2YPVL

Crystal structure of the meningococcal vaccine antigen factor h binding protein in complex with a bactericidal antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'DIVLTQSPSSIYASLGERVTLTCKASQDIHNYLNWFQQKPGKSPKTLIYRANRLVDGVPSRFSGGGSGQDYSLTISSLEFEDIGIYYCLQYDEFPPTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOPROTEIN
molecule tags Immune system
source organism Neisseria meningitidis mc58
publication title Defining a Protective Epitope on Factor H Binding Protein, a Key Meningococcal Virulence Factor and Vaccine Antigen.
pubmed doi rcsb
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvL01
4PR5B 1BQLL 4UV4H 5DRWB 1I3VA 5IB2B 4BZYA 3BH9A 4PBWD 4YDVB 4LEOA 3QA3A 3BT2H 3P0YL 3IXTA 1QFWH 4J4PC 2ZWLT 2FX7L 2WINA 4KJPD 4I18C 1YNKL 2Q6WB 3RL2A 3H3PL 3HA0A 1A3LL 3PXHA 1E0OB 3EO0B 4ZO7A 2EO9A 4X5WB 5TQ2L 2C5DC 1SYSB 4KWUA 3CH8A 3FRPG 4PLKD 2N56A 4P2QB 3HB3C 3LPWA 2UY7A 2EDWA 2BNRA 3BKYL 2PYED 2R2EA 4JHBA 1HOCA 4X7CC 1QBLL 5I6XC 5IMLA 2UWEB 3V4VL 4AY0A 5SWQB 2QL1A 4OZIF 4OSUL 5IFHH 1NC4D 1SY6L 3P30L 2P4AB 2HT4C 4ELKA 4N8PA 1D9KC 5HY9B 2FEDC 3CSYB 1PVHA 4IBLT 3MUZ1 4HWBL 1IL1B 2WV3A 4L3ED 1PZ5B 1QKZH 1WFUA 4EN3A 4K94H 4CMHB 1FL6B 2BVQB 5C2BL 1GIGL 5DJZB 5E7FA 3DSFH 5IQ7H 1IAMA 5HYEA 1UEYA 5E8OB 3C5JB 3SE3A 4DW2L 5H37H 3IGAA 4Z7WE 1MUJB 3QPQD 4OCWH 1SJEB 4YE4L 5JW3L 2EEAA 4XBEL 5E24E 2Q1EA 4XCNA 5CSBA 3NTCH 3LEVL 5B4MC 1TJHL 3EZ8A 3RBSA 1FO0L 1I8KA 5E6ZA 5HVGB 5IHUH 2ESVE 4OQ1A 3VXUE 4XH2B 1NFDB 1T83C 5CD5D 4S11A 1H0DA 4JRXE 3VFWA 5DT1L 3B2UD 1QFOA 4YQXL 4WO4D 4NQUA 3GSWA 2G60H 4M7LL 1TJGH 2DS4A 2CH8A 3HR6A 2WP3O 3PGFL 3G5ZA 4BSWA 3LIZL 4U33A 2NY4C 4DQOL 4HIJA 5I17B 1CT8B 4G6KH 1V05A 4M1DH 1T04A 3JVGC 4XC3H 1BPVA 1OGAB 1MI5E 3T4YA 4NKOA 1CLZL 3MLWH 1PY4A 5D1XA 2DWEB 4PV8B 4NPYB 4C83A 1KYOJ 4GBXC 4KKNA 4GMTL 4K8RL 3OR6B 2APXA 2VKWA 3G04A 2Z8VC 3TF7C 2E6JA 1KJVA 4LOUD 2FZ3B 2HJFB 1CFNB 1MHHB 3BYYA 2LTQB 1XEDA 3VXUD 2OQJA 1OAYL 3GMRA 4R26L 1P5VA 5D70H 5DJ0A 3QZWG 2W9DL 2W91A 5DTFA 5GRZA 2EYRB 4GBXD 1RUKH 2Y5EA 4LCWA 1JN6A 2YD4A 4QNPF 1I1AB 3FL7A 4LCIH 1ZGLA 4EI6A 5DURD 4ZXBD 5BJTB 3JV4A 4OZ4A 4AL8L 4E41E 3JSSA 4H8WH 1S9WB 1G7HA 1T5XA 5CKGA 4Y2DA 4HIEA 1V5JA 2E7HA 4N0FB 4X6CB 5IW1A 2DMKA 4POUB 1AGFB 2EH8L 1HHIB 1HHKB 5D8JH 2WANA 1A1OB 1BQSA 1NGQL 3BKCH 5A2IH 5HGBA 3BD3A 1JWSB 2D7OA 4MJ4A 1CG9A 3PGDB 4OJFL 2DRUA 2R0WL 4MAUH 1KCRH 1VFBA 1W8OA 3BEVB 3UAJC 3C6LB 2W38A 5DUPH 1ZA3B 4PJBE 4HQQH 4UDTB 4WI2A 4F9PC 1UJ3B 4NT6B 2ZCKH 4U1HA 3V0VB 4EUPA 2IWGA 5JLZB 4PJIE 3L1OH 5C09A 5I73B 3KJ6L 4P4KB 4PG9B 5DT1H 4WWKA 1U8IB 3TIEB 1A5FL 1X5LA 2EYSA 2G60L 1RZ7H 1UQSA 3WUWB 5DFVD 1OOAA 4YGVB 1U8OA 3CZFB 3RY6A 3IAGC 2O5ZL 5C0DB 3ZKSD 5DRXB 1QSEE 4GG6B 1I9JL 3GJFB 1NFIB 1JHLL 4LCWE 2R39A 5ELIA 5D2LB 2Q3ZA 2V5RA 1HHGA 3V8OA 5EIVA 1FIGH 5I1GL 2YN3A 4PLNC 3RWFB 1JPFB 4JM2B 4X6BB 5LXGL 4M1DL 1J18A 3FN0H 4RIRA 3AAZA 1G0DA 4TRPL 1KXTB 1MI5B 3TO4B 3LN5A 2VUYA 4XP4L 3KPOA 5C08B 4V1DA 1I8MB 3KR3H 2B4CL 5DJXB 1JGUL 2A9MH 4HUXA 1NFDF 3IFPA 1JJUA 1UYWH 1A7NL 1FJ1B 5HGHA 1CIDA 2OM5A 3QWQB 5LCVH 1RAMA 3WIHH 2BNUB 3THMH 5C0BB 3DUSA 4Y2DD 3NH7L 4Y1AE 1A1MA 1DUZB 2BNQE 2VXTH 3RWHB 1LWRA 5ICZB 1BF8A 5I18L 1TQCC 4RFOH 3W0WB 3D85D 1HSBB 1OPGH 1I1FA 3H3PH 3LKPB 4JY4B 3JUYA 5F1IB 3L5WB 5DK0B 2NNAA 2FD6H 4RFEA 4S1QH 2IBBA 4YIQB 5C8JB 4ACPA 5TDNA 1ES0B 3LN4A 3RHWK 3M8OH 4QHUA 4EI5C 5JHDA 1S3KH 5FV2A 1ZHKA 5H8DA 1QZ1A 3MXVL 2VE6A 5EU5A 1ZS8A 4D0BB 3SKOA 3VXUA 5ANMA 3IFLH 1DSFL 1MEXL 3MROA 4NJ9H 1B0WA 4LLWA 1P9MA 5MEPB 3OKEB 3CSBA 4LHJB 1T5WA 4P5KB 3QG6A 3PP4L 1RHHB 2CLZB 1QBAA 2VLLA 4RGNB 4TTDC 4XBGB 5C09E 4UUJA 1RZJL 4URTB 4BH7B 2FL5A 2VDNH 3FFCA 1U8NA 4M5ZL 2HFFA 3O3AA 4MD4A 2BK8A 1B88A 1EVUA 2PTVA 3CVHA 5FA3B 4W4OA 2QR0B 2VISA 3DUUB 3P40A 4YBQD 4D2NA 1Y6NR 5DD1L 2WQ8A 2FJGB 5CEZL 1RJCA 2CMRH 1FDLH 2XICA 1CI5A 4MXWL 4OF6A 1MLCA 2R2HA 4M93C 4NJAL 1S9XB 3JTTA 4K7FA 2DQJL 3QUXB 4MQTB 1WT5C 4OQTL 2VLJA 4WI8A 4JFYA 1ZV5A 4N0RA 3O3BA 4U1GB 2P8PA 2HJLA 2J7LA 2CPCA 2F5BL 2OX5A 3SE4C 4Z9KB 3T77B 4HS3A 2VTFA 4LCUB 1MELA 1LK2A 4EXKA 5KSUA 5GGRB 5IEHB 4HK3N 5DHVA 3X3GH 1BHGA 1ZLSL 4MA1B 5ISZD 4UQ3A 1FGVH 2NXYB 2OCFD 4Y2OA 1RU9L 4ZO6A 4EQ3A 3RVWD 2W0KA 1ZLWH 5LGHL 1FAKT 1LO5B 1Q1JH 2YKLL 4XHJD 1BVKA 4YBQC 5EZOL 2AV1B 2IPTH 2BNQA 1CFVH 3MMEA 1X5KA 1X7QA 2I60L 4JDVB 5BRZA 3MNWA 3V4VH 2IMNA 4Z7VB 4FG6D 5EOTA 1UFUA 4P2RB 1Q9LA 4DZ8A 2XWBB 3P30H 1JK8A 4PRHE 4GXVL 2FRGP 3KXFE 2WWMC 2VXUL 1T89C 2QADD 3NZHL 1C5CL 3G9AB 1FNEB 2IFGA 4GS7C 1TQBC 4P2CG 3SPVA 5C7XH 4YXHL 4NJ9L 3RNQA 2R2BA 3GSNB 1KLUB 1QLEH 1UXSA 2A74B 3H0TA 3IDGB 1MCBA 5HYQA 4P46C 1C1EL 3KPSE 5JOFA 1INEH 2DQIH 1RZFH 3V95A 4ALAL 4NN5B 1S5HB 1IGIL 3U79A 2JJWA 4M1CC 1YEKH 3G5XA 5D6DC 1PQZA 1Q94A 4FFYH 3AC0A 4YDLB 3CJJA 3O11B 5B3JE 3WXVL 3KPRB 2C1OA 5JR1L 1KFAH 4BFEA 1OP5K 4GSDL 4ERSH 1N5AB 1MFEH 2PCPB 4MJ2A 5JA9A 3DPBA 5KVEH 4NIKB 5HHMB 2EKSB 1FZMB 4KJYA 4D9LH 5I6XB 2GYSA 1REIA 3PGFH 4Y8DC 1GC1C 4YPGA 1DQJB 1Y6MR 3L7FA 1U92A 2HKFL 4BM7A 3GMNB 2OSLA 3EGSB 3CXHJ 4J3WA 1AD0A 2EIEA 1T0NA 2NY4B 1LEKB 3EYOB 3REWA 3TYFA 1NCDL 3S37X 1EAJA 