2BWDA

Atomic resolution structure of achromobacter cycloclastes cu nitrite reductase with endogenously bound nitrite and no
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
total genus 90
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA02
1JZGA 1ET5A 1OOWA 4N8UA 1AANA 3SBPA 3QJQB 1PZCA 3EH5B 3ERXA 3PLYA 1PZAA 2CAKA 5F7BA 3NJLA 4HCIA 1ZV2A 1OF0A 2DYRB 2VW6A 1WA0X 3N55A 3FU8A 1BXUA 1TKWA 2DY2A 3FYIB 4N4YB 1HAUA 1YLBB 4E9QA 2BZ7A 2J57A 5I6OA 1JOIA 4YVNA 3TU6A 4YSOA 4DPBX 4KNSA 5I28A 2J5WA 3WKPA 2UXFA 2YAPA 1W6WA 3UABA 3EF4A 3NYKA 3GXUB 1BQKA 4BDVA 3X1FA 1GR7A 1J5DA 1OE3A 1A65A 3H4HA 4E9TA 4GP5B 1QLEB 3TBBA 3QJRB 2CUAA 2XXFA 1W6LA 2TSAA 1SHXA 2HRHA 2PPEA 2VM4A 1AS7A 3NJGA 1JZJA 4M3HA 4AZUA 2PPCA 1GY1A 4DP2X 3CDZB 5AFAA 2W8CA 1QHQA 2HX7A 1GS8A 3AZUA 6PAZA 1E30A 1CYXA 2PCFA 2BP8B 1KYAA 1ET7A 1OE2A 1PLAA 2FT6A 4HIPA 2J56A 3FS9A 2OCCB 4TXVB 2H3XC 2RACA 2XV3A 1EHKB 4KO7A 2GSMB 2FT8A 2FWLB 4BK5C 1L9TA 4YSTA 3IN0A 4DP8X 3CZUB 2YAEA 1AZRA 1SFHA 1CC3A 2PLTA 2FQDA 2FQEA 3KW8A 5I6MA 2HZHA 3DTUB 4QKTA 1BQ5A 1PMYA 1J9QA 1NIEA 3WKQA 3CG8A 2IH8A 2BWDA 1E67A 3QPKA 3T9WA 4KNTA 3OM3B 4HHWA 1SDDB 2UXVA 1N70A 1GY2A 5PCYA 4G7QB 4G7SB 2MRYA 4JHVA 2YXVA 3WIAA 3T6ZA 4AI7A 1ETJA 2QT6A 3SQRA 1NZRA 2BO0A 1KCBA 4AX3A 1SHWA 1AQ8A 2IWEA 1PLBA 1ET8A 3C75A 5EHFA 3FQ1A 3WNJA 4DP4X 1NWPA 1ZPUA 4NERA 4WTQA 1WS7A 5I5IA 2ZXWB 3FSZA 1NWOA 4GY4A 1GW0A 3X1GA 1KDIA 1MG3C 4YL4A 4E9VA 2IDQA 3PPSA 1IBYA 1RZPA 1A4AA 1NPJA 1JXFA 3TA4D 2ZWNA 3FSWA 1XMEB 2VSKB 4W9ZA 2YARA 2BW4A 4G72B 1ASQA 5AZUA 3AY2A 3DIVA 5B1KA 2UX6A 5LDUA 1CYWA 3G5WA 1J9RA 4AKQA 3T6XA 2GB2A 1DYZA 2XUWA 2VW7A 3S3DB 2BZCA 2JFCA 8PAZA 5B7EA 4GP8B 1OCZB 4DPCX 2H47C 2EIMB 1AAJA 2BP0B 5IY5B 3CVCA 2B3IA 1KGYE 1V54B 1RCYA 4A2GA 4A2HA 4M4RB 1KV7A 1SNRA 2UX7A 2BW5A 5ANHA 4QLWA 3PXLA 3H4FA 3ZIYA 1HAWA 3ASOB 1SJMA 5TK2A 3MBWB 2E86A 4UF7C 3FSVA 3UAEA 1NIDA 3PCYA 3UACA 3NJNA 1AACA 1CUOA 3X2QB 3ABMB 3FPYA 4HZ1A 4YSQA 3QJVB 2B08A 3ZBMA 1EZLA 1BXAA 1XB3A 2EIJB 2HXAA 1PF3A 1OCOB 3NJJA 5I6PA 1M57B 4HALA 4KOCA 3NP4A 3X1BA 1NDTA 3FQ2A 1E5ZA 1IBZA 2H5UA 1NTDA 4G71B 4YSEA 4X4KA 2DWTA 4AKOA 1NIFA 2VMJA 1AS8A 1AG6A 2FJSA 5B1AB 3T71A 3UAAA 3ASNB 1GS6X 2NRDA 1J9TA 4ENZA 2WO2B 4FA7B 1KCWA 1M56B 2XV0A 4G7RB 5TK4A 2Y1AA 3IBOA 3ZX1A 4BXSV 2Q9OA 4DP6X 2IDSA 3FQYA 4E9YA 2QPDB 3JTBA 1ADWA 2J55A 2PPDA 5PAZA 2CALA 2ZOOA 2BHFA 1AG0A 1J9SA 3H56A 4DP1X 3ABGA 4BWTA 1ZIAA 2PP8A 1PCSA 1BYPA 1AZCA 3NSFA 2XLLA 4L0PB 1JVLA 5D4IA 4A2EA 4YVUA 4JHUA 1FWXA 5F7AA 4UANA 1NIAA 4JKNA 3FU7A 4MFHA 2P80A 1HFUA 1JXDA 4KO6A 3KW7A 1V55B 2PCYA 1KBWA 2IDTA 5I6KA 2FT7A 4HCGA 2IWFA 1TU2A 2W88A 1SFDA 1QNIA 2OV0A 4PCYA 2Q5BA 1WAEA 9PCYA 1ID2A 4GXFA 4AKPA 3ZDWA 1BAWA 2FNWA 1BYOA 6PCYA 1A4CA 1JZEA 3PAVA 4CSPA 1GS7A 1IKOP 1WA2X 4YSSA 1V10A 1A4BA 2UXTA 3S8FB 1MDAA 3HB3B 4BDVB 1MZZA 1RZQA 5B7FA 3BQVA 4A2FA 1JZHA 1NICA 2JKWA 1AZNA 2GBAA 1ASPA 2XU9A 3FSAA 2EINB 1MG2C 3EH4B 3U25A 1F56A 4P5RA 3MX0B 3V9CA 2DYSB 2YAFA 2WO3B 5I5JA 3V9EA 4K9JA 3CVBA 3X1EA 3FYEB 4NB7A 4KNUA 2FQGA 3NJHA 1JVOA 2CCWA 2VN3A 3NSYA 3ABLB 1PNDA 5I5MA 3JT2A 3T6VA 1AZBA 3NSCA 1E5YA 1PLCA 2IH9A 3EHBB 5I26A 3AG1B 2UXGA 4YSUA 5B1JA 3D12B 2X87A 1W8EA 5E9NA 2PP7A 1A8ZA 2FTAA 4F7KA 1A3ZA 1KBVA 2R7EA 4BWUA 1AZUA 2P80D 3NJIA 2X88A 1SF3A 1IUZA 4Q8BA 4GYBA 4DP7X 1SDDA 1L9PA 3FU7B 3PAUA 4GP4B 4EF3A 1J5CA 4RH4A 1GSKA 3OMIB 4E9RA 5B1BB 1N68A 2HRGA 2JXMA 3S3BB 1FFTB 1NIBA 3FT0A 1OV8A 1VLXA 2IWKA 1JERA 3T6WA 5B7MA 2VM3A 2GC7C 2LLNA 1OCCB 2QDWA 2YQBA 3NJFA 3QJUB 4YSRA 2XV2A 2GIMA 4Q89A 3CVDA 1BXVA 4W1TA 1I53A 4HHGA 3X1NA 1L9RA 1WA1X 3IEAA 3EH3B 2DWSA 1L9QA 1R1CA 1TEFA 3PAZA 2XYBA 2EIKB 1SF5A 4DP9X 4FAAB 2YAOA 4WKXA 3GYRA 2YAQA 2YAHA 2ZONA 3BVDB 2IDUA 1XB6A 3NJKA 3RYMA 2YAMA 2IDFA 2HX8A 3AW5A 2XVBA 3QJSB 3DKHA 3FU9A 1L9SA 3OMNB 4A2DA 1ILUA 2TSBA 3TBCA 2HLEB 4KOBA 4DP0X 2MTAA 5I6NA 1MZYA 1FA4A 1IC0A 2I7OA 1NPNA 1OCRB 2BP0A 4A67A 1ZDQA 4YSAA 3GDCA 1ILSA 2AFNA 7PCYA 1DZ0A 3UADA 2IAAC 4UAHA 2BWIA 3NSDA 1PNCA 2WSDA 2FQFA 2Y69B 3S8GB 2A3TA 2EILB 3AG4B 1B3IA 1TEGA 4NAJA 2R7EB 1XB8A 1AIZA 4CSZA 3UGEA 2XXGA 2AANA 1URIA 2N0MA 2AVFA 2YXWA 1M9WA 1AOZA 5I6LA 2QDVA 1E65A 3AG2B 3NT0A 4F2FA 3N2JA 1PAZA 4E9XA 3ABKB 2AZUA 3S3CB 1OE1A 4HAKA 1PY0A 3TASA 3WNIA 2PP9A 1AS6A 4YSPA 1CURA 4BXVA 4A68A 3CDZA 4YSDA 1KDJA 7PAZA 1AR1B 3IN2A 2BP8A 2CJ3A 2XX0A 3WG7B 1ASOA 1PZBA 1RKRA 5FC9A 4YSCA 2VSMB 4HCFA 3SBQA 3OQRA 2PPFA 4DP5X 2OJ1A 1L9OA 1GYCA 3OD3A 3OMAB 2I7SA 1BEXA 3NJMA 4PAZA 2GC4C 5D4JA 2XX1A 2QPEB 2PPAA 2HX9A 1X9UA 1JZIA 2XWZA 1ZDSA 2AZAA 5D4HA 1JZFA 1UATA 3QQXA 4G70B 3SBRA 1JXGA 3HEIB 4KO5A 1X9RA 4A66A 1ZIBA 4F2EA 3AG3B 4E9WA 2CBPA 2I85A 4DPAX 2GHZA 3WI9A 4BWWA 5B3SB 3FPXA 2VW4A 3L45A 3QJTB 4E9SA 4P5SA 3IE9A 4ZK8A 5AKRA 5B1JC 3NP3A 1BQRA 4KO9A 1WS8A 2GI0A 1T5KA 5A7EA 1NINA 2DV6A
chains in the Genus database with same CATH superfamily
