2YPVL

Crystal structure of the meningococcal vaccine antigen factor h binding protein in complex with a bactericidal antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPSSIYASLGERVTLTCKASQDIHNYLNWFQQKPGKSPKTLIYRANRLVDGVPSRFSGGGSGQDYSLTISSLEFEDIGIYYCLQYDEFPPTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOPROTEIN
publication title Defining a Protective Epitope on Factor H Binding Protein, a Key Meningococcal Virulence Factor and Vaccine Antigen.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Immune system
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvL01
1WFTA 2ZOLA 2X89A 5C92A 2EYRB 3TZVA 4JREB 1HQRA 5EO9A 4DGIL 3K1KC 1Q1JH 5F1NA 4LAJH 1S5IL 5EH1A 3V95A 3TNMB 1ZE3C 4G6MH 1SM3H 5FECA 5IWLA 3CSYB 3I6KB 2BSRA 3V6BR 2Q6WA 5CEZD 1IEHA 3FQTA 3BZ4A 3FB6A 1ADQL 4F3FA 1HDMB 3MRLB 3V0AC 2Q7YB 3BT2H 4NNYB 4QRRA 3QULB 5C0AD 1RJZA 3VXUB 5DMKB 3OKKA 1TJIL 4PV8B 5IBLD 5EORL 3KWWB 3H7LA 5FKAB 1AGCA 2HG5A 1BFOB 2BCKA 4HK0A 1IKFL 4Z78B 2X4RA 1JIBA 1MEXL 2NXZB 2X5PA 4R2GB 2EYSB 1QFUL 4NCC1 5C8JA 2HLAA 5SWQB 3RKDC 1BQUA 2MKLC 3JUYA 3VGAC 5E6YA 1ZGLM 1U8IA 3ULUL 4H0IA 1JGVH 3VW3H 5EO1B 2Y07H 4HWEH 1MLCB 3L5JA 3OJ2C 3UDWC 1J11A 3H9ZA 3NCJH 4AL8L 1XF5A 1UJ3B 1YMMB 1LP9A 2ARJB 3LY6A 1NANI 5HYQB 3WFHB 3BN9C 5IG7A 4N90E 3THMH 4PYGA 4XMLH 3QPQC 4MNGB 4BSVB 1FNAA 4JDVA 4NO2A 4TTDC 5DZOA 3GHBL 3L3JB 1XIWA 4PJ8D 1K85A 4HPOL 3AS3A 4XRCB 4OLEA 1CD0A 4YFLI 4YIQB 2BVOB 4JQIH 1PLGL 4P9ML 2MWCA 2QV2A 3G08B 1LVEA 5C07A 3BGMB 3QCTH 2F74A 4OKVB 4U49A 3MGAA 1MF2H 4M1GL 2QBWA 1WFUA 2MCPH 3BPCA 1HHIA 1L7IL 5DJ2B 4LLDA 2XTJD 1T0NB 1C5BH 4OLWL 3AVEA 1D7FA 4JRYE 2DDQH 1FVEA 1S9WA 5AZ2L 1OM3H 3ZDYF 5B3JF 4Z0XA 3OG4B 4FQ2L 3WSQL 1KPVA 5KOMC 3GK8L 3DWTA 1JNNL 4Y5YB 5J13B 3QXUA 1U91A 1Z3GH 2EH7L 1LO2H 4HWUA 4DZ8B 2ZCKH 3LD8C 1QYGL 1UVQB 4PV9A 1NFDB 5I1HL 3BPOC 1SEBB 2D9CA 5IEHA 2WWKO 3V79C 4UNTA 5IHUL 1F3DH 4DQOH 1LE9B 1C08B 5F3HB 5C0FA 4NP4L 2VLME 2EE3A 3U9UB 5GJTL 1D5BB 1DBAL 3DGCR 4KXZI 3BO8B 3H9YA 1HKFA 5I1EH 3T8XB 1RUML 2JLLA 3INUL 2EICA 4M8VA 5FYLE 1MJJB 1RURH 2DLEA 1G7QA 3IDYC 1QP1A 4G6KH 3AMKA 2VABA 4KI5D 5E8DH 5F8RC 5C3TA 3BVNB 1RUKL 3AREC 5J12B 4P59L 4KK5C 2P24A 1WT5C 4LNRB 5HHOD 4MMXC 1CG9A 1BP3B 4GAFB 1XEDA 1DQJB 4FMKA 3JBG7 4OGYL 1A3RL 3JWOC 3HI1A 1JYXA 3DBXA 4WHTB 3BX7C 5J6HB 3TN0B 5J3HC 3C60C 3RGVD 4P0DA 2HFEB 3G9AB 4XCYB 2JJWA 3ARFA 4PJFE 4HEPG 4Y1AA 4GW4B 5CSZA 4HFUL 4OIAA 4HSQA 4N8CH 3QIUC 4ODHH 4UAOC 5DHVB 4XNYL 5B8CB 3MJ8A 5IQ7H 3P9LA 3TF7C 3TP4A 4P23A 1DFBL 4RRPA 3L6FB 4KRPB 4L4TD 1G0DA 2BSED 4WI3A 1VPOL 3WS3B 4ZUVB 5GS0C 1PEWA 5LWYH 4U6XB 1OWRM 1J87A 1M05A 1F6AB 5SX4I 4Y2DD 5E4EC 3LAFA 4U31A 2ATKA 5F7EL 4YHYB 3GJFB 2QQKH 4LCWB 3SDXE 1UT9A 4KFZC 1X6LA 4U1GC 3E6FA 2XA8H 5KS9A 3O4LE 4O5LL 1A4KA 4S11A 2UUDK 3CZFB 4JANB 1E28A 4L5FH 1GZPB 5E5MA 5DJ6A 3RVXD 1UM5H 2WWMD 5IMLA 4U05A 1LK2B 5GS2H 3OBAA 3N0PB 4TUOB 2UY6A 4ZFOB 4LHJB 1MI5B 5MEPB 1I1CA 4D0BB 2XFXB 3X3FL 4U0RB 4N0CC 4G9DA 2VOTA 3H9HA 5EULV 5ISZD 3QT2A 4GG8B 4I3GA 3ULUE 5D1QD 4M62L 4JY4B 4QGYA 2X09A 3F65A 5KSAC 1FIGL 4G8GA 1IGCH 5CHNB 4DAGL 3IFOB 3UPCA 1JE6A 1YEHH 3QG7L 4WV1C 3X13B 5BQ7A 3KS0H 4WTXA 1OSZA 5TE4H 4YO0B 3IFPA 3SCMC 4AEFA 3UPRB 3OZ9L 3PGCA 4PJDA 3TBVB 4NOFA 1OHQA 4LRNL 4MJ2A 3VXPA 1I1YB 1FNSL 1JPTH 3T0EA 3U36A 35C8H 3B2UC 2BOCA 4H5SA 1JZ6A 5DJDB 5KOVC 5C0IB 3OPZH 1KOAA 4LPXA 2OTWB 1EJOL 1KC5H 2DQFA 2B2XL 4APQC 1NFIA 3SE9L 1U8KB 2MHAB 2AJSH 4L4VE 1IGFH 2ESVE 3C6SB 4QHMB 5E99H 2C1PA 4AENA 4Y7MA 4PGEA 1CBVH 3U0PA 5DVLA 4FTVD 4UUJB 5DSCA 2YK1L 2YXMA 5IM7B 5I1LB 5KVDL 5IK3B 1FL3B 5DA0B 3DO7B 2YPLA 4Y5VA 1NH6A 4MAUH 5HI4C 4KK8C 4ODTL 5DHXB 2H3NA 1A7OL 2A1WH 2A9NH 2FNBA 2WANA 3ROLB 1U6AL 2QQNL 4PRIA 2C4XA 1QD0A 1XGUA 3NFNB 2AEPL 4Q7DA 1BQSA 3HE7A 5CIPB 3V5KB 2R69H 2VXSH 3WNOA 1HHGA 5EPMA 4KKAD 3BOVA 1RZJH 5D93C 5TFSH 2HMID 4PRHA 3VXOA 1ND0B 3WIHA 1FRGH 1MCQA 4A6YB 4L8CA 3PHQB 4Y19B 2GFBB 4NWUH 5AYUH 3F6IA 4F33A 2GTWB 4PD4K 5AD0B 3VD9A 1IL1B 1YPZE 3B9VA 3K2UH 4XNZB 2EEBA 4OD3L 4TSCL 4F7EB 1YN7A 5T33L 2FIKA 4X6FA 4HJ0C 4FQXB 1WV7T 1HIMH 5EN2A 3QDGD 1OVZA 4WHCA 1ZLWK 1ACYH 3BD5A 4H8WL 3MRJB 3O3EA 4JVWA 4QYOB 4NJAH 3MLSL 4FTVE 2D7OA 4GRLD 4WFFE 1WSST 4NQED 1Z5LB 4LSQL 5D72L 5CJBA 5I71C 3P4NA 1X5JA 3K8MA 1RFDL 1Y6NR 1J1OL 2DQUL 1FZKA 4FRWA 1I1AA 1H3XA 1XGYH 5TF1H 5I76A 4XWOC 4OD1H 5BCAA 1EZVY 2G2RB 1F97A 1KIQB 1CXFA 1EH9A 2IEPA 2JJSA 4Z7OF 3VFNA 4WI6A 5IW6B 3V5DB 2R29L 4GRWE 5DZNA 1LO5A 3MJ9L 3U82B 3AY4C 4S2SA 5IB4B 1UFUA 1GGIH 3F5WB 3V8CA 4X0KB 4I48B 2H26B 5FO7B 3VFMB 5C0CA 3FT4A 1B0WA 1DQQB 2M1KA 1IAKB 3KPSA 2CRZA 3LS5L 5CWSA 2ZOKB 2XOTA 4MX7A 3G04B 3FRPA 4FFYL 5IBLC 2HLFD 3L3GB 1WITA 4C56E 3FB8B 3UTPE 4QCIA 5DFVD 4OZHE 4CGTA 5D2NE 2WK2A 3GBLA 2DWEB 2VZVA 4QO1A 4HJGB 1P5VA 1T2QH 5CILH 3MUY1 3LCYA 3BEWA 4GG6E 3SJVB 1MQKH 3FQXB 1K9TA 3FL7A 3MUGB 3P11L 2AJUL 3KS0J 5D6DC 3QUZC 5IVNA 3OJVC 4XB7A 3H8NA 2YXFA 5ANMA 3LN4B 5HDBF 5L8KB 1DSFL 5IKCB 4Y8AA 3FQNA 3T09A 5HYFA 1IZKA 5FYKH 4JVUA 1A6AA 1U3HD 2DI8A 1QFOA 4JFDA 3ZYIA 2VDQL 5CP7B 1BFVL 4I77H 2Y36H 5DJZB 4P4RB 2VLRE 4ZG1A 1J5OL 4ZOEA 