5C07D 4IS6A 5I76A 2YS4A 4NDMA 2OMBA 4XI5D 3TBWA 3GSQA 4I0PA 3SDAC 5BS0A 43CAB 5LQBH 5T1DL 4PJGF 4DGYH 3S36H 5KVGL 4Y16B 3SQBA 2G2RB 3D9AL 4JM4H 2W0FB 5CUSL 3U0WH 3MRMB 5I2IB 5LXGH 2YR3A 4QRPD 3G5YA 3QUML 5JXEC 1WITA 1MUJA 5FKAA 3L3OB 2VO5A 4GFTB 3VXTA 2BHYA 2JK5A 3DMMA 1T2QH 3SGJA 4NQVB 3DO7A 2ESVB 2KL6A 3BPLB 4LKCA 3PV6B 4QRTA 4K71C 1X5XA 1W0WB 3NZHH 1MFAL 1SM3H 3SE4A 1MCPH 3GSVA 4YDIL 1IQWH 1FCGA 2QQLL 4I77H 4NBYB 2UYLA 2F9BT 4EBQL 3MLZL 3L9RB 5HYSA 1AR2A 1XGQB 2DI7A 4XHQA 2IH3B 3AU1A 1A9EB 1PW3A 1HZHL 1A9BB 4HCRH 5HHOB 1CL7L 4RFNC 4TUJA 1YYML 3WLBB 3A6BH 1BVZA 4I9WD 3FZUC 4DUXA 2ZG2A 1TNNA 1JHKL 4QOKD 2ZPKL 2JLLA 5AUMA 3TBTB 3V4UH 1J8HD 3NMEA 1OT1A 3FCTA 2CIKB 2PNDA 4U3CA 2Z35A 4QRPE 3VD7A 3C6LC 4KMTH 1T4KA 2CUHA 2VR9A 5INCB 4MA1C 4WFEE 1IC5L 1AP2B 4POZD 1RPQA 2VL5B 2CKBL 1G9EA 4Q9BA 5MEQB 1P9MC 1T7WA 3T3PF 2AXFB 4UT7H 3TN0C 2VABA 4X6EB 2CD0A 3GMRB 2XTJC 3FFDA 2VZOA 3HAEA 1C08A 4OLVL 5ADOL 2EC9T 3I84A 1N7MH 2R1WB 1N64L 2BSSB 3I75A 1MVUB 4GW5A 4UAOB 1BEYH 4HUVA 1EEZB 4KK6D 3U82B 4QTIH 3HLAA 4IRJA 1VGKA 5EU3A 3DLQR 4PYGA 4GT7A 1KELH 3FFCD 3S36L 2GJ6A 3PHSA 2K1MA 2XPGB 2C4XA 3B43A 1L9MA 3SKJH 3I50H 1E27B 3T1WA 3M17A 1JYVA 4P4RA 5TF1H 4LVNB 4GLRI 4Z6AT 4ZSOE 4TQEL 4N0YH 5TDPA 3NH7H 1ND0A 1L0YA 3VJ6A 1QPPA 4RFOL 3P2TA 2AI0L 2UZYB 4G7YH 1A3RH 5DMIL 5IBUG 1CG9B 2J12B 3TFKC 4R6UA 4J6RH 3SBWA 4JPWL 4BUGA 1T22B 4WUUD 1WBXA 1YNLL 5HPMB 5M7QA 1Y6KR 3GUTB 3HRZB 1FN4A 4WO4B 1GJIA 4H26B 4PY7A 2IFFL 3A67H 3MRKB 4HBCL 2P1YA 4HWBH 3D85A 1MF2L 4I77L 2ARJA 3O45B 1KB9K 4EBQH 3BSZH 3ZYOA 2YZ8A 1RFDH 5DJAB 3UBXA 2E9WA 3ROOB 1NUGA 4L4JA 1RZIB 3WKML 3S96B 1S7TB 1W0VB 4NQDA 1ZVSA 5GHWL 1ZT1B 5CEYB 1KPUB 1INDH 4KC3B 1KTLB 4M7ZC 5EOCL 1TQCB 3FAXA 5SWQA 3FO9A 4NQXB 5T5NF 2C3WA 1S7WB 2IC2A 4Z7WA 4F9PA 1EO8L 4NKDA 1A6UH 3DX7A 3T3MF 2RB8A 3MLYL 1NBYB 3BD4A 5DUBB 5CCKH 3RUGE 4PV9B 4GKNB 1UM4H 2IADB 3DIFB 5LGJB 5JIKA 1J8HE 4XPGH 1EVTC 1F6LL 4F2MB 4KJQC 4TPRH 1TJIH 4HJGB 2DI9A 1N59B 1BD2A 2BXYA 4OD2A 5FOJA 2F58L 4PJDE 4OLWH 3WFBH 4X8XA 2IQ9L 3CFEA 4UIKH 3CC5B 3SGEI 3QUYA 4LCCC 4S1DD 5T5FL 4LDEB 2A6KB 5ICXA 4JM2F 2ZUSA 2DD8H 5GS1A 1A7BA 5EO0B 1YDPA 5LVEA 3NFPB 4Z7UF 4MLSA 4Z5RA 4JGUA 2BJML 3SDXF 12E8H 5I8KL 3UTTA 3HUJE 3MOQA 3IU3A 4OLVH 4BFIA 3BGAA 3O4LD 5IBLD 2X1QA 3VXSA 3BDXA 4NFBA 1C5DA 2WBJB 4HX1B 5KJRH 1KT2A 1Q0YL 4JRXA 3SGKC 4PUBH 4WU5B 1G7JA 3O4LB 4XAKD 3KPNA 1FBIH 4NP4H 3MRGB 4PGZA 2APFA 4PJ9A 3OKMB 3V6OC 1H3XA 1UH3A 3N1PC 4ZUTB 2DDQL 1YEJL 1T3FA 1IILE 4IRSB 4JFHE 5EBLA 3CFBA 2AQ3A 2IPUG 2GITB 1XGTB 2CDEA 3GSRA 5CEXA 4CADA 1T2JA 2O61A 1KIPB 4F9LC 1TZIB 4BZ1L 3FAWA 3ARDA 4G8EB 3WIHA 4NUGL 4K9EL 5DMGC 5J1SC 1HEZA 3DMMC 3MA7B 3NIDE 3RU8L 3U7WH 2HTLD 2D31B 4Z7NF 4UNUA 5EU4B 3HMXL 3K8LA 2XI9A 2Q86B 3OB0H 4ZFFB 3TCLA 2LE9A 4LFHG 4MJIB 1XIWD 5F8QC 4M9OA 2VLME 4CJ1A 1SEQL 1TZHB 3HUJA 4XVJL 5BRZE 1AHWA 4NOFA 1A7PL 1U3HB 1IAOB 4M6OL 1EZVX 1T6WA 5E8PB 5IG7B 1CGUA 4MD5A 1U36A 3PQYA 5FK9A 4D9QD 3L3HB 5AD0A 2Y7QA 4X5XA 1JN6B 1FZJA 1LK2B 2L7JA 4HJ0C 4PB9H 1Y18B 1QSFE 3QEUA 3UCRA 4JFEE 4XPGL 2NY6C 2EC8A 4HQQL 5H35B 3FQUA 4H1LA 1UXWA 4Y4HB 3VMPA 3ZTNH 2XQBH 4H0HB 1AXSB 3VFUB 5GS2H 1YPZF 1CF8H 2OI9C 5E9DB 4W6YB 4MAYC 2IAMC 5I74B 4U0RC 4R2GB 1NL0H 1AQKL 2AV1A 2X89D 4OM0H 4AMKH 4S0TD 2XFXB 3FRUB 1V7NH 3T09A 5JDSB 5E2JA 4L8SB 1NGWB 4QT5B 3OF6A 3O6FA 2FGWH 3E6FB 1AGBA 4Z76A 1RSFA 2EEDA 2PO6C 2FWOB 2ZZUT 2P8LA 3KVQA 5JMRA 5D7IE 4WWKB 3TM6A 3LIZH 3CDFA 5LQBL 2CDFA 3K80A 1H8OA 5C0EA 3ARZA 3F5WA 1ZHLA 3IF1A 5I0ZA 4KV5E 5GGSB 3TGXA 4XCYA 7FABH 1NSNL 4JFZL 4XP5L 3ZE0F 4A6YH 3QHFL 4POZC 4G43B 2EYTB 4JM2A 4X6BA 3EFFB 3QQNA 4O4YL 35C8L 5KVFL 1RIHL 4YDVA 4XZUA 3KJ4C 5HGDB 4P57A 3RAJL 4XVUD 5HI5D 3O41A 1F11A 1G7PA 4M62H 4WO4C 4P2OA 4YDIH 1MHPH 3DMMD 4HGKC 3ESVF 2NY1C 4X4XB 3MACH 4ZOEA 1DSFH 1NJ9B 2VLJE 2R9HD 2HAZA 1AY1L 3CAFA 2R0ZH 3LZFH 3TO4C 5GZNC 2UZIH 1IAKA 1A1MB 1DLFH 4Y5YA 1RUKL 3TWCH 1NC4B 2Y4SA 3WJJC 1LO0H 4LCIL 4QHKJ 3QCUL 2RFXA 2AXJA 5JHLH 3T2PA 4G6AC 1P7HL 2J8UB 5C8JA 2OTPA 2P5WE 3BSZL 5SV3A 2XY1A 1RUAL 3U9UB 4Y5XB 2V7HB 5EN2A 3V5DB 3F62A 1CVSC 2EDHA 5HHNB 5DQJB 2BVYA 3VGAC 2NY2D 2VQTA 1PBYA 2HFTA 3EO0A 4G9FD 3ULSB 2EH8H 4Y4KD 4KMTL 4YHML 1GOHA 1MCIA 3DUHA 1NGQH 4KKAC 4G6MH 4HH9A 1JNHA 1NL0L 1YY8A 4YDLC 3ARXA 4UMGA 2C3VA 5K9OB 4M9PA 4XB8A 3QNZB 3G5YB 3MZTA 5DJ6B 1UADC 3HNSL 4J8RA 5FUOL 2I07B 4G8FA 1RMFL 2HVKA 3DYMA 4KKAD 1CGVA 2J6EA 1BZQK 4OUUA 2AKRB 1MAKA 4YJZL 5D9SA 3OKKA 1OLLA 3QBTB 4W4OC 2VXQH 1KJMA 3PABB 1UVQB 4JQVA 3EO9H 2O5ZH 1G6RB 2IALB 5KSBF 2DKSA 1DN2A 1MY5A 1HXYB 2Z31B 1H0DB 1IGML 1SYVA 4Y88A 1P4LB 4X6FA 4IOIA 4KROB 3O3BB 3ISWA 3VI4E 5KANG 3QUXD 5KJRL 1FORH 3SE8H 4TRPH 3T08A 3VW3L 3QUMB 1WZ1H 4TUJB 4HJJL 1AC6A 5GJSH 3P0VH 3AY4A 1GC1L 1HH6B 4HUUA 5KVFH 5IEHA 2QSCL 4QRPB 1FPTH 1YEEL 4PB0H 2YPKA 5CSZB 4BSVA 4OF7A 1EEYA 3HHRB 1KEGL 3EDEA 2CIKA 4I2XE 1Z9LA 2WWKO 4HJ0D 3UP1A 3O6KL 2A9NH 3PGCA 5C7XL 3CLEL 1JGDA 5EWIH 1AY1H 2DLTA 4P5TB 5IVZA 5D1QB 4Y7MA 3FHAA 4I3RL 2CRMA 4JAMA 3TPKA 3DVGA 2R29H 4JDVA 4L29A 3ZKMC 4APQB 4XMLL 3RGHA 5L2KA 4JO1H 1KB5A 4U6YA 2HT2D 5T3ZH 4KROC 3B9KD 