2BWDA

Atomic resolution structure of achromobacter cycloclastes cu nitrite reductase with endogenously bound nitrite and no
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
334
Chain Sequence
VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPASM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of Resting-State, Substrate- and Product-Complexed Cu-Nitrite Reductase Provide Insight Into Catalytic Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords COPPER-CONTAINING NITRITE REDUCTASE
total genus 90
structure length 334
sequence length 334
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bwdA02
1UATA 1OV8A 1PZBA 1TEFA 1OCCB 1ASOA 2MRYA 1XB8A 3EH3B 1PAZA 3T71A 2IDSA 4DP9X 4GYBA 1V10A 5I6LA 1RZQA 2FT6A 2UX6A 3HEIB 5I6NA 2VW7A 2HX8A 1TU2A 4G7QB 1ILSA 1R1CA 2BP8B 3TU6A 3NJIA 3PPSA 4A2HA 1V55B 1WA1X 3BVDB 1E5YA 5I6PA 2GBAA 2HRGA 1IBYA 1VLXA 4HIPA 3CVDA 1OCRB 2IWKA 2CUAA 1RKRA 5EHFA 3IE9A 5B1AB 1WS8A 3KW8A 2YARA 3S3CB 3FQYA 4UF7C 4KO9A 3MX0B 4A67A 1NIDA 3FQ1A 2HX7A 1SDDB 2FTAA 1PMYA 2UX7A 4L0PB 2YAEA 3NSYA 4BWUA 4DP6X 2R7EB 3SBQA 1ID2A 2YAOA 3FQ2A 4AX3A 4E9VA 4A2GA 3CDZB 4CSZA 3FSAA 2BWIA 1AAJA 2YQBA 3NT0A 3WG7B 5I6OA 2HLEB 2UXGA 3AG1B 1ETJA 1ZDQA 2UXFA 1E65A 4YSSA 4E9TA 1AS7A 1PY0A 3AG2B 1J5DA 3ERXA 1JZJA 2XXFA 5I28A 1F56A 2IH8A 2R7EA 9PCYA 1JXGA 1PCSA 2X88A 4MFHA 2DWTA 2IWEA 2FQDA 1KYAA 3G5WA 3WNIA 5AFAA 2W88A 3QJTB 4X4KA 2NRDA 2I85A 1OCZB 2Y1AA 1JXDA 1JZIA 1PZAA 3FS9A 4ZK8A 1KDIA 2PLTA 2I7OA 3X2QB 4YSUA 1NZRA 2IDQA 4W9ZA 2CCWA 2DV6A 1AG6A 1NICA 1YLBB 3RYMA 4YSQA 1EHKB 1IBZA 3WI9A 2E86A 4DP4X 2Q5BA 1FWXA 1JVOA 1AR1B 2GI0A 1KV7A 4FA7B 5IY5B 2N0MA 4G7RB 2BO0A 1N70A 2PPFA 1AS8A 3QJSB 2QPDB 3FSVA 1BXAA 5AZUA 1CUOA 4A2DA 4JKNA 1NPNA 4A2EA 3T6XA 1NDTA 2AZUA 2X87A 3TASA 3NJLA 1OE2A 5B3SB 1GY1A 2YAQA 3UAEA 2WSDA 3QJQB 1PLCA 3FSZA 1A65A 1A4AA 1NIBA 2VM3A 3T6WA 1HAUA 3X1NA 2IAAC 3PAVA 2OJ1A 1NWOA 2PPCA 2VW6A 2CJ3A 2XX0A 4RH4A 1PNCA 1AZNA 2HX9A 2AZAA 1IC0A 2P80D 2FQEA 2BW4A 4WTQA 1BYPA 3ASNB 1SFHA 3NJNA 3X1EA 2YAHA 2QT6A 3CVBA 1AACA 2BWDA 4KO5A 2H5UA 1SF3A 3AG3B 1EZLA 4DP8X 4G72B 1BYOA 2FWLB 1PF3A 1JERA 1L9PA 2QDVA 2XV2A 3DKHA 1T5KA 1ASPA 3EH4B 3S3DB 3NP4A 1W8EA 3MBWB 1AZBA 1IKOP 1CC3A 2H3XC 4BXVA 2DY2A 4M3HA 3T9WA 2QDWA 3X1BA 5LDUA 1OCOB 5E9NA 1ZPUA 4BDVB 1WA2X 2FT8A 5B1BB 3QJRB 7PAZA 1M56B 4GP4B 4BWTA 1BXUA 1GS8A 1OF0A 3NSDA 2QPEB 4N8UA 3HB3B 1JZGA 2YAPA 4A66A 3UACA 4DP2X 2CAKA 3H4HA 2FQFA 4BDVA 1NIEA 1J9QA 4E9WA 3OM3B 1N68A 5AKRA 5PCYA 3U25A 2EIJB 2IWFA 3GXUB 1TKWA 2BHFA 4A2FA 1E67A 4DPCX 3AZUA 3ABKB 3X1FA 1TEGA 2XU9A 2EIKB 5PAZA 1GS6X 1E30A 3OD3A 1QLEB 2DWSA 1IUZA 3FSWA 1HFUA 1JZFA 2J55A 1SF5A 4E9RA 1NPJA 2XYBA 2BP0A 2WO3B 5I5IA 4BWWA 1QNIA 1XB3A 5B1JA 3QJVB 2XXGA 3NJMA 4HHGA 3N2JA 2H47C 1X9RA 2I7SA 1MG2C 1DYZA 3NSFA 3NYKA 2GC4C 4G70B 2ZWNA 2VN3A 1J9RA 2PPAA 3T6ZA 2RACA 2DYRB 2VM4A 3NJFA 7PCYA 3NJKA 3NJGA 5B1KA 1ZV2A 3CVCA 4F2FA 1E5ZA 1KBWA 3FYEB 1CYWA 1PZCA 1WA0X 1JXFA 2JXMA 4YSAA 3TBCA 1A4BA 4HAKA 2XV0A 1A4CA 2FNWA 1OE3A 4YSPA 1SNRA 5A7EA 3FU8A 1AG0A 2W8CA 1AANA 4YSOA 1KDJA 2JKWA 1BEXA 1J9SA 2GC7C 2BW5A 4JHUA 1MZZA 2YXWA 4DP7X 2ZONA 5D4JA 1ILUA 4JHVA 1XB6A 5I6MA 1GR7A 2GIMA 2HZHA 2OCCB 3QQXA 2PP7A 4YSRA 1JZEA 4YL4A 3X1GA 3OMAB 3EF4A 3IN0A 3JT2A 3WKPA 3OMIB 1A3ZA 1AZCA 1X9UA 3AW5A 2EIMB 3ABGA 3SBPA 1JOIA 4BXSV 2J5WA 1OOWA 2IDUA 1W6LA 4W1TA 3D12B 3FT0A 6PCYA 2BP8A 4GP8B 1A8ZA 1M57B 1OE1A 1PLBA 4F2EA 1MZYA 2XVBA 1GS7A 2CBPA 2P80A 4HALA 1KCBA 2PP8A 1BQ5A 4WKXA 2XLLA 3ABMB 5I5JA 2HRHA 5I26A 2VSKB 2Y69B 1L9SA 2GHZA 1URIA 3WKQA 1FFTB 4GXFA 1AIZA 1SFDA 3NJHA 4CSPA 3ZDWA 1GYCA 3OQRA 1PNDA 1ZIBA 4M4RB 4QKTA 3AY2A 2IDFA 3UGEA 1NIFA 1KGYE 1J9TA 3BQVA 1RZPA 4HCGA 4YSDA 1J5CA 4ENZA 5B7EA 3WIAA 2J56A 4KNSA 2PP9A 3PAZA 5B1JC 1GSKA 2EILB 1KBVA 2CALA 3H56A 3PXLA 2Q9OA 2YXVA 4DPBX 3CDZA 4KO7A 3S8GB 4YVNA 4UANA 2FJSA 3JTBA 3N55A 3SBRA 4YSEA 1M9WA 3DIVA 1ET8A 2VMJA 1BAWA 3GYRA 4HCIA 3TBBA 3UABA 3S8FB 3OMNB 4DP1X 1L9OA 4DP0X 1FA4A 1AQ8A 2TSBA 2IH9A 2YAFA 1BQRA 4K9JA 3FU9A 2JFCA 3GDCA 3ZBMA 3UADA 4N4YB 1B3IA 4G71B 4E9SA 1L9RA 3NP3A 2VSMB 4KO6A 2BZCA 1AS6A 1ZDSA 2J57A 3NJJA 3TA4D 1BXVA 2XV3A 4NAJA 2XX1A 4UAHA 4FAAB 2GSMB 1I53A 2VW4A 4GY4A 5B7MA 4PCYA 3FYIB 3L45A 1BQKA 1AOZA 2OV0A 2LLNA 2FQGA 3WNJA 4TXVB 1AZRA 4AKOA 4KOBA 2PPDA 1NTDA 3NSCA 4BK5C 4P5RA 1HAWA 1V54B 1RCYA 3FPXA 1JVLA 2PCYA 4GP5B 4PAZA 2B3IA 2ZXWB 1NIAA 3CZUB 2A3TA 5TK2A 3ZX1A 1ADWA 1ZIAA 1CURA 3CG8A 2UXVA 4YVUA 1XMEB 1WAEA 1GY2A 4KNUA 4F7KA 4QLWA 3DTUB 2XUWA 4AZUA 2DYSB 1CYXA 3QJUB 3PCYA 1MG3C 4HZ1A 4DPAX 1SHXA 4YSCA 2WO2B 2IDTA 1PLAA 2GB2A 1GW0A 6PAZA 3V9CA 4A68A 3EHBB 2AFNA 1W6WA 3FU7B 2YAMA 1QHQA 1WS7A 4E9XA 3H4FA 5I6KA 5F7BA 3KW7A 5I5MA 1L9TA 3QPKA 5TK4A 4DP5X 3EH5B 4HCFA 2TSAA 4NB7A 4AKQA 4E9QA 4NERA 2EINB 1JZHA 1ET5A 2MTAA 1ASQA 4EF3A 3FU7A 5D4HA 5ANHA 3S3BB 1SHWA 3ABLB 8PAZA 1NWPA 3FPYA 2BP0B 4KNTA 1L9QA 1NINA 4Q89A 3PLYA 5D4IA 2PPEA 2B08A 4HHWA 1ET7A 4Q8BA 1DZ0A 3IBOA 3T6VA 3SQRA 3UAAA 3C75A 5FC9A 3ZIYA 5F7AA 5B7FA 3V9EA 1SJMA 4E9YA 2AANA 4G7SB 3AG4B 3ASOB 1MDAA 1SDDA 4P5SA 2PCFA 4YSTA 4AI7A 2XWZA 2BZ7A 3PAUA 2AVFA 4AKPA 1AZUA 2FT7A 3IN2A 1KCWA 4KOCA 2UXTA 2ZOOA 3IEAA 2HXAA