1QLFA 3B1UA 3LKRB 3JZYA 4RGNB 5H4YA 3VXRA 5EU6A 3QJQB 5C09B 3M7OA 2HG5A 3NABL 5CZRA 3L1EA 3NGBC 1PZAA 4G8FA 4YS4A 3NJLA 1EO8L 1VESA 4O2FB 4V1DE 4NKDA 1DE4A 4ODUA 3JUZA 1OF0A 1YEWA 4ANXA 5I18L 1MJ8L 5L8JB 1U4EA 2WKGA 5CBEB 1BXUA 4KKNA 3ARBC 4NO5A 4UTAH 4N4YB 1AMYA 2FL5B 3D06A 5I1GL 2GT9B 4QJ3B 4E9QA 1TQSA 1DL7L 4WWKB 3UTSA 2ZOTA 1UJ3B 1VFBB 2H6PA 1WTLA 2FEDC 2XY2A 3T0BA 4L3EE 3TO2A 2X5PA 4QOKB 3WAJA 3V5KA 2M8XA 2Y7SA 4FZ8H 3V0AC 2A9BA 4HIHA 2CLZA 5IQ7H 2YAPA 1WCBB 4XNQB 2H8PA 2YN5A 1J86A 4ILDA 3EF4A 3ES6B 3MRPB 4DK3A 3BQUB 3QPXL 2FZ3A 4L1LA 1FN4B 3GXUB 3BXNB 1IGCH 1KCLA 2VLME 3H4HA 4E9TA 1HCFX 1TTCA 2PCPA 1AI1H 1K72A 2V5YA 3LB6C 5IK3B 5EZJA 1Y7VA 1DUZA 4ZNEE 3DV6A 3ORJA 4L48A 4GMSH 3D7PA 5IB4A 1J5IA 1JMXA 1CFVL 5TDNB 4AZUA 2PPCA 1J8KA 5TE7H 1OIOA 4TQHA 1GS8A 4X5RA 3AZUA 2FO1A 3P4NA 4AQ1C 2K9UA 1AD9A 3G5VB 4ODWB 3BZ4A 3F00A 2DQJH 4NKOA 1NCWH 1KIQB 5ISZA 3W2DH 4OUUB 2XV3A 1J1PH 2WLYA 4LHUB 5CHNB 4OD1L 4KTYA 2FT8A 2EZ0D 5DHXB 3G6JE 5DD3L 2CLVA 4NN6C 1C8QA 2D8KA 2HSIA 4HKBB 2R29L 2IPKB 4I4WB 4M4RA 3T1FA 5EDSA 2HKHH 2YAEA 4LASL 1BZEA 3VXOA 3L4YA 3X13B 4OZIA 1KYOK 2K70A 3D34A 2HB0A 3LEXA 2CKBB 3NGBB 4D8PB 1UFGA 1S7TB 4KMTH 5E99L 5AB2A 3C2AL 1YY8B 5J13C 3BEWB 5F96H 5D1ZD 1ZA6B 3MRNB 1XSKA 2F8OA 3V55A 1ODAA 5DLLA 4FI8A 1I8MB 1U4FA 1RFDH 3DX7A 3LH2L 1N70A 4Y5YB 3ARBB 3BDYH 4H8QA 5IJKC 4UMSA 3DVNA 3G5ZA 4JFSA 5EFIA 2X7LB 1MVFA 3O9WD 2G5RA 3FT3B 5BZXA 4L29A 1TKWB 5CP3H 5F0MB 2ENSA 1TJHL 1N9PA 2OL3L 2CGYA 4WI9A 2XZZA 3G04B 1PX8A 4X5LA 3T77A 3EJYD 2D3NA 1P7QA 3VGFA 1DCLA 5ID1A 1YDPA 5CLWA 2ZCKL 3JTTA 3KXFD 3KYOA 3NK4A 1EFXD 2OMUB 2OP4L 3IAPA 3Q2NA 4JRYD 1BECA 2ZD0A 4MAUL 1CTMA 3PPSA 5EC2A 1RSYA 3EG9A 4UT6A 4AG4L 2VLJB 1KBKA 2A74C 4UV7L 1HS6A 4POYA 1QOKA 1XR8B 5ITFB 5IEKB 4AH2B 1MAML 4ZO7A 2VDQL 3ELQA 2GB2A 4ZUWA 4U6VH 3SE6A 4Z95L 1UCBL 1ZT7A 4IU2A 2AGJL 4U49A 5D72L 3LMJH 3MRCA 4NWTH 4XCYA 2NW3B 4GLRH 2IQAA 3CD4A 4WI2A 5GISH 2XZAH 4GOSA 5G4NA 4CNIA 1AGFB 3CVCA 1VFAA 2YUVA 4DO6A 4KVCH 3WHE0 1U3NA 3T09A 1KV7A 3TC9A 3BSHA 3HZKB 3KNBB 2DPKA 2F5AH 2XN0A 5HYJA 4FLOA 4OCRH 3KH4A 3ASOB 2ZYIA 2J6WA 1FAIL 4FXKC 5J13B 1JDCA 3HMWL 1BA9A 4E2OA 3EYQC 1FDLH 1T1XB 3APCA 4O00A 1I7UA 1XGTB 1S5HA 1MFBH 2G5UA 4PJHE 5JPMB 1OB0A 4MA3B 2FECI 2AJUL 5J11B 5CJXC 2BS8A 5DC4B 5ILTH 1DBBH 3NPSC 3O6FD 4G1MB 1O6SB 5EBLA 1BVKA 3IJHA 4PJFE 3ROOB 4MZRA 1JCVA 4Z77A 2ZP0T 4GRWH 4KI5D 4JDEB 4M6OH 1IRAY 2CRMA 3FQTB 3NQIA 1RIVL 4G3YL 4MMXB 3TA3B 4EEEA 4AIEA 4KKLD 2OR7A 3B9AA 1OXYA 3PL6D 2VMDA 3UTPD 4LKCB 3ZK0A 2VJXA 3FO2B 5ID0A 3Q1EA 3WXWH 3A67L 3HRZC 2V5TA 2LFEA 1U30A 5DFVD 4PJDF 3D33A 1HXMA 5IV2A 4LK4A 4PR5A 3ZX1A 1U95B 3FQYA 2V17L 3QDGE 5HGHB 4HT1L 5HGBA 1IJ9A 4B50A 3QCUL 3MVSA 3CQPA 3E9UA 3R18A 3GSNA 3MLVH 4WI5A 2DI8A 2ZP8A 4NQCD 5E9DD 3WXVL 1U8HA 2WNKA 1BYPA 2ZP9A 3IU4L 2EDBA 1M6UA 3L2LA 4LVNB 5E1AB 1XGQA 1WBXA 1MHHA 4QMEA 4L8DA 2XG5A 5CMAB 3L6FB 1RZ7H 3MLYH 3VWJC 1UZGA 3DIFA 4R2GB 4JRXA 2AXWA 5FS5A 1YUHA 1A4JB 3SDDA 2IPUG 3EFDH 5IVZB 2EDKA 2RIKA 3ECBB 1IL1A 4ZTOH 5I6KA 4G82A 2EXWD 3PWLB 1Z9PA 3GMOA 3G6DL 5K9KA 4FXKB 3EGXB 3M07A 3ZT7A 1A1MB 4EI6B 1WAEA 1ZXQA 1CGUA 3F12A 4APQB 4NQEE 4IRJD 4X6CF 2A0LD 3DGDA 5L9DH 1G0XA 1HZHL 3HIZA 1H3PH 3KXFE 1MCNA 5IQOA 2X2JA 4HQQL 3ZDZB 3RGVD 3KBHE 3LXCA 4HJ0C 1AXSB 4H0IA 3NPSB 4K2UH 4OZGF 3DARA 2F61A 1NFDB 4K9EH 1JGUH 4M5ZH 4O58L 1KJMA 5IHZA 3AY4C 3ULAB 4PRAA 5AW7B 4C56D 5F9JA 1V3LA 2R2HB 1AR1D 2KKQA 2W07B 4KKCD 4XOAA 1JPSH 4M02A 4ONGH 4BH8A 2MHAA 3I9IA 4MQ7B 4XMLH 4QRPD 3VFPB 4XMTA 5H2BB 2OYKA 2R0KH 1J9CT 4GW4B 3BW9A 5JPNB 5I1KH 2V3FA 1JZ6A 2B14A 2P5EA 3TEXA 3P4MA 3UZEC 3US0A 2JV6A 3GC3A 1UB6B 4MJJA 4NAMA 4B96A 3EOAA 2VN3A 1UWXH 3ESPA 4FXGC 2J88H 2Y2WA 4JM4L 2VDRL 4PJEE 2A74A 2ZCZA 2I5YL 3QXDB 1PLCA 4AMWA 2NTFA 3AFLA 1WGOA 1MRCH 2J12B 3MREB 3JYCA 5EG6C 4GB9A 5B1JA 2VRQA 5SX4I 3SJVE 2PP7A 2VLLA 5CBAB 4W9DC 1A3ZA 3OX8B 4IGBB 1FL3B 2VMCA 1EO5A 1U8LB 4BWUA 3HE6A 4X8XA 5IB5A 1S9VA 3VWJB 4G42A 4W9JC 1E7UA 3PAUA 4WUUA 5FGCB 2MWCA 2WCGA 1RHHA 25C8L 3MO1B 2HMID 2JLPA 3STLA 4HLEA 3ULUH 1WZMA 4ZMVA 3BESR 2EH7L 4MCYB 5I19H 1VZIA 1TU2B 4Z7NE 4YDJA 2XTSA 5GIRB 2GC7C 3NSJA 3C5SA 1O7SA 1S7SB 4JPVL 5TDOB 4ZUSA 1I8IB 1M2VA 1UB5B 5HYEA 2FATL 4P9HC 5DD6A 1GJUA 1GVIA 1OSYA 2KH2B 1S7XA 3TNMB 4KKRA 2ITEA 4OUOA 1GKOA 1FSKB 2N01B 2X2IA 3WKNA 4QRUA 4YZWA 2R1YA 1TYRA 3EYFB 3ARPA 2Y3AA 3ULSB 2VR3A 2H3KA 2H41A 2ADIB 3Q6GL 3RYMA 1KFAL 4MZ2A 2IDFA 3VFNB 3CFEB 3LKNA 1L9SA 4Y4HD 4WJ5A 5DR5L 3WHXA 3LZNA 3LD8C 4FXGB 2FYVA 5CD5C 3GDBA 3IB4A 4BK5A 3RJDA 1OCRB 3FKUS 2O6FA 1S7WA 4AQEB 3WCYA 4KITB 2UWEB 3IWUA 3GHEH 3B6SA 4LHUG 2ROYA 4DKFL 1R9FA 1K5NB 1U8PA 4HIEA 1INEH 3I6LD 4PLKC 2EILB 4ELKA 4ZOAA 2GJ6B 3RTLA 1G5AA 1MPAH 2X44D 1KYUA 4JM2A 1BMGA 3EJZC 4NO0B 1UADC 4H2AA 1IC4H 4C56E 5ES4B 4UI2A 5DJCA 2ADGB 1AOZA 4ICXA 3OSKA 5ANMA 3NTCL 4TRPL 5FCSH 1TZGH 3NT0A 3RY6C 5DMKA 2DIBA 3RZCB 5D93C 3W0WD 3GSUB 1EV2E 3OC5A 1KG0A 3VB8A 4UQ2B 1LO3L 1A6WL 1CVRA 2M83A 3PP4H 3II2A 2ZSWB 5JXEC 1IMHC 3K3QA 4NN7C 2L4OA 2MOVA 3SQOL 5FECA 4GRWF 3ZE2E 2MCMA 5GGRB 5IFAL 3IN2A 5IR1B 3L7FB 1JI1A 1K4CB 1M1XB 1OK0A 1WP6A 3FNKA 3OLIA 4G9FD 2DOCA 5ICXB 3H53A 4K8RD 4RQQA 3M46A 3MV8D 3QQ4B 2Y4SA 1UT9A 3W11D 2XG4B 4ALAH 2AJXH 3QFJE 1NC4B 3OXSA 