1A6UL 4M5YL 1EUUA 5IBTL 3LHPH 4LNRA 5TE7H 1MQKH 2DQGL 5I8OH 1JZ3A 3QIWB 1CLOH 4NO0D 1FNEA 1AQDB 1G7MA 4MCZA 4PRIE 5HDLA 2D0FA 4TVPE 5FAAA 2WMPA 1Z9SA 1OAUL 1QR4A 5E1AB 3ZT6A 1CD1B 2C4FU 4LPXA 3IDMB 2J8HA 4NPYA 4Y2DB 1K3ZA 3PWJB 5T33H 3HMWH 4HG4J 5KSVA 4ONOA 4RX4D 4FQIH 4AYFA 4YFEA 1JHTB 2FEEI 2YD7A 2CLVB 5EIIA 3RGVD 4XNQA 2ENYA 3KLAA 3QQ3A 4KHTH 1U8KA 3D5OF 3ULVE 1K4DB 3I3EA 5JOPD 5H2BA 4JFHD 3T0AA 2YRPA 3FQNA 3ZKXC 1XH3A 3LQAH 1QSED 4WV1B 1LHZA 4G80B 4WHTB 3KLSA 4QF1A 4YWGL 4NHUA 4QGTA 5C86A 2QSVA 4XCEB 5L9DH 2NYYD 4HMCA 4OBRA 1VCAA 3VWJA 3U2SA 5TQ2H 5L2JB 2F5BH 3KPQB 2VH5H 2HKHH 1U95A 4ODWB 1FV1B 1WWCA 3D9AH 4XMPL 4OCSH 3U0WL 1E4KC 3BKYH 4NZJA 3MRRA 1AGFA 3ZTJH 4NM4H 1XIWA 3FB7A 3RUGB 1LDPH 4YPGB 5IBUB 4EVNA 4TVPD 2QLVB 5DRWA 4F58L 2P47B 3P4OB 2AJVL 3WXWH 3GGWA 2X1WL 3B9AA 5TGBB 3QEGH 1FQ9C 3IDJA 2VDPH 2DM3A 3BEVA 3WO3B 1EJ6A 4PBVC 3OAZK 1SBSL 2C4FT 2NY3B 4OD2B 7FABL 4MB4A 4U1KB 3WFCH 3CLEH 2AS5M 3QNXB 2JKXA 3L3KA 3V6OE 4NN7C 4MXVE 5EFIA 6FABH 5IR1A 4JQXA 1BZ9A 5FDWA 1I8LC 5ALCL 3DUSB 1F2XK 2LQRA 3RAJH 4MHHG 2JCCA 4AEHH 4N9OB 5ICZA 3L3OA 4M48L 2VZUA 1ZHBB 4NQVA 3WFDL 1JFQL 3OKOA 3WJLC 1QQDA 2NY3D 3GMQB 3MR9A 5IB3A 2VDRL 3MLTA 4E5XB 2ZOKA 3SDAD 3IKCB 15C8H 3LN4B 3TBYB 2R1YB 3FO0H 4OGAC 3VXSD 2VZ3A 4JO2L 5EU5B 2BDNH 2BC4B 5F44A 3H9HB 4HGWB 3QI9A 1INEL 4GUPA 3OKMA 1JF5A 4KI5C 3E2HC 2IBZX 4OZHF 4OLXH 2VXVL 4UUJB 1SHMA 4P2YA 5ITFB 1CD9B 3UC0H 4OTXL 2JJVA 1LDSA 4UIMB 3CH1B 1FLRL 2A6DA 1I8IB 3STBA 2ENSA 3FONB 4PGDA 1T03L 3N9GL 5A2FA 5IHZB 1CU4L 3QXAA 3QXTA 4WJ5B 1RIVH 3KPMA 4JPKL 2YC1A 3CLFH 3O9WA 3F7VA 4PY8I 4Z78B 4LIQH 1NLDH 3P9MA 3S36X 3SE3C 3BE1H 3H7BA 4H88L 4I18B 4F7PA 4FTVA 3LV3B 1KELL 1J1PL 2AJXH 4G8IA 3MJ6A 4X0KB 5MEOB 5J6HA 2F54A 3FFCB 1EK3A 4ODTH 4CAGA 4MD4B 3QFJE 5BVPL 2EDYA 4U6HB 1KUMA 5K9JH 1R5VB 4JB9L 2XNAB 4R90L 1WFTA 1V3MA 1NEZG 4J6RL 4ZQKA 4YDJA 1V7ML 4FQ1H 3HE7D 1L7TL 4WTXA 3PDGA 1XGRA 1CZ8H 1N0LA 3LQZB 4ZDHA 4J1UA 3O8XB 1U8LA 1U93A 3RVUC 5FF6B 5E9DA 1WZ1L 3ARPA 4HK0A 1T20B 1DCLA 3ARSA 5ESAB 4UT6H 1TVBB 3PE9A 4PRPA 1NCCL 4Z77B 5D1QD 5KSAB 1U8PB 3ZYIA 4NO5B 4CGTA 4RBPH 4DOHE 1RUPL 4PRDA 1E6JL 3E6FA 4ZO9A 1YMME 3S37H 4YR6B 4RQQA 4OCLC 2YOCA 4OLYL 5EZIH 2HTLC 4P59L 1KIQB 5HPOA 3X13A 1AR1D 3C2SA 2QKIB 3RGVA 2F58H 3ROOA 4RAHA 4WNQB 1TZGH 4RRPG 4I5BB 3VFVA 5F7KC 5T5FH 2M2DA 4M61A 1W72H 1D5BA 4OLXL 1KPVB 4YO0A 2DQHH 4CMMA 5EC1B 2BRRL 2X44D 1FO0H 1Q72L 2EDOA 1MLBA 3HC3H 5J11B 1FC1A 1S5HA 3NN8A 3QJFB 4OT1H 2XWBA 3TN0A 2YWZA 5HGDA 4H1LG 3GI8L 3AMKA 3PL6A 5IFJB 1RIVL 4N5EC 2VN4A 2F8VA 3JWOL 5D72L 3MBXL 5C09B 3N1QC 4ODSH 1KJ3L 3QUYB 4KQ4L 5EUKA 4OCRL 5IJKC 3OBAA 1DDHA 2X9XA 4AG4H 3QDMA 4F7CA 4O51B 4QOKE 5F71A 4X5LA 2WBJC 1DVFC 1XMWA 3KNBA 3WFHB 3GJFA 4WGVB 1J0HA 4LGRB 2EDBA 4R90H 5GJTH 2PYFB 1GC1H 4LDLB 1NBZB 5E2UH 5D5ME 3DSNA 5HHNA 1FNFA 3MO1A 1GHFH 4X7DC 2A73A 5L8KB 5SX5H 3R0MA 1ZT4A 3G6AB 1H5BB 2H3NB 2ZJSH 1VPOH 5DF0A 4FP8L 3QUXC 3MV11 2MTPA 5D70L 4L4VD 3FKUS 1DUYA 4LKXA 3ORJA 3EFDH 3BIKB 2HH0H 3RWHA 1I1YB 1A1NA 4U1GC 3GSXB 2X05A 4X98B 4PJ5D 5FKAB 4NNXA 4BH8B 3F7YA 5JXEA 4GAFB 3NCJL 4FOMA 2YD1A 1RUPH 5ISZB 4OUUB 2FECI 3CFDB 4QRTB 2D3VA 4XVTL 2OXGA 4MSWB 1CLOL 1FDLL 2CJUH 4YBHA 3SKOB 5EZIL 1UACL 3NA4A 1G0YR 4WENB 4OLUL 5F97E 1N0XH 4RWHA 5FO7A 3L6FA 1KNOB 2RAMA 5HYJB 5D8JL 4ONGL 2LTQC 3EJYC 3P73A 2H32B 4HLZG 4M4RA 4OZGA 1AQKH 3LKQB 3QDGD 4JGJA 1OW0C 2BVQA 2X9YA 1WIOA 4OD3H 3V5HA 2DJUA 5E8OA 5E1HB 4KRMB 3ILPB 1XT5A 1X5FA 4PJCB 3SQOL 3HB3D 4OT1L 1G7IB 4JKPL 5LKNA 4DGIL 5I1LA 1XF3B 2EDDA 1UCBL 4GKSA 4TN9A 5E5RB 3O4LE 3B2VH 5DD0H 4L9DA 4AM0B 4HIXH 4TULL 3AREA 2LABA 4IJ3B 2RIKA 1I9JH 4HKJB 2X4OB 4XNYH 3VXPA 4LMQE 3BH9B 3MSPA 3BW9B 4XAWL 4ONFL 5DFWH 3FT4B 1NUDA 3GJEB 5KVMC 1EGJA 1PGRB 3ZDXE 4HWEL 4YAQB 4S10A 1LVEA 3S5LB 3DI3B 5HHVL 1R5IB 1BZ7A 1KBGH 4U7KA 1QUNA 5DJ2A 4XP4H 5IK3A 2AEIT 4L3CA 1LDPL 4MHHI 4MWFA 1HNFA 1K4CA 4KI5D 3O2VL 4FQPA 4KHXH 4X9FA 5K9QG 4P46A 5KSBB 2XKNB 2AJUL 2OJEB 5DRNA 1CDIA 3GIZL 1IGYA 1ZKAA 4DTGH 4ELME 1MRCH 1DQDH 3BWAB 1P84J 1GHFL 1OGAA 5GS2D 4AQOA 2YEZA 1PG7H 3HZKA 3RZCA 1NGZA 1F3DH 3KPTA 1U8JA 1OM3H 3RKPA 3QCTL 5IHBA 3CVIL 4NQED 3G9VA 3L5JA 4P23B 3M17B 4K3DL 1DLFL 1U8QA 3J8F7 3T8XA 2DMCA 1YEDA 5DDHA 4NRZA 4PJ8D 3BP7A 4EKXA 2D9CA 3MRCA 3QWRD 4NZDA 3EBAA 2EZ0D 3L5XH 4EN3B 4XPHH 3K1KC 1EFXB 1MI5D 3O41B 1B0RB 4AENB 4U6VL 4KJQD 1A6TA 2ZCHL 3D25B 1PKQE 3QWOB 3GUTA 3QH3A 1NCCH 4JO2H 3HE6A 4M6OH 2VMFA 1A7QL 4Z95L 1LE5B 3JV4B 4OZ4B 5JO5B 3ZDYE 1HSAA 3EYUH 1G9NH 1ACYL 4XMKH 1TCRB 3V7AE 5B38A 5E6IB 3HI6H 4OUOA 1PYWB 5GGUB 2NXYC 4DAGH 4DUWA 3VXMB 4NN6B 5AAMA 1Z9MA 1EJOH 2XZCH 1AE6H 2FJHA 3QXVA 5CIPB 4YHLH 3VRIB 5ABDE 4P48A 5E00A 3B2UC 2C1PB 1CF8L 1C16A 2DM4A 1UCBH 4OF3A 1NMAH 3GMPA 4RISH 2MWCA 4M8QA 4WTZG 1FN4B 1L7IL 2BOCA 1DANT 1D7FA 4EZMA 3TV3L 4TNVK 4U1HB 4D0DA 1BWMA 1V3KA 1BX2B 4RAUA 4XGZB 3Q6FA 5I1AA 1J1PH 3S96A 5CBEB 4IMLB 4M7KH 1KPRA 5AYQA 3DHMA 3QNZA 5TF0A 4P5MA 3VDAA 4X6DA 1T0PB 4ELMF 3RVWC 3RIAK 3GRWL 2P44B 3HC0B 4JFQB 1AGDB 4MAYD 1NFIA 5K9JL 1E4XL 3L7FB 4JQIH 3T0VA 3IDIB 2DWEA 4PV8A 4ZAKB 3T0EC 2KH2B 1BGXH 3FB6A 