4X7SH

Structure of omalizumab fab fragment crystal form 1
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNYNPSVKGRITISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epididymis luminal protein 214
publication title Structure of the omalizumab Fab
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2014-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7sH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x7sH01
2NY3B 5ALCL 4P2YA 3PWNA 3EYOB 4GKNB 1YYML 1CQYA 1PDKA 3UTTA 5CKAA 3ZMRA 1C5BL 1INQA 2A77H 1FV1B 2Z91B 2YUVA 4KDTA 1Y6KR 4KQ3H 5IOPA 3FB7A 3A0OA 3ZDYF 4NYLA 4NQDD 4PJ5E 2J8OA 1KLUA 4WY7H 2F58H 3PP3H 3R8BB 5ITFA 3QZWB 1VA9A 1U8NB 3TBYA 3WO3B 5F1IB 1HINL 3CK0H 4ODBD 1NCDL 3MLTB 1DN0A 1I8LC 4QT5B 4JPWL 2JJSA 3FFCA 5E2TL 1PLGL 1Y0LA 4LRIC 3O0RH 4U6HA 3GSNB 5TE4L 4JGMA 4OZHB 3SHSA 1LO4L 3L3OA 4DW2H 2H2SC 2IQAA 1NEZG 4X7TA 1HOCA 1JWMA 2H9GB 4P2RD 2AV1B 3DROB 4YWGL 5EZIH 3IFPA 1BQUA 3OB0H 3RX5A 3LN4A 2OZ4L 1JYWA 5C6PB 2Z31A 2EZ0D 4XXCC 1QPPA 5L2KA 3ZYIA 3LEXA 2R4RH 5GS2H 1FG9C 3LH2H 4ERSL 2OX5A 4P4KC 5EA0H 2C3GA 3GI8H 4OQTA 5IF0B 1RUKL 2HLFC 5EWIL 1OY3B 3O2DL 4MD4A 2JCCA 4Y4KD 3UO1H 4ZUTB 3MUGB 5D7IF 1NEZA 5GIRB 2Q8AL 4I18B 4HGWA 1CLOH 2DMCA 5EO9B 3UTOA 1FNGB 1JWSB 1QSEB 5BVJA 3O6ML 4NPYA 1UCBL 5DR5L 3TF7C 1NBYA 5DC4B 3HAEH 2BDNL 3CFKA 2LTQB 3O3EA 2IQ9L 4R3SB 1QD0A 2KQNA 1CWVA 12E8L 1QBML 3U1SL 3Q3GA 4YJZL 2DWEA 4Z7VA 4QRUB 3IDGB 1F8TH 3UC0L 5KSUB 4HUWA 4OIBA 1S9WB 4UDUB 4CVWA 2V5YA 5KSAB 3ROLA 1E6JH 4ZNEE 1A7QH 2A74A 3QEUB 1FAIH 2F19H 5FV2A 2VLMD 5C09B 4KQ4L 1YDPB 4XP4L 2WINA 1I8LA 3F7YA 1BF8A 3IRZA 1AQDB 1UZ6F 3B2UC 3DIFA 4LRIA 3FFDB 1MHEA 4CDHA 1JPFB 3CVIL 3LQMA 2J8UB 5DUBA 3JWOL 3C6SB 3TESA 3TV3L 1X4XA 1IEHA 1C12A 1WK0A 1BJ8A 1DUYA 4MB3A 4N9OB 5FK9B 2YD9A 4OF0A 5D2LF 2R0LL 4U33A 2IAMC 5EZLA 3IAPA 1JNLH 5IFJB 1B4JL 2H41A 3FQXB 2BRRL 2ZOKB 4IM8A 3QHTC 1I8MA 1DFBL 4OUUB 1SM3L 1TLKA 1YNKL 4Q6IC 1J9CT 2EO9A 4P4KA 5DJCA 4PJFE 3P77A 4PJDE 5I1DB 4KTEH 5HY9B 1JGDB 2V7NA 1XF4B 2CXGA 3VRJB 3PHQA 1X5XA 3KPPA 1RZ8B 1CVSC 1XCQB 3E2HC 3V95A 1AGDB 4Y5XB 5DI8A 5DJ0A 4BFEA 1KBGL 5SX4H 1IAIH 3RTQD 3CPLB 4AYFA 3QJHB 1I7UB 1UH2A 4M9PA 3MV9A 3QDMB 4Y16C 1EAPB 3I3BA 2VDPH 4K3HA 3C5ZB 5IKCB 2LU4A 3LOWA 3WS3B 3VFUA 1WZ1H 3PQYD 4R2GC 4UUJA 2PYED 5F3BA 5GZNC 2NY0C 1MQKH 3QXDA 5H2BB 2VDRH 1OAKL 2GFBA 2ERJB 2UZIH 5CJBA 5I73B 4JJ5A 3A6OA 5I2IA 3ALWA 4DUVA 6CGTA 1IAOA 1PG7L 3I02A 1B3JA 3TCXA 4OGAD 4Y89A 3KAAA 4XPHH 3VI4E 1G0DA 4K94H 1BQSA 1D5ZB 3K80A 1CIDA 2FBJL 2R9HD 1DBJH 1AY1H 1I1YA 1T20B 3RWEA 2ADJB 3D6GA 4OV5B 4Z6AT 4OCWL 3MNWA 4JZOA 4KK6C 2DQFB 1OM3L 2R0ZH 4Q6IA 2R1YA 3THMH 2E27L 2BC4A 1XH3B 3CXDL 1UM6L 3C9NA 3P9MB 4XNMB 3KPOB 4CVXA 3P0VH 5JDJA 1XCTB 4JM4H 5INCB 1DEEA 3OR6A 5ENWB 2ZG1A 3WYRA 1EEZA 5C08E 3CSYB 4PG9B 4X8JA 5DFWH 3SKOA 1RUAL 5IROC 2JCCF 2L0DA 2B8OT 2X09A 1WBXA 4HKBB 4Y16A 4FNLH 4OCYH 4RGND 3Q1SL 4XCEA 5TE7L 3HN3A 3PGFL 2MPAL 4OCSL 3RVWD 3S9DB 4O5LH 4KMLB 2FRGP 1CFSB 4YQXL 3QH3B 4NIKB 3SO5A 3WO4C 3MLVL 1KT2B 5MENE 2R1XB 4X4ME 4HF5L 1UJTA 1JBJA 3EYFA 4Z7VF 4HZLB 3SGEH 5JIHA 2VNCA 2D7QA 3E0GA 4K3GA 5C0RL 3WSQL 5JIPA 3TNNA 4IIQB 5IMLA 4GG6B 4TVSa 1NSNH 2Z92A 2DQEH 5DJ2A 2N7BA 4YR6A 4PV9A 4U6VL 4KI5C 5E6IB 3RVVD 1HIMH 3WHE1 3GMMB 1P7KB 3DXAB 1LO0L 4K7PY 4QOKB 5E8DL 1KB9K 1TJIH 1ZANL 2VN7A 3PWLA 4HMEA 3SJVD 3MOQA 4CVZA 1QYGH 4NQEA 5F72S 1SJHA 2BRQA 1R3IL 4BSVA 4WCYL 5T5FL 5EH1A 2J6EH 2CDFA 4XAWL 5IR1B 5T5NF 1T66D 4NKMA 2HLAB 1LEKA 5DUPH 5JOFB 5KVMC 1RFDH 4G9DA 3FO2B 1P4BL 4HS8H 3D85A 3DUUB 2XY2A 1C1EL 2F53E 4TVPH 1NAMA 1PD6A 1RPQA 1ZGLA 5IROA 4CMHB 1MUJB 3NAAL 3BMWA 2CO6B 4PRIB 3OKDB 4HPYL 1BZQK 3FQUA 5DD0H 5KSBB 2VL4A 2NTSP 5AZ2L 4A2LA 32C2B 5CP7B 5JHDD 3ILPB 2I60H 3QDAA 1BD2E 4XWGL 4JZNA 4NKIL 3QXVA 5DMKB 3L95B 1EX0A 5I66B 1E4KC 2DM4A 2GIYA 2YOCA 2SEBA 2ZUQC 3BHBB 3RPIA 5AAWA 5DTFA 4BH7B 1HEZA 5E4IA 3HMXH 3NOIA 3DXAE 1EVTC 4WUUB 4IMLB 3GKZA 5A16A 4OI7A 2RBLA 3OAUH 2VIRB 1ZHNB 4QRPE 4D94A 3QNYB 1NKRA 4NT6B 1EZVX 2OTPA 2YUWA 1UT9A 4Z95L 5AAMA 5FEBA 1ZVSB 3SDCD 1QQDA 1VKXA 1D9KA 1BBDH 3CU7A 5C6WH 2IANA 1M05A 4JZJA 2QV2A 5JOEA 4PJ9C 5E8OB 4WFHE 5KG9A 2B5IC 5T1KA 4YEEA 5E03A 2WWMC 4HJJL 3T3MF 3ILQC 5KSBE 2Y5EA 5C0IB 4UT6H 1BZ9B 1N7MH 3OMZA 4O4YL 4R4BA 3BE1L 4QNPE 5IEKA 1N59A 2YN3A 2NTFB 2Q76B 1XZ0A 3LQZA 3JXAA 4NQCA 5EOCL 2JLLA 5DFVC 3S37L 1Q9OA 1T21B 2ZCLL 3T65B 5JHLH 2EXYD 3MFFA 1CE6A 1EERB 5ICXA 4F8TA 3V5HA 3U0TB 1A6TA 2G2RB 3WHXB 3DMMD 1E4KA 1JFQH 1GGUA 3RVXD 1QA9A 4JDTL 3QIBC 1T7ZA 3OKEB 1CLYH 1R24A 2D7TL 3HZVA 4DN3H 3IF1A 2YK1H 4ZTOH 3HC0B 3EHBD 3ARFB 2I27N 4ELME 2AAVA 3QHFH 3CJJA 1GC1H 1D5BB 5CIPA 3EFDL 1FN4A 3RY6C 3T09A 4DGYH 2XQYG 3KXFA 2VDOL 2AEIT 1U6AH 4UTBH 1EHLH 1MCHA 2YMXH 3Q6FA 3G9VA 3O6LH 4F9PC 1T3FA 4RFNC 3CSBA 4BZ2H 3NTCH 4BYHA 3SDAD 1J12A 3CUPA 3AS0A 4PJ9A 5TQ0H 5D96C 5KSVA 1KCLA 1VADB 5IESH 3H8NA 1T2XA 4ZSOB 2O5XH 4OLYL 2I9LB 4J6RH 2OQJA 2FSEB 1QR4A 3PNWB 1GHFH 4LSTL 4P2QE 2R2CA 3L3GA 1MLBB 2BP3A 4JHWL 1XGPB 4B0MM 5I8CB 4QTIL 2VSDA 3HI1B 3TBSB 5A3IC 5IQ7H 3F6IA 3T0EE 1G7MA 4MJID 3WD5H 4JRXE 