4X7SH

Structure of omalizumab fab fragment crystal form 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNYNPSVKGRITISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epididymis luminal protein 214
publication title Structure of the omalizumab Fab
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7sH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7sH01
2KZWA 3P11H 2AKRB 1T66D 3L7FA 5BOZG 4OI8A 4NHCH 4M5ZL 3IJSA 4N9OB 5ANMA 2A77H 4XPTH 4PJDF 4WI6A 4ZFOA 3UC0H 1T2JA 4C54A 5E00A 3MV9E 3ISWA 3C5JB 5I9QC 3FFDB 1UXWB 5DD5H 2NY7L 4OFVA 1IGFH 5D2LF 1WFNA 3FT3B 1FIGH 3MBEA 2DQHL 1XGUA 3KPSD 1NKRA 3MLWL 4G8IB 1J1OL 5TQ0H 3HCVB 2D03H 3V2AR 4OD2A 1CQKA 1BZ7A 1TQCB 3MV9A 5F9OH 5TQ2L 2V5MA 1N2RA 3VXME 5DR5L 3SOBH 2PTUA 2OXGA 3SPVB 2DTML 2WLZA 3CLFL 1B9ZA 1R6VA 3MCKA 1AXTH 2A9NH 5ERWA 3V4VL 4RGMC 1RQ5A 3WKML 1U8JA 1C5DA 1KLUB 3O2WL 2IG2H 3NCYP 3DVIA 3UTTB 3RZCB 4AIOA 1VB9A 5J89A 4HXAH 4V2BA 3VXMA 1JMZA 3GIVA 4XHQA 1QRND 1RK0B 4YHPB 4M93B 1J05A 1XIWD 4KFZC 3NCJH 2BCKA 3WV0A 1U8QB 5CGTA 4JFEE 3EYVA 4L8SB 3T0EE 4RIRB 1S9YA 1XCTB 3QB7C 4LPCA 2W65A 4BH7A 4YPGA 1L0YA 5CBAA 3SQOL 1X5ZA 4MCYA 2OYPA 2GJ6E 1D6VL 4PREB 1L7IH 3KLSA 3CH1B 3GUTA 5C0IA 3H0TA 2PNDA 3WN5C 5ICZA 3SKJH 4JFEA 3TO4B 2Y5TB 1FFOA 3T0EA 1UM4H 3CFKA 2R2EB 3V7AG 2X4RA 3R06A 5TE6L 4ODXA 5MEOA 4HPOH 2JJUA 2O61A 4OLYH 1IEHA 4XMLH 1LDPL 1J8HB 2GJ6A 4POUB 3S36X 5F3BA 5DRXA 5EZOL 3MLYH 2YMXL 2D31B 3BQUD 1EBPA 4ODHL 2B4CH 5BVJB 4I9WD 3V6BR 1X6LA 25C8H 4NQDE 3ZKQD 3HMXL 4I77L 4E41E 3NA9H 3EHBD 3O41B 4TVPD 3NTCL 3O8XB 4RGNE 5DHVH 1JYNA 3O3DB 4KJYB 4MAYD 4R4FH 2R0LL 4JQIL 3BP5B 2OR7A 2P5WD 5DRZB 3D3VD 1I8LA 5IGXL 3D48R 1I3VA 3DI3B 4NQDA 3BESR 2G2RA 4LSQH 1SY6A 4Y4KD 2APWA 4E41A 3Q1SH 2B1AH 5IMOA 5F1NA 5DYOA 3ROLB 4G9DB 2HJFA 3L3DB 3FQXA 2WIIA 3UTPD 3QSKB 3BW9A 3DX6A 5HYIA 3MREA 1X6NA 2NXYD 1N26A 5HHPA 4R6UA 1IGYB 1MVUB 3D18B 4ZS6D 5EOCH 1WWBX 3VFUA 1PJ9A 3HE6D 4XNXL 3SKOA 4Y19D 1NANI 5C0RL 2HMID 1UVQB 5A2FA 3GMMA 4JG1H 4E0RB 4PTTB 3P9LB 2RBLA 5MERB 5MEND 2XZAH 4G6KL 4JY5L 2OR9L 4M6OH 3OJVC 2FGWL 3MOBH 5E8PB 4AEIH 4GS7B 3VE0B 3SKMA 5E94B 3BSZL 2RIKA 4WWKD 4J12A 4NQXB 2JKXA 4POZD 4QXUH 1YY9D 5F7WC 1FNSH 2M1KA 3T4AB 4GFTB 3DBXB 3MRKB 3WXVL 2QQKL 1D9KA 3QPXL 1EGJA 3DX9A 1D5MA 4NCC2 2P24B 1F4HA 3GNML 1A7RL 1EPFA 4OZFG 5FYKL 4GO6B 2DL2A 5FKAB 5D2NA 8FABB 3GMOB 4GKSB 1MFBL 4Y16B 5CP7B 5C2BH 4YXLH 5JLZA 3G9AB 3PGCB 2D7PA 3LB6C 2X7LB 4A6YL 4G7YL 4O2CA 1GGTA 3CDGB 1T1WA 4JFXA 4HJ0C 3VJ6B 2EE6A 4Q9QL 3EDFA 2W9EL 4HIHB 1W0VB 3EDJA 1CXLA 5KVGH 3PWLB 4MJIE 1HHJB 4DUWA 3U4AA 3IRZA 4LCWD 3AB0C 3GMLB 1X9QA 3ZLQC 4RISL 2NY2D 3TM6A 2CIIB 1KTDB 5I1JL 4WHYG 5HY9A 3B8SA 2CKBA 1NBVH 4MWFA 5TDOA 1KLFA 2VLRD 5D1XC 2J3SA 2YD6A 4OJFH 5KJRL 1MY7A 3DO7A 5LGHL 3VFWB 1GCFA 3HC3L 1NEZG 5IOPB 3X11A 3LIZH 4YLQT 3A67H 3I6KA 5EO1A 1T6VN 4F57L 3PHOA 4KUCF 1II4E 1QO3B 1S5IH 1UT9A 1VPOL 4OFPA 5C08D 1Q1JH 3RX8A 1IM9A 1GGUA 1SM3H 2FX8L 5IROA 1RZFL 3W39B 3SE8L 1U3JA 1ND0B 5SX5K 4WFEE 4JO2H 4JJ5B 2CXGA 3GJFB 4KAQH 1R3KB 2ZJSH 4FQLL 2EC9U 1DANU 4DKFL 4NKMA 5C3TA 4CVXB 1IJ9A 2AQ1A 4QNPF 3FL7A 3Q6FB 5HXMA 5IMLA 4L3EB 4OCMC 1I7ZB 3TJEH 2HLFD 4HG4J 2EE3A 5JIPA 1ACYL 5T3ZD 5A43C 4HZLB 1HIMH 3G6AA 4NRZA 1IM3A 2X9WA 1AC6A 5E2TL 4PS4L 3RWDB 4HW6A 2VXQH 5EU7C 5CUSH 1HEZB 3QFDB 3ZKNC 3RWEB 1KB9K 1OSPH 2PO6A 3P0GB 5IESL 4AENB 4MD4A 1S7QB 1ZHBA 3I6LD 5I76B 1WGOA 3BGAA 2BSRA 1QBMH 4PJCB 3REVB 4LRIA 3CNKA 3PGDB 2YRPA 1A7QH 2UV3A 4MD0B 5DK2A 3OKMB 1HSBA 3VW3L 2VRAA 4ZTPL 2ZNXA 3O4LD 1KJ2L 3MV7D 3FOMA 4JGMA 4QYOA 3C87A 4PRID 4O5LL 1H9VA 4L8DA 3ZYJA 3GRWH 3KJ6L 2FSEB 3VA6A 4YXKH 3LKQB 3S96B 2ICEA 1MWAL 3DHJA 2G5RA 1S78D 3KWWA 1CE6A 4CJ1A 4HHAB 4P2OB 5TE4H 2OTWA 4JZNB 3HAEG 1A1NA 1FVDB 2DQIL 4DZBA 2ERJC 3U7WL 3MR9B 3C5ZC 4R90H 5D6DC 4OIIL 1KUMA 3NZ8B 3QDGE 1T21A 1D5XB 4F3FA 3JZ7A 1W0WA 3GBLA 4LIQL 1MCQA 5IV2B 2PXYB 3D69A 15C8L 3VWJC 1B0GA 3JUZA 5IQ9A 2YD1A 3ZL4L 1T03L 2BOCA 1NMCB 3GHBH 1Q94B 4Y5YB 3ZHKA 3QDGA 5IIEA 4ZO6A 5D7SH 4S11A 2ZSVA 1A0QH 1JJUA 3ZE2E 5T5NF 3S4SB 3PQYD 4JRYD 3N0PB 4Y5XB 3B83A 2DQJH 2DAVA 2VB5A 1A3LH 4IS6B 2VIRA 3CFJA 2BVEA 4U4BA 5MI0B 1EHAA 1CXHA 4YWGL 1HQRA 1EVUA 1FBIH 3CPLA 3TZVD 5C07A 4XZUA 5HPMA 2G9HA 5LVEA 5HVHB 1ZK9A 5IR1B 4PLNC 5DDHB 5J9PB 2FEDD 4ZDHA 3I6GA 1MCEA 4FFYH 32C2B 1ZGLM 4OF7A 2ATPA 4JQVC 4HS8H 1FO0A 1HWGB 4HKXB 2O5YH 1TZGH 2QQNL 4G42B 2GY7B 4JDTL 3AAZB 4F7CB 3QJHA 3ALWA 5C0CD 1KFAH 4HV8A 2ADGB 2P8LA 1RVFL 1SYSA 3DXAD 1U3ZA 3KYKH 2W92A 4XT1C 5DLML 4S1RL 1IAKB 1LNUA 2ARJQ 3O6LH 2MFNA 4E42A 4NZUL 4ZPTA 3VRIA 3I9GH 3U82B 3AXLB 5I1DB 1X4YA 2DI8A 4PJ8C 1KIRA 2VDQL 1C7TA 1L0QA 5BV7L 2NPLX 1EUUA 5TH2B 5C0FA 4X4ME 3QIWC 5IW6A 5DJ6A 2C4FU 1XF4B 2XN9D 3RPKA 4ISVB 4NM4L 2OTUA 4JKWA 4M6NL 1F4YH 1NBZB 2J7LA 4PTUB 1RJLB 5KTEH 3QUXA 3FN3A 4Z8FL 2F58H 4ODSH 4PGBB 2DIBA 5BVPL 1OP3H 1L9NA 4X4MA 1WLHA 4HAGA 2VKWA 5AYQA 1AGBB 4XTRC 4NQEE 4H1LA 2Z0BA 3SDCD 3BISA 3SQBA 2EYSB 4H8WC 3HC4H 4V1DE 4MXQC 5C9JB 1W72H 5T3ZH 4GMTL 4PJDB 3ZKXB 3F7QA 4M7LH 4CAGA 4RAHA 1O0VA 2R69H 1NFDF 2NY4C 1N6UA 1U8IB 4K71B 