5SWSD 3EYOA 1LEKA 3REWB 3TYFB 3GIZH 1MSPA 4DTGL 3RDTB 1MCFA 5LGHH 2XTJB 1FG2A 3OJMB 1IZJA 2BC4A 3D3VB 3HNVH 2IALA 4P2QD 1XR8B 3O6KH 2Z31A 3KPSD 2BVEA 4UINL 2VDOH 3D39A 3NIFE 1KEML 4XRCA 2ICEB 4B5EA 3DRTB 2G2RA 3B9KC 1MY7A 1OQOA 3SCMA 3O0RL 3MYJA 1T3FB 2BXZA 3PWPB 3ZHDA 3RTQD 4AIXA 2Q7NA 1U8MB 1FGNL 3P3YA 1MPAH 2VLKB 3HPLB 1C5CH 4HCRL 4XNMA 2Y5TA 2CO6B 3SY0B 5DLMH 4F3FB 5BXFB 3F6IA 3W0WA 4U1LA 4NN5C 1I1FB 4YHIA 3MRFA 4TSAH 3C6LD 5EH1A 1MQKL 1A2YB 4RMQA 4EI5B 2ZJSL 1DBJL 1KT2B 3S4SG 3ARBD 5HGAB 4O2EA 4E41B 4HT1H 1C12B 3MA7A 2APVA 5IW1B 4WW1B 5E8NA 3O4LA 4JPVH 4B0MM 1YQVL 5D7SL 5DEFA 5ANMB 4X83A 5HBBA 2EEBA 2GFBB 3K2MC 5KZCB 5CWSB 5GRWA 3TBVA 3VXQB 1GZQB 4HPYH 3HZYA 3P9LA 1A9EA 5GS0D 4XP1L 5FGBC 2DYPB 5IKCA 3ZMRA 2M1KA 4KZEL 4UDTA 3K4DA 1JGLL 3PIQB 1XGTA 1S7VB 3H9YA 1IBGL 5E2VL 2XNAA 4NNPL 3TNNA 1L0XA 4LHUG 4YHLL 5T3ZE 4X7EC 3VDBA 4ORZC 1WBYA 3VCLB 3UXFA 5C0FB 5BV7B 4L4VE 5IMKB 2NTSP 4R8WH 5KVEL 1HEZB 1A0QH 3MTRA 3RL1B 4YGVA 3BZEB 4GRWF 3BUTA 3BPNC 2Q86A 3WN5C 5A16B 1UXWB 4OD3L 1J7VR 1JWUB 4LARH 4MJ5B 4UILL 2IG2L 5MENE 4GW4A 3UTPE 3SKJL 3DYPA 5EO9A 2OXHA 2JJTC 3MA9L 3L5IA 3RNKA 5BQ7A 2Y6SC 1MAML 1R3IH 3UEZA 3SDYH 1QHOA 3QDJD 3KLAB 1I8MA 3CX5K 1DQQB 1B90A 3HG1D 1K4DA 1LO2H 1WBZA 1HKLL 1IEAA 3H42L 5KW9H 3P4MA 1H3PH 5SWSE 4JPWH 2BHUA 4E0RB 4GW5B 4RNRB 1AGBB 3EOYG 5DR5H 4GOSA 1SBSH 1VGKB 5EU3B 1LP9E 4EOWH 3QO1B 6CGTA 4LNVA 4OCXL 3QT2A 3VFPA 1N6UA 5FEBA 4QRSA 1U95B 4D0CB 4DFIA 5ICYA 1KLGA 3QHTC 4ELKB 1K5NB 5CGYC 4H5SB 3TBSB 3V52H 1KACB 5T5NG 4HV8B 2YZ1A 3BQUC 2R23B 1D5MA 2X7LB 4NQCA 1IKNA 3I6GB 5DVLA 3RTQB 4PLJC 3U4EA 3QDAA 5F72S 1DJSA 4X6DF 4PJIB 2B20A 2QBWA 4F7MB 1AFVL 4PD4J 5D6CB 3D85B 1G9MH 1VSCA 1S78C 1ZLVH 2R29L 4HMDA 5FHBH 1NGYA 1C7SA 1R3KA 3H8NA 4ISVB 3QDMB 4F7CB 4DZBB 1EHNA 1A6ZA 1AJ7H 1JPST 1QRNB 5ADPL 3C60C 3UC0L 3FO9B 4FQJL 4QHKI 1MLCB 5IW6B 3TC9A 2WIIA 1QBBA 3ZO0A 4PJ5B 5JPMA 2ZOKB 2FB4H 1RZ8B 3MODL 4NRYA 1JRHH 3G5XB 2JJUA 4NC0B 5D7IB 2UY6A 3S4SA 4M7LT 3VFTB 3MO1B 1Q94B 4P2OB 3DX8A 1CE1H 1I3GH 4ENED 1TJGL 1KYOK 3GBNL 3V4PH 3D48R 1NC2A 4DKAA 4LARL 3FOLA 1NDMB 2V17L 3OX8A 5E94A 4R4ND 3GBML 1U58A 4G8GE 5HSFA 1N7ML 1VESA 1I1YA 4LVOB 4RISL 1FNAA 4JR9H 1TTGA 4P2RD 4ZG1A 1L7IH 2RFXB 5BJTA 5IB5A 3AFLA 5KW9L 1CCZA 1DANU 4E42B 4QO1A 4Z7UB 2ICWB 4AQ1B 1DVFB 1AD0B 3J7HA 4GKZB 1CZ8L 2D7TH 2MCPH 5BVJB 4NHCL 4TQEH 4OZFG 1HHKA 2D0GA 1CFNA 1BQHB 2A38A 4D8PA 1JP5A 2A6IB 4KUCF 3VH8B 3L3IA 4UT6L 5EZLA 3P73B 5F9OL 3OKNB 3BAEL 1UKQA 1RK0B 1M7IB 4NO3B 2P5WD 1J1OH 4R96B 2HA1A 4I0PD 4ZPTA 1AIFB 1AR1C 1FCCA 4HBCH 2PO6D 3KPLA 4QXGH 1AO7D 3AB0B 1GCFA 3QXWA 4GKSB 4PJHB 4XVSL 3TYGL 4OCYH 1TVHA 4OZFA 4OFVA 1P4IH 5EBMB 5A40E 4CW1A 1MRDL 3GHEL 5HJ3B 4FXLA 3OXRB 5KS9E 4U1JA 3WDIA 4GG6A 4KJPC 3MRPA 5FHBL 4JEGB 4OQTA 4JREB 2VZSA 3ALPA 4U2YA 5HDQH 4KK9C 3VG0L 2KDGA 4QRRD 5C92A 3EYUL 1YECL 2ZNXA 4LCYA 5GIRB 3PQYE 4OZHA 4MAUL 3UJJH 3CK0H 3T65A 5HYJD 4V1DB 1VFAA 2N7AA 5KOMC 1OGAE 4MD5B 5E95B 3VWKC 4GAJL 1OD7A 4HWZA 4I13B 3RL2B 5AD0B 4X7SH 5IJVB 3FMGH 4WCYL 1OQXA 3GB7B 4I4WA 5FECB 3KJ6H 3DXAA 4YR6A 3OJ2C 5ACZB 5CZXC 5D71H 3SEPA 1XR9A 5ESQA 3UYRH 1NAML 2X4TB 4ZODA 2VXVH 5JDJA 3GNMH 3VMOA 4Z0BH 1CGWA 5MENA 4OTXH 4FQXC 4ONHA 1KJ3H 4ZNCD 1VGEL 4JY4A 1CDGA 1HIML 3WO4B 2UZXB 2XTLA 3FB8B 5KVDH 5ITBH 2QADB 4JAMB 4LEOB 4ZFOL 1BECA 4WI6A 1BFVH 5DVNA 4PRBA 1WFOA 5M94B 3FRUA 4XCFL 3CSYA 3UZVB 3VXUB 4TNWF 5I1JL 3LN5B 4KKCC 1DFBH 4L8SA 5C08A 5BS0B 1LEIB 4Y16A 3U7AA 2DAVA 5E2UL 5FGBA 3I75B 3BKML 5C2UB 3ULVF 1MOEA 1J87A 4JO3H 4WFFD 4I1NB 2NR6D 3LQAC 2GHWB 2VISB 3UBXI 1RULL 5DO2C 3QIBA 3O2DL 1P7QA 3H42H 1HKLH 5GS0L 3CCHB 3B5TA 3BVNB 2X70A 4JCMA 5AWNH 2FD6L 3BKJH 3I2CL 5SX4H 1I8KB 3D69A 5F1NB 3NIFF 2F54E 4N8VG 4ZOCA 1RURH 1S9XA 2NY0B 2UYLB 4DKEL 1WAAF 1OTUD 1ETZB 4F80A 2IANE 3CUPB 3PWUB 3BO8B 4HLZH 3IETA 1YYLL 4P9MH 4MMZC 1P4IL 2LFGA 1FYTE 1SEQH 4HBQA 3R1GL 2WWMD 1A7PH 1CGXA 1AXTL 3V52L 1NJ9A 2VAAB 5JORA 5D7SH 3W0WD 4EDWL 1TTFA 3LKRB 3T77A 5HVWA 2Z31C 5EFIB 2P43B 2QR0A 4LKXB 3U0PB 4HIIA 5CP7B 5TE6H 2QQQA 3W5NA 2UWEE 4WY7H 4X6DB 4NQTA 5E8DH 3S34L 4PB9L 3MFGB 4TSCH 2VLJD 4XP1H 1LK3H 4X98A 3QPXH 4JZJA 2PW1A 3OG6B 3X3FH 2FJFA 1IBGH 1NFDA 5E2VH 1G9ML 5TQ0H 3T4YB 2E7LA 2R8SH 3KAAA 3T0ED 5IB3B 5INCA 1XGYH 5H37G 1UENA 5EN2B 3V5DA 3BIAX 1MWAL 1H3VA 1A0QL 4P5TD 2VQ1A 3TBYA 2VXQL 1P7KA 3MPCA 2YK1L 1CE6B 2I27N 4TVPL 1KJVB 1DLHA 4LLDA 2R69L 4JN2A 3WS3A 3QIUD 3IU4L 4P3DA 5EIQA 4ZOAA 5GS0C 4V2CB 3MLSH 4G3YL 2OR9H 1YY8B 3L3DA 4OV5A 4DVBA 1MVUA 3DTXA 5DC9B 2Q87A 1EDQA 2GIYA 3M45A 3TZVD 4S2SB 3S5LG 3VWJD 1NUNB 1B2WH 3QQ4A 3GBNH 5FHAL 4WHYH 5TE4H 4HKXA 2Z4QB 4FABH 2GJ6E 5D9SB 4M1GL 4DN4L 1M6OB 4Y19A 4N0CD 1K8IB 3GKWH 4CVZA 3QEQA 1BLNB 4WUUE 2HWZH 3QFJD 2ZSVB 1OARL 2FX9L 5MI0B 3LD8C 4ZAKD 2AQ2A 2IQAB 2C7UA 3CDCA 1FVDB 4BYHA 3LKSA 3KG5A 2R0LL 3MC0A 4NUJA 3N50A 4JN1L 3T0EE 2PTUA 3BH8A 5I1CH 5CSGA 3S5LA 5L0QC 1NH6A 2FATH 4AIZB 1NLBH 1NGPH 1YN6A 4X4YA 2LVEA 2F54B 4H26A 2VSCA 3ZHLA 5IK3B 2VXUH 4HZLB 5CZXD 5KAQG 2D7TL 3QZWA 1UJ3A 4MDJA 4NT6A 4CADB 1LO4L 4J7RA 1NCWH 2RQ8A 2PCPA 2QJDA 2R2BB 4ZQKB 3VWKD 4WJ5A 3MUHL 