4X7SH

Structure of omalizumab fab fragment crystal form 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNYNPSVKGRITISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epididymis luminal protein 214
publication title Structure of the omalizumab Fab
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7sH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7sH01
4HUMB 1U3YA 3FZUC 1QD0A 4NJAL 4TYUA 4MAYD 5HPOA 4M3KB 5E8PA 5J12C 4NNYA 1T2QL 4GG8B 2F53E 2FJHA 1J05A 3G6JA 1CICD 2FX8H 1YUHB 1YDPB 1VGEL 1JRHI 5I8EB 5L8KB 1Q1JH 1OAUH 3KLSA 4H20H 5IK3A 1UKQA 5BMFH 3KPPB 1NKOA 1VFMA 2NY0C 1ZLSL 3DXAA 5IMOA 3SKOA 1U3HC 1NDMA 4B7IA 4BZ1H 3MV11 2NY4D 5BW7C 1QP1A 2AKRB 4LSPH 5F8QC 4Y1AD 2Y6SC 2H32A 4K07A 3ZTJG 2VABA 4LRNL 2BY3A 4L3AA 4NSKA 4WVRA 2EDTA 5FM8A 5DZLA 2F58L 3GIZL 3B5TA 3QHTC 3S5LB 3G5VB 4MA8L 4OD2A 3CU7A 3P0GB 3KPRE 4KK9C 4XP6H 2DN7A 2QL1A 4JDTH 3SDDB 2YZ8A 4MAYC 5C6TL 4H5SA 1YEDB 4QYOA 4YHIA 4X6FB 2VSDA 1EGJA 2BNQA 2OXHA 2SEBB 2NTFA 1CICC 4HWUA 4NQDE 4PRID 4N1CA 3QIBD 2DQJH 2EH8H 4ODHH 3EYUH 1IGYA 5ERWA 4M3JA 3EO9L 5B8CA 3QIWB 2Y5EA 2E7LA 4F2MA 1CZ8H 1KV3A 5BS0A 4WUKH 2ZUQB 3AY4C 4S0TD 4BZ2L 3GDBA 4DN3H 3LZFL 1EEZB 1A1MA 3HG1E 2DAVA 4JLRA 5E7BA 5MHSD 2NY4C 3OJMB 4KKBD 4KQ4H 3DSFH 1AJ7L 1AY1H 1MCHA 4OAWA 5F96L 3QXDB 4DFIA 5F1NB 2X44D 2PO6A 2YPKA 5I17A 1AR1D 1YY8A 1FFPB 2R2EA 4RBPK 5FDWA 1WWCA 3KHQA 3KPOA 4AK1A 2ZSVB 4Z7WB 3ARTA 3QUMH 5IW3A 2P5EB 43C9A 1RZFH 2Q6WA 3H9ZA 1SJVA 5D7IF 1YNLH 5D70L 4PRHB 3C8DA 2VN4A 1D9KD 1IL1B 1T1YB 3DV4B 4OLXL 5MERA 1KC5H 3QIBC 1LO0H 4M7LH 3U4EB 4OCNC 2B5IC 3PGCA 3BD5A 1UWGH 5AAWA 4JVPA 3ESVF 1HXMA 4POZC 4QTIL 3QDGA 1NCAL 2BSED 5E9DE 4PJBF 3ZYOA 1E6OH 2XYCA 3D18A 1NC2D 3TV3H 3MCKB 5TH2A 3KS0H 1NCUA 4HXAL 5DRWA 4KKBC 2VL5A 1GGBH 1O5DT 1Q9WB 2EE2A 4KGLA 1N0LA 3C5ZB 2X4PA 2JB5H 5E8DH 1SJXA 3BZ4A 4U7SA 3OPZL 4KMTH 4R6UA 1RZJL 3STLA 5EN2A 1BGXH 2JB6B 1AR1C 4LLAA 4Y4FB 2B4CH 5IVOA 1YYMH 5ITFB 1RY7B 3A67H 2ITCB 4JRYD 1DFBH 3SE9L 2X4SB 1R24A 3ULSA 5BXFB 5T3ZL 5KG9A 2EIDA 3QQ3A 1D9KC 2ARJA 1BX2A 1CLZL 1DSFH 4NQXB 5F9DC 3NIDF 5F9OH 4Y4KA 3L3IB 2XZQL 5IROC 4L3EB 3PWPD 3CFBA 1EV2E 1H3WM 1T4KA 4F7CA 1JGUL 3HFMH 5KZCB 1P4IL 3L5HA 5HGAB 3D85D 1LE5B 4QHNB 1UENA 2ERJC 2CGRL 2NX5E 5INDB 4JHBA 2CIKA 4GLRH 2AJYH 4JFDE 3RFZC 4MD5A 2YRZA 3H8NA 3MYJB 3ULUD 3GHEH 5INCB 4KDVA 2B1AL 2C3VB 2EYSB 1EDQA 4ZODA 3S5LG 3VFOB 3WFDL 4S1SH 3P4NB 3U2SB 1KYOJ 1FFQA 3GHBH 1NAKL 3N1GC 3QI9B 2G60L 4F15B 3RWEA 3NGBB 3VD7A 4HKJB 1AP2A 1GC1C 4XRCA 5IMKA 3GSNL 4AEFA 1EX0A 3UTSA 3T3ME 4NDMB 2E27H 4P2RE 1LK2A 3PP3H 2BVQB 3I6KA 1GAFL 1MCNA 3HE7A 3UYRH 1YEFL 2FX9L 1MJ8L 4CKVX 4R26L 1CDYA 4U6TA 3ECBA 2VDPL 1KLUA 5CJ8A 4XBEL 3KPSE 3LD8C 2MPAH 1RK1A 4OZGF 4APQB 5JORA 3O6KL 4TVPL 3MOBH 4HWZB 4UB0L 5D7IE 2FHFA 1JNNL 1A0QL 3WN5C 3MRIB 3ULUC 2O5XL 5LAXB 3JV0A 1OTSD 1S8DB 1ZANL 3BD4A 1SM3L 2W1NA 2EE9A 3R8BB 2XWBB 3OX8B 3MLSL 5D2NE 4K3DL 3BIKB 2BJML 2HJKA 5E2UL 3NZ8A 1W0YT 4DJMA 1PQZA 5C09E 1RD6A 1FP5A 2VLJD 1EHNA 3G6DH 5GS1A 4PJBE 2Q8BL 2Z8SA 4XMKL 4GRWH 3HKFA 3QQNA 3HS0B 5FHAL 4M7KH 2FJFA 2V17H 1KEMH 5GGUB 1KBGH 5ITBH 1NUNB 1TVBA 3B2VH 5GZOD 4I9WE 3WFEH 3IF1B 4LP5A 4C4KO 2APVA 1EHAA 5C0AE 1S7WA 3BXNA 5LWYL 4X7CC 1JE6A 2XTJE 5E94B 5FKAB 4X5XB 4K3GA 1CS6A 2BY2A 2K7PA 2QADB 3F5WB 2AV7A 2Y07H 4XP9H 3IAGC 1N64H 1IBGH 4YJZL 1OTSC 3NIDE 3Q48A 3E2HC 2ZUSA 3ETBF 1UZ8B 3U6RA 4X83A 5GGTA 1J86A 4U05A 2A9MH 4I0PA 5KSAB 4MMZC 1AKJD 4OZIA 4BH7B 3MV01 4NQED 3REWA 3GIVA 3W0WE 5ESAA 5HVHC 3DX6A 2VLMD 1KIQB 5SWSB 1N5AB 3MRLB 1LO2H 5I1JH 3QEHB 3T2NH 1QR4A 5E8EA 5C0IB 2XN9A 5HGDA 3ARBD 4UOJA 4X0KA 5F6HI 4P46A 4ZO7A 4KMLB 3ARFD 3GO1H 3S96B 4PJ7B 1LO3L 1J0HA 4LCCB 3W2DL 4KAQH 1T04A 4BA8A 1GZPA 5BV7H 1KENH 1QSEA 3LPGA 4K94H 4HWNA 1RJCA 3IETB 5ANMB 3OF6A 3TBWB 4PB9H 4NNXA 3JWOH 4OZGE 4P4RA 5IW6B 4MCYB 1RUML 2OQJA 1G6VK 1RJZB 1IFHH 5IB5A 3B3IB 3P11L 4QCIB 5DYOA 5SV4A 3L3JA 3MGOB 4HMEA 5JIHA 3ELAT 4O2CA 4DN3L 2WUCL 4C83B 1DQTA 5D6DC 5JDJA 5J8OA 2OBGA 1MIEH 1CD9B 2HFGH 3QP3A 3IXAA 5H2BA 4NRYB 4KQ4L 3ARYA 2PXYA 2W92A 3ARBC 2Y5TB 3STZB 4FTVB 1T7VA 3ARFC 1XIWA 3IU3B 1CTOA 1OF2A 1FSKB 1N59B 1P69B 5TJWK 3FQXB 3AC0A 3Q0HA 1OGAE 4FXKA 3CFKB 4PJHB 4WI4A 3PUCA 2W0KA 1RZFL 3GMLB 1IAOA 5KN5A 3BUTA 1VSCA 4ZUTB 5EU5A 1FNGA 3BI9X 3NN8A 4MX7B 3BIAX 1OP5K 2J8UA 1EIBA 3BEWA 5K9JH 1LO0L 3MUGA 5L2KB 4XHJD 4RAUA 1F4HA 2J2ZA 1UWGL 1MRCH 3I75A 5JIIA 4EI5B 3C60D 3RU8H 5I18H 1NCDL 3TH2T 3OJDB 1VPOH 1S78D 1OVZA 1QSFA 3F12B 3KYNB 1X5YA 4WFGD 2F8OA 4ODWA 1H3XA 3IS1X 3RX7A 2BFVH 3OB0H 3W11D 4JQVA 5LGJB 1IGFL 2FH8A 1QO3B 4NO5A 1MFAL 4UTAL 2ARWA 5E8DL 2UYLA 1CLOH 1V5JA 1JGEA 1SVZA 4KMTL 2YPVH 2E9JA 1R5IB 2VDNH 4QY8B 1MAJA 1S7QA 2B4CL 1YYML 3MC0A 4NT6B 1JZ2A 1JK8B 5HI4D 1DFBL 1TCRB 1HOCA 4CN6A 3C5SA 1MSPA 2EDHA 4D3CH 3LKPB 5EWIL 2W65A 4PR5A 5CUSH 3EFFB 2B39A 1S7RB 3E6FA 5E2VH 5LXGH 4PJ8D 3NIFE 4XHJC 4RWYH 2VWEC 4O51B 7FABL 3BDYL 4CU8A 3F58H 1NLDL 1FYTB 2NW3A 3C60C 3N1PC 4J4PD 1KB5A 4PIRF 4IOIB 2WQ8A 3SDXB 1S78C 3GJFB 5GRJH 3EZJB 4AIOA 2AJYL 2P5EE 3UJTH 2P47B 1ZAGA 4PJIB 2FBOJ 3W11C 