4PJBF 5F1IA 4OZGF 3FO1A 3RAJL 4UILL 4XBPA 3KJ4C 7CGTA 2C9AA 2FECI 4P3CH 1YYLL 3VXTA 4PJ5A 3LHPL 3OF6A 2VDOL 1DUZA 2GT9B 5DJXB 2JB6A 2HFGL 3C6LB 3B9AA 4N9GB 3IAGC 1HNFA 1J1XL 2C5DC 4Y4HD 1KCVL 3MLZL 1IQDA 2D0GA 1I85A 1OF2A 4GXUN 3TA3B 5LGJA 2AXJA 3QHZL 3QXDB 1D5MB 4OJFH 2NW3A 1BBJA 4WI2A 3KPRB 1NC2B 1P2CB 3C9NA 1T21B 2W59A 3QCUL 2IMMA 4PJHA 1HILB 5EUOB 1CTOA 3PWPE 4PLOB 3IGAA 4PJGA 4LSTH 2QSTA 3SKUD 3CH1A 1HH6A 4QOKA 2FWOA 3MUJA 4R0LA 1QSZA 4Y5XB 1OTUC 4MSWA 3H3KA 4XVTL 4WU7B 6FABL 4OUUA 5GGUA 4LSUL 3S96A 4X98B 1G7LB 4IRSB 4M7LH 5DXWA 2Z31D 2YEZB 2VC2L 1J8HD 4S10A 5A16B 1HXMB 5SV3A 2CKNA 2FJFB 2IG2L 3TO4D 1DLHB 4HW6A 3SE4C 5KBNC 2H41A 4R90L 4X7EC 5ICYA 4M5ZL 4GH7B 3C09B 4NQDD 2J8UE 5KVEL 5GRWA 2XN9B 3F6LA 2W0FB 2P5WE 5JUEH 2FL5A 2AXHA 1INDH 3HUJE 3VFOB 5DEZA 2X1WL 2NY1C 3FHAA 5HD8C 1N59B 5DT1L 4HGWB 4BQCA 4ZSOE 4O2CB 4QHKI 3X11A 3ZTNL 1KIPB 3ZHLA 1PEZA 4NQCB 4GUPB 3NIGF 3BUYB 1T22A 1KEMH 1DTUA 3ZE2F 2R39A 4XPGL 1KBGL 2OR9L 2WQ8A 5F1OB 1UH4A 3N9GH 1EO5A 1H8OA 1EPFA 4N9OB 4D8PB 3TNNB 3KLHD 1O7VA 4JDTL 2ZUVA 3PL6D 4XP9L 4XVSL 2VZ3A 3EYFA 3QWQB 3QFDA 4MQSB 5GGTL 1RJYB 1DEEB 3N1PC 1YY9C 4X99A 5LCVL 1UKTA 1JWUB 4Z7UA 3DGGA 4HIJA 3QDMB 3QEUB 1MCOH 1IC5L 3EYOB 5IVXF 4K3HA 4KGLA 1F58H 1MHEA 3W2DL 1A9EB 2X4QA 5E6IB 1XR8A 1QSFB 3HRPA 5CJQH 5DJYA 4HMEA 4I1NB 2OTUA 1MAML 5F9AC 4Z0BH 3C5JA 1E4XI 4OGXH 3LZFH 3A6BL 3UAJD 1I8MB 4IRZH 1RIVH 3GBML 2APWA 3MLVH 4NKMB 4U1HB 2DJUA 1LNUB 3ARGA 1PG7L 3HI5H 5TE7H 2JJVA 3IJYB 4FXKB 4YDLC 5BO1H 1SYVB 2C4FU 4DUWA 1I3RA 4K9EH 3RNQB 1ETZA 2CGRH 1T1ZA 3GB7B 4ZD3L 3C2SA 3FAWA 5KG9A 2DKMA 3C2AH 4KJWC 4HDIB 2IPKA 3JZ7A 3QZWG 5C2BL 4MJ4A 4Z6AT 4QHNB 4AYFA 1GIGL 3HG1D 4UI2A 4CNIA 4FABH 3QI9D 5BMFL 3T2OA 5F8QC 2HRPH 5C0BA 4ZQKA 4P4KA 2X4UA 3O45B 3QDAA 3W0WB 3WYRA 3ETBF 3P4MA 1GC1L 1JRHH 1A6UL 2QL1A 2X9YA 3FN0L 3PWJA 4RGND 2HP4A 5BV7C 3I6LD 4RFEB 4GBXD 4TVSa 1JNHB 5DD1L 4JQXA 2UVFA 1MHHB 2P5EB 1IBGL 4HD9A 4XWGL 4BH8A 1NSNL 2XQBL 5TE6L 1RZIB 1EFXD 2FD6H 2IANA 3CK0L 2RAMA 1NDMB 5D1XB 5DLML 2ICWI 1QSEE 4JQVC 4POUB 1BQHG 4OCMC 1S7WB 4XC1H 4J2XA 4XBGA 3MRQA 3Q6GL 1KLGA 4OFIA 3WHXB 4JY5H 4KQ4L 3ZKQD 2DQIL 2ICWA 4LPVA 5JW3L 4KVNL 2B5IC 2CUHA 4J7RA 1QA9A 4U6HA 5JTWA 4X8XA 3P77B 4I0PD 1BD2A 3SO3C 2VAAB 1E6OH 2BVUA 2EDHA 3WEXA 3ZDZF 4R9HA 4YDIL 4PS4L 1QR4A 2NY7L 2EC9U 3BQUB 3MCLH 4LHUG 3VRLE 2R1YB 2FJHB 5I6XC 25C8H 4Y0GA 5HBBA 2VDKH 4ZUSB 5IFAH 4JJHA 3MRIA 1ZMYA 2XWJB 3KYKL 4QXWA 4PYHA 5EIVA 2YKLH 3I6GA 4V2CB 3DXAB 2WM0A 5D2NC 4JVPA 5BJTA 5JORA 3MRPA 4YE4H 5C7XH 4WFEE 3O2VH 1QO3A 4HT1L 2BC4B 4MNQE 3KPOA 5FYJE 2AQ2A 4KZDL 1YEIH 1CIDA 3IRZA 3OAUL 3AAZB 2B1AH 5C0JA 3NCMA 5L9DH 2QR0A 5INCB 5L7XL 4JPKL 1FJ1B 1KG0A 3NPSB 1BQHB 3L7EA 4U1KA 2HVJA 1U9KA 3HZKB 3QH3A 1Y0LB 2ZPKH 1KUMA 3IDXH 2BJMH 3EHBD 3NACH 4XXCA 5D71H 4KK9C 5E9DB 1TZGL 3VCLA 5D7IA 4R4NC 1IGYA 1QBMH 1N6QL 4PP2A 2ICCA 2ICEA 5D2LB 5GGQL 3G6JF 3LDBB 5BS0D 5IQ9B 4LHUB 2FH6A 3D39D 3C8KA 3RUGB 3CXDH 2AK4A 1T03H 1FBIL 4YWGL 3ARBD 2JELL 3VFSA 4PJEE 5FA4A 1T5XB 4G6AD 3MOBH 3SQBA 4LSSL 4OF5A 1HSAB 3P9WB 2LAGB 3RL1B 5I0ZA 5H2BB 5I0DA 3MTRA 2YMXH 3MRHB 3KXFD 3TBYA 5FB8A 5DR5L 3O8XC 4U1NA 4MB4A 5HPMA 4KHXH 1EEUA 5E95B 4CU7A 9CGTA 4WFHE 3QQ9C 4P3DB 5F7NC 3VWJA 1T7ZA 2FRGP 4UT6L 2NX5D 3JV6B 1D9KD 5SWSA 5IROC 4RMVA 2FR4A 3B3IA 4EN3A 4FFWD 1FC2D 1UEMA 1F90L 3U4EA 3MNWA 4JKWA 3ALXA 5GPRA 2WIIA 4KI1A 3E8UL 4LSPH 5B38G 3LD8B 5DYOB 3X3GL 2ITDA 1MWAL 3QPXH 5AYQA 4I9WE 2JIXD 1A21A 1DR9A 1E4KA 1EAJA 1A7NL 1GGCH 1RU9H 3KYMA 4GAYB 2Z92B 1JGEB 2GY5A 4ALAH 2EIZB 3EOTL 5FO8B 1EO7A 5E8EB 1H0DA 2UWEF 3H9SB 4M48H 1BVZA 1QEWA 4ONOA 4AT6A 3BHBA 2EXYC 5T3ZD 2P46B 3G5ZA 4W6WB 2UZIL 3MZGB 1BJ1H 1PG7W 3IDYB 4DVBB 2WBKA 1IGJB 1FORH 5D70H 1FE8H 5EOCL 4LQ1A 3BMWA 2VZOA 4XHJC 4C4KT 3SY0B 1V7NH 4WTZA 3LN5A 2NX5E 2CDEA 5A3ID 4FQIH 2IGFH 2EDFA 4N5UA 5L0QC 1KTKE 1XGTA 5C0ND 3SGJA 3QWOA 2XI9A 3L1OL 5C9JA 1FHGA 2Y6SD 4NP4H 1HHJB 3O11A 4U2YA 3D9AL 1CE6B 3MO1A 4F8QA 3FQWB 1HOCA 4XCCL 4P5TD 1I8LC 3CFDB 5EU3B 2CKBL 1V3KA 4JRXD 4UNVA 4YDKH 4JN1L 4UAOB 1TFHA 4WW2C 4HS6A 4A6YH 4ZUWB 3MUZ1 4HHAA 3B9KB 4BZ2L 4OKDA 4OCXH 3BW9A 3VXSE 3RVVC 1CZ8L 2PO6C 5KVGH 2XA3A 1MIEH 3QEGH 1ZK9A 1WVZA 3I3DA 4N8VB 3KHQA 5ENWB 3RY6A 4D9QD 3LKSA 5C09E 4J6RL 5KVMC 5EZLB 4JZNA 3BKCL 4U1GB 1OGAA 5IF0A 3CJJA 3ZO0A 3PIQA 1MRFH 3L95A 1CI5A 4HFUH 5TDPA 1OTTD 1A14H 1DL7L 4FQQB 4DN3H 1CK0H 3GM8A 3BH9B 3S88L 3H3PL 3KLHC 4G80B 3R06B 2CO6B 5ALCL 1ZS8B 1X5HA 2YPKB 2VLKD 1KLUA 2BRQA 3MA9H 5DMIH 3PL6C 1I7TB 1R3LA 4C4KO 1T04B 4UT7L 1YMHB 2NW2A 1D5IH 2UWEB 4BELD 4JM2D 5EU6A 3QUXB 1ZGLP 5SWZA 2JJUA 2OMBA 2DTML 3BZFB 4QXUH 2X4NA 3CLEL 3V4UH 1SMAA 3BPLB 1YDPB 2HT3D 5FEBA 4HXAL 3RTQC 1A1NB 4YHOL 5JQ6H 1MREH 3TT3L 4XPAH 3CSPA 3OKNB 2HKFH 2QJDA 3I50H 5IEKB 5BVJA 3NFSH 1B4JH 3MRDB 2PYEE 2ZJSH 5DUMH 2DL9A 1HEZB 4RQQA 3D2UA 5J7CC 2VLJD 3VU2A 4IRJD 1RQ5A 3TWCH 1GGYA 2ZUWA 3ULSA 4OLUH 2W60B 3KAAA 2CIKB 5ETUB 5FIEA 1E4WL 4YDVA 4S1DC 1X6NA 8CGTA 2IADB 3ILPA 1TVHA 1AKJB 2ADFH 4PLJC 3QUKA 1P7QA 4FFZL 5ACMA 5BRZD 1BHGA 4PJXE 4V1DD 1NMBH 1MWAB 3QG7H 1CFVH 3HI6H 4PJ9D 3OGCA 1S7SA 