3ULUF 2O5YH 3DETD 4KRLB 1WZLA 1B6DA 3O8XA 4ZFFA 4GXUM 3ES6B 2AXGB 3QCUH 5HGBB 4XPAL 4ALAH 3EGSA 4X0KA 2Y36H 1KCLA 2F19L 4XVSH 2IADA 3DIFA 4OZGF 4NRZB 2N4IA 1IAIL 1QNZL 1UH4A 4L4TD 2Q6WA 3UDWA 1UZ6F 1WBZB 4W6WB 4EDXB 1VACA 4PJDA 3MODH 4KAQH 3AM8A 5GS1B 1ZANH 1ZHNB 4KTDL 4RGNE 3RFZC 1GYAA 3OL2A 1JCKA 3TIDA 2EKJA 2YPVL 4JHZA 3G6DL 2XXCB 1MJ7L 3FQXB 2CR3A 1IE5A 2F53B 4DGVL 1HSBA 1F13A 4FQHA 1CK0L 2HKHL 1DQJA 5F1IA 3QG7L 3MLVL 1TETH 3RPIA 25C8L 5ALBH 3N06B 3LH2H 5JW4Q 4NO2B 5IGXH 5KSAA 1SJVA 5K33A 1XF2A 3VXME 3I02B 1P1ZB 2MPAL 3SDCB 3UYRL 5CJ5A 1MHCB 5CHNB 4ZTOL 4JFFA 3ELAT 4ZUVB 5HYSB 3FJTA 2VDLH 3RKDC 1PY9A 5DJCA 2XRAL 4K2UL 4KK8C 4NC1E 1IFHH 4RQQB 1QSZA 3PL6B 4G80A 4WHTA 1DBBH 5ID0A 1J0YA 4QWWC 3A0OA 2I9LB 4RGNC 1ZK9A 5E4IA 2R2EB 1NGYB 4HC1L 1BX2A 4MA7L 2YD3A 4WWID 1WSST 5HGGS 2E3VA 4HXBH 5E99H 1VEMA 2VB5A 1IEBB 2WBJD 2KKQA 3P0VL 1T2QL 4OIAA 3B4NA 1A6ZB 1QRNA 2BY3A 3IF1B 3LKNA 1HDMA 3NBNA 2KPNA 1YEEH 4PB0L 2XY2A 3WFHA 4YGAB 1MNUH 1MPAL 4KXZI 4FN0A 2V5YA 2O26U 1JFQH 3EOAA 1CICA 1FH5L 1RZ8A 4MGXA 5MEPA 2VIRB 5CJXC 3TT1H 2GKIA 3BX7C 1RHHA 3U30C 5D7IA 4K94C 1AGEB 4XZUB 5MEQA 1XGQA 4L1DA 4OLZH 2Z8RA 5AYUH 1HCFX 3KLHD 1QTYT 2PN5A 4Y5XC 1PSKL 3DGGB 4Y5VA 3VG9C 3OGCB 5HDQL 4R4NC 3QFJB 4CRPA 5I17A 4HPYL 1KJ2A 2FEEL 3OPZL 5J8OA 4UOW0 4X6CF 2JCCB 1XCTB 2ADJB 4MNQD 3WIIL 4HS6A 5C0CA 3TNMB 3GSXA 3P77A 4JKWA 4IOFC 4LRNH 3ZE1E 5KANI 3MLWL 3VXOA 2GT9A 2H8PA 4C83B 3CVHH 3BPNB 1DVFA 4FZ8L 4QXWA 2R1YA 4KTDH 3X12A 4ORGB 2VYRE 1AP2A 3OZ9H 4HWNA 3R8QA 5IFAH 3ZKXB 2E6QA 3N1FC 4OB5H 2FBJL 5J1AB 2ATKA 4WHDA 3NZ8A 5K9KB 3QEHB 1ZT4B 3HI5H 3T0BA 3BESR 5FUZH 1J0JA 1QSEB 3G5VA 4J3OC 5CBAB 2PKDA 4P2RA 2BVPB 4FFZH 4YEFA 2C3HA 2VERN 5ITFA 5DA4A 1BFTA 4H25B 4WI3A 3HRZA 4NCDA 4LLQA 3RWCB 3KYKH 5SWZA 3CH1A 5B8CC 4X8JB 3MLRL 2FIRT 4M8VA 5TPWH 2ARJB 3TV3H 1F58L 2A1WH 5TJWK 4QRRE 2R0KH 4JFDD 1S9VB 2BOBA 1H8SA 1UB6B 3B9EA 1ZSDB 1ZT1A 3LS4L 4CW1B 1TPXC 5JW5B 3M07A 4NNYA 3CZJA 5DHXB 5CFHA 1BVKB 1E27A 3H0TB 1RJZA 3IDGA 1JRHI 4XMPH 3OF6D 3BN9D 3QDHA 3BYTA 3MLXH 1S7WA 4MJ5A 3L6FB 5I66B 4KZDL 5IV2B 3GRWH 4GW4B 4IMKC 3MJ7A 5C0CD 3VGBA 1P4LA 3BPOC 3PWPE 5ID1B 4JVPA 2B2XL 2A77H 3T2NL 3Q5TA 4JJ5B 1GOFA 2ORBL 5C08E 2FCBA 3K46A 3IVKA 3ARGC 2ZCKL 1R5IA 3MRHB 5JUEL 1HXMB 5CGMA 4L3CB 5E7BA 3TIEA 1NCAL 1CQYA 2XACC 2G5BB 1A4KA 4ZS6C 2IPUK 4L8CA 4R4FL 3S37L 1LP9F 1NCBH 5DK3A 3ARFA 5IW3A 2I9TB 4L3EB 2Y6SD 4K55A 4FZEL 5CJOL 3PQYD 1MFCH 1U8JB 4P4KD 1S7QA 1CFSB 2L4OA 5D1QA 1PQZB 1DN0B 2BRRH 4TYUA 4TSCL 1U8PA 4PG2A 5LGJA 1WF5A 4IS6B 2NY2C 2QHRH 1S7XB 4HS8L 3BPCB 2AV7B 3ECBB 3BP7B 1J1XL 1KN4L 4NZRL 5KSBA 3CVHL 4ODXA 1P4BH 4PJIF 4F7MA 3L3GA 3D0LB 1FZMA 4S1RH 1NBVL 2CRZA 3P0GB 4QY8B 4ZUUA 1R3HB 2YWYA 1AQDA 3MRMA 3X13B 1T1ZB 2YD5A 3HFMH 3BUYB 5FA4A 1OAZL 4RWYL 3ULUL 1ONQA 1BIIB 1CICC 4YDKL 1E4JA 4WEBH 5FUZL 4RMTA 3QDJA 4YK4C 3INUH 2F5AH 2X70B 1ES0A 4OFYA 3CFKA 1ZHKB 4F57L 4YH6A 1Z5LA 1W0WA 3C08L 1FHGA 4JLRA 4Q2ZA 3O6LL 2CDGB 4B7LA 4U05A 3ARBC 3HNTL 2FH6A 4JFED 3G6DH 1GGBL 4MJIA 3TN0B 4F33B 2JB5H 4FTVD 1FBIL 3U36B 1R0AH 3QSKB 4DGVH 4QEGA 1HH9A 4OI8A 2AJXL 4DUVA 3S35X 2JELH 1TETL 1NEZB 3EYSH 5J9PA 3TESA 3SJVB 2FLBT 5C0JA 1WVZA 5JORB 2DQFA 4KZDH 1DQLL 4R7NB 2CDEB 3EO1B 3GSRB 3I9GH 2Y7QB 3LMJH 4L8BA 4RAUB 2O61B 3VRJB 2YXFA 3E8UL 5BV7C 5B38B 4IMLA 4NSKB 1CDHA 2WBKA 3AVEA 5TDNB 4NYLA 5AUMB 3ROLB 2NTFA 3LEYH 4Y4HA 1HCVA 2KZWA 2Z35B 5JIIA 3SJVD 2BSTB 3NCJH 1MREH 1NCAH 32C2B 3C5SB 3MV9D 3VFWB 2YUZA 4XVTH 1WTGT 1L6XA 3RDTA 3QUZD 3EOTH 4PJAF 4PRPE 1OP5H 1PEZA 1Z6JT 1EHXA 4IRZH 1WAAA 5KG9B 2AEQH 3LSOB 4WIQA 3HCVB 4X6EA 3U4BH 2V5SA 1O7VA 1NGWA 1I3RB 5DVOA 1A8JH 2XWJA 4R2GD 5KSUB 4P5MB 1JGEB 3KYOA 1YC8A 5DJYA 2ZUTA 2HT3C 5E5MB 3KDMB 4S2SA 2ADIA 2AJYH 2GI7A 5TFSL 1IM3B 2OMNA 1OSPL 1QA9B 2P7TB 3MBEA 4P59H 3DROA 4RZCB 1FGVL 3VI4F 3RWEA 4ZAKA 4YHIB 3UAJD 2RCSH 3IDMA 3ZKNC 4JKKA 1ZHLB 5EBMA 5BO1L 2K7QA 4KKBD 4UB0H 1TZGL 1E4KA 5KSVB 3QEQD 4M6NL 3CSPA 3D1MC 4JG0L 2YUWA 1KNOA 4G5ZH 1OAZH 1YPZA 3ULUH 1JNNH 3I3DA 1W8NA 4YDKH 3DRTA 3SOBL 1U91B 1YMHA 4J2XA 3CX5J 4QT5A 2NMSA 3HZYB 5F7DA 4PJEB 1VFAB 2XN9E 1B4JL 2DYPA 4WW2C 5A2LH 4AIOA 4ZMAT 5IKCB 2AGJH 3MV7A 3HLAB 2DKMA 5DHVB 3SPVB 3MRKA 5DC0A 4OB5L 1CE1L 4UTBL 5FYLH 3TPUA 1UM5L 5T1LD 2AJUH 5DD3H 5ERWA 1DZBA 1MJ8L 2GTWA 4HIEB 4QCIA 4WW1A 5E8NB 5TDPB 1J11A 4C56B 5B8CA 1RZFL 4ONHB 3RI5K 3UYOD 4F7PB 1UKSA 3ULVL 4NQXA 1X7QB 2Q7YA 4KTYA 5CWSA 3TBVB 5JMOC 1G7QB 4IRSD 2VSDA 5D7LB 2R9HC 3EFFA 3MRIB 1I3UA 5SWZE 3KPPA 1DEDA 3VE0A 4N8CL 3BHBB 1WWBX 2X4SA 2FECL 4W70A 4LLYA 5DJAA 2VLRD 2OK0L 5GSVA 3AGVA 4K23H 1M4KA 3WV0A 3Q3GB 5IBLC 4X7TA 1A64A 3PXJA 4R0LA 3RRQA 2GJJA 4LEXL 5C0DA 2Y9RT 4I48A 4IRZL 3MQIA 3MV9A 3L3JB 2RHEA 5M95B 3D18B 3MGTB 1A02N 3DX7B 3IDYB 3HRPA 5F3HB 1RZKH 5IVXA 3MJ9A 4U1IA 2NXZC 4QWWD 1W0YT 2G9HA 1YMMB 3TYGH 1BAFH 1A4JA 4H5SA 3TBSA 3RVUD 5J0BA 2FX7H 5FYJU 1Q38A 1G7JB 1UACH 4JRYE 5J6GB 5FGCE 2R8SL 2C1OB 4S1SL 3E0GA 4YHPB 3VGDA 3CC5A 4JFFE 4WI5A 5GS3A 2HJKA 2J88L 5I16B 4E0RA 3PWPD 3D25A 3IDUA 4GW1B 1BM3L 1J5OL 1O0VA 2VAAA 4Q7DA 2GITA 4BFIB 2ESVA 2GY5A 5DEZA 4YHYC 4HUUB 1QLFB 