1Y18A 1EAJA 2V7HA 1CBVH 1INEH 1JWMA 3U9PL 4XPAL 1H3TA 1KIPB 1Y6KR 4IEFB 4CVXA 5JIPA 2E7BA 4FQ1L 4N5UA 2G2RB 4MSWA 2DD8L 4KZDL 3FO0H 1WVZA 2OP4L 1EVUA 4S0SD 3DVGA 4G9FD 3TIEA 4PBVC 1OAKL 2GEEA 4PJAA 4CVZB 3NFNB 1KN4L 1NAMH 1DBAL 2JK5B 4X7SH 5GS2D 5IWLA 2ADGB 3OR7A 5HI4C 4QHUA 4I3GA 1A8JH 1CXKA 4Q9CA 3BKCH 1RSFA 4WHTA 1C5DB 3D25A 5C0GB 1XZ0A 1NBYA 3ARDA 3GZKA 5GHWH 1JF5A 4UI2A 4KY1L 4PJ8C 5ENWA 5IHZA 5GJTH 1W0WB 4N9GB 1J10A 2MPAL 3AS0A 1DANT 4J4PC 1U8MB 5I1AB 1X6NA 4ZPTA 3SJVB 2XY1A 5DQ9B 2EDWA 5C7XL 3EO1A 4WRLA 3JZ7A 4ZNCD 1FRGH 1WZMA 5D2LA 5D1ZA 4QRTB 2GFBA 4JFED 1DBMH 4WO4B 2PTTA 4R96A 5CJ5A 3VMOA 2V5MA 3PABA 4HBQA 5HYEA 3BPLB 1EUUA 1NKRA 5I1HL 1TZGH 1OQXA 4L3EE 3RI5K 2EDOA 3H7LA 4Q9RH 5JHDA 4EIGB 1DQQB 3BFOA 1NANI 4LVOB 3MLVL 2NY1D 3KXFA 3CC5A 4XVUC 2QQNL 4NQSA 3V0WH 5IB1A 2V17L 3CSGA 2V2XA 5ITBL 1PAMA 2JF1A 4ZUWB 4HHAA 2FIRT 4XCFH 1XT5A 3O3EA 5C0ND 3B2VL 4P48A 4RAVA 4XVSL 4AG4L 3N9GH 4M00A 3TEUA 2GY7B 3RNKB 1KCUL 2X6MA 5FXCH 3SQOH 2VLKA 4JFQB 4PJ7F 1I3UA 1BECA 4NQCA 4LPUA 3JWDC 4OF6A 3HPJA 4OQTA 1EXUA 2BNRA 2XNAA 1IBGL 3K2UH 3HNTH 3VGFA 4NO0B 1QR1A 5DI8B 3LQAC 2A77H 4X4ME 5FM5M 1F6FB 4UTBH 4JHZA 2ICWI 5MI0C 4UT6L 4C56B 1L4IA 4WGVB 2EDDA 2IH1A 1JJUA 4LAJH 1FBIH 1X5XA 5DC9B 5HVFB 5HYQB 1C16B 5FYJL 4UQ3A 4DKEL 4P5MA 2CK0H 2X9WA 2OS7A 5C07D 3FN3A 3D85B 4HC1H 2LTQB 4XXCC 1U8PB 4CMHB 5HYFA 4YZFF 5I1JL 2Q7YA 3WFHB 3T2NL 3THMH 5BQ7B 1A7PH 4ORGA 5C9JB 4L8SA 5CD3B 4QKXB 4G6FD 4OBSA 2D7OA 4L5FL 1MHCB 5BJTB 3V5KA 1WQVT 3QG6B 3QFJA 1B88A 1P5VA 3P4MA 4ZAKB 3H9SB 2RCSH 1U8IB 1PKQA 2I07A 2BOBB 4KAQL 1MCCA 1S7UA 1YEIL 1T83A 3QUZB 4ONGH 4PJHF 1A7QH 5HHME 1MOEA 5CSZA 1E6JL 1YNTA 5IMMB 6FABL 2D7MA 4G43A 1S7TB 3MSPA 4NQVB 4K94L 1VACA 5ALCH 3G08B 2CRZA 3O3DA 5C8JB 3C6SB 4PB9L 4Y19D 3ORJA 4R7DB 3KPNA 1Z0NA 1B9ZA 4XP4L 1IFHL 1KCVH 5K9QI 4UMGA 3QDME 2R0ZL 4JFZH 1LEGA 3LKOB 2VNCA 1PEWA 4GRLA 1JWUA 3NCMA 4X4ZA 4JJ5A 1YEKL 5EO0A 2HFGL 1G9NH 2WNGA 4AT6B 3EYQD 1C5CL 1E28B 2NXZB 5F6IC 3C5JA 3QNXA 3ZYJA 3UXFA 3MXVL 3C87A 3TBTA 3WSQL 5D7JA 4NC1C 3K8KA 3WNNA 1OSPH 5E8NA 4MDJA 5I9QC 4R2GB 5A43C 1YEHH 1DEEB 4HKZA 4XPFH 5SWZB 3RVWD 5KVMC 4M1DH 5B4MD 3MV7A 5SWSE 4TUKH 4ZFFB 2AJUL 2DM7A 5TE4L 3RGVA 1WIPA 2XKSA 2DLEA 1MCBA 5FGCE 2NY7H 1JMZA 3FOMB 1EMTH 2C1OB 3MBEA 5EBLA 1L7IH 2BXYA 4GMTH 1U41A 3C08L 4RMUA 3LEVH 3BKYL 4PJ7E 4KRPD 5I18L 1CK0L 3OKKA 1LGVA 4RQQA 1VPOL 3QEGH 5CCKL 3CU1A 3RL1A 1JI1A 3HE6D 3SDXF 1SEQH 3U0TB 1Z9MA 2BFVL 5CJXC 3EYQC 1HYSD 3VFUB 2AV1B 2R2CA 2V2TB 4OLYH 4HQQH 5C92A 5T3ZD 1ZE3C 1HQRA 1CLOL 4QRRA 5ANME 3T0EB 3UTZB 2YPVL 3DVFA 5A2KH 4E0RB 3ESUF 2KQNA 3FT2B 5D71H 2VDNL 4RDQG 1KPVA 1AKJB 4XCNA 3BGFC 2HWZH 4PRNB 4Y2DA 1MUJA 1MHEB 1V3LA 1MRFH 4YZFE 3RVWC 3MO1A 1MCEA 2YD2A 1CDUA 4QTHB 4HKBB 3FRUB 3VXUA 4PJ9A 5CILH 4J23A 12E8H 5C0CB 4WDIA 5E2VL 3RWJB 5HHQB 4RWYL 4FTVE 3V52L 5C0EA 4RFOH 3F58L 2E6PA 2CKBH 4WW2A 3RVVD 5FYKH 2DQGL 2E8YA 4KRPC 2BSRA 2I24N 5CBEA 1TCMA 4L9LA 1RZJC 5GRJL 35C8L 3L3OA 4M5YH 4PJHE 2HVJB 4B41A 3SCMB 3HE6C 4PRBA 5D7SL 3NA4A 3QH3A 4RGMB 3CNKA 1HHJB 1NGXB 1AD0A 1OHQA 2DB8A 1HYSC 3H42L 2MCG1 3BGAA 1INEL 3LN4A 1GZQA 1VERA 4BSWB 1IGMH 5J6GB 2VDKH 1G9MH 4MJ5B 5L2KE 1T0NB 4HXBL 2JE8A 3VGAC 3HNSL 1NAML 4X7SL 3P0VL 3VH8A 1PKOA 2R1XB 1U95A 4HK0A 1AXSA 3BKCL 2L4OA 4TVPD 3HAEH 2DI8A 4Y5XB 3BSZH 3HNVH 5GHWL 1X5HA 2R0LL 2AEIT 5DC0A 2I5YH 5GJTL 1AGEA 2PW2A 2XQYG 1BOGB 1I7ZA 4WEMB 3RVVC 3JWNC 1CE6B 1CIUA 2XWTA 5E95B 3MPCA 3B6SB 3QWRD 3GM8A 2EC8A 5ECJE 4HH9A 1AR2A 3QCVL 4ZSOA 4JANB 4RDQF 1WC7B 4FQIL 4XPTL 4KC3B 4KV5F 4WFHE 1T89C 4WWID 1N4XL 2EIEA 3WEXB 1RHHB 3PJSB 4FXGA 1TZGL 3JBG7 4I18C 4CNIB 4Q9RL 3ZKMD 2DLGA 1WIOA 4MA3A 1YN6B 2GJ6D 3VXSD 5A2JH 1FYTE 3TC9A 5FA4A 3QFDB 4J1UA 3RVTD 1HXYA 1U93B 4A6YB 4Z78B 2RBLA 2DQCL 4XNQB 3SDXE 2A38A 1EFXA 3BP7A 4Y4HA 2JLLA 3MX0A 3RJQB 3V0WL 5IBTL 1ND0B 4HGWA 3QT2A 4XNZB 2GCYB 4HG4K 5TE6L 4XCFL 4TNWK 4JN1L 4NWTH 3P30L 4HUXA 2O5ZH 1R3KB 4XVJL 2J8OA 2AK4A 3RDTD 3ULUF 5EZLA 4RGND 1MCWW 4PRIE 4HX1B 1ZHLB 5EU4B 4I13B 5ACZB 2Z31A 5ISZA 3BKMH 4OCYH 3B9AA 4AEHH 1JN6A 2MHAA 4HEME 4YE4L 2ZPKL 4J12A 2DM4A 2GUOA 1B0GB 1JFQH 2GT9A 1FL5B 1OB1B 4F33B 2YXFA 4DK6A 2M2DA 1QSVA 2C4FT 5F93C 3HNTL 4PRPD 3T0XA 5ADPL 5GS0H 3OAZK 4L9DA 3UPRB 4DAGH 1OP3H 2A77L 1K4CB 4HJGA 5MHSE 3HI1A 4WFEE 1WEJH 5AYQA 3ROOB 3T0VA 1AI1L 2OR9L 3IKCB 4OM1H 1UB6B 3ZKMC 5TGBB 2EDXA 2A6KA 3GNMH 5CIPB 2QBWA 3SJVE 2ZSWB 3RVTC 2OTUA 3V79C 1MIMH 1U36A 3P9LA 2X7LA 1EH9A 3IDGA 2QQKH 3VMNA 1KFAH 3TT1H 3M8OH 3RDTC 4RGNC 5FK9B 2OSLA 5ETUB 3X17A 4BJLA 1Q94B 3U9UB 3OQ3B 2BXZA 4FFZH 5HD8D 2FLBT 5DFVD 5SWQB 1E4XI 4BSVB 1RZKL 5H94B 3GB7A 2C3WA 4Y5VA 1UQSB 3EOAB 2VXTH 4HH8A 4ONGL 4NKIL 3C09B 4P49A 4LCWD 4JFHE 1SJEA 2ATKB 5EUKB 4BQBA 5BZWB 3BJ91 5K59F 4BQCA 2YD1A 3ARRA 1FZJA 3LOWA 5ALCL 3D9AH 3KDMA 4MQ7A 3W9EA 3ARZA 3C9NA 4PJXB 1RV6X 4TSAH 3VRIB 5IOPA 1OW0A 4JFZL 1JHTA 1ZS8B 4ONFL 4NP4H 1MHHA 1F8TH 3VXPB 4M9OA 2AXGA 3TVMA 4WIQA 4CBPA 1KCLA 3VWKB 2BSTB 3MV9B 1N6QH 3E0GA 4KV5E 1VENA 4M8QA 4HS6A 1HI6A 3CUPA 3CMGA 3IFLH 3K4DA 3D39A 4KI5F 4C56E 4O2EA 1CGSH 