4X7SH

Structure of omalizumab fab fragment crystal form 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNYNPSVKGRITISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Epididymis luminal protein 214
publication title Structure of the omalizumab Fab
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7sH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7sH01
4FG6C 2AQ2A 2PR4H 4ZO8A 4WTZA 2H26A 4P59L 3WV0A 5GIRB 1LE5A 1BOGB 3UX9B 1EFXB 5ALBH 2DYPD 4JFFB 2G5BB 1ACYL 2CRIA 4Z7WA 5HI3C 4EZMA 3G6JA 5FO7A 4OQTH 3QZWA 1IBGL 1U93B 3PF2A 3PL6A 4D8PB 1TJGH 1A6WL 1DEDA 4K94H 4TPRL 1SM3L 4H1LG 1B2WH 2VE6A 4XP6L 5D7SH 4TUOA 1G7IB 4HIHB 4MNHB 2UVEA 3D85A 3PGDB 2JK5A 3N9GH 2JJTC 2QSCH 2V5TA 2C7UB 3IJSB 2EYRA 3MLVL 1VB9A 5JZ7C 2MNUA 5LCVL 2XWJA 3L5WB 1R3LA 3PWNB 4UT7H 1UENA 2EE9A 3JWDH 3BQUB 2YBRB 2X4UA 2YC1A 2APVA 2XACC 2FJFA 4XPHH 1P5UA 4FMFA 5GGSY 4JPWH 1CLYH 1A64A 4WO4A 5F7EL 2OBGA 2W07A 3STLB 1DBKH 5JHDA 5JOEA 2P5WD 1MWAA 1P7QB 1U41A 2XZCH 2E6QA 3EAKA 1B9ZA 4PP2B 3HAEH 3RY6A 5HPMB 4M3KB 1OD9A 1FIGL 5JO5B 1VEPA 4LSRH 3O11B 4R97B 3TVMD 3ULVC 1OAQH 3UPRB 3TO2A 1FQ9C 1YEGL 5HHOB 1E4XL 3TBYA 5C0ND 1TZGL 1W8NA 5E1AA 1PLGL 1HQRA 2NY5L 4DGVH 1TQBB 5JNYB 3ARFC 5B38A 3T2OA 1A6VH 1J0IA 3ECBB 4PJDA 4S10A 4JFEA 4QWWC 3KPOA 1JWUB 4NHUA 3DV6A 4O4YL 4JB9H 3MCKB 5GGUB 1INDH 1J0KA 4MWFA 5CZKA 3OJ2C 4OZFB 4PJ9C 1NGZA 3IFOB 5FB8A 4E41B 3VFVB 4EXPX 1IT9H 2AK4B 3NZ8B 4KMTH 4NQDD 1M6OA 4MAYD 3DHJA 5I2IB 3RAJL 4OLYH 3GRWH 5D1QD 1FFQA 4Y16A 1W72L 5E2TH 4RA3A 2XKSA 1IGML 5ICYB 4Z7OE 5M95B 4J1UA 3V6FA 5F9JB 2QKIA 3TYFB 4BFGA 4Y5XC 4RZCA 2OMNA 2AJSL 3QIWD 4OZGB 2X9WA 5KVDH 4QOKE 5I8OL 1ADQL 3MV11 1Z6JT 5DMYA 1CE1H 4K94C 2P8LA 5HY9A 1DLFL 1TCRB 2AV1A 3DX8A 4LVOC 4DOHE 1OWRM 4EBQH 3LZFH 1IAKB 4DN4L 4O5LL 4MA3B 5BO1L 5F7FA 1MJUH 1GXEA 2D03L 1RIHH 1IGYA 2NW2A 4L4TB 3VXPB 4OFIA 5CFHA 4G8GB 1DFBH 1MPAH 4YBQC 3JWDC 2XZQL 1K4CB 3ZE0E 2XKNA 2J6EL 1YNLL 1CQYA 4EUPH 3GSWB 1FL3A 2CDFB 2DIBA 5CINL 4O02L 2NX5B 1YEDA 2OX5A 4QRTB 3QXDA 2B1AH 3QDMB 4NKMA 4Y4FC 2HLFD 4RMQA 2IQ9H 5F9AC 4MD4B 5BRZB 5CEZL 3O4LB 3WIIH 1KELL 2YUVA 3B83A 4G6AC 3VGAB 4ZS6C 3QWQB 1YC8A 4F7EB 3CDGB 4GG6A 4KRLB 4KDTC 4LCCB 3H3KA 4LLUB 1R6VA 1WAAA 3X3GL 1QKZH 4F7PA 2WWMD 4XPBL 3T2QA 3CUPB 2DBJA 4YNYA 1DN0B 2ZNXA 2X42A 4MVBD 5L2KD 1FNHA 2VDRH 3O4OB 2VDOH 1J5OH 1CF8H 4HT1L 1V3MA 3DNKA 1C16A 3B8SA 5FM5O 4JQXA 1A7PH 2Z93B 4IDJL 5JORB 3VE0A 2BDNL 5SWZE 4MQ7B 1L9NA 4MA7H 2AK1L 4HPOH 2C3WA 1T1XA 2QTEA 4XBEH 3VWKC 2AQ3A 3VRLE 1MELA 4P4KC 4G6JL 1BD2D 1QSEB 3HZYB 5I1KH 3QEUA 1NUGA 4K7FA 3OGCB 3I6LD 4X6DA 5A2IH 1KBGH 1AHWB 4WWKC 3GEWB 1OP3H 5BZDA 2YN5A 5K59E 4PLNC 1JMXA 1KLGB 2R1WB 1JCKA 4M93C 1U3HD 2XXCB 2ZCKH 4NDMA 4WW2B 2QADB 4LCYB 4KVNL 4LSDA 3KYOB 1BEYL 4ORZC 3BZEB 5BS0B 3HPJB 2Y4SA 4WDIA 4B50A 1JYWA 2FRGP 4L3EA 1OSZB 3E1F1 1WQVT 3TBWA 3FFCB 1Q1JH 2IALB 2DTML 1XGYH 3UAJD 3P9WB 4L8CB 2GKIA 3DBXB 1QBAA 4K71C 4J3VA 1FDLL 4Z7VB 3NVQA 5GIRA 5D6DA 1S5IL 5HYQB 1BOGA 1EFXA 5FYJD 2F54E 4AT6B 1AQKL 3OPZL 2EH8H 4H8WH 3RWFB 1RV6X 4E9LA 1U93A 5HHVL 4D8PA 2AEQL 4KK9C 3NCYP 1HHJB 2FL5B 4I3SL 3S9DB 1G9MH 4X83A 1G7IA 4HIHA 5HXMA 5IJVB 1J12A 3PGDA 1AO7D 3SDXB 3BD4A 5EZOH 2C7UA 3LSOB 2VLKD 3IJSA 2ZUTA 1L7IH 3L5WA 1YEHL 1NDGB 3BQUA 1IZJA 2YBRA 2HMID 2D9QB 3ORJA 4G9FD 3IVKB 5J0BA 3HNSL 3BPLB 1T2QL 4PY8J 5CCKH 3QEHB 1NCUA 4UOW1 4PP2A 4KAQL 2DQHL 2W1NA 2YSSB 5LWYL 3W2DH 5DUPL 1TNNA 4I3RL 4TSBL 5BV7B 3QNYB 5JO5A 1OGAB 3O11A 3ABZA 4M1DH 43C9B 1JPGB 4Z95L 3UPRA 3M1BB 3ZKMD 4PP1C 5HHOA 3ZTNL 2XPGB 5ETUB 4BFBD 2NY2C 3BT2H 4S0SD 1FORL 1ZHBB 4GFTB 1FC2D 3ECBA 4JANB 1XF2A 3W82A 1JWUA 2D7PA 2AS5M 3MCKA 5GGUA 4NM4L 4GW1B 1XIWD 4UUJB 4Y7MA 3RIAF 4OZFA 2NTFB 3IFOA 5FCUH 4WI2A 1MHEB 4MMXC 4J3OC 1YYLH 4E41A 3B4NA 2DI8A 3OZ9H 4MXQD 4ZAKD 3VFVA 2AK4A 3NZ8A 1PX3A 1F3JB 3MLYH 2NY0D 4CUCA 4FP8H 2WUBL 5I2IA 4OCLC 1IGIH 4UQ3B 1WCQA 4FZ8H 1UWXH 4OQ1A 2EC9U 5BVPH 5ICYA 1EHNA 1VERA 4NQDE 2P49B 3ZKSD 3B9DA 4WEBL 5F9JA 4M3JA 3TGXA 3TYFA 4JRXD 4OZGA 4PRHB 4OIIH 4DFHA 3WHXB 4LGPB 5FV2A 3HMXH 5J6GB 2MQ0A 2E5EA 1TCRA 2C9AA 1G9MC 1IAKA 3RDTD 5CKAA 1HXMB 4MA3A 5I1JH 4PJCE 4U3CA 5C0JB 4K8RC 5FO8B 5KSAB 3BKJL 4L4TA 5BZWB 4ZXBD 2W9EL 2XTJC 1GAFH 4G8GA 3HAEG 4Z18A 1K4CA 3SDDD 3HS0B 2D7NA 3GSWA 2CDFA 3GSUB 5GHWL 2NX5A 4QRTA 1YYML 4JO3H 2W92A 3QDMA 3MXVH 2LE9A 4PJGF 2NY4D 1WEJL 1VADB 4MD4A 5BRZA 1IAOB 3O4LA 4F7CB 1MNUL 4HCRH 2DAVA 2H32B 1CLZH 1NC4B 1Z0MA 2DKSA 4U1JB 4EOWL 4GAGL 3TZVD 1N6QH 5IMLB 4UIMB 1T5XB 4F7EA 2EDFA 4F57L 3CDGA 2F58H 4TVPD 4LCCA 4LLUA 1EGJH 4ELMB 3O2DH 3CK0H 4HHAA 3BN3B 2NXYC 3CUPA 3RBGA 1DN0A 2J5LC 4ZUUB 5JW4Q 1CU4L 4HPYL 3OHXB 3T4YB 1DEEB 1G7PB 4Q9RL 4RA0C 3ARRA 3PL6D 3BKML 5JORA 2Z93A 1I3UA 1NGPH 1FN4B 4GRLB 4MQ7A 5KSBF 4UU9B 4MMZC 2XZAL 3NCFB 2DMKA 3FQRB 4LPVA 5D70H 2AW2A 5L2KE 3QFDB 3BPNC 5DHVB 3D85D 4U0QB 5EIVA 2VLMD 4GQ9L 4NZJA 1F2QA 1OP5K 4M5YH 1QSEA 1U8PB 3HZYA 4L8SC 3QQNA 3J7HA 4LRIA 5DD0L 4YQXL 3MLZL 2MTPA 3OGCA 2VC2L 1AHWA 3FRUB 2BJMH 3DIFB 1QFWH 1KLGA 2R1WA 4ZUVB 5F89B 1A6AB 1BD2E 3HNVH 4WW2A 4LCYA 3KYOA 3NABL 