4G3YH 4FFWC 4NZRH 4QRPA 5E6ID 1P4BL 1EEYB 1B4JH 4HV8A 2IBGA 3NA9H 2XQYK 1MH5A 4UTAL 4M7ZB 4OCNC 2UVFA 3KPNB 1BP3B 2JIXA 3GNML 4CKVX 1MLBB 3U7YL 3SDDD 5J56B 3JWDH 2C1PA 4KU1A 1INQB 4RWYH 4QXTB 1DBMH 2HTKD 4FABL 2W65B 3WFEL 4WEBL 4XVUC 1IGMH 1LNUA 1EEQA 4XNYL 4P0DA 4QOKB 1MFNA 3VFTA 4P3CL 3BZ4A 4BH7A 1DLHB 2NW2B 4LLDB 4LHQB 1G7LA 1RVFL 2VRAA 4Y16C 4CNIA 4XCFH 5KSAC 4U1SB 2HFFB 3O3AB 3QAZC 1Q9WB 4R97C 3V0WL 2QSTA 3ARDB 3FOMB 3VXTB 1FIGL 4WFFE 5I1GH 4M00A 4RGOH 4GXUN 3QIWA 2Q8BH 1BBJA 1QSFA 5IEKB 1CYGA 1R5WA 3FN0L 5T3XE 4NC1C 4AZ8A 5CSZA 2GSIA 3BEWB 4MXQD 1QHPA 2YA1A 4ZDHB 1EERB 3GSVB 2EE9A 1A7NH 3JTSB 2X4PA 3MOAL 4K23L 2WUBL 3RUGF 3D3VA 3ULUD 4HAGA 4UT7L 5INDA 4OKDA 4CDHA 5AWNL 5FIEA 3QDME 4LVHB 5BVJA 1T7ZA 5I18H 2AW2A 1EBAA 5A43C 2WINB 3G5VB 3VA6A 4TUOB 1MCNA 1MRFH 1RZKL 2H3NA 4S1QL 5HDOA 2H6PB 4H25A 1FIEA 1DUYB 2Y25A 3GMMB 5EZJA 1U8HB 3FB5A 4L9LA 3PP3H 4Y4FC 3UJIL 5CGTA 1ZGLP 4U1MB 1XAUA 1KIQA 3MCKB 5A2KH 2R15A 2DQTH 3RGVB 4NCC2 1S9VA 4Z95H 4KTEH 3I50L 3PP4H 1JWMB 4RBPK 4K7PX 3TZVC 4S1RL 1WIUA 5TE6L 1T1WA 5AZ2L 4P4KC 4Z8FL 3AROA 4LP5A 3BDYL 1MJ7H 2XV6B 2HT4D 3GEWB 2APBA 3CFJB 3LDBC 4JFDB 5BRZB 3KHQA 5EOTB 4TSBL 3UPCA 1DQML 2BCKB 3HAEB 5I15H 1WBXB 4UI2A 3P9LB 4PREA 4HMEA 3IFOA 1A6PA 3WS6C 1QVOA 5I30H 4IIQC 5DQDL 1A3QA 3O6LH 1MF2H 1A22B 2H1PL 2B1AL 3W9DA 5HI3D 5AEAA 3U7YH 4LHUA 1QO3A 4LF3B 2QQKL 4U0RB 1T7XA 1N6QL 3V8CA 5MERB 2G5BA 1VEPA 5C70A 3WFEH 1SJEA 1CD8A 3NGBB 4Z18A 2VDMH 1OP9A 2A2QT 1KB5H 5DD5H 4OCSL 2IH1B 3CD4A 5FDYA 1F5WA 4F8QA 3MV9E 1F42A 4YK4B 2AK4B 4E9LA 3MOBL 1Y0LB 3MRNB 3S8WA 4DOHB 4J3TA 5IMMB 5F1KC 2BVOB 1HQRB 4M1GH 3TA3D 3SKMA 3LS5L 4GLRH 2AEWA 4TOYL 4XP9H 4HPOL 5I1EL 4JFFB 3L1OL 1DBAH 3AXLA 1Q9KB 1DL7L 1Z0NA 1N8ZB 4J23A 3WFCL 4ODXB 4YC2C 3BPOB 1KEMH 5KS9A 5LGKA 2EE3A 4QY8A 4MJIE 4Y5YB 5CP3H 1AHWC 1T1ZA 1OAKH 1U3ZA 2FATL 1NMBH 4BQ6A 3VFPB 2I60H 2DMBA 1FRGH 5CINL 2EDNA 4HAFA 2DM7A 5J7CC 3EDJA 3VXSB 1UG9A 5E70A 5T3ZD 1HNGA 1C5DB 1E6OL 2GUOA 2AKRA 3IKKA 4PRPD 3F7VB 1J0ZA 4JLRB 4Q2ZB 5F7WC 3D69B 5F1NA 4MNGB 4ZTPH 2B4CH 2EDRA 5JOEA 3LV3A 5E9DD 3I6GA 4PJ9B 4L5FL 1ZTXL 4L8DB 4PJ7F 2OQJB 1JRHL 1GPOL 3NFSH 4X6CE 4ZUTA 2DBLL 4N0UB 3S9DB 2B8OT 2MSPA 3CFBB 1YJDL 4IOIB 1ZLUK 2C3VB 5I1DA 2GSGA 2H45A 1IVLA 4XC3L 1BAFL 3KYAA 1I85A 2K9UA 3IJSA 4QHLA 2UWEF 3OJDB 4PRID 2ZUYA 1NDGA 3HG1A 2JIXD 4NNPH 5E03A 4KI5F 1KF9B 1DE4A 4NUGH 2BFVH 2VDQH 3DO7B 1FL3B 3GHBH 4MB5A 3U0PA 5L2KE 1HSAB 1RK1A 5BS0E 4RDQG 3STLB 2NTFB 2J1KA 4I2XA 1PD6A 4PJDF 3DURB 4F7EB 3U1SL 4UTBH 3KXFD 2OL3L 2H8PB 2DJ4A 2X4OA 3UJTH 5GRUH 4UILH 4N8VA 3UTQA 3B5GA 4C4KO 4P2QE 4X9HA 4M8QB 4KDTA 3MLVH 3JV6B 1BJ1H 4NHCH 1IAII 3TJHC 1S9YA 1CLYH 1ZAGA 5DJ2B 2B39A 2FDBP 4CVXA 3ZSSA 2DM2A 3JWDC 4U6HA 4S0SD 4KUZL 1R24B 2DKUA 3ET9F 5F9AC 4IMKA 2OJEA 5DRNB 4LGPB 3VXRD 5C07B 2ADIB 1M7DB 1UQSB 1I9RL 1XGRB 3WUWA 4TOYH 4NBZB 3MBEB 5F6IB 2DI8A 1QP1A 3LQZA 2NY5C 1X3DA 4K7PY 3M1BA 1N6VA 3S97C 4P23A 4OCYL 3RGVC 4R4FH 4RGOL 1QSFD 3DHJA 3RBGA 3VWKA 1GGCL 1MCKA 3S3JA 1NMBL 4A6YA 3MV01 2FGZA 2CLVA 2IQAA 1FFRA 1VADA 1SY6H 3CDYA 3OKYA 4NUJB 5C0BD 2I5YH 3ZLQC 3IFNL 3MUGB 2FWOA 2FX8L 1U8MA 2AABL 3N1MC 4XNMB 5HI5C 3VFRA 4LP4A 4YXKH 3D39D 3WFZA 4WW2F 3ZDXF 2D4DA 3VFSA 4ZXBA 4PP1D 2P5ED 3AS1A 5F7MC 1RY7B 1JZ8A 3O2WL 5B3JF 4ZSOA 1F4WH 4LCWD 2Z0BA 4ZFZA 2PXYC 5JHDB 3BGFB 3HFML 5DEFB 5FO8A 4XNQB 1JTOA 2FR4B 2R4RL 5JW3H 4HFUL 2VDQL 1YUHA 4J3VA 2F15A 4XXCA 5BV7L 5B22A 1T22A 3OKEA 2FNBA 2Z91B 3PWVA 2X5PA 3BISA 5KSBE 4AEIL 3IJHA 5CD5C 5DEGB 5F7UA 5IFAL 2GQHA 2X4SB 1MJJA 1CDUA 1GSMA 3C9NA 5CZVH 3PHOB 3DXAB 3BGMB 4LSRH 3BQUD 3D6GA 4OD1L 4JANB 3F5WB 5CEYA 5ILTL 1ITBB 1SJXA 3T3PE 5I73C 1XIWB 2XIDA 5C3LD 4JR9L 3T0EA 5KTEL 1M1SA 3PWNB 5ADOH 4HKZB 3CFKB 1HHJA 1OCWH 3T04D 5IM7B 8CGTA 4G6JL 4R0LC 3I2CH 3SDDC 5LBSH 1PG7X 4RAVA 4F33A 4M6ML 1XF1A 4FXKA 3H9HA 3LPGA 3RY5A 1RV6X 4MJ6A 3VGFA 5C6TH 3WSQH 1WGOA 3G6AA 2V7NB 4HUNB 2H32A 5EUOB 4POYA 2WUBH 5ICXB 3FO1B 1FYHB 4P23D 5GGRA 1YC7A 1IKFL 1P53A 3LKOB 4R7NA 2VITA 2PUQT 4XHJC 4PRHB 5L2KD 3GMQA 4NNXB 3TZVB 3PDOA 4KDVA 5FM4A 4J3XA 2BSED 3ROLA 3S35H 1V3LA 1XF2B 3FQWB 1NAMB 4XCCL 1H3GA 3QIBD 4AL8H 1A7OH 1D5MB 3UZEA 2RCSL 2N1KA 2XT1B 3HE6C 2NXZD 1N2RB 5D1QC 4XPTH 1MWAH 2LAAA 3OKDB 3F58L 1XZ0A 2DLIA 5EBLB 2OR7A 4CNIB 4WFHD 2P5EB 4GRLC 4K3HA 3CXDH 2NZIA 4H8WC 2PXYD 5IFHL 3KXFA 1F6AB 4HIIB 4PGDB 2EXYD 2X10A 4L5FH 4TSBH 2IAMB 4NC2B 5C9JB 3VCLA 5C0FA 4WCYH 1G7IA 3LKNB 3DRQB 5IMKA 1KEGH 3L95A 4RA0C 4CJ0A 1HI6B 2JE8A 2NXZB 1NBVH 1MAJA 4LSTL 1GGIH 5C2BH 2D31A 5DC4B 2HN7B 3H7BB 4XAKE 4LLUA 1U8LB 4L9LC 4MS8C 3GBLA 2P48B 4UAOC 3SDXA 3VWJC 5DVKA 5EO9B 1A5FH 1HIMH 1AGEA 3RVTC 1F90L 4KQ3L 2VQ1B 1RZ7L 2CKNA 3GKWL 2WSKA 3VXPB 1GIGH 1TZHA 2F5AL 4MA8L 4XAWH 4L29B 3FT4A 1U3HA 2YD8A 3DXAD 1JNJA 3RX5A 4ZPVB 2YMXL 2ED8A 5J1AA 4U6YB 5IVXE 1FE8H 4UT9L 3T0WA 4JFDE 4MWFB 4KJWD 4OV5B 4FMFA 2FBOJ 1B0RA 1DBKH 4RNRA 2XKNA 2DL2A 1XCTA 5KAQF 2VDKH 3HKFA 1IGYB 3UBXG 3TVMB 1PLGH 4HG4K 5H35A 2CXKA 2UVEA 1U93B 1DQDL 4KI5E 1CD1A 4IM8A 1DBAL 3ABZA 1NCWL 2Z4QA 1LP9B 3EDDA 5EC2A 1K85A 1K8IA 4CVZB 1WCBA 5IB2A 2QQNH 5JQ6H 4JZNA 