3LEVH 5DMKA 2NMSA 1HOCA 2CSPA 4NQEA 4WU7B 5A16B 4BSVA 1QPPA 1G9NH 1T5XA 2IALB 5E8DH 4V1DA 5D2LB 3V4PH 2WBJA 4PR5A 4ODUA 4JM2C 1JGVL 4OLXH 3LHPL 5K93A 3NFPA 5ALBL 5FM5M 3RDTD 1KCSL 1PDKA 4HDIA 3ES6A 1LP9B 4TUOA 2AEQL 4DN4H 4KK5D 4EKXA 2YKLL 1I75A 3G6JF 4XP6H 1A3RH 4FRWA 1CK0H 2NY1B 4PGEA 3NVQA 2ED7A 3E2HB 5FECA 1QBLL 2M8XA 5D7LA 4F7MB 1OAQH 3B2VL 1HCVA 2FHFA 4GRWH 5IQ7L 5L8JB 1FFPB 1BD2B 4P5KB 5JW5B 2E7LA 3RWJA 3BGFC 5I2IB 4OKVB 5CZVH 1TQBB 3U1SH 4RMUA 5IB1A 4JPKL 5ITFA 2A0LD 2W9DL 3QDJB 1MREL 4A2MA 4M3KB 4IOFD 4Z7OF 5J1SC 3MV8D 4OF3A 4G8GE 4U1MA 3SE3A 5BS0D 4KKBC 5I66A 2IAMC 1X44A 1BZ9B 2J5LB 3IGAB 5AUMB 2H6PA 5FGCE 4EXPX 3DROA 3C09C 3QIUD 1JGLH 4QXWA 1J86A 4EUPH 3EOTH 2ZUYA 2A73A 1HHKB 3QEHB 3WIHL 3SJVB 1HHGA 2HYMA 1KLGA 2H3NA 3I3DA 3VH8B 1BFOA 1A2YA 4G8GA 1U8OA 3MXVL 1EHLH 2H32A 5EG6C 3X3GH 3MRFA 3H7LA 3TYFA 4C4KT 4JHAL 3KLHC 3L5IA 5DT1H 5GGTA 4GMSH 3F5WA 5K59F 4J23A 2AQ2A 4MA8L 1Z5LA 1IGML 2JJWA 3BPLB 4HPYH 2GSIB 2IEPA 4DW2L 4N1HB 5EU4B 1S7VB 3VFRB 5L8LB 1R3LB 1RZJH 3U2SA 3CX5J 1SBBA 7FABL 5MP6L 3ULVF 3RA7H 1J11A 1P1ZA 1JGDB 5ADOH 5BQ7A 2B4CC 4W68A 4TYUA 1IGCL 4B50A 4M5YL 5FUOH 2FBJH 1CFSA 1HHHB 4WHTA 4I0KA 4F33B 3VGHA 1OTSC 1FH5L 3T0DA 3TBYB 3VXPB 1S9VA 1LILA 1LO3H 5J6HB 2W0FB 2CR6A 5D1ZA 2BRRH 3BN9C 3HFML 4HS3B 2NY6D 1FFRA 1WWAX 2VSDA 2R2HA 4FHBD 5KVEH 4NO2B 5FO9A 1ZLWH 4GQPH 3JV6A 4LASH 2X41A 2HWZL 1JN6A 4DWHA 2QR0A 3ARGA 3MYJB 4YZFF 1AHWC 2NZ9D 4FA8A 5CEZE 4HIJA 4MNQE 2IAND 4RQQB 3ARFB 3TCLA 3H8NA 1YMMD 4YDJA 4YDKL 1JFQL 4G9FD 3D87B 1CXEA 1VGKA 3QNYB 1GAFH 2ED8A 1JF1B 4OF6A 4DVBA 5SWSD 4LCWE 4W6YB 5IB3A 1ZSDA 3CSPA 1EJOH 4MNQA 3ESUF 2L4OA 3HUJF 3X12B 5E5MB 1JI1A 1BVKB 4TUJA 4U1JB 4LSSH 2DRUA 3R0NA 4GQ9L 1P4IL 3IJHB 3D39B 5I0ZA 1WVZA 1I7RB 2OI9C 3L3GA 3Q3GA 4DQOH 5GGUA 4LKCB 4EXKA 1R24A 4DAGH 1XGPB 1DQDH 5C08E 4YUEL 3PWUA 4CADB 4Y4FB 4LLVA 4XCCL 1K4CA 5FF6A 4FFZH 4U6VH 3QWQB 2HH0H 5DZNA 1CYGA 3B9KB 2CDFB 3UC0L 5I6XC 4PUBH 4KPHL 5DRNA 2PCPA 3DETD 3OR6A 5C08A 4DZ8B 4X4YB 1QEWA 4YEFA 3SE9H 1ZVSB 2ZPKH 3MRCB 4L9LC 3QG6B 4XCNA 2WQRA 2QJDA 4PV8B 3NOIA 4OAWB 1JE6A 3GM8A 1C1EL 3DRTB 2VDNL 4URTB 4CRPA 3BUYA 1A9BB 1QTYT 5HHXL 4K7PL 3DVGA 4GRLB 3HE7C 5KG9B 2BY1A 1BM3H 3WS6C 4ZFGH 3RVUD 4G6FB 4H0IA 5EOCJ 2A9NL 2IQAA 1PAMA 4NKIL 1IZJA 4ZUTB 1VHPA 1EEQA 3INUH 4FZ8H 4ORZC 1EMTL 4U6YA 2LTQB 2OZ4H 3NACH 4PP2A 4Y2DC 4JFHD 2EECA 1IAIH 1ZEAL 4PRIE 5TJWK 1I8MA 1MCWW 3KPOB 4AMKL 5JOFA 1D5ZB 2JK5B 5I16B 2VZOA 4M43L 3AS0A 4U3XA 3KYNB 2GK2A 2AABL 4ZO9A 5JPMA 3PDOA 3TNMA 1NC2D 1YNTB 4L4TD 4PJ9D 5LGJA 3KPRE 1YECL 2C5DC 1U3HD 5ABDE 4S1DC 4YGVB 3WD5H 4PRIA 5HBBA 1BFTA 2J8UF 3OAUH 4NUJA 2IH3B 3QPQD 3HLAB 3KXFA 4NM8H 1PY9A 5K33A 1T89C 5T1KA 3V5HA 1Z9SA 1JHTB 5F7KC 1RUMH 5GXBB 3KPRA 4HX1A 2QSTA 4U33A 4MXVF 1WEJH 5TE7L 1JNJA 5ENWA 3B3IA 1CFVL 4XMLL 2HFEB 4JFDE 4RWYH 4U6XA 3C8KA 4X98A 5IBTL 4BQ8A 4R4ND 5CJOL 3W0WE 4QRPB 2A38A 1A6AB 5DEFA 4U0RC 1A9EA 4YFDB 1DQJA 1NKOA 4RX4D 4WCYL 1IAIM 3E6FA 5KSBF 5DFVC 1EZVY 4JO4L 1RU9H 5FOBA 2PYED 3S5LB 3GSRA 3RJDA 2YWYA 4OQ1A 4R4FL 1OWRM 4IRJD 4PLKC 4JFDA 5KW9H 5JA8B 4X6BB 3FFCB 4R3SB 5FAAA 1BMGA 3W0WA 1UWXH 3EYFB 4O4YH 3HZYB 4YBLB 5HGAB 1WK0A 3Q1SL 4RSVA 3EJYD 1QG3A 2B1AL 1RULL 3L3OA 4QO1A 4PP1C 1YEFL 2HFGH 3VXUE 4Z7NE 2JB6B 1BREA 5EULV 4UU9A 1CD0A 1CLOL 2C4XA 4LL9A 2VLJD 3Q6GL 3GMPB 1CFTB 3MJ8A 3M8OH 2A6IA 4HUVB 4HFWA 3WE6B 4UILL 3MV11 3VXUA 5F7EH 1ODAA 1G7HB 5E4EC 5IVOA 1X3DA 1FVCB 5C0CE 1HKLH 4YDVB 2AI0H 1J0JA 3CZJA 3UTZA 2XZAL 1G0YR 1YY9C 4M6OL 4PJAE 5DURD 4TSAL 4KRPB 2BHYA 1EUTA 3QO1B 2ADIA 4LRNL 4LSUL 1LO4L 4OCWH 4ZUSA 2R4RH 2NW2A 3TT1H 2HT2D 1FRGH 2XN9E 3LPWA 1L4IA 2A6JB 3DV6B 5HVFB 4NRYB 4ETYA 4PJAA 3RWCB 3OJ2C 3D0VA 4OZHF 4QOKB 1OP5H 3O3BB 1MI5E 3T77B 3U9UB 2R23A 4AEHL 5JQHC 1T1YA 5B39B 2HFFA 3RTQC 3BGMA 2XN9A 3NIFE 3O9WC 2YPVL 3WXWH 1DQQB 2GJZA 3L3JA 4AIXA 4LVNC 3WN5A 4UTAL 1M71B 1UZ6E 1RMFH 4OZFA 1MI5A 4Y7MA 2NY2C 3FB5B 2CQVA 4OLZH 5BW7C 4N0UE 2NR6D 3BE1H 2DWEB 3PIQB 4JZOA 1AR1D 5J3HC 5KVGL 4YHYB 1UQSA 1H8OA 1AGCA 4HUUB 4LVHB 5F9WC 1U8KB 4KK8D 3NPSB 1LO5A 3TGXA 3TH4T 1DDHA 2NXZD 1G7PB 3ARYA 1E4KC 5ETUB 5F97E 5AZ2H 4N0UA 2DQUL 2UWEE 4GRMB 4MX7A 4EJ1C 5IBLC 4HK3J 1CTNA 3MGOA 5INCA 3DX7A 4NFCA 4JFZL 2JB5H 1U8MB 4FP8H 1SQ2N 1MHHB 4KRNA 1GOHA 1NFDB 5HYFA 1X7QA 2EH7H 5J56B 3QUML 1GC1H 1QSZA 3MODH 4CL7A 2Z93A 4JFFB 1S5IL 2UWEA 4R26H 5TPWL 4PRHB 4MJ6B 1HILB 2DLEA 5HHME 3PL6B 3F7YB 2X4NB 1I1FB 5IVZA 2VMFA 4HLJA 3V0WL 2YD4A 2E3VA 4M7KL 3EDKA 2LU7A 3REWB 1R5VB 2BXYA 3TV3L 5JXEC 4ETQA 5HD8D 4LLWB 4HF5H 4K7PY 4M6MH 2DIJA 3MRPA 5AD0A 5F8RC 5DSCA 3WNNA 2WUCL 3G6JB 4MDIA 2KPNA 4K7FB 4MD5A 4OCRL 3T0XA 5EUKA 1JMXA 5FA3B 4DN3H 2OL3A 4N1EA 5EO0A 1HIML 2DWDA 2VXUH 4P99A 1ZOXA 2R2CA 1G9NC 1OD7A 3W9DB 4HLZH 3BP7B 5CUSL 5JUEH 1K8DA 1AE6L 2RFXB 1Z6JT 4P2QB 4QRSB 4W6XB 2VDKL 5C92A 4TVPL 2VZTA 3C5SB 4BZ1H 2E6QA 5H2BA 1KACB 5D7IE 1S9KC 2R4SH 3B8YA 4LP5A 2PTTB 4ZTOH 2BNQD 4ESKA 3NIGE 1XR8A 1I1YB 4WW2F 4P2YA 1XF2B 5LBSH 2C3VB 4KROC 3FZUD 4IRZH 3UPRA 3H9SE 3MNZB 1FL6A 1E4JA 4RMSA 3OGCB 1G6RA 3GRWL 1C12A 3HI1A 3VFVA 