chains in the Genus database with same CATH superfamily
3K71A 1FBIH 1OB0A 3DX2A 4CN6A 2E7LC 5KW9H 1OV8A 3V4LA 3S88H 5DFVD 1G6RA 1ECZA 1AI1L 1V10A 3VD0A 5K33A 4Z3JA 1JWUA 4KK6D 5CD5D 1MNUL 2E27H 3OXRB 4TSBH 5I6NA 3QDME 1QPKA 5DQ9A 1DUYA 4HXAH 1FNSH 5JZ7C 2MFNA 5D1ZB 1E8WA 1UZ8B 1NC4D 4EN3A 5ELIA 4HUXB 4LU5H 3JWOL 2VXSL 5C0JB 4G7YL 1I8KB 1Q9LB 3VXQB 4Z7NE 4Y19E 1QLFA 1USQA 4J3OH 1EO8H 3RWDA 4AQ8C 4YZFE 3VCLA 3WLBA 1SDDB 3JWOC 4UILH 4F2ME 2WANA 3OR6B 3V4UL 4ELMF 5JW4Q 4XN7A 3LRHA 3QRFM 3ZE2B 3BZEA 3D0VA 5BJTB 5JPNA 3GMNB 4IRJA 4LLDA 2IV8A 1JK8B 5F21B 3IWUA 2IPTL 1H5BB 1G7IB 3K8MA 3MLTB 3FHQA 4KK6C 4JHBA 1G7QB 4HT1L 2J4WH 3MLZL 4KRLB 1F3JA 4Q2ZB 5I17A 2W60A 4R84A 2ZOKB 3KWVA 4CNIB 1FF5A 2X2YA 4YGVA 2P8PB 1XGYL 4X42A 4MTMA 3DX7B 2DQCL 1ZPLA 2YEZA 3US1A 4FADA 1HEHC 3QWRA 4JAMB 1JRHL 4PWHA 3G5WA 1IE5A 2EXWD 1UFUA 2Y1VA 4MNGA 3CPUA 4X4KA 1D5BB 4XI5C 5C0IB 3HI6L 2NY2C 4WHTA 4CAGA 1JXDA 1QR4A 1XTMA 1WT5A 1ZHNB 5I1HL 4OCSL 2WKOA 4M7KL 5T3XH 5A6IA 4CADA 2DWYA 4PR5A 3IDUA 3WD5L 2DDQL 3LS4L 4AENA 2BRRH 5DMGC 4PREB 1ZEAL 3TA3B 3BHBB 2J8HA 5LJYH 2B2XH 3MLUH 2NY5H 4MJ6B 3SY0B 3UC0L 3TFBA 3WNLA 4D0BB 5KN5A 4QI3A 1PBYA 4G3YH 2X53A 4WI0B 5CGTA 3H3BC 2ZAGA 2XWJB 3FDWA 4G9FA 1I9RH 5D70H 3QHZH 1JNHB 1NSNL 2R23B 4ODXA 1FHNA 4ZPTB 4XE0A 1KB9J 2G2NA 3BXNB 4PJGF 4PGDA 1J0KA 3TPKA 1X5KA 2X4SB 3L1OL 4KBPA 5HDRA 4J3OF 1BLNB 3NZ8A 4IU3A 4U0QB 5ESAB 4FQXA 2WSDA 4OZ4A 3RVXC 1LE5B 2WXQA 1A6UH 3DXAA 3X1NA 5B1CA 3EYQD 3PAVA 4G6MH 1S5IL 3JYBA 5TH2A 5BS0D 1DN2A 2Z91B 5L2JA 4LSQH 2ZOLA 4DFHA 1I9JL 2K1MA 2YRZA 1HXYB 4MLIA 2WJ7A 1KB5B 1XSIA 2HTLC 1MNUH 4QRRB 4XVTH 3MRLB 1A66A 1HDMA 2Y07H 3D39A 4YDZA 2FK9A 1GZQB 1ND0B 4WCYL 5SWZB 3K5RA 3GSOB 4L1TA 5DVLA 5AG9A 3GM0A 1ZV9A 4Z3HA 1IT9L 4CN1A 4Y2DA 1I3VA 3L9RB 5JTWA 2CDEB 5F97E 2O6EA 2EDMA 4TNVK 1A14H 1N64H 5ACZA 1VRSA 1YQVH 2ZCLL 3NIGE 5I8EA 1NFDA 2EYTB 4HOZA 2P5EE 3AFLA 3S34L 3QFJB 1KB5L 5DYOB 1GZHA 3GBLA 1W0YT 4PI2A 4WWPA 4I87A 4NPKA 3SDCB 2C3VB 2CD0A 2DI8A 1BQSA 3P2TA 7PAZA 1U92B 2DQIH 3TO4B 3LMJH 3EO1A 2GYSA 2X4UA 4JRYA 5JXEA 3SKMA 2VLLB 3NPSB 4DF9A 4NO3A 1UFGA 3CC1A 2FWOA 2IQ9H 3O81A 1JZGA 1KENL 4FXKB 4A7GF 5IR1B 2CAKA 2F18A 3L95A 4L0YA 1ORQA 1WFTA 5CZRA 3RIFK 4OF0A 5B8CC 1CFVL 5ENWA 1T7VA 4PB9L 1UA6L 5AKRA 5SWSD 4I18B 5EZJA 3D18A 3WJLA 3H7BB 5F96L 1FYTA 3X14A 3MHZA 4HQQL 3CVHB 3JV6A 1AC0A 5CP7B 1R5WA 1RU9L 3QZBA 3X1FA 4HHAA 3HB3C 3G6JE 5AVSB 2DQFA 4FEMA 4WK0B 4XNUH 4GBXA 5GS2H 3AAZB 5IMLA 4UZGA 1EWHA 1JZFA 3BWUF 5C08D 3RNKA 3TT3H 3ZZSA 3IAGC 5KYYB 2VDOB 3VD7A 1T1WA 3EFDH 5LBSH 5B1JA 2PO6D 3HZVB 3J07A 3QJVB 3IMBA 2I32A 4NCDA 4PRID 1NJ9A 3OPZH 1ZY9A 2W0KA 4N9OB 5IBTL 3SDAB 1MHHA 1Z32X 2ZP8A 4KDVA 2N56A 2YFOA 3T0DA 3ECUA 5E9AA 4TN9A 1SYVA 2GIXA 3LS5H 1G94A 5FO8B 2QPUA 1NKRA 3Q44A 2DYPB 5HGGS 4OB5H 3VNZA 3CH8A 4IRSA 2YMXH 3CVCA 4YHYC 1E5ZA 4IS6B 3QG6A 2OJEA 1WTGT 3RWHA 2VLMD 3L3GB 5JW3L 1R0AH 1BF5A 3F58L 5D2LE 4AQAA 1T66D 3DRQB 3IM1A 4HAKA 1G9MC 4ONHB 4ZFFB 1SNRA 5GGRY 3LVEA 1D2OA 3N1PC 3HI5H 4IOIA 3CGTA 1LO2H 1DVXA 3RHWF 3N3EA 3QZPA 4WFEE 1AANA 5KSUB 2DH2A 3VJ6A 4FTVB 2JJWA 1P1ZB 1TVHB 1CE1H 5E9DA 4BHUA 5J06A 3U9WA 2CO1A 4PYHA 1M71A 1F41A 3DTXB 2VNCA 2ZONA 2VM9A 3BKJL 3CHPA 2OKMA 4N90E 4F33A 3O6KL 4YDKH 5EZIL 3KPNB 2A9DA 3P9MB 3APCA 1T5XA 4J3OG 2X4TA 2ATKB 3IN0A 4O2EA 2Y5TA 4YIQA 5IHUL 3HZMA 1NBVH 4BK8A 3D07A 3NEOA 5IQ9B 3VB9A 3AS0A 5FHBL 5C6WH 1G6RB 2AC0A 2E47A 5D1ZA 3MRHB 2Q3ZA 1PLBA 3KXFD 4J2QA 4F2EA 1KPRA 1TJHL 2NSQA 5C0JA 4Y5VC 4JK0D 4L4VE 1OARL 2GSGA 1H8OA 1LO3L 3U9PH 4NUMA 1D5ZB 1OIOA 2HRHA 4OR1A 1R3LB 3HNTL 4XI5D 1JV5B 5JIKA 4Q9QH 2PMZA 2JCCE 4YN3A 3GHEH 5C9JB 4RAUA 3QXWA 5EDSA 3KM1A 1W72L 3QPQD 4Y89A 3AY2A 3VFRA 5CP3A 3DSNA 2NTSP 1H5BA 4X9FA 3T8MA 3DX4A 3J8F7 1CWVA 1MQ8A 1KWGA 2R0KL 4XXCC 5G5DB 5F7EH 4OTXH 3WNMA 4F2MA 3AXLB 3GMNA 1YNLL 2Q7YA 4FF9A 3QIWB 1LP9E 2YXVA 3J2PA 3RVWD 5DFWH 4U1NA 3WXWL 3FOMB 3DJZA 3ECBB 5DRZA 4A2MA 1KJ2H 3H9SB 3CBRA 1WIUA 4TNVF 4LSPL 3MRDB 4UOJA 1ET8A 1SEQH 4RDBA 2Z64C 3HS0C 3L5JA 5HI4D 2NUPB 2VLRA 1EANA 5DJYB 1C7SA 3O6FD 5DJ0B 1B0RB 2VCOA 1J10A 3WFEH 3D39D 4MQ7B 4WHYH 3FU9A 3CU1A 1WCBA 2GI7A 2NZ9D 3VD9A 1XGQB 2Y72A 5I76B 2YUVA 4PREA 2NW3A 3O2DH 4QRQB 3G5ZA 4GSDH 2ICWB 1QZNA 3BUTA 2WHVA 3TA4D 3L4VA 2RMNA 1R3HB 3IDMB 4XNAA 4ZX3A 3T0XA 5E4OA 1JP5A 1MXDA 4WO4C 3HIZA 2VE6B 2E6QA 4LEOB 2XPGB 2AEPH 2O61A 4KKAC 3ZPDA 1ACZA 1JFQL 3K46A 4GS7C 5LKNA 1B2WH 4MA7H 4Z76B 4GKLA 2DQTL 2YBRB 4IU3B 4NYLA 2X4PB 7FABL 3ULVE 4KQ3H 5FYJE 4X0KA 3OKYA 4Q4IA 5I19H 4HJJL 2DKUA 5FYJL 1NCHA 4HLZH 5TH2B 5C9KA 2P1YA 3TPUB 1C5CL 1JHKL 1QI3A 4AJWA 4OZFB 4N24A 1HXYA 2B3IA 4DK3A 1Q0XL 4LESA 1MIEH 5IEHA 2ITFA 1C5DA 2VKXA 2VABA 4KNUA 1EAQA 4FQHB 2AK1L 5C0CB 2QKIB 2I07B 4U6HA 4U6TA 1P9MA 2DQIL 4IHBA 3AGVA 1CI3M 2CUHA 2IADA 3US9A 1T0NA 4XCNA 2HYMA 2F54E 5EFIB 1ZLVK 2A74B 3D4ZA 2IBGA 4NQTA 3NA9H 4PG9A 2JE8A 2QSQA 4JFWA 3U36A 5I6KA 4LSRL 4YJZL 3FFCD 3AXHA 2L7JA 3EH5B 2Z92A 2IOOA 3KJ6L 3BQUA 2ZAIA 1N0XH 4J3SA 3BKCH 3GQFA 1JZDC 1F8TH 2A1WH 