2BWDA

Atomic resolution structure of achromobacter cycloclastes cu nitrite reductase with endogenously bound nitrite and no
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
334
Chain Sequence
b'VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 90
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA02
4UAHA 2HRGA 2VN3A 4AX3A 4DP0X 2GC4C 2JXMA 1CYWA 5AFAA 2IWFA 2UXTA 3PXLA 3NJJA 2TSBA 3S3BB 4F7KA 2DYSB 1KBWA 3TA4D 4NAJA 5IY5B 3GDCA 3NJMA 1BXAA 3SBPA 4BXVA 3UGEA 4A2FA 3EHBB 4HAKA 1B3IA 1GY2A 4CSZA 1HFUA 1PY0A 2GB2A 2R7EB 3NJNA 2BZCA 3PAUA 5I26A 3EH5B 1GS6X 3FQ1A 3IBOA 4HALA 2FJSA 1AZBA 1FWXA 3CVBA 3DKHA 4G71B 1X9RA 4FA7B 3FPYA 4JHUA 1ZPUA 1TEFA 4L0PB 2FTAA 1ID2A 4YSDA 4A67A 4HCIA 3ZBMA 1QNIA 3EH4B 1CUOA 1N70A 2AVFA 4DPBX 3H4HA 3UACA 1NPNA 1PCSA 3IE9A 4PCYA 2W88A 1IC0A 2BP8A 2IH9A 1MDAA 2GIMA 2CCWA 2PPEA 1PF3A 3ZIYA 4DP8X 2JFCA 1NTDA 1HAUA 2ZOOA 2J57A 5I5IA 2PP8A 1KDJA 1ZIAA 3FU9A 4GYBA 4P5SA 1NICA 4UF7C 1SDDA 3FSAA 2AZUA 3AG4B 2OJ1A 2VM3A 1IBYA 2YAQA 2VW6A 4Q89A 4RH4A 2CUAA 4AKOA 4YSPA 5PAZA 2FQGA 2GI0A 4QLWA 2BW5A 3HB3B 7PCYA 4GP8B 1L9QA 3GYRA 3WKQA 2XWZA 1DZ0A 2BWIA 1ASPA 1NIBA 4BDVB 3V9EA 3OM3B 2HX9A 4HHWA 1PZAA 3ASOB 4KNSA 4YSOA 1JXGA 2R7EA 1AS7A 3CG8A 4YSRA 1M57B 2Y69B 1ASOA 1JVLA 3D12B 3ABKB 3CDZB 1OE1A 1W8EA 3OMNB 4JHVA 2WO3B 3CZUB 1OE2A 4YSSA 1L9OA 2VSMB 2EILB 5F7BA 5D4IA 3ZX1A 1EZLA 2NRDA 1TU2A 5B7MA 4N4YB 3EF4A 1N68A 3QQXA 4FAAB 2AZAA 2EIJB 5AZUA 1J9TA 2VMJA 3X1EA 1NIFA 5B1JA 3T9WA 1ET8A 3T6ZA 4AKPA 1JZJA 1PAZA 1JZGA 1WA1X 3WNIA 2FQFA 2P80A 3ABLB 1NIEA 2OV0A 1IKOP 3AW5A 1MZZA 4E9YA 2BHFA 2I7SA 1A4AA 2PLTA 4GP4B 1PLAA 1W6LA 1WS7A 3DIVA 1ADWA 1AZRA 1ET5A 1BYOA 1L9PA 4F2FA 1MG3C 1W6WA 3KW8A 3NJKA 3ABGA 3U25A 2FT7A 1WA0X 1E67A 1PZCA 4HIPA 2IDUA 2Y1AA 3DTUB 3UABA 6PAZA 2QDWA 3WIAA 2HLEB 1XMEB 1WS8A 1GSKA 1NIAA 1NZRA 1JXDA 1JZEA 3G5WA 1KCBA 1KBVA 1SFHA 4G7SB 3FSWA 3FU7B 3TU6A 4BDVA 4HCGA 1E5ZA 3ABMB 3FU8A 1A4BA 2DWTA 5B7FA 2BWDA 3T6WA 3CDZA 1XB3A 2PPFA 4GP5B 3X1NA 2UXVA 5B3SB 4KO6A 2UXGA 4YVUA 4A2EA 3NSCA 1JZIA 4BK5C 3ASNB 3C75A 3MBWB 2GBAA 1PZBA 1AZUA 3GXUB 1A4CA 1X9UA 2CAKA 2H3XC 2FT8A 3T6VA 2YAPA 3QJRB 5A7EA 2VW4A 1IUZA 2OCCB 2QT6A 1AS6A 6PCYA 4KO7A 2XXFA 2A3TA 2YXVA 1PLCA 1ASQA 1J9QA 3H4FA 4N8UA 2BW4A 4YSCA 1CURA 1AAJA 3FYEB 5EHFA 3NSFA 1YLBB 3QJSB 2BZ7A 3QJUB 4DP4X 5LDUA 2EINB 2PP9A 5B1KA 4DP6X 5I5MA 1ZIBA 1AQ8A 1JZFA 5I6LA 1NWOA 2W8CA 1SNRA 3AY2A 1E5YA 1HAWA 2RACA 3IN0A 2YAMA 2Q5BA 3X1GA 2XV2A 1SFDA 3TBBA 3HEIB 4E9QA 2XUWA 3L45A 1SHXA 2HX7A 2FT6A 4G7RB 2GHZA 5I5JA 4E9RA 2IWEA 4HHGA 3FPXA 5I6PA 4X4KA 1GY1A 3FU7A 5ANHA 4BWUA 1BXUA 2J55A 5I6OA 4NB7A 2DY2A 1V55B 3AG1B 1AZCA 3H56A 7PAZA 1JXFA 5TK4A 1KGYE 2LLNA 1JVOA 3S3CB 1ILUA 1OCRB 1BQ5A 4E9XA 2I85A 2YQBA 1AZNA 1V54B 2VW7A 3AG3B 3T71A 4E9SA 1ILSA 4KOBA 2GSMB 1CC3A 3PCYA 3UAAA 3CVDA 2XU9A 4A2GA 4A68A 1SF3A 1PNDA 3SBRA 4G72B 2I7OA 4AKQA 3V9CA 5AKRA 3WKPA 2DYRB 4YSUA 5I6KA 2J56A 1MZYA 3T6XA 4CSPA 3PLYA 5I6MA 1F56A 1J5CA 2JKWA 3BQVA 3JTBA 2CJ3A 1AACA 1PMYA 2J5WA 1CYXA 2FQEA 4WTQA 3X1FA 4A66A 4Q8BA 9PCYA 1NPJA 1PLBA 3NYKA 4YSTA 3RYMA 1L9TA 4WKXA 4DPAX 2YAOA 4P5RA 2IH8A 1A65A 3NP3A 3WNJA 1J5DA 1KCWA 1AG6A 1NWPA 2B3IA 1TKWA 1RCYA 1JOIA 1M9WA 1OCZB 2BO0A 2QPDB 2EIKB 2B08A 2H5UA 2UX7A 4HCFA 1AR1B 3OMAB 3UAEA 3OD3A 1KV7A 2N0MA 1SF5A 1ZV2A 2Q9OA 2IWKA 1XB8A 2XX0A 2BP8B 3ZDWA 3NJIA 2IAAC 1T5KA 4GXFA 3UADA 1NINA 2ZONA 2MTAA 2QDVA 2XV3A 3FYIB 4W1TA 1OF0A 4GY4A 5B1JC 2CALA 1L9SA 2PPDA 4MFHA 1XB6A 3TBCA 2FNWA 4DPCX 2XVBA 3FT0A 1SDDB 2XXGA 2IDTA 1OE3A 1E30A 1BQRA 1UATA 4YSAA 3QJQB 4DP5X 2TSAA 4A2HA 1A8ZA 2E86A 1BYPA 3TASA 4ENZA 3PAVA 2XV0A 2IDQA 4BWTA 2AANA 3NJLA 1V10A 4KNTA 1SJMA 1BAWA 4F2EA 1RZQA 1J9RA 3FQ2A 4KO9A 1BEXA 8PAZA 1TEGA 4DP1X 4EF3A 4NERA 3NT0A 2BP0B 4PAZA 2X87A 1M56B 4K9JA 2HRHA 3NJFA 1I53A 2EIMB 5E9NA 4G70B 4KO5A 1L9RA 1BQKA 1WA2X 2YAHA 2HXAA 3S8GB 1EHKB 2CBPA 3WI9A 3ERXA 3BVDB 2HX8A 2FQDA 5PCYA 4E9VA 2IDSA 5TK2A 3PPSA 5I28A 1BXVA 1AIZA 2UX6A 3AG2B 4AZUA 5I6NA 3WG7B 3NJHA 4DP2X 2ZWNA 1AG0A 3FS9A 1PNCA 1GYCA 4G7QB 4A2DA 1GS8A 1FFTB 1GS7A 3NJGA 4E9WA 1KYAA 4BWWA 2MRYA 5B1AB 1FA4A 2PPCA 3JT2A 1ETJA 3IN2A 1ZDSA 1ZDQA 3X2QB 1J9SA 1JZHA 2QPEB 5F7AA 2P80D 4KOCA 2H47C 1VLXA 3SQRA 4YL4A 3FSZA 3N55A 2AFNA 2YARA 2XYBA 3NSDA 5D4JA 3KW7A 1JERA 2HZHA 5D4HA 3QJVB 2VSKB 2PCFA 1E65A 4YSQA 4QKTA 2YAFA 4AI7A 2UXFA 4ZK8A 2YAEA 1DYZA 1NIDA 2X88A 4BXSV 2DWSA 2ZXWB 3N2JA 2PPAA 4KNUA 1SHWA 1AANA 1A3ZA 4TXVB 4M4RB 3FSVA 2BP0A 3NSYA 4M3HA 1AOZA 3AZUA 3X1BA 3QPKA 3MX0B 4E9TA 1GW0A 5B1BB 2PP7A 3SBQA 3IEAA 2VM4A 3S3DB 4W9ZA 3NP4A 2XX1A 2YXWA 2WSDA 1WAEA 1RZPA 5B7EA 1RKRA 4HZ1A 1AS8A 2XLLA 1R1CA 2DV6A 2IDFA 2GC7C 1URIA 3PAZA 1MG2C 4UANA 5FC9A 1OV8A 1QLEB 1GR7A 1OCCB 1KDIA 2PCYA 3OMIB 1IBZA 4DP7X 3QJTB 3OQRA 1OOWA 2WO2B 2FWLB 3CVCA 4JKNA 1QHQA 4YVNA 1NDTA 1OCOB 4DP9X 4YSEA 1ET7A 3FQYA 3EH3B 3S8FB
chains in the Genus database with same CATH superfamily