2OMYB 2WZPA 2BM3A 3I50L 4XHJC 4BZYA 1MCHA 1T21A 4AMKH 1OGAE 4L4TD 3AXLB 3CMOH 2Q76A 3IDIA 1AFVL 3MYJA 2E9JA 3UZEA 5GZOA 5D4HA 1WAAA 4XCCH 1VAHA 3GO1H 3Q44A 1DBMH 5IMLB 1QQDA 1BLNB 2Y6TE 3LD8B 1A6TA 1VGKB 1MRFL 3F7VA 3TT1L 3WI9A 3GSOB 3QJTB 2JCCE 3FT1A 5IT2L 1DR9A 4S1DD 1OF2B 2NX5D 2A9ML 4NDMB 5A7EA 5IESH 5EUOA 1ET5A 3BKJH 5IUSA 2ZX7A 4YHLH 1CT8B 2WAQA 3PLYA 2RALA 5GS2H 1OANA 2Y7QB 4RFEA 43C9A 3HLKA 2VKXA 5DJZA 1DZBA 3OMZA 2DLIA 5DQ9B 2DQHH 1D2PA 2GITB 3U6RB 3EBIA 4IEFA 5GHWL 3VGAC 4PJ6A 3VO0A 1N64H 4D2NA 5ALCL 1PIFA 2WVSA 3RWIB 2FX8H 2JK5B 4NN5C 2YK1L 1UOKA 5CEZD 1MAKA 3GMMA 3IDYB 4X4XA 3WFZA 1UWEL 2AJVL 1KYDA 5D93B 4R26L 5CJQH 3VWKA 1EAOA 5FWQA 4YHYC 4KRPD 1N6QH 4MZ3A 4KGJA 3LHPL 3AREC 3C8HA 1OGTB 3BT2H 4KXZH 1N5YH 3EOTH 3L3OC 4M7LH 3UDWA 1JGDB 4AZ8B 2CUAA 4GKSA 5I5RA 3B8SA 5DK2B 3VACA 1Q9OB 1XCQA 4F8PA 4D9QD 1JZJA 4OBSA 4F5CA 1H3XA 3QH3A 3CPLB 5SWSE 1LTXA 4DKTA 2JJVA 1BG1A 4HIPA 3AS2A 1UM4H 2WN2A 5DWPA 2NXZC 4RMTA 4BINA 3I75B 1F4YL 5DJAB 3VUAA 3IT8D 4LLYB 4IDLA 5E8NB 4FCHA 1KB9J 2IXQB 3VMOA 4AYFA 4WI4A 1ORQB 3K6IA 4DGWC 1NGPH 4MXVF 4NJAH 1ACCA 1EANA 4FRWA 3CZUB 4XGZA 3CCHA 3G5XB 4WWOA 4XXWA 1AZRA 1RZJL 5F7EH 3JV6B 3VQLA 3X12A 1D5ZB 1FNSH 5CUSH 5FYKE 3VXRD 5DQDL 4LL9A 5EU6D 3RX7A 3GBEA 2ITFA 4RWYH 2CO7A 3QJFA 1PMYA 4N2HA 3REVB 4HFWB 4X8CA 1YQ2A 3MUZ1 4FGMA 2WBXA 2VXSH 4PJ5D 1NMAH 2NT1A 3THML 3RI5K 3GXFA 3UTSD 5CWSB 1G9EA 3RWJB 1E2WA 4KHXH 5EOCL 2FBJL 2ZF8A 2Z4QB 1NANH 3FCTB 1DUYA 1MJ7H 2QADD 2R23B 3BZDA 4G9FE 4NN5B 4OLZH 3T6QC 4PREA 1IC7L 2WXMA 3TBWB 4A6YL 1HVXA 4J2QA 1YQVL 3EJPA 5DDHA 4YDNA 2Y07L 5EORL 3T8VA 5AVVB 3BHBA 5E5MA 4G8IA 1SY6A 3VDBA 4P2OB 1NFAA 2Z92A 4KVNH 3U1PA 2OI9B 2C3VB 2AVGA 1ACYL 1MHPH 1W9XA 1QG3A 3DOSB 4PS4H 4EE2A 5I8KH 1G7PA 2FH8A 2I26N 3AREB 3QXVA 2MH4A 3QIWA 3Q8FA 3L3OB 3H0TA 1G9NC 2YQ2A 4KQ3H 3X1GA 5JXEA 3CZFA 4B5EA 5KS9E 3LOWA 4FYSA 2X0UA 1J0ZA 4O02L 2NW2A 4ZSOA 3I2CH 4YDVA 4RFOL 4KDWA 1YN7A 5DRZA 2EDEA 1OM3H 3K71A 5JOFB 4XN8A 1K3IA 3I9AA 2EC9U 4WNSA 3VDAA 1C8PA 4XVSH 1IO4C 3UJJH 1S9XB 5AZUA 1OY3B 1WLHA 5ISZD 4HUWA 4XWGH 2NXZB 2XY1A 4UMGA 4AKQA 3RVVD 5HDWA 3ZUCA 43CAA 1OZTG 4YPJA 1UZ6E 1R0AL 1T83C 2Z1KA 1ZLSL 3QUZC 4HPYL 4JUSA 4RGMC 1XT5A 3TYGH 4QUOA 2IMNA 5CCKH 5E8OA 2BOBA 4KKPA 4XMPL 5ERWB 3PV6B 4UTBA 1V54B 3FOMA 4FFYL 4WWPA 3P9LB 5LUMA 3OKNB 3FW6A 1HHJB 3MU3A 4JHBA 2OMXA 1MVYA 1E8WA 4LE8A 4K55A 4WNJA 5E2TH 4QLWA 4N2BA 2A9NH 3TF4A 4ZMWA 3ET9F 1HDMB 2FDBP 3MRRB 1SJMA 3AT9A 3IFPB 1CD0A 2OSWA 1GYVA 3US9A 1QR1B 1MCWW 2ZUUA 3BISA 2ZX6A 4LBEA 5E8EB 3IJEA 4BE5A 2VDPL 3MJWA 5AYUL 3VRJA 3X2QB 4OZFA 5IBUB 3KGUA 3MRIA 5BZZA 3VXTB 2XWDA 1OHQA 1UWYA 5EEWA 5KSAA 1NDGB 2C9UA 2WP3O 4GAGH 1PF3A 3HUJF 3TH3T 3M7FB 5I1AA 3BE1H 1V7NH 2ORBH 1IBZA 3V52L 4FTVE 4MDRA 1TTGA 3QULA 4XN4A 1P7QD 1R3LA 3HNVL 1WEJL 1BDYA 4AIOA 4CW1A 1JNLH 1XHHA 4KK6D 1DJGA 3KYMB 3Q8AA 4JANB 4XNYH 5D7JC 2YD4A 4LQFL 3NCWA 5IQMA 4NQTA 2Z8WC 4R96A 1JV5B 4A2LA 2ZJSH 2IPTL 5ABDE 3VXRE 3CK0H 3VGEA 3ESVF 2B7DT 2QBWA 5HSFA 4BWTA 3VXUB 1ZIAA 5JNYB 5KBNC 1W91A 1X5IA 3K80A 2Q1EA 3DVGB 3MV7B 3DK2A 2MCAA 2WLNA 2BMKA 1F6FB 4NP4H 4XNMB 3UTSE 3LSOB 4RGMB 1HJBC 1O6TA 2DAVA 1WZLA 5JHDB 4EBQL 3GS4A 1IE5A 3KPRA 3MCKB 4OBRA 2X2HA 1JXDA 3M17B 4Z9KB 5HPMA 4PGEA 4HLZG 4RDQG 3BWUF 5HYJD 5IB1A 1Z9NA 3SY0B 4BIKA 2W94A 4JFDA 2CUMA 2QKIC 4JFZH 4R7XA 2X0WA 2BY1A 2Q5BA 2P24B 1CDGA 3MUJA 1MUJB 3BN3B 4QTHB 1XIWA 1KIRA 3SDXA 4H8WL 4PUBH 1GAFH 1UJTA 5CLYA 4UTAL 1FPTH 2A6IA 3H6JA 1BVLB 2FR4A 1E2VA 4K7FA 4WTWA 4OLYH 4IOIB 4ETQA 1QATA 4BDVB 4PJGE 3ISRA 1DVUA 2OJZL 3U0PA 5IQ7L 5ISZE 2R56L 3N3EA 3QUYA 1D5XA 5EUKB 1JNNH 3KCWA 2XTLA 5HDRA 5KSBB 5D7JB 4OZHB 5C3LD 1IGCL 3DOHA 1F56A 2VDKH 3DTXB 5TQ2L 1ZLVK 2GW5A 4ZBJA 2V2TB 1AI1L 1BEYL 4N26A 3V9EA 4MDJB 4Y2NA 5I16A 3RA7H 1VGEH 3IFLH 2VH5H 3CSFA 3P11H 4Z6AT 1AQMA 2WANA 3NJHA 2CCWA 5B8CB 4AIZB 4RGNE 4PU2A 5CEXA 4UNTA 5C09E 3O6MH 3RL1A 4YDIH 3GKWH 4PJBE 2WC7A 3JT2A 3JWDC 4JO5A 5TE7L 5DGQA 3AABA 5KBKA 3OZLA 1LJMA 1W0WA 2PO6C 1FGVH 2DQJL 4ZD3L 5E0FA 2WXPA 1IAKB 3WNPA 5K39B 1NCWL 3W2DL 1TJXA 4NPKA 5BRZA 1J1PL 5C0FB 1HL5A 1HI6A 4XMZA 2NSMA 4CILA 1SM3H 1JK9A 3WS3B 2IALA 4EN2A 2YHGA 4JRXD 3TJHD 5FLVA 4N1EA 3SDDD 2JKSA 1FF5A 4KI5F 4LHQB 5I1LB 3FU7B 5KAQG 4Z3JA 3LRLA 4XE0A 5LO7A 3MBXH 1O9WA 1YAZA 4X6BB 2HH0L 5D1QE 4JJ5B 3ZPDA 1FLTX 4I8DA 1I3GH 4Z7NF 1JI2A 3BH8A 4P07A 5ABZA 4ZX5A 1FNAA 4DIXA 1JERA 1WG3A 2VM3A 5AW6B 3CIAA 3IMWA 1MIEH 1ECZA 3UROR 1PLGH 3RWFA 3HMXH 2YQBA 1QAWA 3QHFH 3BDYL 4ONFH 5IMMA 3AS0A 2EEBA 4IK6A 4LARH 2BFGA 3AWFA 4Q89A 2H9GA 1V7MH 4XP5H 2FSDA 4CJ0A 4U1KB 5J6SA 4HULB 3IEAA 3OJDA 1L9QA 1TEFA 4NZJA 1T1YA 5BV7C 2EIKB 1KXQA 1RUPH 2J4WH 5DJYB 4WHCA 3S8WA 4J5VA 2P5ED 3MNMA 3N06B 1MIMH 4LMQI 3S4SB 2PKDA 5AVZB 3MNWB 2CBQA 3RPIA 3ZE0B 2CHNA 1A6VH 2DH3A 2N1TE 2C8NA 2CRIA 1ILUA 2G9KA 2AV7A 4PIRF 2XTJB 5HYJE 3CDGA 5JHLA 3FOLB 3FTYA 3RVWC 5AAMC 3WLWD 2BSRA 3JWNC 3NZ8B 2PO6B 4KY1H 3DHJA 1ADQH 2OCJA 4LLMB 4LRIC 4LSPH 4FA8A 4A7GA 1FHGA 1SVBA 3GHBH 4HLJA 4U6VL 1IAOB 3FFDA 3GMPB 4KDTA 3HE6D 5F3FA 3D18B 2DN7A 3APDA 