3ZSSA 5JR1L 5I76B 1ZT7A 4M6NL 1IQWL 2R69H 2X4TA 3JVGC 3G04B 3MRMA 2NY5H 4YBQC 5T3XH 5TF0A 3D25B 3OKOB 5EBWA 3D5OF 5IQ9A 4F7MB 4LIQH 1BAFH 1TPXC 3TPUA 2BK8A 3UZVB 4HDIA 4K71B 4Z0BL 5L8JB 3VFWA 1X5FA 1YC8A 1YEGL 4Q0XL 3SDXA 2NW3B 5CGYD 2GJZA 2JB5H 2WUBL 4GW1A 3SDDA 2ZUVA 5IK3A 1QEWB 1RSFA 1ZLUK 1AC6A 2V7HB 1BLNB 2I07B 4AY0A 5C2UB 4JGUA 1K4CB 1TQCC 3CLEH 4H88H 4Z7OE 2ZG2A 3ZDXE 1BEYL 3RY6A 1ZT4B 3F7QA 1P2CA 1I7TA 4F9PA 4PB0L 3O11A 1LNUA 2E9WA 4KRPD 4PRHD 4D0DB 4BKLA 1YN7A 5D8JH 5FA4B 1FZOA 4FQ2L 2EEBA 1XEDA 4MLSA 4MSWA 4KI5F 4P3CL 4JE4B 4HQQL 4N1EA 5K9JL 1ZTXL 5IMKA 3VGDA 2GQHA 5MERA 1L9MA 2ICEB 1H3XA 3VFVB 5K59E 3UTQA 2FZ3B 3OJMB 1PW3A 2R1WA 3BPCB 2IG2L 4JHBA 4XBEL 2A9NH 3GBNL 3I6KB 1INEL 4KPHL 3EO0B 1HHKB 3TIDA 1GH7A 2ED7A 1NCTA 2AJVH 1DL7L 5FYKD 5IB1A 4NQVB 1U92B 4M7ZB 4LCWB 4IRJD 4G6AC 4JFZH 4H26B 2QSTA 2NY6B 5HHVL 2EE9A 3JVGA 3V7AG 4PB9H 2PTTB 2EEAA 3O9WB 2VN4A 3CFIC 4OCXH 4M6MH 4QHMA 1G9MC 1P4IL 4F7EB 4TUOA 3QFJE 3IJYB 2F74B 3TCLA 5D1ZC 4Q2ZB 1EFXD 4GRWH 5TFSH 4PJAA 1WEJL 1OTUC 5L7XH 2F54A 1JRHI 4R26H 5DDHA 5IB2A 5DRXA 1GIGL 1CICB 1YMME 4ZYKB 3UPRB 3BSZH 2O61B 4EI6A 1A6UH 4LQ1A 3SO3B 1I4FB 1ZT1B 1MHCA 5DK3A 4K55A 2FECL 4ZXBB 2CLVB 1WFTA 2X1QA 3MJ9A 3VXUD 1QSFB 2P8MB 2C3HA 3B6SA 4HFWA 5DK0B 1XF2A 1NMCC 1IC7L 2UUDK 1CDGA 3FO0H 4ONFL 1NC2B 1LILA 3SDYL 2NY3C 5CEXB 3G6JF 3UTPE 4ONGL 4UOW1 1Q9WA 5I8KL 1E4WL 2YD8A 5CP3A 3P11H 2PXYB 3VW3H 2CDGB 4BUHA 1P1ZB 4J3TA 5JMRA 1PYWB 3TVMB 3W9EB 1BVZA 1IGFL 4XNXH 1KENH 5JQ6L 3KPQB 5CBEA 4GLRI 3K8MA 2OP4H 1YEEH 4HIEA 2ITDA 3T4YB 2FJHB 1G0YR 1AP2B 3WXWL 4AENB 1IMHC 4G6MH 1ZSDA 3HE7D 4LAQH 1HZHH 2E6JA 5D1ZA 5T1DL 2J12B 4H8WL 2HN7A 2EDXA 1FFNA 2AI0L 3RKDD 2J5LC 4R97B 5DJ8A 2X40A 3TN0D 3VG9B 4MB5A 1I3RA 1RK0B 3MLZH 4PRPA 4FXKB 4KROD 3SDXF 1XIWA 4LLYB 3C8DA 4YGVA 4GAYA 5IEHA 43CAB 4ALAH 1TCMA 4ZUUB 2B7DT 3BP4B 3C5JA 3HC4H 5D1XD 5BW7C 5LXGL 2P4AB 4PJ7F 3K4ZA 3RPKA 3V7MA 2GEEA 1VGKA 1YECL 4Z7QF 1U36A 1I9JL 5L8KB 2FBOJ 3EJZD 5EIVA 2IH1B 5BZWB 3O4LB 3EYOA 2EH8L 4GKNA 4FQJL 3QZWG 4RZCB 2DS4A 4YBHA 4JO3H 1YQVL 3QPXL 3GMLA 4N0RA 4I18C 2XZCL 3K4DA 2PO6B 1JGEB 1OD7A 1YPZB 2N4IA 1FV1A 3FN3A 3VXME 3TGXA 5DUMH 2LTQC 1WFOA 3DHJA 1S7RB 4OCMC 1BFVH 4PP1C 2DQJL 2PYFB 1I8KB 2GY7B 2QSCH 1FZKB 1A9BB 5A2KH 4OM0H 2XTJB 5DD6B 3G6AA 4RBPH 4W4NA 3QZWA 2B2XL 2IFFL 3ZHKA 4X8XA 4N0YL 4WFEE 3ZE0F 5J13C 4K23L 1U8NA 1FE8H 4M61A 4NJ9H 1D5MB 5CD3B 5IMMB 5F1IA 3MROB 3RKPA 4R4FL 1OGAB 3RWCB 3B9AA 2L4OA 3JTSB 3TZVB 3QUXB 1KJVB 3GZKA 3MV11 4PJHE 3VE0B 4GAJH 4QT5A 1RZJC 1AXTH 1IGIH 8FABB 2YPKB 1KCUH 5DLMH 3EOYG 4JY4A 3HR5B 3CMOH 5HDQL 2P43B 3A67L 4FTVD 1FO0H 1UM4H 1EBPA 2MCG1 2FCBA 2H9GA 3BQUB 3O4LE 4OLUL 2AV1A 3DROA 2EIEA 4PJAF 4JFDD 5C0AB 3ZLQC 3QDJB 3GMRA 1O0VA 4X6CE 1XMWA 5TF1L 4QHUB 1QFWM 3O6KH 3MYJB 4AM0B 1EZVY 5FV1L 4K8RH 2DJSA 4LLAA 4OZIB 1I9EA 5IF0A 1FVDA 3B5TA 3I75A 3P0YL 4ZUTA 3MUGA 3O3BB 5IW6B 4AIOA 5GIRA 3MRIA 4I18A 1GAFL 3FN9A 3ARZA 1H5BB 4WU7A 1FNGA 3MV8D 2AEPH 1JWSA 4PY8I 4ZODA 1PG7X 3EO9H 5I8EA 2EYTA 3DOSA 2J1KA 3HHRB 3T0DA 5DD5L 3HZKA 3LDBB 4R3SA 3W82A 4PJFA 1BFOB 4G3YL 2HTLD 1KFAH 5ERWA 4YPJA 1KLFA 3VXTB 3QO1B 2DIBA 4QRUA 3IDGA 3NFPB 1S9WA 3DRTA 1LO5A 2QL1A 1G7LA 2OLDA 3QI9C 1XF1A 3QEUA 1R5VB 3QRGH 4UV7H 3KLAB 1BQHB 5HGDB 3GM8A 3BISA 2ERJC 2G75A 3V6ZB 4L3AA 2MCPH 3VFNA 3KYOB 1AQDA 1ES0B 2AVGA 1RZFH 3FFDA 1JPFA 4OTXH 2J8UA 2DQDH 5B39G 1ZLSL 1FNSH 2P49B 3IFOB 4U0RC 1UQSA 2CRIA 5JUEL 5FK9A 4X7CC 1U0QA 4OFIA 1SY6A 4FABL 1F4AA 5C7XL 3KHOA 3QG7L 4HKJA 3FQXA 3BPOB 3GBLA 3OX8B 5IT2H 1KJ2H 2ZOKA 2X1OA 4NZUH 4QXTB 1S5IL 4OUUA 5C0CD 3KJ6H 1F58L 4LF3B 1OP3K 3DV6B 5I74B 3REVB 2Q7YB 1T2QL 4J4PC 4XVUD 4PJBF 1MFBH 2AXGB 5I1DA 3GSVB 3VFSB 3IXTB 5E4EC 3QPQD 3U9PH 5B39A 3KLHD 5HY9A 1JGDA 1XF4A 3VRJA 4YFDB 3P4OA 1RZ8A 1XCQA 4U1LB 3MLRH 1AGDA 1PEZA 1F4YL 2V2XB 5GHWL 2R15A 4G42B 2HVJB 4NNPH 4LCCB 3CPLA 3QJHA 1I7UA 3WFZA 1NGXB 3WIHH 5MEOB 3QDMA 3VWJB 1EAPA 1P7QD 3HI6L 3JTTB 1QHPA 1CBVH 2AK4D 3OF6A 2JIXA 3QEHB 1KIPB 5JXAH 5EBLB 3GRWA 2YS4A 3S8WA 4ZFOA 3PDDA 1RULH 1C08B 4ZG1A 5L0QB 1YN6B 4P3DA 1SHMA 1TZGL 1YNTB 1YEJL 1KB5H 1ZA3A 3RA7L 2WBKA 3GNMH 2KKQA 3UJJH 3R1GL 4IIQC 3U0WH 2DDQL 1R3KB 4OGYH 3B9KD 1RU9L 3MGTB 1G7HB 4OJFH 4WTWA 1YEHL 1IL1B 4RFOL 5E6IC 4DKEH 5HI5D 5MENA 1A0QL 4YDIH 1OL0A 4JM2B 2O5ZH 3SE4C 3QHZL 1N0XL 3D0VB 3D18A 3KPSD 4OZHF 1DBMH 1T20A 2ADJA 4KZEL 4OV5A 1F2XK 2HFGL 1NC4B 1RJYB 5K9KB 4MJ4A 4BK4A 4PBWD 5DFTA 4QRSB 4LMQE 3P9MA 2FEEL 1Q0YH 2A38A 3KPOA 1RUQL 43C9A 2BVPB 2FGWL 4LHQB 2YKLH 4XX1E 5INCA 1JZ5A 3QCTH 4HXBL 5HHOB 2UV3A 2DWDB 5ENWA 3QCVL 2B1HL 1IGYB 3CSYA 4PG9A 4NQDE 4JN1L 4E0RB 4CMHC 3I50H 2VQ1B 1X5JA 3DO3A 2FX7H 2AEQH 2FX9H 4AEHH 3MLWH 1YZZA 2VLKB 3T0WA 5GGVL 4QXGH 4UBDC 5FYJL 2ZWLT 2HH0H 1CFSA 3SE9L 5MP6H 3F58H 1J5OL 1CGUA 3QH3A 1IKFH 1WLHA 3K81A 1QLEH 2VDNL 1KT2A 2DAVA 2R1XA 1C5CH 4HPOL 3OPZL 1OWWA 1LEGB 4TUKL 4KVNL 2HJFB 2G9HB 1MAML 4IIQA 1BX2A 1NCCH 1BD2A 4LLDA 1BIHA 2C3XA 3HA0A 5D70L 2NXZD 4GG6A 5E5MB 3IU3B 2P5WB 4KUCF 5DD1L 2VWEC 5E6IA 1TITA 4G5ZL 1LGVA 3S37X 3C60B 4TTGA 3H42H 4DGVH 1P7KA 3DXAA 