2MTAA 4FG0A 4D94A 1JTPA 1G6RL 2VLME 4LLMB 5FF6B 2H8PA 1BFTA 5FWRA 1N3NA 5A16A 1E4JA 4ZMNA 1IGYA 4KKBC 4HLEA 4I9WE 4KNTA 3QFJA 4ZQKA 3OZ9H 4QRPE 3V6FB 4HFWB 4Q89A 3DIFB 2OA9A 4X5XB 3CH1B 4Y7OC 4W6YB 4IBQA 3FSOA 1J1OL 2AQSA 4QXTA 4S10A 5ENWB 5T1KD 3VD5A 5FC9A 4N1CA 3MNMA 4F57H 2BHYA 1JHLH 4DKEL 4OGZA 4N28A 1KN2L 4FXKA 4ENEC 1FGNL 4TF4A 2Q8AL 1CBJA 1I9IH 1WAAA 5CHNA 1BQLL 4YSTA 2FATL 3MAWA 5CCJA 2G60L 1UB5B 2HKFH 3ZMRA 4EN3D 3BWZA 4NQEB 3O2WL 2P9RA 2JI1A 1QASA 5I0DA 5IB3A 5C08E 4WLCA 3C6SB 3OBAA 1H3GA 1BVZA 3O2DL 1JV2B 3HRZB 2VYRE 4TVSa 3PGCA 3SDXF 3UBGA 3QWQB 2WLHA 4YWGH 1NOAA 2NMSA 1TTBA 1XR9B 1NJ9B 3GDBA 4LCCC 2NZ1A 1TLMA 2BP8B 4HIJB 1P4IL 5D9SB 4X5PA 4YHMH 3BVDB 4X2UA 3GKWL 4KVCH 4XBPA 1KPUA 2ARJA 3F5WB 1YY8A 2YN3A 2QFPA 1ZTXE 4IDLA 5F1NB 5DHEA 1WSST 2MHAB 4UF7C 1XZ0B 3BGFB 1CGSL 1NOLA 4LL4A 5JXAH 2COVD 3TBVB 3V4UH 1KCUH 2CIIA 4Y8DC 3BIAX 4Z7UE 3N0AA 3SGDH 3UTQB 4JDEA 1OAQH 4H0HB 4IOIB 4Y9EA 1CDBA 3W9EB 2QADB 1CF8L 3BDYH 3MKGA 5I1JH 4LB8A 4NP4L 2PXYB 2CXGA 2VITB 3U4EB 1J0YA 3BOVA 1KYDA 4NP9A 4R4BB 1HJCA 4GUQA 2YQBA 2R39A 1O6TA 3O6MH 2HJLB 3MNWB 5IMMB 3DTXA 1WAPA 2B59A 5GGSA 3VWJB 1VFBB 4QXGL 5F9JB 1AD9A 2ITEA 2VDQL 3B56A 2D9CA 5KOVC 3GSWA 3S36X 5JIIA 3NFSL 1KJ2B 2VDQB 2G2PA 5TDNA 1RHHB 3BKCL 5FO7B 3UTTA 2E8YA 1XAUA 3RGBA 1RZIA 5TQ0H 1RIUL 4OBSA 1GC1H 5BS0E 5E94A 5C3IA 2G0LA 2NY3B 4JZJA 5T1MA 5TDPA 4APQA 4G8EB 5A2AA 5HHOA 2I7OA 4HKJB 4GKSB 5E6ZA 2OZNA 4JLRA 3TVMC 4G9DA 2DTSA 2O26U 3IMUA 3U4AA 2V17L 3FH8A 4NJAH 3FBQA 2OCJA 2MQ3A 5ADPL 1YLBB 1NDMB 1WBXA 4N9GB 2BX5A 4FQLL 3WI9A 1RERA 5HHXL 4E41A 1KNOA 2PCPA 3CWGA 1WC7B 2GI0A 3MUGB 1DFBL 4K3JL 4A6YB 1FZKB 4JN1L 4RA3A 5D2NA 4G6AC 3UYOD 5MEPB 3QJSB 1UA3A 3SDXA 4L8CB 5BMFL 3GGWA 2QVTA 4ZTPL 1FHGA 4NC2B 1EHAA 1NPNA 4A2EA 4UM8A 4WNSA 1BVLA 3VYNA 3VB8A 1HCZA 3EJPA 2YAQA 1XCTB 1ZTMA 3RY6A 3W39A 3Q6GL 5DGQA 4IKLA 2PPCA 1AXTH 4G1EB 1JN6A 3CJJA 3FOMA 4J7RA 4NI6A 5DK0B 2MQ0A 4MAYA 4P46A 3H9SA 2DQGH 1P6AB 1QQDB 3GO1H 3QA3B 4K3EH 1BYPA 4AMKH 5HYSB 2BNRB 3T4AA 5IVNA 4YHML 4X6CF 5HVHB 2PWHA 2WTRB 1B4TA 2X2UA 1IT9H 1J11A 4JCWA 3SYQA 1EZLA 4G6JH 1A3QA 1PF3A 1BX2B 4BFNA 3R7QA 4HIXH 2HFTA 3MBWB 4M6NH 2H3XC 3CLFH 4Y4KB 5EDXA 2Q8BH 3T9WA 5DK3A 4PJ9D 5DC2A 2AGJH 4AYBA 2WLJA 3NIGF 1OSPL 1PS3A 5E9NA 5T33H 1ZPUA 3UZQB 1DVQA 1JHTB 1T20B 4HPOL 4X6BB 5B1BB 2YD0A 1XR8B 1YEHH 2VDKH 1GL4B 2EKSA 4KPHL 4LHQB 2NW3B 3FTUA 3N91A 5JQIB 4BFIA 3NH7H 3QQ3A 2X1WL 4BINA 4FQQA 1S78D 2JKXA 4HWNA 4KKQA 3C5SA 2WIIA 3RURA 2FX8H 4N6QA 2VN6A 4W9FC 4OJCA 1NIEA 1U8MB 2EIBA 2RCSH 5CSZB 4ICXA 4L1DA 2ZCZA 4NQVA 4XPTH 1TCRB 4FMFA 4U1JA 3TN0D 3ZHKA 4NGHH 4M7ZB 3GXUB 3GZKA 2GITB 2VDMH 2LAAA 2GFBA 2XWTA 1WFJA 3DHPA 5CBEB 5FB8B 3D2TA 5C0BB 2ZZUT 1NGXA 4F8OA 1M9SA 5D7LD 1KFGA 5I71B 4M61A 4UTCA 1E4WH 4OGQC 4P5TB 1AGEA 3FSWA 4GUPA 3U1QA 5IW6B 2EH8H 1HHIA 1HSAA 4IOSA 1U2CA 2WNKA 2J55A 1U8IA 1NPJA 4FABH 1MW0A 1O7DC 1YEGL 2WO3B 4GAGL 2F7IA 2FWSA 3FUFA 4EPSA 5EOCL 3NIDB 1G9NL 3L9BA 1HKLL 4GRLC 2W59A 3HFMH 3VFNB 2OJZL 2R4SL 4M62H 1LP9F 3DPBB 3ILQC 1UWYA 3D1MC 3K72B 3MACH 5ACLA 2GC4C 1A6WH 3TIDB 3M46A 4X9BA 4OM0H 4CKQA 5DD3L 4I3RH 2YGPA 2VL5A 5FFGA 4QHUB 4Z78A 3WUZA 2PPAA 4URTB 4ZW7A 4YR6B 5E8EB 2IH3A 2H1LM 5DS8A 2RTTA 5JR1H 5LGJA 2WWKT 3D4CA 3QXAB 4Y88A 1P7BA 3QUKA 1KBWA 1JXJA 1HOCB 4MXVE 1X9QA 4Z6AT 3ARFC 2JXMA 2NZ9C 1WYJA 4FQCH 4FQIH 4GAAA 1QWUA 4F58L 2CIKA 1FIEA 2HSIA 4R0LC 3QFGA 3WTUA 3L4TA 2FHBA 3KYNB 4HD5A 1A6AB 3CFNA 4U1SA 1OP9A 2Z4TA 1FP5A 4YSOA 1NMAH 2B9BA 4GAFB 1IILE 1AGBA 1KSRA 2J7LA 4LK4A 5TPWH 3SPJA 5IB3B 3VQ2C 4JFDA 2A6JB 2YRPA 3KS0H 2XWBB 3LEXB 2OMUB 3CLFL 4KUZL 4LDCA 3X13A 4UIMB 3CN4A 2GIMA 2OCCB 3VXRB 4MCMA 3EOBA 4A7TA 4AV0A 3VRLF 4DW2H 4HWEH 5LXGL 4HXBH 3OXSA 2XTJB 4PRDB 1AHKA 3GSXA 2V5RA 3PY9A 2YEVB 5L4FA 5E6IC 1S7TA 5CZVH 1X9UA 4X6DA 1YVLA 3W11D 3P3SA 3UEZA 1JZ3A 4PRNA 2EJ1A 4OM1L 4L5FL 2FBOJ 2IDUA 3KPQB 1QO3B 5TE7L 5AW2B 2YGQA 4TUOA 4WFFE 2BSRB 2ZKHL 1HHJA 1MCPL 3HLKA 1H8LA 1PLGL 3F2LA 2HKHL 4YDMA 4OZIB 3GSUA 1U8HA 5HXMA 1KBKA 5FS5A 4DHLA 4K7FB 5FUOL 4WKXA 3N0PB 3SPHA 4R7XA 2DQJL 2F08A 1L3WA 3MCLL 5C0CE 3AADB 4JANA 1R9FA 3VRJB 3RI5K 3SGDI 2OXHB 4GXFA 3OHXC 5DURB 4DTGH 3HC2A 1CFMA 3KWWA 3OR7B 5IQMA 3UTQA 3CFKB 4KQ4H 1M7DB 3C5ZC 1YY8B 1ZIBA 5CINL 2XQBH 2BOCA 3LKPB 3FQ4A 5T5NG 3UGEA 1DVZA 1I7UA 4HCGA 2LHAA 4WU7B 4MA1C 4BH7B 1T7YA 4R4BA 3K6IA 4ZUUB 3WO4B 5E56A 2H1XA 3VFGL 3QO1B 4XMXA 3I6SA 4RFEB 5LCVH 3K0WA 3T0AA 3V5HA 4LLVB 2ED8A 1DO6A 2MOQA 2UZIL 3L3KB 3O3AA 5EA0H 5B1JC 3SJVB 4DFIA 3WAJA 2LGNA 2EUZA 2CR6A 3O41B 5GXBB 3V0FA 1BZ7A 1G0YR 3OQ3B 2R1YB 1WEJL 3TYGH 2VISA 5K39A 2BSED 2FBJH 3ZRSA 2B59B 2XHNA 5MP6L 4AV5A 3BVTA 5L2KB 4N5EC 1UKQA 4K7PL 5B39A 2D7QA 4NIKB 4XZ4A 3BN9C 4MJIE 2YPKB 2CBMA 3BH8B 4HEME 5EUOF 2PTTA 4HKJA 4PJ7A 3LRLA 1XIWD 5TDNB 2B20A 4UNIA 5HVWA 3RA7H 2WLMA 2Z35B 1E8ZA 2PR4L 1HE8A 4AZ8B 2R9HD 3ZE0E 5KAQG 4K2UL 4PJEA 4LASL 2ZX6A 3MREB 1U8PB 5I30L 5D2NB 3FCSB 3C6LB 3VFPB 5IB5A 1VAHA 1EZVX 3ZK0A 1R34A 3CSPA 3FCBA 2LE9A 3G04A 1NC2D 3O8XD 3V4PH 1ZGLA 3IFNL 4UM8B 4DEPC 1HCVA 4EUPA 4HIIB 3SOBH 4EN2A 1GXEA 2JWYA 4F8QA 2WAHA 5LAPA 