3IDXL 3DMMA 5FGRA 1BQHA 2EKJA 3S4SA 5HD8C 5J3HD 1OSPL 5CGTA 5DFVC 5TDPB 1ZLUH 1HHGA 5HHOA 1YEHL 4JG0L 4ODTL 1L9MA 2EIBA 2XTLA 4L4VA 1A6UL 4TUKL 5IFAH 4MNQD 4DGYH 1ZT1A 3LKRA 5F7HA 5DQJA 2XIDA 1K3IA 4TRPL 4WEBL 3VJ6A 3D0LB 3WYRA 3ULUE 1FL6A 2W0LA 2NY7L 4BFIA 4N8PA 3TWCH 5JA9A 4GMTL 4HS8L 4NOFA 3DRQA 1C5BL 2I9TB 4HIJB 5T1MB 2FBJL 1P1ZB 1KB5L 4HV8A 2IJ0C 2AKRA 1IM3B 4JR9H 4ZUSB 3MNZB 4HIXH 3SOBH 3WKMH 3WE6A 4AJ0A 2FGWH 1S9XB 1A9BB 1RZ8B 3KWWB 1XF3B 3TNNA 3ES6A 4NCDA 3G5VA 15C8L 1FL3B 5D71L 1WBXA 4OKDA 3OZ9H 4LL9A 1JL8A 1YJDL 3FB7B 5J3HC 3QEUA 2HWZL 3PWVB 4YWGH 5T1DH 3S3JA 4NZTL 5F3HA 4K8RC 3RIFK 1TTFA 4J3SA 5AYUH 5IESH 2F9BT 1MRFL 3PL6D 3DIFB 1W72B 1A3RH 1OD9A 3G04A 1JPST 4U6HB 1QUNA 4KUZL 1LNUB 4L4TB 5FOBB 5MEPB 2X4TA 1FGNH 1IC4H 1QRND 4HWBH 3A6BH 1IM9D 1MY7A 4YAQA 1IGCL 1QFUH 1W8NA 1J7VR 2UZIH 5JPNB 2Q3ZA 1L6ZA 4PJDB 4V1DA 4MCZB 4XAKD 1A6ZA 4Y8AA 4UIKH 1QQDA 2CDEA 4FP8H 3PV6B 5MEQA 2VLJE 1JGVH 4M5YL 2VC2H 2B4CC 3INUL 1XH3B 5IV2B 1PZ5B 3QXDA 5SWZE 5K59E 5LVEA 2P1YA 3VXNB 3GSRB 4JY6A 4TNVF 3T4AB 1H15B 3CCHA 4X6EA 2Q3AA 4WUUB 3F6LA 2A9NH 5DZOA 3VFTB 4Y19B 2K3TA 2RIKA 5I75C 1G7MB 1RFDL 2VZTA 5FYLE 4OIIH 1FVEB 3OL2A 4WV1B 3EYFA 2YEZA 4CADA 4Q0XH 1YN7B 3FONB 3JV4B 5EDXA 3ALPA 5EZOL 3PL6C 4Z0XA 4F8QA 5C2UB 5JLZB 3ZT6A 4KJYA 3MRJB 4K23L 3QUXB 3UDWC 2VLRB 2A6IB 1CCZA 5TF0A 2JJSA 1S9WB 2NY6C 1KGCD 1QPPA 1WICA 2JELH 2FLRT 4KI5E 1BBJA 3DRTB 3F7PC 1BAFH 4M61A 4R4BA 2IFGA 4AMKH 1QLFA 5GSVB 3WNOA 3O8XC 4I3RL 3P9MB 1BFVH 4GW1A 3VFWA 3BGFB 4JFYB 5DJ6B 1MQ8A 3MNWB 4F37F 4Q7DA 1UADC 5I1LB 1CXIA 4PGDA 3VMPA 4OLZH 1QTYT 4D0DB 1AO7D 5ESVA 1QNZH 4KI1A 4IHOB 4GXVH 3ARXA 1IGIH 3L3HA 4PJ5A 5HSFA 4FQJL 5DD6B 5IUSA 1WFNA 2R23B 1KELL 5C0CE 1AXIB 5BVPH 2B7DT 4EDXB 3QDHA 3BDBA 1EHXA 5FECB 2YPLA 1KJ2H 3BYYA 1LDSA 3QUYA 4ELMA 3ZDYF 1A1NB 4HF5H 2IANB 4NQXA 1CTNA 4LBEA 2C3HA 4HJ0D 1LP9B 5KSBB 1FGVL 1WFUA 1KYOK 1HDMB 4ZXBD 2R1WA 4NWTL 4OCRH 3LKQA 1S7VA 3O2DH 3O9WB 1NDGA 2OK0L 5CGYD 5TQ0L 1GGIH 4UT9H 3LSOA 5INDA 4LPVA 3O3AB 5D5MB 4AEHL 2F54A 2JCCA 1U8QA 3WHE0 1VFAA 1JFQL 3VGAB 1MCIA 1FO0B 4FQQB 1ES0A 1TNMA 3BP4B 2DQUH 5FYJD 4PJCB 3TA3D 1SY6L 2OLDA 3RPIA 4PJFA 4RX4A 3OKEA 5GS0L 4OFYD 3U2SA 4PRDA 3ARPA 3S35L 5BS0D 5I0DA 4E41B 5DHYB 4J3WA 1BJ1J 3SDCB 5ICYA 2XA3A 2HT2D 1FZKA 2KL6A 4OM1L 1IVLA 1F3DJ 4M5ZH 2LU4A 2HRLA 2EC9T 1T20B 4PJXF 1QLRA 5EU3A 4G8EA 4QOKB 1U8HA 4HGKC 5CSBA 2VITA 3BW9A 3QQ9D 3KYMA 5DJDA 5IEKA 1ZHKB 4QXUL 1UWXK 3MV8B 4HJ0C 2QQKL 2RGSA 4ZXBC 4GW5A 1KFAL 2FHBA 1TTUA 4R4ND 4APQA 4FXLA 4YXHL 3TT1L 5CGYC 5D7LB 3R1GH 3T4YA 4R4FL 5EOTB 1J1XH 3OAYK 4LCYB 4LK4A 4RMVA 3X3FH 4MAUH 4FFZL 4J6RH 2VWEE 1FDLH 2NW2A 3KPQB 2C7UA 3TA3C 3CX5K 4Z76A 1J8HA 5EO1A 3G5ZB 3PWJB 5EORH 3T65B 3VA6A 2VDQH 3BH8A 3FT3A 1KF9B 3PGDA 3IJYA 4HS3A 2NTSP 5DUBA 1OM3H 2HT2C 3PHSA 4XCEA 3UZVB 3BYTA 1D5XB 5CEZE 2AJ3B 3O41A 1F8TL 1KJ3H 3DYOA 1QKZL 1C1EL 3P0YH 2ZKHL 1FZOA 3QQ9C 4LEXL 1E4WH 2PO6C 2MNUA 5E24E 4D0CB 1N6QL 2H45A 4KZEH 1OAQH 3IDNB 4R4NC 3UO1H 1AXTH 1U3ZA 1EBPA 2ICEA 3RY4A 1ZHNA 1CDCA 4TQEL 5E08L 4KK5D 5E94A 3O2WH 4K94C 3T1FB 2X4QB 1RUAH 4O2FB 3VG0H 1BBDH 2ICWB 5C0RH 3QEQD 4JREB 4CL7A 3RWGB 1Q9LB 1BD2A 4DGYL 1CDGA 3MCG1 5KSAA 1KEGH 2RFXA 5ICXB 5H35A 2ZP0T 4UIMA 3SGEI 2GTZA 5F9WB 5J13B 4QO1A 1GIGH 5HYIA 3MMEB 3TWCL 4ZS7H 4NM4H 2BVTA 1CFQB 3SDAA 1EEYB 4KVNH 1F97A 2APWA 3AU1B 3QDJB 3FHQA 3U0PB 5GRUH 5CJOH 1G7IB 3FO9A 1L7TH 4HSQA 3T77B 4JR9L 4YK4B 5TFSH 3TNMB 1P84J 4HIXL 3SOBL 1ORSB 3WKML 4P5KB 3I50H 3OXSA 3HC4L 3RNQB 1UKTA 4Y16B 3IDYB 2JJWA 5EUOB 3W39B 4F58L 1RZ7H 3V0AC 4LSSH 1WF5A 4I4WB 3PDDA 4KK5C 4EI6B 5HDLA 4LLUA 4PJXE 2X89D 3OZ9L 4ZO8A 4HIEB 4W70A 2HG5B 3ARED 4K71B 4F7EB 3HE7D 1VKXB 5T1DL 1CU4H 4FMFA 3HRZA 4Q6IA 2J4WH 4M93B 3MV9E 5E6ZA 2H3NB 1I7TA 4MCYA 3MLYH 1NCNA 1PG7H 1NGZB 1T66D 4WWKA 5E00A 3VXMD 2AJSH 3TN0A 1IC4L 4QHMA 2Q8AH 1F3JA 1A9EB 1DN0B 3SKNA 4EBQH 5D9SA 5F8RC 4WJ5B 2UZIL 2EXWC 2GJJA 3VI3F 3GBML 1K2DA 5JHLH 1CD1A 4BM7A 1UM6L 4HC1A 4FP8L 1DBBL 5E1HB 4ZDHB 1AE6H 4P4KB 2YD8A 2VC2L 2VQTA 2M1KA 1Y0LA 3P73B 3SPVB 2D03H 3STZA 4YFEA 3BRDA 3OKOA 1A4KA 4U1GC 1LMKA 1CXHA 3ZTNH 3CFKA 4AQ1B 3FO2A 2EKSB 4KKNA 5BO1H 3WFBH 3GMLA 3AREC 3VRLF 3HMXL 3HE7C 2J5LC 3T0WA 4JGJA 5JW4Q 2NNAB 5KVFL 5F1IB 3UTQB 3WO4B 3LEYL 5FGSA 4OT1L 4NC0B 1FH5H 1P2CA 3QULA 2N7BA 3ILPA 5E4IA 4YDJA 1D6VL 3GMOA 2AK1H 1YMMA 2OR8A 4K7PX 4IDJH 3DTXB 1BIIA 1LP9F 3K8MA 2CJUH 4EI5A 1BAFL 5GGVH 2WK2A 3CFJB 1TJIH 1QYGH 4GSDH 1TZIA 3OR6B 1Z9SA 1N8ZB 3KAAA 3KYNA 5KJRH 2Z8VC 5DQDH 1BFVL 2GQHA 3NCCB 1UM5H 1L6XA 4EDWH 5E6YA 5EH1A 1QNZL 1I1FB 4FQXA 4PJCF 2YBRB 4GXVL 4MNQB 5D7KD 3ZDZF 3D3VA 3QWOB 4OGXL 2UWEB 4NYLA 1IGIL 1R5IA 3R8QA 1BWWA 1YMHA 3MRKB 4KJWD 3DI3B 4QNPE 1PY9A 1T1XB 4N90D 3MRMB 4NN7C 3AAZB 5A1AA 4RSVA 1NCTA 2YA0A 2XN9D 4PJDE 2XQBH 4KXZI 4PG2A 4DVBB 3BZEB 4WW1B 1C12B 5EC2B 4HF5L 4P46D 5FGBC 3EFFA 3MLXH 3RAJH 3TT3L 1S7RA 3MRFA 4IM8A 2Z35B 3SHSA 3OV6A 4UV4L 4H8WH 1BVKB 2WANA 3VFNB 2CDFB 1ADQH 3GSQB 3C6LD 3O2DL 1G7PB 2R39A 4QWWC 2GJZB 3CXHJ 4U1SA 4WUUE 3S97C 5C08A 4Y19E 2D7TL 3M1BA 5I75B 4R7NA 1QSED 