5D7IA 5FA4B 3QI9B 1LE9A 4JKPL 1J87A 3HZMB 4WUKH 4YXKL 2N7BA 4EIZC 2R56H 2AEIT 3CVHL 5IFJA 1JWSB 4NBZB 2FJHA 3G08B 1N5YH 3ULSA 3PV6A 4G8FB 3X13A 4R90L 3H9SA 4I4WA 1HXYA 5C9KA 1KULA 1HYSD 2N4IA 3UYRH 3ZYZA 5EU6B 1I9IL 5EU5B 4KH2A 3WSQL 2GTWB 1OAZH 5FO8A 4Y8DC 2PR4L 1DUZA 1AP2B 1P69B 1NBYA 5CEYB 3G5ZA 3PXHA 3EO1B 4MZ3A 3CFBA 1G84A 4KI5F 3BEVA 2X70B 1U58B 2EDQA 4FG6D 43CAB 2J8HA 4EDWH 2OLDA 3QR2A 4M48H 3W11D 5DQJB 3CK0H 4BSWA 5JZ7C 5GSVB 3SCMD 3LRHA 2X4TB 1TCRA 4HWZA 4QHMA 3B2UD 3VFTB 2HVKB 4WHCA 4EN3B 4FMFA 5DMIL 1A3LL 2IANE 3HNTL 4FXGB 2SEBA 2CH8A 1T04B 4XVUC 4G9FE 1D5IL 4X6DE 3P73B 1RZJC 4A6YB 5SWSE 3KYAA 5EU7E 2W0LA 2BP3A 2XRAH 4Y4HB 4XXDB 4EI6B 4U1LA 5DF0A 4QGYA 5I9QB 3LAFA 3HC0B 3ZKMC 4G9FA 3RNKB 1DLHA 4NGHL 4X6DA 1F5WA 5I1IH 4LPTA 5I75B 2R39A 1UJ3B 3DTXA 1ZHLB 5FUCC 5SWSA 3V52H 5E24E 1IEAA 1OARL 3I84A 1OAXL 1K2DB 3ECBB 3T4YB 5FGSA 1QBBA 4MLSA 1OHQA 1KFAL 2F8OA 4HBCL 3I50H 1AGFB 5JXAL 5TF0A 4X6EA 5DK0A 4PLJC 1TVHB 2Z31D 4ZD3H 1OCWL 4YR6B 3SN6N 5IEKB 3BYYA 2P48B 3MRJB 3CLEL 4LARL 2EH8L 1KG0B 1WZMA 1QQDB 2FJGB 4NZDA 2P8PB 4FQJH 4KXZI 3QUYC 3WJJA 3VMOA 2C3XA 4YX2H 5GGRA 3VG0H 3NFNB 1T7XA 1L6XA 3CX2A 5A3IC 1N3NB 1M7IA 2R0WL 2UVEA 3M45A 4ODSL 3MCG1 4BSJA 2X1XR 2YXFA 3VXNA 3OPZH 3P4MB 1M05A 3WKNA 3C5ZA 4EUPG 4L3CB 3KYMB 2YD3A 1RZ8A 1NCAH 2X4QA 1QA9A 1DP0A 1S9XA 5HYSG 1DLFH 3QIBD 1XF3A 1CG9B 5T3ZL 3BPCB 1LD9B 3F65A 1UACH 3VWJA 4KZDL 2R69L 4XPFH 5FYJU 4OCYH 3QEUB 3C8HA 1P5VA 1SMAA 3BPNC 4UT7L 3UBXA 1FNEA 1NAKH 1G9NL 5DTFA 5DVKA 1CWVA 3V4PL 4BFBD 1KT2B 1XCQB 4OLXL 3OKKB 3SGEI 3QCUH 1I1AB 4JRXD 4LF3B 1WZ1L 2MCPH 1ZANH 3C6LC 1LK3H 5F7DA 4XHJD 1I85C 3BZ4B 1KJ2B 3MRQA 1U36A 3N85H 4XP6L 1DSFL 1IC1A 4HKBB 3WJLC 4WNQB 1QSEE 4NO0D 5CD5D 1MWAB 4WHDA 3LEYH 1H0DB 1LMKA 5T3XH 1JV5A 1OAQL 1FFNA 1BZQK 1AR2A 1NEZB 1S7RA 4QTHB 4GAFB 4OGXL 4QWWC 5IHZB 2O93L 4X0KA 5CZVL 4IOFC 1NC2A 1MHPH 5F7YC 3OG6B 3OHXB 2D7OA 2CKNA 4FXKA 2NY0B 4QCIB 5D7JB 1A6UH 3FO2A 5DS8B 4JQVA 1QSEA 4OQTL 3BZFB 5HYEA 1Z0MA 4JREB 2VZ1A 1RK1A 3JVGC 5DUPL 5GQBA 3TVMC 3K7UA 3C60A 3O11B 5IKCB 3T3PF 4P3CH 4P5TD 4NNXB 2PYEE 3BD4A 3TN0B 4G3YL 1NCWL 2UYLA 4OLUH 2YUWA 4X7SH 3ARPA 2UUDH 3VI3E 3IJYA 1JGLL 3EYUH 4ODVL 4PY7A 3RL2A 4WFHD 5H37H 1BQLL 5E9DE 3QFJA 2C3WA 4CNIA 3TNNB 5F21B 4CDHA 4XI5D 4GW5A 2XTJB 4RX4A 1EHLL 1S7TB 3QIWA 5E6IC 1LK2B 5CCKH 2PYEA 3TIEB 4BFGA 1NGXB 3GMNB 3WLBA 2CJUL 1KTKE 1WCBB 3ZKSD 3M1BA 1E27B 2DQEH 1TXKA 5KSBB 12E8L 2YEZA 5E9DA 2BSTA 3N9GH 1KPVB 4HPYL 3BZEB 4JEGB 4WW1A 2EDBA 3KYOA 4TTDC 3LKOB 1F45A 2MSPA 1URLA 3OZ9L 1JGUH 1X5AA 1Z9OA 3NZHH 1HH6B 1MPAL 3GGWA 3LKNA 3DO3A 2IBGA 2KZ1B 2NY3C 3BKCL 3UZEA 3WLWC 2FBJL 4X7TB 4O2FA 1CDCA 2JIXD 4XNMA 1RZGB 2GAZB 1UWGL 1HCFX 4RAUB 2YSSB 1DBBH 3E6HB 4WO4D 1RIUH 4PRBB 4ONGL 5BV7B 5A2LH 4EZMA 3LMJH 3OKOB 1FG9C 3MX0A 1QFWI 3OXSB 3BWAA 1N0XH 3ZTJH 5IF0A 4MAUL 4QHNA 1T83C 4D0BB 4EI5C 4QXTB 3MBEB 3KLAA 2I60H 3MXWH 3OWEA 1NC4A 4NQUA 2E9BA 1AD9B 1IC4L 3QA3A 4E5XB 3MV9B 3OXRB 1F00I 1IKFL 4P3DA 3C9NB 5INDA 3R4DA 2ZCLH 1K4DB 1MLBA 3TA3B 1PBYA 4PJ5A 4OZHB 2FJFA 2V2WB 3GJFH 3PV7A 4O00A 4AZ8A 4MNHA 2MQ0A 3WFDH 5B38G 2CLZA 3MCKB 3SDDD 3DNKA 3BD3A 3DYPA 3MJ6A 3UCRA 2BVQB 3GEWB 3SO5A 2X4SA 4ODWB 3UJIL 5ISZD 4H88L 5GRJH 5GZOD 3G5VB 4L4VB 4XH2A 3VXSE 4QT5B 1QLEL 2FECL 3RVWD 1QLFA 2E8YA 2GHWB 3X3FH 1PYWA 1RJYA 1SMOA 5C7XH 5HHNA 4D0DB 4NN5B 1K6QH 3VWKB 4NKDA 2FZ3A 2GIYA 1U3YA 1ORSA 1V8HA 3VXSA 1UB5B 1J10A 1QR1B 2E8ZA 1PY4A 3TESA 5E8EB 4FTVE 2WBWB 4PJBE 5C0IB 4W81A 3NABH 1FFOB 2OSLA 2X89A 4JLRB 3CFKB 4PJFE 4MXWH 5EOQH 2KUTA 3R06B 2EEAA 3PWJB 1QP1A 4N1CA 2H2SD 3BJLA 3MLSH 5CLWA 3SE9L 4JN1L 5D1QC 2ZPKL 1OM3H 5CEXA 1PVHA 4I0PC 5DQDH 1QKZL 4FTVA 2R1XB 1V3LA 4PJBA 4M62H 1RZIB 1A02N 1LO0H 2RJMA 3CC5A 1XZ0B 1NMBL 5CZXC 3O3AB 5B22A 4KJQC 4QRRD 5DHVA 3ZHDA 2Z35A 3B9AA 4FQXD 4JPVH 4EVNB 2FR4A 4HKZB 4PV9B 1MIEH 3T8XB 5BZDB 1JNHB 3ROOA 1UKTA 5CP3H 5ICXB 5BOPA 2X4PA 2BNQE 3IRPX 3VXRE 4LVEA 3INUL 5FYLH 4RGNB 5F1NB 1NCBL 2D7TH 5SWZA 1D6EA 1INQB 2UVFA 3NACL 1V7NL 4MJ4A 1UG9A 2IADA 3DX6B 4RZCB 3O45B 3MREB 4PGCA 4XVTH 4LLQB 2Q8AL 1A7OH 1ES0B 2BNQA 3LS5H 1G6VK 1IAMA 3VXRA 5AAWA 2Q7NA 2NTFB 2Y7QA 4JHWH 3SKOB 5LWYH 1KEML 5KS9F 1GOGA 2BNRD 4ZAKC 1W8OA 4PRDB 4Y1AD 1UA6H 3WD5L 2HA1A 2JJTC 2VAAA 3CFEB 1JZ7A 3VRJA 4WW2B 4G6ML 2XKSA 4M1DL 4ODTH 5ITBH 5DJ8A 3WL9A 3AMLA 1IKNC 1NL0L 4OLEA 1AY1L 1WEJL 3L3HA 2RAMA 5IEHA 3SHSA 3QNXB 5IVXF 1ZA6A 5FYJE 3EFDH 1YPZE 4NHUA 1RY7B 1VACA 4UAOC 4IRJC 1A1OA 3P0VH 1YQVL 3DX9B 5DD1L 5DC4B 3EJZC 4ZQKB 4ZSOB 4OCLC 3U6RB 3TPUB 3RVVD 1A47A 4UBDC 3H7BB 5ADPL 1RU9L 5JW4R 2QTEA 1YY8B 4XCFH 1U95A 3DGGB 5L2JA 2OQJA 1KJMB 4HH8A 4P46D 5KW9L 4CU6A 3OF6A 3GMQA 5HDBE 2HRPL 1YPZA 1IQWH 5GGVH 4QHUB 4O4YL 1J5OH 2NQCA 1YUHA 4XVJL 3SDAB 1LDSA 2FX7H 4U7MA 5LG1A 2ATKA 1DBAL 1SHMA 4MB5A 2GITA 2ZOLA 2AJUH 4P4RA 3EZ8A 2C9AA 1CGTA 2HFGL 5EUOE 4Z77B 5DMJB 1IQDB 4L9LA 1EO5A 1I4FB 5IP4A 5IW1A 2NCMA 2EIZB 3B5TA 3U4BL 5IMMA 3RWFA 4HUWB 1TVDA 1F4WL 3K0WA 1CGUA 3FMGH 5DVLA 4K3EH 3I75A 4FFWD 4PJEE 1DTUA 2P45B 3GMRB 1HI6B 1R3IL 1PLGH 1ONQA 1O5DT 4U1KA 1V05A 