1KENH 1WIUA 1FVEB 1AHWA 1CDHA 2CO1A 2NY5L 2AV7A 2YUWA 5H94B 3CH1B 2FEEI 3OHMB 4I4WB 3C8HA 4PJHF 4OLUH 4B9FA 1OSEA 1XD0A 4ZW8A 3Q8CA 2Q9OA 1CO1A 5EPMB 3F6LA 4XCNB 1SVZA 4FZ8L 3C6EA 4EI5A 1HCYA 1NCJA 4MJJA 5AZUA 4BFNA 1VHPA 2C4FT 3EXLA 4DKDC 4TQHA 4MGXA 5EU4A 4OZGA 4HW6A 5JDSA 1NMAL 1UZ6F 5KANG 1XCWA 3W2DH 1ZY9A 2GEEA 5BV7C 1N19A 3TPUB 1FGVH 3IDGA 4NSKA 4W9DC 2PWHA 1JJUA 3UOAB 3TBYA 1YN7B 5IHUH 3CDZA 2P8LB 1PIFA 1QRNE 1AOZA 1BJMA 3FO2A 3GRBA 3UZEC 1J9RA 5IQOA 3GSWB 5DVOA 2DYRB 3O6KL 4WU5B 4O4YL 2H8PB 5DK2B 4IBTA 1L5GB 4BXSV 1IGYA 5DWPA 2MHAA 2PP8A 2DOCA 2UXGA 1KBBA 2R1XA 5EU4B 5AALA 3TJEL 3ZT6A 3U30B 1MAJA 4BK5C 1NDTA 2B39A 1I8MA 1GOFA 2CO6B 4G6FB 3HB3D 3T8VA 4JO3L 4HYTB 3QZPA 2WP3O 3HBPA 5E8PA 5CWSA 3WGUB 4HISA 4JZOA 4QWWC 2XWBA 3SEPA 3LAFA 4MCMA 3FUDA 2FIKB 4NJAH 1DN0B 3QFJA 1ZHLA 3MZGB 4OLWH 5EO0B 4DTGL 1RZIB 3FL7A 3KH3A 4N2BA 3HBQA 3D52A 1IC4L 4G59C 3VD1A 3OGCA 4F8NA 2BSTA 4J4PD 3APNA 1MRFH 3ZY7A 4Z7WF 2WSPA 2JIXB 3HCVB 4WKXA 4XP5L 1TKWA 4PBVC 1U4FA 3EYQC 3TYGH 4BRJA 1KY7A 3QE5A 4OZFG 3NGBB 3KS0J 1U95B 1O6SA 3ZE1B 3WNJA 4ENZA 2XWTA 4M5SA 5G4NA 2VW4A 4A6YA 3QDMB 3BH8B 4JRWA 4PW9A 1FYHB 3SY0A 2Q3ZA 1DLHA 1B2WL 5DRWA 1XEDA 2XOTA 2GY7B 4W9EC 2OYPA 1HEHC 3GWJA 1EEQA 4O02A 2O5YL 3MV7E 2YQ2A 2RH0A 4HJGB 1DBJH 5EA0L 2R69A 1C12A 1O7VA 3D4GA 3G6DH 4OFIA 3QS2A 4QOKD 5D1ZC 5F44A 5AVZB 1INEH 1P7BA 4U3CA 5D96C 4BKTC 3LN4A 2B5IC 3LVEA 4HULB 5E8EA 3RFZA 5I8KH 1OE3A 4WW2C 3RWCA 5DJXB 2WZPD 1FFOB 1II4E 4X6BA 1WHOA 4WNJA 4MBOA 5DD6B 5JW4M 3MN8A 4OFQA 2CUAA 4JPSA 4HXBH 3UC2A 1HAUA 1DP0A 1U8PB 2EC8A 3QDMA 2PCPB 4WU7A 5F89B 3UYPB 1I85A 3S35X 5EEWA 4KXDA 3C60C 1X7QA 2AK1L 3DPDA 4P23A 2OZ4H 3I6KB 2VMCA 1JPFB 1IIKA 1ID2A 2C3WA 3CLFH 2NY4C 2QGDA 5DC0A 2X09A 5TPWL 2NDFA 4L4TB 2VOTA 4FTVB 1LLAA 1AGBA 3U0TA 4ABWA 1KDJA 3SDCA 