4MA7L 4QOKA 3SE4A 3VXNB 4OIAA 4HK3J 5EU7E 5BQ7A 2X9WA 5E2WH 1KPRB 1KEML 1DANT 5T1MA 3X14B 4UB0L 4PD4K 3TA3D 2J8UF 3HB3C 3HFML 4LU5H 2X4QB 2LVEA 5TGBA 4HFUH 3V0WH 2YD5A 4H1LG 3BZDA 3IDIB 1DBKL 1GL4B 3ZYZA 2APTA 2APWA 5FYLH 5BV7L 1BVLA 4UAOC 2D0HA 2E7MA 2ENSA 2HLAA 4ELKB 5JOFA 4OQ1A 1AKJD 1T1ZB 4JPIB 3DUUA 5GISH 8CGTA 4N8CH 5CBAB 1AO7D 3GI9H 4XB7A 5DD3L 1A3LL 3QP3A 4MNQB 4PRIA 5KSBA 3OKDA 3EZJB 4D2NA 3MNVB 3TBWB 4H1LA 5CP7A 3ABZA 1Z5LB 2XN9D 3L95A 5I66A 4MXWL 4RMRA 3IKCB 1B0WA 2P5WE 3NCFB 3BHBA 3IYLW 2D03H 3T0EC 5L2JA 3KPMA 1IAMA 4MB4A 5KVFH 1CXLA 3QSKB 4PJGB 2DIJA 3MV7B 1N5YL 4WUUA 2VC2H 4IMLA 3MJ6A 4QRRB 4Z5RB 4PJIB 1FZMA 5ACZB 5IIEB 4RMWA 1CD8A 1ZHNA 2AS5M 4Y2DB 4XI5D 4FZ8L 3CDGA 1UWXH 3UTTD 4CBPA 3SCMB 4OSUL 1A9EB 1I85C 1ZVSA 5L8LB 1LDPL 3PWVB 5GS0D 3UBXB 5DS8B 2DQIL 3QA3B 4OIIL 1X5HA 2WQRA 1RUPH 4JO2L 4ELMA 5E9DB 3DRQB 2AJXH 3CSGA 5CMAA 4N0CC 2BOCB 1Z9SA 1BZ9A 4Z7NE 4X4XB 5DEGB 5D7KD 1E4XH 4W6XB 4ETYA 4QLRA 4UT9L 3K1DA 1DQLH 1UH4A 1AJ7L 3LKRB 3NIGF 4I3SL 1PZ5B 3QIUC 4L9DA 2Q76A 2W1NA 3FFCD 4TNVK 3MRBB 1DZBA 4WO4B 1OAXL 1H8OA 3GJFK 1T21A 5LCVH 2H6PB 2MNUA 3T65A 3PQYE 3MLXL 3O8XB 2PYEE 2EKJA 3VFRB 1L4IA 3U0TA 5IVNA 2G2RA 2Z31D 2HT4D 3LRGA 4UDTB 4HX1B 5IB3B 5L2KD 4R4ND 3T0EA 2HFEA 1NCBH 1LVEA 1WJ3A 4L3EB 4OLWL 5DQDL 2OCFD 2NMSA 1I7ZB 3ARFA 1CCZA 3PWPB 4WV1B 5D71H 4YNYA 4QXUH 3ZYOA 2XKSA 2NY4B 3QEQE 2OZ4A 1RURH 1ZLWH 7FABH 5IW1B 4HAFA 2UWEB 4TSAL 3DYMA 3I6LE 4PLOB 1XAUA 4XPAL 4MDIB 3MJ7B 4J8RB 5IM7B 1VFBB 4GG6F 1MLCB 1U8HA 3PABA 4XVJH 5ANME 2BSTA 3O2DA 4XC3L 3HKFA 1BIIB 5I1KH 1VADA 1WITA 1P53A 2VDQL 4ZSOA 1DCLA 3UYRL 1MCKA 2FSEA 3RUGE 2R2BB 1UXSB 4DVRL 4JO4L 1MLBA 5E99L 4GW4A 2JB6B 1BOYA 1GGYA 5I8CA 3QIUA 3MMEA 1IFHL 3HI1A 5H37H 4JLRB 4QKXB 5F6IC 4JO1L 3MACH 4M7ZC 3FONB 4RGNE 2H2SD 4J12A 5BRZB 4HWNA 1FVEB 1J0YA 3DYPA 5FKPB 1A4KB 3G04A 1NAKH 1MCWW 1ZWIB 3D25A 3LZFL 2ADFL 5DO2C 3NZ8B 5HYEA 4F7MA 4JR9H 1Q1JL 1JGVL 5HHNA 5KSBF 2CSPA 1RIUH 1HYSD 2NW3A 3KYMA 5CSZB 3U79A 5INDA 1IVLA 4PRAB 3C8KB 4U6TA 4PRBB 4HCRL 4P4KD 4ETQA 3WFHB 1TZHB 1X6NA 1BLNA 2I07A 1A1OB 3QG6A 5JIKA 1K4CA 2RAMA 4AZ8A 5HD8C 1JYNA 2CGRH 4A6YA 1ZT4A 3K2MC 4CRPA 3BN9C 3MRHB 1TJHH 1UENA 1RZ7H 3PJSB 4DZBB 3V6OC 5LKNA 1YMHB 3ULUF 2A77L 1SEBA 4JREB 3QFJA 4D0DA 5K9OB 3SJVE 3VD4A 4ZXBC 4KQ3L 5FA4A 1S7XB 3T2QA 1U3ZA 4WY7L 2F58L 4R90H 5EU5B 1T22B 4BQBA 3WIFB 1SYVB 4GOSA 5E2UH 1MJ8H 2ICEA 3BVNB 4DOHB 1U3HB 4M93B 1DJSA 1UM5H 3I6KA 2MHAA 3VDBA 1ZA6B 3CK0L 4X6DE 5ICYA 5IFAH 3EO0A 1HHKA 5DC0A 3S34H 3ECBB 4NQVA 3B2UD 3TVMC 1A6AB 1F97A 4OAWA 4J7RA 3O0RL 4LCWA 3BIKB 4H26A 4DW2L 4AG4H 3MR9B 1EH9A 2D9CA 5EZIL 3N1FC 4KAQH 2F15A 3S98A 1OWRM 1IRAY 3ZHDA 4X5WB 2R4RL 1YUHA 3IJYA 3LH2L 2F74A 1S7UA 3MLUH 2P5EB 5EA0L 3GI8L 3BESR 2GK2A 4R97C 5AG9A 3VG9C 4POZC 3R4DA 4LSQH 1BWWA 3UO1L 1ZGLP 1JGUH 1CICA 4EN3C 3CLFH 4ZYKA 3WUWG 3UPRA 1HH9A 1CLOL 4NO5A 3V6OA 1I4FA 3EOAB 4HV8B 3MLPA 4L1DA 4RFEA 1G7QB 1Z9MA 4ZXBA 2CLVA 2J8HA 4GBXD 3D3VB 1QSFA 4Y16D 2P8MA 3EW3B 3S4SB 2ITCB 2GHWB 1F42A 5DK0A 3ARDC 1XF5B 4OZGB 4GW5A 1QLFA 4R2GD 1J11A 5CEXA 1F8TL 4YX2H 3VFPA 4D8PA 5GGUA 3BUYB 4M62H 2W60B 4ODWB 2OJEB 3AAZB 1E6JL 1A7QL 2LAGB 1FAIL 1WICA 2F19L 2PW2B 5HYSG 2W0FA 5DGRA 2PO6C 1IAKA 5EUOB 2CDGA 2OXHA 5CHNB 1P1ZA 3NIDE 2DJUA 2ADGB 1PYWA 1OOAA 3TVMA 1WWBX 2V5MA 4U1HB 4Y8DC 1T4KA 1KELH 4UU9B 1IQDA 1FRGH 2ZOLB 5EORH 4QXWA 3OB8A 4I77H 3T4YA 2ZUUA 3HMWH 1AP2A 1M7DA 4AENA 2EICA 1JNLL 3VXMA 4ENED 2YRPA 1CFTB 3MBXH 4KK6D 1MCQA 4NRXA 2KZWA 5DXWA 3GMQA 2BHUA 4LKCB 3NFNA 2NPLX 4G80A 4X99B 1K3ZA 4LGPB 3TZVC 3QUXC 3ZDZF 1CVRA 3OGCA 2XPGB 1ULVA 1KCKA 2DRUA 4CUCA 5LG1A 2EE3A 1RK0A 3WKNA 4KTEL 4FXKA 3QYCA 5ISZE 1CTNA 3BKJH 4EN3A 4RIRA 3KWWB 2GCYA 2BHYA 4LSDA 4GXUM 3RWFB 4ZUUA 1IAIL 1M71B 3BP4A 1NBZA 4PJHA 4KJWC 1M6OB 1QNZH 1U2HA 2D31A 5B3JE 5BV7B 2DLFH 2VDPL 3ARDA 4E41B 3UP1A 3QUMA 1WZ1L 3EJJX 5FYJE 5KANG 1JZ4A 4WI9A 2DBJA 5GRJH 4BSWA 2CIKB 2IH1A 5C86A 1MQKL 3O4LA 1CXFA 4OKVA 4RZCA 4HKXB 2CD0A 1B90A 2VDRL 4QY8B 4X6CA 4I9WD 2PO6A 1QO3B 2UZIL 3WLBB 4MJIE 4PJCB 1MH5B 3RNKB 5FDYA 1YEKH 2FJFB 3LDBC 5CZVH 4C56E 1S7RA 4KI5D 4RWYH 4XPHL 2FH6A 2PYFA 4K94L 1I8KA 1ZVYA 3BP6B 5B3NA 3DETC 1A9BA 5TE6H 1D9KD 3CD4A 1IC4H 1W0WA 4U1MB 2IAND 2Z0BA 1WBYA 2A9MH 1DBJL 1AY1L 1K2DB 4S1QH 5CD3A 1D5MA 1MIMH 5IMMA 3RWCA 1EGJH 4M5ZH 5T33H 2HWZH 1X3DA 2EDTA 3TZVA 5BJTB 2R0ZL 3QUXA 1KJVA 3VE0A 3THML 4RGMC 1EHNA 3B9EA 1W0VA 4NQUA 5D5MB 3SPVA 4X7EC 4FQIH 1U9KA 4JANB 8FABA 4NCC1 2YPKA 4CW1B 2ICWB 1UC6A 3GSWB 3P0VL 3MO1B 4JM4L 4M6AA 1I1FB 4PRHE 1KTDB 1BF2A 1MHPH 4PD4J 4NQCD 4JY5H 3FQNB 1WZKA 3P30H 3QDJA 4HK0A 1MCBA 1N64H 3VI3F 4R8WH 4JPKH 4FNLL 2WSKA 1MCWM 1JNHA 4QHUA 4JQIH 3MYJA 4P2OB 4OCYL 4AM0A 5EIQA 5HTSA 5HYJB 2IFGA 1AIFA 2OTUB 1FNAA 4TNWF 2EDYA 4LDEB 1EXUB 1J8HB 1NFDE 5EC1B 3G5YB 1GXEA 3CZFB 4UZGA 1WAAA 3OB0K 5DURD 2DLIA 5FYKE 1H5BA 1MAKA 5CJ5A 3HNSH 2HG5A 5GGRY 4ZS7H 1EHXA 2BERA 4KK9D 5ESAB 5JPMB 4RMVA 1NSNL 5C0JB 2DQEL 4OFYA 3KXFD 3RDTC 5EC2B 1D7FA 4PRDB 1HIML 5HGHB 4GO6B 3STZB 3FZUC 1FVCB 3JV0A 4KKCC 2FO4B 4F37F 1QRNB 1TJIL 4PJ9D 3BAEH 1R5VA 