1K8DB 1ZLVK 1N3NB 3BPCB 5DJ8B 1NBZA 4PJIA 4XC1L 3GMQB 1KUMA 1N2RB 4OI7A 2B0SH 4UDTA 4M7LT 5BRZA 5CHNA 5IKCB 5DMIH 5JQ6H 4M8VA 2VLRE 4MJIA 2KDGA 5CZXD 2NY6B 4XHQA 3UTTA 3VGBA 5I73B 2CQVA 3VDCA 2VZOA 4KJWC 3NBNA 2VDOL 3TZVA 5HJ3A 3VI3E 2BHUA 1TQBB 3RQ3A 5IF0A 5GS3A 1OGTB 3O8XB 3Q1SH 5K9QG 2I25N 3HZVB 2I26N 5B22A 4P46C 3O4LB 1K3ZA 2XZZA 1H5BA 5HXMA 2OTWA 4ALAH 3CDCA 1FZMA 4N9GA 5CSGA 4QRUA 32C2A 3C6LC 3FFCA 5I1AA 4YDKH 4O9HH 3U30B 2AJZB 5AWNH 5IIEA 1OPGL 3S88L 2V5YA 3VRLE 4GRMB 4FNLH 1CFNA 3BEVB 3RI5F 5I1CH 5JOPD 4XBGA 4WO4A 3G5YA 4PJGA 3BMVA 1NMCC 2IANE 3I9GL 3MA7A 4NZRH 3CVHA 5CZKA 5K9KB 4EJ1C 1LP9E 5CZXC 2ESVA 4IRSD 4EUPH 2OM5A 2VE6A 5DJYA 3EYVB 4B53A 5FO8A 5F7EL 4HPOH 3TBYA 5T3ZE 5L6YH 3H3BC 2HKHH 2BRQA 3S34H 2AJVH 5E8PB 3HZKA 1KJ3L 1BJ8A 3MLRL 2FJHB 1J05B 3G6JB 4YFDB 1ITBB 3LEXA 1XEDA 3UYOD 4Z7VA 1QBAA 3HAEA 4PJCE 1QFWI 1G1CA 1AD9A 1K6QH 4QRSA 3ZDZE 4F9PC 1DEDA 4M7JH 1RZKC 4KMQA 1FV1A 4QT5A 1JPTL 4TSCH 3LMJH 1GPOL 3MLZL 1BQSA 3QHFH 2PTVA 5IK3B 3BDXA 4P99A 5E5MA 1BM3L 3WBDA 1F4AA 4YHOL 1MEXL 4E41E 5A2FA 5MP6H 3V6ZA 3DXAB 5IMOB 3P4LA 1LDPL 3SKOB 4TSBL 5KAQG 4ODVH 1NDMB 3LKNA 4QRPD 3SKJH 5JW4R 3EJJX 4QOKE 1NGPH 3SGJC 1BBDL 2H32B 4Z95H 2VN7A 2VABB 1DVFA 2CO6B 3ME0A 5I76B 4NSKB 3MV8E 4W6YB 3WIHL 4ETYA 4IRSC 4DFHA 2E3VA 5HYQA 1C16A 5EU6A 4GKSA 5IVXA 1VA9A 4OD2B 3G9VA 1GIGL 3SGDH 5F72S 5D7LE 5F44A 4KVNL 1FYHB 4KQ3H 1NMAH 5HYJA 2LVCA 4JM4H 4H5SB 4QYOB 4YHIB 1U8PA 5I0ZA 3Q6GH 2BNQB 4Z0BH 3C8KA 4JO2H 2NTFB 2ZUXA 5GRUL 5CJOL 4OF5A 4FN0A 5CD3A 4GBXD 3GMNA 1IGYB 5ERWB 5B8CB 3I50L 4TVPE 4G7VH 4ZTOH 1RZ7L 5BS0B 5GRZA 1FFOA 1NCCH 1A1MB 3RKPA 5CKGA 4ODUB 4JM2A 3WS6A 1I8IA 3NTCH 1RIUH 5D1QA 2VLLB 4DZ8A 4U1IA 5IMMA 1YQVH 3T08A 4OAWB 3PWLA 5CINL 3CXDL 3EO0A 2J4WL 2PO6B 2YPKB 5I17B 1YY8B 3D2UD 3MNVA 5FDWB 2V9TA 5F21B 2APFA 3UEZA 3KPOB 3MCLH 1XCTA 1WFTA 1CYGA 43C9B 5D1ZD 4LQ1A 2Q87A 1TETH 5KVDH 4YGAB 3VFSA 5JHLL 1OY3B 2D9CA 4U1HB 3B9KA 4FABH 1YJDC 4M48L 5MERB 1HKLL 2X10A 2Z93A 4GBXC 4H0IA 4NQDA 5JHDD 5KAQF 4PUBL 3W5NA 5BOZG 1J0YA 3ZO0A 4YQXL 5IHLB 1HXMB 1G6RA 4WTZG 3QDGB 2UWEF 3EOTH 3D18B 4NZUH 4OZHA 4QEGA 4RGNE 5TH2B 5DRWB 3C2AL 2MQCA 2VL5B 1WGOA 3QDJE 2XWJA 1T7XA 2W0FB 1BFSA 2X4PB 3GI9H 3RZCA 1GH7A 3BZ4B 2R4RH 4N0YL 4NO2A 3STLB 3RWIA 2C1OA 1TQCB 4UT7H 2IAMD 2A6DA 3IKKA 4NQCD 2VXVH 1SJHA 5DMKB 5D1ZC 5TDNA 1KNOA 4GSDL 2BNRD 3B9DA 1R24B 4LVNC 1CE1H 5KJRL 5KG9B 1F90L 4OV5A 2H2PD 3QQ3B 3ZHDA 2HRPH 2ARJB 1BX2B 4CRPA 4IIQA 4Y4KB 1DLFH 1M7IA 3CFBB 1T4KB 4F7CB 4ELKA 2WBKA 5C70A 5HBBA 1OAYH 2AEPH 3PWNA 1WFOA 2F53D 2CIKB 4RGOL 4XNMA 3V6FA 5KSUB 3S37L 4MD5B 4O4YH 4DTGH 1MI5A 1UXSB 2PW1A 4JY5H 1XGPA 3ARSA 3MLXL 3TPKA 5AD0A 5HHQA 3GBNL 3RWEB 2IAMC 1ONQB 3UTPE 2R8SL 1PBYA 2OJEA 3HC0A 2G5RA 4XRCB 2DI7A 5IMKB 3V7AE 5GS0D 3U83A 2QJDA 3UTSB 3ZHKA 2K7QA 4XPHH 3L5XL 2H2PC 3CVIH 3HZMA 3I6KB 4N0FA 5DVMA 2R69L 4ETQB 2VIRA 1EHLH 3OXRA 4QXGL 3VWJA 4MA7H 3KPRD 3GSXA 4JDVA 2B0SL 4PYHA 3ECBB 4BSWA 1V7ML 5GGSY 1KLUB 1O7VA 1A47A 2GHWB 4MJ5A 4YHLH 3ZDXE 3MOAH 4P9MH 5JORB 3WUWA 5HDBF 2DTMH 4R9HA 5DHVB 3SGKC 3CK0L 1BFOA 4G8IB 2NX5A 4I2XE 4YHNA 2XG4A 3JTSA 4L8SC 1ACYH 2YS4A 3Q1SL 2OL3H 1I1YA 1AQKH 2PTUA 1I85C 5IG7A 2HJKB 3G6JF 3NZ8B 1PQZB 2VAJA 2GAZA 5LQBL 3OHXA 4MNQE 4K9EL 2YD7A 3HTLX 4Z7OF 2CD0A 5GS1B 5JW5A 2UWEE 5GS0C 1PSKL 4WFFE 3TCXA 1A1OA 1BZ9A 1T83C 2FB4H 1CE6A 1UVQA 2QR0A 3NMEA 5E6ID 1WT5C 4FNLL 4ENED 1X4YA 1RURH 3MBXH 5IB2A 4DZBA 1GC1H 1J18A 2GSIA 1TVBB 4Q97A 4LQFL 1R6VA 3MBED 2OYPA 4PP1D 4MWFA 1A6PA 3ARGD 1EJOH 1QBML 1R5VA 4ONHA 1WZ1H 1S7WB 3BXNB 1A7BA 4X80H 1ZVSA 3B2UC 4MB4A 3DBXA 4KROB 3QFDA 2V9RA 2AV7B 3STBA 5L6YL 1JZ4A 4JRXA 2E7CA 2PF6A 5HYSB 4G8GA 5D7IA 4G6JH 5B38A 5I1KL 2B1HH 3U6RB 2KQMA 4Z77A 2KZWA 4U1KA 1ZV5A 5D7JC 4YHYC 2ORBL 2OZ4A 4I0PB 1K6QL 3ULUH 3LVEA 1SYSA 3FT4A 5I8KH 4TSCL 3LMJL 4OQ1A 4OZIB 1UJ3A 4XAWL 3REWB 3GIVB 2UUDH 5ESAB 3DX6B 5E6IC 4ENEC 1WWWX 3P4OA 4ODVL 2QSCH 3DSNA 4V2BA 3VFMA 4QHLA 5C9KA 1Z5LB 4XP1L 5E2TH 3RTQD 5KVEH 1JTOA 4P9HL 5E8EB 4EQ3A 5HGDB 1P6FA 3H0TA 4Z95L 3MBEC 4F7MA 1K8IA 1AGCA 4PP1C 1HH6A 3O4LE 4P46B 3ARGC 3BUYA 3GKWH 4JGMA 5C3TA 3ROOA 4WI9A 4ZPVA 4CUCA 2FO1A 1NCBH 1U3JA 1YPZA 5GJSH 4QHKJ 2YSSA 3KLHD 1T04B 3O6FA 4KQ3L 1NGQL 3LHPH 1KJ2A 2VZVA 3VCLA 1GZPB 3Q6GL 5DFTA 5JUEL 1QSEB 5DJXB 4JO2L 4JO3H 4LHUB 3U7YH 3FOLA 4YNYA 1BLNA 3KYKH 1T1WA 4NNXB 4P4RB 3WDJA 4JFDD 2NY5L 2OQJB 5HDBE 3JSSA 4JEGB 5IB5B 5ETUA 4IRZL 5DYOB 4JQIH 4G7VL 5ID1A 3L3JB 3ULVL 3BE1H 3F7QA 5FO9A 1EBAA 2AQ3A 1JV5A 4O2CB 5ADOH 2AW2A 2RJMA 1EERB 1JIBA 5E0QA 2GSGA 4YPJA 4GMSH 3EOAA 1RQ5A 3NTCL 1RIUL 3RTQC 3IXAB 2FSEA 5H2BB 2PXYB 1JRHH 3G6JE 4G3YH 2ICES 1MPAL 4KDWA 4QXWA 4WW2C 2M8XA 1I1CA 4YIQA 1XIWB 4LDOB 4LFHD 4NN6C 1OF2B 4P2RD 4Z7OE 4L9LC 3F7YA 4FXKB 3FQTA 5T1KD 3KLHC 4I0KA 3MCLL 5ESQA 5FYLH 1IAOB 5KN5B 1F58H 3NIGF 3KPSD 5EU5B 2DQEL 5CJQH 1FNGB 3NN8B 5DF0A 2BSTA 1D7FA 4MYWB 5GGQH 2CLZA 2J8UB 3BEWB 3MUGB 2EDKA 1MJUL 1G84A 5C0DA 4H88L 4RAUB 1HCFX 3I75B 5GPRA 4AL8H 3MOQA 2Y7QA 4DGIH 2VXSH 3QCTL 1EFXD 4OF7A 4Y4HD 1QSFB 3DHJA 5TDPA 4ZFZA 3SY0A 3HUJA 4MXQD 