5J57B 3ETTA 5LUMA 4L1HA 4ANUA 1GGUA 5FYJH 4C8XA 1AGDA 1YNTB 3T0EA 2H32H 4PEEA 1FH2A 4D7PA 1YMHA 3FTWA 1MCEA 1V54B 2P44B 3MPCA 5EO9A 3PHOA 1T2XA 3SDCD 1YRKA 3FT2B 5ECJE 1I3GH 4UNUA 4W9GC 2X6BA 2EDXA 4I5BB 1FNAA 2JB5H 1P7QB 5IV2B 1D5MB 5KANI 2OMNA 3UDWC 3P2BA 2XUWA 3FZUC 2W92A 1TYJA 1NBZA 1G1YA 2OW7A 3Q2VA 4XPGH 2K0RA 3EZJB 4EI6B 5HI4C 3INOA 4HH9A 1F42A 2F54D 3V9CA 1HILB 1CG9A 3FRPB 1TPXB 3EDJA 3V6ZA 2GPZA 1OAKL 3D08A 3WNPA 3MJ8B 3GTVA 1T03L 1IGTA 2FB4H 2GTWB 3T0BA 4FNTA 4G6AD 2EDQA 4XR8C 4UQCA 1HU8A 5CJ8A 1EJ6A 3I6KB 5AAWC 3EDEA 3L13A 1BX2A 4GRWF 1BXXA 3S5LA 2IQAB 5LGHL 1A7OL 1RP9A 3ZTDC 4BK5A 3BKML 3OSKA 3AMKA 4JFXA 4TNGA 1YN7B 8PAZA 1SHWA 1PDKB 3B34A 1JNNH 3ZDZF 4B95C 3SKJH 1E4WL 4LKXA 5DQ9B 3MROB 3VFSB 2P5WE 3K4DA 4PY7A 4WI4A 3IPBA 3FQWB 3MRJB 3B9KB 4IRJD 1LTXA 4AEHL 4NFBA 5F9WB 4WV1B 1DBAL 2FYYB 1QPXA 2GITA 4B96A 1AQMA 2BNUA 5HI3D 2X9XA 3QEGL 4L8DB 2QPFA 3HLAA 4U6XA 1RUAH 4M61B 4LCYB 3Q1SL 1QLEH 4YZWA 5EO1A 5GS1C 3WIHH 1KTLA 3TJHD 2Y36L 4M48L 4PGBA 3GRWA 2QQNH 3ARED 3QG7L 2HAZA 3KPMA 1OCCB 1ZLVH 3L7EA 5MI0B 1I1AC 3RX8A 3ZQWA 2J1KA 4YQXH 4HK3J 3D34A 2ZOKA 4N2GA 3ARUA 5ICXA 3DPBA 4E2OA 5EF3A 3FN3A 3NRPA 4IOFD 1UOKA 4YUEL 1YY9C 3RGVD 1M6OB 2OP4L 3B9VA 3O11B 3IJYB 5DWUL 1CE1L 2F1AA 5CLWA 3QDJA 5IESL 1JZ6A 5I8OH 3BX7C 3FT3B 1SXNA 5CGYC 3SO5A 2HRGA 4ZYKB 4M5ZL 2C1OB 2LFGA 5EHFA 4ZO9A 1ZHNA 1WS8A 4POZC 1BBJB 3WY4A 3JTSA 3TZVA 4DW2L 4OV5A 4D9RE 4PFEA 4BYHA 1XGYH 1PMYA 4KKZA 4L0PB 1DJZA 4CVUA 3B1UA 4XNBA 2IALB 3JWDH 3X3FL 4NN7C 4UOZA 5DMGD 3SZKC 2OI9B 4W9LC 3IXTA 2CMRH 2P7TB 2X6MA 4QHLA 5J6SA 5MEND 5D4QA 3ZHDA 2BIMA 1MI5E 4EIBA 4NNYB 3EF7A 1QZ1A 4L4JA 4KVNH 2CRZA 1KIUB 2DLFL 1A6AA 3VMPA 1ZDQA 1LO5B 5I1HH 5IHBA 1QX1A 4AK1A 1HYSD 4NZTH 4HCRH 1CJYA 2PYEE 3KXFE 4MZIA 1B4JL 1YJDC 1A7PH 3RHWK 4OD2B 2C9AA 4Y1AA 4EDWL 1F56A 5SWSA 1BF8A 3DUUB 4NO5B 2XYCA 4B9IA 1O6SB 3SPVB 2Z91A 5L2JB 1BZQK 1MFEL 1JWSA 4AL8L 3GK8L 2WVTA 2CXKA 4GLRH 2NRDA 2I85A 2W0LA 4MWFB 2FHFA 1IIIA 2X6CA 4NZRL 4FXTA 2YWYA 4JFHD 3G6JA 5HHMB 5KBPA 4KU1A 2WBJA 1S7WA 4HUNB 3VG0L 4ZPVB 2LABA 1JCVA 1LL1A 2B4CH 5SX4H 3MNVA 5GJTL 3PWNA 4N5ED 2NXZD 4M5TA 3VGFA 1RJYA 3FO2B 1U2YA 1M05A 1O7VA 1QW9A 4XNUL 2R8SL 1CO1A 3GSQB 5IEKA 1HNGA 5TE6L 5JO5A 2O6DA 1NUDA 3V4PB 5CR1A 3OTTA 4MNHB 5ICZB 1SMDA 3S4SG 1ICTA 3L6FA 4D0DB 4ELMA 3TFKC 3QO1A 4Z0BH 5I23A 3ZHNA 3BP6B 4GMSL 4N2EA 4RFEA 5IVOA 3U7AA 1NIBA 3G5YB 2XVKA 1NCCL 2DJSA 3QIUD 3BDBA 4FNSA 1B3JA 5D6CA 4Y4FA 4W4OC 4G80A 2VISB 1CFQB 4LLVA 4A6YL 4E0RB 4WTZG 3O3AB 2P80D 5CD5C 1SXSA 3D18B 4K9EH 4FXGC 4D9LL 1L7IL 4BUHA 3Q6FB 1J7VR 4C47A 4AMWA 3HC0B 2BWDA 3HHSA 4WUUD 1FNGB 2F7OA 2VDPL 2PWGA 4G72B 4YDJA 1T5WB 2KERA 3SDCC 4APXA 4MKTA 1OAZL 4WEMB 2DKMA 1EJ8A 4FZEL 3RWIA 4RISH 2OSXA 3CAFA 3Q5TA 4Z7WE 4BXVA 1AGCB 3K6DA 2D2CC 3QO0B 1A1MA 4BKLA 1WZAA 3MRFA 4ANVA 3DVIA 3MA9H 3GUFA 4MB1A 3GIZH 4MJ5A 5C0FA 4Y19A 1EFXD 4LAQL 5KYUB 4UZSA 1S3KH 4JKLA 3FQXA 1RPUA 1USZA 3WMQA 2IPKB 2Z8VC 4RAVB 4QRBA 4UTBL 1RY7B 1X4ZA 5H35A 4KWUA 2X3CA 3B9DA 5LN4A 5KOMC 2J8UA 1UM5H 5DVKA 3W81A 4DP2X 2GT9A 1G4MA 1GYUA 1FC1A 3V8CA 1ZHLA 4S0SD 5AOKA 5AEAA 5T1KA 4QHMB 4E9WA 2DB8A 4JFOB 3FTXA 1YEDB 2VDML 1NAML 4Y2DC 2Z31D 4CGUB 5DUJA 1TJIH 1K72A 4JGUA 3NCJL 4OGXL 1ZT7B 1YNTA 2EIKB 5PAZA 2KYIA 3KGUA 1QWNA 1YMHB 3V0VA 2CJTA 5JPMC 1QLEB 2B1OA 4AMXA 4G8IA 4OQTA 5E08H 1MCQA 2XYBA 1UCBH 2HFFA 2IMMA 3GINA 3A4DA 4HOXA 1QNIA 4DPRA 1FORL 4BRVA 5AVUB 4U3SB 3UTSB 2BIIA 2ZNXA 1T3FB 3P77A 3ZUCA 1CLOL 2RQEA 4AE1A 4KRMB 3PWUA 5JHBA 2DIJA 3OKMA 3EO9H 1T5XB 3QIBC 3LHAA 3UIZA 1QBLH 2VN3A 2C7FA 2X0UA 1IGTB 2GTWA 4ZO7A 4P99A 5ESQA 1WUZA 3NJFA 1RUAL 2DL2A 1T80A 3LH8A 3NJKA 4QNPF 2X09A 1EAJA 4WW1A 1MLCA 4CMMA 3SQBA 5L0QC 2DM4A 4OZIF 2AJZB 1CYWA 1IKFH 2C3GA 2ZWKA 1A6VH 1MI5A 2X4QA 3FHEA 1JZ7A 1RJCA 2HLAB 4KTYA 4I0PD 1X5FA 1WGVA 2EXYC 5I18L 5BUAA 1CICC 2YQGA 1RVFH 4HUVB 2XG4B 2BNUB 3IWVA 5IB2A 2P8LB 3U6RB 3UTTD 2J1WA 2MKLC 4Y5YC 5CLZA 2JKTM 4YBHA 4PRIB 2A4CA 4BQCA 3BVUA 4JG1H 4P2QD 5EO1B 1J9SA 4N3UA 4XMLH 1T2JA 4MGXA 4IKIA 3DMMA 1TJHH 2QSTA 3RDJA 1N64L 1KTKE 5HPMB 3GBNL 4H8WC 3VGDA 1BJMA 4LCYA 3TONA 4KTGA 2BVPA 1U2HA 5AZEL 1EA9C 1T4WA 1U6AL 3ULUF 4P4RB 4NKIL 2EDFA 4GINA 4BGDA 4PGBB 1LK3H 1N0LA 5FKAB 1QHPA 1EJFA 4U1LB 1UB6A 4PVBA 4PJ9B 2KDGA 3M86A 3QH3A 1IAKA 4HX1B 5FYLD 2IF7A 3TESA 2VERA 4WWKB 1AFVH 1O9ZA 5ILTH 1KCBA 2PP8A 4FDWA 2VQ4A 1IZJA 2E7LA 4KXDA 1CZ8H 5F7EL 3CIAA 5FLVA 1ETZB 3Q8AA 2BFVL 4YHPA 4L3EA 1RJLB 1MJ7L 5HVGB 4JZJC 3RU8L 4HGKC 3SE8H 2EDJA 1BVKA 3K91A 4UQ2B 4EOWL 3K5SA 5F1KC 2C1OA 3RDTC 2B16A 2WBJD 4XMTA 2W9EH 3TO2A 4X9IA 4AK2A 4UM9A 1QUNB 4XBEH 4P57A 1CGTA 4F9LA 5H37A 1UCBL 4OFQA 4Y16A 1U36A 4Y19D 1RIHL 3C60B 5FOBB 1UYWL 2J71A 3W11C 4IBVA 1U3JA 3HS0B 5K9JH 3UBXG 5TGBA 4EZLA 2VDLB 3DX0A 3NPZB 4JY4A 2P7TA 3UPAA 3K6SA 3S8GB 4N8CH 1AMYA 3PDDA 2X3AA 1G1KA 3SBRA 3DHJA 1UQSB 3VD1A 1F8TL 1SJXA 3EYVB 4XC3L 5HI3C 2X6AA 4NHUB 3ZGHA 5F6HI 3V6OA 4AJVA 4ZMLA 1NEZG 3MYJA 3WEMA 2QR0B 1MHEB 1E50A 1GHFL 1I3RA 2JKLA 2K6ZA 4J6IA 5IHZA 3TJHC 4LCWA 5CEZH 4YNYB 4FFZH 1FA4A 4TRPL 1WZKA 5B38G 1BOYA 2HFGL 3LDBC 2V8LA 5CN3A 4H1LB 