1T2QL 2A1WH 3D2UD 2VDKB 1MKFA 2R0LL 1LWHA 3KD4A 2NCEA 5L9DL 5IR1B 4ZJ9A 4F7PB 3U0PA 4FQPA 3O6KH 4ISVB 3A6OA 4U1IA 1X5AA 3L2LA 5I76A 5HHMB 2WZ5A 43C9A 3QEGL 5IJDC 3T3ME 1GGCL 5FLUA 1FAIH 4ONHB 1BZEA 5HYJA 1S7TB 1KT2B 2XNAB 4JRXB 4UUJA 1SMDA 5IVOA 3HNSH 4BFGA 1KC5H 2DLHA 5EOTA 3I9PA 1OSYA 1SYVB 3VE0B 3ATDA 2LTQB 3FZUD 3MLVH 2NSMA 4Y8DC 4EZMA 2X1WL 3AAZA 5D7KE 2MQ0A 1VFAB 4M5YH 5EWIL 5BUAA 3I6GB 3D7PA 3GXIA 1YC8A 4LVNC 3VFMA 4FADA 4NC1E 3V52H 2CHZA 3CSYB 3GK8H 1XH2A 2K9FB 3BT2H 4LLYA 1PYWB 5DD6B 5CEZH 3VD7A 3IMVA 1YQVL 3OL2A 3UIZA 2VCOA 3VG0H 5GPRA 1IBFA 5C7XL 4MXQD 4OZ4B 4WWNA 3V7MA 1UB5A 1OB1A 3RGVB 3VSVA 1CICD 3H4HA 4K73A 4M1CC 3T3PB 3WMSA 3UZQB 2QV4A 2VLJD 3BZFA 1ND0A 5KVGL 1U8NB 1NGQH 1P5VB 3OB0K 4X9HA 5IUSA 4QKXB 2P46B 2KPWA 5HGBB 2A9NL 4TUOA 4C56D 2Z31A 3HBGA 2FJUB 4YO0B 3OGCB 4NO0D 4EI5A 2VC2H 3QORC 2ZX5A 4ODSL 3RY5A 1RZ7L 4FI7A 3WFHA 1BAFL 3FU9A 4XMTA 5GGVL 4NQEA 5KTEH 4WGWB 1ZVNA 3TXAA 4M6OL 1Q9OA 4OLUL 3N1PC 4KTYA 4PBWD 3N1MC 4AK1A 1RURL 2CUAA 4NYLB 2ZYRA 4HBCH 2BNUA 2CM6A 5D4QA 3VU1A 1JE6A 1RI8A 1CZ8H 3BVNA 3KLHC 3BLKA 1KACB 2CXKA 4JFHD 3U36B 4UZUA 1EK3A 1R17A 1IO4C 1IILE 4A55A 1DQIA 4OCLC 4KI5C 4YSOA 1C5DB 2ZP9A 2VXVH 4GUCA 1M53A 3P0GB 3WEOA 2ZICA 4DNLA 3EYOB 3QC5X 4FNPA 2Y0SA 4G1EA 4URTB 3W9EA 2HN7A 2EE6A 1HC1A 4FXGA 4KJYA 3MRIB 2DOCA 1NAKH 2YRBA 4DKFH 4ZNCD 4UILL 2X4SB 3SJVE 1XH0A 1O9WA 3BGFB 1J0JA 3NDYE 5AZEH 2P8PB 2DF3A 5KOVC 4JDTL 2IALB 4O02B 1N64H 3NSJA 4BKLB 3OHXC 3Q6FA 3QPQD 4PRBA 1A9BB 3IM1A 4KK6C 4BK5A 1F4XH 2ATPB 2F61A 5DJCB 1ZT7B 1TETH 3BKML 5E6ZA 3TBSB 3UBXA 4BUQA 3HE7C 2ADFH 1EO5A 5TF1L 1RIVH 3WFBH 4I0PD 5EZIL 2AVGA 1ED3B 4BZ2L 5E8PB 4LEXH 5KYYB 2FNBA 4X0KB 4L3EA 2WUBL 1IGYA 3T3PF 25C8L 3IFLH 4HD5A 3RVWD 4FZ8H 3ZO0A 1D6EA 4P5KA 3T0VA 1AKPA 4A6YH 1U3HA 1CQKA 2BZDA 2RTTA 4V2BA 3ZTDC 1MVUA 1MI5B 3FOLA 4YHKH 2K1MA 4Z0BL 2F58L 1SUHA 2GK2A 5EZPA 5FYKH 3G5WA 2LW3A 5FCUH 5JPMA 3KPRE 4M7LH 2EUVA 1NCBL 3TT1L 1TQBB 1A4BA 4HK0B 1QQDB 1NEPA 1WRFA 3PRZA 3EO1A 4LNRA 3BXNB 2QELA 3BP6A 3MUJA 4ZO8A 3TN0C 3DIFA 1JGUH 1YDPA 2EIZA 3KJ4B 2XTLA 2Y1ZA 5KS9E 3KPNA 2VDKH 2D7OA 2MKLC 3S5LB 4BCXA 2GUOB 5D2NB 4HP5A 4IHOB 3B5GA 1LD9A 4UDTA 3UOAB 1UASA 1RUQL 1FL6A 1UD4A 1HCFX 1VACB 3VI4B 3H2WA 2WIMA 3JV6B 4ZXBC 2Q7YA 2X38A 3VD2A 3B2UD 1JZ3A 1YNTA 4OFPA 4CVZA 3UGUA 3UJTL 2YPLE 4OFYA 2XPYA 2CK0H 3HHSA 4EVNB 3IXAB 4HXAH 5SWSB 4Z7IA 3SKJH 2X12A 1U58B 3CH1B 3FYEB 1LNUA 4F7CA 3SCMB 2JKIS 4PV9A 4DP6X 4JFDE 2V8MA 1DLHB 5C09E 3TZVD 1MCNA 1J88A 5AW3B 1ZLVK 4PGJA 3TEXA 3SDAA 3MKGA 1GAFL 4PJBF 3LRKA 2OMBA 3OLIA 3S34L 3AACA 4X4YB 1NBZA 2BNRD 2UZIH 4G7RB 4IKJA 4YHPB 4JFPA 3L5XL 3BO8B 4U3SA 1K6QL 4NUPA 1L7IH 4WY7H 3WUZA 2G75B 1Z7JA 5ANHA 1F42A 5T5FL 3TLRA 4R8WH 2V37A 4R4FH 2CZNA 5I1AA 1CDCA 1O9ZA 4YQXL 1SGKA 3D30A 3K72A 3QE5A 1PPIA 5T3ZD 1LO2L 3FO2B 3IGAB 2ZOLA 3CVHB 5FDYA 2BSCA 2FO4B 3MV9B 3MXWH 3QFDA 3HE6C 5D7SL 3HHMA 4MCZA 3TA3C 4AT6B 3MV8D 2Y5EA 1HIMH 4FLQA 3IMTA 1V54B 3MGAA 4RSVA 2BCKA 3OXRA 4NHCH 3U9WA 5ISZD 1O6SA 2PCXA 1S7QB 1XSIA 3EFFB 4JO3L 3RPIB 1IT9L 1RVFH 4Y5XA 4AYDC 1V7MH 4AQ8A 3TL5A 2I7OA 4ACTA 1N6VA 1D5MA 1S3KL 5AKRA 1ERNA 3RHWK 2H6PB 5EIIA 4L1TA 3ZDYF 5HYSB 3QR2A 4BBWA 1CDGA 3KYKH 1HWWA 4L1DA 5AVWB 2QQLH 1OAXH 3HNTL 1AFVL 3GO1H 2J5WA 3APDA 5SV4A 4MCYA 2YMXL 3VXMA 1B90A 2QMKA 3FU5A 3NH7H 4N2FA 4YSTA 2CCLA 2HKHL 4XNXL 5DD1L 3SKOB 3QISA 3ARBA 1JSYA 4P5RA 5A16A 3AXIA 4IEFA 1GGBL 5J1AB 3ML9A 3HUJE 1EBPA 4ZQKB 5IBTH 1JWMA 2C1PA 1JF6A 3CPLA 1RP9A 2ZKXA 3V4UL 2CRZA 1J0IA 1NUGA 3KM1A 4QXUH 2DQMA 4LSPH 1I7UA 1HSBB 1MFNA 3TBYA 4PP2A 5GGQL 3RWFB 1Z3GL 5CEXA 4BFFA 4BSVB 1SF5A 3L9RB 3R4RA 1HOCA 4UTBH 4GXVH 5BOJA 1JRHL 4UZGA 5G55A 4MB5A 4B9PA 2AQ1A 2J7LA 1Y0LA 1XGYH 3MUGB 3O6MH 2ZOKB 1OF0A 4MJ5A 4GRLB 4JPIA 4HEPG 1XF4B 4XPHL 5LBSL 3MLSL 1OLZA 3VGDA 3MCLH 3P0VH 1OE3A 3WS3B 4UIKL 1D9KD 4KHTH 5AG9A 1DVUA 1R5VA 2V2WA 1I1AB 3UG3A 3MUY1 3S88L 4X8JB 2ZCHH 5GSVB 3RFZA 3PWUA 3KVDD 4L5FE 2WXOA 2GITB 1N12A 2O5NA 2IFGA 2ZSVA 2APVA 4NHUB 4HSQA 2VN5A 3LZFL 5DS8B 1GTFA 2XG4A 4U6HA 1QSED 2Y7QA 5T3ZL 5I1LA 3PWPE 2NLJA 4BA0A 1FO0A 3VD4A 4K9EH 1CTNA 4Z1PA 5DRNB 2F54D 3KGTA 3UC0L 3WIHL 1T1WA 3QDGE 2VDPB 5AOJA 3HPLB 3HNVL 2J88L 3QHFH 3WIIL 4YXLL 1QPXA 4JL1A 4IRSC 3PHSA 5L2KE 4YIQB 1ACYH 2K7PA 3GF8A 2AJSL 3JTTB 5IMMA 3FULA 5JOPE 3DRQA 2QGCA 1MCBA 1DVTA 1KEGL 1NMBH 5ESAB 1RHHA 5L7XL 4B0MB 1Z0NA 4KGLA 1G7PA 3R8QA 3U4KA 5CD5D 1B0GB 1DSFH 4TNGA 1FYHB 1YN6A 4NRYB 3W0WA 5DJYA 5C0CB 4FA6A 2CO2A 1GYCA 3EFOA 5CZVH 1IARB 4KWUA 1AXIB 4FFZA 4EIBA 5CUSH 3L3IA 1ZDSA 4M7JL 1CDBA 3MJ9A 4OGYL 3ZGHA 3GRGA 4IKIA 3HOGA 4KU1A 5HJ3A 4RA0C 4DW2L 2Y06L 2YARA 4NNXA 1CE6B 1WUNT 2B7DT 1VFBA 1W72L 5D4JA 3MCKA 3WKYA 5L8LB 2VR9A 3QZWG 4PRHA 4WK2B 1ODAA 4U1IB 2X09A 3B6SA 4PW3A 4IBWA 3CVHH 5K39A 4PJHB 3RI5K 1GJWA 2XBDA 4A39A 2EVJA 2Q10A 1F58L 3KPSB 2JIXD 4MZ3A 4NLAA 4UUJB 4Y4KA 1AO7D 1U8IA 2UWEF 5IB4A 2VITA 4W4NA 2ESVB 1WLHA 2IADA 5EFIA 3RAJH 2BP0A 2MQGA 1KGJA 4LSSL 3D50A 3MRGA 1AZVA 2X4RA 2PP7A 3AAZB 2DQHL 4KUZL 4FLRA 4K3EL 4NX0A 4RZCA 3VFMB 2AW2A 3FTUA 1RZJH 2DMBA 3A4DA 1J48A 5DR5L 2V3EA 5GQBA 4JM2B 4LLYB 5HD8D 5C08E 1KB3A 4XXDA 1LM8V 3OKKB 4ODHL 5FGCB 1NL0H 1NCCH 2IDFA 1I4FB 1URIA 