4JKPL 2ZCLH 5JPMA 5GGRY 2R2BB 5C09D 4OCXH 1KTDA 2BNQE 5GISH 4NO5B 2AK4D 3GI9L 2UYLB 1VB9A 3KYOA 1PEZA 1JGEB 4R0LA 4MD0A 5FYJE 2VR5A 5ISZD 2DRUA 1KJVA 1NFDB 5IB4A 2P8LA 2NY2D 1F4XH 3K81A 3BVNA 4H1LB 5BS0E 2IG2H 1T0MA 4MNGA 1HOCB 1A6TA 3C5SB 1CE1L 4LMQI 4U33A 5C0AD 4MDIA 5KBNC 1QSZA 5F88A 2W65B 3MNZA 2EDLA 5EPMA 2XTJD 3E6FB 3UPCA 5ILTH 3MRBA 1RZ8A 3A6CL 5TQ2L 2DWDB 2IPTL 2EECA 1OAYL 4M43L 1FL3A 2NW3B 4ZTPH 4AZ8A 1KB5B 4PY7B 4Y4HC 1G7JA 2ZUUA 5D1XA 3I3DA 3U7WL 5D2NC 1MELA 2O93L 4MXQC 2GTWA 4Y0GA 1A4JA 3UAJD 2V7HB 3HI6H 3LKSA 4NNPH 3MACH 4RMWA 1JWMB 1P9MA 5EBGA 3CH1A 3IFNH 3TO4D 4U6HA 4AENA 4CVXB 9CGTA 3WFCH 2PETA 3BOVA 4L4TA 5FOBA 4MSWB 1L0XA 1Q38A 4PRAA 3QYCA 3DVGB 3TIEB 4PJAB 3GK8L 2WBWB 4MA1B 5JPNA 2CK2A 1GL4B 3OR7B 4C55A 2HLAB 4QHUB 3PV6A 3M17A 2V9QA 4NGHL 4WHTB 5I16A 1MAMH 1RUKL 3D25B 3CVIL 1XZ0B 3OMZA 5JXED 4M9PA 4DCQA 3ARDB 4LSDA 2XTJC 1MJJA 4RZCA 1FNSH 4MA7L 5ENWB 5E56A 4TN9A 5IHZB 2DYPA 4YX2H 1NPUA 1NSNL 4JHAH 1H15A 4NZDA 4O5LH 1JI2A 4BFGA 4YHLL 3MOAL 3DUSA 4ZPTB 1TPXC 4P23A 3EO1B 2XA8L 5EB9A 4WI5A 5A2IH 4TUOA 5KTEL 3NIGE 5D2LB 1IKNA 5D1ZB 5GGSA 2GFBB 3UAJC 4A6YH 3MRJA 1KSRA 2PTTB 4R96B 4CU7A 3MLUL 5I19H 3TO4C 3PABB 1AHWA 1AQKL 3LRSA 3NFSH 1CD0A 1I9IH 4MD4A 3BPOC 1T03L 1UXWA 3SBWA 4BKLA 3GMRA 5H37H 4X9FA 1INQA 3DMMD 1MF2H 1HKFA 5JHDB 4LVHC 3ZLQC 5GSVA 1FFNA 3T8XA 4MXWH 5C0BA 5CEZH 1X5KA 4FS0A 4OZIF 2FB4L 3KXFB 4L4VD 3CC5B 4NQSB 1Q0YH 3NZHH 1EFQA 5IB1B 2E5EA 2V2XB 1G7QA 4HHAB 4JFPA 5JXEC 5L8JB 3O3EB 4RAVB 3WJJA 1M4KA 3V6OA 3VG9B 5LGHH 1VEPA 4QLRA 4ODXA 1YEEH 5DD3H 5EIQA 4YR6A 1FE8H 1IC7H 3BQUA 2R23A 1WZ1L 3P77A 3DV6A 3GRWH 3V4PH 2VLKB 3BIBX 4OZFA 2WLZA 3B5GA 1Q0XH 1T22A 4HUUA 4BSJA 3HPJB 4LEOA 5CIPH 1EXUB 2J6EH 2XNAB 4JPKL 5EA0H 3UTSE 2WBJA 1IAIM 1HZHL 4G6JL 5IHUL 4J3VA 4S1RH 1QR1B 3RWDA 5KSBA 4O02L 4TTGA 4CN4A 5DR5L 3OBAA 1C8PA 2IH1B 3DMMC 2R1YA 4YPGA 3QHZL 3SDDD 5I8KL 2CKNA 4K7FA 4UQ3B 4X4XA 3O3AA 4P5MB 1A2YB 4NO3A 4NZJA 4B0MM 5D96B 1I9RL 4KTDL 1MHPL 4UAOB 1WCQA 4ZD3H 5KVEL 5GS2H 5DEZA 2F5BL 3QIWD 4IRJA 5L9DH 5MENB 4ORGB 4L8SB 3VXRA 3OSKA 4LLYA 1UB5A 1IGTA 5C0FA 3V5KB 2ATPA 1JUFA 1K5NA 3QFJB 3NH7H 4LPYA 4OD1H 4FQLL 2R2HA 2O61A 1U2HA 1BZ7A 1PKQB 1KN2H 2I07B 1S7UB 1P4BH 3LHPL 1ZA6B 5FO7A 2ZUYA 5CSZB 4OLWH 3K1DA 3TFKD 1YNTB 3GEWB 3TF7C 4G43B 1FAIH 1CDHA 2X9XA 1VACB 3MREA 3FTGA 3JWDH 3O3DB 1X4ZA 4E42A 1MFEH 2P5ED 1I9EA 3KPNB 5DUPL 1HHIA 3X13B 3SDDC 4N0CD 1FIGH 3LQAH 2FHCA 1LEGB 1ADQA 5IJKC 4X9GA 1MJ7H 4PRHD 4GRLB 1JWUB 4FMKA 5ADOL 3O4OB 2QKIA 4JJ5B 5LKNA 4XZUA 5DK0A 5EO0B 4PREB 2HP4A 3V5HA 4EEEA 2I60H 3QIUA 3QIWC 3C5JB 3QNXB 1DBKL 2WP3T 5A40E 2ZUQC 3TBTB 1CT8A 4POYA 5D7JB 2Z4QA 4FQCH 2FEDC 1VCAA 1OT1A 5E8NB 4NJAH 4OZIE 4EN3A 4MDJB 5FYLL 3C5ZD 2KZ1B 2J88L 2O5YH 4HKZB 2IQ9H 1F58L 2X4UA 3MV7B 3TFKC 1DLHA 1VGEH 3DYMA 5CJQL 3G9AB 4XB8A 4N90E 3FQRB 3RRQA 5GGQL 4Y4FD 2H8PA 3RGVB 2VAAA 3I2CH 3IDNA 5TPWH 2XN9E 2N7AA 3BHBB 3OJVC 2QTEA 4AYFA 3MBEB 5EBLB 5GRXG 4N0CC 3PGFL 5EIVA 1ZLSH 3OKKB 4DGIL 4RQQB 1SBSL 1NH6A 3IJSA 5MEOA 2WV3A 2JJSC 3RL1B 4L3ED 2ZCLL 4YBHA 4LRNH 4N1EA 1P4LA 4OM0L 1QSEE 2P8MB 5GISL 3DWTA 2F58H 3GIZH 3DGCR 1HQRB 4QRRB 1W72H 1EUTA 1YEJL 1MRDL 4MLSA 4P2OA 1KPVB 2QSTA 4XCNB 3PHQA 1F4XL 5GGRA 4GS7B 4EUPA 4FFWD 4AEEA 1PJ9A 5C6TH 3AU1A 4Y2DB 3C5ZC 1MUJB 3WIIL 4PJAF 1NGWB 4F57L 1KCRH 4NJ9L 1OLLA 3MO1B 2DDQH 4F9LC 2EEAA 1G7IA 3QI9D 1IC1A 3VXUB 5FHBH 4PJ9B 3BISA 4WDIB 2HFTA 1B4JH 1UEMA 2Y23A 1XGRA 5E99H 5C0EB 3R06A 1UGNA 4BZ2H 3BT2L 4WW2B 3LZFH 2BSRB 1DJSA 4M6NL 2NPLX 3LPWA 4L9LB 1U2CA 5EFIA 2FJGA 3L3OB 2PNDA 3T1WA 1F4YH 4M03A 4PRBB 2E7MA 1AJ7H 3QH3B 3L7EA 2GYSA 1AD0B 5D2LF 3M07A 3HI6L 1UT9A 1JYNA 4NNPL 4APQD 3LN4B 1GZQB 4LLQA 2CR6A 5JOPE 4JPVL 2CRMA 2VMFA 3MRDA 1MCJA 3B8SA 1U91A 2AAVA 1A9EA 3T04D 3DGGB 4OBRA 4FFWC 4ISVA 4LIQE 2DS4A 2DIJA 5D70H 3VH8B 3KPLA 1U8KB 1U95B 4HK0B 1RZGA 4BUHA 1AXSB 4CW1A 4XVTH 3GI8L 4F15C 4P5TA 3NGBC 2DJ4A 1VFUA 1D5ZA 4JHAL 4QTIH 3B43A 1AGEB 2PW2B 2RR3A 1I7ZB 4O5LL 2DLHA 4UZGA 3SE3A 4ZFOA 3A6OA 4YUEH 4J3UA 2XWTB 1JVKA 5L2JA 3N1MC 4HH9B 1MCLA 3G5XA 4ZSOB 4W6WB 1MAKA 2ICCA 4APQC 4Z7UB 1RZJH 4X98A 2JIXA 4CAGA 3K3QA 5L8LB 3NFSL 1I9IL 5GSRA 1U3HA 4FXGB 1NMBH 2QADD 4X5LA 3CFJA 5BW7A 2X09A 2OZ4L 3RHWK 4MA3B 3QO1A 5FA4B 4Q6YA 5T3ZH 3QUMB 1R3LA 4J1UB 1HXYB 5CEZL 1CLZH 3BP7B 1Q9OA 3CDYA 2XZQH 1FO0H 5KSAD 4Z5RA 1I1FA 2VDLL 1R0AH 4HUXB 1P4IH 4U49A 4MAYA 2YKLL 5LGHL 5EZLB 3SDAD 2IALA 3RUGA 1YEEL 3VU2A 2APXA 5C71A 1FE8L 1IC7L 2Z31B 5ISZB 1JPGB 3QRGH 2FO4A 1JN6B 1CICA 3DX9A 2MHAB 3V4PL 2GUOB 1VEMA 3D0VA 2GT9B 4PJAE 3BO8B 1Q0XL 5I30H 2E7HA 4X6BA 2B1AH 2BMKA 4K9EC 4WW1A 2J6EL 5EC2A 3CSPA 1S3KL 1X7QA 3MRGB 3S3SA 4HG4J 2HT4D 4HJGB 3FO1A 1KIUA 2G60H 3HI1B 3QISA 4WY7H 4NIKB 2QADC 4HFWA 5I8OL 1JNLL 2VUYA 1FNAA 2A6KB 4Y1AA 1RIVH 1CLCA 5F89A 3F62A 4D2NA 2OTUB 1K8DA 2A73A 2X7LB 1F2QA 3GMQA 5TDOA 1YNKL 5D2LE 3TJEL 3QDAA 2FX9H 1MJ8H 4PJEA 4R26H 5KSAC 3IDGB 4LNRA 1OP3K 3CZJA 1A02N 5EOCH 5L9DL 3TN0D 4OGYL 3SDAC 4TVPH 2OSLB 3BPOB 4UB0H 1NANH 2BVPA 1JNNH 3I3BA 3NH7L 4PRIA 3QIBA 5JHDE 3FZUD 4LVHB 1A0QH 4C59B 