2BWDA

Atomic resolution structure of achromobacter cycloclastes cu nitrite reductase with endogenously bound nitrite and no
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 90
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA02
1OV8A 2JKWA 3QJVB 1PZCA 3DTUB 3PXLA 2UX6A 4G72B 4WKXA 2VSMB 1BXVA 1J5CA 5I5MA 2B3IA 1EZLA 4YSDA 1JZFA 1SF3A 1QNIA 2IWKA 4HIPA 4BXSV 2MTAA 2BP8A 2QDWA 1M57B 1A8ZA 1AZRA 2PCYA 1KV7A 1PLAA 3MBWB 2GC7C 3FU7A 1AR1B 4AKOA 3AW5A 1A4AA 1NIFA 4NB7A 1AAJA 1GS6X 4A2HA 4KOCA 2X87A 4DP8X 4DP6X 2YARA 1A4BA 1XB3A 4DP2X 5PAZA 1XMEB 1QHQA 2VW6A 3FSAA 3ZX1A 3NJGA 1E5YA 2UXTA 3AG1B 1OCZB 1PNDA 3EHBB 4DP5X 4YL4A 2TSBA 4YSSA 2J55A 1ET5A 4QLWA 1JXGA 2XWZA 2BWDA 4KNUA 1J9SA 3ERXA 4HALA 3IN0A 3NJLA 4GP5B 4YSCA 2OV0A 3ZDWA 3NT0A 3FQYA 1GW0A 5B1JC 1NWOA 4G7SB 1PLCA 2YAEA 2YAHA 1FA4A 1E5ZA 1FFTB 1RZQA 2ZOOA 3OMNB 1WAEA 3UABA 2ZONA 1OE1A 3NJIA 4HHWA 4BXVA 3ZBMA 4YSUA 2GB2A 2QT6A 4N8UA 3X1BA 3ABGA 3CZUB 1E30A 1JZHA 4A2FA 4BWUA 2CUAA 1R1CA 1V54B 1AANA 2BHFA 3TBBA 4G70B 1L9QA 1L9SA 2UXVA 1ID2A 3T6WA 4F7KA 2FQFA 4YSOA 3OMIB 3CDZB 1IBYA 1MG3C 4FAAB 4YVUA 2OJ1A 4WTQA 3SBPA 2WSDA 2FT8A 4KO5A 2YAFA 2J57A 4KO7A 1BXAA 1X9RA 2EIJB 2AFNA 4KNSA 2I7SA 1ASQA 4CSZA 5I26A 5AKRA 4A2GA 1NIAA 1IC0A 2J5WA 3GYRA 3NJHA 3ABLB 2CBPA 2R7EB 1AS8A 1E67A 4YSAA 2PCFA 4EF3A 4PCYA 2VW4A 4DPBX 3SQRA 4Q89A 1W8EA 4A66A 1NZRA 3T6XA 4UF7C 1ILUA 3CVDA 4E9SA 3SBRA 1NINA 1WA0X 3NJJA 5EHFA 1DYZA 9PCYA 3S8GB 1SHWA 4NAJA 1NPJA 4KO6A 1GR7A 5IY5B 3NJNA 1J5DA 2FJSA 4GP4B 1N68A 5I5JA 1KBVA 3H56A 3S3BB 3CDZA 3FYEB 1RCYA 1E65A 1TEFA 3QJSB 5TK2A 5B7MA 2IDSA 4E9YA 7PAZA 3FSVA 4DP9X 3PCYA 2FQEA 2BP0B 3AY2A 3IE9A 1PF3A 2UXFA 4RH4A 4W9ZA 5I28A 6PAZA 3JTBA 1ADWA 4HAKA 5LDUA 2GBAA 5ANHA 1NWPA 2PLTA 1AS7A 4A2DA 3EH5B 2XU9A 5FC9A 1NPNA 2WO3B 4YSPA 4YSRA 3QPKA 4JHVA 5E9NA 3BVDB 3S3DB 4DP0X 2YAPA 3HEIB 2XXGA 2Y69B 1JZEA 5I6NA 3FU8A 1AACA 2BW5A 1AQ8A 2BO0A 1SFHA 2QDVA 2HRHA 1F56A 4G71B 4YSEA 2B08A 3X1EA 3PAVA 2VSKB 4X4KA 2HZHA 1W6LA 2H3XC 2VM4A 5B7EA 4E9QA 3ASOB 3NP4A 1B3IA 1NIEA 3WNIA 3EH3B 2HLEB 4CSPA 1AIZA 1BQ5A 3IBOA 4AI7A 3KW8A 1AZNA 2ZXWB 1JERA 2E86A 2FNWA 3FYIB 4GY4A 1IBZA 1TKWA 1VLXA 2GIMA 3UGEA 3X1NA 2XLLA 4MFHA 1CURA 1KDJA 1HAWA 3QJQB 2DYSB 1CYXA 3T6VA 4E9VA 2XXFA 4F2EA 1J9QA 3OQRA 3NJFA 5B1JA 1J9RA 4AZUA 3WG7B 3MX0B 2EILB 1BYPA 1RKRA 4HHGA 2FT7A 3AG2B 1X9UA 4HZ1A 1KYAA 2DWSA 1ZPUA 1KGYE 1ILSA 1SFDA 3IN2A 3WKQA 1T5KA 4ENZA 4E9RA 4YSQA 3WIAA 2FTAA 2YXWA 3T6ZA 1KCBA 1ASPA 3FT0A 1MDAA 1GSKA 2EINB 1NIDA 3JT2A 1ASOA 4TXVB 5D4IA 2H47C 1DZ0A 2Q9OA 1PZAA 3S3CB 5I6KA 4HCFA 1W6WA 1OF0A 2WO2B 1MZYA 3UAAA 3FU9A 1ZIAA 2UX7A 3ZIYA 1OCCB 1PLBA 1GY1A 1PAZA 1L9OA 2I7OA 4KOBA 1SDDB 1RZPA 2XVBA 1AG6A 3V9CA 1HAUA 2XX0A 2CALA 3OM3B 1NIBA 3OD3A 2VM3A 3S8FB 1SNRA 5B7FA 1UATA 4L0PB 4GP8B 3NP3A 2XX1A 4QKTA 4UAHA 1MG2C 1ETJA 2JXMA 1J9TA 3ASNB 4JHUA 1KDIA 1SF5A 4DP7X 1NDTA 1GYCA 1BAWA 4GXFA 2XV2A 1JXFA 1WS7A 2N0MA 2QPDB 2PPEA 4YVNA 3QJTB 3DIVA 3UACA 1SHXA 4G7QB 2GI0A 2GC4C 2X88A 3NSFA 2IAAC 2CJ3A 4JKNA 3HB3B 2GSMB 4YSTA 4P5RA 2NRDA 5I6LA 1PMYA 3FQ2A 3BQVA 1NICA 3CVBA 4PAZA 2HRGA 2Q5BA 4M3HA 3SBQA 2YAQA 3X1FA 3ABKB 2BP8B 5D4HA 3TA4D 1WA1X 2W88A 2AVFA 3T71A 2AANA 2YQBA 3FU7B 1GS7A 2P80A 2A3TA 3D12B 1AZUA 2DWTA 3H4HA 1AG0A 2R7EA 2IH8A 3QJRB 1V55B 1JVOA 1I53A 1V10A 1OE2A 7PCYA 2I85A 2IDUA 2PPDA 3NSYA 4AKPA 4KO9A 1AZBA 2P80D 2XV0A 3WI9A 2IDQA 3PAZA 1KBWA 1HFUA 2EIKB 3AG3B 3NSCA 2CCWA 1NTDA 3N55A 2GHZA 2IWFA 2VN3A 3V9EA 2PPAA 2BW4A 3EF4A 4BWWA 2PP9A 4P5SA 2FQDA 3NJKA 3WKPA 1CYWA 3UAEA 2XV3A 3CVCA 4F2FA 3GDCA 1M56B 4A67A 3NYKA 3DKHA 2BP0A 1JXDA 3C75A 3QQXA 4M4RB 4G7RB 4BDVB 5A7EA 1OCOB 1QLEB 2IDFA 3OMAB 1WA2X 3T9WA 2CAKA 4A2EA 1ZDSA 2H5UA 4N4YB 5I6PA 2Y1AA 1GY2A 2VW7A 2XYBA 1ET7A 1L9PA 5PCYA 4DPCX 2FT6A 3FPXA 8PAZA 3PAUA 1L9RA 2PPFA 4BWTA 1BYOA 3ABMB 2YAOA 2RACA 1GS8A 3L45A 2PP8A 2BWIA 3FS9A 4W1TA 1PZBA 2DY2A 1PCSA 4E9WA 1CC3A 1JOIA 1PNCA 5F7AA 4FA7B 5I6OA 1BQRA 5I5IA 1AS6A 2FQGA 1PY0A 3KW7A 1KCWA 1ZV2A 1XB6A 6PCYA 5B1AB 2DYRB 2XUWA 1JVLA 4KNTA 2YAMA 3FPYA 1L9TA 2BZCA 2HX8A 1CUOA 5TK4A 3TU6A 3WNJA 2HX7A 3X1GA 1N70A 3GXUB 4BDVA 1FWXA 3G5WA 1SJMA 3TASA 4ZK8A 1XB8A 1JZGA 5B3SB 2AZUA 1OOWA 3AZUA 5B1BB 3NSDA 1OCRB 4A68A 4E9XA 2LLNA 4DPAX 5I6MA 1A65A 2ZWNA 1MZZA 3AG4B 3FSZA 1OE3A 1URIA 2QPEB 1AOZA 1JZJA 1AZCA 3UADA 5F7BA 1BEXA 4GYBA 2VMJA 3FQ1A 5D4JA 4AKQA 3X2QB 1M9WA 2AZAA 2HXAA 3H4FA 1IKOP 2EIMB 1TEGA 2W8CA 1A4CA 4DP4X 4E9TA 3CG8A 3U25A 1WS8A 1IUZA 1JZIA 3PPSA 2TSAA 1A3ZA 4UANA 2BZ7A 2JFCA 2MRYA 2UXGA 2YXVA 4K9JA 1SDDA 1YLBB 1ET8A 1ZDQA 2PPCA 2PP7A 2DV6A 5AZUA 1ZIBA 2IDTA 5B1KA 3EH4B 3PLYA 4HCGA 2IH9A 4Q8BA 4HCIA 3FSWA 4AX3A 4BK5C 2OCCB 1BXUA 3TBCA 4NERA 2J56A 3N2JA 3NJMA 3QJUB 4DP1X 2FWLB 3IEAA 1BQKA 1TU2A 3RYMA 5AFAA 2HX9A 1EHKB 2IWEA
chains in the Genus database with same CATH superfamily