4ZMAT 1AY1L 4M5SA 1EAQA 5DJAA 1OOAA 3D4GA 4OAWB 1OB1B 5D1QE 4QHMA 2VZ1A 2R56L 1ZSDA 3BZFB 3QZOA 3QCUH 5SWZD 2AI0H 3K6OA 1NAMB 2WQSA 2Z31B 5C0BB 2OL3L 2W60A 2HVBA 2WV3A 3BFWA 5GJSH 3VD9A 5JA9A 1PG7H 4TL4A 4BJLA 2YD7A 5IQMA 5IMOA 2D0FA 1OP3H 4ZAKC 4OLZH 5J1TC 1MFBL 1Q9OB 1OL0A 2B16A 4PREA 4NFBA 1WUZA 4RX4A 4LLUA 5KUMA 4Q9BA 1Z9MA 2QQNH 3GMPA 4P23A 2BSRA 5KG9B 1YMME 5TGBB 1NBCA 2BNUB 1MCEA 2TSBA 4ELMA 4YNYB 3BVNB 5E00A 5FUCC 3F7RA 5IWLA 5FYJU 5IY5B 3FU6A 3NJMA 3SDYH 2AJXH 2ZYSA 5GGRA 5CD3A 2CO6A 1GY2A 4Y2DB 2DW5A 4WI9A 3SDXE 1QPPA 1EGJL 5GRUH 4PY8I 4AJWA 4YUEH 4HBQA 3K91A 2HTLD 3LNHA 1W0YT 5K1NA 1U9KA 2XXMB 3DPDA 5IW3A 4XBEH 5CGYC 4DESA 4RGOH 1II4E 2X4NA 3D0VA 4FG6C 4G71B 1QRKA 2EDMA 2HN7B 2MJWA 5E8OA 1KCVH 2B4CH 4FXGB 4GSXA 4Y4FC 3OKLA 2DKSA 3G3LA 1OGSA 3QQDB 3HG1D 4HS3B 4OKVA 4AL8L 1CDUA 3BIAX 2WYIA 3HHRB 4QHPA 4GUQA 4OI9A 2HSIA 4PRBB 1IC0A 3MLZH 4M03A 5E94A 1CVRA 1NCWL 3VXSE 4CUCA 2WBJB 3NEOA 2WZPD 3ENEA 4WHTA 4F2ME 5MEQB 2PXYD 3MFGB 4HLZH 1DVZA 2R8SL 3PWNA 1KDJA 4L3EB 4AIEA 1IGYB 3ZTCC 2VDPH 2PTTA 4Z77A 3IMWA 5KAQF 1ZTXL 1D6EB 4Q9QH 1OW0A 1SDDA 4P5KB 4YHOH 4Y4HD 3QIBB 5FW6A 1X6NA 3ULSA 1MVUB 3CIQA 1MJ7L 1TKWB 4UT7H 4L23A 2I24N 1R3IL 3H3PH 4HIHA 2ENPA 3DSFH 1ACZA 1A66A 4TUJA 1SJXA 1JPTH 3LRGA 3U4BH 4FQQA 5JPMB 4HPOL 3WN6A 2QFPA 3GT6A 4W81A 3CG8A 3EO1B 1VEPA 5IREA 3E1ZA 4H13C 4RGNE 2ZX7A 4XNBA 3UO1H 1DL7L 4JPSA 4XVJL 3RUGB 5L4JA 3DIFB 1CMOA 3CZUB 3SB3A 1MHPH 2CKNA 4ZD3H 5D4IA 3WDHA 4PJ9D 2GTWA 1W0VA 2BSDA 5IJKC 4BZYA 4IHBA 2G60L 2OCFD 4O4YH 2AZAA 1LD9B 1PG7W 1MW2A 4EJ1C 4PGDA 3ARDA 1GHFH 4I87A 4TUKL 2VR8A 12E8L 3WCYA 2Q7YB 2WZ0A 1RIHL 4KKNA 3LEVH 1YNTB 3W38A 3ZDXF 4XMWA 4M7KH 4ZX4A 1DLFH 1O7DE 4E9YA 1HKLH 4NUGH 5EO9A 4PJFA 1P9MA 4GP4B 4XO3A 5LCVL 4C4UA 3RDTA 3ETBJ 4NQCD 4YDKL 5C6PB 1XTLA 2IDCA 3TCLA 4OCXL 5FGBA 1LNUB 5IVXB 2HUHA 3DMMA 4PV9B 5ICXA 2UY6A 4BFIA 4R0LA 5LAPA 1PX3A 5HI3D 3D1MC 3F7PC 5A2IH 1MN4A 1U8KB 2IDUA 3FTZA 4Y9EA 3OJMB 2YLHA 1HXKA 1R75A 2HLEB 1NBZB 1EDYA 1V05A 1XSOA 5FHAH 4JFPB 4M61A 3STLB 4EUPA 1CO1A 4U3SB 3BMWA 3CSPA 1N7MH 4XOCA 3QK0A 4BDVA 4KRPB 4WJ5B 5I1AB 3U2IA 3FU8A 3RX9A 1NCTA 2HVJB 1A8JH 3C6LB 3K72B 4WU5A 5ID1A 1NC2A 1LQSR 5HI4C 2VXTH 1NAMH 4M8QB 5KOMC 3KPRA 1UWGH 3RX7A 1X7SA 1DJIA 3SOBL 3OZ9H 3QFDB 5AB1A 1QRND 5EO0A 4U7MA 4MCZB 2X4PB 3BEWA 3HN5A 3IGLA 5BOPA 4N5UA 2GBAA 5D7JD 5J6GB 5JHMA 1FVCB 1PZSA 1B88A 5CP3A 2AITA 2WTOA 2BCKB 3UP1A 2VLKD 3OXRB 3NRQA 4OCNC 1E43A 1O6SB 3UTTD 5A7EA 3Q2WA 1VEMA 5LXVA 5AOMA 2OCCB 5JUEH 5HGHB 3C08L 3I3DA 3RILA 1FBIH 4X0NA 4OQTL 5EIIB 1Q90A 4OD1H 4G5AA 1WITA 3ZKXB 2BSBA 5J57B 1YLBB 2J8UE 4PGZA 3GRWA 5T8IA 2YPLA 5JZ7C 1CJYA 1SNRA 1E5YA 3VXMB 4GUOA 1OGAE 5LG1A 3MRDA 4IIQB 2YO3A 2IAMA 4E9QA 2P5WE 2VXUL 3ARBB 1M2VA 1WWAX 5A16B 4J6RH 1ESOA 1AQDA 2APFA 5C09A 1XIWD 15C8H 3GS4A 1JWMB 4ZYKA 2P44B 3GPEA 3CPLB 3WFZA 1W8NA 3U4EA 4G1MA 1I7UB 2EEFA 3RB5A 5I6OA 2K8QA 4FTDA 3LQAL 3GMQA 4MMZA 1V55B 4FQXA 4NBYB 5CEXB 5CLXA 4GAJH 3MXVH 4FTVE 4F57H 3C8DA 4HVBA 1HOCB 2Q3XA 4LCIH 1LO3L 3L5WB 3ULUD 4Z76A 5EOCL 5F3BB 2NPLX 2BP3A 5B39A 1Y0LB 1XCTA 3D34A 4BH8A 1PJWA 4S2SB 4MJ5B 1L9MA 4JPIB 5DVMA 2FRGP 5AVZB 1CB4A 3T1FA 1ILSA 4JS7A 4QHLB 3LN5A 2X0WA 1B9ZA 1X3DA 2CNYA 3FN0H 3CVDA 3HN8A 1COBA 4N2KA 3ZT6A 3FB7A 2WCSA 5HHPA 2XQYG 1DO5A 1AKJA 3QFJE 4AE0A 1R5VB 4KTGA 4M6NL 1A7RL 1JHLL 1FE8L 2EDYA 5EUOA 3RFZB 4FNTA 3PWUB 1IM9A 3IU4L 2JI2A 1XCQA 3FZUC 1TG8A 1BZ8A 2ZSVB 1Z66A 2DMGA 3APCA 2ZXAA 3JSSA 2EECA 2DLFH 4HJ0D 2Y7QB 3NBNA 2OK0L 4O2CB 3WNNA 2J5LB 5I1LB 1I8LA 2NLJB 4GKSA 4FQHB 4QRUA 2GT9B 2V8LA 4ZOEA 2XZAL 1T1WB 2A5UA 4BKSC 2ISDA 1FNEA 4MXQC 1Y18B 3AREB 1OARL 2CM5A 1CICC 2WP3O 1ZVYA 2BWQA 1Y07A 2F7PA 5F7DB 3DRQB 3HRZA 4ZMZA 1RUML 1T0OA 4WENB 1RHHB 3NJIA 2WNKA 3PP3K 1OP5K 1G7PB 7FABL 5IESH 2A73A 3HLAB 2LE9A 1KJ3L 3IRCA 1CD8A 5DJYB 5EU6D 3W0WB 1MCWM 1IEBB 3EFOB 1B2WL 1L9SA 3IFNL 3ME0B 2G4GA 4GT7A 3TBCA 1E4XI 4O5LH 3L3IB 5H37G 3L2NA 3GBML 2XVBA 2X1OA 3FT0A 3QZBA 1XWVA 3VQLA 4D8PA 3PGCA 1ZHKA 1AXSA 5HJ3B 5GRVL 4XC3L 1EJ6A 3QEQE 3GLZA 4NNXB 2R0ZH 1VFBB 2EVFA 4XH2A 3MCKB 2CG9X 3TV8A 4KX9A 4B95C 3B6SB 2ZX9A 3FONA 5K39B 5DURB 4S11A 1L9NA 1KIRA 1N2RA 1DFBH 4JANA 2VITB 4K8RC 1T7YA 2IADB 1ZOXA 2Y5TA 5EFIB 2K6YA 1U2HA 1QMUA 1WV7T 2BP0B 2E27H 2HFTA 2X87A 4OGQC 3SQBA 3G6AB 5EULV 1BXXA 2GY5A 1MFAL 1EANA 2CLZA 3WXVH 3ULUL 1I53A 3NZ8A 2HP4A 2MWCA 5GJTH 4RZCB 4TNWF 1L9RA 3RBGA 4QOKD 1CFVH 4XMVA 4X80L 1T0MA 3SOTA 2W9EH 2FHFA 5E08H 3PL6B 4DVRL 2V2XB 5BRQA 1IMHC 4IBLT 4KQ0A 3QPQC 3MYZA 4FQ1L 4G6ML 4RDQF 2R2HB 5DJAB 3V5HA 1KEMH 2ZWNA 3AM8A 4JR9H 4QHMB 1GA2A 3AUWB 1CT8B 1TFPA 1KOAA 1HN1A 2E3VA 3TONA 1NLBH 4BINA 1FFTB 2VR7A 1NMAH 3TBWA 3ZN6A 4M62H 5E2TH 3RVWC 2ZKHH 3E6FA 5IB5B 4XNZC 1WPCA 3V6OC 3LKQA 1QUPA 4IOIA 3VGGA 3VXUE 5IUCA 2VAAA 1FH5L 3E9UA 3VXTA 3TURA 3BZEA 4IBYA 5JHDE 2Y2YA 3GDBA 3N50A 2R29A 1G7HA 4G5ZL 2JELH 4OKDA 3D4ZA 1NSNL 4LLUB 4RZKA 4WGKA 5EO1A 1ADQA 4P23B 5C71A 4OGXL 1QP1A 5KVFE 1HS6A 1G5GA 1UA6H 3OR6B 5E00B 2PO6A 3VDBA 2MPAH 1WHOA 2BOBA 2OXGA 1SHWA 4JO4H 4BEIA 5GGRB 2E7CA 2BJMH 