1ADQL 2JFCA 3T4YB 1B3IA 5D1QD 3IGAA 3LH9A 1A25A 2BZCA 1H8NA 1JXKA 2IFGA 5I8KH 3NJJA 5I30H 3MR9B 2X38A 4P06A 1RJYB 2A77H 3D3VA 5I1AA 4N8PA 4PLJD 1F00I 2H2SD 4K9EL 2D0HA 2BRQA 4P9ML 4QRSA 5BVPH 1X4YA 1DUZA 4FOMA 4Z3TA 4O5LL 1D9KD 1FNHA 2DM7A 4TNFA 1U0QA 1N3NB 4KMTL 1K4DA 2V5SA 4JFZL 3A24A 3QUHA 4J23A 5FA4B 1NFDF 2VLRE 2BERA 2VDLL 3PWVB 2MSPA 2KDYA 3JV4B 5LLIC 3EJZC 4K5LA 4PAZA 3IDJB 4W93A 4YWGL 2CO2A 4TQPA 4X50A 4QXTB 4WSJA 5D71L 1CURA 1IU1A 2UUDK 2AV7A 3F01A 3FW6A 4LSDA 1GY2A 5JDSA 2VLKB 4ODWB 3Q6FA 5DUPL 3QJUB 1YJDL 5HTSA 4JPKL 5EN2B 1PG7W 1XBDA 3H2PA 2IDTA 6PAZA 3BN9D 3U9PL 4LOUC 2XZCL 4JQIH 4K55A 3EDKA 5C0ND 3QWOA 2MCPL 2YAMA 1M6UA 4ZMVA 4AL8C 1V27A 1IGFL 4J27A 5DC9B 4R4FL 1SY6A 3O8XC 3WS6C 1TTFA 1K85A 3IB4A 2EUVA 3O0LA 3P9LB 1KGIA 2APFA 3MV7E 4K3DL 5C07B 5C09E 4KXAA 2TSAA 1CLZH 1WFIA 1X6NA 3ZDZB 4MDJA 1CDYA 2J3SA 4OKVB 4B5ZA 4ATWA 2IWGA 5A6MA 1EEZA 5AQ0A 1QHOA 3ZT5A 1JGEA 2A9ML 2IVFC 4XNXL 4KRNA 3HKFA 4PJDA 4N0FB 1DLFL 2J6WA 4YXLL 1LEIA 4U33A 1UA6H 2FGZA 1EVTC 2IPKA 3MLWH 1K8IB 1ZAGA 3TN0A 2OL3H 5B7FA 2B14A 2EDEA 4JFEA 2IAMC 4Y16D 3I9PA 4NRZA 2J44A 2EACA 4WUKL 3K8LA 3TBVA 4OIBA 4G9FD 1JPSH 1QSEB 1OTUD 3F62A 2A0LD 1KACB 1ES0B 3P0VL 3O2VL 2BVQA 2MPVA 4QCIA 4KKCD 4AIZA 2B1HL 1TTGA 4AYEC 5A2KH 2ZOOA 3E3QC 4P5KA 3OJDA 3FFCB 3SJVE 1J05A 1AGFB 4JDZA 2X05A 3FONB 5HHQA 3LV3A 4R8WL 3C12A 4UQ3A 5I8KL 3WFDL 1DJGA 4NPYB 3SGKA 3WEXA 5C3TA 3NCMA 3MJ7B 1CFNB 12E8H 4C56A 2ZCLH 3FT1A 5B38A 1CDJA 3I84A 3QFJE 4ZTPH 1AHMA 4GXVH 1HINH 1TQUA 1EJOH 3BT2L 5L2KE 5L88L 4MNQA 1NOFA 2BOBA 3APDA 4YEEA 2DEXX 4PBVC 5BZXA 3SDDD 3ZKMC 4OJFL 3D2UD 2VR7A 2P4AB 4P23A 5E4EC 4A2HA 4DVRL 4MA8H 1LQBC 5DQJB 5A3IC 2VZSA 1CPUA 5KSAD 1RKRA 5E99H 2JKRM 2VXVH 3EDFA 4C4KT 3B3IA 1FSKC 4GSXA 4HULB 2V2XA 2WXIA 1HC1A 2H45A 3P73B 4RX4A 1Q9WB 3REWB 4J3OC 1AP2B 2OSLA 3NSYA 3QJFB 4E41B 1C08B 4DP6X 1TQVA 2H26A 4I77H 2HVBA 1WISA 3KBFA 1ITBB 1K8DB 3FQ2A 3MV8B 4E9VA 4N1EA 1TVBA 4WWID 3VTTA 3BFWA 1WZMA 2XZCH 4JQIL 4DERA 4AYDC 3K4ZA 3KYMB 3MCKA 4LHJB 4M1GH 2LW3A 4Z7NB 2WXRA 4YBLB 1BVLB 4NPJA 5E03A 1OO2A 3AUWB 3QIUB 1DQLH 2C9RA 4DTGL 1ESOA 1MVUB 4XXCA 2X2HA 2GJPA 1FJ1A 4E41D 1HI6B 5E2TH 4PP2A 4FS0A 2NNAB 1DANU 4PJAB 4QXVA 1NAMB 5D7IA 1WFNA 2J1YA 4GRMA 2X89A 2M8XA 5GS0D 2GCYA 1G6RH 2W9EL 4I48B 4YAQB 3MBEA 3E9TA 1AVAA 2Z4QA 1IAKB 3T2QA 4EUPG 5H37G 5HYSA 1MREH 2EE2A 3TWCL 4WWKA 3IFOB 3VW3H 1K6QH 3L4UA 3CUPA 3LEYH 4LVEA 4P4KB 3AWEA 3C5ZA 2BVYA 3D6GA 5KVGH 3QUXA 3BAWA 3UZVB 5IHHA 3N40P 1J0ZA 4LRNH 3HI1B 2Q5BA 2W95A 3FAXA 2A83B 5DHDA 2LU3A 3MBWA 5F7HA 2BO0A 2KH2B 2R29A 3L81A 2PPFA 4UQ2A 4IDJH 4WW2C 2QPDB 1BXAA 2WMPB 3ARGB 4JNXA 2NDFA 1ZE3C 3CLEL 3BSHA 1XV8A 3ULUL 3TF7C 1ZS8B 3KCWA 4PJCA 4B9PA 3NJLA 4LP5A 2EDRA 4FFZL 5ID0A 3RFZA 5GRUH 3SOTA 4OJYA 4YBQD 1F58H 2JH2A 5KEZA 3VMNA 2UY6A 3BISA 5GPRA 2APVA 4I85A 2CQVA 4G9FB 2YBGA 4IIZA 3MRPB 2E46A 3AB0B 2DRUA 4N0YH 4LLWB 1W91A 3E6FB 3GMPB 2A77L 3VH8G 1ITCA 3ZE2E 2UZXB 4BSWB 5GZNC 4N6RA 1J5IA 1C5BH 2YZ8A 3NCFB 3TCTA 3IFNH 4K5MA 3UTPD 1NMAL 4X8JA 5HYJB 5CWSA 2QR0A 1S7RA 1X5LA 3TM6A 1XH3A 1FRGL 1N5YH 3PRZA 2YRLA 5ICYB 4PJIE 1KGWA 3DVNA 5DJCB 3QHFH 5F93C 3S3DB 1E40A 3IJSA 4A55A 1IBHA 4YL9A 2EUWA 2YUWA 5TJWK 5IB4B 1VADA 4BA0A 4BFOA 5LDUA 2UVFA 5K1VA 4ZUTA 1WA2X 3RUGF 1T4KA 1MLBB 1IVTA 2XC8A 1WD9A 4LSTL 5AKVA 2NYYC 3DSFH 1W0VA 2H6PB 3ULSB 1FI8C 1CR9H 1DQMH 2D7PA 3BD4A 4XN2A 5E5LA 7FABH 3QZWA 2VQUA 3FTGA 2XN2A 3B7SA 3SKNA 1OF0A 3HCVB 4GO8A 4NO0A 3WV0A 2UV3A 4BDVA 4ZTOH 2LLLA 2PTVA 4N85A 2GQHA 3ARBD 4K3GA 3DV4B 2CLZA 5EEVA 3Q3GB 2XN9D 2IWFA 2FEEL 4DQOL 4UNTA 3RJDA 4QXWA 3V2AR 1E67A 1DEEB 3PE9A 3KCPA 1L5GA 3S5LG 2AQPA 1OM3L 1OVZA 5IR1A 2WGNB 4MAYD 1PKQE 2EDHA 1LK2B 2WQXA 3MFGB 3V0EA 5FHAH 2Z6FA 2XBDA 1XH1A 3ARWA 4Z7AA 5IJDC 3MCLH 2XKSA 3HE7B 5CSBA 4QUOA 3RY4A 3WLWC 1TKWB 4J5VA 5D1QE 4XPAH 1GKEA 2Y06H 4N2NA 1CE6B 4P59L 3V52L 5DD5H 2Q2LA 4IDJL 4OCRL 3WFHA 4BJLA 2JKSA 2CPUA 3NYKA 4O02A 1WBZB 4X7TB 4NT6A 1GTNA 4TUUA 4GKZB 1T21A 3LZPA 1DE4B 2PYEA 5DEFB 1T1WB 3AM8C 2HT3D 4EI5A 1J8HD 3GRWH 3L3IA 4JRXE 3D4GA 2Y7NA 3I2CL 3TEZA 3RA7L 3CPLB 4B9GA 4RMUA 1RZKH 5E8NB 4BQ9A 1MHHB 1OQXA 2HJFB 3BO8B 4PWIA 3LKOB 1U8OA 2JJUA 3IJHB 2FNWA 5CZXD 1MJUL 5CCKH 4Z7UB 3NGBB 3FU6A 4M8VA 3X12A 3FU8A 2WJ5A 3QISA 3QIBD 3HBZA 2FUQA 1C12B 1CDIA 1PSKH 3DYMA 4RWYL 2OCFD 4J4PC 4DKAA 4I2XE 2ICCA 2CHDA 2BVQB 3K4AA 2DI7A 1BEXA 2Y0SA 2GC7C 4WUUA 5D7HA 4QHKJ 4X5LA 3WUWG 4LF3A 3KR3L 1VDGA 2V0AA 2RR3A 3HBQA 5JLZA 4Q9CA 4NQSB 5CUSH 2P5ED 2UWEE 1GR7A 3ZDYF 5J5EA 1CFSB 4MXWL 4XHJD 5FK9A 2AJXL 2HT3C 1S7XA 3TYFB 3MI6A 3KPRD 4AH2A 5DZNA 4KDTA 5KVEE 4PG2C 2B15A 1CFTB 4TKWA 4PU2A 4JAMA 4UYQA 4MQXD 4H20L 5D8JH 5DHVB 1NA8A 1PZ5A 2K6WA 1X5MA 3T65A 1E43A 2R4RH 2EEDA 1EH9A 4GP8B 3ROOB 4O58L 3NEEA 1FO0L 3EGXB 4DGIH 3TBTA 1E2WA 4QGYA 4C56E 3KBEA 4CU8A 1DQVA 3PWPA 3HNSL 4UZUA 1ZJAA 4RGNC 2AF2A 4DGYL 4JPIB 2JB5L 3F12A 2X2IA 4PJ5A 4Y2OA 5I75B 4XCYA 4G8GD 4Z0XA 4L4VA 4X98A 1AO7A 2BSCA 4O02L 4JY5H 4GOSA 1WEJH 3TYGL 4Z7OE 1HYRC 2UUDH 2Y1YA 4ZFZA 5GZNA 4AT6A 1J5CA 1G7PA 4ZMZA 2GSGB 3BXNA 2H0FA 3QC5X 1WK0A 4XP5L 2P8MA 5H4YA 2Y25A 