3GMOA 1QYGL 3KLAA 4PRNB 1BQHA 4ZO6A 3ILQD 5HGDA 3HZYB 5B38G 4XPGH 2OK0H 1DLHB 3VWKB 1MEXH 5FFLA 1K4DB 1A4JB 2J6EL 1SBSH 3TBTB 5DUPL 1RFDL 4HS8L 2P24A 1SBBA 2NQCA 4NKOB 2AKRB 4TVPL 4MD5A 2I24N 2PCPB 3VXUE 5I17B 3OAYH 4Z76B 4NM4H 5DJAB 3DSNA 3BH8B 5DD0L 1MCFA 5B38A 4Z7UE 5MEQA 2BXYA 4QXTA 2I60L 3CVHH 3GIZH 1DUZB 5CS7A 4LF3A 2Q7YA 1KIQB 4XX1G 3TO4B 2AXGA 3GSVA 3QFDB 3VFSA 2HT2C 5J9PB 5FDWA 3HMXL 5EU7C 3SDDD 1A21A 1QVOB 2XIDA 1R3LA 1WIPA 1IEAA 3M1BB 4O00A 4U1LA 4BM7A 5C9JA 3JWDH 5HYQB 1U8QB 3OAUL 4G42A 4HIHB 4MJ6A 3D2UA 3VGAB 4NFBA 1CQKA 3TIEB 2AQ1A 3RDTA 5MEOA 5TQ2H 1AI1H 3HRZA 2NZ9C 5HVWA 2ARJB 1DQQB 2VZSA 2YUXA 1YPZF 1DVFB 1K8IB 5GRVK 1BBDL 1UZ8B 2WBJB 3OKNA 4LGSB 3QEHA 1KIPA 4G8FB 2ZUXA 5EBLA 4GKOA 1L0QA 4BZYA 1PVHA 5IHUH 1PQZB 1YNTA 4FZEH 3F6LA 2A6IA 4UT6L 1FNHA 1R3KA 4S1SH 1F3DH 1N7ML 1NH6A 3WN5B 3MGTA 1RJLA 1Q94B 1G7HA 5I1HH 3IKKA 1IL1A 4LCIH 4X6BB 4V1DB 1S8DB 5A3ID 3C60C 1H0DB 5SWZE 3WE6B 3ZTNH 2XA8H 1UACH 3KYKH 2NY2B 3BWAA 5M7QA 5JHLL 1DEDA 2OL3H 4MCYA 4CKVX 1NC4A 1NCNA 1RJYA 3OBAA 4N8VG 3LMJH 5K9KA 4BELD 5CUSH 1JFQL 4YDKH 4LVEA 2EDLA 4QRSA 3D9AH 4PR5B 5KZCD 1DQJA 1CLYL 2CR6A 1I1AB 4DN3L 4WI8A 2GI7A 2DWDA 2YK1L 2P47B 3MXWH 4ZTOL 5D6DC 2R2HA 1T7WA 4OZIF 1E4JA 4AQ1B 4MNHB 5H94B 4Y5YB 3QHFL 5F6HI 4E0RA 3WNPA 1U8OB 1GC1L 3LD8C 1WAAF 4DGYL 1A3QA 4UTBL 1U6AL 1MCIA 3C08H 1EHLL 2YMXL 3ZE2E 3O6LL 1C5DA 2UZYB 5DZLA 3L3HB 1OTTC 5I1IH 1X44A 3G5XB 4BZ2L 3NTCL 4H8WC 3FB5B 3RTQC 1MSPA 5TQ0L 4HHAB 3QAZB 1LP9E 4JRYB 3CAFA 3UTSB 1SQ2N 1N3NB 5IESL 3PDGA 1LEGA 3QDGB 2O5XL 4J6RL 2BXZA 2HJFA 2G9HA 1GHFL 1ONQB 4FTVE 1EV2E 1GYAA 2XICA 3HAEB 4PGDA 4WWKD 5E5MA 3GJEB 3IU3A 2P5WA 2BVOB 2YBRB 3ISWA 5F8RC 1AR1C 4JFDE 3C60A 3QQ4A 2AW2A 4MXVF 2PETA 5IQ7L 4OGXH 5JDSA 3VXNA 2EE2A 2BX5A 4AH2B 3WD5L 3K3QA 3H9YA 2WM0A 1KPRA 4G6AD 3RWIA 4OGAC 3X14A 4CJ0A 2R69L 2X4QA 2NY5L 4YO0B 4RNRA 5GJTH 5T3XL 4F80A 2EDJA 3W9DB 3PGDB 4LIQL 5HVHC 2X4UB 4I0CC 1BAFL 3S36H 4FQXD 5F3HA 3PF2A 1KXQE 4ELKA 3UYPA 3H9HB 2JB5L 4MAYB 4JPIA 5D1ZD 1HKFA 3ARGB 1MRCH 1B2WH 1IC1A 5D6DA 1OTUD 3IDYB 4N1CA 1CGVA 4MQXC 1KXVC 2NYYD 4PRPD 4JN2B 5FCUH 3CLEL 4H88L 1ETZA 2CUMA 1XIWD 3CFCH 3TBWA 4LNVA 4EQ2A 3O8XC 2FJGB 3IDMB 1Z5LA 5D8JL 3IKCA 1ZHLB 3RTQA 4M3JA 4G8IA 4NO2A 4XPFH 2ZUYA 3AXLA 4C83A 5H8DA 1MF2H 4QF1B 2NY3D 4PJGA 1OB1B 2EIDA 1CDIA 2LU7A 4QRRA 4PJIA 5ACZA 4I0KA 1G0XA 5IIEA 1YEDA 4Y2DA 2IGFH 2NY4C 2A9NL 1Q9KB 1GZQA 2YD4A 3SCMA 4MYWB 5CEZH 1A9EA 5MHSE 4UV4H 4Y4HB 3DX9A 4IS6B 5E1AB 2AJVL 3PWVA 5CLTA 5GGSB 5DS8A 1E27B 3QA3A 5E24E 4Q7DA 2WWKO 2LQRA 1B4RA 1HKLH 4JFZL 1A47A 3Q6GH 5C0CE 2ICCA 3RVVC 1G84A 3QEQA 4M48H 4PB9L 5JA9A 4JM2F 4QRQB 2CXKA 4BQCA 4OCXL 4NBYB 4M6ML 3GKWH 4X4XA 2W0KA 4Y5VB 5ANMA 1PSKH 3PWUB 4JDZB 3LKRA 1PZ5A 4U2ZA 5J6HB 4XC1H 1MFAH 2VERN 5TFSL 2AQ2A 5L7XL 3MRBA 4R26L 4QRTB 2IMMA 2H6PA 3VRLE 4MA1B 3BSZL 4P3WA 1A6UL 4KKAC 3O8XA 3RUGA 2AK4E 5TPWH 5E2VH 1CG9B 1CDCA 5E6ZA 2XKUA 4APQB 1JI2A 3HE6B 4HX1A 1OAQH 5F9JA 3RL2B 3FO0L 2QLVB 4L3EA 1TTUA 3ZDYE 3QQNA 1U8KB 4EXPX 5GGTH 3PWPA 4WI6A 4WV1A 4PPTA 1QBAA 1UKSA 3W2DH 3TT3H 1KACB 1K6QH 4XP5H 3P11L 1F3JB 1HSBA 3VW3L 3B2VH 1U8LB 3MRLB 1RZGB 2YC1B 1W72H 3MJ7A 4J8RA 3SQOH 4JREC 3I6GB 3KPSE 5IM7A 5KN5A 2XACC 4B50A 1MLCA 4XNXL 1KENL 4PP1D 2OP4L 1YEEL 1R5WB 3G5ZB 3TFKD 1F11A 3MRRB 2R56H 5DRWB 5KSAD 4G6ML 3SGJC 1S3KH 4KUCD 4LAQL 3DX6B 2R2BA 5HDLA 3AY4C 2BNQB 4HWEH 3LV3B 1HZHL 4NKDA 3TYFB 2DKMA 1MVUB 1WGOA 2JB6A 1JNNH 4WGWB 3AREB 3ZKXC 1U3JA 5T1LA 3MLZL 1KC5H 5CZXC 4WI5A 2WWKT 4EI5B 4GG8B 5BRZA 4DKAA 1D6EB 4LHUB 1NKOA 3LKNA 2X89A 1MCCA 1ZWIA 4ALAL 1JPSH 3TJHC 5JZ7D 4NO0B 3VGBA 4XP6H 5D7IE 3HC4L 4OZFH 1WC7B 4J3SA 4Z7NF 4JRWA 1IM9B 3C8KA 5GGRB 3Q5YA 2DMKA 1F6AB 4PRBA 1EEQA 4ORGA 1TZHA 5CEYB 4YEFA 1A1OA 1EBAA 3B3IB 5FUZH 1I7RB 4JO3L 3R06A 4O2FB 3MRHA 3EBAA 4YLQT 3TM6A 3BPLB 4D9LH 3KYNB 4KGJA 3F12B 4DZBA 4PJGF 1YMHA 1Z2KA 3EHBC 4PJIF 5K9OA 4IJ3B 3RI5F 3DVFA 2EDKA 3NA9H 5DUML 4UMGA 3QDMD 2NW2B 1HHHA 3BT2H 3FT3B 4WRLA 1AD0B 2IC2A 4O58H 1S7XA 2NNAB 1BFVL 3MA7B 3N0PB 2QSCL 4UTAH 1T22A 4D9QD 1N6QH 4OM0L 4ZPTA 4RSVA 1UZ6E 3OF6D 3VXOA 2VRAA 2J3SA 4G7YH 3S5LG 5FHBH 3L3IB 2Y7QB 3BVNA 4CVUA 4F7CB 4RISH 3HI5H 3SGJA 1FE8L 4NJ9L 3AY4A 1D5IH 2VXQH 1ZA6A 1LO3H 3GB7B 5D2LE 4N0UE 4GAJL 1FFOB 3DBXB 2LU3A 4N90D 2W38A 1AXTL 1IGIL 5DLML 1KCUL 4P2RB 5E56A 3CMOL 4KXZH 5IVOA 5L6YH 15C8H 1FO0L 1NGPH 1UM4L 5MEND 3MR9A 2XN9E 5FGCB 4QHLB 1GZPB 2IALA 3RHWF 2DTMH 4RGOH 3DVGA 3IDNB 5IP4A 3EKCA 4WI3A 3IDJB 5DZNA 3DVNA 1RUMH 3U0PA 1FGNH 1JVKA 3O6KL 4ORZC 3KDMB 3RU8H 3NABH 3EYSH 4F15B 1I3GH 4K8RL 5ADPH 4WI2A 4HH8A 3UTTE 4AEIH 1X7QB 2JK5B 5CP3H 4ZAKC 1T6WA 3FB6B 2FATH 2AEPL 3RWHB 3FO9B 3EOAA 4Q74A 4XP1H 3EO9L 2KL6A 1G7QA 4HUUA 3VH8G 5GRUH 3U9UA 2D7MA 3U30B 1U8PA 2MKLC 2I5YH 1WISA 4EQ3A 3RNQA 2V5TA 1KFAL 2UWEF 5ISZA 4OZGA 1L0XA 4KDWA 1VPOH 3GIVB 4ODTH 3IXAB 2H3NA 5D7KE 4K3EH 4DKDC 3BUYA 2A6KB 4WGVB 3F7RA 3AAZA 3DSFH 2DI9A 3QRGL 2K7QA 3AVEA 3NCMA 4UV7L 1UB5A 2PW2A 4YDVA 3ORJA 3F62A 5C0EB 1T7XA 4XNUH 5EUOA 5JO5A 5LWYH 1BD2D 2DQTH 1REIA 3NMEA 2MCPL 4MHHI 4ZUSB 4Q9QH 3O2VH 