2CDEA 5CD3B 2CO6B 2WXNA 4F9LA 2YA0A 1A5FL 1IBDA 3T3MB 5A6LA 4DSYA 1S9VA 3BPLB 3IDNA 2AQTA 2PYFA 2JF1A 1Q72H 1QWUA 4LRNL 3S3DB 2WB7A 3TO2A 3QQ3A 4HZ1A 2X4NB 2WWKO 1AS8A 1KZQA 4Q9RH 5E8OB 3MV01 4NZJA 3SDDD 2HFEA 3W3BA 3OKLB 3KEDA 4U0RB 2Y36L 3B2UC 4IGBA 5C7ZA 4K2UH 3LPFA 5AVQB 3LXBA 4FNRA 4UOW0 2CMRL 1QZ1A 2KZBA 1FP5A 5C08A 4N5ED 1C1EL 4JPWL 3JXAA 1VB9A 3IPEA 5E94B 2ZPKH 2AKRB 3CVCA 5EU5A 1IEHA 2Z1KA 5LAXB 5IF0B 4Y16B 1I8IA 4I2XE 3TZVC 2EH7L 4M56A 1FC2D 4WHTB 5D1QA 2OMZA 4LF3B 1XGQA 4UOJA 5FV2A 3FFDB 3P11L 3CIAA 2PTTB 4Z77B 3GZQA 1RUPH 4PJCE 4HQQH 3ILPB 5CS7A 2GC4C 2H3NB 4U2ZA 1U3ZA 5BOZG 4DQAA 4K94L 2X2UA 2FYVA 4HIHB 3DO3A 3NIGE 3OAUH 4IOFD 3VD0A 3QDME 3LNEA 4FQQB 3UGEA 5KN5A 4L8SC 4G9FD 3LIUA 2KHAA 1YMMA 1A1OA 1ZRUA 2EO7A 3FUFA 1JTPA 3FB5A 3KH4A 2G2RB 4BHUA 2C9AA 4Y5YA 4FFZH 5D9SA 4NRXA 3VJ6A 4OV5A 3W82A 4ELMF 2WXFA 5I26A 2XBZA 1KMGA 3EH5B 1GS6X 3EYQD 3I9AA 3GBDA 3F7YA 4PBVC 3EJYC 2J44A 2FWSA 2XXCB 4F1SA 5L8JB 2GTWB 1NEZG 1W0VB 5T1DH 2O5XH 1LDPL 3ARGD 2Q8BL 4KHXL 3RWJA 4YSDA 1S7XA 2YKKA 3ARDB 1UJ3C 1XTMA 1CVSC 3EH4B 1NBVH 1EBAA 2HG0A 4MRBA 1JWUA 3DX6A 3I2CL 4AZ8A 1HQ4B 5A7BA 4Z3FA 2D31A 5SX5K 1MREH 1KLUB 2CBMA 1KUMA 1HAUA 3OZLA 5D71L 3RDTB 3TCLB 5I5IA 1BVKA 2Z1PA 3R1GL 4BFIB 5ICXB 1ZIAA 5TPWH 4ANVA 1HCZA 2Z8RA 4R0LB 2QLVB 3B1UA 2WNGA 4IRZA 4OBRA 4K3DH 4F2MA 3FO1B 3F05A 1IBYA 2XWCA 3O9WA 4FQCH 4U6TA 5J13C 5CSGA 4Y1SA 1IAIH 3I6LD 3FRPG 5DHEA 3DA0A 4EUPB 2DEYX 4FFWD 4NUQA 2K6WA 2B39A 1FVDB 5JPNA 4BDVB 5I0DA 4KXDA 4QHUA 3GMNA 5AW2B 3UTPE 1YPZE 3F7VA 3D85D 5ID1B 1NC2B 4NEHB 3VSTA 1OE1A 4JHVA 3KPRB 4RRPA 5EN2B 2D3NA 3ARFA 1E4KA 4YH6A 3RTQA 3L13A 5EO0B 1KN2H 2Z7UA 4AM0A 2ICWI 3BEWB 3CZNA 4OCWL 3CGTA 4GAAA 3LZNA 4GIAA 2A74C 4HXBL 5B7MA 1WICA 1IKFH 3EF4A 2EIJB 3DSNA 4YC2B 1D9KC 1RD6A 4UOW1 5G4OA 1NIFA 5CWSB 3NN8A 1R5WB 5B3NA 2CPCA 2Z93A 1QATA 4GSRA 1KY6A 4MNQE 4OIBA 1OT1A 2ZWYA 2OAAA 1LO0L 1VZHA 5ENWA 3DURA 3ETBF 1W91A 3LX9A 3L8QA 5F7NC 3QUML 4Z0XA 5D7EA 3GIZH 3OSKA 1OTSD 3CQQA 2YPLB 5I2IA 1KN4L 4NGHL 3LAFA 4WFGE 5F9JA 3OR7A 2I9TA 3DTUB 1G0DA 3QUXA 5M94B 3P9WB 1UM4H 4MDJA 2IAMB 4UT9A 4CGTA 5ECGA 4PJFF 1JG9A 1M2VB 2KERA 3AMLA 4J1UA 3S9DB 2EC9U 1ZLEA 3JUYA 2FHCA 1NIAA 4AJVA 5FK9A 2TAAA 4JFDB 4WK4B 3UP6A 3LN4A 4Q6IC 5C09B 3WD5H 1E4HA 2HA1A 4RVBA 5I1HH 4G1MB 2W0FA 1YECH 1L0YA 5J4MA 3U9PL 1UD3A 2CKBA 1BZDA 4ALAH 3X12A 1KTJA 3GMQB 4FQXB 4JKWA 2Y3AA 1S7SB 4ZOBA 3BN9D 1E9PB 2CBTA 2M83A 2E6PA 2Y7NA 2YEVB 4AMKH 4Z76B 4XRCA 4FFYL 3BMVA 1QTPA 3FQTB 4UAOB 1CGYA 4BH8B 1FL3A 2BSTA 5F8QC 4RMRA 1J86A 3C75A 4RQQA 4AL8C 2A0LD 1HHKA 1EJFA 3CLFH 5EU4A 4LNVA 5GHWH 1URZA 5LGYA 2VGLM 3MRQB 2NYYD 3SPHA 2DQJH 2HTKD 3VFSB 4UIMA 1RK1A 1FF5A 3QH3A 3QO0A 1KSRA 3FB7B 5HHPB 4PJ8B 5LVEA 1AKJB 2OW6A 1XAKA 4WI6A 4X5RA 5IHZA 5TD4A 2DD8L 4ZUTA 2DI9A 2IPTL 4M6MH 2WQWA 5DEGA 2J2ZA 5DVKA 1IGFL 4W4OC 5FKPA 2ILLA 2H41A 3HCVA 1I8UA 4PRAB 1SBSL 1UOLA 4TSAL 4P2QA 5KEZA 1VRSA 5B1KA 2EABA 3RIAF 4LOVA 2ZAIA 2YAMA 3TBBA 1GZQA 3HMXL 4GKSB 5HI5D 5AW1B 3X14B 4QRUB 2NQDA 5A43C 3JWDH 1BQHB 3I02A 2NCMA 3K81A 2HUEA 3FQWA 2WN2A 2XTJE 1FRGL 2BVQB 2P5WA 3GXMA 2FB4H 3C9NA 3QO1A 1CPUA 1ZS2A 4KK8D 4NB7A 5T5NF 3V55A 2DB8A 1KCKA 4XZUA 4JRYD 5AOIA 5F1IA 5C0GB 3LZLA 4I1RA 1IFRA 3HRZB 5ICYA 1JXFA 4J3TA 1CLCA 1XF2A 3R8BB 4QHKJ 1MSPA 2A73B 4U4IA 4XB7A 2JJTC 1USQA 4NQDE 4ADJA 5E1AA 3MBWA 4CN4A 1LEGA 2YFOA 4HS8L 2H1LM 1NBQA 4ZW5A 3ZGIA 4D3CL 3QYMA 4D8PB 3U6XA 3S2AA 2A6KB 1MAMH 1ZHKB 3H55A 1VERA 2QQQA 4EUPH 3ZKMD 2XT1B 1TJHH 4Y19D 2C3HA 2RCSH 2WWOA 4XH2B 5AB2A 3KGRA 3S36X 4K3JH 3VFTA 1T2JA 2I07B 2P3YA 43CAB 3LSOB 4UT6H 1F56A 2YPVH 2NY7L 5E8EA 3VRJA 2GQHA 1L6PA 3SE8L 1N2RB 4JANB 2HTLC 4OSUH 4Z95L 5IFAH 4JK0D 1G7JA 2Y5TB 4WRLA 1JJUA 4H0IA 1T0NA 3K6SB 5HY9A 3AC0A 5EUOF 1A65A 4N0FA 1CLOL 2YRZA 5CP3H 2EEXA 4PWKA 3QCTL 4HJTA 3NAAL 3GSVB 3UEZA 3MNWA 1QLFB 3MLWH 3PWPB 3CZEA 5FA4B 1T0MB 1MRCH 1A6UL 1ZTMA 5IK3A 3VQ1C 2DM3A 2OCJA 1F00I 1LLAA 3C2AL 3QDGB 5INCA 1SZNA 4A04A 4GXFA 2X10A 4QF1A 3V5HB 5CSZA 4UNTA 2WKGA 5B3JE 3NG5A 2IAND 5IROD 3GRWH 3O8XD 3WNLA 1TQCB 5L2KB 2O26U 2PXYC 3LHPL 2BRRH 1UEMA 4G8IA 3FFCE 3TBWB 3HR6A 4HIEA 2IPUK 2XOTA 1KYOK 3IVKA 3E6FB 3GRBA 4XO9A 4PGEA 3LKQB 2F5BH 1OSEA 4IOIB 3E0GA 4Y4HC 3TBVA 4GLRH 3V4VA 3CBRA 3OAYH 5L88H 2IGTA 3BE1H 1F4WL 2E0PA 5KSVA 3L5JA 2F0CA 5EF0A 4OVVA 2BXZA 3MRCA 1G7HB 4GSDL 1NC4A 2EE2A 2OFQA 2VRKA 2YXMA 3D2TA 1S7UB 3BDXA 5F88A 5LQBH 4DGYL 4L4VE 2XWJA 1D5IL 3QUYA 4LSUL 3QG6A 4KPHH 3HC2A 2PO6B 2O1AA 2BOBB 2OXGB 1FVEA 3HIZA 3RWIA 4IIZA 3F7QA 3VRIA 2CDEB 3BH9A 4J4PA 1E4XL 5DMYA 4JHWH 1HJCA 4ONOA 4P5TA 2PYFB 4PJ9C 3D08A 3LQAC 2OMUA 4G70B 3FTVA 5JR1L 3TO2B 4AOFA 3QQ3B 2X70A 5GS0D 2AK4E 3S5LG 1E4WH 2EICA 5H35A 4OD3L 2MQ3A 1JN6B 3GXTA 4IGBB 1ZD6A 3AG2B 2C4FT 4PEEA 5KBDA 3PY9A 1MPAL 5B4MD 2KDGA 5C08B 3IDUA 1WFTA 4FI8A 5EA0H 5ABDE 3NCCB 2GUYA 3UYRH 1UVQA 4LCWA 4AH2B 3STZA 4Y7OC 5KANG 4LCVA 1FA4A 1I8IB 2NUPA 3HA0A 5D1QB 3BD3A 2FHBA 2OMZB 1C12A 2P80D 3OJDB 4M8VA 4CC0A 4MA1B 4KK5D 2DIBA 1XGQB 3S48A 3FSZA 2DJMA 4R5VA 2WZ6A 3WLBA 4O2FB 4Q74A 5GS1B 5CHNA 5D7IE 