1JK8B 3MGAA 4YHYB 5BS0A 3BZEA 3LV3B 3HPJA 1EJOH 3I6LE 1NMCC 4PRDB 5IVOA 4XTRD 1OSZA 2I60H 3C6SB 4NT6B 2OYPA 4JO1H 3QQ4B 4ALAH 3FFCA 4PGEA 2IALA 4EUPG 1FO0H 1M7XA 5K9JH 4L8CA 1A7RH 5D2NE 3SDAD 3V5DB 3DBXA 3RUGE 4ENEC 3G04B 2AJYL 4Z7VA 3QG7H 5HYQA 1FC1A 5D1XB 4WENB 1LK3H 4N1EA 5DD1L 4AT6A 5IV2B 3RWFA 3ZYJA 3BDYH 4ZFGH 2P5EB 1RUMH 4U1GB 2FD6H 4R96B 4XVJH 1HHJA 4AL8L 2FL5A 3AY4A 3EOBB 1JRHL 1GPOL 1X5FA 5FYJE 1J05B 1WBZB 5IIEB 5T1DL 5IJVA 2PW1B 1FZMA 1YEIH 3HPLB 1HYSD 3SDXA 3LSOA 2A6KB 3AXLB 3PWPD 4ODWB 3EDKA 7FABH 4M6NL 4XGZB 4JFOB 1NDGA 2ORBL 1BQHG 1YC7A 3IVKA 2GHWB 4MLSA 5EZJB 3BP6B 1IKNC 2P24B 2VLKE 2SEBB 4KKAC 1CDGA 1KACB 3QEHA 3ARFB 4MDIB 1S7QB 3MBEB 4G9FE 5D72H 2YSSA 4JKLA 2FGWH 4P99A 3MV7A 2DBLL 3QNYA 1OGAA 3WNOA 1I4FB 43C9A 1JPGA 1XR9B 3M1BA 4JPKL 1HE7A 1FZKB 3MNWB 2XPGA 4WUKH 5ETUA 2ICEB 2PF6A 1JTTA 2VZSA 3ZDYF 1ZHBA 1IBGH 4XVUD 2A6DB 2WBJB 3V7AE 1A6WH 4JANA 4TPRH 1UACH 4IBLT 1SM3H 3FHAA 3MOBL 2A6JB 5DF0A 3MV9E 4GW1A 5D6CB 3EYSL 3QCUL 4ZTPH 4M6ML 4UUJA 3PQYB 1MCOL 2NTFA 3HI6H 3L3OB 5IKCB 4ETYA 3O2VL 1MHEA 4Y5XB 1ZEAH 5LCVH 1AXSB 1F3JA 3K8KA 5GJSH 1UXSB 1G6RB 4UQ3A 1VFMA 4LGRB 5F7EH 1YPZF 4CN4A 2B5IC 4QNPF 4PLKD 1FIGH 3WHXA 1UA6L 3UEZA 2VO5A 4CU6A 1LE9B 1QFOA 5E2UH 1YEGH 3HFML 1HXMA 2FCBA 5C0JA 4JRXE 4U6XB 5FO8A 5KSAA 1PLGH 5IJKC 5BZWA 2VLJB 2H2SD 5KN5B 2MQCA 3CZFB 3HAEB 4JFQB 5L0QC 3HS0A 3EO0B 3GSUA 4OM1H 1QPPA 2R69L 1E4XI 1WSST 2DICA 4HJJL 3UC0L 1VADA 3AROA 1IAOA 1QG3A 2HRPL 4F7CA 4Z7UB 2WBKA 2H32A 1NC4A 1IRAY 1OQOA 3QUZB 3TWCH 4L3ED 4U1JA 5F97E 1RZGB 1EVUA 5IMLA 4UIMA 1T5XA 3UPAA 3RAJH 3VFNB 4ELMA 3EJYD 3VWKB 1U8QB 4ZUUA 2X1QA 5HYFA 4OD3L 1EFXD 3MPCA 2HG5B 3OHXA 1WISA 3O3EA 1DEEA 5CBAB 1G7PA 3U79A 4TVPE 1CD9B 4HK3N 2AJSH 5I8OH 1ADQH 3MRLB 1FN4A 4BSJA 4UU9A 5T3ZH 1S3KL 4KK8C 3EBAA 3TO4D 3FQRA 5DD3L 1DVFB 4M93B 4K3EL 4Z5RB 1Q0YL 4X7SL 5D7KD 3RZCC 3QFDA 4DN4H 3G6JE 5DHVA 4O5LH 4F3FB 3JTTB 4OCMC 2D03H 4HWBA 3EDEA 1HILB 4HWUA 3UROR 1U8PA 2YD4A 4OFDA 4ODTH 2XZQH 3BQUD 1LO3L 1YNLH 3LHPH 1PBYA 3FRUA 4OCRL 5CINH 3NCCB 2VLME 3UO1H 1JGUL 4ZUWB 4PJAF 4ZUVA 3Q6GH 5F89A 3EOAB 1A6AA 5E9DD 5CEZH 5GGTL 1JK8A 3QUXC 3LV3A 1CVSC 4PRDA 3VGFA 3AMLA 4ZOAA 3CFKB 3C6SA 4NT6A 3QQ4A 4CN1A 1QYGL 5GGRY 2YD6A 3Q0HA 1T7ZA 2VXUH 1EZVY 3V5DA 5HHOD 3G04A 2YD7A 1ZWIB 3QUML 4U1NB 4J23A 2IC2A 3V52L 1XGRB 3BGAA 5IB3B 4LP4A 5JQ6L 5D1XA 1LILA 2X4PB 1D6EB 4HT1H 5IV2A 5I0DA 2PCPB 4YX2H 3LIZH 1KLUB 5FGBC 4IDJH 4GSDL 1F6AB 2BDNH 2P5EA 3RGHA 4M8VA 5K33A 4NO5B 4NBYB 4C57C 4R96A 3EOBA 4WI8A 2Z0BA 1J05A 1WBZA 5ADOL 3ZE2E 5IIEA 3U2SB 5J1TC 2PW1A 3FAWA 3IS1X 3T3ME 3QPQD 2CKBL 3HPLA 2Q20A 3CXDL 2YD9A 3IU4L 4E41D 2A6KA 3AXLA 5DZLA 3RVWC 2AK4D 4ODWA 3ILQD 5CIPH 5I1DB 2F5BL 3F12B 4XGZA 1BQHB 4JFOA 4M7ZB 3LCYA 1A7OL 4I4WB 5HGDA 5E2VL 2YN3A 5FUCC 4NJ9L 2OR8A 5EZJA 3BP6A 4PJ7B 4OKDA 2P24A 4MXWL 3PWPE 2SEBA 3HNTH 4KVNH 1FNEB 1BEYH 5BQ7B 1PG7W 2PTTB 1AD0B 2HTLC 5EO1A 5HI4C 3ARFA 4MDIA 3A6BH 1S7QA 3MBEA 3S3SA 4XMPL 5IMKB 5ICXB 4RWYH 2VR4A 1I4FA 2V6HA 1XR9A 4GAJL 4MB3A 1FZKA 2DS4A 3MNWA 1QO3B 1BWWA 1GGIH 5C09B 4IRJB 2ICEA 1BJ1H 1RZKL 1FVEB 3OPZH 3U0WH 4L4TD 1QACA 1G7LB 4G8GD 3QDHA 4N5EC 2A6DA 1CIUA 5HHVH 2ED8A 3OX8B 2AEQH 3E2HC 4GXVH 3CFCL 2WBJA 1QPXA 2NX5D 4Y2DC 4I3SH 2A6JA 1DR9A 1ES0A 2DI9A 3RIFF 5D6CA 3PQYA 5BRZD 1U9KA 3MLSL 3L3OA 2CK2A 3O4LD 5IKCA 2X09A 4Y5XA 3SJVB 4GQPH 5IBLD 3NACH 1AXSA 4Q2ZA 1DQDL 4Y89A 4OUUA 1G6RA 4OCNC 3IAGC 2D9CA 4HK3J 2D7QA 3TH3T 3HNSH 4GO6B 2IPUK 3LMJL 1EO8H 4J4PC 5C0CB 2CLRB 3GSXB 3X17A 3IDIB 2EDEA 4GG6E 4OZIF 1WAAE 3ZSTA 2CDEB 3MRCA 4KAQH 2DQHH 3NAAL 3G9AB 5D71L 4GKOA 5LWYH 1X3DA 1NL0L 3WBDA 2HVKB 4I3RH 4TSBH 8FABA 2K3TA 4KZDL 1WGOA 5DJAB 4ZD3L 4Z95H 1R5WB 1LE9A 2YKLL 5F44A 3BJ91 2OZ4H 4RFEB 1F4YH 2ADJB 2NXZC 4U6XA 3R4DA 1KULA 1AY1L 1QSED 1FGVL 2VLJA 4UNUA 5KN5A 3CZFA 4JFQA 4CU7A 4JGMA 4JREC 1U8IB 4U1MB 3EO0A 5MEOB 2NXYB 2XN9B 4P5TD 2QADD 3QDGB 4D0BB 5F6HI 3EOTL 3A6CL 5TJWK 3HZMB 43CAB 4Z7UA 4DKEL 5EU5B 4X6DE 5DUML 4PBVC 3QUZA 1RZGA 5DLML 2Y36H 2AEIT 5FYLD 1RHHB 3FFCD 5IMOB 1X4ZA 4KK5C 3IRZA 2MFNA 1EH9A 4BH8B 5JA8B 3VFNA 5CD3B 1XEDA 1KFAL 3BPNB 3VWKA 1U8QA 3CU7A 4MD5B 2JJSC 4RFNB 2HG5A 1IC7L 3GNMH 3IKCB 3BRFA 3SN6N 4L8SB 4WEBH 4AIXA 1X7QB 5CBAA 3U36B 4BQCA 1PDKA 4HEME 3PNWB 1PYWB 3I02B 3GRWA 4NQVB 1QLRB 5ERWB 1U92A 1XF3A 2QSVA 1AGDB 1DVFA 1X6NA 4Z5RA 4LLDB 4UILH 4F3FA 1ZAGA 3V0VA 1HILA 1SJHB 3R8BB 3VFGL 1KYOJ 1NMCB 5KTEL 4LOUC 2W9EH 4Y8AA 1K5NB 1N4XH 2CLZB 2ATPB 1VENA 3BH8B 1LQSR 5D7KE 3FB8B 5GHWH 1IGFL 1JGEB 4ZUWA 1CZ8L 5SWSD 3ZHKA 3GZKA 4NHCL 5B39B 1EO5A 3EOAA 4WRLA 4GMTL 2OL3B 1WEJH 4JFHD 2NZ9D 4EQ3A 3AMKA 2IAMD 3NCBB 1FNFA 3WUZA 4EOWH 2WIIB 4D9QD 3CFKA 5HGGS 4HH8A 3BMWA 4U2ZA 4F57H 1AJ7L 3MV7D 1OGAD 2PYFB 1MLCB 1OARL 4XNQB 5IB4B 5E9DE 5GZNC 3SE9L 1F6LL 1CXEA 5L2JB 1ZWIA 3RHWF 4U1NA 3HA0A 1KGCD 1XGRA 1GCFA 5IB3A 3V6OE 1II4E 2W9DL 3IDYC 4N0FB 2X4PA 1D6EA 1MAML 2PCPA 4G7VL 5DHYB 5EPMB 5MHSD 4Q9RH 1KLUA 2X9YA 3EDFA 3BKMH 4M1CD 3RP1A 1I3RB 1F6AA 5HHOE 1BREA 1L9MA 3LN4B 2VWEE 4LCWD 4MZ2A 4NO5A 1EEQA 1URLA 3ZZ1A 2FR4B 1FFPB 3U2SA 