4X7TA 5M94B 1DR9A 3RBGA 2FR4A 3H2WA 3RWHA 3J7HA 3GB7B 1ZANH 1RI8A 1KN2L 4Y5VB 3U0WL 3HZVA 3VGEA 3KXFE 3ULVD 1U92A 1SEBA 4OLWL 3MLSH 1SJEB 5CMAA 4K3DH 1KPUB 2HT4C 4U7KA 5E2UH 2F19L 4Y5YA 2ED9A 1FZJB 3W9EB 3KDMB 4LLWA 4MQ7B 3C9NB 2H2SD 4P9HC 3TH4T 2AJZA 3VH8G 4XMKH 3K0WA 1SYVA 4WHCA 1FIGL 3FKUS 4OTXH 4CJ1A 3FQWB 1NLBL 1JHTB 5FHAH 4TTDD 3BEVA 2AXGB 3TVMB 5DT1H 4G6ML 3DVNA 3RP1A 4Q6IC 4NQCE 3ARQA 4K3JH 4K2UH 4EIZC 5L2KD 2F15A 1UM4L 2BNRE 3I84A 1IMHC 5FV1L 4IS6B 4GT7A 4TUJA 4HS6B 3TN0C 3IVKA 4IOSD 1B6UA 2OXGA 4EI5D 5IBUB 1HI6B 3CUPB 3QZWA 5LWYH 5HI3C 4I5BA 3D39B 5CEXA 1D9KA 4FQCL 4O2EB 3UC0H 4RRPA 3DMMB 1BQHB 3S4SB 5DRNA 4CU6A 5J1SC 4NFDA 5IROA 2NY5C 2AVGA 4HGMA 1HHGB 5HHOB 3ULVC 2O5YL 2IQ9L 4L4VB 4ACPA 4DKDC 1NEZA 5FAAA 1FSKC 1ZT1B 2OL3A 3LKRB 5DQJB 4LVEA 3I2CL 1UWEH 5TPWL 3VJ6B 4LKCA 1FL6B 1NC2A 1ZWIB 4BFIB 5KSVA 3BWUC 2H2SC 3FN0L 1L0YA 4WHYG 4LSTH 3DRQB 3MFFA 4GKZA 3QFJE 4TTDC 5J1TC 4WW2F 4WFHD 3RIAF 4EVNA 1VGKA 4HV8B 4LSRL 1PKQE 4DOHB 1JNHA 4GAJH 2ZG2A 2XG5A 4HUVA 4JRYA 5I76A 3WE6B 4OI9A 1FYTD 4EI5C 4PGEA 1LO3H 4F7TA 1GSMA 4H26A 3TNNB 3ES6B 3NCFB 8CGTA 1W72L 3E8UL 3AFLA 1B3JA 5C08D 3EIFA 4KHTL 1WBXB 1NFIA 3W2DH 1DE4A 3F7VA 3UPAA 4NN5B 2IGFH 3K2MC 1A5FL 3QEUB 2BRRL 3TP4A 2VB5A 3PWPA 5JNYA 3C2SA 2FIKB 5F3HB 3LV3A 2ZWLT 1IQWH 4WNQA 1KCRL 3DNKA 1CGWA 2DDQL 3G04B 1RUMH 3L7FA 2LAAA 1A3LL 3TCLA 5FHBL 1KXVC 5FUCE 4AY0A 1Y6MR 3P11H 3MRQA 3U46A 2X4TB 1B4JL 5E99L 5FB8A 4POZD 4YAQB 3UJIH 3VRJA 3L6FA 5CD5D 2GITA 2WUCH 5IEHA 3TYFB 3IDMA 4V1DB 4ODUA 1A6ZB 1KB9J 1QQDB 2CDEB 3T3MF 5MEQB 2P48B 4WFED 2VLLA 1F4YL 2A2QT 4E5XA 1MCKA 2BERA 3QO0A 3S36L 4CN1A 5C0JB 3MV7E 4K7PY 4HAFA 3IRPX 1YC7A 4JY6B 3SJVD 4ZNEA 1KJMA 3CCHB 4X6EB 4X6DA 4IMLA 3PXJA 1FC1A 1LEKA 4LF3A 2JKXA 2Y36L 3EYFB 3S35X 4LSUL 2YEZB 1C7TA 4WO4D 1M71A 4X9HA 5DA4A 4CADB 3CPLA 4JN2A 4U1HA 2VXUH 5DK2A 5T5FH 1H0DA 5I1DA 4Z0XB 2D7PA 4KJYB 4P3CH 2NXYB 4XVTL 3FMGL 3MLTA 3KHOA 1U8OA 5C2BL 2EO1A 4YDVA 5T1LB 1CDIA 4K8RH 5D72H 1BBJB 1NCDH 4M61B 5I6XB 4R4BB 4W4NA 4QRRE 5CD5C 1QLFB 5E2JA 2OJZH 2AXJA 1GGUA 4JFHD 4OUUA 4GW1B 4JGUA 4YUEL 3VFWB 4JVWA 1IGFH 5A2LH 2W0FA 4PGDB 5IBUG 1MFAH 2VLJA 4UTAH 4QF1B 5ESVB 1WISA 4BQ9A 4L3CA 3KNBA 3W81A 2PYEA 3CMOH 4HEPG 2XPGA 3VXUE 3L3HB 4PJ5B 1BEYH 2ZG3A 1BQHG 3S4SG 5FEBA 3EYSH 1NMBL 4LGSB 5DMKA 1D5BA 2IF7A 1K4DA 2YPLB 4JDZA 4WO4C 4NO0D 3QUYB 5EWIH 4ELMB 3DUUA 3BPLC 4C56D 3MJ9L 1ZT7A 3EGSA 1TENA 4LBEB 1FO0L 5J11C 7FABH 4TPRL 4UU9A 2R1WB 3BDYH 1R0AL 1NLDH 3LKQB 3AB0B 1S7VB 4LVOC 5D6CB 1NDGB 4PD4J 3LSOB 1E4KC 3QG7L 1T5XA 1WZLA 3QRGL 2F54B 2JCCB 1U8QB 5E8OB 5KSUA 1VFAB 4DWHA 1B2WL 1ES0B 1VHPA 5I30L 1PX4A 3U9PH 1UXSA 4YGVA 4XPAH 3RPIB 4PJFB 1URLA 3OKEB 2OMNA 1H8SA 2XZCL 4FQ1H 4PRDB 3T0AA 4NQEA 2DD8H 2YN5A 4KZDH 2OP4H 3BP6A 3FQNA 4UILL 2EXYC 4WY7L 1ONQA 3BJLA 1OAKH 4ZAKD 5EBMA 3BGMB 3H9SD 4JPWL 1KN4H 5ICYB 1B90A 5KS9A 1DBAH 1FZKB 2K1MA 4X8XA 1LWRA 1NL0L 4Q74A 3QUZD 4WU7A 3ARBA 5EU3B 1QLRB 1RIVL 4G8EB 2IQAA 1U8HB 1QFPA 4R3SA 1XF1A 3FAXA 2VITB 3ARFA 3BW9B 3KYMB 5DJDB 4ETQA 5IEKB 3MXWH 4KY1H 3O6ML 5TE7H 3U48A 4ZSOE 1NQBA 4GW5B 1G1YA 5EOCL 1VFOA 1F6AA 3T4YB 2W59A 2LTQC 5C7XH 5DHVA 1XGQA 5HGGS 4QGYA 4GG6B 2DQTL 4CMHC 3CFEA 2DQDH 4G8IA 3B9KD 5E2WH 2NW2B 1CN4A 1ETZA 2C7UB 1CVRA 2NXZD 3CZFA 2X70A 4Z76B 4NPYA 1J8HB 5EO1B 4M6ML 5DWUH 1IAIL 1U58B 3VA2C 5I1HH 2IPKA 3BH8B 3FT3B 3PGDB 4OJFH 4DKAA 3EHBD 1HINL 3IJYB 4ZAKC 5IR1A 4HS3B 5DUBB 2AK4E 3MLVH 3BWAA 3I6LD 3PQYA 1BOYA 4JM2C 4XCEB 2V7NA 4R2GD 2HKFH 3QUZC 4LSVL 3O41B 4OTXL 5SWZD 2QQNH 4KHXL 5F1OB 5ISZE 1IEHA 5IW1A 2HJLA 2IPUG 2V5SA 2RB8A 2WM0A 4NBXB 4ZUVA 1I4FA 1FZOB 3RZCD 5DT1L 2BVYA 3CX5J 2C1PA 3GSWA 4K3JL 4K2UL 4XVSH 4AG4H 5DEGA 5IFJA 5FYLD 1KCUH 1CGVA 3ZE1F 2QHRH 2ICEB 1ZHNB 1EZVX 3IGAA 5FYKU 2YZ1A 3UC0L 2Z92A 1FNLA 3B9KC 2ZOLB 5HYSA 1PG7W 4JY4A 4DEPC 2A6JA 2NXZC 3VDAA 2R4SL 4KI5D 1IRAY 4X99A 3C60A 1HILA 3T0ED 4UT6H 1BD2B 4BK5A 2RFXB 4MXVF 2X4NA 5H35B 1UWEL 1WAAA 3ARWA 3EHBC 4HUKB 5FYJH 4UIMB 2GTZB 4P3WA 4DKEH 2GK2A 2I9LA 4R2GC 1XGUA 3SDAB 2Y4SA 4LSTL 4KK6D 1E4XH 4LCIH 5ICZA 5F7UA 3D69A 1ROWA 1MI5D 1NGYB 5J89A 3RZCC 1Z5LA 1T1ZA 5HI5D 4JZJB 4PGJA 5C0CD 3FO9B 4GAJL 3V0VA 3Q6FA 5F6HJ 3U36A 2E6QA 5GQBA 4L5FH 4DUXA 3OXSB 3NIFF 1DN2A 4NOBA 4O00A 1DQLH 1J1PL 1H3PL 2WIIA 1PYWB 1INDL 3LIZL 4LLUB 3GRWA 3SCMD 3CFCL 2IGFL 1YEIH 4Z7WF 2HJFA 1E6JH 4QHKI 4HDIA 4KI5C 6FABH 1A7NH 1UACH 4MJ4A 5DJXA 1J8KA 1IQWL 2AEQL 2DQHH 3HRZB 4LHUA 4Q6IB 3T0EC 3WJLC 3CX2A 1I7TB 4AEIL 2NCMA 3QAZB 1FJ1A 4XP4H 3MFGB 5E00B 4WWKB 2R0ZH 3TN0B 1LD9A 4QHMB 1F3JB 5CZVL 3SKNB 1U8NA 2AQ1A 1WV7T 3UJIL 3D39E 1LO5A 5D9SB 4KK6C 1YEKH 2W60A 1K2DB 1CD1B 1IGJA 4LPWA 4DKFH 2WINB 5HI5C 1C5CH 1Y0LB 4JJHA 4G9FA 5HHOE 5L88H 3MXVH 4N0UB 4L4VE 4HCRA 3WSQH 4Q2ZB 2AI0L 3OKOB 1A4KB 2PN5A 3KGRA 3EFDL 4LHQB 1CDBA 4YDIL 5EC1A 2V2WA 3FO2B 1PFCA 3TJHD 1RZIA 1T2JA 4JB9H 3SCMC 1HH9A 1AGDA 4RGMC 5I71B 1TLKA 4U3XA 2AJUH 2VH5H 2HVKA 1RVFL 3RWCA 2VXUL 5T5FL 5TE4H 1P2CB 1TDQA 3FRPA 4P3CL 3QULB 3FFDA 3ILPB 4ELMF 4YDJB 3GMOB 3ZE1E 1R5WA 1BF2A 1YMMB 4XPBL 3WIFB 3C08H 3OAUH 1T7YA 