1IQWL 1YNTA 3A6CL 3PNWB 4QYOA 4X8JB 3RX7A 4G80B 1P69B 2IBZX 3PP4L 3FTXA 1Z9SA 3NK3A 1BOGA 3HIZA 2LABA 5L6YH 4PTUB 2IBGA 3EBHA 3HNVH 4ICXA 4ZFGL 3IAGC 4YHML 1YEIL 1IO4C 2QEJA 2CIKA 1KLGB 3T0VA 1IEBA 1YN6B 3CSBA 3FQNB 1A5FL 1EERB 4POZC 4KJPD 3FU3A 2MQGA 4N3TA 1PJWA 2WBJA 1JL8A 2UYLB 2LHAA 4UNTA 2Z8WC 5I0DA 4IKKA 4ERSH 3A5VA 1FPTL 5E0QA 5FUZH 4JM2A 3ZQWA 4ZNEA 1YDPA 2RIKA 2AJYH 3GFUA 3I02B 4IOSA 3MRIB 4KKLD 2NUPA 5HI3D 2BSEA 3RWFB 3SGJA 4MJIA 4QJ4B 1RLBA 4F15B 4Y7OC 4H5SA 5KVGL 1UM4L 4NPYB 5PAZA 1SBSH 4WI0B 5KSAC 2YD1A 1E50A 2IWGA 4PTTB 1UCTA 5J1TC 3O3AB 4FG6C 3SYCA 4P2RD 4IDJH 2ZXEB 4FL4B 2HFTA 1DJWA 4RMQA 5HPMB 3BVNB 4NRYB 4NYLB 3K2UH 1QBLH 4YPGA 5GGVL 4JE4B 4TKWA 4DOHE 1HQRA 1DHKA 2X4OB 4WO4D 3NEOA 5BV7C 1DUYA 1GJIA 3NJLA 1OSEA 1S7SB 3U0TB 3B8SA 3VE0B 4HH9A 2DF3A 3TH3T 2JV6A 4PRHA 2X10A 3SGKC 4MNHB 1YPZF 1QSFD 2PWHA 3JYBA 3QVAA 3MUY1 3DX1A 2KLTA 4YC2C 4BH8B 3UJIH 3MBWA 4HHWA 1BQHB 3RWJB 2GB2A 4N8UA 1WH0A 2WLIB 3OKYA 3CSPA 3TBBA 3QI9D 1I1AD 4DH2A 3FHAA 4MMZC 5AW0B 1ETA1 1L9QA 3O2VH 4LF3B 1NJ9B 2UXVA 4N2MA 4RFNB 1DBKH 2R4RL 3FFCD 1IGCH 2X53A 3FQUA 3OMIB 4FJZA 2WTPA 4YHZH 2VZVA 4WTQA 2HJKA 4LQFH 3NACH 4ADGA 4F8PA 4X5XA 1RIHH 5EV7A 2WZPD 1J8HB 3HPLB 1ZGLB 25C8L 3NDZE 4IBTA 5AKRA 2WXNA 2OS7A 1LO4L 3HI6L 4CSZA 2VDNH 4BRVA 3K46A 5LBGA 2PXYA 4PJ8C 3DPBA 4Z7VA 2PCFA 4AIXA 4PLJD 1AFVH 4NO2A 2EYSA 1NFDF 2CO7B 4NT6B 5DJ0A 1B0RA 2A6KB 3ILDA 4XPGH 5K9QI 1K8IB 3VFMA 1ZSHA 4AMXA 4DGYH 2VYRE 3CLEL 2GJPA 2O5NA 1SJEA 2LVCA 3LH2H 4I1RA 4ORZC 4XVJH 2WKLA 5KBLA 1HYRC 5DJXB 3LZPA 2X89A 1OZTG 3WS3A 3MLTB 5I76B 2X4PA 5DJ6B 1CDYA 2HH0L 4KTGA 4BCYA 5EU4A 1SY6H 5ITBH 2WXLA 4NUJB 3WAKA 4KMTL 3LH9A 5A2KH 1OXYA 2YD7A 3QDGE 5I74B 5L2KD 1ZVHA 2BVQB 1U8IA 4UZGA 2VDPB 3L3GA 1UWGL 5BOPA 4IRSD 1VFUA 3K0YA 1X9QA 3RDTA 2OJEA 5C0DA 2BH0A 5F6HJ 3MRRA 2COVD 4Y5VA 5F7DA 1CIUA 3HE7B 2OMXA 4PJXA 2OL3L 3MRBA 4JL2A 2BP0B 2NY5H 2XPGB 5K1VA 2YEZB 3TZVC 4YHYB 1DL7H 4BFNA 2XTJC 4D7BA 1XHHA 5L88H 3MCKB 3P0VL 4HD9A 2AQRA 4OFVA 5FHAL 2ADJB 2C3VB 2NY0D 3KD4A 3MJ7B 1E27B 4Y5XC 4F33A 4ZS7L 5LO7A 2JELH 4WO4B 3KPPB 3TJPA 4YHKL 4A2DA 5IT2H 3EUDA 4Q6KA 3GIVB 4RRPG 2P5EA 2CKNA 3BVDB 1XAUA 2YAPA 5BZZA 4JDVA 4FP8L 1NCGA 1UXLA 4OCLC 5CHNB 5DHDA 3VXMB 4D9LH 2JQMA 4N2KA 5DD5L 3LQZA 3FTVA 3X1EA 1YJDC 1HL5A 5BS0D 2JLLA 3FOLB 3WY1A 3TPKA 5KVFH 4PRDA 3ASOB 1F4WH 2OMUB 3UZVA 2JKIS 5KSAA 5AW4B 4LPTA 4EQ3A 3QI9B 5CM1A 1QUNA 3T8XB 3H7BB 1U8CA 4NKOB 5KUMA 1A6TB 4JM4H 2JF1A 3FFCB 2ZT9C 4HEPA 3X1NA 4X98B 3IDNB 4PRIE 2XLLA 2DI7A 5I2IB 1AGFB 4YLCA 1IE5A 3H3PL 2XWTB 1E40A 4JR9H 3FHQA 5GGQH 4L0ZA 4TM9A 3NCXA 43C9B 3GUTA 5F7HA 2EDWA 1VADB 3SGKA 4KI5F 5CD3A 2Y5TB 3IMBA 5ESAA 2X3AA 5T1JA 1HNYA 5CXPA 1MHHA 1TTAA 4Y9GA 4XMWA 3N1FC 3QZWG 4ENZA 3UC0L 3WIHH 2VAAA 2KL6A 4O51B 2Q2EB 4F24A 1UM5H 4UILL 4Z0XB 2O30A 5KBNC 3APMA 2G3ZA 4YIQB 1CE6B 3EFDH 5FYLE 1JUFB 4MMZA 3S96B 1VCBC 1PZAA 3INUL 3NIGE 5AW2B 4JLRA 3KL5A 5ICYA 2X2HA 2AJVL 1FFRA 2YD8A 2EIZB 4WWID 2W07A 3DIFB 5L2KB 4WKZA 1UOVA 1B0WA 2E7MA 4QEGA 5DK0A 2QHLA 3V9CA 1OANA 4DW2H 1FNSL 3GWJA 3UXFA 3TBWA 2O72A 3NPZB 3C5ZD 3OAYK 1U4FA 5EZPA 3Q2VA 5IHZB 1WWBX 2VQ1A 2YSSB 3MOBH 1CS6A 4NQCE 4PJ8A 4QKTA 3TESA 5C0BD 1J9TA 2DQDL 2CDGA 4NO0D 1PVHA 3N04A 4ZTPH 1EEZB 2IALA 1NH6A 1VJSA 4R26H 4YDIL 5CEXB 2Y4SA 4LAJH 1X9LA 2AQQA 5DI8B 5I23A 3CVHB 5MEPA 1Q0YL 2UWEF 3T4YB 1EHXA 4QTHA 1PKQB 2GI0A 1A3RL 3K6OA 3LEVH 2X88A 5C0FA 5I8OH 5GIRA 3ZPDA 5IIEA 4WNSA 2ORBH 3B7TA 4BZ2A 1IIIA 2R9HC 3RY4A 2Z8RA 1M9SA 3MLXH 1U3HD 5A7BA 3ULUE 4WWOA 4ZO7A 1KMGA 1I1YB 4OD1H 3QDJA 2DTSA 1OAKL 4IS6A 3X1FA 1R5IB 5TQ2H 2PABA 1QFWL 2YQBA 1TMCB 1KXTB 2A7BA 1W0WB 1GS7A 3FMGL 4N0FA 3TZVA 1JV2B 2DWTA 3PQYA 1EO5A 1T1WB 4LSVH 2IH8A 5MI0B 4LDOB 4EVNB 2K4AA 4IBZA 4O2EA 3UPCA 4Y5XA 4WUKL 4M3JA 4DEWA 4HC1H 1HJBC 1V10A 4J3XA 2FSDA 1SEQL 2DM2A 3GZQA 5D7HA 3RWCB 1VFBA 2XG4B 5CP3A 4CBPA 3GHPA 4KO9A 2EKJA 4DN4L 1IQWH 3A6CH 3AM8A 3WI9A 1NLDL 5DF0A 1DJIA 1QBML 3PP4H 3FT2A 2VQ4A 4ZFGH 4YHMH 2Z4QA 4FE9A 1YEIH 2CCWA 3N55A 1MNNA 2Q8AL 3PXJA 2H1PL 4U2YA 1A5FH 2BPBA 3JWNE 5EU3B 3V9EA 3HE6C 4ELKA 1M2OA 2D8KA 2RH0A 4P5SA 1X5LA 1KCLA 3QISA 1LD9B 3FAWA 5FFGA 4ANVA 1MLCB 4L5FE 3L6FA 3UAEA 1FPTH 3CH8A 4RMTA 5JORB 4RZKA 2RJMA 3MAWA 4F2FA 4Y1TA 2VLKB 3FO0L 5C07D 3EFFB 2WINA 3US1A 4PJXF 5DD3L 2K0RA 1JWMA 2NY5C 1ZJAA 3RVUD 3DA0A 3GSVB 2GBUA 4C58B 5KVGH 1UM4H 2WC7A 3SIKA 3ZKNC 5J9PA 5EBLB 1KXQE 2KI6A 3IJHB 3QZWA 2ZG2A 4Z3TA 1MRFL 3C5ZB 5I6PA 4DETA 3UYRL 2LTQC 5KYXB 1ZVNA 3FPXA 1T22A 3GLDA 4AJYV 3BJ91 4CC0A 3VQMA 3PWLB 5KZCD 5GGVH 1E8YA 5EU7C 1JIBA 4C57C 1CD8A 2OMNA 5E6YA 3F7KA 1RPKA 3OXRB 4LSSL 4U6HA 3V4LA 1QPPA 2V37A 4PJ5D 3BW9B 1H3PL 5ACLA 4J27A 1OTSC 3CC5A 5HVHC 3B5GA 5SX4H 4B9CA 2XTSA 3EDDA 4PJAE 3PJNA 4OU3A 1HE7A 1PD6A 3ZDZE 3SY0B 3QNFA 3H9SE 2E0PA 3GKZA 1ZGLM 5J3HD 1JVLA 2MCPL 4HHAA 2V17H 2YN5A 3FRPG 4I5BA 2IJ0C 5HHOB 5DMGC 3RWHB 1DO5A 1BX2A 4M5TA 1X6NA 4QT5B 1MFDL 1XB8A 2F2HA 2GJ6B 4LNVA 4RSVA 2HMID 2R4RH 4JN1H 1F4AA 3IGAA 2DAVA 3TTSA 4NKMB 1CFNB 4PV9B 4Y4KB 3WAJA 4XZUB 3L08A 4YH6A 4MQXC 1T0MA 2X70B 1MHEA 2B4CC 1HS6A 1AO7B 1MAML 4R2GD 1AVAA 3UADA 25C8H 3FQ1A 4E41E 4HJEA 3HI6H 1LO4H 3H0TA 1M9WA 2RA1A 4ODWB 4KKNA 3UTSB 5HYEA 4E0RA 3FTWA 4ZAKC 4EDXB 1A4CA 3MRFA 3B9KC 1H3VA 