4TOYH 4Q9RH 2OJZH 3MXWH 4EVNA 1KN2L 3ZTJG 4O58H 5JPNB 2KPNA 1EBAA 4ZNEE 1B0GB 4QT5B 1W8OA 1EDQA 3QG6A 2IAMA 4KZEL 1UWXK 1TTGA 4LLAA 5B39G 5DUBA 3AUVA 4DEPB 3TH2T 4X6DE 1A1OA 3MNVB 1CF8H 4P57A 3VXMD 4UNUA 4R96A 2A6DB 4QXGL 4ZFZB 3WJJC 3TBWA 4BFIA 5I1GH 2VZUA 4LQFL 5DURB 1HXYA 3QEQB 5I16A 4OFKA 3WFCH 5I19L 2B4CC 1WIOA 5HHXL 5TGBA 5JA8B 1I1FA 2ORBL 3F8UB 1TJHL 4LVOC 1NBYA 1CD9B 5CBAB 1PZ5A 2DQDL 4OM1H 3TZVD 3FCTB 2R15A 4LIQE 1RV6X 1OT1A 4BFGA 3MRMA 3MLYL 4DGYH 4FP8L 3MRFA 1XGPB 3TEUA 1T83A 5BW7A 5DD0H 2AEPH 5MERA 2Q86B 1H3UA 1XR9A 4GKZB 5TQ0H 4D2NA 3IXTA 4M9PA 4P46C 3R0MA 4D0DA 3V4VH 2HT4D 3MLWL 3QO1A 3PWUA 1QLEH 4QRRD 2I27N 4TVPH 1UXSA 4OQ1A 4UINH 3RWFB 5I17A 4R3SA 3OHXA 4P2QA 1XZ0B 1IM9B 3B9EA 2A2QT 2N7AA 5LAXA 5T33H 3LKOB 1JBJA 1CXLA 4YHNB 5JLZB 2AV7B 3Q48A 1U8LA 1M7XA 1M71B 4OZGA 3U7YH 1UXWB 1IGTA 3KLAB 3SQOL 1JGDA 1P4IL 1BQLH 3JV4B 4LCCB 4PJFF 3HR5A 3TESA 5FGCB 1S9VA 2J1KA 4OTXH 5FCUL 4M6ML 1ERNA 2HJLA 4HS3B 1WCBB 3L9RA 1FFOB 4WNQB 1U8NB 5DQDL 3ISWA 4EXPX 1MH5B 2F53A 4Y4FC 5C0AB 3RWDA 3RZWA 3VWKD 4U1JA 2DQUH 1DBKH 1XIWD 1I8IB 3FOLB 2APBA 2EO9A 5HYEA 1F3JB 3EAKA 4XCFH 4DFHA 1T4KB 2QQLH 1QBLL 4Z7VA 5FHAL 3N1QC 1EERB 3HMWH 4W68A 3JUZA 4HXBH 5EZIH 2WSKA 1AGEA 3SDXF 2VDLL 1NAKL 3HFML 2BERA 4H20L 4YXKH 4X6EA 4C58B 2PR4L 3UP1A 1RZKC 4L1DA 4XP5H 3OJDA 1S7UB 5DMGC 1A4JA 1RJLA 3WXWL 2DL2A 1JNLL 4YFDB 1D6EB 3GMOA 2OZ4H 3PGFL 2Q76B 1JV5B 3PDOB 4CADA 2K3TA 3ULVL 5IUSA 4WEBL 3HMXA 1XAUA 4PJ8B 2FJGB 1SQ2N 5L6YL 1EEYA 3LS4H 2D7PA 1JGUL 2BX5A 3EO9H 4PY7A 5JW4R 3D0VB 4QRSA 1JCKA 3EJJX 1FGNL 1GZQA 1WBXA 1GC1C 1K2DA 3GMQB 4LSRL 4ONFH 2XNAB 1A5FL 5I1IH 2OL3L 2BNQE 3BDXA 4H0GA 1OOAA 4NWTH 4LOUC 3QDJA 3KJ4B 5E00A 5F6IB 4NFBA 2XTJB 4BQ9A 3FFCA 3U0WL 5E8NB 1DANT 5EC1B 3EFFB 4OIBA 3NH7L 1S7XA 4NIKB 1EHLH 4FQPA 2R9HC 1UA6L 4I3RH 5I75B 15C8L 4NZUH 1JYWA 5C07E 1MCNA 2HJKB 3FFDA 3MJ6A 4N0UB 4YEEA 4ODWA 3PWNB 3I3EA 1UB6B 1CLYL 1RZ8A 5HGHA 3X17A 1KCLA 1MJ8H 4MA8L 4G8EB 4JKPL 2VXUH 5JHDE 2VH5L 3P30H 4YXHL 1I9IL 4HS8L 4MXVF 1G7PA 3EDEA 4YC2B 3S3PA 2EKJA 3CH8A 1YEGH 4A2LA 5J6GB 5CJXC 4IOFD 1YYLH 5K9OA 4HZLA 5IVXA 4RIRA 3UJTH 4CVXB 2DJ4A 5HHNB 5CEXA 3KPMB 5EBMB 2HTKD 3ARFD 1IJ9A 3PV6B 1WBYA 4K2UH 4Y1AD 3FQUA 2WBJA 4LDOB 4UOW0 5DD3L 4OCYH 2G9HB 3BP5B 5ICZA 3RVWC 2E6QA 4ZFGL 3CAFA 3O4LB 3OB8A 1N4XL 4XMPH 4NUGL 1I7UB 5DK0A 1IKNC 5TPWH 5HHOB 3WKMH 1F4AA 1YPZF 3LRSB 2R1WB 4YHPA 2HH0H 1QACA 2EE2A 3CX2A 4MGXA 5FDWB 2VNCA 4K7PX 2YWZA 1YEFL 5M94B 4HJJH 4X6CE 3G5VA 3MYZA 1EEZA 1KTLB 2W0KA 3I2CL 3FONA 4MZ3A 1B0RB 3VFUB 4FQCH 4P9HL 4RMRA 4KMLB 3QQ3A 3VGGA 3OKDB 5J1AB 2I9LB 1CDCA 4K8RH 5FOBB 4JPVH 3GSQA 3UBXG 5DRNB 2IC2A 2I9TA 2A77H 2DYPD 1G7IA 5T5FL 1QLFB 4L4TB 3TO2A 1S8DA 2V2XB 5HPOA 4WDIA 3CFJA 4U6YA 2AABH 2P43B 3UDWA 3T0VA 3GRWL 4F9LC 4NC1E 3ARQA 2VXVL 4Y2DB 1EHAA 2ZUYA 4G8GD 1RPQA 4LRIC 4OLZH 3G5XB 3TIEA 2CDGA 1TNNA 4KHTL 3DMMC 3S35L 3VFVB 1G7JB 4X8JB 4YBLB 3S97C 4GMTL 3LMJH 3NGBB 4PRBB 5DQ9A 1G7HB 1GAFL 3OXRB 3OKOB 3T0ED 5I8EB 1PSKL 1RIUH 5K9QI 5ICXB 1VERA 4KMTL 3BH8A 2I60H 1R5WA 1ZA3A 5JXED 1MVUA 1S5HA 2DM4A 3GIZH 3DOSA 4DKAA 5KSUB 3CFIC 4JM2C 5KS9E 1FNLA 2Z4QA 3QIBC 4IHOA 3RPIA 1MCFA 2VDNH 1K5NB 5CCKH 4X9IA 4YZFE 5D1QB 3IETA 5GIRB 5T1KA 3UYRL 5I1KH 4QEGA 1C5DA 2HT3C 3W2DH 2YPLD 2CUMA 3H7BA 2OL3B 1R3HB 2J6EL 1FYTA 2DQTH 4YAQB 3IFLH 4L4JA 5E8OA 3UBXB 2OX5A 1KB9K 4D9RD 2EDWA 2GTZB 5IB1A 4NNXB 3RBGA 1A0QH 4NC2B 5AWNH 1OTSC 3HE7D 4WWKA 5GISL 3MV9A 4JGJA 1TZHA 5EBWB 1Z9LA 3AU1B 3PP4L 4PRHD 4JY6B 1BIIB 3RWEB 2UYLA 3MOQA 1WLHA 2AEIT 1RULH 4FTVB 2JCCE 4PJDE 5CUSL 3BYYA 3T0EE 3VRJA 2GKIA 2YRPA 5CZVH 4K3GA 5TQ2L 3G6DL 3JWDC 2DQGL 3GKWL 3Q5TA 4X5XA 1YQ2A 1TITA 2LFGA 3AREA 3IU3A 1NDGB 2NY5L 4XNUH 4UBDC 1XF4B 4N5ED 1WT5A 3CFCL 3MLXH 4WUUE 2B5IB 1RY7B 1Q9LB 3VXNA 4HX1A 2A6IA 4OGAD 3WO4C 5AAWA 4WY7L 1CFNB 3SO3B 3V6OA 5D6CB 4FQ1H 4U1SB 3NCYP 1HHHB 4XXDB 1DVFC 2OP4H 4X7TA 1N3NA 3WNKA 4E42A 1MHPL 4NJ9L 1DDHA 3C60A 1TJGH 1I1AD 4PRIE 4IBLT 5E0QA 1MJUH 2PUQT 5B38A 4K3EL 1FV1B 3V8OA 5DEGB 2NY4D 1YN6A 4IIQB 2M8XA 3HR6A 3TZVC 2F58L 2J3SA 2V5MA 3QDGB 5DFTA 1JF1B 1S3KL 5D2NB 3W9EB 3MLUH 4UTAH 3CCHB 1BFSA 1ZKAA 3M45A 3Q1SH 5IWLC 5HGGS 3PJSA 4XP1L 2FB4L 4NQEB 1HSBA 4M1CD 5F88A 5FKPB 5FYKD 5C0CD 1JHKH 1S78C 2J8UF 2NQCA 3TH4T 4OI8A 2ZUTA 3KPSD 4PRPA 3RWJA 4LLWB 3V0VB 5HHQA 3HUJF 5ALBL 2HFFB 2VIRB 1T20A 4G9FA 2APTA 1QKZL 5J1TC 3GMMB 4O4YL 4QXTB 2C1OA 4IJ3B 3WUWB 4E41A 1MCPH 1NL0L 3VGDA 3O6KH 5BZDB 3W39A 3L3HB 2ZG1A 3WIFA 1H8SA 3OXSA 4FZ8L 4HIIA 2MQ3A 1F4YH 3HS0A 5DGQA 4G8IA 4FQHB 2BMKB 1BOGB 3STZB 1J0IA 5HY9A 4GS7B 2GCYB 2ZP0T 5D5MA 3WN5A 1U95A 5GS0H 1FDLL 5KSAA 3GI8H 1CD1A 2R56H 1CU4L 3QSKB 5L7XH 1QRNE 1VACA 4JPKH 3RBSA 4WV1A 3PUCA 1NAML 4JFDD 1ITBB 4ZS6C 1FL5A 4I18C 3GI9L 3BGFC 3S7GA 3QFJD 3SCMA 3TVMC 2XQYK 4QNPF 4WW2F 3OKLB 1A3QA 3QJHB 1INEH 1Y6MR 4NN6B 2WUBL 5HSFA 3A67L 3GHEL 4HWZA 3GJEB 1T1YB 4M8QB 3PDDA 4PJ5D 2QKIA 4APQA 3OF6D 1YYMH 2QSCH 1N64L 2P8MA 3VFGL 5DS8B 5EU7E 3HN3A 4I2XE 3KYOB 4LPCA 1YQVL 2D9QB 4GKNB 1EHNA 3PWLA 2YD7A 5I8KH 2XWTA 4M1DL 1MCEA 4G7VH 4BM7A 2YOCA 2C3WA 4N0FB 3MBEA 4GO6B 4U1IB 