5EO0B 4GQ9H 1UQSB 5D7IE 6CGTA 3V9FA 2GYSA 4XC3L 1QFUL 3C60C 1PAMA 5I1DA 4YQXH 3MLZH 3F12A 3ARBB 1A3RH 4LQ1A 2VC2H 3PDOB 5CAYB 2VZ3A 4I4WA 2HT4D 3MJ7B 4LHUD 1MCHA 5SX4H 4XP1L 5HD8D 3QSKB 4E41E 1RJZB 2FB4H 4KY1L 2AK4E 1NFDF 1FNEA 5BQ7A 3RPIB 2PTTA 4G3YL 1AD0A 1A14H 1E28B 4W6WB 4XHQA 4KTDL 4M4RA 2A74B 4D94A 1V7ML 4YDLC 5IMKA 3IKKA 5ICXA 3DO3A 1V7NL 3MROB 5HVWA 1R3HB 3WIFB 3LN9A 2AJYH 1OW0C 1KB5L 1YEEL 3FO9B 3ULSA 3WFHA 1QO3A 2R0KH 5C09A 4IRJA 3K4DA 4I77L 4BUHA 4OZGE 1KCSL 5KSAD 1FVEA 5DD1H 3ZKND 5DMIL 5JW3L 1U3YA 5DR5L 1G7LA 4Z7QE 2FEDD 3OX8A 2EICA 3O41B 1FO0B 1OP3K 5CHNB 1E4KA 2D4FA 4AL8H 1JRHH 1GPOH 3BW9B 3S6CA 5T1DH 1OTSD 4L4TE 4PRBB 2QEJA 1IC1A 5IW3A 4JJHA 3RVTD 4G8GE 3WFEL 2B5IB 3SJVA 1KTRL 1CK0L 5D9SB 5IWLC 3P9MB 3G6DL 3MRJA 2NX5E 1RJCA 4M6NH 4NBXB 5I1GH 2L7JA 2N1KA 2ZUUA 5A1AA 5BRZE 3O4LE 4F33B 2ATKB 2V2XB 3VFOB 4WFED 4QRRB 3I6GB 5DVNA 3DMMC 2VR5A 1UM6H 2XV6B 5C0CA 2CLRA 3FT2B 3GSXA 3P0GB 3IDIA 4X9IA 4L8BB 2CDEA 1K2DB 4YR6B 2EZ0C 5B3NA 5L0QB 2VB5A 2DBLH 2HVKA 2DD8H 2HJLB 5KSBB 5DJAA 4H0HB 1R5WA 4JPKH 5C6PB 1UB6B 4RFEA 5EOTB 1YEKL 2ADJA 3B9KC 5DZOA 3CVIL 3D18B 5GJTL 2DLFH 5EORL 1MCJA 4X6CB 5DQ9B 5T1MB 3ZMRA 3QG6A 4OZHF 3PWJB 1U8IA 5MEOA 1RJYB 2RCSL 2XN9A 3GJFK 3SOBL 1QSEE 3EYSH 4HWZB 3QCUH 3QDGA 4M6MH 1ED3B 4D0BA 4IMKA 3HZMA 43CAA 4NO0B 5EU5A 3HE7B 2XY2A 3KNBB 3CFJB 2IADB 3BMVA 2EE6A 1RHHA 5IMOA 4WHYH 2VAAB 5DMKB 2HA1A 4GOSA 4BH8A 1A1OB 1Z9OA 4DUVA 5CD3A 3RZCB 4KHTL 5CZXC 4MD5A 2IPKB 1NUDA 4WI6A 1NGQH 5D1XD 3IKCA 5FYLE 3FFCE 4L8SA 4S1RH 2IQAB 5DFTA 3T0EC 2A83B 1X7QA 3U36A 1MEXL 3E6FB 1LP9F 4OUOA 4FNLL 1WJ3A 1PYWA 2P5ED 4P0DA 4PGBB 3I02A 4Z7VE 2AXJA 4FS0A 1UA6H 4NQVA 3RA7H 1QLRA 5ERWA 1AGDA 2ZUSA 2KH2B 3MCG1 4M7KL 4LLDA 4U0RC 2XWTB 2ZJSH 4X8JB 1NCTA 4OIBA 5HYEA 4NQXB 1SJHA 4OF0A 4U4BA 1MRFH 1K5NA 3U7WL 2CLZA 4ZSOB 2BFVL 2ATPA 2C3HA 1QR4A 3BH8A 4TQEL 4KRPB 3FB8A 5DZNA 5I18L 1JGEA 2R69H 2RIKA 3LQMA 3SDXE 1EUUA 4ZQKB 5B39A 3KYAA 3CLFL 2OL3A 3ARDD 2CIIB 2DLTA 2Q87A 3ARFD 2WIIA 5A2JH 3MBED 1HHIB 5F7YC 4H0IA 4H0GA 1IC5H 5SWSE 2X4SB 3LS5L 3TCLB 5AZEH 2PYFA 1MLCA 3I85A 4XNQA 5IB4A 4MJ2A 5H37H 1I1FB 4YGVB 4JFHE 4XP9H 5L2JA 1PZUB 4R2GC 1OM3H 4PRPB 4HCRA 4XB7A 4BQ9A 4MNQB 4D9QE 4N0FA 3H42L 3MV7E 5DHYA 5EPMA 3L3IB 1OGAE 1DBMH 1O5DT 1T7WA 2WBJD 1I3RA 2A9NL 3LKOB 1CXIA 1S3KH 3LN4A 4HC1L 4AH2B 3DARA 5GXBB 1KGCE 5DD3H 1W72B 1IKNA 3F7PC 3PABB 2FR4A 2GSGB 1FFPA 3FAXA 5EO0A 1UQSA 3QP3A 4AMKH 4FQCL 5MHSE 5HHXL 4P3WA 2GEEA 1QD0A 4S1SL 2ZPKL 1QSZA 4LCWE 3UTZB 4QTHB 3ARBA 1ZLUK 2IMNA 1LO3H 4KUCD 3PDOA 2X4QB 1CGXA 3MJ7A 4NRZB 5GGVY 1I8LC 3VD9A 1JGUH 4FQXC 1RJZA 2LVEA 4U1HB 3Q3GB 3QAZC 2J88H 4X6EB 3RVUD 3FZUD 3RPIA 3HG1B 4C54A 2I9LB 1E28A 5FAAA 4LDOB 4YBQD 2RJMA 5EU6B 2A74A 3RVXC 1TNMA 1BJ1J 4Y2DB 3MROA 1R3HA 1WIUA 1IKFH 4R0LC 3WIFA 4JHZA 2VLLB 3QUMH 2ICCA 3JZ7A 1P53A 3FO9A 1J9CT 4TNVK 3V52H 3QB7C 5JQ6H 4P2QB 5LGKA 2VLJD 2ARJB 2WQRA 4EIZC 4QO1A 5CP3A 2ERJB 1KYOK 1HHHB 3O41A 1AGCB 2ED9A 5B4MC 4L8DB 5CHNA 2YRPA 4WI4A 1B6UA 4N90D 3BW9A 4RGOL 3HI5L 5ADOH 5MEND 4PRBA 2XQYG 5IP4A 3N85L 4XVSL 4M7LL 3CXDH 1WVZA 3IU4H 5C92A 3PWUB 4X9GA 3G5XB 3QUZD 4U49A 5D9SA 3P9MA 3S7GA 1NUFA 2F5BH 4XWOC 1XCQB 1EFQA 3U9PL 1M1SA 3L9RB 1A7OH 5E2VH 2R56L 4YDJB 3VWKD 4OGYL 3MRDB 4F33A 2ATKA 4MXWH 2V2XA 3VFOA 1YY9D 2NXZB 2B20A 4QRRA 4DKFL 3I6GA 5JPMB 3FT2A 4KFZC 3V4UL 5CIPB 4L8BA 4JREB 4CGTA 1I3GL 1K2DA 2E8YA 4YR6A 5B8CB 3MUHL 1D6VL 4JHBA 4BFIB 3BZ4B 2HJLA 5KSBA 4PLOB 1W8OA 4WFEE 1DVFD 5MP6L 3BRGC 3RTQB 1DLHB 4GAJH 1I8KB 1UB6A 4R6UA 3L7EB 4RMTA 4KKLC 4A2LA 1RY7B 3D18A 4YEFA 3MCLH 4RFOL 4X6CA 5DQ9A 3PWJA 5CZVH 3VXUB 4FABL 1OAXH 3CFCH 4ZMAT 1MFCL 4WI5A 3PE9A 2E9IA 1RJYA 5BMFL 4UT9L 1X5HA 4FA8A 5K9QI 3KJ6H 4WFFD 4JG0L 4PJAB 2V7HB 4HWZA 4YXKL 1ED3A 5IW1B 2HFEA 4X7TB 2XA8L 1KPUB 4NO0A 3HE7A 1IAII 3KNBA 3CFJA 2IADA 4K9EL 1KPVB 1DQDH 4IIQC 5DMKA 2VAAA 3NIGF 4OTXH 3T0DA 1A1OA 4OZ4B 4QTIL 3RZCA 1YEJL 3KXFB 2HH0L 4IMLB 4FFWD 2X4NA 2IPKA 2IANB 4ZO6A 3NTCL 3LMJH 3QR2A 3DURB 2IQAA 2A83A 4AJ0A 3OKNB 3MV8D 3E6FA 5EN2B 3O8XC 3VGDA 5D71H 2FH8A 1CFNB 3SBWC 3WO3B 1EK3A 4ZOCA 4ZD3H 4KROC 2YKLH 5HDLA 3QHZL 3IDXH 3JWNC 2CK0H 4JRYB 2XWTA 4OT1L 4X8JA 5E99H 3ARPA 1IEBB 4NQXA 5A43C 1FGVH 4LPXA 2P5EE 1ZHKB 5I8CB 4KK6D 5I15L 2ESVB 2WUCL 4ZSOA 4ISVB 1MRDH 1W0WB 1I9RH 2K7QA 4ONFH 1D9KC 2ZUXA 1WFUA 1H3GA 3B2VH 3AC0A 25C8H 4ZQKA 1YMMB 3S34L 35C8L 3D5OF 5KAQF 2Z91B 3IDYB 2CIIA 3MA7A 5JIPA 5DUMH 1YEFL 4A6YL 1RMFL 5DLMH 3LVEA 1HHIA 1G0YR 3SEPA 3BEVB 1NEUA 4WEUD 5IK3B 2JB5L 2X4SA 3TCLA 4OF8A 4NM8L 2F8VA 4GRWF 1KFAH 3VXQB 1I1FA 4YGVA 2DJ4A 3EGSB 5C09D 4IRJD 4X7FC 1S7WB 2EXWD 4PRPA 4LMQE 4JDVB 4MNQA 4UNTA 3C60B 1JL8A 2IJ0C 3LEVL 1YN6B 2X4TB 3WIHL 1EBAA 3L3IA 3FOLB 3HZVB 2JF1A 1MAKA 5I9QB 3GIVB 4OCYH 4WHYG 4BUGA 2E8ZA 3LKOA 3WDIA 2FBOJ 1PVHA 4RWHA 3QHFL 4AH2A 4PJFE 2GTZB 1W72A 2WW8A 3PABA 2BSSB 2GSGA 1JYXA 4MCZB 1GGCL 1U58B 3SJVD 1ZOXA 5KTEH 1MI5D 2YEZB 3UTZA 4LCIL 5TQ2L 4QTHA 4JGUA 2FJGB 4YDLB 3FN9A 4JJ5A 2X4QA 4NRZA 1CZ8H 4G42B 5DWUH 1I75A 4K8RD 4U1HA 3Q3GA 4X6EA 1YPZA 5C0CD 3SQOH 3HG1A 4LAQL 