1FNLA 4NO3B 2NXYD 4MZRA 2CNZA 5KVEE 3CLEH 5AVZB 4UWQB 5JHDB 2XNAA 3RIFF 2NY2C 4K9JA 3BWSA 4O02B 1SUHA 2HH0H 4JY6B 1T7XA 3DMMD 4TPRL 1Y18A 5FPIA 1U8HB 1Z9MA 4KMTH 4L4VD 5C07B 3TBSA 4X5PA 2AXGB 5E8OA 4MDJB 4NO5B 3HRZB 1ZJBA 2DWDB 3L3OC 1UWGH 4FTVE 1BVNT 3DNKA 1ZLWK 4MA3B 4AV5A 3TF7C 2AXWA 4U0QB 2E6JA 4P2QD 4W81A 1M7DA 2Q3AA 5A2IH 2OL3H 4FN0A 3CFJB 3P4NA 2R2BB 3CCHA 2J6WA 2CWRA 5ILTL 3P0VH 3ZDYB 2H26B 5J7CC 1HHGA 3VDAA 5FHAH 2VXQL 4L0YA 3QWOA 3PABA 4ZS7H 3HE6A 4N5ED 1SY6A 2ATPB 4YHKH 2Q7YA 1N2RB 1B0GB 3SGEH 3UBXG 3GSXB 1BMGA 4WWKB 4ATTA 4MAYD 4PJ5B 1NANH 1Q0XL 1T3FB 2AEQL 1EHLL 3VI4E 2J4WL 4FP8H 2P9RA 4H26A 3ECUA 4TVUA 4AXWA 3STLA 2R59A 3IF1B 1AR1B 5DD5H 1QLEL 1IM3D 5D7LB 2VR8A 5EU6D 4D8OA 4URKA 2HTLC 5F96L 3HS0B 3L1GA 1AGDB 4GSRA 4NQSB 5KS9B 4OZ4A 2EIDA 4LGSB 1X5HA 2DRUA 2GK2A 1MJJB 4JAMA 1TTBA 5EEZA 4LXFA 4ZSOA 4CVZB 5SWZE 4YSSA 1XZ0A 3KCWA 3U6RA 2BWDA 2PW1A 2NW3B 4ILDA 4NZRL 2F1BA 4YHPA 1DQTA 2ERJB 3D0LA 2OV0A 3VXOB 2BXYA 4PIRF 3H3PH 2C9RA 1FZKA 2BVPB 3BPNC 1NWOA 3LZNA 1JD7A 3QYNA 4U1MB 5EZLB 3D4CA 3IMTA 1F3DH 3UJTL 1UA6L 3EO0A 5HDRA 3FBQA 2DWEA 3WTVA 3NMEA 4S2SA 2NXYB 1FFPA 3UC0H 4PJIE 4RIRA 2I32A 4UILH 1E30A 1URLA 1JZHA 2APTA 5K59E 4LCVA 3TV8A 5BVPL 3GRBA 5ISZB 1BVOA 1ID2A 3DMMB 5JW5B 1A02N 2ZXDA 4L4VB 1T6BX 2AJVH 1VGEL 4JY5L 2XN1A 4RFEA 5I18L 3RIAK 3SBPA 3ZTCC 3IB4A 3P0GB 1JTTA 3JQOB 1TO5A 2IAMD 3FXIC 1NGYA 2HFFB 4KNSA 4IKLA 1DVFC 1FNSH 2BRRL 2CGRL 4JZOA 5I26A 4A2GA 4KXBA 1OGAE 5CLZA 2VMCA 3O11A 4Q2ZA 3IJYA 4KXCA 1TPXC 2ODHA 3KBFA 2D2OA 3OV6A 4ZAKA 2DQDH 5GRWA 3SQBA 4N2AA 3B9KA 3FB5A 4NBZB 4NKDB 1NZRA 4RQQB 1E28A 4PGDA 1FNGB 1NINA 2HVJB 1JI1A 1IKNC 4PMEA 2ZX8A 4YDIH 4LCUB 1CBVL 2EDTA 3C5JA 1EO8L 4MAYB 1OGTB 1Q0YH 3S8GB 3OF6D 1A3RH 1O7DC 3NJNA 1J5DA 2BLFA 3M7FB 5DEFA 3KJ4B 4FQXC 2EXWD 3UAJD 4G9DB 3CHXA 3BISA 5EU6B 3L3OA 3S4SB 1NBZA 2QSVA 2E7HA 4K7FB 2V9TA 4FGMA 5K93A 1PDKA 4D0BA 2IDSA 2K78A 2J1WA 4FQHB 3V6FA 1OAKH 2UVFA 1AYRA 3CN4A 4L1HA 4LCWE 4Q97A 3BD4A 3BAXA 1NGWB 3FMGH 3QDMD 1AKPA 1H19A 1UWXH 4CKVX 4YEFA 3K6NA 2DMHA 2ENPA 4WEEA 1IJNA 1UFUA 3L17A 3O2DA 3L1OL 3KWUA 1OB0A 2XA3A 3I75A 3PJSB 1MHPL 4WUKH 4NRXA 2GBAA 1WITA 5ANHA 2O4EA 1SEQH 2XU9A 1SN2A 1XGQA 2D7PA 2OW6A 4YSPA 3PJLA 4U6YA 2FR4B 4JFTA 4DN4H 3O0RL 1JDDA 4FHJA 1NLDH 1H5BB 1QBMH 2B1AL 3NJXA 4FADA 4Z3HA 5IM7A 3DO7A 1R3KB 2OXGB 3CH1A 1RK0B 3UYPA 3MJ9L 3T3PF 4DFIA 5DQJB 1IAMA 5A43C 2WZAA 4GSQA 5HJBA 2Q8AH 3BP7B 2H1PH 5AW1B 4E36A 3SKMB 4LOUD 3J27A 4ESKA 4JDZA 5AYTA 2YKKA 4JM2D 4Z95L 1JDCA 2GITB 4QRTB 2AMUA 3DX7B 1YYCA 3EGDA 5IUCA 4AZ8B 3OZLA 4WI3A 4EXKA 1FFNB 4H20L 3FO0H 3VM5A 3FYIB 4BE5A 2BSED 2AP2A 4FCAA 5J6GA 1I8IA 5CEYB 3ARQA 5DD3H 4NRZA 3OKMA 2Q1EA 3C6SB 5FFLA 1QSEA 1RK1B 2AJUL 1KEGL 4YZWA 2IAMB 5L4JA 5E5LA 4UOZA 4OBSA 4OF0A 2ADIA 4IJTA 2D3VA 2EIEA 1MRFH 5DK3A 1E9OA 5CBEB 3UYRH 2WQ8A 3KG5A 3ROLA 1ONQB 2FUQA 3TNNA 3L8QA 2JCWA 3DTXB 5HD8C 1BD2E 1KGYE 5IMOB 3WKQA 1KFGA 4IBQA 4JZJB 4WJ5A 4F7CB 1G9NC 1P4IL 3QBTB 4PRHD 1I1FB 5C3IA 4LSSH 3G04B 3DROB 1H3PH 2OYMA 2WGXA 1T83C 5JUEL 2BNUA 2VLLA 2CRMA 5JOFB 2NNAA 3ZOAA 4BFEA 1A7QL 1M4KA 2DBJA 4HIIA 4WENB 3V6BR 3TYFB 5E6ZA 3SBWC 2IMMA 3P2TA 2CHZA 1DLFL 3CGTA 2MCPH 1PLBA 3MBXL 3Q13A 4MD0A 4QXVA 1EX0A 3PV6A 1PAZA 4F37K 2TRYA 3MRMB 4QCIB 4RMVA 5F0JB 3G6DL 1F97A 5EZJA 1DVFA 4QMEA 3H1ZA 4IRJC 4X9GA 4KFZC 1MFDH 2Y2TA 2JNZA 3L2MA 4FFWC 1JGDB 2JXMA 4AVIA 3PDOA 1WFNA 3CDGA 3O3DB 4JFQB 2P1YA 1WTLA 3GSOA 5J1AB 5F6HI 3LKRA 3HC4L 5IB2A 1BF8A 1MAMH 1MWAA 5EPMB 5IJCC 1YNTB 1IKNA 4JREB 4DT2A 4QYOB 4S10A 3PFQA 4Y2OA 1PX8A 1Z9SB 1BOGB 1T21B 2J2ZA 4MXQD 3L9BA 2CIKB 1IEBB 5ABAA 2IOMA 4FQXA 3S5LA 1GC1L 1RMFL 3H9ZA 4XPAL 3EBAA 2WBJB 5IW3A 5IOPA 2KZBA 3NA9L 1YA5A 3RL1A 3BQVA 2X89D 1NICA 1O7VA 1RZIA 1KTCA 4G8FB 3SBQA 4JM2B 4OGZA 1YDPB 3OR7A 3L4VA 3KLDA 1EK3A 4K0OA 2NUPB 2OFQA 3B7UX 4TPRH 1FLTX 3MJ6A 4MNQB 1XH1A 4MJIB 5JOPE 3CZFA 1SBBA 5I1AB 3RDTD 1D5RA 4H5SB 3TONA 3O6FD 3NZHL 7PCYA 2W0KA 1OD9A 3NCYP 2VR5A 4MA8L 3SEPA 2RFXA 2P5WD 4DZ8A 1I8UA 4X42A 1DLHA 5DZOA 1HFUA 1E5CA 2H3KA 4F7TA 4UDTA 2FVNA 5ILTH 3QRFM 4POZD 4YPGB 1F6AA 2GY5A 2VXQH 3GBML 1DUYB 3O9WC 3SYQA 2P5ED 3AXIA 5T1KA 4Y2NA 4PRHB 2FQDA 3BVWA 1Y1UA 2X6CA 4AYSA 4I0PD 1Q0XH 2AEQH 3T1WA 1EHLH 3MKKA 1R5VA 2J4WH 5EORL 3SJVE 1PS3A 3AS2A 1GVIA 1R9FA 1U42A 1MY5A 4A6YB 2UWEB 4Q14A 1QLEH 1B6UA 4WUUA 1IV8A 4MAZA 4NHCL 5DYOA 4PW9A 4YN3A 1H3XA 5F70A 4JZNA 5F96H 5KSAD 4FLHA 2VDOB 2CSPA 2EACA 2IEPA 1EEQA 2WYIA 4FG6D 2HRLA 2H45A 4HV8A 4GXVH 1MJUL 3FQUB 5IFAL 2JB6A 5IKCA 4KXDA 2HJKB 2WQRA 3L3IA 1L9PA 3IDYC 2XBZA 4PJFA 4OAWA 5JO5A 2RACA 5L4IA 1J9CT 3VGEA 2NZIA 4XC1L 4NZRH 3D3VE 4TLSA 4TSAL 4AE1A 3ZU8A 1WEJL 4Y9EA 2PXYB 3TIEA 1BZQK 3HMXL 2PCFB 1JZ5A 1T83A 2NY1C 1U30A 4KFMA 2C34A 4NO2B 2EYSB 5DTFA 3QFJA 2PYEB 4MZ2A 4XNDA 5DJ0B 3V4PL 4JRWA 1B0RB 3G5YA 4GQZA 1UA6H 3RVXC 3KLAB 3UJTH 1G7MA 3VFMB 3SBWA 1XR8B 5JIKA 3MLSL 5MENA 1QHOA 1SJEB 4JJHA 2YAMA 3WS3B 5GRJL 4HWBL 1BG9A 3DRTB 3BFWA 3FTSA 4IRJA 5DEGA 5BVPH 1AE6L 4P3DB 1GAFL 3HUJE 2WKOF 5C0AA 4G43B 2I9LA 3WDJA 4PJHA 1U8IB 1F45A 