3T65A 5DK2A 1EGJL 4JKLA 4LLUB 2WUCL 2X9WA 1X5ZA 3CDGA 3G5YB 4HKJB 3RVTD 4QOKD 5CBEA 3B43A 1DBML 5DD6B 4OAWB 3UTZA 5GSVA 4JGMA 5CJ5A 4L8BA 4YPGA 4ETQA 1X7QB 4OQTL 4NGHH 1EO8L 4JFDE 3B5GA 3CX5J 5F9JB 2HKHL 2DI7A 2VZTA 3QR2A 1KACB 4L9LA 3JTSB 3WFZA 1KTDB 4NDMA 2Z93A 4Y4HB 1YZZA 5KSBE 1NCBL 5DJ8B 3VXRE 3OKEB 32C2A 2C7UA 4X80H 3TBTA 3EJZC 2ERJB 4TUJA 3T4YB 5K9KB 5IVZA 2WQRA 4XBEL 4TSBH 4JHAH 3V4PH 5ESQA 1ZHKA 1D6VH 1T1XB 4KKLC 1G9NL 3L3KA 3PF2A 1CWVA 2L0DA 5L88H 1NGPH 2XRAH 3S36L 1HKLL 3MFGB 3MRLA 2Z31B 1OL0A 3BP4A 4NNYA 1J8HB 3KPPB 3WNMA 1F4WH 1T89A 3KDMB 3TO4B 4FXGB 4NC1C 3D69A 4PJHE 3S34H 1UACL 5JW5A 1KTRL 4WW2B 4XPTL 1WEJH 4NCC2 1MLBA 5GRZA 3KPNA 1CFSB 2VJXA 3L3OB 4NQDB 2XTLA 4E0RB 5MEQA 5EIIB 5B39A 1FFPB 4DKEL 2ZSWA 4P23C 3IKCB 4OBSA 1MCLA 1AR1C 3UXFA 3C8DA 1MNUL 2UZYB 4NRYB 3IYLW 2YUWA 4HUXB 1I7RA 3VGEA 5IB5B 5MHSD 1KYOK 1GPOL 2X7LB 2G60L 2F5AH 3I75A 1E6JL 3WS6A 3BSZL 1IAIH 4Y4KA 4L3EE 1UZ8A 2NXYC 4MAYA 4M7ZB 1CFQB 3MCKA 3PE9A 1KB5B 3L3JA 3PGDB 4JRYA 5DQJB 5E2VH 1KJ2H 4OZIF 1U8HB 3QUYC 4H25A 1SYSA 2IALA 3ZMRA 5JXAH 1KEGL 3CVHL 1C8PA 3MPCA 4BUHA 3VG0H 3PL6B 3ZTJH 1FPTL 3QA3B 5EOTB 4K55A 4Z77B 4EOWH 1YNKH 1SY6L 4XZUA 4XPHH 4EDWL 4UIKH 4LLMB 5GRJH 4DGVL 4L8DA 1EAPB 3U46A 4ETYA 3PABB 4RISL 5ACZA 1VGEL 1IM3B 2W9EL 4MD0A 3QUZA 1YNTB 4JFFE 4W70A 4KRMB 1NAMB 3Q2CA 4F7CA 3MV11 5D1ZC 3SBWC 3Q6FA 3AB0B 5E2UL 2N1KA 4RFOH 4NZRL 5CEZH 2P7TA 4JR9L 1CVSC 2DF3A 3BD3A 5ITBH 4Z8FL 2R0LH 1YUHB 3HCVB 3BEVB 2F8OA 3H3PH 2FGWH 3S88H 4X4YA 2VWEE 5GGVL 1DUYA 5MENE 4XPBH 1M7DA 3T0EC 1G6VK 1YECL 1ORQB 4X5WA 5C0BD 4P4KD 5MHSE 4OSUL 2FATH 1NFDA 1LO3L 4LFHD 5ADOH 4YDJA 1QSEB 2O61A 4MCYA 4HCRL 2K7QA 4RGMB 3O2WH 4Q6IB 4YX2H 1A7QH 1F8TL 5I30H 1LE9A 2NY3C 1OAZH 1ZHLA 5EFIB 4HXAH 4QRQA 5INDB 4I5BA 3D0LB 2V5YA 1KJVB 5K9JH 1UJTA 4MXQC 1ZTXH 2ZKHH 1FLRL 3T8XA 3SGDI 4JZJA 3S4SA 1OPGH 1VCAA 4O00A 3M1BB 3WLBA 1JP5A 2FH8A 3HG1B 1KXTB 2YD4A 3QI9B 4JPIB 1KJ3L 1WBZB 4PJFA 7FABL 4ZO7A 3BVNA 1G1YA 4WEUD 1WFOA 1KULA 4X4MA 2AEQL 1SEQL 3V0WH 4OB5H 1CTNA 1B6DA 4G43B 5I66B 2A74B 4DW2L 5L2KE 4PY8J 5ILTH 2A73B 4RGNB 5DVKA 4OLXH 4LKXB 5DHYA 1BD2D 5FYLH 4GBXB 3H2WA 3BP7B 5FUZH 3F7YB 3RA7H 4OZIB 4KTEL 5DVNA 1N26A 1S9YA 4XNMB 4N1CA 5GXBB 3AS1A 1AI1L 2DD8L 2V7HB 1EFXB 3L5XL 4LVOB 1L4IA 3RGHA 3EBAA 4NHUB 4ORGB 5IMOA 3SDXA 3SE4A 1QVOA 4UTBL 4HV8B 5T3ZL 3K8LA 1I7ZB 2JB5H 4QRPD 3CPLB 5FM4A 1NGQL 3L6FA 3VD5A 2E7BA 1R5IB 3DTXB 3GSVB 3MRNB 4C59B 4KU1A 1KCUL 4L8SC 4HUMB 3O41B 2IANE 1MIMH 4I0PB 4PTTB 3RIAK 3EYQC 2PTTA 4L3CB 5FF6A 3GJFA 1WTLA 2X4TA 2PCPA 2XG4A 4LCWA 3WE6B 4PP1D 3HZYA 3RRQA 4WUKH 2GI7A 2ORBH 1TJHH 4CVZB 4BSWA 5GRVL 3CZFA 4JGUA 1YEEH 2D03L 2Z91A 5LBSL 5DMYA 3T77B 4PBXA 3ZHDA 4WGWB 4OCSL 3X12B 5LKNA 1LO4H 4W4OC 4LP4A 4JFEE 2AQ1A 3EDDA 1WWWX 2RCSL 5E1AA 1JZ4A 1M7IA 2Q8BH 3EYVB 1TPXB 1UB5A 1MRCL 2RJMA 3GSXB 3LB6D 1KCRH 3NTCH 1MHCA 3RL2A 2AK4D 4GG8A 1HH9B 3IVKB 1NUFA 3CVHB 1RZFH 4JO2L 5DTFA 3D3VA 1FZOA 3NBNA 3IFOA 4GFTB 3MRKA 4L4VA 1WK0A 3H3BC 2ESVA 2IQ9H 1VADB 3Q3GA 3MV7E 5EU7C 1LK3H 2FX8H 4KK6C 3L7FB 4YO0A 2MFNA 3B5HA 2CMRL 3UPRA 5M95B 3L3IB 1DP0A 1SJEB 5GGVY 4XNXH 4GAGH 5HVHC 1MFNA 2NZ9D 3QXWA 5HYJE 4JFXA 4JN2B 5BS0B 4H1LG 1CE1L 3C6SA 3D39B 1J88A 4HBQA 1JN6A 4J23A 5F7DA 4EN3D 3EO1A 2DM2A 3DYOA 5C0EB 3ARBB 4K94C 4YR6A 2YUZA 2XT1B 4HC1L 4JM4L 5D7IE 1JWSA 2DMKA 3UC0H 1QBLH 4J8RB 5H94A 3DETC 2EDQA 3HAEG 4ZTPL 1RMFL 3GSUB 5BVPL 3C08H 4JFQA 4B53A 3KXFB 4H20H 3M17B 4Q2ZB 3RFZC 3LEVL 4KH2A 2PR4H 5B4MD 3NFNA 4IDLA 1YEJL 4HULB 3O3BB 1F5WA 1W0VA 5GHWL 1RD6A 4MDJB 5IT2L 2JJTC 2OQJB 2I25N 4ZPVB 2E3VA 2FEEL 2OSLB 4F7TB 1GOGA 2NX5B 4UB0L 5I8CA 1PYWA 1D9KB 2YA2A 1JNLH 5AUMA 1C5CL 2UUDH 3QXTA 1VKXA 4Y19D 3SDDC 5GZOD 4PLNC 3U0TB 3IFNH 2ADGA 1Z9MA 2GTWA 5D7SH 1AQKL 2WP3O 1A9BB 3P73A 2XZAH 1JTOA 3BKYH 4MVBD 4FQXD 4QHLA 5DRWB 1FVCB 3TH3T 4F37K 4LPUA 5SWSE 3L5WA 4JKKA 4KY1H 3FJTA 2QHRH 4KKCD 1AHWB 2C3HA 4G6ML 1SM3L 1VGKA 2AI0H 2DKUA 3SKNA 4BFEA 4R0LC 5KVFH 43CAB 1VHPA 4JM2F 1Z5LA 1ZV5A 3O0RH 5BZWB 3BT2L 3HC4H 2X4OB 3AC0A 3GUTB 3UTTA 1U92B 4IS6B 3WLWD 5BV7H 3HAEB 4X6DF 1ZLVK 1ONQA 3U83A 2E5EA 3DIFA 1NCWH 4FQJH 1S7RA 5AZEH 3V6FB 4QF1A 3LPGA 3CD4A 4GRMB 2G2RA 1KNOA 4O51A 1WC7A 1A6PA 1NCDH 1AH1A 4OCLC 1DN0B 4C56A 3VW3L 1JGVL 4OZHA 4HWEL 2Y07L 1YJDC 1Z9SA 3PQYA 2PXYC 4TNVK 1Q9KB 4R97B 4PTUA 2IBBA 3NCJL 4GG6A 4X0KA 5KANI 4AMKH 4I48A 1OGAD 3THML 5FO9A 4XH2B 4NN5C 4XMLL 1U93B 3DROB 4P5TB 2OMNA 2Z35A 4JRXB 2E9WA 4XB8A 1AC6A 4Q74A 4GRWH 4JQIL 1B6UA 4EDXA 4HJGA 2GIYA 2IPUK 4DZBB 4NUGH 3QCTL 1AIFB 3U6RB 3MRRA 3BD4A 1MF2L 4HKBA 5EU6D 5SWZD 2MCPL 3RNKB 2VWEC 4WFGD 4LP5A 4MA1C 1C5BL 2ID5A 2VLRA 3F12B 2EKSA 2DDQL 1HHKA 4J3SA 1OM3L 2D7NA 3VA2C 2HT2C 4YHLH 5D7KE 1ZSDA 2L7UA 4P9HH 5CKGA 4Z7WB 3C5SB 5D96B 2ATPA 3N1MC 1ZLWH 4UDUB 1J0ZA 1Z3GL 1LO2L 2IFFH 2I5YH 2ZCKL 4ZPTB 2VLKB 1AD0A 2KUTA 4JG0H 1BVLB 3ARGC 4JM2B 2MJWA 5IMKA 5E8PA 2RR3A 4QRTA 3TYFB 4DQOL 4NZTH 3TIDB 3QNXA 4K71C 1WAAE 5DGRA 4K7PH 5EUKB 1CYGA 3PWPA 4KJYB 2AXGB 5IROA 1A47A 3IDIB 3TYGH 5C0GA 1MUJB 1QNZH 4N9GA 5I1EL 1AGDA 5CMAA 3ILQD 1DBJH 4JFYA 3RIFF 1JUFA 3MNZB 