1RZFL 1RZKC 4OTXL 2NXYB 5E6ID 4AIZA 4UU9A 4NCC2 2DQDL 3T2OA 3V4VH 2ZOLA 1FNSL 3FN0H 3DXAD 3GSQB 4QOKD 3QJFA 2WNGA 1I1RA 5ITBH 3MX0A 3GMPB 1XGTA 5HI3C 5IT2L 1KJ2L 4NZUL 4C56A 2G5BB 4X99A 4LKCA 2JCCE 3KJ6L 3NCYP 3EGSA 3S96B 4NN7B 3OXSB 5B22A 1MFBL 4LCUB 3U9PL 4EDWH 4ZAKA 2D7OA 4IOIB 3KWWA 1PKQB 2E7BA 3L6FB 3MLRL 4JEGB 1KN2H 2V2WB 1MNUH 4F3FA 1MJJB 1DLFH 4PRID 5D1QB 4NNPL 3QDHA 4U7SA 2COQA 4Z7VE 3WIHL 1V3KA 1K8DA 3WNKA 4UBDD 4D0CB 4E41A 3BXNB 3WIIH 5EBMB 1PY4A 4FFZH 2PN5A 1CBVL 3TH4T 2EKSB 2CIKA 4CN1A 1T80A 3L7FB 1HE7A 4MAUH 1LE5B 5AYQA 5JXAL 4P99A 1DDHB 1RULL 4QY8A 2X9YA 1NFKA 4WUUD 3ULUD 1KB5L 1UJ3C 1D6VH 2ATPB 5FHAH 2I9TA 3GNML 3U0WL 3UJJL 2R8SH 4OGYL 4L3CA 2FJFA 3IVKB 4OJFL 2EEDA 5I0DA 3LKQB 4MJ5A 3BP6A 4DKEL 4YDIL 2JJTC 3S3PA 2YPLE 2DM7A 1Z3GH 2O5ZL 3H7BB 3M45A 1M1SA 2NLJA 3HB3D 1QHOA 1PKQE 1T0MA 3WBDA 1DBML 1K2DA 2Y06H 2RCSH 1X9QA 5T3XE 4TNVF 2GSIA 5IVXB 5BJTA 1A6VH 4S2SB 5D5MA 1LE9A 2QEJA 2R0WH 2ZPKH 4JANA 5HVGB 1T1WB 1Q0YL 3QWRA 4CW1A 3HE7C 5FXCH 4OD1H 2HJLB 2YKLL 1S78C 3QCTL 5BOZG 3T77A 1EMTH 1JHLH 2V9TA 2AJZB 2FO1A 3RKDC 3D39B 5HI4D 1RHHB 3I50L 2FX7L 4MQ7B 2AEQL 4P9HH 2FX9L 4AEHL 3MLWL 5KOVC 1U8JB 1GGTA 4LSVH 3D1MC 4QXGL 5HYJA 2XI9A 1KG0A 2HH0L 3NCJH 5MP6L 2JE8A 3EYQD 3F58L 4ZO9A 4GRWB 3T0ED 4GJTB 3TO4C 1IKFL 3U7YH 1QLEL 5EC1A 3G5YA 1NEUA 2PNDA 4OZGF 1C5CL 3ARFD 3VMPA 2EIZB 1R3JB 5C0NC 1NCCL 4U1JA 2FECI 1OD9A 3PV7A 3VA2C 5JPMA 1CF8H 1JV5B 3T3ME 5EC2A 4PRDA 3MNZB 3EAKA 3QXAB 1AFVH 5HGHA 5EUOF 2WK2A 2DD8H 3H42L 2JJTA 4DGVL 3STZA 1FVCA 2FO4A 1ZAGA 2WBJC 5E2WL 5FOBB 3G08B 4RAUB 2VISA 2WV3A 1NANH 2HJKB 1RIHH 4LU5L 5J0BA 4HFUL 3V0WL 3CCHB 3RL1A 1FP5A 1DLHA 4N0CD 5F7YC 1C7SA 3BW9B 5FYLL 1K4DA 1A4JA 3CFBA 2CJUH 1QG3A 3TBTA 5IB4B 2VLRB 3U46B 1V7MH 1FL5A 1DR9A 5CSGA 4NKOA 5GISL 4E5XB 4N8CL 3GI9L 5TDPA 5CLWA 7CGTA 1MWAH 5JHDB 3WS6C 2YWZA 4TSBH 5DJAA 3WL9B 3BH8A 1QRKA 1RZIB 1HK6A 2NY2C 4JB9H 3S97C 2OMBA 4XGZB 1LDSA 3M17A 4HJ0D 1DUZA 3OKKB 4WWID 5IG7B 3TO4A 5SWZA 1N4XH 3QFDA 2D03L 5J9PA 5F89B 5KAQF 1I1AC 5EU6B 5KVFL 3M1BA 2BSED 2WIMA 2X4NB 3IDXH 4X83A 4X7SH 1U8IA 2AV7B 2VC2L 4ZQKB 3U4BH 3WFEH 3QWOB 4EUPG 1U8QA 4Y5YC 4GXUN 4HIHA 4XCYA 3MC0A 5CINH 4BZ1H 4HXAH 3LRHA 1DANU 3WDIA 4C58B 4ODXA 3QFJD 4PJCF 1DVFA 3SKNB 1K8IA 5EN2A 4HCRA 4OLEA 4B7LA 2WBJA 2VLRE 1RUPL 3X11A 3QAZC 2GITB 1PQZA 2AJXL 5I1EH 1NFIB 2X2YA 2J2ZA 1E4XL 1Q94A 1V3JA 4F2MB 3NVQA 4GT7A 1DQLL 1FORH 1EJOH 4X6BA 3BJLA 4V1DA 4HSQA 1EEYA 5D5MF 4KKBD 1UG9A 1MCOH 1MAJA 2XFXB 1HCFX 3N1PC 3WS6A 5F7EH 4LCWD 5LCVL 1ZGLM 1S9KC 2VYRE 2ARWA 4YIQB 3DMMB 4UI2A 3C09B 4GMSH 4P57A 2AABH 5DO2D 5ELIA 3UJIH 4PR5A 1OAYH 1ODAA 4XXDB 4U31A 1I1AA 2R4SH 1NCBL 3OZ9H 5KTEH 1ED3A 3MRCB 2ZG3A 3L9RA 3IDYC 5D71L 5I30H 4HLJA 5H94A 4U49A 4R96B 4Y5YA 4QXUL 4KI5E 5HD8D 3GSUB 4Z0XB 4FS0A 1U8OA 3LRSB 1CICD 3BN9D 1KUMA 1NCWH 1RURL 7FABL 3LQAH 4YBLB 5CD5C 4M7KH 2X5PA 3AMLA 4ZXBD 2W92A 4PBXA 3L3HA 3OJ2C 1QSFD 3G5XA 1Q0XH 5GRZA 3FB5A 4XVJL 3OXRB 4OGZA 2DLEA 3H9SB 1EUUA 3X3GH 4HHAA 4JRYA 5FM8A 3UTSA 5BS0E 5I1KL 4M1CC 2FD6H 1N3NA 3DUSA 3QB7C 3QDGA 1J87A 3ZL4H 1TMCB 4UQ3B 1ONQA 2OS7A 3PL6C 3MLSH 2PXYD 3GJEA 4WUKH 2BVOA 4Z9KB 1LWRA 5GRWA 3VXPB 2Y23A 4NHCH 5I71B 3TVMD 1JF1B 1J8KA 1G6RH 3MACL 4AH2A 1CLZH 3WFBH 4C57C 1MRDH 4R0LB 4UQ2A 1NAKL 4YO0A 5KJRH 5HI5C 3KPTA 4JR9L 3FOLB 1PFCA 3VXMD 1RIUL 3DX7A 4MCZB 5GJSH 5CCKH 4K94C 4KTDH 4YHIB 4POZD 4I5BA 3KXFE 3QUYB 3WHE0 4JN2A 4JVWA 2BNRB 2LVCA 3SKJH 4EN3D 2CGRL 2AK1H 4KRPB 2HFTA 5EO0A 1TJHL 3G6JE 1RZ7L 1KJ2B 4HG4K 2FJGA 2BVTA 4XVTH 1PAMA 4LLVB 3IDMA 4GKZB 5AWNH 4YHNB 2CRZA 3M07A 3IAGC 2A0LD 2VQTA 3HCVB 2GSGB 3ETBF 3TH3T 4HWBH 3HE6C 5I15H 4BFIB 3AB0B 4QO1A 4J3XA 4R90L 2BVEA 4NBXB 4P5TB 4QF1A 4ACPA 2FB4H 5DMGD 1OB1A 3BPNB 2BOBB 1MJ8L 4U7KA 3O4LD 2AK4A 2VDMH 4XMPH 5E2UL 2VL5B 3PL6A 3ULVH 1NGQH 4H0IA 1UM5L 4BA8A 2PO6D 4H25B 4NP4H 4FQ1H 5DHYB 5IFAL 5GSRB 5DSCA 4BSJA 4K9EH 5E1AA 2VLLB 3FHAA 4IRJB 3S34L 3OJDB 1A7BA 5GGSA 1OAUH 4L4TE 1E27A 4KKNA 2NXZC 3VCLB 3O3AB 4WHTB 1SEQH 4AG4L 5F93C 3QUKA 2XTJD 4EXKA 3AM8C 4KAQL 3SDXE 1KB5B 4QRQA 1JUFB 2YZ8A 4PY8J 3NIFF 1NBQA 4H0GA 3GGWB 4PS4H 4PFEA 1JP5A 1B6UA 3S35X 3TZVD 4OCLC 1JGLH 3QUXD 3MLUL 1IZKA 1K5NB 3AREC 4PJ7E 3HS0B 4LSQL 3FB8A 2V2TB 4EI5C 1JGUL 3CLFL 4Z7QE 1KNOB 5HSFA 4M7JH 2WUCH 4XBGB 5H35B 2ENYA 3MUHL 3QDJD 2EECA 3HE6A 3LVEA 3RL2A 2IH3B 3VFMB 2FEEI 3DWTA 3BEWB 1N0LA 1ZVHA 5J56B 1H3WM 1U8KA 1RJZB 4YX2L 4NHUB 3VXSB 1WWWX 4M62L 5D7IA 1UYWH 2WIIB 1F3JA 4JKPH 4WJ5B 3VD5A 4FP8H 1U8LA 1A1NB 3ZE0E 2L7JA 4M8VA 2YC1A 2UVEA 1P9MC 4X7DC 4ZTPH 4PG2C 1BVKA 4OFYD 3FQWB 2CKNA 4XI5C 1KELL 3BZ4B 3BN3B 3DETD 1FRGL 1MPAH 5BOPA 5C07B 1MHHA 4XBPB 5EORL 1R5WA 4WHDA 2XZZA 4RDQF 3P2TA 1RJCA 1M7IA 4I77L 3BP7B 3EDFA 3RGVC 3AM8A 3HMWL 4WW2B 1ZLWK 2Y5TB 4RAVA 4CL7A 3CIQA 4FXGB 2H8PB 1JTPA 3MBXL 4WFFE 1U2CA 2BNQA 3LV3A 3TYFA 4NNYA 4K2UH 4ISVA 4KROB 2X1WL 2AJYH 3AREA 1EUTA 2Q7NA 1L7IH 1XF3B 5C6TH 1JTOA 3RY5A 1S7QB 4EI5A 3BKJL 1OCWH 4X6EB 4A6YH 4QTHB 5B8CC 1H3GA 3VXSE 1TDQA 3FHQA 4NO0A 1FBIH 5D2LA 2J7LA 1QNZL 4YXKH 1WC7A 4BFGA 5J12C 4KJQC 2DLFL 2J6EA 