2BHZA 1YEFH 3JBG7 3QA3B 4JY5H 3RWGB 1XFPA 4Y4KB 4APQA 2VKXA 1X5GA 1CGYA 1CFBA 4LASH 3SN6N 1YEGL 1CGSH 1C16B 3QAZB 1RD6A 3Q1SL 2F19H 1YY9D 4X5WA 3O3DA 4Y8AA 2YRZA 2E5EA 3IDXH 4L4VA 3BHBA 5DYOB 4JRYD 5I2IA 5D1ZC 4IOSD 4XPBH 1QO3B 3IJYA 4JFEA 4MJID 3MRBA 2FHFA 3PV7A 1NAKL 4P2OD 2HG5B 4NOBA 3TVMC 3DX9A 4XVJH 2DBLH 3NCBB 1DDHB 2DQCL 4LSVL 1D6VH 3SDXE 4KKLD 3HAEH 4KK9D 5E8DL 4YHZL 3FB7B 3RUGA 4IIQB 3PJSB 1KGCD 1XF4B 2SEBA 3NN8B 4M43H 2CGRH 4JE4B 5CD3B 5DSCA 4LL9A 1I7RB 3MLPA 2BVOA 2EH7H 3O81A 3W11C 3KYMA 3O2WH 3GO1L 5I74C 4LSTH 1F11B 2HLAA 2EZ0C 4AEEA 4KRPB 4U1KA 1U3JA 2IH3A 3AU1B 1S7XA 5IB4A 2OZ4A 3QNXA 3U1SH 1A9BA 1OP3K 5I75B 1YPZE 3MJGX 1DBML 1GOGA 1KC5H 1Q8MA 4FRWA 2R4RH 3U2SB 5FDWB 3Q6FB 4EI5D 3QO0A 4J12A 3TIDB 4XCNB 4PG2C 4KROD 2HVJB 3O6FD 4M7KL 2I9TA 5DUPL 3UROR 4WRLA 3NCEB 5FA4B 5B39B 2PO6B 3C5ZA 4EVNB 4KUZH 1TENA 2ZUQB 2P5WB 1WWAX 2DLHA 1T4KB 1KTRL 4OD1H 4OFIA 4LPWA 1GXEA 1TJIL 1U6AH 5EULV 1MWAA 2AK4D 2AV7A 3ECBA 5IJKA 5JOPE 4XC1H 4YFLF 2VC2H 2AAVA 3ULVH 1LNUB 4I3SL 5EU6E 2BSRA 3L3KB 4PGCB 5A3IC 4Z7VE 1EA9C 4WUUB 2R0LH 3S6CA 1G6RH 1UB5A 4LQ1A 2I9LA 5I1CL 1NFKA 4JFZH 1MQ8A 2PW2B 5C0JB 4PJEF 3FONA 3BJLA 4IRJB 3EO1A 4ODVL 5GGTL 3OKOB 2ICWI 4Z0XA 4IDJL 5IEKA 2KUTA 5D4QA 3AS2A 5HHPB 3RL1A 3STLA 4EI5A 3FO2B 3FTGA 2XQYG 4R97B 3IFNH 3QIWD 4M62L 5A16A 2WUCH 1C12A 3EOAB 1X4ZA 2AABH 4M03A 1S7UA 4DFHA 1JGUH 2OTWA 4LQFH 3H9ZA 3KPSB 2X41A 4O9HH 1LGVA 4FMKA 4GUPB 4N8VB 3QEQE 1K2DA 3WE6B 5MEOA 3SDCD 3RWIA 1D6VL 4BFBD 1C5BH 5AZ2H 1CR9H 3GJEA 4FQXD 3T65B 4YHZH 4LRIC 2FBJH 1F00I 2ERJC 1UWGH 4KDTC 1IEAB 3HCVA 5FUCC 4YBLB 2CSPA 3BWUC 1U42A 1PX3A 1RUAH 3Q5OA 2F54D 3BN3B 5E4EB 2VR5A 5JZ7D 5GXBB 2MHAB 3QO1A 1JI2A 3BWAA 3MLRH 4KUCD 5FGSA 2D4FA 5C0NC 2VDNL 5LJYH 5A2JH 3DROB 1SVZA 1FZOA 2EE6A 1JWMA 3PGCB 3C5ZC 2X4QA 4LLVA 3GM0A 3GSUB 4W4NA 2IG2H 3O9WD 3H9SE 3EOBA 4GS7B 3K8MA 1P7KB 1BZ7B 3HZMB 2MKWA 5IGXL 3MLXL 1YEDB 3NA9L 3QULB 4BQ9A 5HD8D 4ZD3H 1V3JA 2C9AA 3ULUC 3V0VA 3DETC 4EUPB 4PRDB 5GRVL 2JF1A 1RFDL 5EO1A 1RUMH 4L4TA 1H3PL 1DR9A 4LNRB 5E2TL 2EDXA 2J2ZA 3MRQA 2GEEA 4AENA 3E3QE 4G6JH 4GH7B 3W81A 4MXWH 3MZGB 1KCSL 2YEZB 1DBBL 3HZKB 4NJAH 1AXIB 1SEBA 1U8OB 3CZFA 1F3DJ 3TH3T 5DRXA 3GIVB 1VFMA 3OAUL 3QI9D 5F70A 3HR5A 3V79C 3CCHA 5FYLE 1JVKA 2XTJD 1OB1A 4FQCH 3PWJA 5EUOF 1FNGA 1G6RL 1I1AC 5ESAA 2R0WH 1CLCA 2HMIC 4W6XB 1PDKA 5F96L 3GI9H 1PYWA 4JHWL 4N9GA 1FVCB 4Y4KC 4WFGD 2AXHA 3NABL 5FKPA 5LG1A 2DQDL 3WEXA 2R23A 3QQ3B 3WFBL 3CUPA 5L6YL 4O2CB 1FPTL 5HHXL 2EE2A 3HS0A 3GMPB 4MB3A 3SCMD 1YN6B 3DX8B 3QH3B 2QQNL 5JQ6L 1WC7A 4IRSA 3E3QC 3CU1A 4HS8H 3QZWB 4JZJC 1GZPA 2EDKA 4R4BA 5DHVH 5I8KH 3LKRA 4O9HL 1EHAA 4P2QA 1KIPA 5L2JA 1VFOA 4QRQB 4FNLH 4PLOB 5JW4R 4QRUB 4G8EA 1CL7I 5E6IA 3F58H 4Y19D 5GGUA 4GBXA 1BOYA 2WLYA 3BP6B 4C4KT 5IB5B 3GM8A 2FYYB 5C0GA 3RVTD 2WWKT 5D1XC 4OFPA 5IW6A 4JKMA 4XPBL 1OD9A 4FXGA 5DFVC 1ED3A 2VNCA 4YXHH 1UYWL 3GGWB 3QUZC 1ZEAL 4LLWB 1IJ9A 2DYPD 4PJCE 4F57H 2KQMA 3MV8D 2DLEA 3V4UL 3LAFA 3ULVD 3NCYP 5JZ7C 3C8KB 4LLYB 3GK8L 3A6CL 2X09A 1R0AL 3LZFL 1XF5A 4WFHE 2HJKB 2C26A 4M3JA 4MCYA 4PJGA 3W9EA 5DJZA 1K8DB 5C0CE 5L8JB 1U3HC 1BBDH 4MYWB 5C0IB 1QBML 3MGAA 3KNBB 5I71B 3NFNA 5FOBA 2AJZB 1XGPA 3MUJA 2R2HB 1A6VH 3Q5YA 5BCAA 4ZO8A 1YEHL 4U1IB 5FO9B 3NVQA 5H94A 4FHBD 4MSWA 1A4JB 1B9ZA 4JG1H 1BEYL 2P24A 4YLQT 4HHAB 1IM9A 4JFPB 1KCSH 2VXSH 3I02A 1P84K 1G9MC 4XP6H 4AT6A 1CLZH 2XA8H 5DFTA 3GSWB 4P23C 4QOKA 4XNZB 4X4YB 4XT1C 4HWZB 1A1NB 5IJVA 5BXFA 4L8BB 1P6FA 1ORQA 3U4BL 1OAYH 3NCMA 1AIFA 3GB7A 4I4WB 2M26A 5I8CB 3R06A 4UQ2A 3MV8B 5F6HJ 4PJHA 2XWTA 4V2BA 2VAJA 5L88H 4EN3D 2GSIB 3BEWA 3GHEH 2BSTA 1BFOA 4PRAA 1X9QA 2W65A 1IT9H 1MFCL 4Z7VA 3QFDB 3OR6A 4UB0L 5HHQA 3ETBF 5EPMB 3RTQC 2FGWL 5FM5O 2R1XB 4GG6F 4KK5D 5CZKA 1VHPA 1FZKB 3LVEA 2FHCA 4YFDB 3ZYZA 4U7MA 4GG8A 1JTTA 1MCPL 1PKQA 4UZGA 4JJHA 1EO8H 4Y5VB 4BELD 4XTRD 2EYRA 3MLYH 1KN4H 4CVWA 2LU4A 3IT8D 3LOWA 4OGAD 2HP4A 3GMMA 3GSNA 4ZS6D 5E08L 1CR9L 4N90E 3TNMA 4PJ7A 3MRJA 3DSFL 5JIPA 4AM0A 1YEIH 3UTTE 3KLDA 3VXOB 1QKZL 2NQCA 2YA2A 3ARGD 2LU7A 2AERT 4O4YH 5CKAA 2EIBA 4IRJC 5EU7E 4X6CA 5C71A 2F53E 5IMOA 4K8RC 4X9BA 4Y5XA 5IUSA 4XMLH 1QBMH 1LE9B 5EBWB 3UTSB 5IOPA 4RSVA 1DQQA 3VFGH 3QXDB 1A6VL 4G9FB 2HYMA 1FAIL 3BO8A 1OCWL 1VFBB 2A6JB 1QLEL 2X1XR 2YD9A 3JXAA 1OAUH 1D5ZA 3BE1L 4NRXB 4K3JH 1YNTA 3KR3L 2DQIL 3BGMA 1CLYL 2A9ML 3B3IA 1D6EB 3D3VE 1TPXB 1P7QB 3ARFD 4DZBA 4QCIB 3TFKD 1KIRA 2EIDA 2VXTL 1U8QB 4ODBD 3VGHA 2NLJB 3WXVH 1AE6L 1KJMB 4HKZA 5J3HC 3EYVA 3QIBC 1RURL 2UUDK 4PJ5A 5J4MA 5GGTH 4G7VH 2GK0A 5FCUL 1M71A 3PWUA 1L7TH 3QHZH 1FL5A 1QVOB 1YYLH 2XZAL 1VENA 2BOCB 4APQC 4FXKB 2H9GA 4P9HL 2F53D 4MJ6B 5C08D 4U6XA 3CFCL 1BIHA 2WK2A 1IT9L 5FUOH 2CXGA 3Q2CA 5TF1L 1RMFH 5L6YH 4WU7A 4QGYA 3CNKA 5CP7A 5HHXH 2VITB 2GJZA 4UV7L 2X4NA 1X5HA 3C5ZB 1WUNT 1T1XA 5TQ0L 4XWGH 5CIPA 5T1DH 4Z7QE 4FQXA 5EU6A 2NY1D 4LLMA 3SKUD 1OTUC 1ZS8B 2ITCA 3HUJF 3Q48A 5F7LB 4Y4FD 4UINH 1FP5A 3DECA 1P2CA 4WDIA 3WDHA 2B4CC 3FOLB 1BQHA 4NFDA 1KB5B 4U2ZA 3BH8B 3ZKMD 1N3NA 3NACH 5HTSA 5CCKL 5HHOE 1FGNH 2GSGB 2IPKA 4U6TA 4ETYA 1SM3L 3OG4B 3HZVB 4DK3A 5IIEA 