3LMJL 4NWTL 4Z1PA 4TUKL 1KJVA 5HHQB 1FI8C 4N8PA 3QPQD 5GISL 2XZAL 3RPKA 1KNOA 3S8GB 1TEGA 4WUUD 1KSRA 2E0PA 2BJMH 5EO0B 1DLFL 3LPFA 5F7KC 3W39A 2BVEA 4UBDC 5H35B 1X5KA 2F5AL 4P2RB 2Z0BA 4K3HA 1XAUA 4OCRL 3IMRA 3T3ME 1R5VA 5AAWA 5INDB 2NY1C 4X5XB 1YEIH 1E40A 4ZQKA 4PG9A 1JHTA 1FDLL 2WXLA 4U1SA 2J21A 2R0ZH 4FNSA 2NY5H 4LLUA 4BKSC 3T0EB 1MFBL 3QI9A 4M93C 5F21B 3TASA 4ADIA 5JORA 5KW9L 3GM8A 3TFBA 4PY8J 4PJXA 3DSNA 3N40P 4C4UA 1DBBL 3NRPA 1WHPA 4QCIA 5DJDB 4RDBA 3GLZA 2KC0A 4ZPTA 1JZDC 3K46A 3PHOA 4M6OL 4NNXA 3FTGB 3NIFE 4W9CC 2BFVH 1GYCA 5IQNA 2D3LA 3E3QE 5EIIG 4Q6IA 2EUWA 4E41A 1U8JA 1G9MC 1NUGA 4LCUA 5F6HI 1MWAB 1RU9H 1DQTA 4U1LB 1MFMA 1E9QA 3WXWL 1ZHBB 3MRMB 4G70B 4JRXE 5J12C 1JXGA 2PXYA 3UXFA 1R24A 4K7PY 4F2EA 4N2KA 5B38A 4E9WA 4N9GA 1U8QB 3L5HA 4O4YH 1H15B 3KCPA 4YH6A 5AW9B 1WS8A 2JJTA 2DV6A 3LX9A 1XF5A 3H9SA 1LEIB 4U3SB 3MLVL 1BF2A 1JGEB 3FH7A 2AEOA 5HJDA 1AC0A 2YIHA 3QIUD 4QTIL 3ILQC 4G80A 2PTUA 1U93A 1WA0X 4JO2H 3N40F 4RMQA 4JM2D 1JE6A 2HTLD 2I24N 3U2IA 1NUDA 1M7DA 1MCFA 1O7DE 1RZ7L 3U1QA 3MLYL 5T3XD 3QISA 5LGYA 3TU6A 1YCSA 1QUNB 2K3TA 1TLKA 4RNRB 3ZDXE 4ZFQA 3EFDL 3UBXB 3WKPA 4ZTOL 3L3GB 5E0QA 3VI4F 3GGWB 1UD4A 3DBXB 2IAMC 3SCMB 5IFHH 4LPVA 4UB0H 3QXWA 4WV1A 2CH8A 4PBXA 1I7RA 4Y2OB 5L9DL 1E9PA 1H3PL 2WXQA 1FZOB 4YFDB 2IANA 3QUMB 1IQDB 1BYNA 2R9HC 3LNFA 5IBUG 5C0IA 2J25A 2A6DB 1TTRA 4PRDB 2VSCA 1OAJA 1QR4A 4K2UL 3FU0A 4YC2C 3T2PA 1TVHB 1XCTB 3OKEA 4U6YA 4K9EL 2R1WA 4H88H 1JGUL 1NBYA 1P2CA 1GIGH 4M5ZL 5GRYA 3I6GB 4Z7VA 3P02A 2WZPD 1WIPA 2OMWB 2VLRA 2YPLB 1JPSL 4JKPH 4ONGL 3TL5A 3NEEA 4N8VA 5TH2B 4XMLL 4BZ2L 5EC1A 2E7LC 1LDSA 5GZOD 2ZXAA 3PABA 5G4OA 4B3EA 2NNAA 5I1KL 4J27A 1TFHA 5KVFH 3FHAA 3L3HB 5D7IA 1CGTA 2F74A 3D08A 4QRSB 4X42A 4YXLL 4DERA 2ZKXA 3FFOA 1FZJB 3MMEB 2J88L 3QORC 5E00B 5J3HD 3TIDA 4XI5D 3NIDE 3RPBA 2O6PA 5D2NB 3WKQA 1MRCL 5CLXA 4CU7A 1F02I 4YEFA 1DQKA 5A6MA 3NPZB 3RP1A 2Y0SA 1U21A 4N2DA 1XFPA 3IKCB 3TIEA 4P2CG 4KJPD 3Q5TA 1GY2A 1D7DA 3L95B 5D70H 4DGVH 1NFDE 1IM3B 4J4PA 5KBMA 4WHTA 4DAGL 2F18A 5T1KA 4AM0B 4QI3A 1DANT 4GAJH 3MV9A 4YDKH 3RNKA 2MQCA 4O2EB 1NZRA 2AK4D 4PJCE 3B5GA 2J8UB 3ULUL 2VAAB 4AX3A 1TZAA 1SHWA 5GSRA 3VWKD 4H7VA 1PLBA 4MXWH 2XWEA 4XVOA 5I19L 2XN9A 3FQRB 2VDNB 5D7KD 4TOYH 1Z9MA 4D0CB 2W5PA 3DO4A 5AQ0A 3GI8H 4ZMLA 1CXEA 4FHJA 4F8OA 1H6UA 3PDOA 1ZWIB 2ZAGA 2NUPA 1HHIB 1J1XH 2ICWB 2OZNA 4KC3B 1S2EA 4DEPC 2LFGA 5CGTA 1JXFA 2FO8A 3OB0K 2DYPD 2EIZA 3BVWA 1UFUA 3QZMA 1YYCA 1OWRM 5B1KA 4Z78B 5ACZB 3SN6N 5J7CC 1OTUC 1CFSB 4U1NA 3BT0A 2CDGA 3ZKMD 4EMZA 1CVSC 3GUTA 2X4UA 4L0ZA 4JO3H 4YHOH 3SEPA 2B0SH 4JDVB 1VF5C 4X2UA 4BSVA 4CC1A 2ARJB 5KYWB 4X4YB 1AR1B 4Z7AA 4I18C 3HG4A 2AS5M 5D6CB 4ACPA 2ICES 3DX6B 1AO7B 3P4OA 4MAYA 5ANME 2J7LA 4XCEA 3QORB 4M61A 5J56B 1PX3A 2VZUA 4A7SA 1B90A 4S0TD 2Z35B 5DS1A 5F7HA 3WY3A 1TQCB 4MDIB 3GHEL 2WWKO 3TH4T 3NEOA 1XH1A 2N7SA 4L3FA 1WFJA 1WZKA 1INEL 4KK5C 1HIMH 4HF5H 1UH4A 4OFYA 2B08A 2A6KB 3MCLH 4MD5A 4XNDA 5F0LB 1MPAL 4FFVD 1C5BH 1K4DB 5C0AA 2EE2A 5KBLA 1IC4L 3O2VH 4UILH 5A2FA 5L8KB 5LLIC 1KTDB 2GIYA 4N2AA 2F54A 1H3TA 2WQ8A 1J0KA 4L8SC 4PJAB 3S88L 2BNRE 3QIWD 5I1DA 2OX5A 4BFBD 4ZJ9A 3RVXD 3FT4A 1SJVA 1MJJB 2WO2B 1JN6A 4WW2F 3PP4L 2LAGB 4GKZB 4BXSV 5FYLD 4FQHB 3AADB 3D69A 4ZFFB 3SKUD 4PCSA 4F33B 1GGBH 3FMGH 3GRWA 1J0IA 4EXKA 1VA9A 1GGIH 4L1TA 3SQBB 5KVEE 3L9BA 2OTUA 1T7YA 3BAKA 5HYQA 4ALAL 3I9GH 2AJXL 3ABGA 3CBKB 3ZL4H 1GOGA 1X5GA 4LLQA 5KYUB 4Y2DA 4GXVL 3KLHC 4AMKL 3KYNA 3S4SG 3ATEA 2NR6C 3CMOL 4JHUA 2HWZL 3SDAC 4AYEC 4OGYH 4RZCA 4Q9CA 5IJDC 4HEMA 4C4KT 3D0VA 4XCCL 2HFFB 1FNEA 5DRNB 3T4AC 3GO1L 3QGVA 2MKLC 3DUSB 4RWHA 4L8CA 1LMIA 3F7YB 4GAYB 4IU3A 3WUWB 1V55B 4G9DA 1IZKA 3AWEA 5DC2A 2ZOWA 2DMCA 1FO0A 5IESL 5FW8A 3BKJL 4L4VB 4YHLL 2L04A 5DYOB 4HG4J 5EOTA 2N4IA 4PCYA 9PCYA 4RGOH 2WBKA 2C7FA 5C1MB 4WO4A 2XKSA 3MRGA 5DZAA 3CH1B 4D0DB 5KSAD 3IVKA 1T22A 4MNGB 5C0DA 1IU1A 1QRKA 3HR5B 4GG8A 4W70A 4YBLC 3WIIH 5CN3A 4HKXA 4I7ZC 1N64L 3GBLA 4I89A 3VFMA 3W3BA 2FX8L 5IF0B 1MDAA 2HVKA 3K72A 1Z2KA 1S9WA 4ZX4A 4A2FA 4PWEA 1YY9C 4PGDA 1B2WH 1C7SA 5ALBL 5FOJA 1AZNA 4DF9A 5CJQL 3SY6A 3U82B 1N6QL 1A9BA 3K2UH 3PWPB 1S7VB 1N5YL 3BT2L 1KXVA 3EOTL 3RTQB 1Y07A 5LNGA 2X12A 3HA0A 2YEZA 4M7LL 4H1LB 4OZIF 3FYEB 4KNUA 4WKZA 1P0SE 2FQGA 5I1JH 2ENYA 3QZBA 5JW5B 1LP9A 3QXUA 3FO0L 2VN6A 3ABLB 4ZDHB 3ESOA 1T04B 2AW2A 1JTTA 2NQCA 3EJQA 2GJZB 4GQQA 5IGXH 3IMVA 1HQRB 2XPYA 1WK0A 3ARFA 4NUJB 1DN0A 3V0FA 4QRBA 1IBDA 1QLRB 4LPWA 1UM4L 2BIQA 1N59A 4R4NC 3F7LA 3Q6FA 1GZQB 3C6LC 3VYOA 3CLWA 1BVNT 5B3JE 4JFFE 1IGYA 2R7EA 1WQVT 3KPRD 2GBVA 4Y9BA 4AC4A 1IUZA 3TOPA 1CWVA 1NGPL 2OQJB 3LRSA 4NJAL 3CVIL 2Y36H 2YPKB 1L9PA 4XMXA 1T66C 5F7EL 1I85C 1IE4A 2L8AA 1GSKA 1FNSL 4PRHB 2GSIB 1RZIA 5CUSL 2WVVB 3ECWA 2HPTA 3UMNA 3QSKB 2JXMA 4PWHA 3U36B 2V2XA 3VFRA 4DO5A 5MENA 1XIWD 2VXSL 4Y5XA 2D31A 1NMAL 2IWKA 3QFDB 2X9WA 5HDOA 3SPJA 5SWZB 1GYWA 2LLNA 2HVJB 4CSTA 2XIIA 4ZSOE 5BMFH 3MGOA 3MYZA 4JK0D 5FYLE 2H32A 3F8UB 4MCZA 4YBLB 3VXNB 3MRDB 4HKJB 2JKLA 3CVDA 2VN4A 1XSOA 2ED9A 2GY5A 4OLZL 1BX2A 5CSZB 