2I9LA 1MF2L 3SDYL 1JZ8A 1AQDB 2HYMA 5IG7B 5EU6A 4FXGB 2J6EA 2X41A 2DWDB 5IFAL 4Y2DA 4D0CB 5L88H 3SE9H 5TDNA 4XHJC 5DURB 1CR9L 4AK1A 2VLLA 4Q58C 1OHQA 1TDQA 1ONQB 3LH2L 2X7LB 4P2QA 3ARGC 5H2BB 3U1SL 4LSQL 1FHGA 4Z76B 4G7VH 3C08L 2ARJA 3OL2A 1B3JA 2NY7L 3BVNB 2X4OB 4V2BA 5IT2L 4JFYB 3FOMB 1AGCA 1HCFX 4L8DA 5J1AB 2NXYD 5H37G 1CBVL 5D1ZD 4DEPC 1CVRA 4OFPA 3UTSB 2J8OA 3UYRL 2VLJE 4ODVL 2DQEL 1T21B 1VESA 5E5UB 3TFKC 3PWUA 3G5XA 1QFUH 1RUKL 3BO8B 4LFHD 1BWMA 5E70A 1XCQA 3H6JA 4N90E 2O5XL 3QEQB 5FKPB 3L9RA 5MENE 1C1EL 4XP1H 3N1PC 1TIUA 4I0KA 3LB6C 2NZIA 3MRDA 4Z7UE 5DJZB 4LHJB 3ZKXB 1ZT1B 3LS4H 5JPMA 1G7HB 3OF6A 1CGUA 1VACB 5DEFB 5CIPA 3Q6FB 3PP3H 1UVQB 4KTDH 1PGRB 3P30H 5B8CA 1LO4L 2IF7A 4BFIA 2DI7A 2ZUYA 3BZ4A 1V7NH 4AEFA 5HJ3B 3RTQA 1DLHA 1I8KA 1P4BL 3LQAH 1KB5H 1QFWM 1YEEH 2VH5L 3WNNA 4I77H 3MUGB 1KCSH 4PBWD 5DMIH 3LRSB 3DI3B 5T3XD 3C6LD 1S9XB 5HPOA 3GHBH 1UKSA 2E7CA 3VXUA 1B4JL 5IVZB 5I8KL 3TYGH 4ENED 2QQLH 4NC2B 1FNSL 1F5WA 3QBTB 4LPUA 4M03A 2R1YB 4PJAA 2V7HA 3AFLA 1K8DA 4J3SA 4PTTB 3T0EB 4X7TA 3SKUD 3WFEH 1KPUA 2V17L 1S9WB 1CK0H 1KCUL 2ADIB 2VXTH 1IGTB 1KPVA 2VDLL 4KQ3L 5KOMC 3WLBB 1OSPL 4WFFE 4W6XB 4OZ4A 2QLVB 1VPOH 1FE8H 4FQ1H 4U0RB 4QT5B 2VXSH 3KXFA 3VXSD 3MRHB 4IMLA 2XT1B 2IANA 4X4XB 3DURA 4JO2L 3QCVH 3N1FC 1U8LA 5MI0C 4Z0XB 3OKNA 1JF5A 5EN2A 4QHUB 2ZKHH 4JAMB 3W5NA 4RAUB 1CFNA 4R4FL 2VLRB 3V0WL 1Q0XL 1DANT 4JRYA 1YEKH 2AI0H 3UBXG 3MV8E 4XX1G 1IEBA 3CVIH 5GJTH 5EORH 1ZHKA 3MRBB 4RX4A 5I71B 5FA4B 3ARBD 2ESVA 2R0LL 4ISVA 2FLRT 3EDJA 3MRIA 1W0WA 4UDTB 2A0LD 3KDMB 4OLWL 4YK4C 5AYUL 4Z9KB 2Z91A 3ARVA 3MREB 3W5MA 3BEVA 2YRZA 5C0GB 4WU7B 5E4EC 2M2DA 3K1KC 1WZLA 4JY4B 1VFOA 1CS6A 3VXQA 5FCSH 5DTFB 3LQAC 3IDMB 3EGSA 5IESL 7CGTA 1S7WA 4M6OL 5I19H 4JDVA 3C60A 3GI8H 1MEXH 3K4AA 1YN6A 2X4TA 4K2UL 2BERA 4HX1B 3WD5L 3FOLA 1KJ3H 4YBLC 3HZVA 1SHMA 3VU2A 4JPVL 3GIVA 4FNLH 5FO9B 3O9WB 4WVRA 5CSBA 2GTZA 4FQXB 4M7KH 4Z7WF 2BSSA 2EH7H 3EFDL 3TCXA 1HCVA 3H0TB 3QAZB 4MCZA 1U58A 3KPMB 4QHMB 3BN9C 6FABL 2CIKB 3U7WH 1LWRA 2BFVH 2FJGA 4KVCL 4TQEH 4L9DA 3OSKA 3FKUS 1NBYB 3EYFB 4H5SB 3SJVE 1YNKL 3IT8D 4GKNB 4QRRD 1CWVA 5L6YH 1MI5E 3JWOL 5HSFA 4NN7C 1AQDA 4QXWA 5IG7A 3ALWA 4FXGA 1DQTA 4I8DA 2DWDA 3U4AA 2ZZUT 4RMWA 4HXAL 3OB0H 4D0CA 5E6IB 2I5YH 1MJ8H 1F4WH 5C0CE 4MA1B 2YMXL 5LGHH 1T66C 4LIQL 1BECA 1ONQA 3T08A 1TETH 2X7LA 1FGNL 4WNQB 3WJJC 1I7UB 5H2BA 3PHOB 4XNUH 3V8CA 3H42H 4Z76A 3PUCA 3BVNA 4OZHB 5F9WC 2X4OA 4LARH 4HJ0C 1FLRL 4JFYA 1SY6H 3FOMA 2OXGA 1F90H 5J1AA 3IDUA 2X1PA 1YJDL 3OB8A 4KJQC 4UINL 3UTSA 1CICD 1PZ5B 3SPVB 1T21A 2NY6C 4PJDF 4NO0D 1EVTC 3HE7D 3BO8A 4GMSL 2BXZA 2UUDH 3CLEL 4P23C 4S1SH 1MIEL 2F74B 2LABA 4KI5F 1T03L 3FB5B 4M62L 3QEQA 2NCMA 1HOCB 2PUQT 3DX6A 5FKPA 3MACL 1KJ2L 3RZCD 4APQC 4TSAL 3RKDD 2YD8A 1BAFL 3GBML 5DJZA 1QNZH 2C4FU 1WFOA 1ZT1A 3MRMB 3P77B 5CGYD 3LD8B 1NAMB 1G7HA 5F88B 3BIKB 3P11L 1QRNB 4LLQB 4B0MM 1SYSB 4H88L 1RJLB 5DEFA 2VIRB 1UVQA 4NCC1 2DQTL 1P84J 1JTPA 3ROLB 1OAUL 1JFQL 5HJ3A 2O26U 5EU3B 4G5ZL 1H3XA 4ZDHB 3S96B 3VFPA 1HQ4B 3MUGA 5L9DL 1GC1H 4ODBD 5IBTH 2UWEF 3LRSA 4YDKL 1S9XA 5E6YA 4F8QA 4IIQB 4KJYB 4KRPD 1IARB 4XPTL 5IB1B 5IVZA 2Z8RA 2XYCA 3QUMB 3HI5H 4JCMA 1CGSL 2R1YA 1GSMA 5L8LB 4LEOB 3N85H 5T3XE 2R0ZL 4XVSH 4M7LH 3T0EA 3I9GL 5KAQG 1S9WA 2ADIA 4P2CG 5DD5L 2UV3A 3U9PH 3WLBA 4MLIA 2R56H 1X5JA 2DQDH 4X5WB 3F58L 4QT5A 4U1KB 3MRHA 3U82B 2CKBB 2BHUA 4X4XA 3TH2T 4DKFH 1QSVA 4PRPD 3QNXB 4NZUL 4JFPB 1OGTB 2PTVA 1B90A 4WW1B 1N0LA 2BNQB 1T1WB 4Z0XA 4QHUA 2KPNA 4JAMA 1D6VH 4LVEA 4RAUA 3OG6B 3VXSE 5DO2C 2VLRA 4U1LB 5MP6H 1NAKH 3TNNA 1RK0B 1UCBH 3UBXB 2EKJA 5J6HB 5FYJU 2HTLD 4RFOH 5HI5C 3MRBA 1HH6B 5DMGC 3KG5A 5FA4A 2H9GB 3TT1H 4FABH 1MFCH 2MPAH 3G08B 3B5TA 4UDTA 5IMMB 3MLRH 3KDMA 4UT9H 5KSVB 4JG0H 4Y5YC 4OLVL 3K74B 5EUOF 1CYGA 4YHML 3UDWA 2XA8H 1MFNA 4N9GB 3HG1D 4Q7DA 4Q74A 4XPFL 4ZG1A 3S35L 5CD5C 4K9EH 3MREA 4K3DH 1L7TL 1XF5B 4JQVA 3JVGC 4OM0L 4MAUL 3HC4L 4S0TD 4WU7A 5C0GA 4HIXL 4JY4A 4P2YA 3VW3L 4QTIH 3KS0H 5ALCL 5JDJA 1LEKB 4S11A 1FZJB 4NCC2 2IPTL 5DTFA 5E03A 3IDMA 3NTCH 3GMOB 4PJ8B 4U7KA 1GC1C 4WV1C 5T5FL 4LSSL 5JXED 4U6TA 1F3RB 5DFVD 2HT2C 4DWHA 5EWIL 3QIBC 4X9HA 1NBZB 3O9WA 4JM2F 5FO9A 4XT1C 3I50L 1WBYB 1CL7L 3U30C 4DZ8B 1S9KC 3QHZH 4FQXA 1CDIA 3B9VA 3H0TA 4OT1H 4RAVA 3ZHLA 3RU8H 2R1XB 4UOW0 3DETD 4XNXL 4LQFL 3KPMA 2Y6SD 4OCXL 4QHMA 5EO9B 2CIKA 1U3JA 4KQ4H 4KHXL 1NBYA 4F7TB 3C2AL 1NLDH 4PJGE 4Y19B 4G7YL 2HAZA 3EYFA 3S34H 4H5SA 1TTUA 2NXZD 1P7KB 4GKNA 3TN0B 3S4SB 3OF6D 4A6YH 4NGHL 1RMFH 2BMKB 5AZ2L 3DX9B 4AEHL 2DJUA 1CLCA 4ODUB 1IGCH 1T2XA 4HS8H 3FL7A 1JBJA 1A6PA 2IFFL 4QRRE 5E6IA 3RTQD 1CXFA 4DEPB 2JCCB 4QKXB 1CFBA 1FV1B 1J1PL 2E9WA 4HMEA 1P2CB 3ARYA 4J3TA 4WNQA 1I7UA 3EKCA 2Y72A 3VXRB 3MYJB 3PHOA 2EEBA 4ZTOL 2HWZL 3EYQC 3WIHH 4OZHA 1FFOB 2EE3A 2FX8L 4W4NA 1KEGL 4JO4L 1GOFA 4KTYA 1ZA6B 3QO0B 5C6TL 2BNRD 2W60B 3MYZA 4PUBL 3SGDH 5IHUL 1C8PA 2NR6D 2N4IA 1PZ5A 5KJRL 3QFJD 3SPVA 5J12C 2JKXA 4YHLH 1GGCH 2NQCA 4TUKH 1JGVL 4PJEF 1GGBH 3VFWB 5GZOC 4S1DC 4K9EC 4LEXL 2F74A 2FATL 2V5MA 2ARJQ 3FB5A 1FH5L 4XBGB 1HOCA 