4PJGE 5HYJB 2P7TB 3HE7A 4DFIA 3BUTA 1CS6A 5HGDA 1KGCD 4MJIB 2I5YH 2X1QA 4I5BA 2DN7A 5ESVA 2AI0L 2EXWC 4ZXBD 4KVCH 3WS6A 1QYGL 3I6KB 3KPTA 1T1ZA 3DMMD 4RMQA 2V2TB 1PFCA 3H9YA 4OCWL 1TJIH 3TBTB 2EXYD 5IBUB 5J1AA 3BP6B 1B4RA 1PQZA 4Y2DA 1GPOH 1WBZB 3QCVH 3LDBB 1RURH 3LH2L 3S35L 3B6SA 3PNWB 5HHQA 3CCHB 4BQCA 2R8SL 5SWQA 2VOTA 4RNRA 4IOSD 4NN6B 1I7TB 1ZLVH 5EZIL 1NMAL 4HLZG 1A6TB 1ZAGA 5ICYA 3GBMH 2Z92A 1FZKA 1FNLA 1HXMB 3CXHJ 3D85A 3S34H 2AK4B 1UEMA 5L2KD 1CL7L 2DYPB 4MD4B 1OD9A 4LSDA 1OQXA 1E6JH 1TQCC 1G7IB 3L3KA 1PW3A 2QSCH 4CVZB 4R4BB 1A6ZB 3I3BA 4RFOH 1C16B 4GAJL 1KTLA 4L3AA 5IJVB 4JRWA 4AYFA 3T09A 4K23H 3PWPD 3PG2A 1KV3A 4JFQA 2IAMB 1JZ3A 2ORBH 1NAMH 5DQ9A 4WUUE 3FQTA 2EZ0D 4XBEL 3RZCC 4B53A 3HB3D 5I1GH 2OP4H 3EOBB 4GXUN 4FP8L 1DQTA 2C7UA 2ICEB 5ID0A 1GC1L 3MODL 4M93C 3O2VL 3A6BL 3WO4B 2AXFB 3KJ4B 4L8SC 5F1IB 4WUUA 4R7DA 4MVBC 1RAMA 1U9KA 4HWEL 4YDLB 5SV4A 1T21B 2P5ED 2MHAA 1T22A 4HUXA 3OAZK 4J1UB 1I7UB 4JY6B 3R1GL 2EYRB 3CXDH 4PG9B 5KSAD 3QXTA 4MGXA 1BBDH 1B0GB 3PP4H 4M6ML 3U48A 1T2QH 2ZWLT 3H9HA 1A7NH 4ONHB 3TO4C 2ARJA 2VO5A 3O0RH 5IHUH 3PABB 2WK2A 4WJ5B 2X4OA 1CICB 5ELIA 1VA9A 4YHNB 5DD6A 1ZHKB 2IH1B 1R5IA 2ZSVB 3U0TB 3N1FC 2Y6SC 4YFLI 3IDNA 1YMHA 1DVFD 4JFYA 3UJTH 2YPLD 3MACH 2APXA 1FNAA 1FL5B 4OUUB 2ESVE 1S7SA 4PB9L 4B7IA 5C0AD 3QEGH 4MB4A 5C09B 4QRQB 4GBXB 4H26A 4XMKL 3O8XC 4LPXA 5CZKA 1OB1A 1UWEH 1RJCA 4OV5B 1LO2L 5CS7A 2RGSA 3O81A 2ZUWA 5LBSL 1R3HA 3WFHB 4Q2ZA 2ESVA 4NYLB 3NCYS 4LEOB 3OKDB 4IRZL 1LEIB 3RTQA 2D3VA 2UZIH 3O9WA 2W9LA 4DCQA 5CIPB 3V95A 3LKRB 2AJZA 4MS8D 2XFXB 4JN2B 1FIEA 2YUZA 4UDUB 2CR3A 5F44A 1NFKA 4LLYB 1HYSC 1N5YL 2A9ML 4MNGB 1KXTB 3CX5K 4K2UH 5C0BD 1KC5L 2I9TA 1J12A 1MFAL 5BJTA 4GW4B 4LCIH 3HHRB 1T4KB 1LNUB 1FGNH 5E2UH 4GAGH 5AZEL 3GM0A 4MB3A 1I9EA 1E4KA 2J8OA 3FHQA 5E99H 5GSRA 1EEZA 4GS7C 2XA3A 2BVOB 3SE4C 3MBXH 4EEEA 5IW6B 4NWTH 4Y89A 4YIQB 1AD0A 4ZMAT 2YBRB 3WFBH 1AKJD 3F6LA 2BHZA 4EDWL 4C55A 3NIFF 4PJHE 3AVEA 5E8OA 4HMEA 2Q6WB 2R29L 1XGYH 2F5BH 2IPTL 5CHNA 2XKUA 5L9DH 3BT2L 3OKNB 1UZ6F 3U7YH 2HJLB 4OCSH 4C56D 5EWIH 4ZUVA 4APQD 1JNLH 3SY0B 4TULL 2X42A 2QADD 1J7VR 3EDDA 5JXEA 3QCTL 3W82A 1NH6A 1D5BA 2CDEA 4Y16C 1FG2A 3F6IA 4B41A 3KPSB 2AV1A 5E2VH 4FNLH 5H8DA 3AU1B 3BRFA 3P0YH 3STLB 5EBWB 3VCLB 1UB6B 4BSVB 1T5XB 5JO5B 5I1IL 1YEKL 2H8PB 4ODUB 4PR5B 4KJWD 1X5YA 3MFFB 3IKCA 3V52L 3CUPA 2Z31C 1YEHL 1T0MB 1WBXA 3FT4A 1FDLH 1XGTB 2CGRL 5FDWA 4QLRA 5E1AB 3FQUB 3I50L 3IFNH 2NLJB 4WI3A 5GGRY 3MJ9H 1U6AL 4KC3B 2R1YB 3MUGA 3QHZL 4X6CE 1GHFH 4JPWH 5E08H 1QRNB 4KK6D 3QG7L 5FECB 3D0LB 4M8QB 3ZSTA 1NUFA 4XP4L 3QUMB 1XIWB 4P3WA 2QHRH 4OLVH 2Y23A 2FO4B 5F9JB 1UM6H 5K9OA 5IB1B 1RFDL 4X6CA 4LQFL 4X9HA 2UZXB 4WDIB 3RQ3A 4NRXB 1MCOH 3LQAL 3R0MA 4U49A 1YNLL 1BQUA 5C0JA 1A21A 5L8KB 4GKZB 1RZ7H 2M2DA 1YN6B 4F8QA 4ORGB 1KNOA 5H37G 1X4XA 2ICWA 1DLFL 4D9RE 4QRRE 1G1CA 3DROB 5D7IF 3CFDA 3RGVD 3BQUB 2A73B 4MDJA 4EUPA 3NIGF 4UV4H 4FZEL 1HE7A 1BFOB 1ZWIB 4I0CC 1N4XH 1J1PH 3FOLB 2H32B 1FZJB 3ARBD 4P23D 3MRFB 5JPNA 5D6CA 2WSKA 4MAYB 1MOEA 4QRUA 2VLLB 1IRAY 2XNAB 3KPMB 2P5WB 4FQXA 3KR3H 3L5XH 3WDJA 3D3VB 1B2WH 4UUJA 4HJJH 2CPCA 4NSKB 2CK2A 5I30H 4DKEH 3RY5A 4FQHA 4Y4KB 4LMQI 2CO7B 1LE5B 1Z2KA 2F19H 4MQSB 4XNQA 4GSDH 3UEZA 3F7RA 4XCEB 4X7CC 4K3JH 5EB9A 1MIMH 3ZZ1A 3HZVA 3DIFB 5IFHL 1EK3A 4PJXE 3VFNA 2HN7A 3ARDD 3BKYH 4N0FA 4MJ5A 3FQWB 1G7JB 5ACZA 1P1ZB 3CVHB 3CVIL 2NXYB 5KSUB 3ZDZF 3CSBA 1KF9B 1BBJB 3GSVA 3QUZD 4NDMA 1LVEA 4C4KO 3HE6B 4P2OC 4JFOB 5DMGC 4AIZB 4Y19B 4KK9D 4P9HL 4NKOA 4PJXA 4UQ3A 4POYA 1UZ8B 2ADFH 5MENB 1JGEB 1GIGL 3HZKB 5HYQB 1AO7D 1B4JH 5HDQH 4Z78A 1ZGLB 1XF1A 4B0MM 5KS9B 2PXYC 1GGCL 1ZA3B 3ZTJG 4WWKB 3WHXB 4P3CL 5T5FH 4Q7DA 4UDTA 5HJ3B 2R2HB 1NMCC 4OLUL 1YNKL 4Y5YC 5ESQB 3MRMA 4TN9A 1NJ9A 2VZVA 2EDNA 2CXKA 2DQDH 1VFMA 4YHIA 1KN4H 3BXNA 3T1FA 4Y5XC 1MJJB 1OF2A 3ULVD 3VFOB 4NQSA 3UP1A 3QUYA 1K5NA 4JG0H 2DL9A 4G80B 1P7QD 4PFEA 5IVXB 3L5WA 2DI9A 4D3CH 1XGQB 4UIMA 1OGAD 5CGYC 4LHUD 4QF1A 2ITCA 2DQEL 1FYTD 4MA1B 3N9GL 2JELL 3GSWB 5HVHC 4ZFZA 2DICA 3TJHD 3CJJA 3O6KL 2PF6A 2DLFH 3ARXA 4FXLA 5CKAA 2AXGA 4KTYA 4HC1L 4YK4B 2WW8A 2NY7H 2FRGP 5F89A 4LCWB 1JGUL 4HUNB 3QDMD 3HG1D 1OTTD 2NY2B 1QSFE 5I17B 4U1SA 5EDXA 1NUGA 5I1EL 3TBSA 2VLRB 1KCRL 2W59A 4P4KA 2BX5A 4JCLA 2K9UA 3PWUB 5DR5H 4YO0B 4JQXC 4N0RA 1HNGA 3EYOB 5FF6B 3UJJL 2PW1A 2Z8RA 4GUPB 2DTMH 4NIKB 1DBBL 3SO3B 3CLFH 1QSFA 4D0CA 4UT9L 3TBVA 3C6LA 3V4VH 3P40A 1UCBH 4XP9H 4PJIE 3EO0B 4KTDL 1I85A 3O2WH 3WKMH 3I02B 8CGTA 3LN5B 1N64H 2ZSWB 3QXAB 4WTZA 5C08B 1U8HB 2X1OA 4WFGD 2YZ1A 3C6SA 3U36B 1YN7B 3WJLA 2F53D 4XCNB 3GSUA 2CLRA 3OKEB 1NFIA 3FB6A 3NCCB 2E9JA 3BUYB 5GIRB 4O58L 1CFQB 1T5WA 4PJIA 1CXFA 5E2WH 2EEBA 3FTGA 5L2KE 1DQLL 3JWOL 4ONFL 1D6VH 4J4PC 2FO1A 5JHDD 3TVMA 2CRZA 2WWKT 3MRLB 4ZUWB 2PETA 3SKNA 5DD0H 5E4IA 3IU3B 5TE6H 4K71C 5F8QC 1ZT1A 3P4NA 3QQ3A 2Y36L 4PP2B 1NCDL 3T0WA 2IF7A 1LDPH 3TFKC 1MLCB 2OZ4A 4FOMA 1JYXA 2YMXH 3VDBA 4BFEA 4JHZA 5JOFB 2AEPH 1A4JB 5T1LD 3RVTC 3HMXH 4I77H 4JDVB 3D6GA 3PDOB 4JKKA 1DEDA 3NFSL 3FQNB 4I3RL 5IM7B 5E6IA 3AUVA 5D9SA 