3L3GB 1X5IA 4KKBC 4JY5H 5KYUB 3RX5A 5I18H 1YG9A 4JFOA 3DC0A 3OSVA 2OJEB 5E1HB 1ITBB 3HN8A 2A1WL 4LVEA 1UEYA 1G87A 4Y5VB 5F7DB 4PJXB 4F7PA 2OMXB 4X6CA 2V0AA 2BRRH 1S9YA 2CGRH 5J5EA 1HEZA 4PJ8D 5CU5A 4I18C 4Y4HC 3R8QA 2CO6A 1KY7A 3OKLA 1MW3A 1BWMA 1P7KB 4F33B 1FSKC 4DP4X 5BXFA 2G9HA 1Z5HA 2AAAA 1B2WL 1R75A 1IUZA 1ZD6A 3VGHA 1GGTA 1T7YA 2V6HA 1RP8A 2BZ7A 5GS2H 4PBXA 4WCYL 1CBVH 1ND0A 1EO8H 4FERA 3OMZA 4EZMA 4UYPA 4PJ9D 2DV6A 1E4KC 3GJFK 3U2SA 2VWEC 2K6WA 3SDAC 3MV8A 3LQZB 4CU6A 2G60L 3LNIA 4P2RE 3P3TA 4L8CB 5LBSL 4DKEL 1QPXA 3DX0A 1WBXA 5D9SA 3T2PA 2BNQB 3HR5A 3QDJD 5KSAB 2GJZB 3F65A 4NERA 2J56A 3N2JA 4MWFA 1EZVY 1QUNB 1S8DB 1U8CB 3HZMB 2BSCA 5BOJA 4BFGA 2IWEA 3TZVD 1IKFL 2XTJD 2WLNA 2JKWA 3PQYD 1NSNL 3R0NA 1UM6L 5DLML 1H8NA 5HI5C 2FX8L 3CFCL 1QSFE 3UL4A 1MVFA 3DX6A 1YUKB 3L1OH 1MHPH 3O9WA 5D7JC 1BP3B 2K45A 3N40F 2P8MA 4YSDA 5E03A 3GUTB 2NTSP 3LOWA 4Z7AA 1RL1A 5MERA 3O0RH 4ACTA 3SSGA 2GFBB 5CD3B 2B1AH 1GHFL 5CWSB 3W9DB 3NFPA 5ESAB 5JIQA 2VE6B 3NESA 1MHHB 3MJ9H 3M46A 1QA9A 2GC7C 2YD2A 3QZMA 3FFCE 3AREB 1TJIL 1I4FA 2VAAB 4U1JA 1LWRA 5A6LA 4AG4L 4HS3A 1A4BA 3TH2T 4Z95H 1JK8B 2IANA 1CXLA 2CMRL 3HAEH 4W9IC 3RTQC 4X6EB 4H20H 4HMCA 4YUEL 2J1YA 4RA0C 2W07B 1Q38A 1VZGA 3WEXA 4WKZB 4R7VA 1BBDL 2QFRA 4XT1C 5ES4B 1N19A 2X4SA 3PHQA 1YMHB 3FKUS 2VMDA 3WFBH 4M62L 1T5WB 4ZD3L 2AJUH 3V4VL 5I71C 4B3EA 1K5NA 2APSA 1KEGH 2N0KA 4LHUG 3TT3L 5E9AA 4PJ8B 2VQ1B 5FR3A 2TRHA 5D1XC 2CDGB 1DO6A 2WZ5A 2XY1A 3BAEL 4ONGL 1U92A 2AJXL 3QO1B 1P9MC 3QNZA 1HWHB 1SOSA 2Y6SC 3F04A 3BRDA 5L2KE 4JRXD 1P4IH 2DKMA 1URZA 1HOCA 5MEPB 2QT6A 5EO9A 2FO4A 4QTHB 5JUEH 4BWUA 2CUAA 3T77A 5C0FB 4LVNB 4RSYA 5GIRB 5GS0C 5IHUH 1CFTB 5IIEB 2BS9A 1A7QH 1X5FA 2GJJA 5I9QB 1WICA 4HH8A 1FVEB 3CDZB 3H6AA 4FAAB 2PR9A 1D7FA 3HG0A 1DLFH 5LXGL 4WI6A 3P4MA 3MBXH 4LQ1A 5GGSB 3E38A 3QDJB 4IS6B 1J0YA 1HI6B 2C3HA 2YLHA 3CBRA 3TA3C 2VZ1A 1OSPL 1Z3RA 2NUTB 2V3DA 3G6DH 2VN5A 1QUPA 4N0FB 4I18A 2YMOA 4Y4HA 1GYVA 4WTWA 4HIJA 4Y5XB 3IBEA 1LNUA 4DKAA 1FL6A 2Q7NA 3H53A 4PLKC 2P8PA 1FZMA 3CXHJ 3IFNH 4BZ1A 2ENSA 3HC4H 1VFBB 5BS0E 4IU2B 3O3EA 2VKXA 5HYJA 1XL6A 5ACMA 1V7ML 2MCMA 3FH5A 2Z4QB 3U4KA 3SPIA 1E4KA 3AXHA 3BLKA 3SDAA 3W0WB 2GUOA 4PW3A 3UTTA 5LUMA 2CDEA 4ELKB 4GP4B 3WL9A 1GC1H 1RMFH 4XPAH 3BP4B 3REWB 3BHBA 3H56A 3BEVB 3NA9H 3K5RA 3SODB 4PJHF 5TK2A 3L6FB 5D96C 4XAWL 4FFZA 3APFA 3O0LA 1ETZA 5CN1A 1RJYA 5FM5O 4B53A 1ZLEA 1D5XA 1FAIL 2WINB 1A4KA 1JWMB 4GQQA 4A38A 4CADA 2Z31B 4CW1A 6PAZA 2YRZA 3CSYA 5J9PB 4U3SA 5D7JA 3NZHH 3QZWB 1N0XL 3P4OA 1YRKA 5EOCL 3F6JA 1U9KA 1PX3A 4MA8H 4OFKA 2N1KA 1CXFA 2XFGB 4XH2B 3VRJA 4AYDC 2XXGA 2Y69B 5KW9L 5DK2A 5FGRA 3SCMC 1T22B 5ESVA 2QDVA 5KYYA 4DUXA 3UH8A 4JGNA 2HRHA 5EF2A 2XWBA 5SWSB 4RA3A 3KPMA 3QORC 3GBMH 1KCSL 3TF4A 4LGRB 1ZE3H 2IPTL 4IOFC 5EO0A 4U6HB 2Y9RT 4WLCA 1FGVL 3VGDA 4E2OA 2M8XA 3L9RA 4TNWF 2CKBL 2V5YA 5GSRB 3RTQA 1FNHA 1UZ6E 3MXWL 3PXHA 5FM4A 4OFPA 4GS7C 5DJCA 3B2UD 3KWWB 5C0BE 5KYNA 4NHCH 2X42A 4HHAB 3ZKND 5TFSL 3F64A 4TYUA 4I5BB 3V95A 5DQDL 1BX2B 1FCCA 1XD1A 5E2VL 1RV6X 2OR8A 3TNMA 1MJUH 5I73B 5D1XA 5IFAH 3W9EA 3P4LA 1FL3A 1LLAA 4OSUL 3HZVA 1T0MB 1P9MA 1MHEB 4HZ1A 4GRLC 4XVTL 4KK9C 4XC1H 3BFQG 4ES9A 4YSQA 4TSAH 1NGZA 2FTAA 3H0TB 1WEJH 4HOZA 1OTSD 1YEGL 4NUMA 3HMXH 4E0RB 5IB3A 4QRUA 5IEKB 2NOYA 1YC7A 3MRFB 5E2WL 4HCFA 5CIPA 2B1HL 5DC4B 3MLSH 1U3YA 3NOIA 3QZBA 1J8SA 3T3PB 2XNAB 4W6YB 5FOBA 4S1QL 5GRJH 5DMGD 3WLWC 5CR1A 2WKGA 4HWBH 3TA3A 4R7LA 1Y18B 1ZHBA 3BZEA 1AE6H 3HAEG 1GAFH 5B7FA 4L0PB 5E8OB 1BW8A 2R2EB 1MG2C 2VDNB 4Z9KB 1UVQA 5TJWK 4MQXD 2FDBP 1G9HA 1WCBA 1DQKA 3VXPA 2WSPA 2VRQA 2A1WH 4IIQB 4Y9CA 4WHYH 1M7DB 4QJ5B 5DVPA 3CCHB 3EZJB 3ZXAC 4ZAKD 3N1GC 2ITEA 1HHGB 2X5PA 4LLWB 3ARDD 2ZPKL 1U91B 3QWOB 3PABB 4DEPC 3CE1A 5C07E 3C2SA 3HE6B 4UZUA 4MQ7A 1B2WH 2Q7YB 5C8JA 5IREA 1DJSA 4AENA 4I89A 2AXHA 1REIA 2NY2D 2WAQA 4QRSB 4WCYH 3LZRA 4MMXC 1L3NA 5K39A 4H26B 4H8HA 2RQEA 5H4ZA 1MVUB 2JJSC 1FIEA 2AVFA 3RB5A 4AXWB 2YWZA 2V9RA 5DJ2A 2NR6C 3K2KA 4S11A 2G60H 3O2WL 5E7BA 1TO4A 3C09B 2Y7MA 5LBSH 4CGUB 3G9AB 3ZDYE 4DKEH 4X7FC 4XHJD 1BQSA 2CPUA 3S36X 1KXVC 4OZ4B 4HEME 4JANA 4JO4L 1HU8A 2EDQA 2KYIA 2FSEB 2GG1A 1X7SA 1T7VA 1VZHA 4PJ5E 4JAMB 1IKFH 3OAWA 1XR9A 1ZVSA 1NSNH 2LTQB 1NL0H 4XNQA 4F1ZA 1UM6H 5DLMH 3SCMA 1XZ0B 3JWDC 2D7NA 3CFCH 2NT1A 5KTEL 3U1SL 2J12B 2PW1B 3U6RB 1CPUA 4JVUA 2GHZA 3QORA 3IRCA 4P4RB 3U48A 4C54A 4ZO8A 3D0LB 4F7EA 4UYQA 3QZLA 1MJ8L 3D51A 1U8QB 2ZXQA 1I3GL 1IZJA 2CO3A 3VXNB 5KS9E 3HG5A 5HVHB 4J12A 3KPSA 1GHFH 3EO0B 5JIDA 1EEYA 4KXZI 2X3BA 5LN8A 1FN4A 3EADA 4MLIA 4HZAA 4KVNH 4S2SB 3JUZA 2HTLD 3VWKC 4XP5L 1TJIH 2NY4C 4RIRB 5IQLA 4AG4H 4M9PA 3VSQA 4L18A 2IFGA 4XBPB 1K8DA 4PW4A 3SYOA 3QIBC 2CMRH 2Z0BA 3E9UA 3GMQA 3MYZA 3N40P 4FKKA 1USZA 2PO6C 1MCQA 2DH2A 2XBDA 2PTVA 4YUEH 1NFKA 4A63A 4UT7L 2FZ3A 1ADQA 2L4OA 2PWEA 1BBDH 5AVWB 3KM1A 3ZKXC 3ABMB 4GRLA 4XPTL 1NGYB 2AERT 3L45A 4M62H 4YBQC 4ZD3H 4JZOB 2J5LC 3V4VH 2WLKA 2BSSA 4BK4A 1PCSA 3A3YB 2ZG1A 3O11B 3IJYB 4Q2ZB 4ZG1A 3TT3H 3QIWC 1KYDA 3FCSA 4POYA 5F7AA 1WWAX 2B7DT 4ZAKB 1KY6A 