4K8RL 3BKYH 1BIIB 4PLKD 5D72L 2XZAL 1HHKA 4JFEA 4DVRL 1CK0H 1PGRB 1TZIB 2OJZL 5CCKH 4LASL 4Y5XC 8FABA 1FCGA 3UZEA 2R2BA 2JCCF 4RA0C 5DJAA 2HFFA 4MXVE 4Z7NF 4FQXB 5CEZD 2BC4A 1SMAA 4XPGH 3CMOL 3D3VB 4NYLB 1BEYL 1NFDA 2QQLH 1UC6A 1YMHB 4Y7MA 2P42B 3EYSL 3TJHC 3L3GA 4H1LA 3WNLA 3IAQA 3P2TA 4XCCL 1GOHA 1I75A 5JQHC 4V1DE 3MGTA 1T5WA 1JZ6A 4HPYL 3MRFB 4GAGL 3RY6A 2EO9A 4OCWL 3V52H 1AIFA 1R3JA 2DWDA 5JOFB 4PLKC 2BDNH 5E4EB 3UTOA 3OGCA 2DQGH 2EICA 1J87A 3FHAA 4PY7A 4U1SB 4YHZH 35C8H 5C08B 4Z7WE 3M1BB 2EDFA 4R7NB 4MHHI 5D7SH 4XNZC 1NBZB 5E7FA 1EVTC 4BH8A 2ENSA 3H42H 4PRHE 2NR6D 3V4UH 4UDTB 5BRZB 1TITA 4FFVD 5CHNB 4LU5H 3NVQA 5C07A 1UJ3C 5DK3A 1OP9A 4MJIB 4HXBH 2G75A 1WIUA 4PY8J 1I8LA 3UTTB 3NACL 3QJFA 3HNSH 1CFTA 4RMQA 4X7EC 3TZVB 5HJ3B 2FL5A 1OQOA 1VADA 3P0VH 4WU5B 3SO5A 2HLAA 2EDBA 4MJ6A 4QRQA 4XVUD 4LOUD 2XI9A 2DTSA 5IF0B 1KLGA 3HN3A 3MXWL 1UA6L 3IB4A 1H5BB 5EBWA 3ZKXB 2R0LH 2FATH 3GSVB 4XNYL 5TE7L 2OTWB 2YRPA 1FZMB 3KJ4B 2CH8A 4ZMAT 2PR4L 4QRUB 32C2B 5F7DA 3FFCB 2IC2A 4PJ5E 4FZ8H 5IIEB 1NC4A 1T7WA 4DW2L 5CBAA 4X8JA 2A83A 3VWKD 2CSPA 3S3PA 5BZDA 2FD6H 1CFNB 5HY9A 3EJYC 2DQDL 4LMQE 1J1OL 3MV9D 5E2WL 3QCVH 2YPLE 1ED3A 1N7ML 2IBBA 5HHPA 1PZUB 1XR9A 4FQIH 4XBGB 2JJTC 3G5YB 2NR6C 4XPTH 4ELME 5DJ0A 3REVA 3TBSA 4PJGB 4Y89A 4FFVC 1U6AL 3MA7B 1N4XH 5DWUL 2PCPA 3CVHB 2GW5A 2P5WB 4XWGH 1HSBA 2ESVB 5GGTH 5J11B 2D2OA 5J6HA 4OJFL 3VFVB 2VE6B 5DJYB 3AMKA 4OFPA 5FO8B 3TBYB 5ACLA 5CJXA 3UMTA 3ARUA 2DQCH 2HKFL 1WCBA 3C09C 1JYXA 4LOUC 1ACZA 2JCCE 4FG6D 1PG7X 5IBTH 3HZKB 4PBWD 3RX5A 3ZHLA 5F97E 4ZOEA 3QNZA 43CAA 2RHEA 5TE6H 3DROA 3ROLA 3LEXB 5FDYA 4JN1H 1IAII 3P30H 4Z7VB 4Z7NE 3HAEB 1AD9B 4XVJH 4GH7B 4QRSB 5B39A 4PJFE 1I9JL 3O0RL 3LQMA 1FV1B 4L29A 4QT5B 1J88A 2WP3O 2QHRL 5E5MB 4YE4H 2ZPKH 1AGBA 1F3RB 3SO3B 3V6ZB 3VWKC 1IAKB 3UX9B 1KPRA 4U7MA 1XGYL 3LKNB 5A16B 1FQ9C 3DURA 4GAFB 3BESR 5ADPH 1QFWM 5DRZA 1MWAA 2IBZY 1MLCA 1DVFB 3VW3L 1EGJL 1ZGLA 3MQIA 3A0OA 2A74A 3HR5A 1AI1H 2OR9H 3VXQA 2KH2B 5EU6B 3BD3A 3HE6A 3MUHL 4GKSB 5IVXB 1N0XH 4HMDA 5AAMA 4GAYA 1A2YA 2QSVA 2R15A 2Y06H 4HZLA 3L3KA 3TLRA 5HYJB 1V7NL 1XR8A 3K8LA 4LCIL 1E4XL 2VRAA 4FG6C 3H9HB 3C8KB 1MFNA 1OARL 3VDBA 3EUUA 4L4TD 5CP7A 2OMBA 2Y25A 1PW3A 4X6CA 5MENA 4LRIA 1BFTA 1BQLL 3LB6D 3RBSA 3GMNB 5DGRA 4GQ9H 2BZDA 1SBBA 1A6WH 3ULVF 5FCUH 1DQLL 1FFOB 2XKNA 1RZKH 1RK0A 5DDHB 3LN9A 4JM2B 1CQKA 3K4ZA 1I8IB 3L5JA 4GOSA 1ZA6A 4NKIH 5D1QB 4HKXA 4DZ8B 4D0BA 4U1IB 3LS5L 4PGBA 1A7NL 1UACL 3PWLB 1EAPA 2DQHL 3GMMA 5JA8B 4WUUD 2W9EL 3EO0B 3BKJL 3S37X 5DUMH 3X13A 4P23D 3MNVB 1T3FA 1KLFA 4ONFH 1XCTB 2EYRA 4XMLH 3GSNA 1TVDA 3VD9A 3LRGA 4LIQH 3X3GH 3OKLB 3PP4L 2CDGA 3QUXD 4P59H 2VLRD 4YH6A 4HLJA 3VFSB 1T89A 4PREA 3D6GA 3B9KB 2UVEA 5D93B 1HWHB 4DKFL 3HZYA 4I18A 4DEPB 3GGWA 1S5HA 5L88L 4XP5H 2Z93B 1JGLH 3LB6C 4NQDB 5DD0L 1BD2E 3SGEH 3L3DA 1MREL 1N6VA 3IDXH 1G6RB 1LK3H 5IM7A 3VFRA 3NPSC 5DS8A 4YHML 4JB9L 1GXEA 4NRXA 4OZHB 4JG0H 4ODTH 3KPMA 4HT1H 3HG1B 1I3RA 1A6UH 5EO9A 3WS3A 2XWJB 2VH5L 2LE9A 3VFPA 3FQRA 4XT1C 3RZCB 1QFOA 2J12B 4LKXB 4TRPH 3LH2H 1C7SA 4WEBH 2Z8WC 4U1JA 1YEGH 3M45A 4NO2B 4L8BA 2R0KL 3BHBA 4OFVA 5DA0B 3RWIB 4P23C 3QWRA 3OAUL 4HS8H 4WV1C 2A6DB 2BCKA 2BP3A 1C5BH 1SJHB 5TDNB 1KNOB 4H0GA 2FBJH 2IAND 3EKCA 1KB5H 3QUXC 3JUZA 4OV5B 3HAEG 1CF8H 1M05A 5DSCA 4ZUUB 2HMID 4IIQB 1M7IB 2P8MA 2GJ6A 3O9WD 4PJIF 3VXSA 4MLIA 1MH5A 4ELKB 15C8H 3AS1A 4YHKL 1MLBA 2ADIA 4XPGL 1P7KA 3PWNB 1YJDH 4U0RC 2QQLL 1U8JA 2YD9A 4NZTH 4XNMB 2Z91A 3V6FB 1NGWA 3KS0J 5IQ9A 3T09A 2IEPA 1MCPL 4G5ZL 4QGTA 5E9DB 4OLVL 2IBGA 3RDTA 4IRJD 3HPLB 1MI5B 3V6OC 2PW1B 4KUZH 1XGPB 2FRGP 4E41D 1O7SA 4YO0A 3SDCD 5AD0B 3CD4A 3DX7A 1X9QA 1FCCA 3ULVE 4JFXB 2Q86A 1IGCH 5LBSH 2BDNL 2OJEB 3O6LL 4PYGA 3HC0B 4QOKD 2YMXH 2ZCHL 3JVGC 4PRPA 3SE4C 1I8MA 2R0WH 1I7UA 4YHZL 3INUH 4MS8C 3MV8D 5LG1A 3HZMB 4N0FB 4G8FB 5GRVK 4NFBA 2VIRB 5F7KC 2HMIC 3OXRB 3IFPA 3VWJB 1DBJL 3O9WC 3GSXB 4JDVB 3V4UL 2LV4A 5D7LD 5DVNA 5CWSA 4LU5L 1W0VB 4NKOA 4PJGF 3DO3A 5BOPA 2KUTA 2P7TA 3TM6A 3WUWB 1YMME 1RFDH 3DGGA 1DCLA 2QHLA 2HFEA 1BFOB 4JPIB 1CQYA 4AH2A 3I3EA 3ZSTA 2NX5B 1LEIA 1U8KA 5EZOH 3WKNA 4YHNB 5K33A 3JTSB 4K23H 4IRJC 3PF2A 5JXAL 2GK0A 1I1YB 3X11A 1CLYL 5IG7B 1JZ5A 2FATL 3SDCC 2IMMA 4EXKA 1QLEL 1M7DA 3MLWH 2GAZB 3OHXB 4XI5D 5JW5B 3D3VE 4I3RH 4FZ8L 4LCWA 3L95B 1A1OB 1BZ9B 3O3BA 1QOKA 4LCUA 1UVQB 2QR0B 5JW4N 2YWYA 2FD6L 4KXZH 1UCBL 5IB2B 4DZBB 2GSIB 2YUZA 5DD5L 3RHWF 4RIRA 1C08B 4HZAA 4Z7UA 5FUZL 5HPMA 4FQJH 4Z8FL 4MWFB 4ZOAA 1R5VB 1KELH 3N1FC 4ONHB 4NKQB 4XWGL 1WBZA 1ZVSB 4KGJA 1V3MA 5GGTL 5C3LD 3NFPA 3DBXB 3F65A 3QUMA 2EYTB 1A64A 4J3TA 4JRXB 5I1IH 2ZJSH 3N85L 2JJUA 4CMMA 5C08E 3H3KA 2BNUA 4G8GB 3QIUC 5D7IB 5B38B 3QXAB 4I2XA 4OKVA 1RULL 1FGVH 4Z77B 4PJIE 4U1KB 3GJEA 1NUDA 1TJGL 1V8HA 5BRZE 5IFHL 2OK0H 3FB6A 5TQ0H 1SYSB 3FT4B 3RPKA 4XI5C 1UJ3B 4MJIE 3PWUA 1JPGA 3QDJD 2FEEI 3UTTE 1FG2A 2AS5M 1JF1B 3BO8A 4PJBB 4PTTA 4OFIA 3P4OB 3GUTA 1SY6H 2DIBA 5F3BA 3IRZA 3VFMB 4QHLB 1VDGA 4O58L 3VGHA 4JFOA 1IEBA 3MRGA 4JM2F 3NCEB 3H0TB 4Y16D 3WNPA 1KXQE 3S35H 4F7MB 1K8IB 1AGCB 5C86A 