3UBXG 2V33A 1OLZA 4KKBD 2VC2H 4XCNB 3L5IA 2DWSA 4NM4H 1BFOB 1FVEB 3QUYD 3V4PA 3RQ3A 2Z8SA 3O3DB 1PZDA 5DYFA 4Z7QE 2DS4A 1W15A 3MV01 4M3JA 1WF5A 1KY7A 2X9ZA 2WQRA 1XH3B 1MHPL 3DJSA 4HK3N 4PS4L 5I8KL 3BDXA 2JKXA 3GBNH 3D25B 5C0GA 2VERN 2W0FB 3NJKA 3UJIH 3EYOA 4KQ3L 5HHNB 4P4KC 3RNQB 4WFFD 2OJEB 3DXAE 4OD3L 4AJ0A 2J43A 2A83B 3V4VB 2I07B 3GZQA 5E1GA 3I2CL 3WFHB 3BLPX 3LKRA 5GS0C 4GKLA 1OM3L 4YPGB 2Y3NA 5IJBC 3R8QA 3P2TA 2VZVA 2VGLM 2Z93A 2X1PA 3BP4B 1TZIB 4XVSL 3RURA 4A2MA 4O2FA 5D71L 4CJ1A 5BRZD 3MRJB 4ZXBC 4XWGL 4J3SA 4WAFA 5CBEA 1AHKA 2X4RA 1DZ0A 5BS0A 4LT7A 2EUZA 3C6LB 3E8UH 1BZOA 1ZHNB 3DURA 3RRQA 1L6XA 1A0QL 3T0WA 1INQB 3S48A 3TYGL 5CCKL 1BMZA 1P6WA 4Z8FH 4QNPE 3A5VA 4X9YA 2N0MA 3FU5A 3MRPA 4ZO6A 4N2EA 2RQ8A 2HJKA 2AERT 2Q3XA 1FN4A 1AGBB 2J1WA 2A9NL 3L54A 5IKCA 2XXMB 4NC2B 4AT6B 1VSCA 2NT0A 3AG2B 5D1XB 3RUGB 3A0OA 1IGFH 2NSQA 1TENA 3LZOA 5IOPB 4OB5H 4YGVB 4UZSA 5A6IA 1FNLA 5HBBA 1N0LB 4XPGH 2I9LA 4XPAH 2XZCH 3W9EA 3JQOB 5T1DH 4BKLA 1GGYA 3UBXI 4NNPL 1TEYA 2QMKA 1I1YB 3DGGB 4YXHH 2V7HA 3BE1L 1V7NL 2ORBL 4M7KH 1KIQA 3VTMA 5JIIA 3ALWA 3GZPA 4LHUA 4FERA 3OD3A 4JVPA 4F7CB 4IBUA 5DF0A 1N8ZA 1JNLL 4FEIA 3GK8H 5ICUA 1PKQA 3KPRE 4XNYL 2HTKD 4I4WA 4AYDC 4P4KB 1ZDSA 5DHVH 5LXVA 3X14B 1A5FH 4KO5A 2EC9T 4U31A 4MMZB 4LPUA 2B16A 5B3SB 4JFDE 1OPGH 2CJSA 2VXVL 4UM9A 3WKYA 4OFQA 1JD7A 1BQRA 4QLRA 4Y4KD 5FO2A 4D8PA 3CFJA 2NZIA 3BEWA 3BO8A 1ZA6A 4KBPA 5LBGA 4CGTA 1TJIH 4N8CH 3MTXA 4Y5YA 2XN2A 4TQ8A 3BDBA 1QASA 4XB7A 2MEJB 2EDDA 5BW7C 3FT3A 1TKWA 3FYIB 5F0JB 3O4LB 1RZKC 1ZTXL 1CD1A 1JOIA 5HHMD 2BY3A 3G04A 1UGNA 4MTMA 2NY2D 3UMTA 1WDAA 3LS4H 3VI3F 4Y5VA 3D9AH 1UM5H 5C0EB 1KPVB 1EHXA 3UABA 4JFZL 3V0WH 3C5ZB 3EYVA 2G0KA 5BVJA 3ZRCC 3SGDH 2WY3B 2OMUA 1A7RL 1GR7A 4WFFE 1ND0B 4PUBL 4B7LA 4LAQH 1GAFL 4HK3J 3U6XS 5F6IC 1FPTL 1NCBH 5GGTA 2VM4A 5C0BB 4GT0A 1P9MA 4OLYL 3VXUE 4DP2X 5AFAA 1HQ4A 1Z5YD 3OR7B 4AQ8C 5JYLA 1IEHA 2RBLA 3IGUA 4ELMB 2P45B 1T0NB 1WSST 4K3EH 4BQ9A 1A6PA 4E41D 2FT6A 1JNNL 4HJ1A 4NPYB 2NW3A 3DX3A 4GLRI 1P5UC 1WCQA 4PM1A 4ISVA 4X5WB 2A9CA 2DQMA 2PXYD 2VDKL 4PD4K 2JJSC 2FWLB 3ZHNA 2ICWI 4HV8B 1J8HB 4NQXA 4XVUD 3EDKA 1R5WA 4EDXA 3RA7L 1VGEL 3TT3H 3IFLL 2VH5L 5DD5H 1USQA 3HZKA 3KNBA 1MW1A 4PY7A 4MCNA 1SFHA 3H9SD 2GKIA 3KS0J 4YDIL 1YMMB 2FAUA 3K6OA 4DSYA 1TJMA 2PWFA 3ZHLA 4KK9C 4HWNA 4MJIE 4ZXBA 1XGTA 3LKQB 1J05B 5I1CH 4PBVC 2BLFA 3JWOH 3Q2CA 4IMKC 1XXDC 4LOUC 4MA3A 4XC1H 4Y9FA 3MRBA 2UXVA 4AW7A 3L1OH 3OL2A 4U4IA 3V0JA 2CO2A 5F2FA 4YIQA 4XPFH 5JW4N 1SM3L 3FK3A 4ZFOB 2B1AH 5E8PB 3ROOA 4ZMQA 1SPDA 4M9OA 3A6CH 1T1ZA 4JDEA 3WS6A 3MBXL 4MMXA 3TA3A 4JFOB 1IBFA 2OW7A 1O9VA 1OW0A 4NC1C 1I3GL 4N5EC 1WBYB 2J3SA 3TZVC 3SODB 1ET8A 1PZUB 3FQ1A 2UZIH 3KR3H 1QEXA 2OW6A 1UWFA 1T03L 2IAND 1OAZH 2WOBA 3WFDH 1SJEA 3NZUA 4QXVA 4Q14A 4BFNA 1PLGL 4WJG3 3HMXL 4PGZA 2CWRA 4ONFL 5F6IB 4G6KH 4L9DA 5D2LA 2OL3B 3X3FH 4M6NL 4L1HA 5BRPA 4TLKA 1V7ML 1G6RH 3WTTA 2KUTA 4U3XA 1A4AA 4TVSa 3QRFM 1NPJA 3R1GH 2VLRD 4PJ9C 4MCMA 1DDHA 5ESQB 1ASQA 5E1AA 1RUPL 1MH5B 3DIVA 5IHHA 3CNKA 4R7VA 4JX0A 2JVUA 4JM2F 3ATBA 3I9PA 4ZYKB 1EK3A 1MIML 1PZ2A 2BZCA 2XICA 5CMAA 1FYHB 4B9IA 5IVXB 2NY4D 3LRGA 5DD0L 5L4MA 4GP8B 1A6VL 5HPOA 4HK0B 1HKFA 4H1LG 1CGYA 5IVZA 4Y16D 4QHMA 5ICZA 4GIOA 5DRWB 3G6AB 1FG9C 3NMEA 1MCRA 5HGAA 4F7PB 4DUWA 2IV8A 2V7NB 4TL4A 4WIQA 5AL8A 3TV8A 5CIPB 4APQA 5CEZL 4KY1L 4F7TA 1U91A 1JPTL 1ADQL 2VUYA 5J1AB 3GS7A 1E28B 2UY7A 3MA7B 3GHBL 5C9JB 5JA8B 2P8PB 4PP1C 1AXSA 2CIKB 2K4AA 3EJUA 2C9XA 2K6YA 3QJVB 5T1KD 1JMZA 5E6RB 3ZBMA 3MV9D 1XB3A 4QYOB 4C55A 2BJML 5FDYA 2AJYH 2W07A 1PZ5B 3O2DL 4MQ7A 5H2BA 1BD2B 4E41E 1MREH 1SYSA 3TZVB 1WAAF 3R0NA 5EN2B 2XN9D 4ZT1A 3SGKC 4AITA 5JPNA 3KMDA 3GRGA 1IM9A 3O81A 5HGDB 3T71A 5F93C 4N0RA 5I75B 2R0ZL 5DJXB 2NY5L 5BJTB 3VRIA 4MNQB 2DB8A 5I17B 3RL2A 5EUOF 2HLAA 1YEJH 2DTMH 2W0LA 3BKCH 3ILEA 3H9SE 3VD7A 1LO2L 3AB0B 5C0CA 4KDVA 3MN8A 1FNGB 4OI8A 4PJ9B 5HYIA 1SGKA 3ZQ9A 3VQMA 3WU1A 1TZOA 3QR2A 4TVPD 4FN0A 3KL0A 4LSVH 4Z7WB 3DUHA 2BFVL 1UACL 2P7TA 1S8DB 1WFUA 4IGBA 5ESAB 5F9OL 5SX5H 4HIJB 2ZUWA 3N50A 2B2XH 4N1CA 2NY3B 3WYRA 1RU9L 1MHEB 2LQRA 5AD0A 1FE8H 5EU4B 1M3IA 2C1OA 2XWBB 2V2WB 2ARWA 4MAYD 2AAAA 3U4AA 3B7UX 3RB5A 3N1GC 3BJ91 3VG9C 4R5XA 5GJSH 3NIGE 2PCYA 3UZVA 3PF2A 3CZEA 1TU2A 3EDEA 2B59B 4JY6B 1ICTA 3CVHB 1U3HA 3MA9H 3ZDYF 3ZMNA 4LIQE 1QNIA 4YHMH 3UP1A 2PYFA 1U8NB 2UUDH 3M1OA 4KJQC 4ZPVB 4L9LB 3WUZA 3CZLA 4G8GA 4H8HA 2ZOLB 4PRPA 5TDOA 4CN4A 4OFYD 1HK6A 4JO2L 2HT4C 4Z7VE 1G43A 5AW8B 1A9VA 3PP3H 1P1ZB 2DIEA 5C0AD 1RLWA 2NY0B 4UZGA 1LWHA 5T8IA 4HFUH 4TUOA 2ATPB 1P5VB 4HZLA 4U1HB 2ZNWA 4WF7A 2F54D 1YN6B 3W1ZA 1FYTE 5IFHL 2CR0A 4GAFB 3WAKA 4UB0L 1H8NA 2XU9A 5D7IE 2DIAA 3DJ9A 5EEUA 3VFNA 3BSZH 3VXSA 4P23C 2E6QA 2XDHA 4I2XA 4HS8H 3VVWA 5EO1A 3X1EA 4OFIA 2CHZA 3JWNE 3NCJH 1X7SA 2GTQA 2DD8H 4D8OA 4X99A 4IBVA 4PHZA 4H88L 1GIGL 1YUKB 1VFOA 3W5NA 3EJSA 4X6DB 4ANVA 2UWEA 1FH5H 4X98B 4Y2DD 4JKPL 3QARA 2GY7B 2ZSVB 4JZNB 1TVBB 2H1PH 3ZY7A 5CGYC 1OD9A 4HDIA 4NT6A 4W9GC 1BZ9B 2XI9A 1IGMH 1N7MH 5KVFL 2AV1A 1PZ3A 3IAGC 2DLFH 1CGVA 