5T3XH 1O7SA 1QFPA 4QTHB 1IZKA 3KPLB 3PHQA 3QDJB 4ZFGL 4Z7UA 1DBJH 3CX2A 4HKXB 5E2TH 4HT1L 3FO2A 3FTGB 1S5IH 2O5XL 1OAXL 5E8EB 4BZ2H 1NANH 3W11D 3QEQB 1YQVH 3OR7B 3ZDZE 4GAGL 4GRLA 4QNPE 1X5IA 2ZSVA 5J12B 2BJMH 4LSPH 4GAYB 5T3ZL 3VXQA 4F37F 4YE4H 2KZ1B 1N4XL 2DD8L 3IYLW 5AZEL 2R1WA 4EQ2A 4LCYB 12E8L 4AIZA 5C1MB 1UJTA 1D5IH 1S9YB 2WLZA 3C5ZD 5SWSB 1JPGA 1EEZA 3HPLA 3CXHK 1YEGH 4U1LB 3RHWF 3W2DL 3ARQA 4KMQA 1R5WB 2A83A 4JZOA 4OZFB 1J8HB 1EMTL 4CBPA 1ROWA 2OK0H 1T1YB 3BRDA 3WIHL 5E5UB 4YHYB 1XR9B 4H0GA 4ODHH 1UH2A 4NP4L 5DMKB 4XXDB 1IKFH 4LEXH 5E6IC 4BA8A 3QUKA 1PJ9A 1CGTA 2GFBA 2LAGB 3N1GC 4GMSH 1T7VA 4WUKL 1N5YL 1GZQA 4Z7QF 4DKFH 4N5UA 3MMEB 4OZHB 4WHYG 3K74B 2OTUB 4I0CC 4LSUL 4OI9A 3ZTJG 4OZGE 1IAIH 1X5YA 4PY7B 3SDDA 1VADB 1MEXH 1YEKL 3BFOA 5F9WC 2E9IA 2V2XB 1D5XB 1BOGB 4ELMB 4U1MA 1LD9B 4PGBA 1OLZA 4XPTL 5DQDH 4FQQA 1KENL 4Q0XL 4PTUB 2J5LB 3F12A 1I1CA 3RNQB 5IHLB 3RZCB 1ONQB 2ESVD 1H3UA 4JRYA 3VFSB 1HINH 2D2OA 1MFEL 2OL3B 5F9JA 4O2FB 4MLIA 4KRPD 2GCYA 3MR9B 5CMAA 3G6JA 1UWXH 3RJQB 2W1NA 3BVNA 5DD6A 3MREB 4PJEE 2ATPA 4NO2A 3MRLB 2HRLA 4UTAH 4Q9CA 3PWLB 4KY1H 5IESL 1UM6H 4XBPB 3HI1A 4ZFGH 3CMOH 1MIMH 1KSRA 3KYMB 2X4UA 1RHFA 3T3ME 4XPFL 2E27L 1KGCE 1T66D 1QFWL 2VQUA 5D7KD 3WS6A 4HIXL 3VD9A 3EO9L 3BQUB 4YHNB 2C3GA 2CRYA 4M48H 4NQCD 4G6AD 4I9WE 4JFOA 3VFGL 3CDGA 3REVA 1RIUH 4MA7H 3DGCR 1KV3A 3SJVE 4AJ0A 2Q76A 5C0AA 1DBKL 4JHAL 5C0CB 1K5NA 3BP6A 2WBJA 4HX1A 5I71C 3KYNB 1WEJL 3C2AH 4LLAA 5IQ9A 4HH8A 2X4RA 1EX0A 4ZFOB 4OSUH 1MCRA 2JB6B 2FJHB 3VRIA 1UZ6E 4NQCB 5FUCE 3SGEH 3RTQA 3RKDD 5BMFL 5FV1L 3BMWA 4N1CA 4PS4L 4ODHL 3ARGA 1BFSA 3OKLA 4PRIB 2MOVA 4JFFD 5K9KA 3F7RA 3DV6B 2V17H 3C60D 2V9QA 4PGCA 1RU9H 2EDTA 4LVEA 1GPOH 3NFSL 3IAPA 5KSAD 5TH2A 1K8DA 4HCRA 2YKLH 4O00A 4OZHE 4PJGE 5CBEA 4JKLA 4K3DH 4GG6E 4K7PL 4YDJB 5I8EB 5IQ7L 1WTLA 4JZJB 4KVCL 5T1KB 4A6YL 1ZMYA 4N0CC 4DW2H 2P7TA 3MV9B 5DHYA 5GJTL 4N5ED 3PWNA 3RWEB 1UB6A 3ZKND 1DQTA 2XN9A 3GHBL 1S7RB 1HHJB 4KMLB 4PRNA 4TVSa 4NBXB 4NM8L 4GKZA 4D3CH 2EDLA 5GGVY 4NO0B 4FZ8H 2VN7A 1JMXA 2X42A 4RRPA 1NKRA 5FFLA 1A7QH 1YPZB 2IBZY 4L8DA 3BDYH 1WJ3A 2VUOA 5HD8C 3NZ8B 4XRCB 5JW4N 4MNHB 2VZVA 3OKNA 4M43L 2DN7A 1M7IA 3ARRA 1V7MH 4FQ1L 3M8OL 3WNPA 4XX1G 1TTUA 1BREA 3LRSA 3SE9H 4LLQB 2IAMD 4ETQA 5DO2D 3QQ4B 3IFLL 4G9DA 4H1LB 3TPUB 1JPTH 5F7YC 4OLEA 2QHLA 1RK1B 3JZ7A 5CJ8A 4E42A 3RVVD 5HJ3A 3VFVB 5DVMA 4TTGA 4NKMA 4QHMB 2AJSL 4O2EB 2PTTB 3MRPB 4OLUH 3U6RA 3BD5A 4BK4A 4QTIL 4BSJA 1I85C 3X11A 5GISL 4LU5H 8FABB 1UT9A 5I66A 3LY6A 1IM9D 5D2NB 5DZOA 1BMGA 4Q9QL 1E6JH 4GMTH 1RUQL 3QUZA 5IVXF 4Q58C 2CMRL 1F3JB 2O5XH 4L4TE 1LEGB 1TITA 3QWRA 3FFCE 2JJSC 2Z93A 3FMGL 1U6AL 5FB8A 1VA9A 3B9KA 4U1SA 1QYGH 5IT2H 4EUPG 4EEEA 3IS1X 2XQBL 1CBVH 4AH2B 2IAMA 4TUKL 3H7LA 2X9WA 2Y07L 1MCQA 3DRQA 3TJEL 2BSSA 1JZ2A 4QHNB 1HI6A 3QNYA 1TVHB 1SEBB 2IFFH 3A67L 2QADC 2DIAA 2H41A 2BP3A 1VGEH 3JUZA 4L3EA 5J57B 1QLRA 4AEFA 1QBLH 3IAQA 4H8WL 4LDOB 1A6WH 3MV7D 4FZEH 4HULB 1U2CA 3UTZB 1E28B 1R6VA 5GZND 1I9IL 3W82A 4RGND 3V5KA 2DBJA 4UV7H 4G6FD 4ODUA 1ORSA 3DVNA 5CHNA 5DJ0B 4KK8D 2AQ1A 4TSAL 4RMSA 2QSCH 3GRWA 1HH9B 3WNMA 3O3DB 1WC7B 1BQHG 3VD4A 2QQLH 4PJHF 1YNTB 1GZPB 2HFGL 2Q8AH 3MRDB 3C60A 5DURB 3GK8H 4ZXBB 5BS0D 1T5XB 3QHFH 3ARED 3LPFA 4FQHB 2E6PA 1YYMH 3ARDC 4NSKA 4BUHA 1H3WM 5IBTH 1RIHH 1WICA 1G84A 4I8DA 5GSRB 4I0KA 3U9UA 5AG8A 4PRBB 2APWA 1MHCA 2DTMH 2J8UE 5EG6C 2NPLX 5I9QC 3VGGA 2QV2A 4JDTL 4M5YH 3BRFA 5DRZA 3ARWA 5T1KD 3ULSA 4PREB 2A0LC 1RJLB 4PJ9C 1I7RA 3UJTL 1T21A 1IC5H 2MCG1 4PJIA 3UDWC 2AJSH 2V6HA 5C0AD 1OAXH 5T1LB 1SMOA 4HJGA 4LIQL 2HLAB 3TWCL 3NOIA 4H88H 4FTVE 4EDWH 4P4KA 4PG9A 1MFDL 4O5LH 5DUMH 4LHUB 5F7NC 3VFNB 4NQSB 4R3SA 4Y4HD 5AAWA 5MERA 1K6QL 3O6ML 1G9NL 2XWJB 5LCVL 4Q9QH 1GRWA 2UUDH 1FVEB 1OL0A 3KYOB 5DJYB 2I07A 4G9FE 3VXRA 1RUML 1QRNE 2Y23A 1EIBA 1H8NA 2Z9TA 3NAAH 4FFYL 4LBEB 4NKIL 1AO7A 4HIHB 3LQAL 3QYCA 1HYSD 2IMMA 1HHGB 4TTDD 1KJ2H 4LRIA 4ENEC 2VIRA 4DCQB 3TJEH 3UYPA 3MBEC 5F6IC 3RZCC 5SX5K 2VH5L 3MNZA 3S4SB 2YK1H 3RU8H 3G08A 5KS9F 1ULVA 5ACLA 1WFNA 1D9KD 4P3DB 5ESVB 2ZOLA 5C0RL 2ATKB 3IFPB 4QLRA 3AXLB 1IAIM 2V7NA 5EUOA 4F58H 2COQA 2D03L 2DOCA 5HI4D 3QO0B 1JF1B 1I3RA 4N0YL 4OFYD 5EZJB 4YPJA 3TO2A 4JM2D 2PW1B 1IGFL 2GT9B 3WHE1 3PUCA 3PHQB 2EXWC 1BGXL 3BPLC 5ERWB 1G0XA 4LSDA 2XTJE 1ZSDA 3NIGF 1JTPA 4YFLI 3ZTNL 1FVDA 5BOPA 4JN2B 1P6AB 2NY2B 3DBXA 1IGTB 1HINL 4F15B 5B4MD 1YMHB 1F8TL 4ZS7L 3U30B 1AJ7L 5ADPH 2CIIB 2ED7A 1HE7A 4MA8H 2W0LA 4XB7A 5F7DB 2J6EL 1KCRL 1XCQA 4CL7A 2ZP0T 5DK2A 3OWEA 4R96A 1KN2H 2AGJL 2ZG1A 3DUUA 3OJDA 3FQTB 3W39A 1LE5A 1AO7E 1MIML 3QDGB 5C0ND 5D7LD 3GI8H 5JW5A 2E7LC 4L8CB 4X7TB 2O5YL 3DVIA 3CU7A 4R0LB 3FQUB 3B8YA 2B5IC 4PJXB 1I3GL 4Y5VC 4LAJH 1BBDL 4OKVB 4JVUA 2NZ9D 4O02H 3SE9L 1MFDH 5DUML 5D7JC 3HN3A 4GRLD 4X7FC 3A6BL 4NZUH 3UTQB 1S7QB 5ID1A 2ZUUA 5TE7L 4ZOBA 2Y1VA 1T03H 5D7LA 4JHAH 1H3TA 4ZPVA 2IPTL 2DL9A 4BFGA 1TCMA 4JG1L 3ILQD 2J8OA 2HFEA 2VLRB 2NZ9C 3QULA 3T1FB 4Q9RH 2F8XC 1Q9KA 1X5ZA 4LASL 4YNYA 4OZIA 1EGJH 2DQUL 4XXCC 4D0DB 4F37K 1S8DB 1ZVHA 3DXAE 1FC2D 3Q1SH 1RQ5A 4YQXH 1A6AA 1CXLA 3QHZL 5T33L