2BSTA 2LQRA 1RURL 5FUCE 4G6KL 5E8DL 1GAFH 4JEGB 3VXQB 3QXDA 3FTGB 3MYJB 1P2CA 4IRJB 4EI5A 5JIIA 3T1FB 3MRBA 3WO3B 2GUOA 4ONHA 3QAZC 1KT2B 4MD5B 4JAMA 1XF3A 2MPAL 5CD3A 4HUVB 1NMCC 1ES0B 4M6AA 4NKIH 1JPSH 4M6NH 2P5WA 2UVEA 3GMNB 3LKPB 3HUJA 5BRZB 1JTTA 1G7LA 1LP9F 2VQ1A 1IZJA 4IRSA 4V1DB 4ELME 1X5LA 2J6EH 3PXJA 4I0CC 4F15C 4ZSOA 3ZHKA 4PJ9B 2KBGA 4N8CL 2BNRE 3ET9F 2FX9H 5ESAB 1DLHA 4ODHL 1MSPA 2AKRB 5MI0B 1UADC 4LEOB 1ZWIA 2QQQA 3OGOE 4NUJA 5IQ7L 1XFPA 4FQLH 4KUZH 3ZSSA 5GISH 5HHVH 2DLFH 1OP3K 2YSSB 4YFLF 3RWIB 3VXMB 4S1QH 4LLQB 5LWYL 2EDJA 2DWDA 4PLKD 5H37G 3MLTB 3MXVH 4P2QD 5ITFB 4K3DH 3BPNC 4AM0A 2XA8L 1A8JH 3VRIA 5F71A 3MJGX 5DRXA 1Q9WA 3TZVB 3QISA 1HQRB 5T3XE 5KW9L 1A7PL 5EO9B 1UM5L 1PGRB 2GJ6E 2LU4A 1II4E 4HPYH 5F1NB 1QPPA 3B4NA 5ERWA 3FZUC 2PO6A 2F9BT 5FECB 4MS8D 2BSRB 4M7JH 2Q6WB 3FQTB 2V7NA 3BZ4B 1INQA 2FLBT 3FB6B 4F3FB 5KSVA 4QRRB 1MAKA 2F53D 4Y8DC 1RJZB 1CQKA 3OKKB 5TF0A 1IGCL 2AEWA 4OM0H 3VGBA 5GJSH 3KR3H 1AGCB 2BCKB 1YEHL 3QJFA 5E6IA 5FFLA 1I75A 1CDIA 2X4RB 5TE4L 1JVKA 2HLAB 5C8JB 2A9MH 4MMZC 4FHBD 5CZXD 5TDOB 2AGJH 1U8IB 1JPTL 3R4DA 4ZO6A 1NBZA 3VD3A 2J5LC 4JFHE 3BRDA 3OR7B 3OPZL 4NKMA 1CDBA 4U1HA 1UKQA 1XF5B 5GZND 1RZGA 4QTHA 1LP9B 2AJSL 1IGFL 5E99L 1PY9A 5IG7B 1CBVL 4YHIA 4X4XA 4JDVB 4NO2B 3RTQA 1N5AA 4NQXB 5F1SA 1XIWB 5CKAA 3P0YH 3MLPA 5IW3A 1T6WA 5K93A 1G84A 4MAUL 5FGRA 4XNQA 2A1WL 2A9NL 5C07B 1P7HL 2F74B 4YK4C 4G3YH 5CJOH 1KB5H 1T7YA 3BPCB 3QDJD 4LLDB 3O45A 2R69L 2VXSL 5DEFA 3VWJC 1RZJL 1XF1A 1FVEB 1S9WB 5TFSL 4PJ7E 1MFBH 1FRGL 1CLOH 1KPVB 2F19H 4RFEA 2NR6C 4NWUL 5AYUL 1U8PA 1S7TA 1XGQB 3P4OA 4BQ6A 2JE8A 4WENB 4M7KH 3K2UL 5KS9F 3W5MA 1NKOA 1JNJA 2Y5EA 5D1XD 1HIML 1JYVA 4YZFF 4PV9B 2I07A 2EDXA 1ACYL 1A3LH 3DV6A 4NN7C 2GSIA 3TLRA 5GS1A 4NM8H 4NJAL 2CQVA 1E4KC 2VE6B 5B4MC 1CGUA 4RRPG 4RAUA 1JGLH 4XGZA 3F58H 1FH5H 1KPRA 5C0FB 4F7PB 3G6AA 1H9VA 3IKKA 2Y06H 3WJJA 1H15A 2LTQB 4YHZH 3GIVB 4YGVA 5D7LE 5I2IB 4M1DH 1G7QB 1PAMA 4MNQA 4MQ7A 3U48A 2VABB 1XGYL 2LV4A 5TF1L 3DNKA 1Q9OA 4OD1L 4Z5RA 4MVBC 2VQUA 4HKXA 3FFCE 3S9DB 1MCWW 2JCCF 2P24B 2WAHA 4WO4C 4PJDF 1CG9B 5AG9A 4LGPB 3P0VH 4MZ2A 4KKCC 3JV5A 2R8SH 2GSGB 1MOEA 3HI1B 1KV3A 3DBXB 3SGJC 2QLVB 1PW3A 2FDBP 1GGIL 2DAVA 4P46A 2F54E 3TPKA 2BC4A 1TVDA 2BRRH 1A7RL 1P69B 2WMPA 2ZNWA 3M8OH 3ARFB 4M4RA 4Y1AB 5CSZB 3FO2A 2HVKA 1T80A 4HWBA 4IMLA 1R3JA 3MJ8B 5DJAA 5GGTA 1L0YA 3P9LB 1T2QL 5CILL 1Y0LA 3FB5B 5F7FA 1BM3H 2B4CH 4P99A 3RKDD 3P2TA 5FYJH 1V5JA 4PJEA 1T1WA 1MQKL 4KAQH 3RY6C 1QTYT 1UM6H 1M05B 1Z6JT 2X42A 5MEOA 4P2RE 4UDTA 2XZZA 1HE7A 4NKDA 3MR9A 5D2LA 5ID1A 2FZ3A 4HMDA 3E6FB 3S5LA 1TQCC 5H35A 5KS9B 2XY1A 4UT9H 4Y4FA 1A4KB 3QPQD 1RK1A 1NCCH 4TTDD 3SDCA 1E28B 1Q8MA 1DLFH 1N7MH 5E5MB 43C9A 4BK4A 5JNYA 5FYKL 5DJ6B 1HCFX 2DLHA 1X4ZA 4MQXD 1T5XA 5IMLB 5E70A 5F7KC 4GXVH 2QADC 3SKJH 5F6HI 4E5XA 1H3GA 4JCMA 1R3IH 2Y36L 4MA7H 3SDYH 3RKPA 4HWBH 1QR1A 3OB0K 4Y89A 4Z76A 2J7LA 3ZE0E 2DYPB 1XCQB 1OCWL 5FUCC 2GW5A 3WFEH 4HG4K 2W07A 4G9DB 3UTOA 3H9HB 4Z9KB 4P3CL 3VMOA 5T1KD 4ZAKA 2VITA 4G8GB 1NUNB 5DI8A 5BQ7B 1FYTD 3ZKMC 4Z7NE 1OSZB 4NRXA 4F2MA 2RB8A 5IFJA 3T4AA 3NN8A 3GSOA 3LQMA 3IFPB 1OSPH 4XCNA 2PW2A 3QO0A 3PGCB 4PJDB 3IT8D 4TULL 3VXPB 3TBSA 2JKXA 3T0EB 4OJFL 1J18A 3U36B 3GZKA 2BOCB 4MA3A 4H5SB 1SVCP 4Q9QH 4WWKD 3MV9D 4M9OA 3PNWA 3MV8E 5JOPE 4OV5B 4H88H 4LSTL 2DQFB 4RZCA 2ZWLT 1IC4H 3UTSE 4YBQC 1GGBH 4NKQB 2C1PB 4AENB 3ARDC 4PGEB 1CGWA 4RISH 3NMEA 2Z92A 3CVIH 3RQ3A 3U0PB 1EJ6A 1FSKB 1F4HA 5DSCB 2DLIA 1FC1A 1RZKH 1AO7E 2YPLB 4Y5VB 1IAIM 2CK0H 4XAKD 1C1EH 4J4PA 1EXUA 2H3NB 3ILQC 2FECL 2KQNA 3O6FA 3ECBA 2P48B 4HF5L 2IAMC 5EO0A 3H0TA 1XGUB 3ARED 4OZFG 3HE7B 1X9QA 5J89A 5JUEL 4KK5D 3B5TA 1INDL 1HHGB 5EPMB 5DWUH 3EFDH 1ZT7A 4H1LA 1MELA 2GJZA 4PRHB 3VXOB 1MCCA 3BESR 4NZJA 5GSRA 5CJXA 4L8CB 4GMSH 3O6ML 4O2FB 4UIMA 4F33B 3C60D 4LVNC 5I1CH 1KEML 3PHSA 5C09A 4EUPA 3HC3H 1YN7B 3LKRA 3BDYH 2FIKB 4X6FB 3N9GL 3MV9E 4XPFH 5EN2B 3HTLX 3QIUD 3T2PA 4TNWK 1J05A 3O3EB 2VDPH 1NGXA 2LABA 1T5WA 4CDGC 1IKNA 5KSBF 1G1CA 2FIRT 4KKBC 4DW2H 1HYSD 1IEBA 3KGRA 2PYFB 3D18A 2D2OA 2ZCLH 4ODXA 1Q72H 4PLKC 1BFTA 3P4NB 2Z8VC 4KVCH 4I8DA 1MCOL 1FZKB 2CDFA 4H1LH 4WTWA 1F58L 1I1AB 2Q20A 4G42A 4KTYA 4G9FD 3MC0A 5I76B 5CJQL 1QBBA 1CS6A 1YEDA 3D5OF 1P1ZA 2NY4B 3KYNA 4Y16C 4DN4H 3SGKC 1CDGA 3BH9A 4Z0BL 5E7BA 1FAIH 3FO9A 3VFNB 4OGXL 1V3LA 3LZFL 2M26A 4IRZL 1RIVL 3V6OE 1AFVH 2H9GB 3HHRB 4MB5A 3MLVL 3LQAC 1I3UA 1LO5B 4M3JA 1T04A 2PYEA 1AC0A 3HI5L 5TE7L 4PJHF 4S2SB 2OI9B 4N0CD 5BO1L 2DQCH 3AS0A 4PJGF 1H3WM 1QFWI 2APFA 2P8PA 5C0CB 3FT4B 5L8JB 2CGRL 3KPSB 5T1MB 5CWSB 5KSAD 4MX7B 1YDPA 3DARA 1RK0A 4LRIA 2XQYG 1VA9A 4QCIB 1F42A 3C2AL 3SE8H 3KNBA 3U30B 3DMMA 1TNMA 2W9LA 2L7JA 1AY1H 4XCEA 3SCMD 3IF1A 2D03H 1FFNA 3CC5A 2CJUH 5LBSH 2ZUQC 3BEWB 1CGVA 4PJXA 1K4CA 4FABL 3KLSA 3B2UD 3RDTA 1ZANH 2HRPL 3LV3A 3ARRA 3BWAB 4PRPE 2CXGA 3FOMA 3DYPA 5JIKA 3K2MC 4APQD 1JRHL 5D7JC 4F7MA 1G9MC 4ZNEA 3QIBA 3RWGA 3LH2H 1CLZH 1UWGL 4HMCA 5ANMB 4LBEB 4E41E 3FQNB 4X6DA 1U36A 4FMFA 4RX4A 1A6AB 2FD6L 2E8YA 4JFDB 3QFJB 3O4OC 1IGMH 5FM8A 2CMRH 2OLDA 4LPWA 4K3JL 4XC1L 