4X8JB 2X2YA 4ZG1A 3O4LB 5LGJB 4Z7VE 2R0LH 4JQIH 3MV7B 3THML 3ZDXE 1JPGB 3IDMA 3LRSB 4PRIB 4XVSH 4U1IB 2NY1C 1UXSA 4NUJB 4MA3A 3STZA 2WV3A 2BRQA 3E2HC 4JAMA 4V2CB 2BVYA 3NABL 2PW2B 2F54E 1G1YA 3K8KA 4MXWL 1T20A 1CT8A 4Z7VA 1E4XH 5D5MB 3B3IB 1HQ4A 1TQBC 4U1HA 5FCUL 1AQKL 4LNVA 5GGQL 3VXTB 2Y4SA 3LKPB 5CMAA 4M9PA 4UT6H 4BH8A 1RZKC 3VI3F 2NZIA 2F54A 3LD8B 1W2KT 4ELME 2VABB 1UM5L 2O5XL 2J88H 3E6FB 2G60H 2CRYA 2ZG2A 4XNXH 4IRSD 5BO1H 1H8NA 4HS6B 1KB5L 1BEYL 5C0RH 5T1MB 5M95B 1QFOA 3G04A 2YRLA 3IFPB 4F7TA 1OLZA 4JFDB 1RUQL 1YEIL 2EE9A 1KCVH 3L3IB 1MIEL 1CD1B 5J12B 2J5LC 4G6KH 4JY5H 4ELMA 3PQYB 4JRYB 3BSZH 2ITDB 1DFBL 5C0EA 1KIQB 3ZE0E 4HD9A 4PRPE 4LLUA 5GZND 3ULVH 4R7NB 3RKPA 1RSFA 1P84K 4X7EC 3S3PA 2EC9T 1DANT 1Q9WA 1UH3A 1F6AB 4XVTL 3WXVH 1T83A 5HHOD 2QQKH 4M1CC 4EI5A 3TZVB 3LS5L 3PWNA 4F80A 2D0GA 2ADJB 5J8OA 5KVMC 1CDHA 4PG2C 5F7HA 3F58L 3GNMH 4PRPA 4JHWL 4NWUL 2AXHA 3BPLC 5FYKH 4RWHA 5GPRA 2E6JA 3GSQB 2Q86A 1J88A 2XPGA 1MFBH 4H5SA 3BH9B 3W5MA 3FRUB 1LEGA 2HLAA 4A6YH 1CCZA 4HMCA 4Q9QH 1VDGA 4BM7A 5JQ6L 1VFBB 3MRHB 5BZWB 1ADQH 4ZUSB 2NNAA 5C0CB 5EORL 2DDQL 1OP3K 4RMRA 2J6EL 3DXAB 3ILPB 2G75A 4L8CA 2BY0A 1XF5B 3KDMA 4F7EA 1I8IA 4GT7A 3GSOA 4RISH 1ETZA 3V79C 3EFDL 4RGOH 4MSWA 4IOIA 5BRZD 5I1JH 3FO1B 1HSAB 5EFIA 2XKNB 5EA0L 3UDWC 3EYQD 2R23B 1NGPH 4XCFL 3WUWA 1OQOA 4X6FB 1MCBA 1FVEB 5LGHH 3TF7C 3HC3H 2NX5E 1U92A 2XN9B 3VRLE 3N1MC 1IQWL 5GGVL 3RAJL 3BWUC 1J5OL 3SGEH 4F57H 2HT4C 1KIPB 4BFIB 2XTLA 2Z8WC 1VPOH 1DUYA 4Z95L 1QFUL 3FJTA 3ARFC 5DJ2A 2VL5A 2HTKD 1EV2E 5D1QA 4ODBD 2NX5A 1RZFH 1S7WB 1U2HA 1RUAL 3ZTNL 3JTTB 3SDCB 5C71A 2V9TA 5DC0A 1S7XB 1WC7A 4JPIB 4G5ZL 4DKFH 1AIFB 1EX0A 2H41A 1T6WA 4XPHL 2YC1B 3U30B 4MX7B 4TUKL 1TZIB 5LAXB 4GW1A 1FNHA 1JRHH 3VH8G 4KVCL 5GGSY 4ZYKB 5IB5A 1ACYH 5DJ0B 5E0QA 3EUUA 4N0CD 5E2TH 3D2UA 1G7QB 1IE5A 3MA9L 3V8CA 3RDTB 5IESH 4XNZB 4PJFF 1LEKA 4RFEA 3E1F1 3VXMD 4XAWL 3P9MB 1GPOL 2YD2A 1U8PA 2A2QT 1FNGB 1RURL 2V9RA 4Y4FC 3VXOB 3PHQA 1R3JA 3HA0A 4XX1E 1MELA 3IDYB 2R0KL 3VW3H 1NDMB 3B9KC 4JY4B 4ZAKA 1KJ2H 1OT2A 2BVPB 5B4MC 5JR1H 4MD5B 2JJTA 3KJ6H 3QUKA 4M4RA 2A6DA 3GBML 2IBZY 1MWAH 1RUKH 4JFED 3MGAA 3T0ED 4TVSa 1IFHL 1A22B 1IKNA 1SYVB 1K8DB 2XWBA 1N8ZB 5FHBL 3TO2A 5I0DA 4GG6B 1Q8MA 3BP4A 3MV8B 4PBXA 1HK6A 2GJ6D 2QSCL 1RUPL 1S8DA 4GRLC 5BS0B 1XR9B 2KQMA 3GSXA 2V7HB 3UTSA 1DN0B 2G5BA 1YDPB 1IVLA 4ZUUA 2EZ0C 3QIUB 2C4FT 15C8H 3ARTA 3RGVA 3E8UL 4PBWD 4FS0A 2VLKA 3ZL4H 1T03H 1TZHB 1DBKL 1NAML 4FQ1L 2M26A 4K8RD 5B38B 1DEEB 3ARBA 2LTQC 4NQDD 4MQXC 4NQCE 5IG7B 4XB7A 1FV1A 4E41D 1MHEB 3PF2A 5F9DC 2B7DT 3MJ7A 3ULSB 4PRAA 4WY7L 5SV3A 3AS2A 1NDGA 4O9HL 4YWGH 1IGTB 3E3QE 1VFAB 3V5KA 1T7VA 4NQCA 3EO9L 4MA7H 3EOYG 4LLAA 1YPZF 1BBDL 3GSNL 3PP4L 2R0ZH 3FQRB 4JE4B 1T2QL 4YNYA 4WIQA 3G5ZB 4Y5VB 3QXDB 4OZIE 1GGIH 1BFVL 5FO7A 2HT3C 3H9ZA 5C86A 4ELKA 1VGEL 5EZLA 3BKMH 5HDBF 3AREA 3UJTL 3MACL 4EDXB 2QQNH 4CW1B 3UTQA 5GRUL 3F7PC 4UOJA 1RVFH 3QEGL 4ZNEE 3MA7B 1P4BH 2NY6B 2AKRA 5EUOF 5DLMH 4S1RH 1D9KD 4U6HB 1UWEL 4YDIL 1IZKA 2BC4B 3V7MA 4NZUH 4LDLB 2CUMA 1QNZL 4NZTH 3VI4E 2VN4A 2EC8A 1BOYA 4PJEF 4XBGB 5ACLA 4OSUL 4YBLC 2IANB 5BV7H 5CGMA 1KCLA 3RUGB 4XCYB 1K9TA 4M9OA 5DC9B 4PJGF 1YMMB 4NM4H 4X5WB 1ZTXL 2VDML 4QGTA 4G9FB 4M6NH 1ED3B 3C5JA 5CINL 2XA8L 3FFDA 4LCCC 4Z8FH 1UXWA 1AXSB 2YD9A 3MRGB 5EC2B 5SWSB 4KI1A 3FT3A 2UY6A 5CAYB 4G8IA 5B21A 3W81A 3HCVA 4J3WA 1UGNA 4YFEA 3OJMB 3HI5L 2VDLL 1QLRB 4DVRH 4GMTH 1H3PL 5HI3D 4GAGL 3SPVA 2IPKB 1A4KB 5E99L 4Z7WB 3QH3B 4KDVA 4KRPC 4WI9A 1KLUA 3RGHA 3DUSA 4NWTL 4KKLD 4HWBA 2GK0B 3RZCA 5I1AB 1U93B 2Q8BL 3AS3A 4W4OC 5GS1B 3UZVB 4OCNC 2IFGA 1JYWA 2HTLC 1CE1H 1WFTA 1CXKA 1WFOA 1RK0A 4YHPA 3ULUE 2F5BL 3LHPH 5IMKA 1KCSH 4PJ7E 1IM9D 3P2TA 1CFNA 1U8QA 4GG8B 4L8SA 4HQQL 5HDLA 4RIRA 1SJVA 1XCTA 2EEDA 2AEQH 3RP1A 2QBWA 2YKLH 2X4QB 2JF1A 3O2DL 4AEEA 3QQ9D 5LQBL 3MTRA 1QBLH 2EIEA 3CH1A 4BQ6A 3AFLA 5LGKA 5IQ7H 1CF8H 3T08A 4N0YL 3TO4A 2Y5TA 2VITB 5E2VL 3IB4A 4CVUA 5E03A 3ME0A 4CUCA 2NYYD 3D25B 1MCJA 4JPKH 4WFED 2H9GA 2W9DH 2D7NA 1MREH 5IB2A 1EH9A 1GZPB 4I3SL 1MCLA 4YHYC 4CMHB 1J8HA 4LVHC 3RWHB 3U9PL 2D31A 5BVJA 4NJ9H 1KCUL 3NPSC 1VERA 3LSOB 1FDLL 2PO6D 1KPUA 2NTSP 1P4LB 3O41A 3HPJB 3TPKA 2QEJA 1ZKAA 3O8XA 2EICA 3MJ9L 1U8NB 3O3DA 4KJYA 2QQLL 5EPMB 3OTTA 4K8RH 1FP5A 1LQSR 3BP5A 4TOYL 3WIHH 1BX2B 3FO9B 1FFNB 5T5NG 4NJAH 1RJZB 2XQYG 2K3TA 1IAOB 3MNWB 1A7PL 3ROLA 1NC2B 4L4TB 4M7JH 4PJ9B 1SBSL 4G9DA 3L3DA 3PL6C 4JHAH 1U3HB 3QNZB 4KMQA 3MMEB 2FYYB 5FB8B 4MA8H 3HR5B 1IGYA 1IGMH 1MVUA 3D18A 4S2SB 1RZ7L 2FWOB 4KHTH 1CL7I 5DMYA 1DBML 4D8PB 1UVQA 3LQZA 7FABH 1QACA 4PTTA 5MP6H 4E0RA 1MQ8A 4HIEB 4WTWA 3P9LA 4JVPA 5MERA 4P23C 2P42B 5DUBB 3VMNA 1HWHB 4UV4L 5E8PA 5IJKC 3QEQD 1IGCH 3VE0A 1CDGA 2F9BT 1N4XL 4GW5B 5E94A 3QDGD 4JCMA 4Q58C 4CMMB 4NQXA 3CU7A 2PYEB 1WF5A 4HT1H 4YC2B 4FN0A 5CILL 1KYOK 4FQ2L 1FH5H 2DQFA 3T4AA 3KR3L 3DBXA 3MRKA 2XWJB 3JV4B 4W6WB 2FX9L 5ID1A 1BJ8A 2E7BA 4X5XA 2P24A 3BIKB 2F19L 3HFMH 4AM0B 4QHLA 4GSDL 4K3DL 4K3JL 3WFCL 2X5PA 5FKPB 1T7ZA 3F7VB 5FKAA 8FABA 5C07D 3GMOA 4GKSA 4M61B 4PYGA 3BKYL 