2PKDA 4ZDHA 2WQ8A 3GUTB 3GSXB 3P4MA 3QCUH 1P84J 1QFHA 3QQ3B 4F15C 4YXLH 5CEYA 5GRJL 4FFVC 3IFLH 3UJTH 5FUCE 1H9VA 1S9XB 1I7RA 1IEBB 4YAQB 4O2FA 4XRCB 5D93B 4NSKB 1CL7H 3L3DB 3KYNA 4U1GB 3F12A 4MWFA 5FA3A 1KJ3H 4ZS6D 1FJ1A 1JWUB 5I19H 1P9MA 3MRNB 3D2UD 1N6UA 4PG2A 1YEKL 2FHFA 3RDTD 3U30C 5CZVL 2NW2A 3FT3A 4ZPVB 3U36A 1AD0A 4RWYL 2VLJE 5JW5B 3IS1X 3MA7A 4X6FA 4M4PA 3HMXA 5TE6L 3RIAF 3LKPB 3FZUD 1IC4L 4U1IA 4YDJA 4KKCD 3RGVA 3V8OA 3L3IA 4F7CA 1N8ZB 2A9ML 4FQQA 4S1QL 3O2WH 1MIML 1GC1C 1EGJL 4M5ZL 5E2JA 1XGQB 3LY6A 5T33L 2HWZL 3GB7A 4JFEB 4PRPE 3VD7A 2O5YH 5DRZA 1FFOA 5HGBA 1UEYA 4FQIL 4OZ4B 1JCKA 4KRNA 1OVZA 3DPBA 4JFXB 2IBZX 2ICWI 1C7TA 5D72H 5B8CA 4M7LT 4P46B 1MHPL 4PJBE 2WAHA 3VFOA 4V2CB 1GZPA 4JY5L 3OL2A 4HUNB 1Z9OA 3JZ7A 1FZJB 3IDNA 4LEXH 5IJVB 5KVGH 3P30L 2XWTB 5FO8B 3IDJA 1E6OH 1N64L 4R8WL 4JPKL 1NC4D 2HT3D 4JQIL 1T0NB 3V5DB 3H0TB 35C8H 5BZDB 1WTGT 5TDNB 4TSCH 1ZHKA 2HT2D 3VRIB 4JQVC 3EDKA 1P6FA 5C3TA 5HHOD 1HYSC 3RWGA 4F57H 4BH8B 1B0GB 3FO9A 3HNSL 3ARBB 4ZS7L 2NY5C 3I9GH 1KTKE 5D1QC 2XG4A 1MREH 4JFFB 2NZ9D 4JAMB 2QKIB 4PGCB 1HXMB 5DRNB 2ARJQ 1NCUA 3GIVA 3H9ZA 5EFIB 3T2PA 4D9RD 1QZ1A 3IXAA 3KPRB 2ZUTA 3SE8H 3MBEC 2A6KA 4LPUA 2JKXA 3BAEL 5D7JC 1JK8B 2BCKB 4DVBB 4XPGL 2OK0L 5CJ8A 4OZHE 4Q9RH 1XGRB 1MEXL 2Y36H 3P9LB 3CDCA 3MRKB 3HRPA 1SBSL 2P5WD 1KYOJ 5HHXH 4HS3A 5T5NG 3C60D 1J7VR 3Q5OA 3T4AB 2HMID 2H26B 4NM4L 1Y18A 4YH6A 2DQCH 1MY7A 5HJ3B 1AGFA 4UOW0 4PTUB 1RK1B 4YC2B 3CVHL 3PWJB 3QUMH 3GIZL 5J1SC 3S96A 1WT5A 3OXSA 3PGCB 1EEUA 4X9HA 4JQVA 1DN2A 1QSEE 4Y19B 4LCUA 4FHBD 3GFUA 1QFWH 2YPLA 5BXFA 2QR0A 3E6HB 3NZHH 3GM0A 2H1PH 1PKQA 2NY1C 4O51B 3IDUA 4NC2B 4HC1H 1FG2B 3VDCA 1N26A 3OAZK 3JWDL 1S7WB 1MJJA 3REWB 5FM4A 5D1QA 3WNOA 1LK2B 2C3WA 1P7HL 1AXSB 2NX5B 3IT8D 5TQ2L 1AI1L 5EULV 4D0CA 4AMKH 3BXNA 2ZNWA 1CGYA 1OTTD 3HC3H 3TO2B 5K9QI 5F1SA 3ARPA 2EKSA 5CSBA 4O2EB 4GBXC 5IWLC 3L7FA 3MBEA 4QWWC 5C09E 4HUMB 1LE5A 4YHYC 3DARA 1LHZA 1I9IH 5D7JA 2Q87A 4OF3A 1WIOA 2B20A 2X6MA 2OR7A 5IHUL 1CE1H 2AXJA 4FZEL 1IBGH 1ORQB 4QRRD 2ATPA 2Z8RA 2J8UE 5ID0B 4Y2DD 1XR8B 4S1SL 3TPKA 4JKWA 1U95B 3SCMD 5I1HL 3FMGH 3U82B 1AR1D 3LKQA 1UB6B 4LCIL 3MRPA 1AHWB 1UH3A 3V0AC 4S1RH 5F88B 2BVQB 1FL3B 2E9IA 4I13B 3H7BA 3ZTNL 2XA8L 1UACL 1U93B 1AD9B 3KYKL 2B1AH 1X5IA 1MJUH 3EDEA 3UTZA 3QEQD 2OL3L 3RWDA 4UIMB 4LLMB 3LMJL 2ZKHH 1Q9LA 3I6LD 4OCRH 2DYPB 5LGHH 5CUSL 2HTKC 4GUPB 4S2SA 4YDKL 1HNFA 4YPGB 4D0BB 4P4RB 4L9LB 2MQCA 3D9AL 4FQPA 4HUXB 1T1WA 5FECB 4G43B 4ENEC 2UUDH 4U6YA 2P44B 2HJLA 1HYRC 2VUOA 4NZRH 3MXWL 1VACB 4X0KA 2L7UA 2AJZA 4MQXD 2H32H 2D3VA 3O3DB 3QDME 3D39A 3WNMA 4WO4D 1HQ4B 1T83C 4MQ7A 1H3UA 1T04B 1NGYA 4D9QE 1U8JA 2V9RA 3O8XD 3C08L 3X3FH 4JFQB 2CIIB 3P73B 4G9FB 4PLJD 3UZQA 1NDMB 5I1IL 4JY6B 2IJ0C 2ZUSA 4GBXA 1NUFA 5IWLA 4NUJB 3U4AA 5EO1B 1INDH 3QRFM 5F21B 4KY1H 4L3ED 4PY7A 2CKBH 1J1PH 3GK8H 3PWPD 4N90E 4X9FA 3V8CA 4G8GB 2QSVA 4MVBC 2EIZA 4HG4J 1SJVA 4ZUWA 2NY4D 1TVHB 5ESVB 3ESUF 1II4E 1JV5A 5EU4B 3O4OB 3MNZA 3QXAA 2P48B 2YZ1A 1WFNA 4X4YB 1OARH 2F5AH 4OGXL 4KK5C 2NY7H 5F70A 5LGJB 1ZMYA 3NIGE 4RAUA 2HJKA 1A7OH 5F7MC 5GJTL 1VGEH 1D9KC 4YHLH 3IGAA 1AKJB 5CJOH 1YJDH 3S36L 4JZJC 2GJ6B 3MRJB 4I0PC 1AO7B 4LARH 1U8MA 2VLRA 3U46A 1MRCL 3QUZB 1B2WL 4NN5B 2ED8A 5T1LD 5FCUL 1TNNA 1KTLB 1T83A 3WL9A 3V6FA 5BRZD 4Y4FB 3CFCL 3C6LB 4KKAD 4PJXB 3RIFF 5IUSA 2X89D 3KJ4C 4G8GE 4WU5B 4XGZA 2KPNA 4L8SB 2CQVA 2QJDA 3O41A 3TWCH 2CLRB 1BZ7A 1MCJA 3OKKA 4MNGB 3E1F1 3DLQR 4XPFL 5F89A 2ZSWA 5EU6A 1TXKA 1MF2L 5CFHA 4GG6E 2X4NA 1CDJA 5KBNC 5JORB 3QWOA 1INQB 2E8YA 1I1CA 2IGFL 5SX4I 1IAII 2EDEA 4QOKE 3ES6B 5CEZL 4NYLB 3NPZB 4UV4L 2ID5A 1OSZB 1KLUB 2XZAH 3OKLB 4KK9C 4LQFH 4K8RC 5JW4R 2HRLA 1CU4H 1HKLL 3Q6GL 2QADB 4JFPA 3TBYB 4M48L 1FSKB 5C0BB 4UIKH 5B4MD 1PG7W 3BEVB 3B5HA 4EDXB 2VAJA 2VABB 1U3HD 1NFIA 1H8SA 4EIZC 4LVOB 5DVOA 3GKWL 5JW3H 1CD1B 4I0PA 4F2MA 1JJUA 3FFCB 1PSKL 1Y0LB 1RMFH 1Z0NA 5IVXF 4DZ8A 4IOFC 4PRIE 3RFZC 4XC1L 1MFAL 1TQBB 5GSVB 3P4NA 5BS0A 2F8OA 3VXQB 3W5MA 1JNJA 1A1MA 1HOCB 2XFXA 1PKOA 5CZXD 3SGDH 3QNXA 4L8DB 1AXIB 2AP2A 3LN4B 1VFUA 3QNZA 2Z31B 4ZFZB 4HEME 3TJHD 5TPWL 2WZPD 5E2VL 2M1KA 2YHGA 4U1KA 2VSCA 5L2KB 5TH2B 4U1SB 3LEXB 4LSUH 5JQHC 1VEOA 1R0AH 2Z93B 1OAQL 4WUUE 3ULUE 5LAXB 4XXDA 2Y07H 1ZE3C 1FO0A 1NEZB 4YDLB 4JDVB 2RQ8A 5GGTL 2VWEE 4RRPA 3W2DL 3TT3L 5BVJB 1SVZA 4R96A 4GRWF 3GSUA 4NPYB 1G6VK 1K6QL 3LRSA 4LSRH 4XP5L 5D2NB 3SY0B 5DMYA 4YK4B 3SDDC 5JOPE 2N56A 3B2VL 1X4YA 3MLYH 1W72L 2P7TA 1Z9LA 4WW1B 3SQOL 3Q3GB 1BPVA 3MSPA 4KV5F 4TNWK 2Y25A 1ADQH 1F3RB 1JZ3A 3OXRA 3AB0C 3H9SA 5ISZD 3ROOB 4YHPB 2IBZY 4P5TC 1V7NH 2A74B 5JW4M 5DVMA 2R56L 4L4VB 3G6JA 1UWEH 3BPNC 3SGEI 5GZOC 4J2XA 4O02H 4KHTH 3I2CH 2W59A 1S3KL 3F7YB 1EJ6A 3N9GH 2GTWA 4HWEL 3MREB 3UXFA 1ZK9A 2G5RA 3MCG1 4I4WB 1P5UA 3VXPA 1JNNL 5DUBB 3HPLB 4QHNA 2BVYA 5FYJD 1NDGA 3DV4A 5AD0A 3B5GA 1JF1A 3ARSA 5C8JB 1EO7A 1MCPH 5J4MA 4G6KH 4GAGH 4RA0C 4GMTH 1KC5L 2DM2A 1DUYB 4F37K 4RMUA 2Z8VC 5EZLB 1GSMA 4F8QA 1B6DA 1JPSL 4LGRB 4KHXH 2P45B 5D2NE 1I8MB 4XP6L 1VESA 4KUZH 3UPAA 2NR6C 3LSOB 3R0MA 4JFHD 4MA3A 1HHIB 