4XT1C 2ADGA 4GP4B 4IOFD 3L5JA 4NRXA 5D5MA 3HZYB 4ODHL 2MFNA 2C1PB 3RZCA 1LE9A 1JXKA 2FJFB 4XN5A 3TP4A 3VMPA 4ABWA 4WO4D 4UQ2A 4M48H 5EEZA 3QEHB 1NIBA 2OULB 4LLAA 4PV8A 4NM8H 2Y7MA 3N44F 1FUNA 4FABL 1H6EA 1TO5A 3A4FA 1ZEAH 3P3YA 5ACMA 5GGRA 4DGVL 5D70L 2FLBT 2ED8A 3L7FA 5EOQL 4U0RC 5DZNA 5ICXA 2ALWA 2VN7A 4HHGA 1ERNA 2DBLH 2NZ9C 5EZIL 1ZGLB 1U6AH 4QRQA 3CZSA 4YDKL 4YN3A 3EO0B 4R3SB 4OIBA 1RAMA 3AXLA 4FNQA 4FAAB 1JZ8A 2YAOA 4MXWL 4PG2C 4HGKC 5I82A 3APFA 4A7QA 4H0LC 5JW3H 1NCUA 3BPOC 3VXMA 5ESVB 5C86A 4BFIB 2YD0A 4P23B 2XPZA 3M1CA 3GI8L 3EO1B 4LCWE 2IH3A 2AQPA 2LR4A 2UYLB 3GSOA 1DVFC 2VQUA 4JFEA 1J1XL 4FOMA 3DUUA 3IWVA 4NX0A 2TSBA 4NDMA 2V9TA 4TUUA 3MZTA 2HLEB 3IGAB 3UZQB 3S5LB 4BCYA 1MZYA 3ARFD 2R4RH 4XN2A 2Y7QA 1I3VA 4H8UA 4JLRB 1GOHA 1L7TH 4PJIB 1ILSA 2AFNA 4W4NA 4WY7H 1BAGA 5C8JB 2WLIA 4GIPD 3U6RA 3SYPA 4HU8A 2V37A 1IC5H 5TF1H 1Q1JH 3P73B 4JO3L 4KJYB 4YHOL 5FK9A 5HYFA 1O5DT 2B0SL 3IS1X 1KCUH 2WXIA 3RWIA 2GG1A 5EBGA 2JK5A 5IJCC 1CIDA 1H3VA 3LZQA 4TNFA 3GXTA 2XXGA 5IW6A 4P5TC 2O5ZH 1MCPL 5C08B 1LE5B 3BFQG 4L1DA 5FO8B 3GEWB 4U1JB 3EFOB 3IGFA 4G5AA 3V2AR 1A6ZA 1OGTA 3D2UB 5TD4A 4KXZI 4ZUTA 5CGBA 4EVNB 5MP6H 1F2QA 1JGDA 3KPQA 1JZ4A 3VFGH 4AZ8A 3V79C 2HFTA 3C87A 1M9SA 4F15C 4GH7B 1Q9OA 1HIML 4U0RB 1JPFA 3ZSSA 4BXVA 3MCLL 3MLWH 4X9FA 5I8EB 3BP7B 2RB8A 1RJLA 2VDMH 5CD3B 3UTTB 1Q0YL 1K8IA 2HYMA 1JHKL 4ZOBA 4UILL 2VSMB 3EDJA 2XQYK 3SHSA 1PYWB 3I75A 1UOVA 1XF3B 3GSNL 4OR1A 5DJAA 1B0GA 2Q6WB 1T0MB 3GJFK 3LN4B 4LLYA 4FA6A 5E8NA 4HEME 3KPTA 1HHHB 3BPOB 1KZQA 3FAXA 4M5TA 4NCC2 2OM5A 2W95A 4M5SA 5KG9B 3G5XA 3QQXA 3SBRA 4L37A 4LQ1A 3JV6A 2XXCB 2GHZA 4MX7B 3K2MC 2ESVA 1R47A 2V8MA 1GGBL 2DEWX 2YD7A 1EEZA 4HFWA 1GGIL 2A6JA 4EDWH 1A4KA 5CILH 4JFUA 5J8OA 5JYMA 3SDXF 1NLBH 3I9GL 3DETC 3ZL4L 1JWSA 1OB1B 4UNVA 5BS0D 1XZ0A 1U2YA 2G4GA 2GFBA 3FTWA 5DUJA 2CAKA 3MGTB 1F4WH 1I82A 3M1BB 3RWJA 5AZ2H 3R0MA 2ETWA 4ZMAT 1S9YA 1NPUA 3CHPA 4QOKD 1C08B 1NANI 2R23A 5CEYB 3BUBA 5LCVA 2NOYA 4AYGA 2AXGA 5FKAB 4HJIA 3ZE1B 3PWVA 2GSGA 4DZBA 3SIKA 3BQUD 5FUCC 3BPLC 1EEUA 4PJAE 4E9LA 4P2OA 3HR6A 1WD8A 3EYUH 4TSAH 4S1RH 5HVGB 2VR8A 1OAXL 4D9RD 3LKOB 2BHYA 4HUUB 4GUPA 1ECYA 5ADOH 3CFUA 2GUYA 1OTTC 2H7WA 4AJWA 1QKZH 4ANWA 4F15B 1KB5H 1I1AA 2C7UA 1NAMB 3TPUB 4XXDA 1KUMA 3QDMA 1QBBA 4ZS7H 4AVJA 1K6QH 3PUUA 3TBVB 5AWNL 4FJYA 1W6LA 3D0LB 4L2YA 4JQVA 5AVTB 2HRHA 5AL0A 1AQKH 1EIBA 3RGHA 1IZJA 1BFTA 3DMMA 2DTSA 5GRUH 5DUBA 1ZD6A 4LHUD 2FIKB 3WFCH 1QSEB 4HVBA 2RA1A 3GWJA 3TBTB 4PG2A 1B2WL 1HE8A 1D5BB 2H6UA 3PYCA 4K94H 3K2UL 2YUXA 2DJSA 4F7MB 1IKNA 2AMGA 4FP8H 2QPUA 4M7ZC 4NP9A 4I3GA 3SDCC 3AGVA 3P9LA 2MPAH 4PRIB 1HHJA 1F00I 2APWA 2DQ6A 2EE6A 4UM9D 1B6UA 4YSTA 5I1JL 3S35X 1UUSA 3QYMA 1WZAA 1QO3B 1NM9A 4OF7A 3H3PH 3GNMH 5MENE 3AS1A 1HDMA 2FQDA 3KDMB 4I0PC 5IGXL 2XACC 5HI5D 5D7LE 3V7MA 4U4BA 4Z0XB 1DJZA 1NKOA 4XH2B 4EUPH 1A21A 1AMXA 3VXTA 5CS7A 5GQBA 3VSTA 5GRZA 2BNUA 2PTTA 2G2RB 3F84A 5DLMH 2IFFH 4Z76B 3WIAA 5BO0D 3F6IA 5L88H 4M1DH 2Y36L 1ZT1B 4AUJA 1BPVA 3BVTA 2BS71 4R5VA 3HBPA 5L4FA 1CK0H 5GRJH 1CL7L 1BVNP 1TNNA 3UH8A 2JELH 4JANA 3KYMA 5TDPB 1TJGH 1INDH 3N5AA 2CCVA 3Q43A 2NY6C 2K45A 3RIFF 5I5IA 3FSZA 1KC5H 1WIOA 5F8QC 1RJCA 2B4CH 3QAZC 4OF6A 3ZLQC 2EQDA 1LLAA 4FQ2H 3EBGA 1URZA 4DKAA 4MJ6B 1K2DA 2ZQKA 3QYCA 4A7GF 3TA4D 4J3XA 3KYAA 4PP2B 2VC2L 3H7BA 3ZTCC 3MV7A 4NM4L 1RJYB 4KZDH 4NQVB 3L5WA 3DROB 2P5WB 3D39B 1H6FA 5E4IA 3TX4A 4ES8A 2PR4H 5EA0H 4OF8A 4XNMA 5MERB 3T6XA 2PCFB 1H9DA 3VXQB 3B2UD 3FQXB 1H3UA 5F9WB 1H6TA 3GBNL 2H26B 4M7ZB 3IRZA 3SDCB 2F19L 3M17A 5J1TC 3UJIL 3LDBC 5H37H 3NCYS 5HI3C 1D9KA 3DPBA 3LQZA 3Q5OA 2Q8BH 2D9CA 4I9WD 3SY0A 4GG6B 2R0LH 1ZANH 5T3XL 4A2HA 2OTWB 5TE4H 4I0PB 4AQZA 2Q86A 1CDHA 5ANHA 3MNVB 2OR8A 1DSFL 1F3JB 2CZNA 4TULL 3ZIYA 3PIQB 4KMQA 2FVNA 2ZWYA 5GGSB 1FZMA 4PJXF 3BP6A 3WY1A 3W38A 3GJFB 3NJNA 1SLXA 3E8UL 1FFQA 2EDXA 3ABMB 2ZKYA 5I76A 3UYRL 3HI6H 3HG5A 5HI4C 3MBEB 3OBAA 4NQDB 4CL7A 1MFUA 4CRPA 4RAVB 2XFXB 3GRWH 3TA3D 4Z8FL 2J73A 5J6HB 3CXDH 1RUAH 1PY9A 4OU3A 1R4XA 1DJIA 1MW2A 1OEZW 3HB3C 1JF5A 4FQXA 2H5UA 5FGBC 5KSBA 2VDPB 1PKQE 1MI5A 5D6DA 3QIBB 3P9MB 4YSEA 4H8WC 4X4KA 2NY6B 4MJ4A 3FN0H 4AKOA 3GMQA 2VMJA 2V2TA 2IMMA 3UO1H 4HJGB 4MDJA 1GS6X 4OB5L 4CC4C 2Y5TA 1YNTB 4XPGL 3MR9A 1YEEH 4FA7B 4A6YA 4XPAL 5B8CA 4JQXA 4FX5A 1EAJA 3QS3A 2Q9OA 3O3EB 3MTRA 5T1DL 3WN5B 5D96C 4E9YA 2N0KA 3JTBA 1HNFA 4OF5A 1ADWA 5JHAA 2JKRM 3T2LA 4D9LH 4YXHL 4B9GA 1IAKA 4YFLI 1J9SA 3BUTA 3QEQE 2BY0A 1FV1B 5L4IA 2ZYRA 4KZEH 4CSSA 3RY4A 1PCSA 4OM1H 3FO9A 3QRLA 2BHZA 1G7MB 1FZKA 2D73A 2KLTA 2HT2D 2R2EA 3GK8L 4LBAA 3ARDB 4R2GD 4Y0GA 1FWXA 4P3WA 3LDBB 3APNA 4JKNA 3FU7A 1A5FL 3B9KB 5FX3A 4DETA 1ACXA 2P80A 4NO3B 2CKNA 5AOLA 1OPGL 1WFOA 4APQD 1UHVA 3QJHB 2O26U 4DVBB 2WXHA 1ZHLA 1LILA 1TJIL 1UOWA 5F7LB 2VOTA 4N8CL 1ZVSB 3IMBA 5BZDA 3RILA 1J1OH 4XVJL 3ZTEA 3WNNA 3US1A 4FFYA 1BAWA 5FUZH 3MRQB 2FD6H 1A4CA 5ENWA 1F3RB 3FUDA 4HWBH 4OV6F 5E4AA 4B9YA 1BOGA 2A73A 5FO9A 1DJHA 1AYOA 2HFEA 3KH3A 3O45B 3B5TA 1GZPB 3L9RA 3VSUA 3HB3B 1B4JL 3LS4L 1VPOH 1UM5L 4PVLA 1IM9D 