3FO1B 3RWHA 1T2JA 1WZMA 4XBPB 4JY5L 5DJ0A 4KC3B 3VXTB 4PJ5B 2EDEA 1O7SA 3HB3C 1DUZB 4HBCH 2JB6B 2OM5A 4PRNB 1GVIA 5DFWH 3UJIH 4JHWH 1QQDA 4GW5A 1E6OL 3BUTA 4Z7UF 4RFNC 4BJLA 2VR4A 1U8MA 1IQDB 4HH8A 3MCLL 4RGOH 4JO4H 3ZDXE 5LGJB 3ZKSD 4HJ0D 25C8L 2AAVA 2NW3B 2VDKL 1BBJB 5IFAL 3C9NB 1NLDH 3HA0A 4L29B 4ZTPH 1RMFH 2IBZY 2YKLL 4PJGB 1OT2A 3CH1B 4QOKB 2FWOB 5IR1A 4R0LB 4YE4L 4MSWB 5C7XL 3O2VL 4OUUB 5GGUB 2Z8WC 3E0GA 4UB0H 3S96B 1C12A 2CKBA 1DQDL 5HYSB 5HHME 1YEIL 4LIQH 1DVFA 3EZ8A 4PJIA 4L3AA 2WBJC 3EW3B 2ADJA 4LVHB 3TFKC 5ICYB 4XWOD 4BSJA 4NT6A 1OAUH 4N90D 3T0BA 1G7MA 3LKOA 2ZPKL 3REWA 1FGVH 3G9VA 2BFVH 2AV7A 2PF6A 3IDXL 2BJML 3NACL 5D71L 5JO5A 2FL5B 1JHLH 4PJCE 3JWDH 4PUBH 4RNRA 1JL8A 1QBML 2LVEA 2XKUA 3IDJA 3X11B 5TH2A 3K80A 3QHFH 4K7FA 3P9MA 4N8PA 1OARH 4HS3A 1WCBA 5IESH 1YY8B 1T22B 1OAXH 2R2HA 4Y4KD 3CXDL 3RJDA 4ZYKA 3ABZA 4MAYD 1T03L 3U7WH 4J12A 3I02B 4JRYD 5FK9A 2J4WH 4ZNCD 2O5YL 1HI6B 2OXHA 3MOBL 1UWXH 1WGOA 4JFPA 5IW1B 3EYFB 3QFDB 2YMXL 2NNAA 2R23A 2WWKT 2EDBA 1IAMA 1C16A 2BVPB 2FLRT 5IMMA 3QB7C 2NTFA 4KHXL 4X99B 1U8QA 3QP3A 3VXUE 3QUZD 2FSEA 2YC1A 3DGGB 4Z7UB 3JTTA 2BNQA 4LFHG 1MHEB 5BOZG 4ZFOL 2X4QB 1D6EA 1EMTL 3BISA 4EJ1C 3OWEA 1AGBA 1XR8B 1BX2A 2EH8H 5H8DA 3PDOA 3QUMA 5DJYB 3OAYK 1JF6A 4NBYB 4PBVC 2OTUB 3BKMH 2ITCA 4JLRA 3BN3B 2V2WB 2VLMD 4LSPL 4MQXC 1TTFA 4D0CA 3D0VA 1W0YT 5JW4M 3QNZB 4I18A 3MREA 3TVMA 1A02N 2W0LA 4U7MA 2DM7A 3QNYA 1B3JA 5FYLD 3QPXL 1YMME 1KLFA 3DUUA 4BA8A 5IOPA 4XHQA 3O9WC 1GGCL 1RU9L 2A0LC 1I3RB 2J88H 4ALAL 3D85A 4K71B 1R0AH 1ETZB 3U4BH 2J8OA 4D9LH 5JHDA 4M48L 3DSFH 5EC1A 5H37H 5KG9B 2YUXA 1KN4H 4KTDH 1FORL 2L4OA 1Y18A 5D70L 3QUMH 1FE8L 4CNIB 1NANH 5C0BB 4ZQKB 4P4KB 2X4UB 1CGXA 4XAWH 5EDXA 4AIZA 4WWKC 3VI4F 1Z9OA 1V7NL 3RIAF 1NC4A 3P4MB 4FQIL 3VFRA 2IGFL 3PWJB 3DLQR 1OTUD 3V7MA 5D7IF 1LDPH 4YUEL 2R0ZH 2AP2A 5ID0A 4KQ3H 4BH8B 4S1RH 2XYCA 3GM0A 5HHNA 1F11A 3QIWA 4RDQF 5C6PB 5C9KA 4X6CA 4YDKL 1ORSA 1NFDE 2ENYA 4A6YL 1PBYA 2CLRA 4QWWC 4OCXL 3O4LD 1AE6H 3GJFK 5KVGL 3MRQB 1MIEL 3QEGL 2ICWB 2NY1D 1CR9H 3LRSA 4U6HB 1QA9B 5HD8D 2MPAH 3LSOB 4UV7H 1BD2B 3V6OC 5J06A 5KTEH 3DV4A 3W82A 3WEXB 3IDNA 1P7KA 5ADPH 3BPNB 1KTLA 4PIRF 3RGVA 4MDIA 4P49A 5EWIL 3WD5H 1MRFL 1H3VA 4ISVA 5EU4A 1B0RA 5GRUH 1VFMA 4RDQG 5C1MB 3ULUD 2MTPA 1A14L 4X4ME 4DN3L 1CK0L 3MRIB 3DX9A 1EUTA 4NHCH 3ARZA 3NIDF 2OK0H 3R8QA 1ZHBB 3I6GB 1L7TH 1ZXQA 4QRPB 2WLYA 3MA9L 3GSWA 5DMIL 3RP1A 3GMLA 1EX0A 5BJTB 3MRPB 1N0XH 4NRZA 4X7SH 1D5IL 4KXZH 1QO3B 2X70A 1XH3A 5I1DA 2V2XA 4HQQH 3ARXA 1HYSC 3KPOB 5T1DH 3RY4A 3CU7A 1YY9D 4KPHH 2AV1A 4QXUL 4JB9H 1WISA 5L2JB 1FG2B 2AVGA 3V4UL 3E2HB 5C0JB 4XI5C 4ZDHB 4V2BA 4ZS7H 3U1SH 3D3VD 2QR0B 5JQ6L 1MREL 4XPAL 1KG0B 4L4VD 2HKFL 3L7EB 2ESVD 4U1KB 3I50L 3BXNA 4Q0XH 5BXFA 3ZL4H 3QH3B 3NFSL 1B4JL 1W0WA 1GHFH 1G7JA 2ZJSL 4WGVB 1X44A 5DUML 2P45B 1A7PH 3QUYA 5KW9H 3ZDYE 4NKOA 5B3JE 2F8VA 3EYUH 2G75A 3VCLB 5D7IB 1K4DA 5F89A 3DHJA 3NAAH 1IGYB 1RSFA 2FHBA 2YD8A 3TWCL 2H8PB 2ZG2A 1ED3B 3QEHA 4LCWE 4PP2B 4OLUL 2ICEB 2Y5TA 1YA5A 3E3QE 2AK4B 5ISZA 1ZA6A 2ADFL 3N85H 5I9QC 4QTIH 3WN5C 5D1ZA 3VFSB 3SBWA 1NMBL 3RHWK 1QBAA 1H5BA 5FA4B 4KJWD 4F37F 1CICA 2X05A 1CFVL 3B2VH 4U6TA 3HI6L 3CLFH 4TOYL 4Q9RL 2OJZL 3MXWL 4O58L 3GSNA 2DS4A 1MI5E 2JCCA 3ROOA 4YK4B 1ZVHA 5SX4H 4NNXA 3GMRA 2AJZA 5FB8B 3TBYB 1OLZA 4U1NB 5HPMB 1UH3A 3C5ZA 4WTZG 3D3VE 3QCVH 1CF8L 4P5KA 3PV7A 2DQJH 2FR4B 1DN2A 3GSRA 1RUQL 5I1GL 3B3IB 4EN3B 3UZVB 4WUUA 4WFFD 3MNWB 3U4EB 3WFCL 2BXZA 3RZCC 4CMMA 4U6VH 1DQMH 4L9DA 3SDAC 2WIIB 1NEZA 3LPFA 3RU8H 3ARTA 3MBEC 4OM1L 5F7HA 4OLVH 1BREA 3O81A 1WAAF 4Q6YA 4NN7B 1F3DJ 1NJ9A 5I74B 4DGYL 3ES6A 4X7CC 5DD0L 3GSNH 3UZEA 5TQ0L 3ZT6A 1H0DB 5FA3A 3ARYA 4KJQC 4MYWB 1JYNA 3V4VL 2DBJA 1KIUA 4AT6B 1QLEL 1CFNA 5E2TH 3STBA 4PRDA 3BHBB 4TVPL 4UINL 5EC2B 1A2YA 1HHHA 2G5BA 3UTTD 3G5ZB 4LF3A 3S37X 4L9LC 4CVUA 4NSKA 4X9HA 3EYSH 3SPVA 2X9XA 3T3MF 2YPVH 5DEGA 4IIQA 3WMSA 4JREC 1Q94B 3QDGA 2HTLC 3LN5B 1ZHNA 4FS0A 4C56D 2CDEB 3UTPD 3U7YL 1JF1A 4F8TA 4M5YH 1N6VA 3NABH 1BQLL 2ZZUT 1MRDH 4HFWA 4RSVA 1XGTB 3BJLA 1BPVA 1FNEB 3QWOB 4OTXL 3P4LA 4HIHB 1U8OA 4L8SA 4GRLA 5AEAA 3CUPA 2Z9TA 3BIBX 3O11B 2NY6D 1GYAA 2EIBA 4R6UA 3MO1B 1HOCB 1T89C 1GGTA 5LGKA 4PGJA 1B9ZA 1DBKL 2IPUG 3WIHH 5DMJB 3K0WA 4HS6B 1AXIB 4HHAB 4XCFL 3BW9B 4OZFA 2QQLL 2NXZC 3WUZA 1FNHA 1FO0A 3HMWL 3GBNH 4HXBL 3QQ4A 5EZIL 1TZIA 4KK9D 4YXKL 5FHBH 3SOBH 1QRNA 4K9EC 1VFBA 1LDSA 3LKSB 4W4OA 4R4ND 1R5VB 3DYMA 1JWMA 3UTTE 1JPGA 4JZNB 4P5MB 4XP5L 4EI6A 2VLRD 1UJ3C 4RMUA 3STZA 3WS6C 1OGAB 5IF0B 2OZ4L 1A7RH 3PIQB 1OAKH 4Y4KC 5DRZA 4FFVC 4MAYC 3L95B 1TQBB 3LS4L 5TDNA 4I3SL 3EO9L 4DOHB 4MNHA 1RHHA 1U42A 2O5ZH 3PQYE 4G5ZH 1HN1A 4I2XA 1KLUB 4ONFL 4P2OA 1BZQK 1MY7A 4K23H 5I1IL 1R3LB 2NW2B 4U7SA 4NWTL 2NPLX 4XC3H 3OKLA 3O8XD 4OZFH 5EU6B 5SWZB 1FO0H 3S3SA 1JFQH 1U8JA 3VE0B 2X4NB 2PTUA 3QQ9D 2R0KH 3WFDH 3PWPD 4ZXBA 1EHLL 5D8JH 2BOBA 4I3RL 2RQ8A 4NZUL 5BVJB 2HJFA 4Y5YC 2IWGA 3H42H 4AZ8A 1OB1A 1U3HA 1MFAH 3CDYA 1BGXH 5F44A 3LKNA 3HMXL 1MJ8L 4RQQB 3NCEB 3D2UB 2VXUL 3ZT5A 4S0SD 5J0BA 5KSBA 5A1AA 4EI5D 3P30L 3VXRA 1FNFA 1OCWH 1DJSA 