4FQ2H 1IJ9A 1JGDB 3KXFD 4RGNC 3C5SB 2VXQL 2IAND 3BSZL 3MRMA 3P77A 1IAMA 4OD2B 4RCAA 3X3FL 1NAMA 1T1ZB 5F88A 1GRWA 3BIKA 1QRNA 3ARZA 3C5ZB 4LLQA 3SDYH 1MF2H 1RJLA 4PGZA 2VIRA 4MHHG 3MSPA 4JHAH 1OF2B 5IFAH 4ZNCD 2APFA 1JWMB 3ROLA 4KXZI 4JZJC 4D9LH 5EU3A 1R5VB 3S96A 4OQTL 5GGTA 1HQ4A 4POUB 2APWA 3EJZC 4LSQH 1TJGL 4RBPK 5TE6L 4RX4D 3INUH 4NUJB 5JR1L 2NY7H 1U0QA 5IT2H 2ESVD 4IIQA 4KJYA 4OI8A 4X99B 4FQJH 2ZWLT 5TQ0H 1NBVL 2W65B 5IB1A 2RAMA 3N9GL 2BSED 1CBVH 3C09C 3V6ZB 4I48B 4KJPD 4ODHH 2VZOA 3QUMA 4DKDC 4EI5C 4HKXB 1BQSA 2VN7A 2NYYC 4LEOA 5F1NB 4ODVH 1VCAA 2DQEH 4ZSOE 3JWDL 5MI0B 1Q9OB 1RUKH 2ARWA 1AXIB 4M7JH 1KIQB 3ZO0A 4FOMA 2O5XH 5BW7A 2VTFA 5ANMB 2UZIL 5FYJL 3WN5C 4MJ6B 4X5WA 4U1KA 4GRWB 1LEIB 1DBKL 3FQWB 2CKBA 3RL2B 3QNXA 4JFPA 4N0UB 1OGTA 2KL6A 4WW1A 3CU1A 2BNQA 3KPRE 1T1WA 3TJEL 3SO5A 5F8RC 5KW9L 1JNHB 2H8PB 1BQLL 1NGYB 2E7HA 2BY0A 4I0CC 3S35X 1FNLA 4U1LA 4PRPE 1P4BH 1MCKA 3MFGB 2C5DC 1RK0A 2VH5H 3ZDYE 1GGUA 4YK4B 4FN0A 3HE6C 5J6HA 4NKIL 5L8JB 4UAOC 4PJHE 1XCTB 3HKFA 1Q9LB 5IB5B 3AS3A 2R8SL 1HH6A 5HGAB 3REVB 2H9GA 2PO6D 1DQLL 4JB9L 1B4JH 5SWQB 1INDL 3G08A 4JM2C 5IMMA 4KDVA 3KYKL 2XRAL 5KSVA 3O6ML 5FOBB 4KMTL 5D93C 4ZPVA 2OSLB 5F72S 4GW4B 2WMPA 3T0XA 4OLYL 4YBLB 3W9DB 1AGBA 4OGAC 2VDLH 4Y5VC 1XF5A 1L0QA 5CMAB 3K2MC 5D7JC 1OSPH 4MQTB 4N9OB 4JG1L 1CGWA 4M7LT 5HHMD 1YPZE 3ELAT 4LVNC 1VFBB 1FZJA 4M5ZH 1LEKA 1P84K 1UM5H 3HG1E 4NIKB 5F7MC 4QNPE 3GMOA 4KJWD 4PJ8A 3MZGB 4JO2H 2P8MB 5KVDL 1OTTC 2UZXB 1A4KB 3BGFC 4ZFFB 5F9DC 4JRWA 4H20L 1NBZA 4X4ZA 1Y18B 4EBQL 1WBYA 4DZ8A 1Q0XH 3QNZB 3P4NB 1T89C 1PSKH 2AABL 5LGJB 2K7PA 2R1XA 4GKZB 3AGVA 1UKQA 1S9YB 4LLVB 5ELIA 5EO9A 3DHMA 4XH2B 1H8OA 2R0LH 2FBJL 2IEPA 3QEQD 3SKMB 2B1AL 3T3PF 4F7TA 3NFSH 4XCCL 4Y19A 4WI7A 5J11C 2ADFL 3WIIL 3NH7L 5KANG 2OP4L 1P7KA 3TN0A 5AYUH 3B3IB 1MCRA 2DIJA 1CD8A 2N7BA 3S4SA 4AEIH 2YZ8A 2DJSA 2OJEB 4WGWB 2BMKA 3DX9A 4P9MH 1QKZL 4ODUA 1A3LH 3ET9F 5T1LB 4BK4A 4PJXF 2VDRL 2VDOL 2JCCA 3MRKA 4UBDD 1FV1A 1N7ML 4ONHB 5IB2B 1P2CA 3HC3H 2YD1A 3FTGB 3KHQA 4M6OH 4YGAB 5HYIA 1A7PL 3MYJA 5FM4A 5FYKD 3VXRA 1JHLH 4WFGD 4PJIB 3SE4A 4K2UH 4MA7L 4HKBB 4JPVH 1PEWA 1FFOA 4LSVH 4XBEL 4PY7B 4DW2H 1ZA6A 2Y5TB 3QO0A 2Z9TA 2W60A 3EFDH 1M7IB 1NLBL 2YHGA 3TJHD 5I1IL 4Z6AT 4MS8C 5E24E 4MA8L 4TVPL 2R23B 1QFHA 1JZ5A 1KCLA 3VFWA 6FABH 1X6LA 2CGRL 1BJMA 2BNRE 4XBGA 3J8F7 2ZCKL 4O9HL 5H35B 2DN7A 3QFJE 3D1MC 1JGDA 3FN0L 2WLYA 3C5SA 4RDQG 2VERN 4OV6F 4U2YA 1YNKH 4OD2A 1QBLL 3MLUL 3JWOH 2O93L 3UJIH 1T1ZA 2BHYA 3UYPA 4I5BB 5A2LH 1Q1JL 3C5ZA 1J10A 1XGYL 2K9UA 3RVVD 3QXAA 1KN4H 5CJXC 4DGIL 1HKLL 1P1ZB 3WDJA 1YQ2A 2VL5B 3KXFE 1IMHC 1OF2A 2VLRD 4HXAH 1JWMA 2IANE 1TZIB 2NNAB 1ZLSL 1R5VA 4HUWB 3VH8G 1X44A 2YMXH 4FFYL 4CVZB 2EH8L 4H8WL 1XGQB 4P5MB 5I1HL 1ZE3C 5KVFH 5I1LB 4O2EB 5E6ZA 4OFKA 1TJIH 4NUJA 5L7XH 1FLRH 1DBAL 4X99A 2NMSA 1EHLH 3EFFB 4O51B 5JUEL 3L5HA 2W65A 3WS6C 2UY7A 1QSFB 3V6ZA 1YJDH 5EZOL 3BDBA 1L7IL 5F7HA 5F1NA 4YHIB 3RL1B 2ESVE 1Q9OA 4GMSH 3CLEH 4F9PC 4HUXB 1MIEH 2BY1A 5I75B 4UMGA 3N06B 2MKLC 1T03H 2VDKL 5J3HC 5ANMA 1KJ2H 4GS7C 2J4WL 4MJ6A 5C70A 4TSAH 1LEIA 1BAFH 3GBMH 4PG2A 5CCKL 4U3HA 1UZ8B 3FQWA 1KUMA 2C1OB 1H0DB 3RL2A 4N0UA 1TCMA 2GSIB 3P11H 1H5BC 4TNWK 4RQQB 2PXYC 5EU7E 4M1DL 2DQTH 3QH3B 3O9WD 3IXAB 1JNHA 2H8PA 3VGEA 1NGYA 2A1WL 4KPHH 1OAUH 1JFQH 3QCTL 2MCG1 4G5ZH 2Q76B 4Y5YB 3F6LA 3MRQB 2QR0B 1IFHL 3P0VL 3W0WB 2DQGH 4MCYB 1XCTA 4GKSB 1Q9LA 5IB5A 1IEHA 2KUTA 4YDKH 5C3TA 5HGAA 5HDQL 1ZVHA 4JFZL 3REVA 1E4JA 1C7TA 3OTTA 5SWQA 3CD4A 2ED7A 4U31A 3V79C 3ALXA 2EDRA 4CDHA 1REIA 3F6IA 1CGSH 2CH8A 3OZ9L 4RIRB 3JWOC 4WV1B 1BQUA 4I3GA 2OSLA 1SJVA 3LKSB 3I9GH 3PP3K 3BP5B 4FP8L 4K23H 4GW4A 4X7CC 5E56A 2ITDA 3QIUD 5DD5H 1IGIL 3K81A 1PG7X 3QIBB 3W9DA 4OKVB 3WO4C 4FZ8L 4R4BB 5CMAA 4GBXC 1G7MB 1D5XB 5E6ID 2FIKB 1VFBA 2P48B 1HH9A 3GBLA 3F7VA 3MGOB 4AIZB 4XVTH 4OZIE 4WI3A 2P8MA 1GGYA 3RGVD 5TFSH 1CD1B 4JKKA 5T33L 1A4KA 1K3ZA 4ZFFA 5HHME 1UWEL 3TF7C 4ZODA 5I1JL 3QNZA 1YJDC 3BJLA 1OLZA 3P4NA 3JV4B 4GKZA 1S9YA 1GAFL 4IRSB 3EHBC 1I1AB 4LLVA 2F53B 5CSGA 4PY8I 4XH2A 1F2XK 4X0KB 4JO3L 3MFFB 3SKMA 4JZNB 3QUYC 1J1XL 3O6FC 1MQKH 2FECL 3W11C 1IILE 5D4QA 4OLVH 4KKLD 2WBWB 1MY7A 5KSUB 3B3IA 2KDGA 4JN1L 3WJJA 1N6QL 3U7AA 1KEMH 2HT3D 4IS6B 5T1KB 2F58L 3S35H 3ULVF 1EGJL 2OJEA 3AREB 5IOPB 1GZQB 1L7TH 4OFVA 3X14B 1A5FL 4OM0H 4MAUH 4RMRA 5T1LA 4PJ5B 4MJIB 1I3VA 1QLEL 2FH6A 5F1SA 5ALCH 1TXKA 3WKNA 2IPTH 2Y9RT 5IB2A 3VA2C 4CMHB 3GFUA 5J12B 1X9QA 2B0SH 4G6FB 4N0RA 4LSSH 5CBEB 5FOJA 4PJIA 2UWEB 2FJHB 4YHPB 4HKBA 4HWNA 5EWIH 2EDLA 4PY7A 5CJBA 3D39B 1CL7H 1PFCA 1OT2A 3IFNL 4RGNB 2Y5TA 3SCMB 1GHFH 1C5CH 1M7IA 4YFLF 5FYKE 4WFGE 2AEPL 4HS3B 2R23A 3OJDB 3BISA 3QEGH 4LQFH 4OCXH 1ZGLM 3PJSB 2PNDA 1S7TB 5TF0A 1QFWL 2NY1D 4KHXH 2BC4B 3UCRA 4FFVD 1F8TL 1X5ZA 3HNVL 1VA9A 5H35A 4G7YH 4KKBD 2DQUH 1MLBB 1J18A 2XKUA 4ALAL 3SDCD 4I5BA 4NGHH 5E7FA 5K9JL 3SE8H 5AZ2H 4AEHH 1A7RL 1P1ZA 4XXDB 4NZTH 4GLRH 2VL5A 1G1CA 2EXYD 1JJUA 2IFFH 3RWCB 3C09B 1TZIA 2NNAA 3VH8B 1HI6B 4HUWA 4X8XA 1LK3L 1J1PH 4CVZA 3LKNB 4TSCH 1XGQA 3BDYL 4P5MA 4NYLB 