3SQBB 1P6WA 3FK3A 5GGTA 3BAEH 3B9KB 3FB5B 4ONGH 2AJXH 1SMAA 2VIRA 1E28B 4L4VE 2DLIA 4PGDB 3HCVA 4R5VA 3ULSB 3CFBA 4JDEA 4MDIA 1T0OA 3BIBX 4HG4J 3SDXA 5IMKA 3WFZA 3C5JB 3CXFA 3RUGE 4RRPM 2NY2B 2WAHA 5BRZA 3QNYA 4P2QE 3TASA 3U4EA 2BCKA 4J1UA 2L8AA 3OZ9L 3JZ7A 4MHHG 3L48A 1OM3L 5B1BB 2WO4A 3D2TA 3CPLA 1J12A 2IDCA 5LXGH 2VJXA 1I3UA 1DVFD 5FCSH 3V6FB 1J1OL 4N2CA 3AB0B 1AOZA 1OSPH 3B1UA 2DQUL 5IW6A 3UTZA 3Q0HA 1I8KB 2DI8A 4G8IA 5AL8A 2Q6WA 2PUQT 4AVHA 5I0WA 4FF9A 3W38A 3I75B 4NRXB 4I48A 2BOBB 4W9JC 2H2PC 4KTDL 5EUOE 1XGQB 4FLQA 4FEIA 3LVTA 4OKDA 5C09A 1P5VA 4P5KA 1YN7B 1WUZA 3MGAA 4YWGL 1UH3A 3AQDA 4MMXA 3CH1B 2GPZA 1V7MH 1JPEA 2JJSA 3S35L 3UYPB 3DVGB 4FRWA 2NR6A 1CLYL 4W9FC 5AZUA 4FQXD 3ZUNC 3SDYL 4U1HA 5D7IA 3EGXA 3HZ3A 4F2ME 4K71C 4TSCL 2EUXA 5ACZA 3TO4B 3LIUA 2RMNA 2YZ8A 5BW7C 1ZHLB 1KXVA 4LFHD 4WWPA 3EGDB 2FWLB 5C9KA 1J0KA 3IPFA 1BQKA 4XAWH 4M48L 4HD5A 4X0KA 1MCRA 1I8IB 1FAIH 2VJ0A 5AW6B 4PS3A 3OKMB 1RJLA 2UX6A 2HKAA 1H8SA 4M56A 4U1GC 1QSEB 4P9HC 4ZUTA 1BXVA 1MEXL 2ADIB 1GA2A 3UCRA 4N2IA 4AJVA 1PAMA 1N0XH 4GQPH 4WHYG 5EOCH 1N6UA 1E9OB 5ICUA 4LSPL 3ROLB 1AGEA 1G7QB 5KW9H 2MTAA 5IF0A 5I8EA 4QO1A 3KGTA 3VYOA 4WJ5B 3AU0A 1NBYA 5T1KD 2NNRA 3VWKA 4XNUL 3T04D 1KCSH 4A2HA 4PWIA 2IPTH 1WFTA 5JXEC 1J5HA 4R5TA 1FGVH 4XP1L 2BNUB 2VLLB 1Q8MA 3B5HA 4DP2X 1ZT4A 4BA8A 4H0IA 5D5MF 3QIBA 1TQVA 4HIIB 3CN1A 3MXWH 1QAWA 1BLNB 2PO6A 3QGVA 3AG1B 4WUUD 4KRLB 1ZOXA 3EHBB 5LGYA 3Q8FA 4MD0B 2QGCA 3PV6B 5JW4Q 2ICEC 5TFSH 2XWZA 2B9BA 1J9SA 3CXHK 1DVFB 1OGSA 5EZJB 3GSRB 1CL7L 4JPVL 5DQDH 3WFDL 4KROC 5E2VH 1XGUA 3RY5A 3C6EA 1TPXB 3NPSB 3NT0A 3QIWA 4P2OB 3PDOB 2MFNA 3CDGB 2DDQL 3OJVC 1D7DA 3GSOB 3GBLA 4OSUH 5HD8D 5B38A 5IB2B 3HR6A 4NXKA 4Z7QF 3HHSA 4UV7L 4XVTH 3RHWF 1OE1A 5E51A 1TZGL 4Y2OB 2ZOKA 4L1LA 3U79A 4ODHL 3X1BA 1P7HL 1YEGH 3WLBA 2J2ZB 1B0IA 3QFJD 4HK3J 4A2FA 1KPVA 4MCZB 4EIBA 2DN7A 1MIEL 4YHLL 1FP5A 3JVGC 3QDME 4FQXB 3NIFB 4PGBB 2VN4A 3WKNA 4KWUA 5E2WH 3ZO9A 5MEND 2B1HH 5IOPB 3RRQA 4Y9BA 3RL1B 2OMYA 2C7FA 5EDSA 1RZIB 4UV4L 4FXGC 3OR7B 4S1QH 2NSQA 4IRJD 2I7SA 3L4UA 3NH7L 4HMEA 2E8YA 1JF1A 4LK4A 5C0AD 5C0RL 4PJ7A 2XQBL 2ZYIA 1BVKB 1KENL 4FFWD 4PMFA 1OP5H 2CBPA 3CZJA 3CZFB 5DDHA 2LVEA 3H2QA 4JB9L 4PCYA 5LAXA 1DQIA 1DSWA 4F3FB 4ZMAT 4A66A 4AGQA 3GTVA 1E2ZA 3V0FA 4CMHC 1F3DJ 3V4PA 1AC6A 4QRAA 4DIXA 4DZ8B 3X13A 1BFOA 2XVGA 4EOWL 1DLHB 4WTZG 4ZNEE 3KGSA 1P6FA 2ZP8A 4WI9A 4F7TB 4UDTB 2YJQA 1RLWA 5JIMA 4NC1E 3DVFA 1F6AB 4ZTEA 4NCDA 4QI3A 2ZPKH 2APWA 4HZLA 3IGUA 5TDOA 4DO5A 4KZDL 5T1KB 3ETSA 1A6AA 4WV1C 1JK9A 1EVTC 3S5YA 1C16A 2A9ML 5BW7A 3ZTEA 2HUEA 3JUYA 3G3LA 4G8GA 1R5VB 1QI5A 1T80A 3VXSB 3MV8D 2EH8L 4X5QA 4GO6B 3B9DA 3C8DA 5FO8A 1T7WA 1Y6KR 2PTTA 1N5AB 3L5HA 4RH4A 3O2WH 5DYOB 4W9ZA 4KZEL 2F1AA 5D55A 2O26U 5DURB 3U9UA 3QWRA 1AGBA 4JVWA 4HV8B 3EH5B 4JO4H 1NPNA 3SPHA 3NGBC 3GZOA 4ZPVB 5IKCB 4DP0X 1MNUL 1SMOA 4C8XA 1AQ8A 5K9KA 1S9XA 3VCLB 5KTEH 4X2UA 3U1SH 3O9WD 3VGFA 4FNLL 4KHTL 2F61A 5TDNA 3FU0A 1NUDA 1PZ3A 3PAVA 2VR3A 5JXEA 3TIEB 5D7IF 5HGDA 2B3RA 3NP4A 3FBKA 2G4EA 1MJ8H 4FMFA 1I3GH 5DTFB 5LBSA 3QFJB 4W9KC 3DRQA 4G9FA 3G5YB 4Y88A 4XWOC 1IBFA 2CLVB 1G7MB 4FQJL 5IVXA 2ZXWB 5MENB 4BKSC 1CMOA 4AUYA 4XP5H 1CFSA 1EGJL 2OCFD 4N6RA 32C2A 4XR8C 1YEEL 2ICEA 4AEHL 4NNYA 1HAWA 3U7AA 2W5PA 3VXUA 3L3DA 1UG9A 4IRJB 5DEGB 3ULVH 1J9QA 5C0AB 1TTCA 2I9LB 4Z7VE 4Y1AA 4YQXL 4PJHB 4KZ0A 1F6FB 4AZUA 2XIBA 4N2HA 4CILA 1NM4A 4UT7H 1KULA 5JA9A 1TJMA 1YCSA 4PG9B 5BO0D 5C0NC 2X4NA 3ZLQC 1RP9A 1RKRA 5L8KB 2VDQL 4F27A 4XPTH 1QNZL 3D9AL 4J28A 4CVUA 4F7PB 3WDIA 1NOFA 1S9YB 1HEZB 4JMXA 4P5TC 1BIIA 2NY1D 1WQVT 4KU1A 1GSKA 2CO6B 5DFVC 4PY7B 3OKLB 3RVXD 2P47B 3JVGA 2H47C 4O00A 2V5RA 3UCQA 3GRWL 5BXFB 2A2QT 2G9HB 4KK6C 5E1GA 3DVNA 1MH5A 1NAML 3SKJL 1OCCB 5ETUA 4ACPA 5JIIA 1E42A 3DYMA 4FQIL 1ND0B 3VGGA 1JXJA 4FXGA 2HT2C 5I0ZA 1DJHA 4FYSA 2CALA 2QVFB 3ZE0B 3U2SB 2P5WE 4NQXB 3GMMA 3S8FB 3BKJL 3OZ9H 1A3LL 4GAYA 3FUIA 3NP3A 4I9WD 4KKBD 1OM3H 3BT2L 5IMLB 2AC0A 5D9SB 3ASNB 4OUUA 3HR5B 1KDIA 4PRAA 1X5MA 2WXKA 4MWFB 3FHEA 3QRBA 3FFDA 4HKXB 3MX0A 4PQXA 2WHVA 1LEKA 1NOLA 6FABL 2XQYK 4O2CA 4NP4L 5F1OB 1J1OH 2P5EE 4XAKD 4ZFQA 1BV8A 3RVTC 3DIVA 3BAIA 1D5MB 4Y16C 2DQUH 2O5ZL 4RMSA 4DK3A 3MGTB 4YDLC 3GI9L 1QMUA 3ARWA 4WTXA 3O9WB 4I85A 5GHWL 3V8CA 5ELIA 4KTDH 4GKNB 4WU7A 2P8MB 3CQFA 3P1VA 4WV1A 4APQC 3Q8CA 1H6UA 4HPHA 3PS6A 3D39A 4YWGH 3IJ7A 2MOQA 4MLSA 3NFPB 3QK0A 4BJLA 3S35H 1H8OA 1QA9B 3T0BA 1CLYH 4ABWA 1CT8B 5IV2A 3SDYH 2DLEA 3HG1B 4FEMA 1ECZA 3EJJX 5AVXB 2XWCA 4J3OH 2FX9L 3BAWA 4U1JB 4TSCH 4HS3B 3RPKA 5AG8A 4HJIA 2CJUL 2X1XR 1XBDA 4MD5B 3KCPA 2CM6A 2P3YA 3PE9A 2IANB 4H0HB 5E0FA 1JZ3A 4M48H 1RZGB 5HI5D 2IDQA 2VR6A 2F8IA 5AVVB 3IDYB 1QZ1A 4UAOC 3O8XC 4BFIA 2XZQL 2X4SB 2HRPL 2ZYHA 3NSCA 4K3HA 4QLRA 5D7JD 3GB7A 2GTWA 1C9SA 1MEXH 3RJDA 4UUJA 5DJDA 1FFQA 1PTZA 1S9VA 4NZTL 3LPGA 2NY1B 4R83A 4LSPH 5B8CB 1ZLDA 3GSWA 1CYWA 3CLWA 4QXGL 3L4CA 1I7ZB 1EZUA 3OHXC 4QRBA 1OTTC 1WZ1L 3PFUA 4XNUH 3VX1A 3D09A 2CM5A 1HOCB 4N1HB 1OLZA 4NBYB 4UINL 1Q9KA 2FO4B 5EO9B 1XF5A 5F89B 2AHIA 3RTQD 3G6JF 