1I8KA 2HFTA 1S7VA 1YEGL 1KFAH 4BH7A 4YDVB 2JJTA 2Y25A 3ILPB 1TVHB 2P5WD 1LEGB 3QUKB 1A6WH 1P7QB 1X7QA 3FT2A 1EK3A 4HAGA 3UJTL 4BZ1H 2EXYD 3SDDA 4K2UL 5HI5C 3DURA 2D31A 3OGCB 4OCYL 4MWFA 1S7SB 1CLCA 4EVNB 3BZEA 1E0OB 4JZJC 3T4YA 1YEKH 2WINA 3CMGA 4TULH 3QG6B 2IAMB 4XHJD 3WKNA 4K94H 5F9WC 4XMPL 3VMPA 4D3CH 4Z7VF 5DUBB 4ZTOH 4G8FA 1A1OB 4W6XB 3EIFA 5TPWL 1F6FB 4R8WH 4PRAA 3WKML 4QHUB 2HH0L 5T5NF 5GGSA 4OT1H 2ADIA 2EDKA 4R96B 4HJJL 3TBWB 4BFIB 3CFEB 1HXYB 1A6ZA 4Z7OE 5I16B 1L0QA 4J3XA 4LAQL 4LSDA 3GNMH 4U1LB 1G0YR 2Z31A 1B2WH 5TGBB 2EO1A 1I1FB 4ESKA 4FQCL 3MRCA 1NBYB 3KPRE 3QYCA 3LIZH 1PZ5B 4LARH 3DX8B 4KGJA 4OZ4A 5EUOE 3LQZA 1M4KA 1UCBH 5HVFB 3MRMB 4KDTC 4K8RL 4RBPK 3KPLA 5B8CC 3MRFB 4JPVL 4L3EA 4HF5H 3RVVD 2PO6D 5I1JH 5MERB 4QY8B 2A77L 3VA6A 1WUNT 2P42B 1XR9B 3ZKNC 4CBPA 4KRPC 1X4XA 5DC0A 1TCRA 2GQHA 3IXTB 5T5NG 4LGSB 4HWNA 2PXYA 2AABL 4D0DB 2W1NA 2XZCH 2RHEA 3PWUB 1UXSB 3J7HA 5I17B 3O6MH 4R3SB 3OHXB 2R2EA 1N6UA 4P2QB 4YHYC 1LEIA 4JFZH 4OLZL 4O02H 3B83A 5LAXB 2GEEA 1RIHH 2JF1A 2XN9E 3E3QC 1DEDA 4JFFA 3ULUC 1U8LB 3LMJL 1RUAH 2AJXH 4PJBB 2WW8A 2AXFA 5D4QA 4OZGB 3VI3E 1H3PH 1JGDB 5HDBE 2ED9A 1RIUL 1FFRA 3HR5B 4JHBA 3QA3A 3MUHL 2I60L 1S9VB 2YRLA 3GIZL 2HJLB 4M61A 4NQCE 4J1UA 4N1EA 1CN4A 4OF7A 5MENA 3L9RB 3NFPA 4U0RC 4UV4L 4XTRC 4WVRA 2VDNL 4JO1H 2F53B 2QSVA 5CCKL 4R4BA 1YJDH 5I1KL 1NGZA 1IT9L 1NAMA 3RTQD 4POZC 2EDDA 3T2NH 2R2BA 2DQTL 3IFLL 4K07A 4PGBA 4AEEA 4JPWH 4GXUM 4WJ5A 4Z7VB 1GRWA 2X1QA 3HCVA 4ORZC 2PKDA 1AGEB 2DQEH 1A0QL 4X6EB 3SEPA 5AWNL 2XY2A 2VDMH 2OR7A 3QDME 4ZOCA 2Q3AA 3D1MC 5DZLA 3OJDB 4N0YH 3NCYS 1SJHA 1A4JB 1RJLB 3HZMA 1QSED 2DIAA 1NGYB 5C08A 4S1DD 2CRYA 4PLJD 4TQEL 1RULL 4WW1B 2NY2C 1S9XA 5L2KA 1EEYB 1EGJA 2AERT 1MCKA 4PY7B 3D0LA 5C6TH 3O3DA 5CZVL 1GZQB 1WBXB 1K2DB 5HGAA 4JJ5A 3WNNA 4OIIH 1FL6A 3FO0H 4GAJH 3VFPA 2DTSA 1PQZA 3QI9A 3QDJB 4XNUL 4Z7QE 4LLYA 1R24A 3MJ7A 4IOIA 1PZUB 1OY3B 4Z7NF 2YD9A 3MLXL 3FFCB 5I66A 4DVRH 1MJ7H 1HWHB 1S7XB 2BVEA 2A73A 1UWGH 1ZT4B 1E4XH 2A6JA 4FQ1L 2R4RH 2OP4L 4IMKC 4WFED 4NBZB 1QLRA 1TJGL 3FFDB 3AFLA 4MNQD 1FZJA 4ODWB 2HWZL 3CFBA 2BSSA 1MJUL 4XNZC 5FYJD 4R7NA 1IEAA 1RZ8B 5EB9A 5HGHB 4JZOA 4PJAA 3VG9B 3W0WE 1FFQA 4K3JH 3NIGE 1G7PB 3ZE2E 1I7ZA 1K6QH 3MLUL 4DCQA 1QSVA 4UTAL 2GAZA 4DJMA 1CCZA 3Q1SL 3VMNA 2BVYA 5K9OB 4HZLB 2P5EE 4P46D 5IVXB 1UM4H 5GGRY 4RIRB 2EE6A 1MFDH 5L8LB 3GGWA 5HDOA 5CEXB 3LEYH 1JHKL 4BQ8A 3FQUB 4JFEA 3QZWB 1ZAGA 3TJHC 5JOEA 4OF0A 1WZ1H 3JWOL 4RAVA 3HPLA 5GGRB 3PHOA 3F7VA 5JIPA 4IM8A 1HK6A 1QFWM 3IXAA 2VZSA 1MCPL 5DK0B 2P8LA 2R0WH 1NCUA 3O6KL 4YHPB 1L9MA 1CXIA 2WIMA 4UZGA 1RZ7H 4FG6C 4HIEA 5C2UB 3MV7A 4RCAA 3DSNA 3DRTA 3DX7A 1LE5A 3MSPA 1F4YL 4OUOA 4LPYA 1PFCA 1EEZB 2IPTH 3TCLA 1LEKA 1DQDH 2E6JA 1HWGB 5K9QG 2GYSA 4Y4FD 3FONB 1AXTH 1WJ3A 4EBQH 2NY6C 1CFTA 1IAOA 4X6BA 2B0SH 4CVWA 3SDCD 1HH9A 5GS0L 3GI8L 3IVKA 2R56L 4WFHD 2AK1H 3QQ3B 5FM5O 1X4YA 3T2QA 5HYJA 3DXAE 1NCAH 1P5UA 1SY6A 3GSQB 3QWRA 3L7FA 2I9TB 4X9BA 3VGAB 5DO2C 3TV3H 1G7IB 4GSDH 1S8DB 1INEL 3CX5K 2PW1A 3EOBA 4WDIB 3CFJB 2YZ1A 4U6YB 3CXHJ 5EZJA 4N0RA 1LWRA 5DMGD 1YYML 4ZAKD 4H26A 1I9JH 2QSCL 4I9WD 3VFWA 4QHKJ 4RMTA 1FQ9C 1W72A 2CDGB 1DQLH 3V7AE 4FXLA 3RVUC 5I8KL 5C0EA 4TRPH 5C0DA 2FBOJ 4G7VL 1UWEH 1X5IA 5E9DE 4NQSA 2O5YH 4PB0L 4Z95H 3CFKB 4KROC 3BH8B 4TUKH 1R5WB 1ZA3B 2AJVH 2B8OT 1MVUB 1S5HB 2FX7H 5D2LE 4DUVA 3AGVA 1N5YH 2A6KA 3RX7A 4OI9A 4LOUD 3VFTA 2NTSP 4CAGA 3M17A 2Z4QB 3RUGE 1IQWH 3RPIB 4HIXH 4PPTA 4LGRB 3IETB 5T1KB 1C5DB 2OSLA 1LD9B 4NGHL 4QRUA 2C3VA 2R9HD 1NLBH 3H7BB 1EMTH 3C6LC 1FYTB 2IBZX 5E8OB 4LCYA 4J4PD 1ZLUK 4X80L 4XVUC 5IB1B 1W72H 3IDMA 5E4IA 5IFHH 2H1PH 3O6FD 4DWHA 4TSBL 3NA4A 3TA3C 2OXGA 4JHAL 5DRWA 3V4PL 4WWKB 2IH3A 1D6VL 5DUPL 3UJJH 3MV9B 3BPOB 4EI5C 5FYKU 1TZHB 3ARVA 4AH2A 2R4SH 1CGSH 2JIXA 1ZVSA 2N4IA 1AHWA 4TSAH 2UYLB 5L88L 1NGPL 2XRAL 3VXSD 4MLSA 1TVBA 2DJSA 1J9CT 1Y6KR 4LNVA 5HGBA 4IRSC 5C09D 3VRJB 4KDVA 2X4OA 3JVGA 1F4WL 5JPMB 4GW1A 4M02A 5D5MF 3S34L 4H8WC 2EDTA 1WEJL 3VD4A 1K8IA 3RVWD 1MAJA 5DD5H 2SEBA 1KPUB 2R1XA 3AREB 3IU3B 4M43L 1IARB 4OF3A 1XGRA 3UMTA 1F02I 5IHZA 5ECJE 4WO4A 3H9SE 4KMQA 3UO1H 1ZEAH 3G6JB 3U4AA 3BRGC 4G7YH 3VXNB 4HH9B 4HX1B 5IJVA 2A6IB 1O5DT 5T1LA 2NCMA 3HE6A 4YUEH 2DBLH 3BJ91 2F5AL 1N3NB 4GQPH 4X7TB 5E2WH 5F1KC 5HDQL 1DDHB 3C60B 4XP4H 4Y2OA 1IAIL 4YXLH 4XH2A 5B38B 1ZT1B 4NQVA 3DROA 4P5TA 1YN6B 3IJHA 3WDIA 4WI5A 4JRXA 3QIUB 5E2VL 1KJ2L 2BNUA 4PREA 3CNKA 5JXAL 3VG0L 3TJEH 3L3DA 4AY0A 4EOWL 2ICWJ 1YNKL 3MMEA 4DK6A 2Y7QA 2PYED 4XPHL 1VSCA 4UIKL 1U58B 3PJSB 5GRJL 3DUSA 1FVDA 2DLTA 1HSBB 4GLRI 5FGBC 5F88B 1ROWA 5E4EB 4LCUB 5IBTH 3RWJB 5IIEB 3FT3B 5HHQB 5FOJA 4RFOL 4PJCF 5EWIH 1T20B 4G9FB 5CEZL 5E6IC 4CW1A 3DMMD 3DVGA 3O2DA 5ITBL 1A6VH 3DPBA 3HNSH 2R0LL 2C1OB 2IH1A 1WAAA 4YHKL 3MOAH 2FGWL 4LU5H 2CIIB 4XPBL 2V5SA 4Q58C 4HUWA 3RDTD 3W39B 5C6WH 3I3BA 2XWBA 3WIFB 3OXSB 4PB9H 2FATL 3NZHH 5ADOL 4HIIB 4HLZG 1OAYL 3HS0B 4MJ6A 4G8IB 1FNGA 3QIBD 1MCSA 1TMCB 4LPTA 1FZMA 3O2WL 1PKOA 4YX2L 5HY9B 1A7QL 5I30L 2R2CA 5D5MB 4HC1A 1OAZL 1U95B 1WTGT 5KSAB 1CD1B 1Q0XH 5F7MC 3STLB 3MA7A 4RX4D 1VACB 