3S7GA 1LJMA 1WBYB 4JJ5A 3TH2T 4BK4A 5JW4M 2XN1A 5H4ZA 5J56B 2KZWA 4W9CC 1JXJA 3K6DA 1VENA 5CILH 2NTSP 1ACXA 2KUTA 4J3VA 5F7YC 2ATAA 5D6DC 4GRWF 4WK0B 2TRYA 3R19A 2JJSC 1WISA 1AANA 1U8CB 4JPKL 5DC9B 3S96B 2FSEA 1WT5C 2C9SA 5KN5B 1ZGLP 1KBGH 1K5WA 2QHRH 1YMMB 5DJ8A 1A1OB 4PS8A 4EIZC 5FPIA 3FCTA 3X1BA 3FB5B 4TQEH 3U46A 5D9SB 4N0RA 3BPCB 3R4DA 5D7JC 1RULH 4AYSA 3EGSA 2DTML 3L3GA 4BFJA 3ZE1F 1RZPA 1INQA 3F7YB 3HI1A 2O5YL 4I4WB 4IDJH 3W11C 3KPLA 3SDXB 4HOZA 1MCOL 2YQ2A 4LLVA 4NUMA 1X5ZA 1S7XB 3KPQA 1MG2C 2BINA 5TDOA 3T0DA 1OV8A 1F45A 1Z0MA 4KVNH 5DMKA 4DN3L 4DP7X 3ZHNA 2C3VA 4D0CA 5F72S 2D31B 3BISA 4YDNA 4L5FH 1NDTA 3EYUL 3G6JE 5HYSG 3CCHA 1OAQH 3CDCA 4OLVL 5ECJE 1SLXA 2XC8A 1BVKB 3SO5A 3S8FB 4ZI8A 3UROR 2HPOA 1DN0A 1J18A 3ARTA 4E0RA 3VXSB 2IV8A 1I1RA 5E4EB 1RIUL 4I2XA 3T2NH 2VWEC 1HT6A 1XIWC 3Q9QA 5EIVA 1T89C 4F2MB 1AD0A 2QPFA 3VG9C 3O9WB 1MRDH 3H7BB 4AEIL 5LKNA 2Q86A 3X3FH 1F3DH 1JMXA 3PGFL 3N85L 4OJFL 4LP8A 5I17A 1OF2B 1FFOA 1WZLA 3GDCA 1BXAA 5F9AC 1TTUA 5GS0L 4M1DL 5JPNB 3EHBB 3DX2A 3QJHA 4H20H 1Q0YH 4NJAH 5DHDA 3ULUC 4URKA 5FUOH 1VJSA 4G6FB 4YHYB 3U1SL 4YLCA 2X42A 5KBKA 1X5FA 3QDMA 4MLIA 2IIJA 1BSIA 4NQSB 2VL4A 3ARFB 3FH7A 4GBXC 3Q3GB 4YMPA 2RD0A 4DO4A 4HC1H 4AM0B 4PLJD 1XBDA 4MYPA 4WTWA 2D0GA 4RGNB 3P0YH 2WKLA 2O5ZL 3BAKA 2R29H 3D6GA 2V9RA 4RWYH 5EORL 3BCDA 5JHLA 5EF2A 3DSNB 1Z9NA 4O58L 1ADQH 1E2VA 1IC5H 5DD5H 2EDHA 5JIIA 3HS9A 2BFVH 2VL5B 4GO6B 4G80B 4L05A 2Z93B 2DM2A 4WWKD 3LH2L 4XE0A 3BPOC 4HT1H 2KZ1B 1EO8L 4DPBX 4WUUD 3GSRB 4OLEA 2IH9A 4XWGL 4F58L 1P7KB 4LEBA 5ENWB 4DP8X 5IM7A 2P5EA 1ZK9A 4ACPA 2BY0A 3GSQA 1Y6NR 5CJOH 3DUUB 1S9YA 4HJ0C 1UT1A 3RL1B 1G94A 3CAFA 2EUXA 3RHWF 1JGVL 5I2IB 3O4LD 3OHXA 4QRRE 1OTUD 5I75C 1IKNC 4TNVF 5F9JB 2I9TB 4RESB 1RU9L 2OJ1A 5FW8A 4MDJB 4D9RE 4B50A 5I8KH 2VQUA 4Y1AD 4J1UB 4AE1A 4LIQL 3SKNA 3HB3B 4HLZG 4GP8B 4P59H 5FK9B 3LN4B 2MEJB 3GBLA 3KLDA 3WEBA 4HK3J 3MUZ1 1C5CH 4HK3N 3FTXA 4X9YA 1G9NL 3V4PA 4PRPE 3OC5A 4LPXA 2CKBB 1J8SA 2IEPA 3IDGA 3X12B 2ZUSA 5AW0B 4KH2A 4L3CA 1TR7A 2VUOA 4IRJB 4NO3B 4U1SA 3BGAA 1FZMA 1UFUA 4W9JC 4XX1G 1YAIA 2OYMA 5IBLC 1S4IA 3NTCH 2E7BA 3VVVA 1S7RA 2BVPA 3KWWA 4X5WA 5T33H 2YGPA 3F58L 2OYKA 1FL3B 4X6FB 4UV7H 5GZNA 4U33A 4KDTC 3L3OA 4P07A 1XXDC 1HHKB 2B8OT 3WKML 5IEKA 5EU4B 5KYWB 2CH8A 3EOTH 3NFNA 4D7PA 2WYTA 2HRPL 3ZKND 1TJGH 1IFHL 4UTAH 2NDGA 3T9WA 5EBGA 4QYOA 3K5SA 3SKMA 4UIMB 1F1DA 1H15A 4WDIB 2E59A 4RMBA 4F8NA 4MD0B 3L1EA 4H1LB 4G8AC 3B3BA 4B9CA 4ZUTB 2R1WA 2BC4A 1JTOA 1G1OA 4E5XG 2Y07H 1HXYA 4MNQA 1H3TA 3A6CH 5HPMB 2X6AA 5F6IC 1BM3L 3HCVB 1ZJBA 5TE7H 3C09C 5GRJL 4GS7C 5I1CL 4IK6A 1TCRA 4JJOA 4K94C 1TFHA 1A7OL 2Y1AA 3MVSA 1X5GA 4BCZA 3UABA 5EZLB 3QCVH 1UC6A 2WVVB 5C70A 4WO4D 2J8UB 2XQBL 2VLRD 1AI1L 3N44B 1WZKA 3P73A 3FMGH 3I02B 1DJYA 5JIDA 4X7SL 4B7LA 3CUPA 3FSWA 2J21A 3SGJC 5EEZA 4TTDD 3TU6A 1AQKH 3B34A 5KBNC 2P5WB 2ICEC 3C9NB 3QO1B 2DI7A 4KZCA 3L95B 4MHHG 4IQHA 1BOGA 4K5NA 2DQDL 5E2VL 3T6WA 4P2OD 1XL6A 3LKSA 3CDZA 5ICYB 1G7MA 1RMFH 1JIBA 2OMTA 2VJ8A 3MPCA 1JD9A 5B3SB 1CFTB 3EYFA 1U8QA 4KO6A 3Q1EA 3ULVF 1AGEB 3CU7A 5E1AB 3MBWB 3RL2A 1LEGB 2D7MA 2NY6B 3GXUB 3FF7A 3DDFA 2WKOA 5DEFA 4KRNA 4R7VA 4LHUG 3O2DA 4F93B 1BIHA 1SEBA 2OXHA 1AHKA 3HE6A 4B27A 4EN3A 2OTPA 1AS6A 3VWJD 1OCWL 1TPXC 4MZRA 2VABA 1ZHLA 4XP6L 1WFMA 3VFTB 4FQ2L 3BAIA 2CIKA 1NGXA 4UQ2A 3WJJC 2EDQA 4ABVA 3JWOL 5BJTA 3V0WL 3NIFF 1HHHA 5E8EB 3VRJB 3CFQA 1OAUH 1IAMA 2J12B 3BPNB 4O51A 5I0ZA 2IWGA 1HZHL 5I6LA 5EEVA 1ZJAA 3X1GA 5KZCB 5JIHA 2WINB 2PYED 3MHZA 4S1RL 2EDKA 4LU5H 3MOBH 3RQ3A 4N0FB 1I3VA 3SDDC 1NFIA 4DEUA 4WSGA 4IMLB 1GSMA 1ZT1A 4NQTA 4R3SA 4PYHA 4JJHA 1SRDA 1A7NH 1QTSA 1P7QD 4LGRB 4RGMB 2BS71 2H9GA 4N5EC 4P2CG 4FZEL 1VCBC 1UOWA 2H0JA 2VXQA 2ATKB 3N44F 1M71A 5INCB 1ONQA 4WHDA 2V0AA 1TVHA 5CSZB 1OWWA 4N22A 2P5PA 3V5DA 4KKQA 4X8CA 4F1ZA 1T83A 3G5VA 5F0LB 4KVCL 4LCCC 3D69A 1MFCH 4G8IB 4ORZC 1D5ZA 3BQUD 4MDRA 3K3QA 3GEFA 3MLYL 4HIEB 4IU2A 3IVKB 1J1XH 3QWRA 4UT9H 2W38A 4R26L 4BFOA 1YEIL 4PB0H 2LU4A 5IOKA 1NOLA 1KGCD 2YD9A 3IDMA 3NA9L 1BZQK 4HWBL 5FOJA 3TBVB 4DPRA 1UUNA 2VLLA 5H4YA 5KSVB 2MPVA 4J8QA 3VWKD 3F85A 1E6JH 4A37A 2VDRL 2CKBH 4IOFC 4LPTA 1NM9A 2J56A 3ZK0A 2XWJB 5I16A 4JFHE 3QUYB 3QEQB 1A9VA 4N2DA 5CN1A 4ABQA 4Z7QF 1IE4A 1AACA 1CFMA 4DKEL 2ZSWA 1FVEB 4WTQA 3RWIB 1CFBA 1RK0B 4JMNA 3GQFA 4KX7A 4GKLA 5EF3A 3EYQC 4YX2L 3OKDA 1MJUL 4DPAX 4XNMA 2V7NA 1TTBA 4P5TB 4LSVL 3WNJA 1SOKA 1Q0EA 4FYRA 4PJ5E 1JAEA 2QFRA 4N1CA 1T1YA 3HJ0A 3GI8H 1OT4A 1ZXKA 4X9GA 1U91A 2X70B 4CKVX 2QPDB 3WV0A 2HVKA 5TFSL 4X6CA 4H1LH 4RFNB 1W0WA 1YUKB 5H35B 5KANI 3BD5A 1K72A 2IWKA 1HHJA 3IB4A 5E99L 1XR8B 1JNNH 4YXHL 2DWEA 3GZPA 5AKVA 4KY1H 4JPVH 4FEMA 3K2MC 1TYEB 4J3OF 4LASH 2BERA 4W70A 1IM3D 1MF2L 1KFGA 2EDTA 2MTAA 2QHLA 1UVQB 4IRSA 3LZRA 1HE7A 3GBNL 3OAZH 4PGBA 2AGJL 3RWDA 1J5IA 2NUPB 4TTGA 4JO2H 1Q9WA 1X9LA 4XPTL 4GQ9H 2K0RA 1SHSA 4GQZA 4JW3A 4B9FA 4UCFA 1LO4L 4QT5A 2HH0L 1UQSA 2C3GA 4JJ5B 1ORSA 1N4XH 4FFWC 3EH2A 5JW4R 1MHHA 3VXUB 1QO3A 3ABZA 4ZODA 2ADGA 3DBXA 3QWQB 3VH8B 5JHDB 2GFBB 1IU1A 2WP3T 3BW9B 4KO9A 