5I1AB 5I1LA 4O2EA 1A1NB 2VLRE 1HZHL 1MFBH 4FTVB 1RUML 2NY3D 4XVJL 2VDQH 3EFFA 4UQ2B 5GISH 3CC5B 3AS1A 1ZANH 1QSFA 4PUBH 4NNPL 2Q3ZA 2GITB 1UZ6F 5KJRH 5EUOB 1G7QA 2WSKA 2CXKA 4YHIA 2R29L 3RL1A 4DFIA 1KIRB 1JGVH 2HKFH 4BQ8A 4U05A 4HUXA 4C55A 1UH2A 4LEXH 4ZUTB 1X5YA 2FATH 4LBEB 1UH3A 2H41A 3FQTB 5C0NC 5JW5A 3OB0K 1U2CA 4HC1A 4YHKL 1NFDE 2WIMA 4KKCD 4QRPB 2VXQH 5D2LF 2EDQA 5FEBA 2C1OA 1H0DA 1NQBA 2PYEB 4PJ8D 4UAOB 3S3JA 2GSIA 4RQQA 4Y4KD 3LDBC 5AAWA 4HD9A 3QH3A 3WKMH 3IXAA 4CJ1A 4JM2B 3T1WA 2WM0A 4WUKL 4YBHA 2Q76A 4Y5YA 3MRQA 4G80B 2QR0A 4YFLI 4M00A 5D93B 4MAYC 4TTDD 5IVXE 3W0WA 5E00B 4MCYA 2UUDK 3DUUB 4GKSA 3VI3E 1FJ1B 2BVOB 5D1QC 5TE6H 5JR1H 1UACL 1LO5B 1J1OH 4Y5VB 1CN4A 3KYNB 5FXCH 3SO3C 2JJVA 2X05A 2P4AB 5E7BA 1NBVH 1PQZB 1YN7B 4ZTPL 4Y19D 4LVNB 4XP4H 4XHJD 4LU5L 3HI6L 1NJ9B 1T7VA 2B4CL 1FZOB 3QIWC 1XFPA 5GS1C 3TN0D 4RIRA 1ZEAL 2XICA 4WV1A 3LKSA 4LPCA 5GJSL 1JUFB 4KUZL 3BP5A 3WMSA 5DHXB 1Q8MA 3BGFB 3QIBA 3TEUA 4OKVA 4R4BA 5E2WL 1G7MA 2UZIH 5FYJH 1D5XA 1OCWH 5ACLA 2FIKA 3C2SA 1HIML 2ZSWB 1ORQB 3MGOA 4AIZA 2M26A 3VXRD 3RFZC 4TUJB 1CD1A 3TJEH 32C2B 2WP3T 5KW9H 5E2UL 2HLFC 3KLHD 1BQLH 2Z8VC 3KJ4C 4OLUH 3FQUB 2HFTA 5J11B 3OKLB 4FQQB 4QYOB 3JV4A 3EO1B 3BP4B 1EERB 2OI9B 4I0PB 4JEGB 4X98B 3T1FB 4OZHE 4NKIH 2VOTA 4IRSA 1I1AA 4HMDA 5CILL 3GJEB 2F53A 4CRPA 4PJEB 3UTTB 2R8SH 2VKXA 4OM1L 3RY5A 3IETB 1DQLH 4MVBC 4X0KA 3MFFA 4JZNA 2LFGA 1T2JA 5GS2D 4LKCB 3KYKH 3U0PB 3K8MA 4NFCA 2XRAH 4YXLL 3UZVB 4U3XA 1TVBB 3O6MH 5KSUA 3TWCL 5A16A 4IS6A 2PW2B 3C5ZD 3Q5TA 3O45B 5T1KA 3N50A 5IOPA 2CDGB 3AREA 3D69B 1GZQA 3X14A 3L3KB 4JPIB 4PJ7F 4I9WD 4NP4H 4PJ5A 4MJIA 4JG1H 3QRGL 4PLJD 1MHHB 1HYRC 2QJDA 4OD1H 3H9SB 5GS3A 1RZFH 2ZCLL 1LP9E 4EN3D 2FHFA 5CBEA 1SMOA 2DL9A 2UWEA 4MXVE 3W9EB 5T3ZL 4YHPA 4M48H 1U3HC 4X9BA 4H20H 5A40E 5D2NC 2XWBB 1EA9C 1MCSA 1BVKA 1WWWX 3D39A 4NKDB 4LNVA 3SCMA 1INQB 2AABH 2RBLA 5FYLL 2J8HA 3CFDB 4XPGL 1BZ9B 1PG7H 4HS3A 3UAJC 3OJDA 4ODTL 2D31B 4W70A 1DL7L 3MJGX 3QXTA 5LBSH 3DGGB 3LHPL 3PJSA 3UO1L 5JIIA 2FBJH 3QO1A 4HKJB 2BC4A 3Q6GL 3AB0C 1DUZB 4XCCH 4KGLA 2HJFB 2YXFA 2ADFH 4RGMC 4Y4HD 1MLBA 5I74C 3NH7H 3OAZH 2OP4H 3T2PA 1S7RB 3WEXB 1KG0B 1PD6A 5E8OB 4F2MB 1V3KA 2VXUL 1BIHA 4XXDA 2O61B 3MUY1 3CCHB 3QA3B 3EOYG 2X44D 3RWCA 4L4VD 5HHQB 3VH8A 3KPTA 1A9BB 2FO1A 1N7MH 3FRPG 2J12B 2E6JA 2YOCA 3LKNA 4YX2L 3QPXH 3LIZL 1M4KA 5AEAA 2HMIC 4P2RB 5FGRA 4NYLA 5I1AA 4LGSB 1A1NA 4OCSL 1WBXB 1SEBA 2VKWA 4FTVA 1WF5A 1C7SA 1ITBB 3ZE2F 4GS7B 3CC5A 2YR3A 1NPUA 4HGWB 2GITA 1NLBH 5I1IH 2P45B 1CFSB 1OT1A 5EUOA 4LNRB 2Z31C 5FIEA 5C07D 5C3LD 1KIRA 4MA8H 4TVPH 1H5BB 3OMZA 1RIVH 3WIHA 3ZKMC 3KGRA 1GIGH 3F65A 3D87B 4ZUTA 4LBEA 2WAHA 3HB3D 2CGRH 1H3PH 3D2UD 4DVBB 3P9LB 3P0YL 4O9HH 4Q6IC 1UYWL 3HNTL 3FN0H 4L9LB 2OJZL 4QRPA 2N7AA 2Q7NA 1QBLH 3MLUH 3MNZB 2PYEA 1KB9J 3A6BL 3OBAA 1CDCA 1JPTL 2IH3A 4RWYL 3VMOA 4DGIH 1HKLH 1XIWC 2Q6WB 1MY5A 3ULUE 3MRNB 1Q9KB 4JM2A 1KT2B 2W9LA 1N3NB 1GGIL 3Q5YA 4ZAKC 1U36A 1ZLSH 4JFFA 2G5BA 4G80A 4FFYH 3U0WL 4UTAH 5DA4A 3TPUB 2NY0C 2XA3A 1OOAA 5I1HH 3UJJH 5E00A 1YDPB 4CVWA 4WI9A 4JZOB 4GXVL 4QRSB 4XI5D 5HVGB 1FJ1A 2BVOA 1JWSB 4H1LB 4NBZB 2A6IB 1LO5A 4Y5VA 3WO4B 2I24N 1DBAH 3KYNA 3U48A 1OB1B 5JUEH 4GBXB 1YN7A 2IBZY 4MNHA 2P44B 4C83B 2FEEL 1N5YH 3QXWA 1NJ9A 5FGSA 1FZOA 3K1DA 2BSRB 3NACL 1MFEL 3PWNA 3EUUA 1JUFA 3SGKA 2AAVA 3DRTB 4RISH 4CJ0A 3MLXL 4HIJB 4QRQB 3JV6B 4W4OA 2MSPA 4Y19E 3RDTC 2VDKH 2FX9H 3GJFH 2J4WH 3GMPB 1JHKL 1EO8L 4PJXB 3GUTB 1T89A 4ZXBC 3STLA 2ZSWA 3V5KB 3UP1A 1ORQA 1MFAL 1P7QA 5EDXA 3VXMB 4F9LA 4TUJA 5HPMA 4PS4H 5SWZB 32C2A 3OAYH 2R15A 3CJJA 2A1WH 2OZ4L 3O6FB 4NKQB 1GOGA 2P5WE 4WHTB 5EZLB 1F4YL 3QCTH 2FLBT 3FQUA 3OKLA 4FQQA 3TZVC 3VXRE 3EO1A 1IFHH 3BP4A 4I0PA 3T1FA 5AUMB 1K85A 4X98A 3P0VH 1J7VR 5JNYA 3TBSB 2O5YL 3GJEA 4PJEA 3UTTA 5HDQH 1QR1B 4JFZH 3IETA 4XPAL 2I27N 2Z8SA 1S8DB 4LKCA 3U0PA 1SQ2N 1ZKAA 1CIDA 2IPUG 5EIIB 5ID0B 2Y1VA 5MEQB 2OTPA 3V5HB 1TVBA 4NNXB 2Y36L 2XZZA 2PW2A 5GGVH 3O45A 1PW3A 3NIGE 3KAAA 2V9TA 2CDGA 3D69A 4OV5B 3L3KA 4JPIA 2MKWA 1TTGA 5FUOL 4F7MB 2OCFD 2EE2A 2UVFA 4TNVF 3T8XB 3GNML 1MHHA 1TLKA 5DDHB 2ENYA 3H9SA 4H8WC 4L1HA 3VWJD 4AG4H 5C8JB 1MCCA 4I9WE 3W9EA 5T33H 2H6PB 4P4RB 1RURH 1S7XB 1NANH 1UWEH 3ARTA 4UILL 1BFVL 1QSFD 4NKDA 1EHAA 1J0YA 1INQA 4XTRC 3SGEH 3RY6C 3LPWA 3CFDA 5GGRB 1MH5B 3VXPA 1BZ9A 1MCQA 1GVIA 1N4XL 2D31A 3NPSB 3DGGA 3SDAC 5F6IB 3S98A 5LG1A 2CPCA 4XMLL 3VFTB 1F6FB 4HKJA 2EKSB 5DO2D 1AKJB 1J0JA 4YE4H 1J1XH 5IFHH 4OBRA 2J1KA 2HJFA 1I8IB 3RQ3A 1NBQA 5HVHB 4LASL 2ICWJ 1S7RA 3WEXA 4JN1H 1H8SA 3DUHA 1KG0A 5CGMA 5E8OA 4K3JL 3PGFL 4F2MA 1ZLUH 5ANME 5D5ME 1E6JL 1A5FH 1UC6A 4OCWH 2VXVL 3QA3A 4GRWE 2O61A 1HYSC 1QLEH 3WS6A 5HHQA 4N0CD 4U6HB 3FQNB 1A9BA 4QXGL 1EEYB 1U6AL 5E94B 4P2RA 4HUMB 4C4KT 5JW4N 2A77H 1IM3B 5E8PB 1WBXA 3V7AG 1U91B 4L4VE 4GAFB 2X70B 3EDDA 4NN5B 1SBSH 2VISB 4IJ3C 5J57B 3IFNH 2R39A 1ULVA 4HGWA 4X6CF 4I13B 1M7DB 2AEPH 4LNRA 4HIEB 4KTEL 4F58L 4HZAA 1H5BA 2OQJB 1A3RL 1NGWB 4V2CB 1V3LA 3LDBB 1LO2L 4UZGA 4KXZH 4DVBA 2FB4L 1F8TH 1T6WA 3P9LA 4WO4D 3VMPA 5C07E 2XIDA 4NQDB 