1NMCB 2V3DA 2W07B 1SMAA 3T8VA 2Q9OA 3TEUA 4GQ9L 4KO7A 1A7QH 1E9OB 1KC5L 5HYJE 5L7XL 4QY8A 2MNWA 1FZMB 3BD5A 4UANA 1NLBH 1I7TA 2SEBB 4GG6A 1E5UI 4QRRA 4PV8B 1SQ2N 3PABB 4DCQB 2WBJC 5HGBA 3VXSB 2OTWA 3V6BR 5KVEL 2ORBL 2VDRL 3E1ZA 4N0CD 2AQQA 2CDFA 5D2NC 3SDXE 2OTUA 2K3TA 2WLLB 3LX9A 3S4SA 3CMGA 1XCQB 2ZJSH 7TAAA 3L9RA 1ZA6A 3T2PA 2KKQA 4URKA 5C0AA 3FMGH 2V4LA 1K3IA 1MHCA 1YNTF 1T0PB 4OQ1A 3WNNA 1J0IA 4PGZA 1MQKH 2FX7L 4HAFA 1AS6A 3OKKB 2BNQA 4ZXBC 3OKNA 1HVXA 1MW1A 1Z0MA 4TUJB 1MCIA 3ZU8A 5JPMA 1ZK5A 2EYSA 2GK0A 2JK5B 3A67H 1T6VN 1UTDA 1GA2A 4KAQL 3UJTH 1QACA 3AC0A 3O9WA 4LCCA 1KJ3H 2G30A 5JQHC 1BA9A 4NQEE 5HJGA 5CBAA 2L7UA 1U8LB 5EWIL 3PU7A 2Q7NA 1NTDA 4P2AA 1I4FB 1NL0L 1KB3A 4LPYA 4MDRA 4WU5A 3TBWA 1HAWA 4X80H 2K8QA 5DJXA 3UZEA 4KJQD 4M7LH 4FNLL 5HYSG 3GMLA 3AJ7A 3QYMA 3B9KA 3WL9A 4YXHL 3DURA 3CVHA 4LLWA 4GRWB 2D8KA 1TTRA 3P0YL 1UZ6F 5T1DL 3FAWA 3HPJB 5D93C 3WIFA 4QLWA 4ZMYA 1JYXA 3EH2A 1FG2A 4U1HA 1IM3B 2Y2YA 3ULVL 2N7AA 5EU5A 4M93C 4LVOC 5HYIA 4A68A 3EIFA 1KTLB 3FH7A 4QYOA 5IQNA 3WEAA 3IXAA 5DLMH 2V17H 1ZD6A 5GSVB 4GUCA 2CKBH 5LBSL 2YD8A 5DJDA 4CA4A 4MAYC 2XPYA 3ULAB 4HCFA 3QFDB 5FAAA 1QVOA 3EXLA 4H26A 4HKBB 2X7LA 1I1AD 4XMKH 2SODB 3FU7A 4RMTA 4N1HB 1KCSH 4YHLL 1GVIA 1FC2D 4QJ4B 3T1WA 1KOAA 4YBQC 3SKNB 5FM8A 3MXVL 4FQ2L 3RGVC 4LFHD 4L8SC 1YEEL 2BZDA 3OKEA 2HFEB 4U1MA 3GHBL 4IM8A 1A7QL 4Q58C 4WI7A 4AJ0A 1DJIA 5GS1B 1QFWM 4ZMQA 1RZJH 3NFNB 1AKJB 5SWZE 5CGMA 4N2MA 3F6LA 4D8OA 1LP9A 1MFEH 3I3BA 2IAMA 4TQEH 1A1NA 3W2DH 4QRPA 2H0EA 2NY0D 3HI5L 4QO1A 3UTOA 4QRUB 1KEMH 4OFPA 1FNEB 3SE3C 1TQWA 4F20A 1BQHG 4JRYD 4PRBA 4XT1C 5D7JB 1KCWA 1G0DA 3QZWG 4KOCA 3LKRA 3CFCL 5AYUL 1BM3H 3LPGA 3KCPB 1V3LA 3O3BB 1TEFA 4PJ5E 4FQ1H 4MAUL 2EO1A 5GGRB 3U30B 3X11B 4M5ZH 4Z7WB 4OI8A 4LASH 1PAZA 4IGBB 2FH8A 1PZ3A 3DRTA 1MH5B 4J6RL 2OL3B 4JQVA 4JFHE 3MV9E 4G8GA 3WTTA 4ODHH 1XIWC 3MRNA 1TO5A 4DUXA 1NBYA 4UT9H 1X44A 5JR1L 4P23C 2X44D 1HX0A 2ZT9C 4PPTA 2OMTA 1WA1X 2QQQA 5I6PA 1J8SA 1TXKA 1TDQA 4X7TA 3BAYA 4JREB 3B2DC 4HG4K 1U3HC 2BMKA 3QDMB 1MCCA 3QJOA 1NUFA 2PN5A 2M83A 2YARA 3I02B 4FHKA 4LGSB 3LKOA 1SEBB 3CTTA 2HX7A 4S1QL 1T6WA 4LCWE 1LK3L 2P24B 5E8NA 1N8ZB 2NX5B 1FCGA 3BPOC 1MRFL 3ZQ9A 4F1ZA 3EYSH 1TG8A 4BKTC 3SBQA 4DZ8B 3QI9D 1JRHH 2GUOA 3SDDA 5JZ7D 4N26A 3V7AG 1RAMA 5ID1A 3MUY1 4JZNB 3D87B 5JO5B 1PZUB 3FO1B 3S36H 4J8RB 1BQHB 5DMKB 2WN3A 1YQ2A 3PAYA 5I8CB 3DX9A 5EOTB 4BD4A 3QUXD 1A6TB 2ATPB 4ALAC 3QUGA 2XXFA 3A22A 3II3A 4DN4L 1JXGA 1Z0NA 2NLJA 3HN8A 1CFTA 4J28A 2BY3A 1E3ZA 2IWEA 2FQDA 1ZSDA 3DUHA 4LFHG 5J11B 2W88A 4Y2LA 2FRGP 4L29B 3CHQA 5FK9B 1KF9B 4HUWB 3T65B 4ZK8A 2BC4B 3TCXA 1UCTA 2AK4D 4UIKH 5DZOA 4P2OD 5DRWA 1N12A 3OX8B 1IFRA 2ZUTA 2GTZB 1V3MA 1AQKL 2E9JA 5K1NA 3N40F 1KJ2A 1MFDL 5E5UB 1GKOA 1EHKB 1IBZA 1TQBC 3N41B 4KK9D 3UAJD 5JOEA 4UQAA 1JVOA 4IRSD 2O6FA 5TF1H 2ATAA 2IIJA 1KV7A 1EZVY 3LH2L 1CL7L 1Z66A 2N0MA 4R5XA 4B9FA 4L4VB 1SRDA 4X98B 2VXTH 3CN0A 3S96A 4LSQL 2P45B 3WHXB 5D96B 4PTUB 3R8BB 1BD2E 1E4KA 3CFBB 1V05A 5DI8B 4LEOA 3ML8A 3KXFA 1DBBH 2RB8A 5FUZH 3VSQA 4CADB 3IRPX 2UZIH 1JPGA 2M26A 2RJMA 3WJLC 1GY1A 2TRHA 5KYWA 2F74A 1AO7E 3FUHA 2RGSA 4GAYB 1A4AA 1L9MA 4YDVB 2B2XL 3MLUL 4Z7VA 4NRXB 2VW6A 2RHEA 2DQHL 1J0HA 4XCFL 2CJ3A 2BSBA 3G6AA 2HRPL 4L8CA 3RL2A 2C34A 4UT6A 2Q8AH 1W72B 2WXKA 3HB3D 1ZRUA 1LWJA 3ATDA 3ZR6A 2QVFB 3B7TA 3QDGA 2X4RA 4H88H 4TPRL 1S8DB 1Q0YL 2X4SA 4CDHA 2I07A 1ZKAA 1S3KL 4OZ4B 4F8NA 4JL2A 5FGCB 2XN0A 4B9KC 3KL3A 5ABZA 5HHVL 4DCQA 3KLSA 3QHFL 3JTTA 4NM4H 4PLNC 1TJXA 2I9LA 1PZSA 3N43F 2ZSVB 4Q0XH 5D1XE 1IGCH 4Q97A 1OCOB 2F0CA 1UVQB 2VXQH 1LWHA 4HPOH 5EU4B 4Q52A 1UZGA 4AVHA 3P77B 1NFDE 3VU2A 3V7AE 4PSRA 3CSYA 5DUPH 3MLXH 2C9SA 2XACC 3ARTA 1JYVA 4G42A 3IVKA 3QEUA 4X7FC 5GGQH 1CS6A 1PYWA 1I1RA 1E5CA 2F2HA 5EZLA 2MCPH 1OOAA 4BZ1H 2X4NA 2UWEB 3KBPA 3B2XA 4O51A 5GRXG 3PWLA 1DUYB 1URZA 3ZL4L 3TBWB 1XR8A 3U25A 4UQEA 4K71C 5JW4M 4UV4L 4PMFA 2ROYA 3GMQA 3BAXA 3G08A 1HHHA 4A2FA 2YR3A 4DPCX 5E4AA 1V7NH 3RGHA 1C8QA 1EHLH 3ARFD 4APQC 2DBJA 4FCHA 2IQ9L 4FHBD 2OYLA 3U83A 4Q9RH 4X7CC 3GS7A 4Z3IA 1OLLA 4NQXB 4YLQT 2FCBA 4OB5L 3VH8B 5JPNB 5EORH 4P5MB 1BGXL 4HWBL 2VSDA 1FYTB 2K3HA 3X14B 3NJMA 1IMHC 2NY0C 2AVGA 4JX0A 1R5WB 2OYMA 1Y0LB 1DYZA 1U8KA 4MKMA 2BSEA 4KRPD 2R8SH 5FCUL 3B7UX 3VGAC 4KMQA 2DWDB 3T6ZA 1X5ZA 3VXTA 5GIRA 1MVYA 3K2KA 2B0SH 2F5BH 2HVJA 1P6FA 2ZOWA 3AS3A 3GS0A 1ZT4A 4U1LA 4AYID 3FULA 4XBPB 5JUEL 1E8XA 3CFCH 3FUJA 1KELH 4HX1A 5E7BA 1PZCA 1OKEA 4WIQA 3ZHFA 1TTCA 5JMOC 5M94B 1S9WA 2F58H 1ZOXA 1A7BA 2VAAA 4BFKA 3NFNA 1HQRB 1QD0A 4PJFB 4N2CA 1H5BC 4OCMC 1SYVB 4OZHB 3RX7A 4Z7VF 1K4CB 4J6RH 4A1RA 3VA2C 3WUWA 3H3KA 1PU0A 3HNVL 3FB6A 1ZK9A 4EQ3A 1X5YA 4PS3A 4ANKA 4UQIM 4HS3A 4PJGA 1SN0A 4FNUA 4B7IA 4LKCB 1OW0A 4I1PA 3AUVA 2WW8A 4UU9B 1F2XK 3TV3L 1NDGB 4B0MB 3P3RA 5AW1B 4PJXB 3BZ4A 3BUYB 3QRGL 1UKTA 2NY2B 1PL3A 1A3ZA 4HAGA 3K3QA 1V3JA 1CT8B 5D1XC 4Y2NA 1GCYA 1MFCH 3VM7A 3KGTA 5KVDE 4Z7WA 5GGRA 2J5LB 4EOWH 2Q6WA 4PRIE 5E94B 1H3PL 3SYAA 3DC0A 4HFUL 1FYHB 4JZJB 5T1MB 3U7WH 1KEGL 3NCWA 2IFFH 4GW5A 2DMKA 5EUKB 4OLXH 4KKLC 4JFDD 4J3TA 3MRLA 4M8UA 3T3PE 3MV9A 