4JO2L 3T77B 4XP1H 1B6DA 4Z3JA 2D7OA 5E70A 2F7OA 5DUPL 1XEUA 4I87A 3S3PA 2FEEI 4WI5A 3FQTA 1QLRA 1C5BL 5JW4R 3ESVF 1JWUA 1MCJA 2V9QA 1J86A 1G4RA 5I15L 1NFAA 4MCYA 3OR6A 3CIQA 4WJKB 3VO0A 4OZGF 3H54A 3V0EA 1CL7H 4JPVH 4HJJL 4P5TA 3WFDH 3RA7L 4I18B 3ECBA 5KVMC 4Y4HB 4F7MB 5D1XD 4HUWA 4AT6B 4HF5L 1GZPA 3D6GA 2DDQH 4NQUA 3F2LA 4RVBA 1FL6B 4Z18A 1FSKB 2AJ3A 3Q48A 4HWZB 3RX9A 2P8PB 1FZMB 1BFVL 2CKBA 3O3EB 1WSST 2QV4A 5B1AB 5HYJB 5FYKL 3H9YA 5E6UB 5IVXF 1Z5YD 3QDJE 4JGUA 4NI6A 5IOKA 4EDWL 4ODHH 1KB9J 3O41A 4UZSA 3VH8G 4BDVA 5GS0D 5E4AA 1G1CA 1QW8A 3VFUA 3SDAB 1MIEH 2XWRA 1HSBA 4YHLH 5HYFA 3UTTB 5D2NB 1JZGA 1FV1B 2CDEB 2XTJE 3PQYE 3WL9B 4GKLA 2FD6L 3HW7A 3AXLB 3BHBB 4HT1L 1KLUA 2F8VA 3QUXB 2J8UA 4WQOA 4E9XA 5SX5H 5HGHA 3FTYA 3VI3A 1KELL 4OQTL 3VD7A 2ARJQ 2C1OA 4UV4H 1NC2A 5D1ZC 1ETZB 1AXSA 5CZRA 3NH7H 1RJYB 4ZMLA 1D5XB 5H2BA 5C0RH 2XQBH 1A4KB 3V9FA 4Y16A 1KENH 1SLVA 2JCCF 4GKOA 4CADB 4JFYA 4CW1B 5JW4M 1UUNA 2BMKA 4JB9H 3CSYB 2QGEA 2EDHA 5FHBL 4ZYKA 2R23A 4U3SB 4HXAL 4Q6IC 1XH2A 3P4OB 1LP9F 2TSAA 1HL9A 4APQA 3MNVA 4IHBA 3UBXI 2JFCA 2KPWA 3VRJB 4EOWH 2JKRM 1DZBA 2YXVA 1SDDA 5ESVB 5KYYB 5HHNA 5E00A 3KPMB 2G5RA 4N9GA 1TFPA 1UT1A 4HWNA 1UOLA 5EO0B 4KZDH 2F68X 5HHXL 4KDWA 2OCCB 5MP6L 2A9MH 3L9RB 3RTQB 4BUQA 4TMPA 5CSZA 3KEHA 5AFAA 4HUCA 3Q3GA 1TJGL 2PF6A 4LHUB 3X11B 2EH8H 4PRBA 1KCKA 4CDHA 1J8KA 1G9ML 2DMKA 4MNGA 1GL4B 1EXGA 3AAZA 3O8XA 3UFIA 4D9QD 4Z7NF 1ORSA 4KZEH 4Z3GA 2C26A 1T1XA 3ARGC 1TFHA 5SWQB 5IEHA 4ZX4A 4JRXE 3MYJA 4YL9A 1W72L 2JIXD 3TNMB 1JZFA 3PWPA 3MUZ1 5D1XB 3W9EB 1FL3B 2QQLL 1WD9A 1M7UA 1MNUH 1LDPL 4YDZA 3HZVB 5BMFL 4LEOA 1IVTA 3ZYIA 2KKQA 5EBMA 1AZRA 3SKNB 4D9RE 5JQHC 3F12A 3MZGB 2G5UA 3OHXA 4FNLH 4IOFD 4KHTH 4FYTA 5EC1A 5ESQA 5GGSY 1NGZB 3CU1A 1P1ZA 2ARJB 3BZFA 1CGVA 3NCWA 4B5EA 2WTRA 2NSXA 2NYYC 5IB3B 3KPSD 4QRUB 3SOTA 4YDJA 3DBSA 3MV9B 3WNLA 4K5PA 3SOBL 2ESVA 4FQJH 3MA9L 3WY3A 1MCDA 4RWYL 2TSBA 4ZO9A 1X5YA 4J3OG 1C08A 2JJVA 1EGJH 2WNKA 5FOBB 5ADPL 5JDSA 1YEEH 5I1JL 4AEHH 3TA3B 4HALA 3RL2A 5CGMA 4YXKL 3UEZA 3MLUL 3HBPA 3VFWB 4YQXH 4AIEA 3P2BA 2ZOLA 2QFPA 4PI0A 1UVQB 5D1QC 4K55A 2CUHA 1WCBB 4GRLD 3W2DL 2VDQH 1YNKL 1QNZH 3D9AH 5ERWA 2EUVA 3RGVC 3TOPA 4PV8A 3RWGA 1PYWA 1X7QB 1AANA 1X5JA 1CF8L 1CQYA 3LAFA 3GRWH 4NN7C 4F7KA 4MQ7B 5C8JB 5SX4I 1N0LB 4AENB 8CGTA 3QS3A 1NAMH 3SKJH 1FYTA 3KBPA 4FQIH 5D96B 5BRZD 1UFGA 4KO5A 1YEHL 3WLWD 5K39B 2J57A 1YY9C 3BP6A 3VFSA 4WIQA 1JS4A 5D1ZA 4PPTA 2FWSA 1ASQA 1YQVL 5BZWA 3VSTA 4Z5RA 3D30A 4UQEA 1IC0A 1XD0A 3FCUB 2W9LA 4OCWL 3BKJH 4AQZA 1GCYA 1A3LH 1YYML 4EI6A 5EN3A 2EYRA 5D5MB 4EAEA 5ITFA 1WFIA 3OBAA 3BT2H 4QYAA 4LCCC 2BVYA 3CV5A 5CGYC 3WN6A 2YGOA 2XHNA 1R33A 4PJCA 2HT3C 4JANB 5BNXD 3NBNA 3OAYH 6FABH 4Q6IA 3EJSA 3BH4A 4NP4H 3PUUA 1YHPA 1WJ3A 3SE4C 5KSBF 3EXLA 1XTMA 5FGSA 2BP3A 1XR9B 1ZVSB 4X5RA 3LIZL 1YAZA 3AFLA 2E75C 2HVKA 2O5ZH 3MNZA 3SCMB 1QFWM 4M8QA 3AT9A 4I2XB 3U4AA 3QORB 4YHIA 3A4AA 2EDDA 4N3UA 3A6BL 5GHWH 3F01A 4WW2F 2BSRA 3P02A 5IQOA 2BNRD 1UWXK 4MJJA 3KPSB 2J8UF 5C0JB 1EEYB 4NNXA 1NGPL 3BPLC 4GS7B 4P2YA 1FN4B 5DEZA 3NFSL 4ZSOE 1QQDA 2Z0UA 2DQCL 4HU8A 2FAUA 4YE4L 2G75A 4IJ3C 1N10A 1NMAL 3GUFA 3I9GL 3WO4C 2FX9H 5B4MC 2D9CA 1KN4L 5EU7E 2O1AA 4EI5C 2CJUH 4UBDD 1KBPA 3ARGA 1K8DB 4BK8A 1XF3A 3P11L 2PLTA 3GMQB 3BH9A 3N6YA 4TQIA 3DSNA 1HYSC 2ZX9A 4XNZC 2A4CA 2DLGA 3C60B 2FZ3B 3HEIB 2ZP9A 4X6DF 2EVGA 2YUZA 1FC1A 4L3CB 2GVYA 3K2MC 1RUQL 1G7PB 1LQSR 2XZQH 2HRPH 4GRLB 4QHNA 2VSKB 3TBTA 3MSPA 3MV7B 5KSUA 1R3LA 4WGKA 2K7QA 4NZTH 2YPLA 4OCXL 4IM8A 2ZF9A 1NIEA 5LGJA 3SGEI 4OF6A 2E7BA 35C8L 5E8DL 2CG9X 4CN6A 5E8EA 1NANI 1RVFL 2VIRB 4QXGH 4YZFE 2QVKA 3VWKD 1BF2A 3HCVB 3LNGA 2HSIA 1TCRA 1NCIA 3CFKB 3ISYA 3MLRL 4JDEB 2NY4D 1AXTL 3U9WA 5IMKB 1WZ1H 3M8OL 3WCYA 2HPTA 5EU5A 2RR3A 4UINH 5BRZB 1XSIA 3QNYB 5CFHA 1CURA 3QIBD 2Z92A 1BJ8A 4JO2H 4NZFA 4J1UB 2PO6D 5DUPH 3LRSA 1VEMA 4X83A 3L5WA 3RNQA 4TF4A 4ENEC 1G5GA 3GEFA 4GO8A 2F74A 3ZR5A 5D1QA 3CPLB 1YSOA 1C5BH 4JPIB 2ID5A 5IBLC 4YBQD 5I15H 4HHGA 1DN0A 2AKRA 4PJGE 2DIEA 2A5UA 4MAUL 3ATFA 3MUUA 1MN4A 4M7KL 3RGVA 2BIHA 3O4LA 3QIWD 5B39A 4HJJH 3TP4A 2X44D 3RA7H 2EO1A 4JHBA 3UTZB 1JJUA 3TFBA 2NW2A 4G8IB 4HF5H 2OZ4L 1JN6A 3I9AA 4NX0A 4UM8A 3HN5A 4JY4A 4I48B 1NPUA 4JFDA 2L7UA 4NM4L 1HJCA 1BFVH 1AQKL 4LCYA 4ODVL 4UQCA 5C09B 1S78C 4P5KB 4PJEE 3S97C 1Q9WB 1TETL 5FYKH 3B2MA 2UY7A 2WCPA 4MMXB 5G4MA 5C7ZA 3U36A 4EDWH 4OM1L 4XI5C 2NTFA 1DFBL 2EABA 4U1HB 5D7IB 1KT2A 1UJ3B 3EGXB 4FXTA 4JRYD 1XIWC 2FD6H 5ACZB 1J1PL 4HT1H 4LCCA 3GZKA 3A24A 2VLRA 4O5LL 1XH3A 5IQNA 2DM3A 3LNFA 1FHNA 1FZJA 2QQKL 1EWHA 1KELH 2I5YL 4GXFA 3LVEA 4OQTH 4TUUA 5F7WC 4K5NA 1UZ8A 3SE4A 1UASA 3EYFA 2H32H 3QJTB 3QXUA 1JG9A 2B1OA 1FO0L 2OX5A 3BWZA 2G3NA 3ECVA 1ZRUA 3NTCL 3NSFA 4ZUTB 2H2PD 5LXVA 3SKOB 3VA6A 5FHBH 3GIZL 4HXAH 3RTLA 4PWEA 3DUHA 2DJ4A 4JM0A 3CVBA 1KIPB 1AGEB 3MCLL 1DQJA 3ULVF 1II4E 2F18A 2J88L 5IF0B 4OLYL 2W88A 2WQXA 2DKSA 4QO1B 5I8EB 4ZJ9A 2XDHA 3D0VA 3V0VA 1J88A 1MWOA 3VB9A 3VWKB 2NY4B 2R7EA 1F3RB 4OZFH 4ZX6A 5HHXH 2J44A 1JVOA 4EI5A 5MP6H 3KWVA 1ZT4B 2C9PA 