4P4KB 1RV6X 3P77B 3EFFA 4C56D 4L4TA 4MCZA 3O81A 4WEBH 3FO1A 4N5ED 2C3VB 3WV0A 4NZDA 2V7NB 4CMMB 3K0WA 2GKIA 3RBSA 4YHIA 3QUYA 5FUZL 5DI8B 4ZAKD 5DJ0B 4R7DB 3DUHA 4D9LL 4Y1AB 1K3IA 1YEFH 1KJ2A 4ZD3H 1NPUA 3MV9B 4LLVA 1JN6B 4GKZA 4YHNA 4CNIB 4M00A 3CVHB 3NA9L 1Y6NR 3VFUB 3HCVA 2GSGA 4DTGH 4OF8A 2IEPA 4UUJB 3BT2L 1CGSH 1MRFH 4ZSOE 4BFIA 4O58L 5F9WC 4PJ7A 4E41D 5ETUB 4N1HB 2HA1A 1HH6B 4UTAL 4P5TA 1N6QL 5GS3A 1X5YA 2GFBB 4G7YL 4NN6B 5FHBL 3W0WB 2E9BA 1A7RH 4RISL 2IWGA 3HI5L 2J88H 4JJ5B 1QSVA 3OSKA 1D5IL 2VXQL 2JELH 3I02B 3WIHA 4H25A 5L9DH 1LO3L 5DHYA 3LPFA 5GSRA 4Z7WB 1IGTB 1C16B 4HT1H 4LP4A 4HWZB 3VCLA 1T1YB 3ZTJH 5ICZB 3O3AA 4WWKC 3PDOB 3ZDZE 5L6YL 2IAMB 15C8L 5FUCC 1IGJA 1NGPL 1YYLH 3VGGA 2DTML 4RGOL 3MNWB 5K33A 2X05A 4BJLA 1KB5A 1JUFA 5HI3D 5D6CB 4Q6IB 4HBCH 3GGWA 1RUML 2BC4B 1FGNL 5JNYB 4R7NA 3RU8L 4XZUA 3NABL 1NQBA 3EYSL 1DEEB 1I3GL 5ADPL 1X5LA 5DHXB 3SE3C 4HJGB 4DKFH 3QWRD 3HS0A 4FQXC 4I3RH 4AEIL 1KCVH 3NFSH 2X1PA 1VSCA 2V2TA 3SKOB 3WDJA 2EDQA 2FATL 5D7LB 3BD4A 1KNOA 1WBXB 1A7PH 2OL3B 4XP1L 2X7LA 4XBGA 4MDJB 3EIFA 3GDBA 5GRUL 3H6JA 4WTZG 2NYYC 3RZWA 4HIJA 4KJYA 2I5YL 1XIWC 2NY0B 3K46A 3VXRB 2Q20A 5DQJA 5HYJD 5A43C 3VFMA 3KPLA 1JPTH 1L0YA 1VPOL 3LIZH 1FDLH 4PJ8C 4ODTL 1RJZA 3EYFB 4NHUA 3VXSA 3MRFB 4K3EL 3NN8B 3PE9A 4LSSH 3DSFL 1WWCA 4XNQB 4XPTH 1CK0H 2WIIA 3A6CH 3ZKQD 2VJXA 2VOTA 4WJ5A 4U1GC 1A1NA 3PXJA 4XNUL 4WTZA 4YR6B 5LWYL 4PV9B 2DMBA 2DQTL 4LCWE 3RVUD 3ZO0A 1HXYA 2ZCHH 4Q9QL 1ZEAH 4FG6D 3O2VL 1A14H 4WWKA 3BZ4A 3V4VL 5HGGS 5C07A 4XBPA 3FN0L 4LVNB 4BUGA 5HDOA 4CVZB 4NQEB 4LKXA 4X98B 5GPRA 4WW2A 2Y5TA 1A22B 1FGVH 3VU2A 5ITBL 3EYUH 4HGMA 3D69A 4FXGA 1Z0MA 2H8PA 4BSVB 4OD3H 3OQ3B 1AGBA 4LFHG 5E00A 4NKMB 3VWKD 1LEKB 2VLJA 3BRFA 1QPXA 3VI3E 3D85B 3T0AA 3SE3A 2GAZB 5IVZB 4FQXA 3V6OE 3VXRE 3S6CA 4NC0B 3F7VA 3GHBH 1NAMB 3GHEH 4EDWL 1S78D 1S7QA 4F58H 4XNYH 4QTHA 2RHEA 4P46C 1QSFE 4DK3A 1W8NA 1KN2L 1OLZA 1MNUL 3MGAA 1DLFL 4W4OC 1YY8A 2WMPA 2R23A 5LGKA 1WCBB 2MOVA 2SEBB 3WO4B 2E6QA 2BSSB 2XTLA 3WIIL 3T8XA 3GSXA 2W9EH 3QO0A 1FPTH 4FFZL 4PJ8A 3QQ3A 3TO4D 4PJBA 4RA3A 5SWZD 1DBAH 4MAUL 1ORSA 4YAQA 4XRCA 5SWSB 4NSKA 3L3DA 1QLRB 1D6VL 5C0ND 3OV6A 3U7WH 5FHAL 2A73B 1JWUA 4XNZB 4ONOA 4YZFF 2R8SL 3MRNA 3JUYA 1FYTB 1VKXB 4XP9H 4TULH 2X4PB 4ZPVA 5JW5A 2IANB 1M05B 1DVFD 2Z91A 3LKPA 5T1KB 2WBJD 1Z3GL 3Q0HA 3GJFH 3F8UB 1N8ZA 4KZDH 3BWUC 1J0HA 2Y06L 5F7DB 1URLA 2RCSL 6FABH 5I16B 5F6HJ 4GAFB 4JKKA 5F7LB 4U3XA 3TFKC 4JFEA 1A6VL 5IEKB 5HPMB 2R0WL 2ZPKL 5KSAC 1WQVT 4NQCB 4JFXA 3I85A 1CR9H 4OD1L 1Q9OB 4V1DD 2OTWB 1EMTL 1JHLL 4P46A 4NRZB 1XGUB 3MLTA 1CGXA 5HDBF 4W4OA 5ICXB 5IJVA 5FO8A 2XWTA 3V5HB 2NY2D 2Y6SC 3GSNA 4P9HL 1CDBA 4IEFB 4OZHA 4JQXC 1TVBB 1KB9J 3BDBA 2ZUQB 2EDRA 3MV01 4LSVL 1T0NA 1DQDH 3IU4H 1R24B 2XWJB 3V5DA 3HZVB 3H0TA 3NCJL 1FYTE 3MUJA 5JZ7C 3WFCH 1KV3A 4I1NB 3FT2B 3VRIA 3U7YL 1I1AD 1QACA 1YPZE 4QYOB 3L7EB 3P9WB 1FN4B 2DQHH 3WCYA 1QSZA 3ARBA 3ARWA 4NOFA 1NMBH 3Q6FB 4XCCH 1CF8L 2XTJE 5EO9A 3SKUD 1QSEA 4BFBD 1AFVL 4PGCA 1HXMA 4WVRA 5DRNA 1QFUH 5GS2D 4Y5XC 5AUMB 2DD8L 2VAAB 5KSVB 4HIIB 1S7SB 2CH8A 2B5IB 4MXQC 3KPRA 3NCYS 5I1GH 1OGAE 2XRAH 3DGGB 2VZVA 4JRYD 3UTSD 1RIHL 3C5ZC 1JK8A 1V8HA 4NGHH 4AT6B 4DVBA 3QDGD 4MD0B 3QEGH 2DQUH 4OLVH 3QQ9C 5KSUA 2KBGA 4WW2F 5LBSH 1XGRA 1A7NH 1W72B 3P9LA 4UDUA 5KSAA 2CO7B 2DI8A 2CJUL 5C0FB 3ME0A 5HHPB 5H37G 1OF2B 5C09A 1V7ML 5C0AE 1BJ1J 1AH1A 1YDPA 4KFZC 3QDJE 3SN6N 5I73C 4S11A 5DK2B 2X4TB 4G6JH 2H26A 4DGIH 2D2OA 3ARVA 1MWAL 1J0ZA 4U7MA 4TSBL 1P6AB 4JQXA 4GXVH 4JB9L 4PREB 1NLBH 5HJ3A 1NL0H 4OZIE 3QIBB 3C6SA 1RK1A 4Y88A 1CT8B 1MCLA 5KVDH 5MHSD 3PWJA 1GGBH 4GW1B 4LRNH 1QR1B 3EYVB 1WAAE 2VR4A 5D7SH 5IFJA 3MRQB 1N4XL 3O6FB 4Y19A 1C8PA 4HD9A 5FF6B 3E6HA 4JG0H 4BQ6A 1ZHBB 3IDXL 1P2CB 1JZ6A 4X7SL 3U4BL 1S7WA 3WFEL 1A64A 2YSSB 1LNUB 1AXSA 2NX5A 4J3OC 2X42A 1YN7B 4OZFB 5CD5D 2ESVB 2ZP0T 1RZKH 5CINL 4BZ1L 1QKZH 4HXAL 4JFOB 4Y5XA 5BO1H 3V4PH 3TO2A 3EO1B 5FYKH 4PLNC 5SX5H 4O2EA 2XOTA 5IMKB 1V05A 3F7PC 4MXVE 5F1OB 3UTQB 2QQKH 4M1CD 3C5ZA 5IKCA 3WS3A 2HRPH 2OR9H 5I1EL 1G9NH 5ID0A 1FLRH 3PL6D 4FQHB 1XR8A 3BYYA 1OP5H 5DEFB 3RI5K 4U3CA 5H2BA 2WBWB 4KK8C 3O4OC 1FORL 1EJOL 4XMKH 5F88A 1MCOL 2BVQA 1FL3A 2AJUH 2A6DB 4LP5A 5F7EL 1AD9A 1GGIH 4TRPH 1TPXB 1D5ZA 4I48B 2YN5A 4QHMB 4UIMA 2YD1A 4LLMA 2AABL 5DC9B 2DIAA 1F4HA 2DYPA 4GUPA 4IDLA 2EDHA 4DN4H 2VXSH 3UJIL 2VQUA 1OAYL 4BK5A 1CD9B 1J10A 4HUXA 5FECA 1VERA 4G43A 2F54B 2R4SL 2ILLA 3C87A 2DQFA 3OZ9L 5DDHB 4CN6A 5DRXB 5IB2B 5KTEL 5I0ZA 5LVEA 3QUZC 4MQSB 5J7CC 5I30L 1XH3A 1MHCB 3RHWK 4XNMA 3VGFA 1T04A 1XCTA 1NCWL 3LQAL 4FFYH 2ICES 3B6SB 4M7KL 2X9XA 1K9TA 3HG1B 4JFQA 1MCNA 2RJMA 4UT7H 4OFVA 1OW0C 2HVKB 1Q0XL 4JY6A 2B0SH 4M1DH 3HE6D 4ZNCD 1IT9H 4HKBA 1KSRA 3X3GL 4K3DH 4OV6F 2FD6L 2X4SB 2APBA 3ZL4L 4G8GA 4LBEB 4YHZH 4GS7B 5I18H 3KS0J 5LQBH 2P1YA 4RAHA 5DYOB 3MLSL 5ESVA 1MFDH 5DWUH 4IMKC 5EU4A 4WUKL 4HZLA 5E0QA 5GS1B 1TJGH 3ULUC 2R39A 1MI5B 4NHCL 4X4YA 4HIEB 3V52H 2ITDB 2DB8A 1G6RL 1HDMB 3HNTH 5LGJA 1CLZL 3WFBL 1TENA 4GRMB 1MRDL 4NWUH 4ODSH 2QADC 2Q6WB 2KH2B 1T5XB 3KLDA 3GMMA 5KJRL 