5DGQA 1MEXL 3PWVB 3QI9C 2Q3AA 3T3ME 2XQYK 4Y16A 3WIFB 2VLJB 3PGCA 2X7LA 4LQ1A 1RPQA 4KKCD 1SJEB 3RIFK 3CDGA 3VJ6A 1P9MA 2RCSL 3VFPB 5FIEA 1IGJB 2BVTA 1W0VA 4HIHA 4OTXL 5JW4Q 3PWLA 2QKIB 1HHJA 2BY3A 4K94L 3GMLA 2ADFL 1NGQH 4X99B 2IJ0C 4PB0L 2CIIA 4PJHF 5DO2D 1B4JL 1KTDA 5DURB 1EO8H 5BRZE 2CKBH 4P2RD 4JFPB 2LFGA 4J3UA 2R15A 1OTUC 5EIVA 4Q9RL 3ULVC 3HNSL 1B0RB 1OP9A 1QD0A 3AGVA 4GQ9H 5IOPA 4QHNB 1U8LB 3IAQA 4N8VG 2ZUSA 3QA3B 3QDHA 4LSRH 4U1GB 5I71B 2IGFH 1QO3A 4EN3C 5C6TL 4JG0L 2FCBA 4QRTB 4YUEH 4L3EE 4PY8I 5FUZH 3SGDH 3QUXD 4XCCH 4WI5A 1VCAA 3MPCA 4D3CL 4E9LA 2FJFB 3W39A 1ND0A 2VWEC 4JJ5A 1K3IA 1BP3B 2DF3A 4S10A 3GJFA 3TIDB 4LOUD 4AG4H 1R3KA 1BAFH 3V0VA 1WTGT 2C1PB 4KPHH 4CVXA 3Q6FA 1HNFA 4L3EA 1QFHA 2DLFL 3O6FD 5I1KL 4Y4HC 2B8OT 1I7ZA 2V6HA 4KVNH 5GS0D 4BZ2L 3U0PB 4BELD 5EU3B 1RHHB 4HZLA 3VGGA 1C1EH 2AJ3B 2VDNH 4PJCE 4KDTA 3RU8H 2CK0H 2W0PA 5I75C 1UJ3C 2NXZB 2Q7YA 3FKUS 5HHXH 3RWDA 4K7PH 1BJ1H 4NQED 1HEZA 2OJZL 3QFDA 3C8DA 3RWEA 3MLZL 4AENA 4DEPB 1S7QA 5FCSH 3FN9A 4V1DD 4Z6AT 5DJYB 2WBJD 5I76A 3SBWC 2V5SA 4PJCA 3REVA 3PGDA 2D9CA 2RB8A 1MHCA 1G9ML 1UCBL 4XP9L 4NKIH 3CIQA 3OKMA 1N64L 1EMTH 1RV6X 3BHBB 3QXVA 2EYTB 2MCG1 1ZEAH 1G7MB 5D7LD 3HNVL 4AMKH 3MGTA 1CBVH 2W60B 4M43H 3LKQA 3S96A 4HK0B 2AABH 1CGSL 2X44D 4PJFB 5FGBC 1FJ1B 3CC5B 5EOTB 4P2OA 1MRDH 4JZNA 3T0AA 5E2WL 2H2PD 1FVDA 1HINL 1WAAF 1YECH 3QISA 3MR9A 2K1MA 5FYLE 1IILE 3CXHK 2EIDA 3SGJC 3MO1B 3NZ8A 4OI7A 3QQNA 1D5XA 1AI1H 5ALCL 3DPBA 4KQ3L 5IV2A 3PGFL 3HMWH 5CP3A 1E6OH 5DD0L 5TE7H 1SEBB 5C70A 2QSQA 4LHUG 1Q94A 4JANB 1CFVH 4Y5YA 3UYPA 5IBTH 4PGCB 2VXVL 2F5AH 1EEYB 5CJOH 5C0ND 2AEPL 2UY7A 1PGRB 2BNQB 2YPKB 3S4SA 4G8GD 2P8MB 1I1AC 1QVOB 4Y5XA 4WCYH 2MJWA 4JO4H 4FABL 2Y7QB 5CFHA 2B1HL 4IS6A 2RHEA 3RY6C 3HRZB 3PJSB 5IB4B 4GKNB 5MEPB 4QY8B 2VAAB 4XVSL 1JUFB 3WS3B 1JVKA 5I15L 5FK9B 1RULH 1YEFH 1E4XL 5IR1A 1TFHA 5DDHA 5J9PA 4OB5L 5IEHB 4FQQB 4ZODA 5CIPH 3L7EB 5D7JC 2NY0C 32C2A 1CLOH 4UT6L 1MVFA 4HKXA 3Q6GH 4LLMB 4JREC 1AGEB 1HH9B 1V7ML 2J88L 4X4XB 2G60L 4G42A 7CGTA 4UILH 5BO1L 4ZPVB 3AAZA 2GCYB 4RBPK 4F7CA 3TP4A 2ADGA 3HR6A 5EBLB 4BUHA 1KCVL 4JQXA 3TN0C 1YPZB 2HRLA 5GZNC 1IAKA 1F3JB 4NCDA 4TSAH 3SCMB 1ITBB 5D1ZD 4LRNH 4LSUH 3AXLA 5I1DA 1LO4H 2ZG1A 4BA8A 1DJSA 4Z5RB 3ULVL 1INEL 4NC1C 2XTJC 5TH2A 3ZE1F 4AH2B 3MQIA 5D2NE 5L0QB 1XF4A 2BOBB 4ISVA 3L5JA 5CJXC 3ARGD 1O7SA 1NBZA 3AROA 4KDWA 4PTUA 1RJLA 3KNBB 3DOSA 5DVNA 3I75B 3O3UN 1WUNT 5I1CH 4PJDE 3WYRA 4PGBA 2YN3A 4ENED 1EBAA 2CLVB 4AEHH 2Y9RT 5TDNB 5EUOB 4YGAB 2XZCL 4KJPD 2YPVH 5CEZD 4MNQD 4PJEB 5C9JA 5D2LE 4UTAH 2ENSA 4PJDA 5A2IH 2YA1A 3H3PL 5ILTL 4PJGB 1ADQL 1U8IA 1BGXL 3NGBB 1Q9KB 1VKXB 3BEWB 1PQZB 3C2AL 4JM4H 3IDJB 1UEYA 2CRMA 1LP9E 4HGMA 5A16A 3T65B 5GGSB 4RGOL 2Z31B 2IALA 3VXQB 5D2LA 3RI5K 3RWIB 1I3RB 2GFBB 1PEWA 2DQUH 2GQHA 2CMRH 1NGPL 5GHWL 3WHE1 4IHOB 1LP9A 3OR7B 5BV7C 1OAKL 4KTEL 2GUOB 4JFZH 3U4EB 1CD8A 3QDJE 3FAWA 1NEUA 2ZKHL 5DD3H 4CJ0A 3DRQB 3QUMH 1MJ7L 1R5WB 4F7MA 3S7GA 1PZ5B 5TPWH 3MBEC 2K7QA 1NCUA 2DLGA 4N5ED 5DJZB 1FFPA 1BD2A 4P5KA 5JW5A 1BJMA 5I2IA 4OKVA 1PG7H 4OLWH 2O26U 2FNBA 3QDJA 2FHCA 3V0WH 1KTLB 2DB8A 3QIBB 3TA3C 4M7KH 2HAZA 1NLDH 3W2DH 4R2GD 3TV3H 1P7KB 1EAPB 2L7UA 3EDEA 2F74B 2WUCH 3GI9L 4XBPB 5DJCB 5FDYA 3I3EA 2FB4L 1F6FB 1JZ2A 4OCRH 3OMZA 2HKFH 4UTBL 1JRHL 2E7HA 2IQ9H 1TTFA 1BZ9A 2GJJA 4IDJH 3ZDXF 1VADB 1QFPA 2FIKB 3IGAA 5I1LB 5D8JL 3RPIB 1N6QL 3BH8B 4Q9BA 1HHKA 3QEHA 4JRXB 1AE6H 3MRIA 3SJVA 2VDKH 4R0LB 1TIUA 4TVPH 2H32H 4NN5C 4WVRA 3VWKC 1JK8B 4DGVL 3NBNA 4LKXB 5BXFB 4LEXL 1ZT7B 1CDUA 4J3TA 2OK0H 3DVNA 1SJHB 4NO0B 3BOVA 3GO1H 5D70L 4ELMF 3VFMB 1WZKA 1TJGH 2GSIA 2HG5B 5JR1L 4HCRL 5EU4A 1S7VA 5CSGA 3VFRA 1R3LA 4JKPH 4KWUA 1E4WH 2DIAA 3KXFD 1RUKL 4YBQC 3MLRH 2VQ1B 3FT2B 3CVHH 1YMHB 5T1KD 3NA4A 4ZOCA 2ARWA 3KPRD 3V4UH 3LS4L 3QO0B 2HVJB 3QEQE 1KB5B 1WIPA 3ZE0F 4XNYL 4P5TB 3U83A 6FABL 1ZHNB 5EZJB 1JF6A 2MTPA 3GBNH 4F33A 1F6LL 1PKOA 3WDHA 1I9IH 3WSQH 3RL1B 2R1WB 3TBYA 2PR4H 3VXPA 1I8KB 3UDWA 5J6HA 3QEQA 2YUVA 1BVLB 4J3VA 2AJYH 2W0FA 3ZSSA 4JFDD 4RGNC 4HS3A 1GYAA 2DLIA 3W0WD 5DA4A 4NO2A 2F8VA 2DQCL 2AJZB 3CGTA 2Q76B 5C07E 3MYJA 4NNYB 3TBWB 2BDNL 3VGDA 3RKDD 4RQQA 3NCFB 5DMIH 3ARFA 3RIFF 3HNTH 1A5FH 5I74B 1D3CA 5DVOA 2Z91B 5F7NC 4L9DA 1GXEA 1CQYA 1D5IH 5JOPE 3QNYA 3QP3A 4WV1B 4MA7L 1JF1A 4OM1L 4WW2C 3Q48A 2R0ZL 3EKCA 3D39E 4RA0C 4YHML 1YEEL 3VXUD 1FQ9C 4YHKH 1I9JL 4P2RE 4YAQB 5KBNC 1GGIL 5E5MA 3OL2A 4Z7UF 4Z76B 4PGDB 4NGHH 1BVKA 3KPPB 2JIXB 4U1JA 3BKML 1BLNB 3VRLF 5E1HB 3PUCA 1G9EA 3RBSA 4LCUB 2AV7B 3IJHA 5DI8B 1OARH 3D39A 1OAXH 1H5BB 2I07B 1I7RA 4HBCH 4P2RA 4WO4B 4LKCA 5JXAH 1P4BL 5KN5B 4ZUVB 1XGPA 4LCYB 5KZCD 4LU5L 4Y4FA 4PJHB 1OCWH 3B43A 3ARQA 3CFIC 4S0SD 4NZTL 4UOW1 3CLEH 4ZFOL 3AS1A 4DGYH 1M6OB 3P9WB 4LARH 2EH8H 3SDAC 3B9KA 2CDFA 4H20L 2ZG3A 3HI6L 1A1MB 3S88L 2BSSA 3N06B 2BHUA 3RVXC 4DZ8A 4KI5C 1IL1A 4X4YA 4G6AC 4O02H 3X14A 3V6OE 1ZVSA 2E5EA 3MRCA 1DE4B 3QG6A 2R0WH 1GH7A 5HI5C 1MI5D 2W0KA 4M1GH 4PV8A 4OAWA 3DRTA 1A9BA 4QNPE 5FDWB 2DQGL 3SDDB 1J0ZA 2VNCA 35C8L 4R8WH 5ISZB 4GRLA 4NKQB 4X5LA 