3IT8D 4G8GE 4J12A 3BSZH 2FECL 1S7TB 1LEKA 2GJJA 3OWEA 4LNVA 1UZ8A 4LSUL 4CRPA 3FB7A 1OY3B 1GGBH 3BVVA 1VJSA 1Z2KA 3V0IA 1JS4A 1MIEL 2MNUA 2YC1A 2YD6A 4NHCL 3VI4B 1I1YA 3ZDWA 3OQRA 4I1NB 4MXVF 5JA9A 1PNDA 5DHVH 1KYOJ 1MW2A 5DA4A 3UG5A 5SWSE 1KGYE 4Y5XB 1EDYA 1SEBA 3WIAA 3OB0H 1S7QA 1KJMA 2J4WL 3L3HA 1IBFA 1P5UC 3ZZ1A 1KTCA 2YUXA 3KEDA 3PAZA 5EORL 4DKDC 4F7PA 1BZ9A 3ZKXB 1UOWA 2X28A 3AGWA 1A7PL 1IVLA 3QORB 2WXLA 3MOBL 3SDDB 3WELA 2DQCH 3CBKB 3QULA 4Z3FA 4OCWL 1FAIH 4HPYH 3B5GA 2VO8A 5HYQB 1Y1DA 2IGTA 1W72H 3EADA 1ZCRA 5BCAA 4KY2A 2BNQD 4A37A 1ROCA 3V7MA 1F3JB 1UWEH 2J20A 1CB4A 1BPLB 3G3LA 4KHXL 3OWRA 2P8PA 2I24N 4HLZG 3E2HB 1AZZC 4R97C 4DP1X 3EJJX 5F9AC 1PX4A 2R0ZL 2Z7UA 3U0WH 2Q7YB 1NGZB 4OV6F 3LYRA 1KELL 1G7HB 2GIYA 5K59E 1AQ8A 4ZDHB 5GRZA 5LGYA 4UTAL 2YLHA 5D7SL 5DRNB 5K39B 5EIIA 5AAMC 3KWUA 2IBBA 2R4SH 1MCJA 4FN0A 3PPEA 4MJIA 1QKZL 4EDXB 4M29A 5I1KH 1NM9A 3EYUL 1E9QB 4I8DA 3NPSC 2R56L 4NRYB 1WDAA 2VW4A 4PJ7B 4TOYL 3ETSA 3W9DA 1KCLA 5JNYA 5KYXB 1BZ8A 2NTFA 4FLSA 5BUGA 3KVQA 3ZE0F 5KVDL 3BP7A 4POUB 3LIZA 1HN1A 4EXKA 4NKDA 4KVNL 4NAMA 3KXFB 4MMXA 5CSGA 1NFAA 1OD9A 3MV8D 3G6AB 2EDOA 4HCRL 1R3HA 3IDMA 4L1LA 1GGIL 3WXVH 2WTPA 2EO7A 3M1OA 4NNXA 1JMZA 3R19A 4OD3L 2OSWA 1MCHA 1KZQA 2R1WB 3EFOA 3CXDL 3GSNA 3O6FB 4U1GC 4ZFGH 1ZIAA 3POCA 2G4GA 3VWKD 2XVGA 2XG5B 2DYSB 2APBA 2Q87A 4PV1C 5DCCA 1LMIA 1E42A 4KTDH 3DVGA 1PLAA 4FL4B 5CS7A 4IRZA 1U8QB 2CK2A 2W9DL 1XGPB 3FT2A 4QCIB 2D31B 3HMXH 1F1DA 4RVBA 1ND0A 3WDIA 2KS0A 2NXZB 1NCDH 3NAAL 1HH9A 1C16A 3RVTC 3EXJA 2WZPD 5DEJA 3PHSA 4MNGE 2DIEA 4HS6A 4JDZB 4U3XA 4P2RA 2OMVA 4OZFH 3KPSA 4KJYB 3QPKA 3CFMA 3MRRB 1NGPH 4HJIA 4FA6A 1R5IB 1REIA 1RIUH 1UENA 4ZXBD 2EINB 2ZSVA 2B1AH 5I8EB 4WI5A 3QPXH 3HMWH 4OAWB 4TL5A 4J3VA 3U6XA 4OZHE 4HV8A 2BP0B 3EJQA 2A73A 2ZUWA 2HN7B 3SDAD 1YYLL 2V8MA 4BCYA 1U92A 2PF6A 4RNRB 3KLDA 5GGVY 4YK4B 4LIQL 4KX8A 4UB0L 1YN6B 3BWUC 1U30A 4NJ9L 2IDCA 2HH0H 4O2CB 1FGVL 2FH6A 3H7LA 5EOCJ 1SJMA 4NNPL 1HHHB 2ALAA 3EHBD 3FBKA 4F80A 4AIXA 3OF6D 4DKFH 5BXFA 2XICA 4H4NA 2CHXA 3H0TB 2KZKA 3B2VH 4AKPA 1L7IH 1Z5LB 2DKSA 2UXTA 5BO1L 2UWEF 2BS8A 3CFUA 5JUEH 5CXPA 3B2UD 3ISRA 3RVVD 2DIBA 3BPLC 3PIQB 5MENE 1WHPA 3GI9H 1KMGA 4FZEH 4RZKA 2OW6A 2R2BA 1W9XA 4XWOD 5KYYA 2WB1A 2A9BA 2ZKXA 3MLSL 2UX6A 2CKBA 2V37A 3VXUE 2A9NH 1W8OA 5HDBB 3FTYA 4MX7A 1FNSL 1QRND 1E8YA 2XKUA 5D7EA 4N2DA 3SYCA 2VXSH 1X5AA 1JGIA 1YMMA 4QXUL 2P43B 4BHUI 2NY4C 1FQ9C 4DGWC 2J1XA 1SLVA 4KO9A 2MCG1 3TO4D 2RA1A 5I15L 4AQ8A 4JB9H 3FQ1A 4RA0C 1T1XA 3RZWA 2UX7A 1KTRL 1M1XA 1KXVA 3MUHL 2ITCB 3GSVB 1LEGB 2CA3A 2YK1L 3QIBA 3O45A 2ODHA 2VAAB 4AX3A 3S98A 3W3BA 2Q86A 2HLEB 4LEXL 1CTOA 2G75B 5TFSH 4WWKD 2ZX7A 4GEIA 2KLRA 4MS8D 2NR6A 2BLFA 3NDYE 3NSXA 3SQOL 4YSSA 1BZ7B 1IE4A 2MOGA 1LNUB 1UD2A 2P28B 1TENA 1XQ4A 2AI0L 3GMOB 3W9EA 1J8HA 9PCYA 4M1DH 3U82B 1KT2A 2X4PA 5GGUA 3JWNG 1CLYL 2DD8L 2HUEA 5MERA 3WNIA 2N1KA 5AW5B 5IMOA 1G84A 1YEWA 5BQ7B 5ESVB 4QT5A 2AJUL 3WN6A 5IIEB 2PLTA 3VD4A 1QPPA 3CLEH 4R96A 5I0VA 1AO7D 4MHHI 5HP5A 2JVUA 4HC1H 4K8RH 4L8SA 3G9AB 5IQ9A 5IEHB 5DXWA 1IEBA 4GT0A 5KVGE 2VABB 1FZJA 4UB0H 4JBSA 3O2DA 2F7QA 4ZNCD 5TF1L 3HZKA 1CGWA 2AQ1A 1RHHA 1WZLA 3UTTB 1AKPA 2R69L 2APXA 3L1GA 2FJGB 1U8PA 2DQMA 4H13C 4FA7B 1N70A 4I3RL 3U46B 1NCTA 4Q6KA 1CUOA 2C3HA 3DETD 3G6JB 5EU6A 3IYLW 3KJ4B 1BAFL 3BW9B 4DAGL 4J3UA 2WKGA 3QZMA 4P48A 4PJ6A 3EYFA 4X5RA 2R0ZH 1NCIA 4LGPB 5AL8A 5EOCH 3U0WL 5IKCB 3UAEA 3QJQB 3LAFA 1UM4H 4EN3B 5D7IE 4HUXA 1LDPH 3MQIA 5C7XL 1D7DA 1WC7A 4TQHA 4OLVH 4X6FB 3BKJH 2X4OB 5AKTA 4HUUB 4LPCA 4PRPA 5HVFB 2JJSA 3E0GA 1G7JB 4A6YH 4B0MM 4CGTA 1IC0A 1NCWL 4BH8A 1KJVB 1A1OA 4GMTH 5E8PB 4JM2F 3A67L 5EO0B 4M1CC 4BFEA 3NJNA 3ELAT 3WIHL 3VDBA 1XF4B 3PQYB 2VDKL 2XNAA 3EBIA 4QTIH 3ZIMA 3LVTA 1P0SE 1U33A 3W39B 4TNWF 4XZUA 1AIFA 5EWIH 4KY1L 5CCGE 3O4LE 1F3DJ 4V1DD 2QDVA 3MBEC 1J8RA 4H1LH 5E5RB 3UBXA 2QHLA 4K5PA 2NUPA 1HT6A 4MJIB 3RAJH 3KL0A 4N3TA 2FE0A 2E27L 2V9TA 4PWEA 1KFAL 1WWWX 3MOQA 3QK0A 3FUNA 3LN9A 4MQTB 3MLXL 1BSIA 1RULL 1T0MA 5E1AB 15C8H 5IESH 3NJXA 3U79A 4LU5L 1MFNA 2BY2A 4P3WA 3VAEA 4JQXA 1GS8A 3QJZA 4G6KL 3MROA 3PGCB 5TDOA 5B3JF 4NRYA 1B6DA 3VFUA 5T1LA 4R9HA 3ES6A 3UACA 2FO1A 3WS3A 1N19A 4I0PB 3EJTA 3ZO0A 2XPGA 5MEQB 1YNLH 3L2MA 3L2NA 3RKPA 2EIJB 2R2CA 4OF6A 5E1QA 5D71H 1ZLDA 2NT1A 1C8PA 3HE7C 4HWUA 3FUDA 1XIWA 3IGKA 5GGTH 5C86A 3ABKB 3V52H 2JKJA 1NGPL 4C4BA 4C4KO 4DZBB 2XQYG 3QQ3B 1FPTL 1XZ0A 4GKNB 1ZTXL 4X9YA 2GT9B 4OUUB 1N7MH 2WIIB 1KLFB 3QDJD 3NK4A 3EG9B 3ESOA 3SE9H 3B4NA 4J1UA 4E36A 4WRLA 4XNDA 1URLA 2X10A 4H2CA 3WDJA 2VLRD 2XXGA 5EU7E 1RZGA 1C16B 1NLBL 2ED9A 5LAXB 2ICWI 1N0XL 1CFSA 4HKXA 4PVLA 4P2OA 1RQ5A 3ELQA 3ME0A 2OXGA 5D1QC 4JPQA 4XCCH 3AREA 1J9RA 4JY6A 4QHNB 3VTMA 5BZDB 2DYRB 2VM4A 4L3CB 5HDOA 1IEHA 2C9PA 4BFFA 1CQYA 3FF7A 1G9ML 2IBZY 3GJEB 4HV8B 1TETH 4K8RD 3EH1A 4ZYKA 5IP4A 2N59A 3F3HA 5FO7A 4C55A 4KI5D 1OP4A 3VFNA 4P2YA 2FX9H 2OFQA 2NSXA 5CUSL 4KMLB 4WFFD 4OV5B 2AEQH 4TLKA 3TIDA 4YHOL 4XH2A 1IJNA 4G6FB 5EG6C 4NZ8A 2Z31B 1TZIA 2ICEC 5E00A 4MD4A 4Z95L 3BJ91 4G8FB 5DZLA 5IBUB 2B1HH 2ALWA 3CFJB 3LEVL 4JRWA 4LLUA 4IJTA 1QFWH 