4L9LA 2APBA 5JHDD 1A14L 4XVUC 3MNZA 5TDOB 4OF6A 4BSWB 4MQXC 2FHCA 1AI1H 3VRJB 3SO3B 1QFWI 2AJUL 2H2PD 3TLRA 2Q6WA 2OM5A 1Q9KA 1MUJB 1IZKA 4QHKI 2R0KL 2VABB 1X5GA 5D7LB 1K6QL 3QIWB 1MSPA 1T0MB 4GAYB 3TPUA 4AZ8A 2IGFL 4IRSD 1I1AD 1YDPA 4JFED 4JZOA 4QRSA 2DQIL 2GFBB 2F53D 4LP5A 1JWSA 2VDNL 4U6YB 1HZHH 1RD6A 2AJVL 4H1LA 2A6IA 2CR3A 3AAZB 2ICWB 4KI5D 2VUYA 1F58H 1OB1A 4BFEA 1ZLVH 3FMGL 1C5BL 4C83A 1NEZG 4NNPH 4PLKC 5F1IB 3ARWA 2R29H 2BSRA 5I30L 5T1KD 5I1GL 1U8HB 3DRTA 3TV3L 4HIJA 3ARED 5F70A 1WICA 1A3QA 3JV6A 2QV2A 1AO7E 1NCBL 4Y16D 1AR1D 4PJ5D 5JIKA 3KJ4B 3PXJA 2YD5A 2Y07L 4C4KO 3GMPA 4KGJA 4YHKH 4PJXA 1UM6L 2H2SC 4L3CB 3V5KA 1T4KB 3S97C 4G6FD 4WHDA 1JIBA 4PGJA 1I1RA 2V5SA 3VXMA 2E9BA 4DGYH 4FQIL 3VXTB 1OTUD 1WIOA 4S1DD 3GHEL 1GH7A 2DD8L 3MBXL 3MUZ1 4WTXA 5SWZA 4WTZG 1WTGT 3P4OB 1QBML 4OZFH 1P4IL 3O6FA 3D39D 4WHTA 4RGND 4PJ9B 5EZLA 1DQQB 5E8NB 4B7LA 3F5WB 3SCMD 4GXUN 2DLFL 5DK2B 5AUMA 3R0MA 15C8L 4Q9CA 3H9HB 3TBSA 2D4DA 1P6FA 3EJYC 2GK0B 1QR1A 1P9MA 5H94B 1KCRL 3WFDH 5DVLA 2VNCA 3L6FB 1FBIL 1WK0A 1HDMB 2BK8A 3DXAB 1S8DA 1A7NH 4LU5H 5IEKB 5ID0A 5EIIA 2B4CH 5MEQA 1B0RB 4NNXA 4DZBB 3ZKQD 3EJZD 4PJBF 3CFEB 4KUZH 3BHBB 3TO4C 2W38A 5F1KC 3FO0L 4OV5A 1ZVSB 4LVOB 1IQDB 4PRIB 3NIFE 5D2NB 1KB9K 1W0VB 1HHKB 5E2WH 3RPKA 3RUGB 4F7MA 3P4MB 3V7MA 3T8XA 1NGQL 3V4PL 5DDHA 2NYYD 1HIMH 4S1RL 1CDYA 3BQUC 4R90H 3G5YB 4PRHA 5C8JA 3T0BA 5JIHA 3T65B 4QRUB 2BVQB 2JIXB 4FTVD 3RA7L 2H6PA 5J6GA 4P4RA 1S7XA 4OSUL 3AB0B 4Y4FB 2ZJSL 4RGMB 1XR8B 5F3HB 4OGXH 5DT1L 4FXKB 3V6OC 2AXFB 1MH5A 1MRFL 4WUUB 2DTSA 3O6LH 4XXCA 5CILH 2VQ1B 1SMAA 3EZ8A 2G60H 1CXHA 3QI9C 3VFTA 1JN6B 1QSFE 1JZ2A 2EKSA 2CRZA 1AKJA 2D2OA 4LLAA 2VLKB 4QRPD 4YXLH 1I8IA 1TQBC 4S1QH 4XWGL 2PYED 5D2LB 5DC0A 3V95A 1BBDL 4X5XB 4L29B 3E3QE 1IC5L 4P49A 5AZEL 4JM2D 3QPQC 4XP9L 1Z3GH 3QRGH 4P4KB 3WNKA 4JFFD 1OM3L 4U6HA 4KV5F 3ILQC 3FQNA 3T4YA 4W81A 2Z31B 1EEYA 2ZCLH 5E94A 1DBML 1NH6A 4WWKB 4GRLA 1IM3A 5E8PA 4F37K 1U91A 1RUAL 2X70A 1T22B 3KPSB 4NQSB 3MV9B 4Z7WE 4Q6IB 1SJXA 2VISA 4AMKL 3G5VB 2B4CC 3EIFA 5DQDH 2YA0A 1BFOB 5FYLH 4TULL 4XPGH 5GRWA 4HIEA 1Z0NA 2OQJA 1DL7H 1NGWA 1LNUB 1OTTD 3WS3B 4N8CH 1XIWB 5F96H 4O2CB 3DIFA 4K71B 3R1GH 2Z8WC 2FX7L 2J88L 4NQDA 1OAZL 3DI2B 2NY0B 1P7QD 2R9HD 4JVUA 2Q1EA 5TDOA 2VITB 4LLYB 4BSWA 4EUPB 2HN7B 3VRJA 1CT8B 1I1CA 3C87A 1IKFL 3O2WH 3GI9L 2G2RB 1MUJA 5JHDE 4JFXB 5KVGL 2JJTA 1BOYA 2VABA 4UT6H 5D7LA 1MHPH 4OB5H 4AQ1B 3RWIB 5IBLC 3QIWA 1T0MA 4GAYA 4I0PD 5TPWL 4HFUL 1ZMYA 3NCMA 4UTBH 3PG2A 4L5FH 2GFBA 3N1GC 3UTTD 4U6YA 4OCSH 3RDTB 1MCWW 3AAZA 3O0RL 4HKZB 5DJ6B 1NEZB 4ZXBB 5F1IA 1RI8A 3QJFB 5DJCB 4PJDE 5CJQL 4JFEE 2F53E 5HHNB 3WFZA 1YMHB 3D3VB 5DEGB 1TJHL 5C0BB 4KI5E 5C08B 1U8HA 5C6WH 4P3CL 3WLWD 5A3ID 5T5NG 4NRYB 1R3IL 3P0YH 1U8OB 1UYWH 4NSKB 2WV3A 2OJZH 5FDWB 3TZVB 2NY2B 4L3CA 2BRRH 3H9SD 1T4KA 2Z35B 5IF0B 3VXNB 2C1PB 4ZNEA 1AHWC 3VXTA 1Z9LA 3OKDB 3VMNA 1JPTH 4P5TC 4PJ5E 2MCPH 3DGCR 3P4OA 4P46C 3MRFB 3SKNB 4WW2C 2QADC 1S7SB 3QDJB 3O3AB 4YH6A 3KLDA 5JMRA 4PJ9A 1DQQA 5E8NA 3F5WA 2VQUA 3CMGA 2AXHA 3MCLL 5DK2A 2UWEE 4D2NA 2HTKD 3BUTA 3F7RA 4ZPTB 5CZVL 3LEYL 1A7QL 1MQ8A 2VE6B 3H9HA 4NQEB 5LJYH 1OAXL 4BQ6A 3R06B 3TPKA 2GK0A 5ITBH 2D3VA 5H94A 5GS0D 3UZQA 4UV4H 1E27B 3L6FA 3W81A 3KJ6L 3QDMD 5JHLH 3DXAA 3MODL 3MMEB 3BZDA 3OXRB 3MOAL 5IEKA 1B0RA 4OQTA 2LAGB 4DZBA 5INDB 5EA0H 1MFEH 3CFEA 1MVFA 4MB4A 1UXSA 2J7LA 3MLXH 4OTXL 5CLWA 1ZVSA 1IQDA 1WUNT 4PRIA 5D2NA 1W0VA 1HHKA 1QA9B 3P4MA 4F15C 3LRGA 3KLAB 1EUTA 3M8OH 4NKOB 3X11B 1JHKH 5AAMA 1CXLA 1G9NH 1MFAH 1YNTB 3HTLX 1UG9A 1MAJA 2XTJB 3ZT5A 1O0VA 1Z5LB 3G5YA 4P2RD 5F93C 3SDAB 4HUVB 3T65A 4QRUA 2BVQA 4O58L 4XNYL 2JIXA 4FQHB 3W39B 1FVCB 3OKKB 3IDXL 3GJFB 2CK0L 4Y4FA 2NZ9C 4HSQA 5E99L 2IAMC 4W68A 1XR8A 5F3HA 1KENL 3JUYA 4FXKA 2AXFA 3AM8C 2YK1L 4HJGB 4WUUA 2YPVH 3HAEA 4FTVE 2BZDA 2AERT 2MJWA 2J2ZA 1MRDL 2O5YH 4KDTA 4Z77B 2VQ1A 1I9RL 4ONFL 5IHBA 4XPAH 4OF7A 1JN6A 2J5LB 3B2VL 25C8L 3O6KL 3IJHB 3M17B 1OWWA 3PWPB 1QUNA 4K55A 5IROC 5BS0D 5FGCB 5DGRA 4WIQA 5D2LA 4M1CC 1ITCA 4X5XA 1IAIM 4L29A 4IOFC 2YUZA 3BKYL 5CSZB 3BYYA 2X4RB 5DHVH 1EAJA 1VSCA 5FUOH 4R7NB 2IFGA 4QRPE 4IJ3B 4HWBH 3BUYB 1FAIH 1SYVB 2ICES 5JDSB 2PYEE 4L3EE 4P4KA 5DK0B 5DVMA 5JTWA 4LSUH 1MRCL 2FWOB 2Z31A 2X10A 3U6RB 2HT4C 2RR3A 3MRLA 4OCYL 4WWKA 5HD8C 4PJFF 3PDGA 1R3JB 1S9VB 1T22A 1BMGA 3KPSA 4JFFE 4NQSA 3MV9A 4Q6IA 1OLLA 5KVEL 3JTTA 5DFWH 1BFVH 4U33A 3G5VA 3T0AA 1LNUA 2P42B 3WS3A 3X12B 1XIWA 4XMLH 1DCLA 4O2CA 1O7VA 4NWUH 5AWNH 5DWUL 2EDXA 4HQQL 2VMFA 1NSNH 3CFBB 3ZKNC 2JELL 3VFSB 4TOYL 3BDXA 3FO1B 3SQOL 2FEDC 4LASH 3VXMD 5GSVB 3S88L 5C0RL 2ZSVB 2VITA 4LLYA 1CD0A 4K3JH 3I75B 4M1GH 1AIFB 4EUPA 3PGFH 4TVSa 5SWZD 5IR1B 5DK3A 2HN7A 1CT8A 1E6JH 1LDSA 5L88L 1OTSC 2VXVH 1OAYH 3O6FD 3RVTC 2G2RA 3CVHL 2ZP0T 3L5XL 4JFXA 1G6VK 3GSNL 1S78D 2K1MA 3RWIA 3ZDZF 1A7BA 4QXGH 4NFBA 1RUPH 1U6AH 4FMKA 1B88A 2GUOB 2DKUA 5C0IB 3RDTA 3RX8A 4HKZA 2Q86B 2EEDA 3V4VL 1AXTL 1GL4B 1NEZA 5DJ6A 2IBGA 2Y7QB 3OAZK 4ZXBA 3OAUH 4PRAB 1FNGB 4R7DB 2BNUB 3QJFA 4PJEE 5HHNA 4BJLA 1IL1B 4NPYB 4KTEH 2ZUVA 