4DVRL 1X4ZA 3O6FA 1Y0LB 5KG9A 3V6OA 4XPGL 3DV4B 3FB8B 4KZDH 5HGBB 1ERNA 3K4DA 2K7PA 5FEBA 4UT7H 2ZUXA 2VE6B 4ZUTA 2WANA 3OAYK 1FCCA 5C0DB 1BQHB 5DEGB 3IFOB 1FSKB 5IROC 1CE1L 1N5AB 1EFQA 5D7LE 5A40E 3DSFL 3KPOA 1HN1A 4KZEL 1WZ1H 1PX4A 1S9WB 2JK5A 3LDBC 3QQ9C 3UAJC 5I16A 4XP1L 3KYNA 3EBAA 4Z18A 1HDMB 4XRCB 1WSST 5F88B 1NCCL 1TNMA 1YNTA 4NN6C 1DSFH 3IXTB 2ICWB 2WBKA 4OBSA 4YGVA 1ZLSL 4YJZL 2Z8VC 1S7UB 4JZJB 2IH3A 4MDJB 3CZFB 5FM4A 1EHXA 1CF8L 5HHMD 4OGXH 3GZKA 1JHTA 4LFHD 3T1WA 3CH8A 1JIBA 2PYFB 4I18B 4QKXB 1F90H 4QRRB 2HFEA 4OQTH 3GK8L 4FQXB 3FFCE 1WQVT 2VJXA 4NJ9L 3QWOB 3SDXF 5DUPH 4QRPA 4H25B 1A6AA 3D9AH 1A14L 3MLVH 4FQHB 1NAMB 3S5LA 3WIIH 4IDLA 3G9VA 4G3YH 1NCWH 3TLRA 4K8RL 4UINL 4D9LL 1L0XA 3OKLB 2YN5A 3V0AC 3FFCA 4R3SA 4ODVH 2AEWA 3H42L 3HTLX 4N0FB 5DHYB 4P57B 3TH2T 1MJ8L 1SY6L 1ZT4B 3EYFA 1BQLH 1WT5A 3HZYA 4NJAL 3OJDB 4NP4H 5HGAA 2R9HC 3WO4C 3PHSA 3KJ4C 4M7JL 2DQTH 2BNRB 3FCTB 2CJUH 4OZIF 4Y1AB 2JB6A 3CMGA 1X5GA 2A1WH 3LB6D 4YDLC 4G43B 2AAVA 2IC2A 4XMPL 4WFFE 4HJ0D 4G8EB 1M7XA 1OL0A 12E8H 3GSNB 4KGLA 1Q72L 3O3EB 2FL5B 1CFTA 3H9SD 4KHTL 4HUVA 3WE6A 5GJTH 3N1PC 3IDIB 2VL4A 4PD4K 1G7HA 1CICC 4YDVA 3ET9F 5IBUG 1TCMA 2IFFL 2VH5H 3OZ9H 2DM2A 5GS2D 4KQ4H 3BXNB 1TDQA 5D1XD 1MPAH 3VI4F 3T1FB 3BKCH 4GH7B 4DGIL 4HT1L 3QWRA 2R2BB 2XZZA 4RAVB 4W4OA 1IT9H 1W0YT 4GBXC 4P46B 5DRWB 1YYMH 4QTIL 3VDCA 2IMNA 1J0YA 1UWGH 4ERSL 1YJDL 2WP3T 1ORQB 2A6JA 1EGJL 1JPTL 2WWMC 4NRYA 4NUGH 3RWCA 1BJ1J 4HJGB 1X5KA 3ZDYF 1BF2A 4GXUM 4FFVD 4ONGH 2HJKA 3T77A 3U9UA 2UZYB 1UYWL 5LXGH 3KVQA 3FO0H 4AQOA 2AXGB 5B39A 1PKQB 2VSCA 1JWUB 2XACC 4MAUH 1WBYB 1DQQA 2I25N 3IF1B 3K8LA 5IWLC 5FM8A 1IC4H 5K9KB 1M71A 2VLME 2APTA 3FB5A 3IVKB 1MH5B 1FL3B 3DWTA 1IKFH 1F2QA 2JJSC 2DWEA 3PIQA 3U46B 4HUUA 4ZXBB 1ZLVK 1U8KA 1NGQL 5GRYA 3RI5F 1CXIA 4D0CB 3TBVB 3ZKND 1EO8L 1NFDE 3ULUF 3DMMB 2CKBL 4M7LT 3GJEB 1G7PA 3UXFA 2BFVL 4JGJA 1FORH 4JFFE 4PJ7F 5ETUA 3UJIH 2WMPA 4H88H 3S98A 2DKSA 3HPLB 1EZVX 4GRMA 5DUML 2KDGA 4PRHE 3QZWB 5IUSA 1F3DH 4UNTA 1QLEH 1Y18B 5CD3A 5LJYH 4WGVB 2XT1B 3LV3B 3GSUB 1T66C 1U8MA 4RA3A 1MHHA 1NFIB 5IK3B 1NFDA 4LSRL 4C83B 4JFFA 2IGFL 4GXVH 3V8OA 1UCTA 4PRHA 4MJ6A 2VTFA 4N90E 1HILA 1VEOA 3G6JE 3P4OA 3PL6A 3F7YA 4MZ2A 4HBQA 4UIKH 5FUZL 5I8OL 4IJ3B 2X4NA 2OR8A 3IDXL 4AG4L 5J1TC 1BAFL 1BIIB 1R5VA 3DSNA 1MCIA 3C5ZD 4LLWA 1T1XB 4P2QE 1QSVA 5L2KB 1JNNH 1CLZH 3G6JA 4JN1H 4KVNL 2Q1EA 3G5XB 4O2EB 5FA3A 2ZCKH 1QKZH 3VWJD 3JWDL 3RU8L 6CGTA 2CK0L 3KPQB 3W9DA 5IJKA 1KENL 4Z7OE 5TFSH 1GGBL 3BP7A 3PWPB 3HMXA 4P2QA 2RFXA 4QRSA 1NMBH 5J4MA 4U7KA 5D7KE 3T2NH 3SDYH 4XAKD 3C5SA 3MLXL 5AG9A 5EBMB 2WWKO 5CBEA 4U7SA 2PTTA 3ZYIA 3GB7A 2X6MA 4JAMB 1KOAA 5L7XL 4GKOA 1CD9B 1XF2A 1XIWC 2C3VA 3EJJX 1NCBH 3S8WA 1S3KH 2GEEA 2V17L 1V7NH 4CKVX 3MNZA 5I1HL 3NN8B 3OGCA 4OZGE 2Q8AH 1NGZB 2P5EB 5FA4A 3QI9A 1K8IB 4KUZL 1CBVL 3HZMA 3V5DB 2AXJA 3KXFE 5EU6E 5KSAB 3QJFB 1JWSA 1J0HA 3G08A 1MRDL 1TPXB 1KEMH 4WU5B 2EDKA 4G8FA 5IFAL 5JW3L 1QSED 1IGIL 3OX8B 2C26A 4OZGA 1AI1L 4EOWL 4G6MH 5HGGS 4M1DH 2X1WL 3UMTA 3PP3H 5EU6A 5DJAB 3V7AE 1DVFB 3C60D 3MRDB 4ELMB 3HMWL 5GS2H 2H26B 5EU5A 3BQUC 2GTWA 2YPLB 1E6OL 1NL0H 1YEJL 5C0NC 5DFTA 3QDAA 3CFCL 5C0EB 1AY1H 1AP2A 3AMKA 5CEYA 5C0AB 3EHBC 4U1NB 3FRPG 3EO1A 1FCGA 2Z4QA 2X70A 1U58A 43CAA 4IMLB 4MAYC 5CJ8A 2F5AL 3VGBA 1ZGLP 2DBJA 3RWGB 2PTVA 4PJ8D 4L4JA 3QFJD 5DQJA 1AGDB 1YQVH 2VWEE 5DD1H 2X4TA 4L8BB 3QIWD 3VFTA 3N1QC 4KV5E 5ADPH 2A83B 2B5IB 4EN3A 4Y4KC 4FXGA 5DGRA 1W8NA 2Q86B 1T04A 5I8CB 2HRPH 4H5SB 3M17A 4XVJH 5E9DD 2HLAB 3P73A 4M8VA 3MRRB 5DFWH 1Q9LA 2DBLL 1DBAH 5F9AC 2BSED 2NXYC 3JV0A 4XTRD 4A6YA 1K85A 2JJVA 4XC1H 4K7PX 2DJ4A 4ZS6C 5C0BB 3G6DL 4Y4HA 4XXDA 4EI6A 3CU1A 3HE6C 4Q0XH 1U91A 4LCCB 5DZLA 2YD8A 3MNVB 1FO0L 3HC0A 2HMIC 3U4BH 1I8IB 1JL8A 3KPNB 3RNKA 4Z7QE 1F4WH 1QHPA 4J8RA 2NY4D 4N68A 4OF8A 2E27L 1UJ3A 1R3IH 1MCPL 1ZHLA 1DZBA 1IMHC 1K2DA 3T4YA 3ZMRA 2WIMA 5B8CB 2L0DA 5D1ZC 4WWKC 1AGFA 4JM2D 3MOQA 4JDZB 2DMKA 5MHSD 4POZC 1AKJB 1TVHA 1QYGH 3JTSA 4YR6A 5IEKA 2NW3B 3QAZB 3MRJA 1DN2A 1KG0A 5J6GB 5DJ2B 4Z7UB 3QXUA 1C5CH 3QRFM 1QQDA 1ROWA 2FJGA 4C56B 2P8PA 4APQB 4OM0L 4J6RH 5H35B 3NFNA 1Q0YH 3BVNB 3LEXA 3LH2H 3S35H 1NC4D 2VUYA 1N3NA 4HSQA 1QRKA 2QADB 5I1CL 5FGBA 4PJCF 2R8SH 2V7NB 4MA1C 5CWSB 5TGBB 3P4MA 5EZIH 1NMAH 1GJIA 3LZFH 3KYMA 3SGJA 4PJ5D 5JNYB 5GS0L 1SVZA 3PE9A 1CG9A 3EOAB 4K9EH 4YK4C 3BPCA 1LD9A 4PRNB 4KKBD 3W9EB 1CL7H 3QEUA 1MY5A 1A6WL 1H8SA 4JM4L 1U8PB 3ILQD 3BPOB 4CN6A 2FEEL 4I3GA 4GAJH 1I9RH 1KT2A 1XCQA 1FZMA 5HGHB 3OKKA 1XGRB 3SO3C 4LF3A 2CMRL 3VXSD 3UO1L 3KLHD 4I48B 3LCYA 3BZ4A 4XBEH 1KJ2A 4M4PA 4PIRF 2WINB 3V6ZA 3QUKB 4HKBA 4WNQA 5DD3L 4YXHL 4F7PB 2X89D 3O2VH 1MWAA 3A6BH 1H0DA 1HHIB 4LIQE 2D2OA 3UPCA 2XWBB 3DURA 1NEZA 4QTHA 4LNRB 5IHZA 2W38A 1FE8L 1PG7L 4N8VB 1DCLA 4OLWL 4HWEH 4FTVD 3OHXA 5D7JA 4QCIA 2A74B 5DS8A 1YEDB 2HLFC 2EDRA 3R1GH 1B6DA 1NLDL 1Z3GL 3W2DL 3BO8A 5IVNA 3RGVB 5H94B 3QULB 4MXVE 1WCQA 1RIVH 3O11A 5IKCA 4WI2A 3OAZH 2HKFL 4N8CH 1OTSD 2FLBT 4NNXA 4F2MB 2IQ9L 3ARBB 4IDJL 4P23B 2V5YA 3TN0A 2XG5A 3IXAB 1I1CA 4P5MB 3F12B 