3TWCL 3SZ6A 5A2LH 2EE0A 5BRPA 3KAAA 2CQVA 1H3WM 3QDGB 5DZJA 1I8KB 5EC1B 1FFOA 5C0AD 3UTTA 4APQB 3T4AC 2CBTA 35C8H 2ROYA 4R97B 3ABGA 3L8QA 5CBAB 2BNRE 3NESA 2X6AA 4BEIA 4UU9B 1EXHA 1MELA 5C0BE 5HI5D 2Z35B 3RZCC 3QORA 4XO9A 4PREA 5DZ9A 5CN3A 1SQMA 2VN7A 4AVHA 1A6TB 4MA7L 1HKLL 1LL1A 1BFSA 2UUDK 3J07A 4WFGE 5KVDE 3QHFH 6FABH 1QEWB 4AQEB 4JRYB 2X4PA 4HC1H 4KXAA 4FFYH 2BNRA 3OLIA 1SOXA 4LVOB 2E4FA 3APFA 4ZD3H 3EH3B 3SDAC 4M93B 1KTLA 1HZKA 2OMXB 3D85B 3RGHA 1QP1A 1UEMA 3O6KH 1CLZH 2YXVA 3BSZL 3LRGA 4LSSL 3MNWA 4ZAKD 4XP6L 2RQ8A 3ULVH 4CN6A 2MH4A 3STZB 3D2UB 1Q94B 4DKAA 5KG9B 3HE7D 3O4OC 3UBGA 4AMXA 3IN2A 3NJGA 4NKQB 2JB5H 4KK8D 5LGYA 1FAIH 5LG6A 4JVWA 1KFAH 3DKHA 3B56A 5GHWH 1RUKL 3T0EB 2Q3XA 4Z0BH 2J8HA 3HHRB 4PI2A 3R1GL 1LDPL 2IWEA 3QDGD 2PYFB 3WUWB 4H8VA 4I88A 1ERNA 1LEKA 3H9HB 3HN5A 1HI6A 3MRCA 2FEDC 4GG8A 3VCLB 1PZ2A 3K6OA 1DFXA 3OKEA 1DQMH 2OCFD 2FECI 3U1QA 2WV3A 4OM0H 1X5IA 2NW2A 1CD1A 2ATKA 2QMKA 3UERA 5AAWA 2P28B 4PJGF 1J0ZA 2K3TA 2VXSL 3ULUF 4OSUH 4AC4A 2NOYA 3LZFH 3K4AA 3HE6B 3S37L 3WEXA 5DLML 1D7DA 4P0DA 1UGKA 2R0LH 3T0EA 1IAKB 4HGKC 4K94H 2OYLA 3QDJE 1ZHNB 2IG2H 1FBIL 2ZKHH 2HN7A 5BVPL 1U3NA 3B9DA 1MLCB 2HTKD 2L7QA 2VSCA 1AD9B 1RZ8A 4AKOA 3N85L 4DVRH 4MZ3A 1KIUA 2XICA 3VFGH 1R5IA 2UUDH 4R8WH 4AVKA 3QI9C 2VDNH 1UJ3B 4WFGD 5IB5B 5IBLD 3GMOA 5IVXE 2XWZA 2ZCHL 3EOYG 2VSMB 2F8XC 1WFJA 1SN0A 1D2PA 3RIFK 1SDDA 1BD2A 4HALA 2BVQB 4XVTL 4ZFFB 3LQZB 4Y7OC 1OM3H 2ZF8A 1T5KA 2EXTA 3ARGC 3MGOB 1EAQA 3FNKA 3KYOA 3U4EA 2XY2A 3M17A 4HKBB 3ATAA 2PABA 4WI8A 2HRLA 1JGDA 1QZNA 3NA9L 2AANA 4OI9A 4Z77B 4AIXA 3GPSA 2ORBH 2V7HB 3NJLA 3WY4A 4M1GL 3HPJA 5ID1B 3NAAH 4ZMOA 4Z3FA 5MEOA 3I6LE 4N2FA 4U1HA 4MAYC 4P05A 2HP4A 1T7ZA 1JF1B 2IAND 3BP6B 5C2BH 2A5UA 2NNFA 3MI6A 2BK8A 1Z9SB 3VYNA 4BSWA 3HJEA 1QBML 4LSQL 1WIPA 2BNUA 1JNLH