1OE2A 4LO9A 1BZOA 3VRLF 1AD0A 2QR0B 3G08A 5CZVL 4XX1E 2Z7WA 1FGNL 1TJGH 2YD9A 3VD5A 1TZHA 1G9MH 1JV5A 2VUYA 1BDYA 3QUZC 4PD4K 4FNRA 4FABL 3QWRD 3ZKXB 4GUPA 3CZEA 4JNXA 3CMOL 2VN3A 3ZDXE 3AWFA 4PJBF 1XGUB 1W72H 3QIWB 2M2DA 2OQJA 4DVBA 4XB3A 1KB5L 2EIBA 2QQLH 3VU2A 1LDPH 4ETQA 5B38B 1H0DA 5BMFH 4OVVA 1KPRA 3AGWA 2B8OT 5JXED 2NY6C 2V7HA 4WU5A 3MA7B 3IKKA 4X9BA 3WLBB 3RZCA 1MF2L 4LMQE 4FDWA 4ZMTA 5CNHA 4NQDD 1WA2X 4XTRC 2CAKA 1QATA 4MB5A 2ZQKA 1DVSA 3SOBH 3MA9H 4P23C 1A4JA 3TLRA 2OMYB 3HG4A 3ULVE 1ET7A 4RWYH 1HKFA 1S3KL 3PAUA 5E24E 2PPFA 3KPQA 1QSZA 3VXUD 5DGQA 5ADPH 5I1JH 4KROD 3KPRD 3ZYZA 5CJXC 4PJ7B 4APXA 4Y1AD 4XN5A 4YXKH 3MLUH 4MCNA 1U8KA 3ZMEA 1O7DE 4NUQA 5LAXB 1VERA 1D6VL 4U4BA 4P04A 3NIFE 4J3OF 1D5ZA 3W2DH 4AJ0A 1CICB 1RAMA 3EYQC 4QUOA 2Q86B 2I9TB 5D8JL 2CRIA 2KLRA 1YNKH 3V4PB 1BFOB 2VN7A 5E4OA 3S0PA 1XXDC 3QHZL 4K8RC 1SYVA 3QE5A 3KR3L 3L4TA 5TK4A 1ZT1A 1WFOA 3RNKA 3ZTDC 1EGJA 1RZ8A 2CCLA 2O6FA 1CF8H 5TDOB 4K71B 4TQPA 3O6KL 1A6AB 1JK9B 4GB9A 4RMBA 1C16B 4ZQKA 2X1OA 2ZWNA 4FL4C 1MZZA 1KIQB 4G8GB 1YEHH 4P48A 1EDYA 3E0GA 5F9JA 3KE0A 4DESA 3B2VH 4PWJA 5FLUA 1YQVH 5FO8B 2JK5A 2CJSA 5HY9A 4M8VA 1MCLA 4OCWH 2HJFA 4U1GB 1YYMH 1EV2E 4OGQC 5DUML 1M1XA 4AYBA 1N18A 4XCNA 4YO0A 1BF5A 1AGBB 5IUSA 3KHOA 4J23A 4EZKA 2H4EA 4FNQA 4GKSA 3OLIA 4S0TD 3JYCA 4D94A 1TJHL 2MRYA 3LIZH 4A7TA 4B9FA 2UXGA 4OZGB 5AEAA 5K9KB 3KH4A 1KZYA 1S9XB 3V0IA 3BUDA 3ILQC 5DGRA 4GLRH 5CN3A 4WUUE 3I3DA 2MSPA 2GKIA 1I8MA 4HCIA 3A6BH 4WWNA 4RFNC 5HGDB 2ITFA 3D39D 4IK6A 3NCBB 1QWUA 2ZWZA 3TBCA 4KUZL 3ZY7A 5GGVY 2ROYA 3TEZA 3KLHC 1I8AA 1KOAA 4G9FB 3D5OF 3QYCA 1NGPH 5IVXB 1I7RB 1T4KB 1QEWA 3NFSH 2E27L 2DQCH 4A2LA 4YE4H 3QJVB 3QUZA 1CFSB 1NMAH 3I9GH 4PJFE 4N6RB 32C2B 4WKXA 1OW0C 1KN4H 2ICEB 3EJZC 2R83A 4NNYB 4JG1L 3VXUB 3WENA 5E4EC 3P11H 4KROB 5F0LB 2JJTC 2ZP0T 1JGLL 3ALWA 4OTXL 3QFJE 3FO1A 5IW1A 3SE3C 3MTRA 3BSZL 1RUQH 1M57B 5MENE 4XO4A 4JFPA 4UM9A 1KACB 3IPBA 3LYRA 4GAFB 4WHTB 5FK9A 4EEEA 3ZE1E 4L8BA 4JFXA 2C3WA 5I74C 4XN4A 4OCXH 1TQWA 3TBVA 4M61B 4XWOD 1LP9B 5C0AE 35C8H 5E8DH 4QNPE 2GSGA 1JPSL 1RVFH 2ICCA 1W15A 3DVNB 4BQ6A 4TVPD 4ALAC 1MH5B 4KV5E 3MLRH 3Q7JA 4P23A 4Z7WE 1K72A 1TVDA 1AXTH 3M8OH 1OF2A 2C4FU 3OQ3B 3QG6B 4PTUA 4OZFG 3VTMA 1NBVL 4X6CE 3BVTA 4KJQC 3KYNA 4K94L 3VXRB 5CJXA 3B6SA 4GP5B 3W37A 3GMMB 1F4XL 1NCOA 4MKMA 4WGWB 5FM8A 2C3GA 3V4VB 2KUTA 1GW0A 4HSQA 3REVB 3T1FA 2F19L 4A7VA 5FO7A 4NNPL 5C0ND 4OUUB 1CI5A 5EOCJ 5EO1A 4PRAB 1LEKB 2KC0A 3FFDB 3S2AA 3TCLB 3HKFA 3QWQB 5DFWH 1WAEA 4AEFA 1KCVH 4P5TD 4PYGA 4MAUH 4M7KH 5IHBA 3ZBMA 4S1DC 5FYLL 2ZOTA 3QEUA 4UT9A 4D2NA 5DFVD 2KZWA 3CZUB 5AOKA 3WNKA 4DGIL 2Z35A 3B5TA 3ZE0E 5HJDA 1R1CA 2OZ4H 3ECWA 3MV8E 4NPYA 3VNYA 4KK6D 3QB7C 4DKDC 4W9GC 4AH2B 2Q0ZX 1DVYA 1HHJA 4NM4H 2WBXA 3SPVB 4WU7B 2E9BA 1AQKH 4WV1B 1IBYA 3O3AA 1MG3C 4LOFA 4ODVH 3IGLA 4YVUA 4LHQB 3K80A 1TETH 2HT2D 2OR7A 2OZNA 3FUJA 1QP1A 2BHZA 1BXAA 4L9LC 4PBWD 4KQ3L 4PVBA 3BVNA 4NRYA 4OM1H 5CCHE 1MCCA 5DO8A 1DFBH 5IV2B 3I6GA 2ENYA 1E5UI 2FGWL 2WXHA 4X6BA 4QHPA 4OI7A 1FLRL 3NJHA 1A0QL 4XNAA 3U0TA 3IRZA 3VE0A 1MQ8A 1J1PH 4JKMA 3ARUA 2E7LC 5EULV 4MTMA 5GSVA 2OTUA 3KCPB 1MCIA 4KH2A 4O5LH 3R06A 1UD8A 5LDSA 2QQKH 2I5YH 4UF7C 1ILUA 3RVTD 3U0PA 3NGBB 5E08L 3ATDA 5DJZA 1KUMA 1AY1L 1FO0H 2IVFC 3GPSA 4QOKB 2V2XA 3RWJA 4BFIB 1BVZA 4G6FD 3NTCH 2A4EA 3GB7B 2Z6FA 2GTWB 5DWUH 2K8QA 3QH3A 3ULUL 4UUJB 3GIZH 4PP2B 4NC0B 4ZW8A 5DJDB 2Y2WA 4APQD 2EEXA 3ROOA 2XZCL 2IFFL 2DQHL 3GSWB 1DVXA 3MCLH 5F6IC 1U41A 4OLYH 1J8HA 3IM1A 1LEIB 1OIOA 4OQTA 1QWNA 1U4EA 1J18A 4DSYA 1E2WA 1BFSA 4I8DA 4FG4A 3RE0A 1OW0A 5C08A 3ARBC 2VT0A 3II1A 3K6IA 3QHFL 5GRYA 1OD7A 4R4BB 1FORL 1JFHA 2X38A 2JJTA 4MGXA 5CZVH 4JHWL 1FGNH 3FQTB 2EEBA 3ET9F 5E9NA 2ZUYA 1JWUB 3D08A 3SE3A 4J39A 1QRNB 4FABH 4MCYB 5I76A 3MLTA 1T1YA 2AK4D 3JWOH 3OR6B 5DJ6A 2Z7UA 4G71B 3SO3B 4ANXA 3CMOH 2MHAA 3G6AA 4NUJA 1MW2A 4P5TB 2OJZL 2OMTB 3PWPD 3ECBB 4L5FL 2H3XC 2Z7YA 5B7EA 1IEHA 1A21A 4KKAC 3AS1A 2X6UA 3OAZK 1GZPB 1R24B 2GHWB 3BKCL 1KB5H 3IT8D 3AC0A 1G6RA 2AJ3B 2JQZA 4UNUA 1IIKA 3IETA 2MCAA 4AI7A 2CKBB 1JERA 4I9WE 1G1YA 1TVHB 1EFXD 4A1RA 4YXHL 1WZMA 2XPGA 5F1IB 2YEZA 4UQ2B 1CD1A 5AW9B 4D0CA 5K1JA 2KHAA 4J6RL 4AC2A 1MF2H 3MXVL 4OM0L 4WW2B 3VFUB 4MS8C 1HSBB 2C3VA 3MJ7A 2XY2A 4XAKE 2ESVD 1WZKA 3C6LC 5EMYA 3U9PL 1YMMA 4DUVA 4P49A 2AV1A 4H1LH 4TTDC 5H35A 1TUPA 2J8UB 5HGHB 3IAQA 1BMWA 1EDQA 1NEUA 2WP3O 4GW5A 4PRPD 1S3KH 2C1OB 5HDOA 1NC2B 3V0HA 4AL8C 1AXSB 4UOW1 1YY8B 5H2BB 4LL4A 4ZX5A 4Y16B 4YDLB 3AQZA 4UOJA 4JFYB 2BMKB 3BYYA 1D6VH 3OZKA 1L4IA 4ES8A 3VA2C 4X6DB 5D8JH 4NENA 4X6FB 3P9MB 2ICES 3DXAB 3QHZH 2ZTBA 5F9DC 1E3FA 2P28B 2I7OA 2BWQA 1SDDB 3IDNA 4L9LA 2Q8BL 4Z3IA 1AG6A 3KR3H 5HHNB 2NY3C 5E00B 2UUDH 3SD2A 4K2UL 1U21A 2V5TA 4UTBA 1TSHA 2VM3A 3FONB 1CLOL 4TV3A 5K69A 1G94A 3O6KH 12E8L 1FYTD 3LEYL 3BI9X 3OVUB 2E7LA 5TPWL 1MW1A 5CSZB 2Y5TA 1EZSA 1XGYL 2XV2A 3HC2A 4HSCX 3Q3GB 4U1IB 4A7QA 4ZTOH 1EJOL 3GXNA 5F72S 2W9EL 2W0LA 1JTOA 2ROXA 4MNGB 3AAZB 3O8XB 4FQLL 4OQ1A 3VMPA 1ORSB 2XT1B 5DUMH 3EH2A 1ZHNA 1SXAA 1T1XB 