2FEDD 4PJ5B 4Z8FH 5DHVH 5E8NB 5HHOE 4LVOC 2QHLA 3V4UH 2GJ6A 2PW1B 3MRJA 5EBGA 2BNQD 3HG1E 5GJSL 2B4CH 4FOMA 5CCKL 1JZ2A 1TTFA 1MIEH 4JKMA 3QUZA 3ARED 4KTDL 1G7PB 1TQBC 2VLKE 5IEHB 4GAYB 4EI5D 5IR1A 3SKJL 1KTLA 2VDKH 1VFAB 4Y4FA 4LHUD 2AK1L 3FO2A 4PJXA 5GRYA 4D9RE 4XVTL 4NO0D 2QQNH 3KGRA 3BJ91 5AWNL 1BQLH 1VGKB 1OW0A 5HI4C 1MUJA 2YPVH 2YD7A 4NNXB 5IG7A 1DSFH 4HWBL 4U4BA 4MNGA 3AS2A 3TH2T 5I15L 4FRWA 1IM9D 32C2A 4PV8B 3ILPA 1MI5E 3BX7C 2FB4L 3GMLB 3OJVC 4TVPD 4YDLC 5DMKA 4EUPH 4XMPL 1HNGA 5JORA 2VDML 3OG6B 4BH7A 3EYQC 2Q8BH 5D2NC 4IMKA 2Y72A 3ULVL 1NGQL 4YK4C 2CR3A 3MFGB 4NP4L 4FQ1L 3ES6A 4U6XB 4RMSA 3ARFC 4RWHA 4PGEB 1OSZA 4MS8C 4K9EL 4DAGH 1IGMH 2VIRA 3OKLA 2H45A 1OAUL 1GGCH 5ACMA 1DQMH 3BUTA 3G6AB 3ZYJA 1OAZH 2VKXA 1SEQL 3JBG7 3QNYA 4NT6A 1SJEB 1IE5A 4CDGC 3QIWB 4EIGB 3RGVD 4M61B 4HLZG 2VITB 2XWBB 5C0BA 1OQOA 5EOCJ 1VENA 1X5ZA 3BEVA 4EDXA 3T08A 2VABA 5IHBA 4HUKB 3AU1B 3WXVH 2J5LB 5E8OA 1CD1A 2ADIB 4PS4L 1VFMA 1JGLL 4MNQE 4JY4B 2IPUK 5J3HC 2Z8SA 2HYMA 5C0IA 2FH8A 3EJYC 5GSVA 3VXQA 2VUYA 3L5WB 4X9IA 4L8DA 3GMRB 5KW9H 2YD6A 3H2WA 1L7TH 2CK2A 1QBLH 1QP1A 4P5KB 4ZFZA 5SWQB 2NTFA 4M7JL 1CGWA 3RY4A 4NRYB 1EGJA 2WUCL 5TH2A 4DFIA 4U1SA 5EIIB 4F7PB 2FIKB 4KJQD 2MFNA 3E6FB 4PJGE 3V0VB 3MV7E 1J18A 2DLTA 2Z93A 3LHPH 5IW3A 5LAXA 1FVDB 4QRRE 3I75B 4PJIE 4FFVD 1U41A 3MRIB 2E7CA 3PHOB 3MYZA 4JDVA 4HJ0C 5F97E 3WHXA 4WU7B 1BGXH 3OKEA 4K71C 4M03A 2EYTB 5D2NA 5I8EB 2P8PB 1UXWB 3SY0A 3P40A 1UYWL 3HZKB 4JKPL 1FL6B 2XQBH 4FP8L 3HC0A 3JWOC 4PJFB 4PJDB 1NUGA 5C1MB 5ERWB 4WW1A 3H3PH 1CFBA 1JE6A 4ZTPL 1D5BA 5E9DE 4ZOCA 1A5FH 5DJXB 3DRTB 1MPAL 1LO5B 1N2RB 1G7LB 3ROOA 3F5WB 4YHPA 3EDJA 5J13B 2HP4A 3IFNH 1JPGB 5IHZB 4L4VA 4NN6C 2G75B 3JWDC 4NDMB 5B21A 3GO1H 1X6LA 1I9RH 3GMNB 3L5HA 1H3PH 3VFNB 3GBMH 3MREA 3VG0H 1JL8A 4K2UL 1YNLH 3E8UH 4I4WA 2I9LA 4JVPA 3HPLA 2AJYL 3PNWA 5C8JA 1L7IL 3CX2A 1UQSB 2NXYD 5C6TL 1G1CA 1OCWL 4LLWB 1XGPA 4A6YL 3DGCR 4XXCA 4HKJB 1OPGH 3TBSA 3KVQA 3L3KB 4NZTH 4KKBC 4YXHH 1FBIL 3CFEB 2H2PD 5A40E 3LSOA 5I76A 4YXKL 4L3EE 2BY3A 4F7TB 2ATKB 1HHIA 4G6FB 3ESVF 4PJXF 2NY6C 2W0PA 3PWPE 1GPOH 1KEGH 1S9YB 4P23B 2BFVH 4HMDA 5B39B 2C3VA 3OKOA 4WEUD 1MELA 2B39A 3O9WC 4AL8H 1I3VA 3QCUL 3P4OB 4CMMA 4YXLL 5EZJB 2D9QB 3IFLL 4XHJC 1WZMA 3UJTL 5F7WC 3QULB 2YPLD 2UWEE 5J1AB 1KJMB 1MWAB 2EDOA 1FCGA 4L8CB 4R7DA 2ORBH 3IS0X 5E95B 1UVQB 4Y1AA 1CL7L 1QEWA 2DL9A 5T3XD 4Q9BA 2V7HA 5M94B 1KJ3L 5D1QD 1JN6A 1IKNC 5I19L 4CNIA 3CVHA 2YXMA 4YUEH 5M95B 4JVUA 1CICC 2NCMA 1HN1A 1K85A 5ETUA 2JIXB 5C08B 3SO3C 1HH6A 3QI9B 4XAKE 4JKLA 3SQBA 5BCAA 4ZFOB 3MBED 2HKHH 4P3DB 1ZA3B 3TBVB 3W0WA 4RQQB 3ZKND 2JTDA 3LPWA 3IJHB 5D7JD 3O2WL 3TJEH 2VH5H 2O5YL 3VFVA 4LCYB 4Z7WA 2FZ3A 5BRZE 3ZKMC 1IGTA 3BPCA 5MENB 1C16A 4U0RB 4HWZA 1CN4A 5ICZA 1T1YA 2FR4B 2PXYC 3PDOA 5D72L 4WFGD 2IAMA 5CGMA 5F7HA 3D18B 3L1OH 4LVNC 3GSOB 4XH2B 4P9MH 2CRMA 4LEXL 1U92A 5KVGL 2N1KA 1E6OL 4EJ1C 5J11B 5D6CA 2RR3A 3SOBH 4YHMH 2GTZB 5JNYA 2QHRH 5E4EB 43C9B 1E4XI 4S1DD 2PTTA 3O9WA 35C8L 1ACZA 4P59H 4TSCL 4FMKA 4WNQB 5D4QA 4HJGA 2EYRB 3JWNC 1KN4H 4F7EA 2ED9A 4LEOB 2NY1D 4F57L 5D7LA 4Q2ZA 2OL3A 3D39D 5E1HB 3I9GL 1IKNA 1KPVB 4MDJA 1AE6H 1MREL 4C4KO 2XNAB 3MOAH 2F53B 2O61A 4DUWA 3LEVH 1JHTB 3VXRA 1ZT1A 3WFDH 2GJJA 4DOHE 5DF0A 4E9LA 3SE8L 4QWWD 1OTSC 2A0LC 3RAJH 3MRFA 3NN8A 5IB5B 5DQ9B 1BX2B 2LABA 4XNQA 1BD2B 4LLDB 3BRGC 1NC2A 3KR3H 1SYSB 3K4AA 2MTPA 2YA2A 4XMLH 5DMGC 4Q9RL 4XNZC 2Y36L 3GSRB 2CLZB 1ZOXA 1QOKA 2EXWC 2PXYA 4OLXH 5BQ7B 2BY2A 4EEEA 5HHXL 4OCNC 5T1MB 4UOJA 3VFGH 4QRPB 5E5RB 3WKMH 5TGBB 4X98A 3W9EA 4DUXA 5JW4N 1RIVH 2DQCL 2MQ0A 4NWTH 3KPQA 1NMAH 2EC9T 2P5EE 1BVLB 4DCQB 2XTJC 2FJHA 2HTKD 3QUML 4M3KB 2YA1A 5BVPH 3FTGB 1T5WB 2VXTH 2GAZA 2EH7H 5IBTH 5IVZA 5I6XB 4PP2B 1G6RB 1QFWL 2VLRD 3FQTB 5FCSH 3NZHL 2E3VA 2H1PL 3D3VE 4HC1L 4H1LB 4JG1H 4KDVA 2IF7A 1S9VB 2WLZA 2YXFA 4J3VA 4OZGE 3B83A 2PR4H 1WCBA 4LLYA 3SKMB 4AMKL 2APFA 4LPWA 2BSSA 3BQUC 43CAA 3KPMB 5L2JB 3HC3L 1IZJA 3MCKB 1A3RH 2DTSA 5GS0H 4WHYH 4TYUA 5J1TC 2CDEB 5EU6D 5EUOE 1FZMB 1OT1A 5C70A 1I9IL 2OJZH 5SWSA 3CDGB 4ESKA 4S10A 4MVBD 1CE1L 1IBGL 1QLRA 2V17H 4KKLD 5FIEA 5BZWA 2A73A 4HWUA 2OM5A 3AS3A 4X5LA 5FO7B 1FYTA 4C4KT 3U6RB 2X4PA 3FMGL 1H5BC 1KF9B 4ELMB 1JGEA 4S1RL 1YPZA 1LO2H 4Z7WF 4KK5D 4JFHE 3RJDA 4HW6A 2B1AL 4JHAH 5CMAB 1MJUL 5F7DA 1J05B 2YEZB 5I16A 1FZKA 5IBLD 4UAOB 3BFOA 4MZ3A 1GCFA 4QGYA 5DD6A 2ZKHL 4OCRL 3FRPG 5LGHL 3DNKA 1YEIH 5HPMA 4I0PD 4KRMB 3MROA 1SJXA 1OGAA 3BO8B 4CU7A 4EKXA 3JTSA 4KMQA 1ITBB 5EPMB 2OTWA 4NZRL 4NRZA 5BS0D 5ESQB 1XGUA 4P2QB 3PP3K 1EO8H 2A6JB 4OQTH 1JTTA 4E41E 1IM3B 1JRHH 3HR5A 1TVBA 2EDDA 3MA9H 3FRPA 4NQXB 3T0EB 3BQUA 3MRGB 3X3FL 2HFEB 1RY7B 2XWJA 5C0AA 4JRXB 3RRQA 2BHZA 3L5JA 1JZ7A 3FT2A 4O2CB 3O6FC 3BPOC 1OSPH 4YNYB 4ODVH 1INDL 2YWYA 4PJCE 4QYOA 4KY1L 3L7EA 2CKBL 1J1PL 3GK8L 1BOGB 4O5LL 4OZIA 5I74C 1L6XA 1GOFA 4XPBH 3ULVE 4LPCA 3O3BA 5IW6A 3VD3A 1U8HB 3PABB 1BQHG 2BSTB 4GFTB 5AUMA 4XVSH 2VAAA 4HIIA 1S7SA 1OARL 2F5AL 4K8RD 4LCCC 2R2EB 4ZS6C 2NY7L 5GGTA 3NACH 2V5RA 3H9SD 1BFOA 4MHHG 3DGGA 3VWJC 4GLRH 4H5SB 5FB8B