1J9RA 2DM4A 5CLTA 2ZAGA 1J1OH 5CFHA 2R83A 3G5ZB 3O6FD 4DZBA 4L4VA 5DJ8B 3NT0A 5B38B 5D7LD 1VAHA 2BY3A 3R18A 4H88L 3FCTB 3AS1A 1PEZA 5T1LD 1G7QB 3LXCA 3N42F 2PABA 1KY7A 3EGSB 3L3GB 3S8GB 4JFOB 4A1RA 2MIZA 2FJFA 3HI1B 4OIAA 4X5LA 1ID5I 4OF5A 4HF5L 3WI9A 1LEIA 3LMJL 1PY9A 5BO1H 5DHXB 1YEHL 2IDSA 2AXHA 2HJLA 4J39A 1S5IH 1AJ7L 1XMWA 1BXVA 3INOA 1SQMA 4Q0XH 3GSUB 3O2WL 2FL5A 2HT3C 4YAQB 3EZ8A 3FU0A 5TDOB 1X6LA 1WO2A 3ETTA 3KLLA 5G2NA 2QVIA 3DVIA 4MJJA 5DRWB 3BC9A 3APMA 4D0CB 1OTSC 2VO5A 4KQ4L 4UYPA 3NJGA 3PWLA 4TYUA 3BVTA 3CCHB 3N0AA 3HC4H 5KYUA 3EXLA 1O5PA 3DUSA 4A63A 4AQAB 1LO5B 4W9EC 1RFDL 3FHAA 2E74C 5FYJD 5TDPB 1N19A 1DN0B 3KYMA 1VGEL 4BIKA 4PRDA 3SDCD 2VJ0A 4PLNC 4E0RB 4JB9L 4I2XB 2BNRE 1IBHA 1P53A 3EOAA 5TQ0L 4N8PA 1OAYL 1AD0B 2WGNB 3L16A 4YBLC 3WAJA 2V17L 2WW8A 4X9BA 2J1KA 5TQ2H 3SSGA 4B6ZA 4X7FC 2Q86B 4UV4L 4DGWC 5D7IA 4PJCB 3T2OA 5F7HA 1PZ2A 3EYSL 3HZ3A 3BN9C 1G6RL 4ZAKA 5T3ZE 2DMCA 2L3BA 4PJIE 2WLHA 1VADA 3IKKA 1Z32X 1GXEA 3O3AA 3QR1A 1QR1B 1AOZA 4XPAH 1AXTH 4U3CA 5A6IA 1DJGA 5I9QB 3NIGB 2BFGA 3FHQA 4U05A 4XOAA 4OFQA 2I25N 1F90H 3QDMB 2A0LC 4QHNB 4JY4A 3DX7B 1A7QH 2A1WL 5B7EA 4KV5E 1RKRA 4QRPD 3FT3A 1CG9A 3DVGA 2NYYC 4UM8A 2AQSA 3IDJA 2HTKC 5ISZE 1E5CA 5I8OL 1X7TA 4XBPA 2NY0D 2VN4A 1GRWA 2N1KA 4WJG3 3PAZA 5ANMA 1FAIL 4HKJA 3TV3H 4ZS7L 1QLEB 5AVYB 5LB1A 4XTRD 2LVEA 1DBAH 3HNSL 1KC5L 4M7ZC 3QUZB 5C0IA 3MKKA 2BHYA 4Q14A 4AV5A 1HWGB 1GYWA 3MLVL 4JN2B 2P5EB 4JFFE 4YE0A 4HZLA 3GSQB 4HV8A 5CJXC 1S9YB 2DWXA 1O0VA 4FLHA 5FYKD 3V52L 5HI5C 1XAUA 3OHXB 3GK8L 4JX0A 4UQDA 2PW2A 2BNQA 3EG9A 1OAZH 1ZGLA 4LEOA 2HG5B 5DZAA 3TTYA 2NNAA 4ZFGL 1KYUA 1PLGH 2PWDA 5AFAA 2WWKT 3E8UH 2DYPB 4Z6AT 4KK8C 3SKNB 5BNXD 3FUNA 5BRZA 3PGDA 3PWVB 2DL2A 2ODIA 3AITA 4M4RA 1MCDA 3ZSSA 4ZMLA 3M1OA 1MWAL 1J05A 2D2CC 1UYWH 4L3CB 4QRSA 4U1SB 1FZMB 4Z5RB 2VC2L 5HHMD 5KVEE 1RJYA 2BVPB 5J0BA 3IBOA 1FORL 2ZT9C 4PSPA 3BKJL 5KTEL 1KJ2A 1YPZB 4PRIA 1AZZC 4IK7A 4LDEB 3H6AA 4OZFA 1BJ1J 3L3OB 2AV1A 4OUUA 3ZKMC 4EZJA 5DRXA 3AT8A 1U93B 1VEOA 2FTAA 5M95B 1WEJH 5F7EL 4LCUA 2Y1YA 2BM3A 3T0ED 5CJ5A 1Y7VA 1CZ8L 3OF6D 1MIMH 1EFQA 4QYOB 3SKMB 3C5SA 5FYJL 3PQYA 4FABH 3IE9A 4K23H 5ITFA 2W88A 3QIUC 5J9PB 3BKCH 1LMIA 4KI5F 2BH0A 5IJKA 2R1WB 2BC4B 3LEYL 1BZ7A 5KVFH 2VXVL 4JRFA 2DH2A 1LTXA 3RJDA 3VCLB 1NTDA 5BZDB 3U7WH 2QQKH 2DQFA 2WD0A 4MNQB 5F6HJ 4P3WA 1H3GA 3QI9D 4XMXA 3OX8A 4Q6KA 1QSEE 4F3FA 5DUBA 5I18H 3CSBA 3RGVD 1TCRB 3BJ91 5HYQB 3EJRA 1U8PA 3IT8D 1V8HA 2C3WA 2YAQA 3TO4D 3ZDZE 5EH1A 3B2VL 2CSPA 3NRFA 5BVPH 3BWSA 7PCYA 2GAZA 3CSFA 3P73B 3CUPB 1J0YA 4CDHA 2RHEA 1TZAA 1F4XL 2DRUA 3ESVF 3MBED 4YN3A 5D1ZB 5IQ7L 5FAAA 4MA3A 2R7EA 5IROC 1BOGB 3O8XC 5C9JB 3JVGC 2EDXA 1RIVL 5IB3B 3HZYA 4JKPH 3CDZB 1W8EA 4PLKD 5HDBE 4JY6B 5F0PB 1WIUA 2OMTB 4LEXL 3ZE0E 1FNSL 3EYFB 1U8QB 1CE1L 4FZ8L 4KJQD 4N2LA 2N1TE 2WVSA 1JYNA 2HKFH 1CLYH 2YLKA 4GW5A 3GINA 3AXLB 2XN2A 5DEFB 5MI0C 1DQVA 5BZWB 2JJVA 4OVUA 1SEBB 4ZNEE 3RGBA 4XHQA 2OXHB 2WANA 4QEGA 4PBDA 5FYKL 4I3RL 3HE6B 3GKWH 2ED8A 4EN3B 4YHNA 1NIEA 2CNZA 5DYOA 4NI6A 1KYOJ 3CHQA 3B9AA 4X6BA 1UOKA 1A0QH 1WTGT 2FX7H 3FRUB 5A2AA 2GTZA 3PYCA 2CIKB 1NGXB 2G3XA 4QPEA 4UQ2B 1AO7E 2J4WH 5BJTB 5KSBA 1JGUL 2VUYA 1ZTXE 3FN9A 2RIKA 1TNNA 1WTLA 2IPKA 4YHZH 3ML8A 3NGBB 4O51B 5EDXA 3OQ3B 4PVBA 5TDNA 2JCCF 4NCC1 5FKAB 4Z18A 5FOBB 6PAZA 1HEZB 1KNOA 1TZHA 2DMKA 3FO0L 5JHLH 2R69A 4WTZG 3M7FB 5GS0C 4GSUA 1GSKA 2DM7A 3LCYA 1JNLL 4RSYA 2PMZA 4WI5A 1SDYA 4HDIA 1M6UA 1SFHA 1QLEH 1ZT1B 3TPKA 4BRJA 2CHWA 4R3SB 3DUHA 4FQJL 1MUJA 1YMHA 4Q56A 1BAGA 4LAQL 3TIEA 4JAMA 4GNKB 1P4BH 4PSRA 4HXAL 3QEUA 4PJXE 1I9JL 5HYFA 2NSQA 4HCRL 4ELKA 2VR4A 1M71B 2XTJB 3LDBC 1JXKA 4OFKA 1UT9A 3ARYA 4YVUA 1N8OE 3V5DB 4B5EA 5EBWA 3V6BR 1M7DB 3JWNE 5I19H 4KK5C 4WCYL 4XPFL 2WLLA 1NDMA 3VO0A 4KMTH 4RFOL 4WHCA 3K5RA 4FYSA 4NN7C 2RALA 2UZIL 3IDMB 1INEH 4KKRA 5L4FA 3U6RA 4M48H 1L4IA 4WY7L 4R97C 2VLLB 1XH3A 2VYRE 4R4FL 1ZA6B 2XXFA 1SLWA 2PWGA 4OFVA 1I75A 4RIRB 3D2UA 4N0CD 4BSWB 2WKOF 4LFHG 5I16B 4LVOB 5DVLA 3BDYH 3OPZH 5HGDB 2E7HA 4Z78B 4IBZA 3KBPA 4OD2B 4HJSA 4CW1A 3H0TA 3L3JA 4BZ2A 3UBFA 1PKOA 1KELH 4P3CH 2W65A 3OKDB 2V7NB 4NHCL 2Z7WA 4KZEH 3QXUA 4PJDE 3QG7H 4WVRA 2OPCA 2NZ1A 1CK0L 1F3DJ 3MNMA 2YBRA 1GY1A 1V7ML 5D70H 2WUCH 5BUGA 1GGTA 4NT6B 5GRWA 2G3MA 2HVKB 1Q0XH 5G5DA 4TL5A 2X2JA 2Y7OA 1W0WB 1SVBA 3GJFK 1O6VA 3NZSA 1UB6A 1HHJB 4NM8H 2JJUA 1DFXA 1H9DA 1M7IA 2QQLL 1OAXL 5MHSD 2LLNA 3GO1L 4XP5H 1T21B 4YK4C 5FB8A 1JPST 1A7BA 1OCRB 2FGWL 3NH7L 1CICA 5DUPL 5L0QC 3RWDB 1V5JA 2VLJA 3MBXL 4GIPD 1BBDH 3GHBL 4JQXC 4H8PA 1Q9WB 2GHWB 3O0RH 4C56A 1AC6A 3FFCB 4NO0A 4K7PH 4NN6C 4G72B 5E5LA 3PHOA 4O02L 3OKNB 4XP1L 1FPTH 4QT5B 4OM0H 1V3MA 1UQSB 5BMFH 2FX8H 1ORSB 3HI5H 3FC8A 2ZUQC 3QDJE 4Y2OB 4JFEE 3SZKC 1H6FA 2XZZA 3NJXA 1MZYA 3T6XA 3WXWH 4M93B 4QXTA 4GXVL 3LPWA 3DBXB 3GMLA 3L3DB 5T1KD 3WFCH 4WU7A 5HGAB 2FQEA 1XGYL 4XCNB 4LQ1A 5JQ6H 4MNHB 5LGJA 3KLQA 4DZBB 4L4VB 4PMEA 1EO7A 5JXEC 5SX4H 3MCLL 1MXGA 4NP4H 4PLJC 4G3YL 2V9UA 1A3LH 2NOYA 5IB1A 5DXWA 1JPGB 2NNCA 4ZO6A 2ZCKH 3QHZH 2FJFB 1JOIA 4KHTL 5DVPA 