1HWGB 5FHAH 1UD3A 3S4SA 3V0WL 1XR9B 4DUXA 1BAFH 5DVKA 1IEAB 5EU5B 3RWHB 1JG9A 1E4JA 1QABA 4YQXH 4PVMA 2VDLB 2LVCA 5C0JB 2YAFA 4OGXL 3ULVH 5C07B 3PNWB 5FGSA 4TQIA 3FOLA 4XAKD 3TO4C 5C0CD 2BSSB 3CQFA 3CUPB 5KSUB 1T7WA 4IDJH 3BH4A 2Z31C 1NCBL 1I7TB 3PHAA 1BSIA 1AY1H 4B9KC 2J5LC 1BM7A 4Q4IA 2GBUA 2YSSA 3KGSA 1WUZA 3F58H 3GMPA 1VZGA 4IGBD 2JIXB 4K3EL 1BQHG 4WO0A 3WY2A 2X87A 5CCHE 3S36X 2I60H 5LDSA 1DQDH 3V6ZB 3GLEA 4N20A 4P2YA 2H32H 1THCA 3UX9B 2EO7A 3NCBB 4AGMA 3PXHA 4XP6L 5TE6H 2BC4A 5F7MC 3V0EA 5I1EH 1SJHB 5KYXB 4U1GC 3OLDA 1NJ9A 3TT3L 5DD5L 2Q10A 5E08L 1KJ2B 4P2RA 3KAAA 2X9XA 4UQDA 1U3HD 1AGDA 3TCLA 2IADB 1E9OA 3CSYA 3GSQB 3IDJB 5E56A 3QG6B 1UXLA 5I1CL 3T0EA 3C60B 4G8GD 2KPNA 3T3PB 4PRPD 3TJEH 3JWOL 1C5DB 4WTZG 2FUQA 4XC1L 4JN2B 3QEGH 1TCMA 4YE4H 1EAPB 2NY7H 5A2IH 3L1OL 4JNXA 1ZCRA 3VD2A 4U1MA 4KVPA 5F1KC 4QHUB 3RWEB 4XPFL 1F4XL 3LKSB 3U0WL 2B1AL 5FB8B 1TITA 1VJSA 4OKVB 4RAUA 1RK1A 1LO5B 1Y6MR 4KMLB 2BHUA 3A6CL 4KROC 4XO9A 5CGMA 4P05A 3QUXC 4OI7A 2X2UA 2H3NA 4EXPX 2WNXA 3HC3H 4AQAB 3MUHL 3O8XB 1NFIB 1MWAA 4G6FB 3QNYB 3VXSD 2UZIL 3KR3L 3Q13A 4U1LA 3SE8L 4P0DA 1ZHBA 4UTAA 1MCLA 1OAZL 2BK8A 5F1NA 3Q2LA 3WFDL 2TRHA 3OR6A 4TQPA 3ZTDC 4G6KL 1H15A 3TO4B 4UTBL 4WTXA 3X3FL 1BM3H 2Z31B 5HTSA 2CA3A 2EDTA 3OKKB 1X5MA 1LEIA 2MTAA 2D2CC 1UENA 1Z5LA 3FUMA 2BP0A 3V6OC 1MN4A 1ZDQA 5T1LB 4EIUA 1PJWA 5E24E 7PCYA 4AWJC 1CE1H 2GJ6D 3L7EB 1FVCA 2UZYB 3ILPB 1OSPH 2BIIA 4UAHA 2SEBB 5CLZA 4C58B 1V3MA 2WMPB 3MJGX 5GXBB 4H5SB 3P4LA 1VEOA 2CCLA 1B3IA 4U1GB 4RNRA 3S96B 3VXPB 1KN2H 3UBXA 2E8YA 3ML8A 4AYID 1X5FA 3GGWA 3DBXA 3OAZH 3MUGB 1CICC 4AGNA 1RK0A 2XNAA 3GMRA 3I3BA 3POCA 4NPJA 5EIQA 3PWJA 3RZCD 5C6WH 2IDCA 3VG0H 3AUWB 3P2BA 4AV4A 1SDYA 4P5KA 2GYSA 3OAYK 4X6FA 2C9PA 1WFMA 5KSVA 2A6DA 3X3GH 2AZUA 3SKNA 1AD0B 1E90A 5C0CE 1TVHA 3NJVA 5KBPA 4F9LC 5F97E 4JPWH 1FFNB 3KJ6H 3I6GA 5KYYB 2K0RA 3B2XA 2CKBH 5I1HH 5I1IL 4KROB 5DTFA 2B9BA 1F58H 2AJYL 4FF9A 4HH9B 3KWUA 3MLSH 2BSDA 3GBMH 5FC9A 3HFMH 5TH2A 1E8XA 3IDGA 1MREL 2PPFA 3LXAA 5JHBA 2OJ1A 4UDTB 1HSAA 4JG5A 4WGVB 2OMZB 4OFKA 4PAZA 3L3HA 3OHXA 3QCTH 3BN9D 4QRSA 2ZXQA 4LSRH 4MD4B 4JFED 4PJ7B 1QBMH 1YO4A 4ZOEA 1AHWC 3SKMA 4LKXB 5CP3A 2Z8VC 3UPRA 1I9RH 2EE9A 3NH7H 4W9IC 1YEJL 5DMGD 3O6LH 3BKCL 4BQ8A 4PI2A 4E9SA 3MOQA 1S3KH 4ZK8A 1CFBA 5D2NA 2H2SD 5DRXA 2MJWA 1A7OH 4JJHA 2L7EA 3UO8B 3HG1E 3VD4A 4PRPE 4LSVL 3IRCA 2X4SA 1N19A 1JWUB 3AXHA 2A5UA 3EJZD 1IM3A 1KY6A 2B2XL 2G75B 2ERJC 2OSLA 4EIBA 3WD5L 3K81A 3A4EA 2FCBA 3UPAA 4FKEA 1NCCH 2WW8A 4UYQA 3EGSA 4O2EA 4WEEA 4P46C 4N5UA 3RFZC 4NFCA 1FFOB 5E5UB 2IIJA 1CICB 2J8UA 2PW1B 3B2PA 2VAAA 4NC1E 5I74C 5MEOB 3L1GA 5K1NA 3WO4C 1D5MB 3VXSE 1U8IA 1GL4B 3NYKA 2Y72A 4ABVA 3DDFA 3QR0A 1BQKA 1DLHB 2WZ0A 1AXIB 1LP9F 4WHYH 3U30C 1WC7B 3CLFH 4WW1B 2ICWA 5F8RC 3J27A 4UIKH 4NHCH 5JO5A 5AKVA 4L3EB 5JW4R 4M3HA 4HFUL 1U41A 3CDZB 1G4MA 4Z78A 2W8CA 3MRKA 1E6OH 4ABUA 1CFSA 4NENB 4JZOA 4LCCC 3IJ8A 4FFZA 3KPNB 4AJVA 5I6XB 4MJ5B 4YHKH 2XWXA 5E6IC 3QA3B 2CO6B 4TXVB 2B39A 4JDVA 2XPGB 3SPVA 3U2SB 4K7PX 3BSZL 5KYWA 4X4YA 1AHWB 1A3LH 4AE1A 3PG2A 3DX6A 4HS8L 1AO7A 4DTGH 4NGHH 2ESVD 3K91A 1NBVH 5FCUL 1CYGA 1I8LC 3NCJL 2DLEA 3SPIA 2DD8L 4Z7UF 2PLTA 3M45A 4YHIA 4ZW5A 3PWUB 4WNQA 3VYPA 3FRUB 2Z35A 3MV11 3FB5A 3AT8A 1BQ5A 3SO3B 1FH5L 4IKJA 3RX9A 4JPQA 5GRVK 4JFXA 3WIHA 3VFOB 2HG0A 2W9LA 5HDBF 3G6JB 3L3KB 4S1QH 3AS3A 1XGPB 1IGML 1N7ML 4LP5A 2WSPA 5PCYA 5ADOL 4WWID 4ZFZA 1PS3A 1K4DA 4OCWH 3QBTB 4X9IA 4K73A 1G7IB 4MSWB 2DLFL 5I74B 3LZFH 1KTDA 3QO0B 4P2OD 2GJJA 2ICEA 1KTRL 2G3ZA 2VR5A 5DWUH 3SO5A 5CNHA 4PMFA 4AENB 2BOLA 5EU3B 3VXME 5F1IB 3QDAA 2BNQA 4M48L 5EEXA 3T04D 1FC1A 1TZHB 4JFEE 3U30B 3BH9A 1I1AD 4NM8L 2F2HA 3QDMD 2EVJA 2CIIA 5HD8D 4ZFFA 1GW0A 1ZEAL 3RDTB 3B3IB 1JK8B 3LZRA 3ZL1A 4F33A 1U8OB 3DMMD 2BVYA 2DBLL 5GJTH 1U6AL 1L0QA 2YFNA 1LDPH 3WKMH 4LCCB 3C6SB 3HZMA 4LGRB 3M8OH 4L2LA 3DK0A 2YMOA 5TQ0H 3ZYIA 3VB9A 2UX6A 5IJVB 5KJ7E 3L1FA 2KZ1B 4A7UA 5JW3L 2EZ0C 3DRQA 2HFFA 4HSAC 4YMPA 4NRYB 2GQHA 4QXTB 1JPGB 1OCZB 1S3RA 3DUSA 3FHQA 2W80C 3UGUA 1U3YA 1AZZC 1A2YB 1IFHH 2A77H 1JDAA 1Q72H 1V3JA 2PN5A 4BJLA 1WPCA 2VISA 5K69A 3MRHB 4ALAC 5FFOA 3KPMB 3ETBF 4L4VA 5DYOA 5CR8A 5AW0B 2R4RL 1GJIA 2GEQA 3D6GA 5K1JA 4RSVA 5D1ZC 3EJCA 1L7TL 4D0DA 2VQ1B 1TVDA 4XNZC 2QV4A 4NRZB 2P8LA 4WY7L 3MLRH 3OSVA 1HT6A 3F5WB 4MNGA 1X7TA 3ZGIA 4Q9QL 2E9GA 1IC5L 5TF1L 1Q1JL 2FWSA 3V8OA 3O9WC 4GS7C 5DURB 1KCUL 3V9FA 1JGIA 4A37A 5IF0A 4ZUVB 2RAMA 1EZLA 2HXAA 4PTUA 3GMNB 4IRZH 4QY8B 2VAJA 5CP7B 4PTTB 3IDUA 4JPIB 4Q0XH 3HPJB 3L3IB 3BWUC 3EJYC 3VFTB 2HLFD 3PWPA 2F15A 2CJUL 2VCOA 3I02B 2YJQA 2DM2A 2YMTA 5B1AB 4PJHB 3RTQA 1R3KB 4XO3A 2J1ZA 4H1LA 5CR1A 3RVUD 2AEPL 2NXYB 4QTFA 4KRNA 1UEMA 3BD4A 2ESVE 4UT9H 1HHGB 5F70A 1BVOA 5CAYB 1CFQA 1WTGT 3UJTH 2ZKWA 4P2AA 4ZDHA 2O61B 4YGAB 3N9GL 4PJFB 1QPXA 5EZLA 3GSVB 1S6NA 3MV7D 1Z7JA 5K93A 2LT9A 3P77B 5PAZA 1NFKA 2Z6FA 5E1QA 1AG0A 1OT4A 3HFFA 4KXAA 5KTEH 1GZQA 5TGBB 5JHDD 5AW3B 1JYNA 4NZFA 5J06A 1JVLA 3C5JB 1NSNH 2HKFH 2OQJA 5FYKU 5F7AA 1D9KD 2X38A 4PLNC 1ML0A 3UTQA 3QDGB 