3L95B 4F58H 1YMHA 3D3VA 5DEGA 5C0BA 1BQHA 5M94B 5DJ0B 5C08A 1LO2H 4NZDA 2EDJA 2O5ZH 3MXWH 4NRYA 4PJ7A 4CVXB 1FRGH 2CR6A 5JW4R 1U8OA 4NSKA 3LS4L 3RJDA 3TZVA 5FDWA 4IRZL 1NMBH 3CGTA 4B53A 3PWVB 4ZFOL 2Z35A 5IF0A 3MJ9L 3VXNA 2C1PA 4PRHD 2NPLX 3GO1H 3P30L 5EOCL 3DSNA 3OKDA 3TBVB 3FB6B 5SX4I 4NJAL 3MRFA 3SKNA 2AJUH 1S7SA 3QDJA 3O3AA 5GRXG 3LQAL 1AGFB 2W0LA 4ODSH 4YHYC 3H9SE 4H25B 1FIEA 1K6QH 4NC1E 5FHAH 3OQ3B 5F8QC 1HWGB 2B2XH 4POZD 2IGFH 4XP5L 3GHBL 4ZPTA 4NQCB 1G6RH 4NQEA 3TO4B 2DQIH 2QQNL 1OVZA 2R4SL 1A6ZB 2VDNH 3R06A 2AJVH 1KC5H 3TYGL 2QQLL 3H7BB 4J7RA 1E27A 1AKJD 3FMGH 2H1PH 4PD4J 5D1XC 3MMEA 1C5BH 3VGHA 3OXRA 2X1WL 3OR7B 3ZHDA 5TF1H 1NC4D 4I18C 5HGBB 2VXTL 5INDA 2EDDA 1JPSL 1H15B 4YHNB 5JXAL 5I30H 4U1GC 3KR3L 1RFDL 3DVNB 3ES6B 3TV3H 2OLDA 3QDME 4JKMA 1MCFA 3ZE1F 1VPOL 5E9DB 1JRHI 1FE8L 3P2TA 4FQ1L 1NCBH 5DJ2B 1WV7T 1ZT4B 2VXSL 4OLXL 5DUBB 3GSVB 1QA9A 2YUXA 3TESA 2APXA 2Y07H 3KLAA 4NKOA 3X11A 1A6TB 5JOFB 1GJIA 3TA3C 3QCVL 1UGNA 1YNTA 4M61B 1BX2B 1Z5LA 4BELD 2ZKHL 4FQIH 3DROB 3MX0A 3SDAA 4HUVA 5HDOA 4GRLD 3GHEH 2FIRT 3MBXH 4PRNB 3QI9B 2CO6B 1QBMH 3KWWB 4FQHA 1JNLH 1UKTA 1A0QL 3OKKA 1FVCA 3W39A 3ZYIA 3GJFA 2BY2A 1P4IH 3IYLW 3ARDC 4NOBA 3GGWB 4P2OC 2AI0L 5D7IB 4OLZH 1UB5B 4P2RE 1UADC 3L5IA 4BSVB 5J06A 2VDML 3MBEC 4HJGA 4MSWB 4YEEA 15C8H 1RZJL 3RKPA 4JDTL 1XF2B 4FG6D 4Z77A 4U1MA 2NTSP 4K3GA 3MRRB 4HBCH 4MD0B 2CSPA 2BY3A 3PXHA 1IVLA 1KCRH 4HV8B 1FBIH 2C4XA 3ILPB 3IJHA 1E0OB 3M17A 3PWPA 3UYOD 1UJ3C 2J3SA 5HI3D 2DLGA 3CSYB 5CJOL 1L0XA 4ZYKB 4CKVX 4O00A 2WBJC 3EZJB 2JTDA 3GM8A 3CX2A 3OAYK 4LHUG 1DDHB 5CSZA 3FO0H 3DSFL 2X4RA 5ECJE 3UXFA 3CH1B 1VHPA 4R7NA 4XCFL 2DF3A 5BS0E 5C7XL 3S37X 3BUYA 1SYVA 5JDSA 5D7LD 3IAPA 3V4PH 5DK0A 1GGTA 5I19L 5JZ7D 2FWOA 1QZ1A 3GI8L 1X4YA 4GH7B 1KJ3L 1XGTB 3FCTB 4LL9A 3U6RA 3PNWA 2EYSB 1KOAA 1ODAA 1CLOL 5F7WC 4K7PY 2I07B 1R3JA 1S9VA 3WSQH 4WEMB 4XB8A 2EH7L 4OSUH 3RVUC 3A67L 3TM6A 3FZUC 3Q5OA 3QUXB 5MEPB 4Y0GA 5DT1H 3DYMA 2IBBA 4X9FA 1K9TA 4EDWH 5TE7L 2XG4A 2XQBH 3HMXA 3X12A 2DRUA 3ULVD 1KXVC 3T3PE 4J8RB 1V05A 3LRHA 4LIQE 1UXWB 5L6YL 1VFUA 3CFBA 1MCPL 3VFSA 3PV7A 3FO1A 5EZIL 1PY4A 1JPFB 1NMAH 4XWGH 4KRNA 4HBQA 5GSVA 1BBDH 2YUWA 2ZSVA 4HHAB 4QWWD 3I75A 1AIFA 4ONGH 5BCAA 1NGXB 1Z9SA 5IR1A 5FF6B 4PJXE 2I5YL 2R0WL 1MJ8L 1F4WL 1PKOA 2BHZA 5LGHL 4PJ9D 3QUZC 3VXME 1TETL 3TP4A 1ZGLP 4OGZA 4NWTH 4XNUL 4PR5B 1WIPA 4LDLB 4LARL 1SY6L 1EGJA 3O2DA 1F90L 2GUOA 5C0IA 3BE1L 1RUAH 1G0XA 1YY9C 5E08L 2Y06H 4QY8B 2Q86A 3DXAD 3I3BA 2VYRE 1F45A 3PQYD 2Y7QA 1MCWM 2MHAB 4J3XA 4X80H 4PRAA 1FNGA 4R7DA 2BNUA 3BH9B 3GMQB 4TULH 1V8HA 1IL1A 4G6ML 4NPYA 4RBPH 3L95A 4OF3A 4PJBB 4WTWA 4LSTL 5DJ0A 4P5TB 1QOKA 1DVFC 1FG9C 5FECB 3HMWH 4P46B 5GSRB 5JW4M 1JGLH 4PRID 2ZUQC 4UI2A 1M71B 1HNFA 4CVXA 3GBNH 1QNZL 4YXHL 2FX7H 4UV7L 5LQBH 1OAZH 2EDWA 3EYUL 3ESUF 4G8IB 4PGEB 1IE5A 3PWVA 4NNYB 4NO2B 3VCLB 4Z0BL 2VZTA 1I9IL 3E2HB 5TGBB 4N0YH 4C56B 4XAKD 3TBVA 3FB6A 2JIXD 1JMZA 4CADB 3T0VA 4RMUA 4MQSB 3GI9H 4XMKH 2I26N 4Y4FD 3DYOA 1AGFA 5BXFB 5KVGH 4H25A 1GC1L 4PRHE 4G6AD 5IBTL 1XGPB 5TPWH 2X5PA 4HFUH 4ZS6D 4WUUD 5GRJH 4NQCA 2DB8A 3VFUB 3TO4A 1BVLB 1FO0A 1A6ZA 1WWBX 1X5XA 5FYKU 3WFBL 3RBSA 3DUSB 3QYCA 4FFWC 1FZMB 2M1KA 3H7BA 3O0RH 3HR6A 4K8RH 4F15B 1K8IB 2E3VA 2RFXB 4FFZL 3OR7A 5CJQH 1DBJL 3N0PB 5HGBA 4JQIH 4BZYA 1F4XL 1TJHH 1H15A 3QDAA 4YHNA 4CVUA 3DVNA 5ITFB 3ES6A 3O3BB 5SWSB 1SBBA 1NCNA 4P3CH 1IQWH 1BJ8A 2DQDL 5E9DA 5DJ2A 1ZT4A 4IM8A 5DUBA 4Z78B 3GSVA 1R3IH 2IAMB 4P4KD 1A6TA 5JOFA 4PBXA 3V6OA 5IJKA 4KK6C 2Z31D 4M61A 1BX2A 3MV7B 4M7ZC 4DJMA 4ELME 5EBGA 3DROA 5J4MA 3IJYB 4WWKD 2VDPH 2YWZA 3HUJF 3QI9A 1RULL 4PRNA 5C0DB 3DO7B 1ZLVK 5EH1A 3KWWA 3KPSD 2JCCF 2KBGA 5F9OL 1NAKL 3MV9D 3CSBA 5J1SC 1UCBL 2YXMA 3GGWA 5EOTA 3UBXI 5D7IA 5B3JF 1UB5A 4BSVA 2R4RL 5T1MA 4QXUH 4MSWA 2BVPB 3LEYH 4LCWB 1A7QH 3TT1L 2FNBA 1O7SA 4ONOA 2MPAL 3NCYS 5J8OA 4MD0A 1ZTXL 3MRRA 4EDXB 2UYLB 1GZPB 3MLRL 1N8ZB 4DAGH 4E42B 4IRJC 4HV8A 2Q8BH 3ILPA 3MODH 2EXWC 3T09A 3MOAH 1YQVL 3CSYA 4GRMB 4YDIH 4ZYKA 4GXUM 4TTGA 1HEZB 4K3DL 3Q1SL 4LHUB 4KK9D 1E4KC 1DDHA 1X5LA 4TN9A 1G1YA 3U7YH 4YFDB 2LV4A 3CH1A 4LK4A 2W0PA 4HWEH 1ZLWH 4YPGB 4HXBH 4IHOB 5T3XH 3V2AR 5JMOC 4LHQB 1XGTA 4OAWB 2IWGA 4KZEH 3FCTA 4X6FB 2EYSA 5LXGL 3DVFA 4PGBA 2AGJH 4NQUA 4O58H 4XNYH 1JI1A 2I07A 4UB0L 4E0RB 4LAJH 5D7LE 2RB8A 2OL3H 5C0AB 3RU8L 5F21B 4BQBA 1ETZB 3QUXA 5GGQH 5MEPA 4N1HB 1KENH 4PD4K 2YK1H 2CMRL 1H3VA 1AP2B 1Z2KA 3D3VD 5C0BD 3ZDXF 5C08D 4KQ4L 5JA9A 1RIUL 5ICZB 4J8RA 3IU3B 1NLDL 4PPTA 3H2WA 4PP1D 3O6KH 1NCAH 3CIQA 1UXWA 3OV6A 1BPVA 4QEGA 4E5XB 2EC9T 1W0YT 4AM0B 2NY2D 3MA9L 1A2YB 4TNWF 1JPFA 3BAEH 3B9AA 1Q72H 3ULVE 4P5KB 5FGBA 1IGCL 3C8KB 4YIQB 1NGXA 3BKYH 5D1ZC 4HS8L 1OD7A 3QDJD 5FF6A 3O3EB 4IMKC 1JE6A 1B6DA 4ZNEE 3DLQR 1MRCH 3V0AC 5CKGA 2Z92B 4PR5A 3GSOB 4NQED 3DPBA 4G43B 1LO0L 4QY8A 4RFNC 5KVEH 2AJZB 3ZLQC 2MHAA 2VL4A 4D9RD 4YHLL 4YHOH 4TUKL 3BH9A 3GMQA 1GGBL 1B0WA 1JHTB 1ADQA 3QQ9C 4PJBA 4P5TA 3S37H 1DJSA 2F8XC 5FECA 3DXAE 4P46A 5GSRA 4FQ2L 3BOVA 3N1QC 3PQYE 3OJMB 1M71A 4HQQH 1UWGL 2JELH 5FYKL 5IM7B