3KPMA 1LEIB 3REWB 2E8ZA 5EZOH 4WWKC 2RJMA 2D7QA 2AQNA 2EE9A 5T5FA 1JGEA 2ZCHL 1JD7A 3CFCH 5LBVA 2FL5B 3NRPA 1FDLL 2AK4B 2P9RA 1FYTD 1MEXH 4N28A 2DQCL 2JKNA 3KLKA 1F86A 1BWWA 4GQRA 5F71A 3A4EA 5B1JC 2CALA 1CBVH 4X6CF 2OMXA 4YS4A 3PWLB 1HINL 3N3EA 5KYUB 2H8PA 1P1ZB 3DUSB 2R23A 1E30A 4TS6A 4MD4B 3GS0A 4I0PA 3FB6B 4YE4H 2F5AH 4OZGE 4PRDB 3JWOC 2CCVA 3PAVA 4FFTA 2CRYA 4CMMA 1CU4H 4YDLB 3LPPA 1DJHA 3CLWA 3MLUH 1NMBL 2NY5C 2GJZA 3QZLA 5D7IB 1DSFL 2YGOA 5DA0B 5TTRA 1JHTA 4ZAKB 1B4JH 4QLRA 4XVTL 1G9MH 1VADB 1T03H 2ZG1A 1YEEL 2XVGA 4HPYH 2V5TA 3QAZC 4KKPA 2E56A 1JUFA 4OIIH 3W39B 1QRNE 4H8UA 1XT5A 2BS8A 2QSVA 3E8VA 2XG5A 2VDOL 3IJYB 4JY4B 4UQCA 5I0VA 4N87A 1WWWX 4KI1A 3FT3B 3ZKNC 4PLOB 3RU8H 4UM8B 1T04A 2VLKE 3EJZC 4RISH 1EPFA 4XBPB 5I28A 3CVHL 4YWGH 3BWAB 5E1GA 1QWNA 1ITBB 2K7QA 3LH9A 3FQXA 5IMLA 4L9LA 5D93C 4HKJB 2ODHA 1MCIA 4FG2A 1JTTA 1U6AH 2H7WA 5FM4A 4ZXBD 4ZMOA 2FSDA 5C0IB 3X13A 2ARWA 3RAJL 2F15A 1V3KA 4X7DC 1KYAA 3UTZB 3G04A 4HZLB 4HV8B 1V3JA 4BGLA 4S1DD 5EG6C 4BYHA 1RZJL 4WO4C 2IPUG 2XYBA 4GQQA 3IFOB 2PW2B 4PIRF 3I9IA 3P3UA 5DK2A 5DU7A 5A2LH 1ZGLB 2EDFA 4LEOB 3G6JB 2M2DA 3FTSA 2NNAB 1JHKH 3TZVA 5LUMA 1BF5A 4RFEB 4AI7A 3DECA 2E9WA 4TTDC 5DD0L 2BS9A 3Q5OA 3AT0A 4M5ZL 4F8QA 2DWSA 3AWEA 4IMKA 1BQHG 2BNRA 4B7IA 2PPAA 4P2OC 3K2IA 4M4RB 4XN1A 1D5RA 3CX5J 1J8KA 3C8KB 3AZUA 3QPKA 4KAQL 2OULB 1BECA 3MSPA 4QRSB 1BX2A 1N5YH 1PG7L 2Y4SA 1RJYB 4ENED 3ZZQA 2SODB 3KPSD 3D9AH 1KJ2B 3CD4A 4L8SA 3AWFA 3MUHL 3KPPB 3DC0A 4PRIB 1QSZA 2CUHA 3SE3C 3WIHA 1JI1A 3P77B 2NY4B 2QQNL 4OZFB 2ESVD 2AV1B 4OUUB 3VGAC 3VWJC 5DRXB 4TQIA 2WLKA 1EAOA 4LCUB 5E5MB 1UWEH 1R5IA 3DXAD 3S97C 4DO5A 3BDBA 3C5SB 3CZGA 5ISZA 4O9HH 1OCCB 3EO9L 3MMEB 3HZVB 3HS0C 5AVXB 2ZCLL 5ITFB 3OQRA 5JHAA 1F2XK 4J27A 4IM8A 4XN2A 1L0PA 3H2PA 4JM2D 3P4OA 4F5CE 2IBGA 3ZL4L 4YUEL 4TMPA 1UJ3A 4WLCA 1U2CA 2DQFB 4P04A 1G84A 2PR4L 5DJXA 3OX8B 3S35H 4EN2A 3LZPA 3ARXA 2ADJA 4GRMA 3F5WA 3UDWA 2WQVA 2DQIH 1U8PB 3S2CA 4PUBH 4G8FA 1MCSA 3L4YA 2A83A 2H2SD 1W72A 3LRMA 4LHUD 5C0BD 2G2PA 3PXLA 4QRRB 2GAZB 3G5YA 4W9FC 3UX9B 5JW4N 2MCAA 3E38A 3FUKA 1YCSA 2WLMA 2YQGA 4OJEH 1TTCA 8FABA 3HZMA 1JMZA 4CSZA 5IT2H 3X17A 2DKUA 2R7EB 4KDVA 1RZKC 5CCKH 1HQRB 4JM0A 5HJGA 1ROWA 3HZYB 5EU6E 1BFVH 5AB0A 3BQUC 3QA3A 2OM5A 4PRPB 1WBXA 2VDPL 4PJBE 3UJJL 1IQWH 3VRLF 3BAYA 1M2OA 4PWGA 1GW6A 4Y2DD 1IEAA 2YA2A 3QS2A 3VWKC 1ODUA 3SE9L 5J5EA 4FLSA 1OWRM 3GSNB 1IZJA 2A9ML 4ZFZA 2R1XA 5IJVA 2FGZA 4YHNB 4LDCA 2AJYH 3P4NB 5DQDH 1MDAA 2PN5A 5DYOB 5DZPA 4ZT1A 5IKCA 3P4LA 4X6BB 1PF3A 2X9YA 3FAWA 3ZIYA 4OI7A 1D9KA 3VFGH 1UXSA 2GTZB 1YY9D 5FYLD 1ORQA 2E7DA 2ZOOA 4DETA 1T1ZA 2L7UA 4OF7A 2G30A 2VZOA 4LMQE 1MHPL 2OL3A 4ONFL 4ZD3L 2IPKB 1T4KA 3S37H 1JK9A 2WJ5A 3EOBB 2CJUL 1NICA 4UF7C 4KFMA 1ZV5A 2VM3A 3ESMA 5TDNB 1TVBA 4CGUB 2QLYA 4P57A 2G9HA 1TZHB 1KNOB 1XZ0A 4FNLH 5IG7B 3UMTA 4HWEL 1QSEA 2WBJD 4L1BA 4K7FA 2BW5A 4QOKE 1GHFL 1WE5A 2ZKWA 2Y72A 4HDIB 4JG0L 2XA3A 3MJ8A 4X99A 1P5UA 1TLKA 3EDJA 1NCIA 1MRFH 2A77L 2F54A 1X5XA 3SPIA 3ZDYE 1JBJA 1MUJB 4M7KL 2HX9A 3IU3A 1DLFL 3TIEB 1HKLL 4NUGL 4U1NA 3RIKA 2R51A 3QEUB 3QIBD 4ERSL 2DQ6A 2QTVA 4ZMWA 4Q6IA 4ELKB 4OLXH 1NFDA 2F53E 3LOWA 1EGJA 5F8RC 3V6ZA 2X3AA 2D3LA 4YR6A 3BUTA 4XO4A 1YYLH 3RA7H 4XAWL 5D96C 2PTVA 5K93A 1NDMB 3VFUA 4B60A 2AAAA 4H2AA 3E6HB 3WUWA 2VH5H 1ES0A 2VMCA 2D8KA 4HEMA 1JZJA 1PAZA 2XYCA 1N7ML 1WA1X 2FQFA 3ARPA 3LB6D 3QYCA 2XTSA 1IKOP 4ZNEA 3D2UB 3QRGH 3QQNA 3C6EA 2VXTL 1NAML 5LLIC 5DJZB 3O6FC 5GISH 2AXGA 3C5JB 3O41A 5MEPA 1R33A 1UWGL 3ZZLA 3OZ9L 4NM4L 1E2WA 4PHZA 1QACA 1X4XA 2RR3A 3K7UA 3LZOA 5KJRH 3FQ4A 1EX0A 2DLGA 3OJVC 4CW1B 3H0TB 1KJ2H 1E67A 3POHA 2JIXA 1WYJA 4ANKA 4DQOH 1AO7A 4AYGA 4OZFH 1NGWB 3N1GC 1LQBC 4W4OA 3MA9H 5ALCL 3EO0A 1JZ6A 3R06B 2IBZX 5KSBF 1SXCA 2ICCA 3ROOA 4G7SB 1UZ8A 2YBRB 5JUEL 3SPJA 3V0VA 3RNKB 4XC1L 1E5ZA 2X1QA 4K5LA 1WFJA 4A7GA 5G5DB 2UYLA 4KI5D 1M3JA 3UBHA 4OD1L 1MHCA 4OLYH 2W9DH 1XB3A 5AQ0A 1F1AA 1M7IB 2VZTA 2X4TA 4TLTA 4WSJA 4Z7NF 2NR6D 3BP5A 3N43F 3P1VA 1MH5B 3QARA 3NSCA 3ZYZA 3ZQ9A 4ZPTA 1IVTA 3QQ4A 2PKDA 5CLWA 5GGVY 3BJLA 3C6LD 3VXRD 5FYLL 2CAKA 2B5IC 1MDTA 4KGJA 5SWZA 3T6VA 3WSQL 2R0LH 4WFED 2YAPA 4OCSH 4UINL 2JJTA 4GIOA 4L29A 1SN5A 4NO0B 3RWGA 4KXBA 3PHOB 3I3BA 3QEGH 3ZY7A 3PIQA 2DEWX 4CJ0A 4BELD 5J11B 1SOSA 1GGCH 3I6SA 3BRDA 4H26A 3VFPB 5DD3L 2G0LA 3ZZSA 4GAJL 1CURA 2BW4A 1ZWIA 4QXTB 1AAJA 2AJUH 2G9KA 2NY1B 4LCIL 3SYAA 1N59A 4G9FE 2QVFB 4W68A 2X4QA 3V0EA 4WEMB 2JKSA 5I5MA 1ZIBA 5LCVA 3O45B 2J6WA 2V5RA 5K9KA 5EWIH 5LGJB 3HEIB 1EUUA 4G7YL 3L45A 3IPFA 5MERB 5MP6L 2QZ5A 5CKGA 4Z7AA 2OW7A 2ZUUA 3FN0L 2NY0C 5IB1B 3GSNH 1YQVH 1UH3A 4JM4H 5INDA 3US1A 4QJ5B 2ZUTA 3KPMB 2NXYD 3B2DC 2WPGA 3EJJX 4OM1L 1DQDL 4GAYB 4PJ5B 4XTRC 5JDSA 4M9OA 3K8KA 3S36H 2GBVA 4HLJA 4HSAC 5IIEA 1JGEB 3H56A 5HVFB 3OXSA 5TK4A 5CLYA 4ZUWA 2UWEE 5F1SA 3A22A 3WBDA 6TAAA 2WMPB 2A9NH 3UC2A 3HG1A 3A5VA 4FHJA 1A6PA 1BQ5A 3MRNA 2DLFL 1E0OB 1JGDB 5BS0D 4ODSH 3BZDA 1RZ7H 2VW7A 3KPTA 3BUIA 5DI8B 3TFKD 1BAFH 1Z5YD 3HFML 4JZNA 4ZSOE 5F6HI 5GGVH 2OQJB 4E9SA 5BV7B 2H8PB 1UG9A 2R69H 