2YUVA 3MRJB 4JKNA 3RWDB 5KVEL 1S3RA 5IEHB 5GRXG 1PSKL 3UROR 2E9JA 2GSMB 5LCVL 2X4RA 2NRDA 1XCWA 2EIZA 4D0DA 4NQEE 1EJFA 4PAZA 4CSTA 1TJHH 3BT0A 3EYSL 2I25N 3QO0A 2CGYA 4Y19A 1QFUL 5HDBF 1HHHA 1HXMA 5EBMB 2NXZC 3W5NA 4K5MA 2XI9A 5EC1B 5I30L 3UO1L 1IGML 5ESQB 1P1ZB 3LZLA 5JYMA 3CX2A 3ARBA 2WTRB 4L4TA 3GJFH 3IFLH 4KUZH 4YDJB 3IDIA 3WXVL 3L3JB 2QGBA 1I75A 2F54D 1IC7L 5D1XE 2BSBA 1IGJA 4S0SD 2E27H 3PAZA 1XX9C 1C08B 3MACL 5JDSB 2CK2A 2L7JA 4KZCA 2M26A 3II2A 1NTDA 1PKQA 2L7EA 2R2CA 3BH8B 4L3ED 4JG1H 3RL2B 3QQ9D 4Z7IA 5JHLL 2FBJL 4HJ0D 4K3GA 2DICA 4M7ZB 5CZKA 3RVVC 2X41A 1BM3L 4C59B 1JGLH 2ZOLB 1FI8C 2R2HA 4LSDA 4OTXH 1X5KA 3PUCA 4MXVF 4NLAA 3RPIB 4QD2E 5ABZA 2MJWA 2QSTA 2FEDC 3BSZH 1DJXA 1I1YA 3K5SA 4JJ5A 5EH1A 5IVOA 3UP1A 4A67A 3OLGA 2VUOA 4JKKA 1XQ4A 4OZHE 1XMWA 5ERWB 1JXDA 3TVMC 2ADFL 1KXTA 4J2QA 4MJ4A 4ZUWB 5I6XB 2E5EA 3GT6A 1JV2A 2NYYD 4PV8B 3RWGB 1PYWB 4G7RB 3B56A 5C9JB 4FFYL 4E68A 2IDFA 5C97A 4NZUL 4BFBD 3US0A 2FYVA 3C6LA 1JPSH 2NZ9C 4PYHA 4U0RC 1QKZL 3BLBA 4MHHI 2VJ8A 2XFXA 5E6IC 3ZYJA 2Q87A 8PAZA 4G7VL 3BP6B 2DL2A 5D1ZB 1NBVH 2PWFA 5BZWB 3W39B 4K94H 1PZBA 3LN5A 4JFFD 1F4XH 1O0VA 4OF5A 4PGEA 5D1QD 4A7GA 2EYRB 5ITFB 2F19H 3AITA 3QJHA 1LE5A 3ZL2A 4NWUL 4NNPH 4NWTL 3K4DA 5DVOA 1SJHA 2JMRA 2NQ3A 3PWJA 4PJCB 3T0XA 1MSPA 4Q6IB 5JORA 3GO1L 3RGVD 1VDGA 3O4LD 1L3WA 6PCYA 2DYRB 3NSXA 1AR1C 4OVUA 3S37L 2XPZA 3H42L 4N90D 1UH2A 5FYLH 2BSDA 2APBA 3IXTB 4PJBB 1Y7VA 4DGIH 1SJMA 2A38A 3BWUF 4JFDD 3PIQA 4YHIB 1CXIA 5DRNB 5EBLA 2YO3A 5F1SA 5GZND 2C1PA 1XF4B 3I6KA 4MSWA 3R7QA 3CFDA 4D9QE 2ZAHA 3BC9A 4A68A 5A3ID 1J11A 4DPAX 1YY9D 5DT1L 2PYFB 3B1TA 1G9EA 3AG4B 4WY7H 1MELA 2GBTA 1URIA 1BPLB 4NNXB 4KQ3H 2QPEB 3EOTL 3LB6C 1QQDB 2JI3A 1V05A 1IVLA 5KSVA 2FGWH 2F15A 5L4FA 1FLRH 2WWKT 1A0QH 2HXAA 1IILE 4KJWC 4KHXH 2VLRD 5EFIA 4H1LG 4PR5A 4LP5A 1ZK5A 5G5DA 2JKLA 4R9HA 2HT3D 4L2LA 2CA4A 3WTTA 3ARGB 2W8CA 5BZXA 1XF3B 2WM0A 1XF1A 2JKTM 2XKSA 3ALPA 4HW6A 2I60L 2WYZA 3ZGIA 1A3ZA 5E08H 3GXTA 4TULL 4UT6L 4XVOA 1RU9L 3KPSE 1AY1H 4XN8A 4L3FA 3N06B 1S7UB 5KBDA 3P2DA 4QT5A 3ULUH 3TBTB 3V0DA 2CR0A 3I85A 3HBZA 4AX3A 2EDKA 2GJ6A 2XICA 4PH8A 1CTMA 1R3LB 1PZDA 1Z9OA 3BMWA 4PWHA 2XZCH 2YPLB 3LZOA 5A2BA 5CBAB 2IFFH 2DQHH 5LGJB 2B9AA 3NIDB 1CFNA 3IEAA 1IMHC 1AO7A 2DQIL 1TCRB 3BCFA 2BHUA 4QRPD 2E59A 4KPHL 3RB7A 4PLNC 3IMVA 4AQ1C 5EU5B 4EI5D 5LVEA 4OZIA 1FO0A 2Z92B 3QHFH 1XGTB 4BQ8A 1HYSD 1FORH 1NA8A 4GJTB 3LRSB 3RNQB 3L5WB 1JFQL 3H8NA 2RTTA 4NO3A 1W8NA 2APFA 2F74B 1BHGA 4JHWH 5D1QB 2VXSL 3UP6A 3IDJA 1OB1A 5JHDA 2E56A 1XGRA 3BQUB 1DN0B 3JWNH 1VB9A 2WD0A 4M7LT 1KV7A 1M1SA 1DVQA 3FU7A 3TVMA 4JY6A 2EDEA 3SDXE 3AW5A 4H25A 3RGVB 3QR1A 4M7LL 4NB7A 3VWJC 5B39B 2OJZH 3KL0A 4WI8A 3KJ4C 1OZUA 4DP8X 4L5FH 4JBSA 4V1DB 5BRZE 2ETWA 2AXGA 1OAQL 5GS3A 2NW2B 3OL2A 2F5BL 4NO5A 1AI1L 4UM8B 2DLFL 1YECL 2F0CA 3BKCH 3RIAF 3UBHA 3FSAA 5KG9B 4NN7B 2WQUA 4JFDB 1CK0L 1R3IL 1AMXA 2VUKA 3UTQB 4LCYB 1HINL 2NT0A 1BOYA 3FCBA 1HTYA 3GS7A 5E6IA 4YXHH 4H8QA 3B2DC 3TXAA 2UY7B 2G2NA 4UQIM 4EIGB 2HCZX 4FXKC 3VGAB 4QLWA 3UEQA 2NTFB 4ZW6A 4ENED 4J6RH 2H26A 2CPCA 1N8ZA 1UD5A 3MXVH 4N9OB 4OM0H 1I7UA 1KT2B 2X4UA 3WIFA 5CAYB 4OH2A 2CZNA 2C9QA 2ATPA 3U9PH 2EDFA 5CGBA 2X6AA 4LCCB 5D2LF 5IBLD 2VLRB 3WHXA 1S9WA 3NA4A 1FZJB 4U7MA 4KUCD 1KB5A 4U3HA 1TZ8A 3VG9C 5GZOC 4LP8A 3EYFB 3IS1X 5IWLC 4BXVA 3IF1A 1S46A 5IHHA 2OX5B 3Q1SL 2BNRE 3CD4A 4HJTA 1GZQA 4ZUSA 3DYPA 2WIMA 5AOLA 4NQSA 4Y2DB 3H2PA 2B59A 2ZWSA 3D69B 2WYTA 1S78D 1PFOA 3T3MB 3M1BA 1MJJA 5HYIA 4D3CL 3K72A 4CVZA 4XI5D 1DQJB 1KGWA 4NOBA 3BPLB 4XOAA 2Q8BH 3RJQB 3D0VB 1XIWD 2H0JA 3CXDL 3V0VB 2PR4L 4K2UH 3KPLA 3JT0A 4GT0A 3ABLB 2VITA 1CLOH 4ODTL 3WO4B 2R7EB 3VGBA 4EF3A 12E8H 2WIIA 4EN3C 3LEYH 4EI5B 5TPWH 1CU4L 4U1MA 4AUJA 4A7GF 2AQNA 3J8F7 1VENA 2EXSA 3BP5A 2ED9A 4B60A 1AD0B 1XGYH 4YXLL 4E9SA 4XNZB 1WA0X 2FHCA 1EJOH 3COOA 5AB9A 1TZHB 2W9EH 1TZAA 3ARTA 4GG6F 2DQEH 2WVVA 5E7FA 4FQLH 3GRGA 3WY4A 4GUPB 2YFNA 1GR7A 3M1CA 4KGLA 5KVEH 5ISZA 1PSKH 3CTTA 3FUHA 3H7LA 3RY6C 2X7LB 1TOXA 5LCVH 2NX5D 4DVBB 1K4CA 4ODBD 4UTAL 4DQAA 3EYSH 4W4NA 4XCCL 4ETQB 1Q4NX 5AOJA 2G2RA 1QFUH 3CIAA 3MLYL 1H0DB 3FSVA 2WNWA 3U2IA 2EVJA 7FABL 1NEZA 2HFFA 1TIUA 5IQ9B 5I30H 1MAJA 1IGMH 1SZNA 4NQVA 3OX8B 5DMIH 3UO1H 3FCTB 4WU5B 5EBWA 4UNVA 4AQ1A 1F18A 1KSRA 2ZOWA 5LNGA 3JTBA 3RZCB 1WIUA 5J6HA 5LDUA 3FF7A 3KWXA 4CJ0A 3II3A 4ZMPA 3WXVH 1U2CA 2WO3B 4RQQA 4OCNC 3QUZD 1IC7H 5FYJD 4PRNA 1A4JB 2ED7A 4OGAC 3M45A 4JREC 4YPJA 3FU8A 3VFOA 5HYSA 1CXKA 1FVCA 3F7RA 4XNMA 1THAA 4GMSL 3KPQB 3MACH 4WNJA 1LQBC 1L9NA 4YHOL 1OY3B 4UOW0 4P5MA 4V2BA 5JHLH 4LKCA 2FBJH 5HXMA 3D2UA 4KMQA 3VWJA 3BAYA 5C0EA 3WN5C 4G9DA 1U8KB 3RBSA 4KI5C 1BM3H 2Y24A 5MHSD 5CZXC 2WBJC 3ULUC 1YPZA 3WNIA 2AQ2A 3S4SA 4LDCA 2LU5A 4UM9D 2WXIA 1BQ5A 1RH8A 4JRYE 3IBOA 4I0CC 1N59A 4F37F 2NY6D 3DTDA 3LPOA 1O6TA 2IC2A 5CLWA 1LHZA 1TKWA 1VLXA 1NGWA 2ADFH 2D3NA 4B3VA 1SYVB 2FK9A 4MFHA 3WIIL 4FXKA 2I9TA 1JPGA 1ZT1B 4K7PX 1KNOA 4XTRD 4FFYH 3MCYA 1RZ8B 1BA9A 2DYSB 2C9VA 3GDBA 4PJ7E 4RCAA 4C4UA 4NZUH 5HVGB 2EDJA 5I17A 4P23D 1QKZH 3