1FNFA 1JTTA 4NT6B 3VD5A 4OFKA 3BN9D 5DWUL 1JZ6A 3IDGB 5SWZD 4BKLB 3TNNA 4PB9H 4P59L 2C1OB 1S7TA 4XMKH 1LK2A 1A6VH 5CJXA 3TIEA 5GGTL 3GHEH 3GMNA 3M07A 3SDXB 4OT1L 3VXRD 1WCBA 2OK0L 5K9JL 1IEBB 5A2JH 4LLDB 3ARDB 1E27A 4C59B 1LO2H 5D96B 2BNUA 1N7ML 2XIDA 3GO1L 4IM8A 3QUZB 1KPVA 1S78C 2MKLC 1TJGL 4DUXA 3BZEA 2VISB 4YHZL 1E4WL 1WIOA 2ZOKA 3MLRL 3F62A 3LKOA 1FZOB 1WV7T 4GAYB 3C2SA 4HIXH 3CMOL 5KVFL 2A9MH 3V4UL 1AO7B 4KMTL 1KC5H 1HH6A 1EIBA 5C8JB 3LD8C 3L95B 1MFAH 4WI8A 2GTZB 4OZIB 1H15B 4HIIB 1T7YA 4IIQB 2FD6L 4X7TA 3MFGB 1Q9OB 3S36L 3GBNL 1B0WA 1CGYA 1RZGA 2GAZA 4OZ4B 3HAEA 1XH3B 4DOHB 5AZEH 2XQBH 3N50A 4LHQB 4RAUA 3V6FA 2YSSA 3E6HA 5J12C 1AQDB 2GYSA 4OD1H 5MEQB 1MCFA 1RIHL 2BJMH 5D1XA 2AJYL 5M7QA 4P9ML 1JWMB 4PRBA 3OF6D 3RKDC 3OKOA 5FYJD 1EXUB 2KH2B 3BD5A 1PG7X 3WEXB 1P7QB 3WFEH 2YS4A 3OXSA 1O7VA 3IETB 2R29H 2IPTH 4OZHE 4D0BA 1OGAB 4QXTA 4LHUB 3TZVC 3BT2H 1FYTB 1AD9A 3P30H 1A5FL 4XPBL 4E5XA 1E4XI 3OXRA 1C08B 2FHBA 4TULH 4NNPH 4YHOL 1JPFB 1M7DB 1LP9F 3C9NA 4L4VE 2FEDC 1K4DA 4H0HB 2XWTB 3TA3A 5CEZL 1KXQE 3BX7C 4OZHA 2DD8H 3QCTH 4NO3B 2V2WA 2ZUQB 3QDMB 3HG1B 3IYLW 3HE7D 1CFBA 4NPYB 4YHKL 3P77A 3TEUA 2BVQA 2CIKB 3DUSB 4ODWA 3GI8H 1TETL 3G5VA 4L4VA 3TT3L 4F58L 3WNPA 5DA0B 4LDEB 4QT5A 1YEKH 4KMLB 1YEHH 4Z0BL 3C08L 5IMKB 2CGRH 4D0DA 1CFNB 4Y2DD 2O5ZL 3VWKA 2EE2A 1TTUA 1U6AH 2D7QA 4ONOA 4UQ2B 3MRNB 3QHZH 43C9B 1UB5A 3WUZA 4EQ2A 1QR1A 1CI5A 3QG7H 1CR9L 2F53B 4MMXC 5E8EA 4HWNA 4XP4H 4DGYL 4NCC1 5F3HB 3HUJB 4PJ7B 1SJXA 1P2CB 5EIIB 4XWGL 4JLRA 4S1DD 3MRBB 4K3GA 3PWJA 2H9GB 1RFDH 5IB2B 4OD3H 3DX8B 1DL7L 4O02L 4LQFH 2X4UB 3D85D 4HUKB 2R1XA 3LQAH 4M1GL 2I9LB 3SDCC 4MQ7B 1WIUA 1YNLH 5JHDB 1RZIA 1OOAA 1KPUB 1H3TA 5D6DA 4R8WL 3U30C 1XZ0A 4XXCC 3MC0A 1KPRB 3T0VA 4D9QE 3O3AA 3CSYB 1GZQB 2YA2A 1MCKA 4XAKE 4D94A 4BJLA 2ZZUT 5KVDL 3LKSB 1ULVA 4EVNA 5T33L 1OSZB 4HKZA 4PV9A 3T8XA 5BZDA 3LPFA 3MLTB 5DFVD 1JNHA 5ICXA 1E28B 4FZEH 5T1LB 3WIHA 4L29B 3IAGC 4Z0XA 2OCFD 1Y6MR 4PLKD 4NO5B 3RDTC 5CSZB 3DLQR 4XNZC 3QQ4B 1INQA 5EN2B 3IKKA 4RZCA 3O45A 4KK5C 1T0NB 4LLQA 1ES0A 3MZGB 3HS0B 5F6HI 5KSVB 4N9GB 4PP1D 3IAPA 4WUUD 1ZV5A 2AK1L 3IDYC 1BOGB 3HN3A 2NTFA 3QHTC 4Y88A 1P6AB 3MUZ1 3LQZB 4PRDA 2XY1A 4IMKC 5IFHH 2BERA 4R96B 3CFEA 1SEQH 4WW2A 2A0LC 3CVIH 4AT6B 4UV7L 4P2CG 1TJHL 3VDAA 5L6YL 4LGPB 4ZFFB 4ZSOE 2QSVA 1ZS8B 2CDGB 4X8XA 5KOMC 2D9QB 2V9QA 4IRSB 4P9HH 3O4OB 4Q6IB 3WO3B 1JRHI 4LBEB 1F90L 4I1NB 2DQFB 2X40A 2GT9B 1F11B 3QNXA 4I8DA 1TVBB 1GIGH 3ZE2F 5D72L 1DBJH 1X5HA 4HGWB 5ID1B 3D9AL 3QFJE 3MLVL 4ZQKA 3QIUC 4ZSOA 1S5HB 1GGCH 5C6WH 4X5XB 3U6RA 2P1YA 3TPUA 1T3FB 4TRPL 3H7BA 4QHLB 3U0WL 3WIIL 1YY8A 2J8UB 3DGGA 4KI5E 1B6UA 3BKJH 1YNKH 1KJMA 5FYJH 3D1MC 4WRLA 3R8QA 5HHOB 4QHUA 1MQKH 3SDAA 2ESVD 4PJ8A 4NP4L 3AM8C 1INDH 3RTQD 1F3DJ 1X5JA 3O9WD 4TSBL 2DQTL 5HYJE 4Z77A 4LSTL 4XGZB 1IQDA 2A1WL 1I4FA 3G5YB 2EIZA 1KJVB 4HUWA 3BI9X 2H1PL 2JELH 3GMRA 4LHJB 1HI6A 2VXSL 1MRCL 5J3HD 1FN4B 1KJ3L 3O6KH 4NQVB 5GJTL 2AS5M 1NGYB 5HYJA 1OGTB 2P7TA 1MRFL 4O51B 4Y5VC 4MJIA 4HC1H 1F4XL 4HKJA 2Y06L 2VH5L 4JO3H 5MHSE 3Q5TA 4KQ4L 1IC5L 5BRZB 5DJXB 5AG8A 2V2TA 5IBLD 5I1EH 2YOCA 1I3GL 3TBTA 1KCRH 4RRPG 3BP6A 3L7FB 3DYMA 5F7UA 1IT9L 4FFVC 1YYML 3IJSB 5JIHA 1WBZA 2NY6C 4JM2A 5ANMB 3UJJH 3DGCR 2EDLA 4NUGL 4UT9H 4LFHG 4ZFOB 1QHOA 3PNWA 3V0VB 4KTDH 3CCHA 1Q0XL 2NZ9C 2AK4E 4OIBA 5E00B 2DMCA 4WEUD 4J7RA 1MJUL 5LXGL 1I7TA 5B3JE 3FO0L 1KEGL 1OPGH 3SGKC 5JXED 1A6TA 4PJ5E 3K1KC 4CBPA 4CGTA 1XGUB 1WICA 4O58H 1HXMA 2Q7YB 1MCHA 2OMBA 4OD2B 1BZ7B 1CZ8L 2AK4A 2I27N 3JWNC 2DJUA 1DQLH 2DYPA 3JWOH 4ONFH 1N2RB 1G7IA 5HHVH 4CVZA 3GIZL 1GRWA 1A6ZA 4KRLB 4R4BA 1H3GA 1C16A 5E56A 5IJVA 5ERWB 1AFVL 1MHCB 1TNNA 1U8JB 1C5DB 3MJGX 1FORL 1MFEL 2IAMA 1LHZA 2Y36H 1NCDH 3VXMB 1FLRH 3GIVB 3WJJC 1OW0C 5I18L 3EOBA 1V3MA 1FGVH 1J05B 1UC6A 3MGTB 2BCKB 5GS1C 4KROD 4JR9L 2FLRT 3EYVB 5CLTA 1S9YB 3NFSH 2W65B 4BH7B 4I3RH 2AXFA 4GXVL 4YPGB 4XNUL 5CBAB 3EYSL 1BFSA 5F1IA 3THMH 4UIKL 4Q97A 4MCYB 3DETC 3H6JA 1Y6KR 3BMWA 2BY2A 4J1UA 1ZMYA 1I7UA 3GUTB 4JY6A 3H0TB 5ICZB 2EYRA 4JFEB 5D93B 4XC3L 3T0EB 4PG9A 1P7HL 2J4WH 4K9EC 2X4RB 4ODXB 4ONHA 5MEOB 1JNNL 1CLZL 2O61B 1EFXD 3PABA 4WJ5A 4U0QB 2OL3L 1CICA 5E95B 5FCUH 5GGQH 1AQKH 1YEGL 2GJ6B 5C09E 5F3BB 5DRXB 2X9XA 2ZCKL 4S1SH 4YHNA 1ZHKA 2IH1A 5JORA 3U0TA 2VAJA 4HG4K 4CMHC 1NGWA 5TFSL 4MCZA 1UM5H 2O5XH 3RVUC 5BMFL 1KB5H 1BEYH 1FL5A 4OUUA 3T3PE 5JDJA 5SWZE 3T2NL 3NAAL 3SDYL 4D9RD 1F3RB 5C09A 4QRQA 1RUQH 1YEIH 4GBXA 4IEFB 3ARZA 5I8KL 5IHBA 5JZ7D 1QFWL 4OGYL 2BZDA 4NQDB 2G2RB 4OV5A 4E41B 4EIGB 1T0PB 4H0GA 4LSPH 5IMOB 1GC1C 1DFBH 3WFHA 5DYOB 2YWZA 4NYLA 4MNGE 1S3KL 4LEOA 4TSCL 2HJFB 3FQXB 3OKDA 2WIIB 4XVUD 9CGTA 1G6RL 2D0FA 3BW9B 1LEIA 4PJ9C 1A6PA 3BRGC 1IC7H 1AHWA 5CIPA 3LKRA 1U3HC 5HHPB 5IWLA 2XFXA 5JIIA 4JN2A 4Q74A 3MLUH 3VFUB 4UDUA 3R8BB 1AJ7L 4LLYA 3F58H 3QPQC 1CGVA 3NCEB 4MNGA 4NWUH 3ZKMD 2JJSA 3C60C 3GMMB 4RMWA 3SKUD 4GW4A 1T4KA 2EO9A 2ZCHH 5EC1A 4DK6A 3RBGA 3SKMB 4R4NC 1R0AH 5JQ6H 2PKDA 3EFFA 4PLJD 5EORH 2DDQH 5CJQH 2BVOA 1J1XL 1WTLA 2J6EH 4YIQA 2YBRA 4YC2C 1D9KB 1D5MB 3MOAL