1HH6B 3AXLA 3IDIA 3BUYB 1I3GH 4ZFGL 4ZPVB 5B3JF 1YPZB 2E6JA 2YSSB 3AROA 3B8YA 4MNHA 2UUDK 1N0XL 3FFCE 2Y06L 1CL7L 3HRPA 5HDQL 2N4IA 3O6FB 4JREC 1KJ2B 4PB0H 4QXUH 3VCLB 1UYWL 2MCPL 3EDKA 3MRHB 5FCSH 5I66A 4URTB 1A7OL 1TMCB 4KTEL 3FQUA 3FOLB 4YNYB 1DQMH 2NLJA 1BLNB 5F9WC 5J13C 4RFNB 4BZYA 1T1WB 1HYRC 4YXHH 4PJGE 2D3VA 4U2YA 2BSSA 2OCFD 5D8JL 4R4FH 4GQ9L 5HVGB 5ID1B 4I1NB 2FDBP 2MMXA 1A6WL 2ESVE 3PL6A 1AC6A 5FCUL 5FO9B 2DM3A 1JV5B 3NAAL 3RVUD 3UDWA 2APTA 1Z6JT 4P4KD 3TIDB 3W0WB 4YK4C 2GSGB 4UUJA 2XQYK 5DJ2A 3O81A 4P5TD 1QRNA 3UTPD 2FSEB 4OZHF 1IM9A 5T5NG 4Y16C 1QFWH 3IDYC 1KPUA 4G80B 3WUWG 2VKXA 5ACMA 1VEOA 4YIQB 5DUML 3F7YB 4K71C 1L0QA 3FQTB 3FQWA 4XMLL 3EDJA 5ESQB 3BN9D 1QKZH 1C1EH 2ZKHH 4LIQL 1MNUH 1R3HA 1ZSDA 4LEXH 3X3GL 4P59L 4M93C 4GW4B 3AM8C 5F7YC 4CGTA 2C3XA 2CLZB 4MVBD 5I15L 4IS6A 3LCYA 1IE5A 3P40A 4G6AD 1B6DA 3F7RA 4XP5L 1JGLL 5C0DB 4JO1H 1IARB 4TQEH 5HHXL 5E08H 4OZGB 3EBAA 4WENB 4HWEH 2Y7QB 3RVUC 5EU6E 1LK3L 3BZFA 1WLHA 5ALBL 5IVXE 3MR9A 4TVSa 4P4KC 3QWQB 4OLUL 1QBLH 4ZFZB 3SY0B 3HUJB 4K8RD 5J9PB 5HYJE 4P5TC 3WXVL 4HT1L 5JPMB 1KTDB 2BY1A 1X44A 1EPFA 4B50A 2C4XA 4WFFD 3KYOB 3RWFA 2B2XL 3LH2L 1KULA 1YEGL 1ZWIA 4R0LB 4MD0B 1KJVB 3SE3C 4J7RA 2VKWA 3WLWC 5IB4B 2P8LB 2VZ3A 2CLRA 2G9HA 2X4RA 1AO7A 3BVNB 5B38G 4OI8A 3WO4C 1OGAB 3BN9C 5I2IA 1T0MB 4MNGB 3PHOA 1A6TB 3H9SE 3KLDA 4MDIB 3U1SL 2ZZUT 1CF8L 5F88B 4MVBC 3T0BA 5EPMB 4XXDA 1CG9B 1B4RA 4D9LL 2FX7L 3HC4H 4G6AC 4FFYL 4F58H 3MRBB 1FPTH 5B3JE 3H9YA 3MLPA 1Q9KA 5T5NF 1G7JB 5D1XB 5AZ2L 3MJ8A 1KB9K 2CIIA 2FIKA 4ZXBA 2GTWB 4OIBA 2ZUVA 3U79A 1A4JB 4IMKC 3U7AA 3LKSB 1KTKE 3WDIA 1VFBA 1JYWA 3CH1B 2DBLH 4AENB 2NY6D 4N1HB 1UJTA 3TO2A 3GFUA 4PRAB 3RX8A 5LBSL 3TA3A 3JUYA 2VDML 3O3UN 3TYFA 3GBMH 1OTUD 2YMXL 3O8XD 4U6YA 1UM6H 1AQDB 2R0WL 4OFYA 1DBBH 5AZEL 3NPSB 3M17B 3O4LD 4KPHL 5KVGL 3I6LE 1YA5A 5I16B 4OZHE 3NABH 3I02A 3VXOB 4DCQB 1J5OL 2H1PL 5C0JA 2WWMD 4RZCB 1MJJB 2NZ9D 4KDTC 2ZNXA 2DYPB 1YYLL 1HCVA 3DUSB 4FHBD 4P23B 1DDHA 5IT2L 3HMXH 4LDLB 4TUOB 1ZKAA 5KVFH 3LEYH 1H3GA 4OD3L 4OT1H 5KW9L 5GGSB 4NKDA 2D4FA 1HEZA 4AM0B 2ZOKA 1D6VH 3FB8A 4WHYH 5DD1L 3B9VA 3QXUA 1AHWB 3LRSB 5T1LA 5I73C 4JVUA 4OGAD 4TNVK 4XMPL 3QPQD 4MD4B 1UXWB 2HN7A 4BKLB 3GMRB 2YWZA 1INQB 3MLWL 4TOYH 3T0EE 1TQBC 4HLZG 3ZTJH 3PXHA 1FFNB 1CGXA 5JIKA 3T8XB 3IS0X 1OTUC 4R8WH 2ITDA 5C0BB 4U0RB 5JO5A 1ZMYA 1G7QB 4Y5YC 1FVDA 4JFPB 4QF1A 4RAHA 2DQIL 2WWMC 1IZKA 2NZ9C 5ID0A 5L0QB 1MI5E 4OQTL 1NUGA 1RU9H 3U30C 2AGJL 1MFBH 4OGXH 3OKNA 4M1GH 4J3XA 1Q72L 4ZYKA 4ODXB 5DTFB 3W9DA 4YR6B 1F42A 3BQUB 1MWAL 4PD4K 3DXAD 3P77B 3DV6B 4JRWA 4OZFB 2FZ3A 1T22B 1YPZF 2DLTA 5JTWA 4HUUB 4F37K 2CPCA 4LEOB 2EH7H 5I1IL 2ZJSL 4WCYH 2WBJB 3TT3H 2YR3A 4X4YA 2FYYA 3RWDB 2IADB 4OGAC 4UV4H 1DUYA 4PLNC 3QPQC 1RUPH 4G42B 4PV8A 5D6CA 2R1YB 4YPGB 1ZGLP 4K7FB 2ZCKH 4X4XB 3QEQA 3ZE0F 2D7TH 3SEPA 1XF4A 4NO3B 4KVCL 2BNQD 5E8OA 3X14A 4XC1H 5FKPB 4YXLL 2HH0L 4HIIA 2L0DA 3EAKA 4PLJD 4X5WA 4ZOBA 4NUJA 4IRJB 1QA9A 4J3OC 3VXRB 2D7QA 4HIHA 4LLYB 1UB5B 1IGTB 1IILE 5C0FB 1I3GL 1PLGL 3BGMA 2EIZA 2ATPB 2VDOH 1JUFB 4PS4L 1K5NB 4TULH 4JFFA 1QHOA 4HJJH 1RUQL 1OD7A 4FZEH 2R2HB 2O61B 1BZ7B 4PB0L 1RJYA 1DQDL 1F45A 5FO7B 2AJXL 2DL2A 2VISA 3O45B 2PO6D 2VL4A 3BN3B 3MREB 4L8DA 2X89A 1DQML 3FTGB 1NBQA 4E42B 3AREA 3L9RA 5DRXA 1DANU 5HDOA 1HHIB 3L5WA 4F7PA 4U1MA 1OPGH 3S88H 4GG6A 2W91A 4ZQKA 1ZT4B 4PP2A 1CL7I 1FAKT 4H25A 2M26A 3WLBA 1ZA3A 4XCYA 4XTRD 2QKIB 2KPNA 4XZUB 5DK0B 1ZHBA 2WMPA 4JRXE 3VXMA 3V5HB 4PLJC 3I9GH 4G8GE 4NHUA 3UP1A 3HUJF 5B8CC 3QIUB 5DO2D 2E7LC 1NJ9B 1U58A 3TPUA 1QFWL 2Q1EA 3SE8L 1CT8B 1MCOL 1NBVL 2Z4QB 1X4XA 3QDGD 3H6JA 3IFOA 5F7EH 4NUGH 3DI2B 5CS7A 1EO8H 3CLFL 4EN3B 3RKDD 1NAMA 1JHKL 1TVHA 5M95B 4M6OH 1ZVHA 3MLRH 1MNUL 2X4UB 2DKMA 5DZNA 1DLHB 2PYED 2A0LD 4I48A 4U4BA 5HHMB 1XCQA 2H8PB 2BHZA 2VAAB 1JPTH 1GPOH 3MLZH 4FA8A 1H3UA 4JO1L 1BM3H 4JAMA 5JR1L 4YHOH 2X40A 1MEXH 4RFEA 1LDPH 1YPZE 4HWEL 4TSBH 5FGBA 2RAMA 5LJYH 2ZOLA 3QDMB 4XTRC 2HA1A 1HNGA 3DOSA 3IJSB 1M7XA 5MEOB 4Y4KD 1QBLL 3IXTA 1G7LB 1EO7A 5IMLA 1GGTA 5DO2C 1P4LB 2CR3A 3WIHH 2MQ0A 1SHMA 4OZFG 5IB3A 4LSQH 2FX8L 3ZE0E 1QVOA 1JGDA 4GXUN 4P2OB 5H8DA 2XXCB 3PHQB 5GGRB 3RL2A 4EUPB 4XNUH 4QNPF 3RKDC 3S8WA 3S9DB 2EXWD 5KOVC 4L8CA 1Q1JL 3SQBA 1OAUL 1NGYA 4H20L 5GIRB 4PJDF 5BMFL 4JZJA 2A0LC 5E5UB 2LU7A 1TQCC 5GRYA 3WNKA 1ERNA 4MHHG 3PNWA 4RMSA 2ILLA 4BZ1L 4UDUA 1XGRB 2D0HA 5GZOC 1FPTL 3DO7A 3R06B 5FGCB 4LSPL 3UTSD 3OG4B 3KG5A 1CGUA 3EZ8A 3GSOA 2MKLC 1PYWA 4Y2OA 1IQDA 1S7SA 4P57B 1MQKH 5EFIB 2FJGB 5T3XE 3HLAA 3MRPB 3LQZA 4Y4KC 1O0VA 1JP5A 3L7EB 5CINH 5I74B 4XP6L 3C6LA 3CXDH 3DX8A 5SX4I 4JDTL 1S9VA 1GGCH 4XGZB 2DBLL 4LLQB 4GFTB 4W81A 4PGCA 3NPZB 2P4AB 3MRDB 1E27A 1U91B 2I27N 3BAEH 3FJTA 2VYRE 3KLAA 1J12A 1JZ3A 3HI5H 2DQJL 4ISVB 1WUNT 3MZTA 2EH8L 4U1NA 4ODHL 3UYPA 3EYUL 3KPLB 4HAGA 3X12A 1CZ8L 1RZGB 2WINA 4WUKL 1IZJA 2XRAH 4M48H 4CW1B 3HUJE 1MCDA 1KT2A 1HKLH 4A2MA 1J9CT 3MUJA 3NABL 3I85A 4N0UA 4P5TB 4Q2ZA 4PUBH 1D5ZB 1JWSA 4U1LA 3PQYD 5F71A 4YQXH 1MVUA 3DSFL 2Z8RA 1AY1L 5J12B 2Z9TA 2DLFH 4ZFOB 2D31A 1P7QB