3VGHA 4WV1B 3MZTA 5K9JL 3FQRA 3S3JA 1ZTXL 2ZKHL 1FL5B 2FEEI 3SCMB 1OPGL 4PGDA 3REVA 3KJ6L 4N68A 4ELMA 3O2DH 5LGHH 1D5ZA 1OTSD 1NPUA 4HWZB 5LXGH 2D7TH 3O6LH 4P2CG 2VLJA 3QBTB 2BNRA 1I3VA 3V0WL 4OB5L 2QKIB 4APQB 4MD5A 2EZ0D 2P8MB 1RVFL 2XKNA 5ILTL 3W81A 1GL4B 3IAPA 4OLXL 3ARDA 5FYLL 3HPJA 2H2SD 3BE1H 5FUZL 1AD9B 3RA7L 2XWTB 4TPRH 1MPAH 4ZMAT 5BRZA 3HNVH 1HQ4A 2BK8A 3UTQA 3MBEB 3T65B 5DK2B 1NBVH 3ARUA 4NO0D 5GRYA 3NZ8A 2JK5B 1NUDA 4I4WB 5DVOA 5ESAA 1K3ZA 3CDGB 3B8SA 3MLRL 4MCZB 2JB5L 5GS1C 5CBEB 4UBDD 3ZSTA 3UTZB 1UQSB 5GSVB 1N2RA 5HGDA 1G6RA 1SBSH 4L8BB 4ETQB 2GJ6A 5D93B 1BJ1J 3LRHA 2EIDA 4LLQA 1MIML 5BOPA 3F7RA 4XMKL 1DVFD 2X4PA 1RUQH 2Q1EA 4NDMB 2Z93B 4CN6A 32C2B 3TBTB 2ILLA 1WICA 4WUKL 5HJ3A 4TUJB 2RGSA 2X89D 4OV6F 5IVZB 3DJ9A 4OFYA 1YEEL 5SX5K 2ZUSA 2X40A 5ESQB 1QFHA 2AQ3A 2Q8AH 1ZHKB 2PETA 4OGZA 2MQCA 3L3KB 1LO4L 3QXAA 3WFBH 4OCRH 3ESUF 4FA8A 4WU5B 1X5YA 3TT1H 3QEQE 5CGYC 1KGCE 1NFDF 2VL5B 2Q8BL 1AP2A 5CEYA 3R8BB 3ARSA 3MFFA 3ESVF 1KCRL 3NTCL 5I71B 1KJ2B 1G6RH 1S78D 3BP4B 5T3XH 1OLLA 5CP3A 2X41A 1RZFL 3D69B 1OWWA 4U0QB 4QLRA 4X9FA 5JW5B 5JZ7C 4XT1C 2MMXA 3DX6A 1MLBB 2IQ9L 3KPNB 3NPSC 4J3OC 1LK3L 1NFKA 2FX8L 2VXTH 4Y16A 5MEQB 2MKWA 3SGKA 2GK0B 5F70A 5B39B 2Y1VA 2ZSWB 4ELKB 3FMGH 5CGTA 4ZFFA 4XP6H 2XIDA 5TDOA 1VFUA 3W5NA 2GK2A 5EZOH 3VGFA 5F3BA 4PJIE 3IB4A 4XNXL 3WDJA 4GAGL 1I7RB 3PWVA 3OR7A 5I15H 3TGXA 2BNQD 3I75B 3A6CH 1FIEA 1YNLH 3E6HA 2YWYA 3LDBC 1BZ9A 1KIRA 4Y4KB 4U1MA 1UZ8B 4MAYB 3VWKA 3MCKB 3SDCC 4KJPD 5JOFB 2CLVA 4NQXA 3EO0A 4JRYB 2IJ0C 3S37H 4H25B 1SYSB 1WWCA 2IALB 3QQNA 5CP3H 3SE3A 4PJ7A 4ZS6D 3UC0L 5FGCE 3TVMD 1OP3H 3S4SG 5C07D 1ULVA 4G6JH 1UEYA 5CEZE 3FN9A 3C08L 4JFOA 4XZUB 3D6GA 5I1AA 3MBXH 4L8DB 2XXCB 2O5XH 5J9PA 5C0AE 3U46B 3IDUA 4LSVH 5ACZB 2EC8A 3D85D 3EDFA 4MD0B 3QUZB 4NNPH 5D7JA 1CFBA 5JHDD 1N8ZA 4F7CB 4ZAKC 3LQAH 3Q6FB 3V9FA 1L0XA 1JPFA 2P7TB 3HZVA 4RAHA 3R1GH 1L6ZA 3IFNL 5HVGB 1XGQA 5D7SL 3EOAA 4I3SH 4X4YB 1DUYB 5KJRH 2XZAL 3BKYL 1M7DB 4HK3J 4X5WB 1CT8B 2X1XR 3ULUF 4BQBA 1NC4D 5D7LA 1OW0A 4MJ5A 3P40A 4KY1L 4ZOAA 4YDJB 2QHRL 2YBRA 1CIUA 2O61B 4MCYB 2AI0L 5KVFL 4LCIH 2VE6A 3IDGA 3I9GH 1ODAA 1SJXA 1B90A 1ZHLB 5LQBH 3O0RL 3HC4L 4F7PA 4NO5A 4BKLA 4PGCA 4QRQB 4I5BB 4JCLA 1G9MH 3QIWD 5J4MA 4ODSH 5E2JA 4J4PC 3UYPA 5BV7L 4AEHH 3EJZD 4JZJB 3S4SB 3GIVA 5I2IA 2F54A 3BMVA 1NCWL 4FQJL 3WLBB 5AZEL 3LRGA 4R7DB 3O6FC 5F9WB 3BIKA 4PJFB 3HMXH 5DK3A 1NGWA 4B5EA 1NCDL 2XTJE 1BEYH 3P0GB 4MXWH 2CSPA 2D0HA 4KKLD 1A6TA 2OBGA 1AXSA 5DHYB 2GSGA 2W9DL 1WIPA 4LKCA 5EBLA 1EZVX 4N0UE 4AMKL 1S9YB 4MJIA 3OQ3B 3MACH 5F9OL 5A2JH 1CXEA 4JDZA 5DDHB 3AXLA 5IMOB 4P2RA 1X5XA 3SDXB 1QVOB 5FM5M 3NA9H 1S7QA 2XPGA 3B9KC 3WCYA 4P23D 3FB5A 3OL2A 1AR1D 2F5BH 3UEZA 2ZCHH 2NY1B 3V52H 3EGSA 4QKXB 1I4FA 3RHWF 1T0MA 2PTTB 1KJMA 5FF6B 1EIBA 1I9RH 2PCPB 2X4TB 4KI5E 3HZYB 4LAQH 2NXYD 4YHLL 3VJ6A 2DIJA 1JHTB 3BI9X 1MCDA 4BSWB 5EU5A 3HRZA 2IQAB 2Z91B 3S98A 3MGOA 3QUYD 5HHOE 2OJEA 2MNUA 2IFFL 3TM6A 2DQHH 2I5YL 1BBDH 3D25B 3U2SA 3CIQA 5DC9B 4JG0L 3LKQA 2DYPA 1XCQA 3CU1A 5E1AB 3FB7A 1M7IB 1CQYA 8FABA 3ULVD 1UB5B 3QUXC 4AEIH 5ESVA 1MHCB 3RL2B 4NZTL 4NPYA 2VR9A 4K7PL 3BPLC 3MV8A 4AG4L 5DTFB 3D3VB 5D1ZD 1FZOB 2BVQA 1FLTX 3LEXA 4HUUA 3TYGL 3U7AA 3MRKB 3UTSA 4L4VB 3V5HA 4PG9A 1CICD 1QNZL 2ESVB 3Q3GB 2BDNH 2H32A 1M6OA 4YNYA 1VFOA 1XCTA 4GRWF 1DBJL 3QRGL 2NYYC 1PKQA 4L4TE 4LASH 2YUVA 3RX5A 1AO7A 3ARWA 4TN9A 2H6PB 1BZ7B 2YN5A 5JDSA 3RDTC 4WI7A 3DECA 2BY3A 3VH8A 3C5ZD 1KELH 4RMQA 5JXEA 4WI8A 4OV5A 4YDLB 1I3GH 3DVNA 3O9WA 4OZHF 1P4LA 4JFXB 2P4AB 4UV4H 1P4BH 4KUCD 4NKIL 1T7XA 1JPSL 4M6NL 1JN6B 2NY3D 5F7DB 5LG1A 3EO1B 1IT9H 2NY2B 1MFEL 4WUUD 2GITA 4YR6B 3EDKA 1D5XA 2RFXA 2VISA 4MXVE 4DTGH 4GG6F 1ZGLB 1JWSB 4MXQD 2VKXA 5H94B 2FX9L 4OD2A 3EJYC 3DRQA 1YPZB 2H32H 4FNLL 4JFQB 3ULVE 4PRID 1AR2A 1VEPA 1DANU 3QHTC 5FXCH 4FQLL 5ISZE 4KUZL 3NPZB 1KCSH 5HHVL 2DLFL 1W0VB 2X1OA 3RWCA 4DEPC 5HI3C 5I8CB 1K3IA 1PYWB 4S1QL 4HKZA 2EZ0C 5BV7B 5AUMB 1VKXB 2X6MA 2H2SC 3W9DB 4JRWA 3MXVL 1BOYA 2A38A 3MRGA 4KWUA 4TQEH 2ADGB 4O2FA 3HC0A 3OX8A 4K3DL 4ZUTA 1QOKA 3P73B 4D94A 4QHLB 1KENH 2AJ3A 3OB0H 4H0HB 5KANG 3OKMA 4HPYL 3L5WB 2V17H 1GOFA 4B0MM 5FV1L 4LLVB 1VGKB 2IBGA 2VN4A 3SKNB 3IJSA 1A22B 4KDWA 4M7JL 4LK4A 3VD7A 4S1SH 3V6ZB 2PYFA 4L1HA 3SKOA 1BVKA 3MROB 4NO3B 1I1RA 5KN5B 3K7UA 3EYQD 4GRWB 3UTTB 3WL9A 3KPQA 4ONGH 5B22A 4ENEC 1ONQB 4OM0L 5GJSL 1E27A 3DIFB 3KR3L 3WV0A 2HWZH 1S7RB 5I6XB 4QF1B 1J1PH 4WHDA 3HNTH 1TIUA 2A9ML 1KNOB 2YRZA 1WC7B 4O51B 4UOW1 1VB9A 2AGJL 1OP5K 5D9SA 4C56B 1QRND 3Q0HA 1X5GA 4OZHB 4CKVX 2B39A 3PQYB 4ODVH 1BLNA 2V9TA 4FZEH 2H9GA 1A1MA 1F4XH 4LCCC 4M00A 2VN7A 4PTUB 3ARPA 5EUOF 5E03A 1IC7H 4GG6B 4LEXH 2GY7B 2CR6A 2BHUA 2NY6B 3ZYOA 5FO9B 1FYHB 2P1YA 3FRUA 5CINH 4LDLB 5T1MA 4ZUUA 1HZHH 2Z35B 3ZE1E 3QDGE 1B4RA 1PD6A 3P0YL 4K7PY 3JWOH 3B6SA 4KK6D 5TJWK 4EDXB 1AQDA 2Q7NA 4P2OD 2K7PA 1NQBA 3MRRB 4G3YL 4NQEE 4HKBB 5CJOL 1VFAB 1DE4A 4EXKA 1JF5A 1KB5L 5JQHC 5J57B 4P3WA 4OLYH 5JIHA 2W65B 3BWAA 4YHMH 2VLRB 2NY0D 2EKSB 1HHKB 5GS3A 4ZXBD 2X4SA 3VI3F 1MFBL 2F19L 1CLOL 1AGFA 1N0LA 3IU4L 1ZSDB 4LBEA 4KJP