3GXNA 4X0KB 1JF1B 3HOGA 4PRHA 4G59C 4IS6B 1KIUB 2WVVA 1F42A 3V0GA 2J8OA 1NGXB 4EDWL 5CILL 3CMGA 1NLBL 1QHPA 1CLVA 3H55A 4XNZB 2HVJA 3GXPA 5C2UB 1Y18B 3F01A 4AEEA 3DC0A 1F4WL 3HNTH 3QDME 3RU8H 2J1XA 1FFRA 2IGFH 3BC9A 5AZ2L 3UAFA 2HJFB 3LV3B 2BRQA 1HU8A 3O9WB 4JZJA 1HYSC 3IS0X 1TSHA 2YR3A 4DKDC 3O6FC 4QHKI 1IKOP 5CSZA 4B7IA 1TMCB 4S0HA 4B9JA 1BZ8A 1FVEA 5DQJB 4WU5A 4A04A 1KB9K 3O3DA 4KI5C 4FQXD 1CBVL 4ZTEA 3F7KA 1Z9LA 3CC5A 4KKLC 3EYUL 5B7FA 4S1RL 3PL6C 3VRLE 4NQEB 2CDEB 5FA4B 2W0FA 3KXFB 3RNQA 5BQ7B 4R7NB 4AGLA 2BRRH 5DFVC 1A7QH 3MFGB 1E4KC 3VGDA 2OJEA 4BK8A 4E0RA 1QKZL 3V4VA 5I0VA 2I07A 4HIQA 1KB5L 4PFEA 1NGWA 1E0OB 3UBGA 3QQ3B 4K07A 4ZS7L 4YPGA 1K6QL 1ZS8A 2D0GA 2JI3A 1AQKL 1TZIA 4QRTB 4Z3EA 2DMBA 4UAOB 5GRUL 4QD2E 5I5MA 2BVUA 4MBRA 3WFCL 4JDTH 4E5XB 4YHPB 1EGJA 4ENED 2DQCH 5ICYB 2ZPKH 3CFDB 4GI8A 3D05A 3FUEA 3V6FA 4CU6A 4N25A 4MMYB 1MWOA 3K0WA 2MSPA 4P9HH 1QRNA 1F0LA 3GJEA 4FP8L 2VE6B 2P80D 2VIRA 5AEAA 4TVUA 3B34A 3V7AG 4KWUA 2EXWC 4PJEB 4PMEA 3VCLB 3ISWA 4JDZB 1AGBA 3VQ2C 3H3PL 4AT6A 4DN4H 1BPLB 3FQNA 5D1XA 5EPMB 4J3WA 2FGWH 3S9DB 3STZA 1I9EA 3QNXB 5D1ZA 5IOPA 1C12B 4TQEH 4IRJC 2A0LC 4HUVB 1Q8MA 5JIPA 5D2LF 2AEQH 3II3A 3SJVB 5HHPB 2BVQB 1N0LA 3BIKB 3GSWB 2IG2H 1XAKA 4Y19A 3RGVC 2DZEA 4UT7H 1YRKA 4HKZA 2Q2LA 1A1NB 5JHMA 2WKLA 1SYVB 3MOAH 2GCYA 1JAEA 5DLML 1JPEA 2E27H 3O6FB 3RFRA 4KAQH 2GTWA 4WI0A 5HDQH 1PZSA 4NYLB 4GW1B 4KUZH 1I53A 1LK2A 2OYLA 4R4FH 1IGJB 3ZU8A 5FAAA 1AR1C 4KKCC 4U7KA 4PB9H 1A6UH 4IIQA 4N87A 4F7CA 3S37H 1CK0L 1W72B 1CIUA 4GRLA 4YE0A 5GRJL 3W9DA 3HE7B 4HOZA 4Z7NB 4EAEA 2KZWA 2X89A 1TJGL 1INDL 4TVPL 3OJMB 3BVDB 4X7FC 2W60B 4AEIH 4PRIE 2GI7A 2XTJD 3LS5H 1RZGA 4MMZA 4JKKA 1KC5L 2F7PA 1WUNT 1U36A 1R6VA 2YAMA 2Q87A 5SWQA 2WCSA 4ATTA 2XVBA 4X7TB 5DFTA 3SKOB 4BH7B 5AB9A 4I5BA 1B6DA 3OMNB 2XIBA 2XV6B 3ZDZF 2KHAA 2QGBA 1QYGH 4YJZL 4NZUL 4NUQA 2I7OA 4I13B 4LCYA 1NPNA 4P9MH 1NC2B 3B2MA 3GMLB 4HUXB 4IMLB 5DFAA 4KZDL 1KCKA 3GT6A 1VEMA 1L6ZA 4F92B 1N67A 3QWOB 5IEHA 2K8QA 1D6VH 2PR4L 5EA0L 4BQ6A 4LOFA 3O4LA 3BX7C 4PV9A 2FQFA 1ZVHA 3EH2A 5FUCE 4P2RD 5DCCA 1FRGH 2HMIC 1P7KB 2Q8BL 2R0LL 1ZANL 4WQOA 5BPPA 1KPVA 5HHOA 1MI5E 3GPSA 5TE4L 3C5ZA 3MUY1 4PVNA 4FYRA 4IRJB 4MLSA 3T0ED 2CBTA 2OPCA 3WHE1 1FFPB 2QDVA 2CRZA 2PYEE 1ND0A 5DVLA 1E27B 2BH0A 3RGVB 3AVEA 3VGGA 1UD2A 4ZAKB 1HH9A 1LO0H 3NRFA 4F7EA 4Q74A 1A6AA 5HGGS 5C0BA 4K3JH 3HI6L 5F89B 1NAKH 3MLUH 4A1RA 2PF6A 3D4YA 4A68A 3VSQA 3IE4A 4C56B 4H2CA 3GRWL 1U8MA 3AU1B 3E6FA 3UBFA 2J72A 4N0UE 1HILB 2CJ3A 1T0NA 3D39E 3IPEA 3SE4C 3L5XL 1RUAL 1RKRA 4QRPB 3UTOA 4G7YH 2P9RA 2JQZA 1U92A 3PL6A 1LEGA 3IDMB 2WTRB 1YPZA 2GAZB 5KVGH 1LL1A 3G5YB 1L0XA 1VCBC 2GC4C 4HV8A 1E4KA 1VADB 2QPSA 1RPKA 2QQLH 3S98A 2D03H 2E6PA 5LGHH 4Y4HC 1BV8A 1HINH 1NDMB 1VENA 3ZE2B 2F7OA 4A66A 1ZIBA 3DX9B 4UWQB 3U6XA 3WE1A 3FPXA 4KPHH 5FEBA 4IHBA 3SZ6A 1ANUA 3J7HA 1FO0L 3BIAX 3QFJB 4KRLB 1M7IB 4L05A 4NQCA 4D9LL 2EUXA 3GF8A 3CSPA 3MC0A 3SBPA 1CF8H 3OVUB 3HI5H 1XTMA 5T3ZH 1NCHA 2IEPA 5F7BA 4OM1L 3OC8A 1HOCB 1ZV2A 2X4PA 1AGEB 1UASA 5IMKB 1XF2B 4WSKA 4KH2A 1BWWA 2N59A 4G1EB 1YEKL 2JCCB 2DIJA 3NQKA 3SCMD 2WIMA 4TV3A 1A9EB 4H25B 1TIUA 3MLXH 3MLTB 2UZXB 4MA1C 4FG6D 1MEXH 3N43F 1T2QH 2YA1A 4CADB 4TNVK 2ZXEB 5DUMH 4FFTA 1ZXKA 2CG9X 3WJJA 1J1OL 5IB2A 1IEBB 2DQFB 4YK4B 5AUMB 1OE3A 5I66B 5EOCJ 4YBQD 5FUZL 4AMXA 1BOYA 5EU7C 2UWEF 3ESUF 3QXAA 3REWA 2YPLD 1KTLA 4K8RC 3UC0H 3W11C 1NBZA 3L81A 2HRLA 1AS7A 3MX0A 1GY1A 1MH5A 2YGPA 1JPST 4U6XB 1O7VA 1BAFL 5AOIA 4K3DH 4HWZA 4PQXA 1RI8A 4HK0A 1H5BC 4P06A 4PJDE 4Q6KA 1MLCA 4Y4HB 4YQXL 4EI5A 1HSBA 5D5MF 3PNRB 4URTB 1OLLA 4WFHE 4Q7DA 3ULVL 2OMVA 3RBGA 1BBJB 3ZKND 3UTZB 5L0QB 4S1DC 4IDJL 4IRSA 1DJXA 4LFHG 3KWXA 2NNFA 2QR0B 4WI3A 2EE0A 4OCXH 3DRTA 5CKGA 3HPLA 4LSSH 3B1TA 5SWSB 1UA6H 4P57B 2ILLA 2PW2A 2WLLA 4WVRA 3F58L 3D4GA 4C83A 2P8PA 1AR2A 4CDHA 2CIKA 2FHBA 3T4YB 1IM3D 2CLRA 4OIAA 5LBSH 1E67A 1RVFL 2I60L 2Y22A 3O3UN 1DQDL 3PWNA 2X4OB 3QPKA 4LLWA 5KJ4A 1SDDB 5MHSD 1NEZB 2WGNB 4XPTH 3ZR5A 4JPKH 1QSFA 3BP5A 5FM4A 1DEEA 2YXVA 1PD0A 3CDFA 5I1EL 3T6ZA 2YPVA 4YBHA 4WJKB 5A2JH 1E4WH 3G7TA 3U9UA 2QVFB 2YZ1A 3V4PL 4XNXH 2YRZA 3W0WB 1PG7X 4FQ1H 4X6CE 2QSQA 4N9OB 5DJXA 2VXUL 3HAEB 5KAQF 5BJTA 1UD6A 2B5IC 4MNQA 3FUIA 1CMOA 4A7TA 5I17A 1VKXB 1TCRB 1WS7A 3QEGL 4YE4L 3K7UA 1IAIH 2NY7L 2VDOB 2OXGA 3WEOA 1BXXA 4OZGE 3PJLA 3WMSA 1DVYA 4KZ0A 4YL4A 4D0BB 1FNGA 3BGMB 4G9FB 5BVPH 1UXSB 4UM8A 5KYNA 3MV8B 3FUFA 2NNXA 3NESA 1ONQB 3MRFB 4Z7WA 2V8LA 2XKNA 3TBSB 1AOHA 4OCNC 4OFVA 5CJOL 3HC3L 4G72B 1D2OA 3TCTA 2H1LM 1CFNB 1HHKB 3WMQA 2NY5C 1X5XA 1T89C 2A1WH 3PGDB 4XZUA 2VW7A 1H5BB 3IF1B 5C6TH 4UDUA 1AO7D 2JFCA 2V2WA 2APXA 2RR3A 4MS6A 1BHGA 2X42A 3QORD 1FBIH 4PBWD 4WW2C 5K9OB 3WMPA 1NEUA 2AXFB 1BM3L 4JFYB 3K1DA 4ZS6D 4XWOD 3GIVB 2B59A 4HISA 4YXKH 4FD0A 2Y24A 2CGZA 4XBPA 4IBWA 1G7HA 1PL3A 2YOCA 2Z0UA 2E9WA 1G1CA 3CZGA 4L9LA 5LNDA 4CKVX 5ETUB 1CE1L 1QA9A 4PW4A 4I1NB 3CFMA 3FRPG 3T2NH 1GGTA 1P1ZA 2GK0A 1OSPL 2N1KA 1OP3K 2QADC 4XB8A 2X05A 5E5RB 4ORGA 1P5VA 3RAJH 1FG2A 3AAZB 4NQSB 2EIBA 4YLCA 4JAMB