3VI3F 2OP4H 2R23B 1XCXA 2L0DA 4HFUH 1I8MA 1TQSA 4A2GA 4PJEF 4GLRI 2PXYA 4I0PB 4MCNA 2VKWA 3SBRA 4EBQL 4DTGL 2ADYA 4I18B 3PV6A 5GXBB 2J1WA 2DYRB 4YSUA 5DQJB 2FEEL 2YD0A 2V3DA 3UEQA 2GBTA 4Y4HA 4CSPA 4JE4B 1T2XA 4OQTA 2GJZB 5GGSY 4CBPA 5F0MB 1ZLUH 5CZXD 1NOFA 1JHTB 5HYEA 1A6WL 3I85A 3GZOA 3WJMA 1U36A 2GJJA 1S7VA 4XWOC 3P4MB 3NACH 4M7LT 2GSGA 3QDHA 3WGUB 3T4YA 1JUFB 1TO4A 1IC4L 1XGPA 2W07A 2VERN 1R4XA 4MJHA 3OBAA 1NQBA 5BCAA 4PD4J 2LTQC 4XODA 1RCYA 4OY9A 4RAUA 2R0ZL 3T0EC 1T04B 3OMZA 2F19L 2XPZA 4L1SA 5AW7B 1KV7A 1WAAA 4JDTH 1HU8A 4I9WD 5IMLB 4L9LB 2Z65C 4P9MH 4F20A 3BKMH 1I9EA 4ODXA 2ZONA 4NSKA 5D5MA 5TF1H 1DFBL 4Y88A 3X13B 5EZIH 2BDNL 4BZ2H 4H1LG 3ARED 3DVNA 2WUBH 3G04B 1MFEH 3RGVC 3E80A 25C8H 2P52A 4HWNA 4CVXA 5HYJE 1UACL 1NGPH 3LY6A 1BP3B 4PR5B 3WXVL 3KWXA 3LD8B 2C9VA 5GJTL 1BIIA 3TO4C 4YSAA 1JV2B 2Z9TA 1URLA 2AMGA 4NQCA 4ENZA 3T0WA 5E08L 2XV0A 3ASWA 4BWTA 2AANA 3TZVB 2XJLA 3KYOA 2WJ7A 2XACC 3V9FA 4GSQA 3TT1H 5BQ7B 4OZGA 2I60L 3VYNA 1KEML 4PJ7E 2WOBA 3HC0A 5KSAD 2BNRB 2EC8A 1EFXD 4PLKC 3MOAL 2WBWB 5AW6B 4ZW6A 3DX0A 1NLBL 1S8DB 2K4AA 3HRPA 4EF3A 8PAZA 3HN3A 2C3XA 1EA9C 4YPJA 5E2TL 3AQYA 4KJQC 4NAQA 4OZIA 4DEWA 1OSZB 5HHVH 4X6EA 1BX2B 3NEEA 4MD5B 5D6DA 3SYOA 1BGXH 3BAWA 4W9LC 4PJIB 1WA2X 2JJSA 1EHKB 1WC7B 4L8SB 4PN6A 2VN7A 2FQDA 2JELL 4OZHE 5PCYA 1QRNA 4BUGA 3PPSA 2GIYA 3PREA 2V9QA 3GSWA 5F3HB 3DJTA 1JZ8A 1GH7A 3T8XB 5D7JA 3UTQA 3HPJA 1TZGH 1R5IB 3NJHA 4NQEE 4CN1A 3LS5L 3NCYP 1HXMB 5ERWA 1HVXA 2VLKA 5ISZB 3AQXA 4FDWA 3UTTA 1DQTA 5HHOD 4NWTH 1CXHA 4Z7UF 1QG3A 2VIRB 3BGFC 4RMQA 5AALA 3RFRA 3AT9A 3P4OB 1J8HE 4QRTA 1HI6A 4TVUA 1ETJA 2ZD0A 5C2BH 3PL6D 1UJ3B 4JBSA 3UERA 2BY2A 4MAUL 1Q72L 1GAFH 2VDNB 1DCEA 5DJXB 4JQIL 4TVSa 2AFNA 4GRMB 2MCMA 4JREB 3OC8A 4Q9RL 4JFFB 4HUXA 4X83A 3AU1B 1P2CA 2FLBT 3IJHA 3NVQA 3P30H 3K1DA 1NIDA 3M8OL 1KYFA 4F91B 4PI0A 3Q5YA 4OR1A 1I7TB 4HFWA 3VSQA 3QW9A 3ZDXE 2R1YA 3UBGA 1XIWA 1LMKA 2JKRM 2OTWA 1T89A 3RRQA 8FABB 5H2BA 4MYWB 4TOYH 2HFGH 3NK3A 5D7SH 3Q44A 4E9TA 4NZDA 5CBEA 1HEHC 5BV7H 4CSTA 3MRMB 2ED7A 5DHYA 1TQBC 3QA3B 3DOSA 1WBXB 3V95A 1VGKA 1SPDA 3MGTA 2E9GA 2GJ6D 3QJOA 4KJPD 5EC1B 2FCBA 4CNIB 4LCYA 3UFIA 1D6VL 4B3VA 3VDCA 1H6EA 1JPSH 1HL9A 3GB7A 4Z7OB 1IT9H 1MW0A 1F1GA 2UVFA 1IEAB 1UHVA 3KYAA 3D0LA 5FC9A 1T66D 4Y19E 2Y3NA 1CDJA 5D2NC 4N0CC 3OAUL 3I3EA 1OQOA 4ZFZB 3EOYG 1CGWA 4K9EC 4AQEA 4A7VA 2N0KA 5IKCB 3CFDB 5AOKA 2N7AA 1E7UA 1AFVH 1D9KB 3IMBA 1ORQB 3BUYA 2YMXH 4N2IA 2XSKA 1YN7B 4JRLA 5DRZA 2HKHH 2MOGA 5DD1H 4AVIA 2OL3B 3IMSA 4LP4A 1T4KB 4F5CA 2H2PD 3NZHL 5EC2A 2R4SL 1TVBB 3H1ZA 3JVFC 4P57B 2G9HB 1T1XB 4Z7VF 1QSEB 4Y16D 1NA8A 4K7FB 3NJJA 4MQXD 4YDJA 4GEIA 4H5SA 2YWYA 3MJ8B 1P5UB 1DVYA 3H6JA 4X99B 3TCTA 3O2VH 2CE6A 2UZPA 2GI7A 3MRLA 2QL1A 4NN5C 1KYDA 3ZDZB 2VUKA 3P3TA 1JRHH 1MREL 3IU3B 2UVEA 3RY6C 4EXKA 3U2JA 4U1NB 4NFCA 1CXKA 4FXKB 2YKLL 3HG4A 4LFHD 2XWTB 3FQRB 4Q6IB 1ZE3H 2EO9A 1NFDB 4XPHH 2E6QA 3V6ZB 2XQYK 4XP9L 1AZBA 1QBML 2XWDA 3BAEL 4NFDA 1XGRA 1A64A 5EU6A 3VFUB 3ZE0B 1TEFA 5HDBB 4QGYA 3SZ6A 3TVMB 3DGGA 4ETYA 4HCIA 3FJTA 1ES0B 5I0YA 2YOAA 1DE4B 4M5TA 3DDGA 4AQ1A 2AVFA 1NCOA 3AROA 4OF3A 3S88H 3F3HA 1BWMA 5B21A 1CTMA 4FJ6A 4BFKA 2APXA 1EEYA 3AB0B 3QB7C 1RZJC 4Z7OF 3POCA 3WHXA 2AXGB 4BHUI 1OM9A 2EKSA 1H0DA 3GMRB 4HZAA 4RAVA 5T3ZH 2F1BA 4WEEA 3VH8G 5C0JA 1OSPL 1TSHA 2V3FA 3SYQA 1SY6L 3IXTB 5AL8A 5H94B 1SMOA 2AZUA 2Z8SA 3V6FB 3UC0H 1GCFA 2JIXB 1IKFL 3WIHH 3C60B 1AO7B 5AEAA 3SJVD 5B38G 1G4RA 2ZZUT 4MSWA 2AJVL 2J88H 3WIIH 4FJYA 4I88A 4MX7A 3EO0B 5JORA 1R3HB 4XXWA 1U4EA 1DZ0A 1ZCRA 3CFJA 4HMDA 1HILA 3ROOB 4EKXA 5AAWC 4L18A 1UZ8B 3ATFA 3V0VB 1NIBA 2EZ0D 1SEQH 5CEYA 4WWID 5L7XH 4QOKA 2UYLB 2D4FA 5HVGB 4FP8L 2XV6B 1MHCB 1C08A 3OG6B 1UD8A 3GIZL 2ZWSA 3C5XA 4NZFA 3WTSA 2X4TB 1XVSA 2VDNH 1FHNA 2AERT 3BP5B 1VPOL 2IMNA 3HI6L 3LNFA 2ICEA 4M7JH 4KROD 3G6DL 4ZW7A 4HX1A 1S78D 4PJXB 4ZPTB 3D09A 4K71B 1RJLA 4XPGL 5E4IA 2Y06H 4JN1L 2BHUA 1IGTB 5F89A 1ZHBB 3ILEA 1NFDF 4LSQH 1PCXA 2XIBA 2ZYHA 4GRLC 4LKCA 4L29B 4W9HC 2P49B 2KZKA 3CLEL 5I1HL 3ABLB 3JBG7 4MRCA 3F6JA 1F4YL 3T77B 4ALAL 1F58H 3Q2NA 4H26B 4U6YA 3LKRA 3MNDA 1JWSB 2N56A 5BW7C 3DROA 1CGTA 1WIPA 1ZWIB 3FT2A 2B4CC 1IIIA 4Y9GA 1N59B 4AMKL 3X3GH 3CDGB 4LSSH 2CDFA 5FM5O 2X4QB 4ODWB 4ZUUA 1CR9H 4ANUA 3VUAA 5K9KB 2LV4A 4HIPA 1N3NA 3MGOB 4KUZH 4K3EH 4KZ0A 2BOCA 4TULH 4G8EA 3FKUS 4J23A 1Z9OA 5KVEH 3WJJA 3QWNA 5DR5H 4N1EA 4APXA 2DQJL 1NDGA 1ZLWH 4KITB 1ZA3B 4KX8A 4PP1D 5KUKA 2D7TL 4ODHH 2YPLD 3VXQA 1F6AA 5BZXA 3GTTA 2WXMA 1AY1H 4XNUL 1PSKH 5JDSB 4M6ML 4PJDB 1ZANH 32C2A 3I6KA 1IC1A 3SDDA 1BFOA 4DN4L 3GTVA 2NXZB 4JFDD 1DSYA 4XN4A 4A2EA 4G8GE 4Z3EA 1NM4A 4PMFA 2OL3H 5CCGE 3RP1A 1ETZB 1KJMA 1R47A 2VM9A 3ASNB 3MRNB 3VA2C 4S1DC 4WHYH 3CFNA 3LS4H 1PS3A 1E6OH 2CDGB 2FT8A 5KSUB 3MV7E 3QJRB 4W9IC 1MFDH 3GIVA 2VW4A 3JWDL 3O3UN 3W5NA 2OR9L 3GFUA 3QIWA 2DL9A 3ETSA 3Q8BA 4FQIH 2QSTA 5E2WH 1T7WA 1TUPA 2FIKB 3PV6B 2ED6A 5L8KB 1FL5A 3UH8A 4F7MA 1DANT 3ZMNA 4AIZA 4Y4HB 2P42B 2A6DA 1QBBA 4P9HH 2BZ7A 2YHGA 4D2NA 4LLMA 4TV3A 1G7IB 3QUMA 3QDJB 4L8DB 3QC6X 5I24A 4JFEB