1XGRA 3FTZA 4ZFZB 1YUKB 1MCWM 4MNQE 4F93B 2YD4A 4JVWA 3MODL 2ZXCA 1WZ1L 5CHNB 2FJHB 4X80L 1LD9A 2OZ4H 3BLBA 5CILH 5FGBC 1WF5A 2JCCB 2NCMA 3OMAB 1OPGH 5AYQA 5I9QC 1PG7H 4ODBD 1IGIH 4LL9A 4KI5C 3GTTA 3T8XB 1JOIA 3O0RL 3TEXA 3PJSB 2DBLH 3TOPA 3VRLE 3FQTB 5DR5H 4MS8C 5J56B 3T1FB 3FQUA 3DUSB 5I75C 1VKXA 2EDBA 4Y5VA 1G7QA 1M42A 5HHME 3KDMB 1CF1A 3TTYA 3KPOA 4GJTB 4NSKA 4X8CA 3BLPX 4F7MB 3F8UB 4NWTL 3RL1A 3D25A 2HPOA 1MRCH 1CU4L 1PKOA 2VSKB 1UWXH 1FUNA 4N90D 2JI3A 1FDLH 5J3HD 2YD3A 5A40E 5AD0B 2JQZA 2IMNA 3DROB 2VRKA 4K94C 5ANMA 4B27A 1SOXA 1CD9B 2CNZA 3T2OA 3V0WH 3T2NL 3M17A 2E9WA 1G7MA 2F19H 3KEHA 1MF2H 1H9VA 5B4MC 2WUBL 4M6OL 3VFOA 1HNYA 2ERJC 2XQYA 2Q86B 4FZ8L 4Q6IB 3HVDA 2ADYA 2IAMD 3LCYA 5CAYB 2EH8L 1IV8A 2ITCA 4Z7UF 4G7VL 5GRYA 4WTWA 4IK6A 4QOKB 1JNLL 3O9WB 4EQ2A 3OSVA 32C2A 5EU3B 2WQWA 4ZX4A 4TNWK 1AJ7L 3OC5A 4OSUH 4BFIB 2VZTA 1NEZA 4M4RA 4LRIC 3QCUH 2LT9A 1WAAE 4WU5B 5HVHC 2ZOUA 4E0RA 2H3KA 2DEYX 3C5SB 3HC3L 4L05A 3D8MA 1E6JL 1I9JH 4M8RA 5DEGA 4HDIA 4HEMA 3RE0A 5GGVH 2ZG2A 5CMAB 3UABA 1ETB1 3RIAK 1U8MA 4MCZB 4TRPH 1N6VA 1RZKL 4AV4A 1YEEH 4WVRA 3VI3A 2XWTB 3IK2A 2FX9L 1BQRA 5E9DB 1HIML 4K9JA 4LHUD 1MJJA 2AXGB 2NUTA 4I4WA 1SY6L 5CJBA 4DVBB 4FLHA 3QUMA 1ONQB 4U6YB 5KVFL 4G9DB 5IJVB 4QNPE 2BVUA 2E9BA 2NY1C 2VR6A 2YFNA 4LGRB 4LVHC 3VQ1C 2X6VA 5DWUH 3QCVL 2ADGA 1T2QL 1X6LA 2MQGA 3CX5J 4YE4L 2E4TA 5TE7H 2G9KA 4WWNA 2C4XA 1F02I 4F15C 4JFYA 2Y5QA 5MEPA 4NM4L 4LO9A 5KG9B 3B9EA 3QXDB 3ULVH 4XNZB 1WIPA 4ONGL 1G5GA 3D3VB 2PW1A 3PXHA 4GG6F 2CGYA 4BK5C 4L4TA 5MENB 4HKZB 5CJOL 2Y1ZA 1VACB 4LVOB 5IB5B 2VQ1A 3UIYA 1D5ZA 1C5BL 4NN5B 2RBLA 3MXWL 1OP3K 3AWFA 4YVUA 2EE3A 3GS4A 2BNRE 2E3VA 4G1EA 1TJIL 4M56A 2GVYA 1YPZB 3EO1B 4PHXA 4CBZA 4F7TA 1LGVA 2FR4A 3GI8H 4HZ1A 2PNDA 1OTSD 3D51A 5L9DH 4NO3B 2BNQE 5F9DC 1VPOH 3RZCD 1SN2A 3QQ9D 1KJVA 4Y2DD 4U1SB 2AFNA 3Q2LA 4V33A 3TS8A 3MGTB 1BM7A 2VRQA 2XNAB 3H9HB 2H32B 3WSQL 1DJYA 2NDGA 2IC2A 2ZYSA 3KD4A 2GABA 4BIKA 5GSRB 3RGVB 3QUMH 3WHE0 5HJ3A 1Z9SA 3CE1A 2JKNA 4NC1E 4DUWA 5EC2A 3PP3K 1K9TA 1M2VB 2QZ5A 2YJLA 4M6ML 5FX3A 1YAZA 3WGVB 3ARFB 2J88H 1NWPA 3RWCB 3FPYA 1T20A 4X6BA 1SLWA 2PWDA 1WVZA 4M7KH 5D4IA 4LLYA 1U3ZA 5GISH 3MZGB 4RQQA 5HHPA 1PKQA 3QVAA 4XPTL 3TGXA 1QO3A 4Z7WF 5DUBB 5MEOB 4PRHB 1TTUA 3ULVF 3U0TB 5EBLB 4BEIA 4MQ7A 2IQAA 2COQA 4FXKC 1AHWB 5T1LB 1HE7A 1U8HB 3VCLB 4FYTA 1SDDA 4IGBC 3LN4B 5BS0B 3QCTL 1HK6A 4AI7A 4UI2A 2YOCA 2VC2H 3H42L 3NACH 3C8KB 4RMRA 3MOAL 4LVNB 5AVTB 1XIWB 3V0GA 2I25N 2D3JA 3DX6A 3HS9A 5B3NA 4MASA 4XPAL 1H19A 3ESVF 1T1YB 4P2RE 3STZA 5ANME 5ID1B 4IKNA 3GPEA 4AQAB 3KPLB 3EH3B 4F7EA 1FFNA 2J6EA 4QHPA 4X0KB 4NC0B 4R3SB 4AJYV 2HTLD 5FXCH 1F11B 2VZUA 5I6LA 1EPFA 3L3KA 5DC0A 3TNNB 3E6HB 3E38A 4WNQB 5AUMB 2HRLA 3TA3D 3O41A 3P11L 2UYLA 2IG2L 3LXCA 3P4NA 3DYPA 4KPHH 5DZJA 4MNGB 3RLSA 3OLEA 1V55B 4PJAF 5C0IA 1D5BA 2EP6A 3JVGA 2BXZA 4LCIL 3ME0B 1PG7X 1NAKL 5SWQB 4N87A 5FUCC 2VSCA 1EK3A 1E9PB 3MX0B 5GGTA 2NW2B 4PRAB 2FTAA 4TSBL 3WO4C 5BOZG 1FCCA 1GJWA 4GFTB 4ANXA 2BIQA 1RZ7H 2XRAL 1DVFC 5DURD 4BFJA 2OZ4A 3F6JA 2DLGA 2AITA 2CHWA 3MRHA 1AYRA 5KWYC 3TFKD 4CSZA 4E5XB 3CFJA 5A2CA 1KXTA 5E6IA 3WG7B 2WQ8A 1MW3A 3AG1B 3MZTA 3FQRA 2VDOL 3CXHK 3FCSA 1JPTH 4QF1A 3VFPA 2ZX5A 2DQUL 4PGDB 5FFOA 5JMRA 1O5DT 2C1PA 3H53A 5JOFA 1AS7A 3RNQB 4I7ZC 1MHPH 3PF2A 4NLHA 3CZGA 2ZX8A 3LTVA 5K9JL 1Q0XH 4NUGL 5ITFA 4LAQH 1ZVSA 5DHYA 4AC2A 3MJ9H 5DUML 3EJRA 4NBYB 4I3GA 3I50H 1UACL 3I6LE 5I1DB 4TSCH 2CMRL 2HT4D 4OCLC 5EB9A 4CKVX 4UQBA 3MACL 1PX8A 1T04B 1YY9D 5DD6A 4AXWA 3LOWA 3QDMD 5JHDA 3T1FA 1B9ZA 2VJ8A 3VTAA 5FECA 5L4IA 1OWWA 4M7LT 4F2MB 5M7QA 1JSYA 3KBHE 3KDMA 4YNYA 5D96C 1NANH 4KVPA 1QTYT 5INDB 4L9DA 5D55A 4JDTH 4R4FH 2H6OA 1OK0A 4WY7L 4D9RD 1FL6A 2BS71 4KK8D 4YHNB 2DAVA 1CDUA 3IRZA 3SPVA 1CLZL 3U4BH 2M2DA 2FD6L 4F9LC 1XGZA 5ETUA 4HH9B 4PJAE 4I89A 3ARDB 4XNQA 1NQBA 3R7RA 4I0KA 1TVDA 4X9HA 3RTQC 3U0PB 4CC4A 5IM7B 4JFQB 4OQTL 1NPUA 4M03A 4R6UA 5DJ0A 5F44A 2XN9A 4N2OA 1BGXH 3VU1A 3M17B 1F90L 4HIJA 4JUSA 5AG8A 3SKUD 3VSTA 4K3HA 1J1OH 3OZKA 2KQNA 3QAQA 4JFXB 3QG7H 4LOVA 1QKZH 1MFBL 2XX0A 5D7LA 1VF5C 1HOEA 2WXFA 1AZNA 4QAWA 3SE4C 1HWHB 4BZ2L 4WUKH 1GJUA 2ZIDA 1ANUA 1JGVH 3IDJA 5D70L 1MSPA 1AXSB 1MAML 4N2FA 1QA9B 4ZI8A 2HKFL 2VKWA 3CQFA 4QHKI 3V0AC 1TYEB 4HOMA 4P2QB 5C6TL 1VGEH 1RZFL 1G6VK 2WBXA 3BAJA 8CGTA 2ESVA 3AG3B 3JWNE 4MLSA 4WFHE 3VI3B 2AEIT 4LPUA 5I1IH 4NWUH 4PIRF 1EHNA 4P9HH 3T5WA 5K59F 5H94B 4ODTH 1KIQB 3VDCA 1HXKA 3K1DA 5CJOH 1F4WH 4MS6A 3V4VL 4CC0A 5T3ZE 3QUMB 4PJ8B 3DSFL 3MXWH 1NBVL 1CR9L 4OJFH 3V95A 4KAQH 1I1CA 4Z77B 1Z9PA 4HOWA 1BD2D 2Y7QB 3PFUA 4APXB 2QTEA 2ZNWA 3IDGA 3QPQC 2WXHA 4WO4B 4HT1H 1QTPA 4FJYA 5JW5B 4APQB 4TM9A 4ZOBA 4GO9A 3D2UB 4Y5YA 5EEZA 1MCOL 3ARVA 3TCLB 3OL2A 4I77L 4GRWH 1HQRA 4NOBA 2OL3L 3KVPA 3OAUH 4FHJA 3NBNA 5FYKD 5B4MD 3VGGA 5SX5H 4X4XA 3OD3A 2FR4B 3RWGB 3O6LH 2LFEA 4DSYA 3D5OF 5F0MB 3TL5A 4LL1A 5AAWA 5MI0C 1AXIB 1I1AB 2BINA 1QSFE 3L3JA 1RIHH 4JM4L 2R0KH 4ZQKB 3V6FA 5DMIH 3RX9A 2JNZA 3T3PF 1P1ZA 1TVHA 3L1OH 4ZW3A 5CKAA 5I1LA 4ZAKA 5AVRB 4PVNA 1WAAF 3GUTA 2XZQH 1X4XA 1P4LB 2BRRL 4FTVE 4WI6A 2LTQB