2YPVL

Crystal structure of the meningococcal vaccine antigen factor h binding protein in complex with a bactericidal antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPSSIYASLGERVTLTCKASQDIHNYLNWFQQKPGKSPKTLIYRANRLVDGVPSRFSGGGSGQDYSLTISSLEFEDIGIYYCLQYDEFPPTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords LIPOPROTEIN
publication title Defining a Protective Epitope on Factor H Binding Protein, a Key Meningococcal Virulence Factor and Vaccine Antigen.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvL01
3MA9H 5ADOL 4QTHB 1XCTB 1QHPA 2W9DH 4HCRA 1FBIH 3RAJH 5C8JA 5C8JB 1UQSB 3WFZA 4G6KH 3DVNB 2IFFH 3ILPA 4PJGF 4FQIH 3VXUE 2V9TA 1BLNA 2CUHA 1C5CL 4KJYB 3I6KB 3RUGA 5E9DD 3RUGB 1NGYB 1T4KA 5EIVA 4WWKD 1IRAY 3MRLA 3MRLB 2ICCA 1HQRA 1HQRB 4OCLC 5FOBB 1T83C 4MNQB 1U2HA 2CMRH 1U8LA 5H35A 2X41A 1BFSA 1U8LB 5HI5D 5DUBB 1S7XA 5IT2H 2VDLH 3CX2A 4ORGA 3NCCB 2O5XH 5KS9B 1GGIL 1R5VA 1SJHA 2UZIH 3ESVF 3QPQC 5KVGL 5EFIB 2EYRB 1AGFB 3RDTB 2FD6H 4GAGL 1FFQA 4C59B 2OTUB 1P4IH 1RZGA 1RZGB 4QHMA 2PXYA 1QRNE 1HH6B 4EN3A 2PXYB 4KJWD 2Z8WC 1DDHB 1MOEA 2BXZA 1IM9D 1R3LB 1JGEA 4TOYL 1JGEB 1QLRA 5DVLA 1IAKB 3HG1A 5C0AD 1OM3H 1U92B 1N0XL 5JO5A 4MLIA 4MA8L 3M1BA 4K94H 3M1BB 5FUOL 4IRSB 3TM6A 1ZGLB 1AR1D 5AAMA 1XGTB 2HVJB 3STLB 5C0RH 5HHOE 3EYFB 4W4NA 2N1KA 5SX5H 2IPUK 1MAML 2Q3ZA 3ULUC 5E08L 4OB5H 3L3KA 5C09B 5I9QB 4UB0L 5HGHB 4P23D 3C6LD 2UZYB 4WUUD 3C6SA 2OZ4H 1PJ9A 4P4RA 3T2OA 2DMBA 2C3VB 3AB0C 4F8QA 3JWOH 5TFSH 5CINH 3FRPA 1NL0H 3JTSA 4Y19A 3JTSB 4Y19B 1CICC 2XTJD 5J3HC 4KJPC 3BDXA 4ODUA 5JIIA 4QRPD 4YAQA 1UADC 4ODHL 1KN2L 1J1XH 1WZ1H 4ODVL 5EORL 3ULSB 4F7MB 4PRPA 2F53E 4FFVD 3ETBF 4PRPB 4UIKH 3K1KC 1MVFA 5D71L 1RUPH 1ZSDA 1ZSDB 5IKCA 3CSYA 4Z7OE 2Z0BA 1ZHLB 3CCHA 4WFFD 3CCHB 2JLLA 4OV5B 3NZ8A 3NZ8B 2GJJA 5F88A 4Q2ZA 3X11A 4Q2ZB 1A3RL 1OPGL 1DN0B 4NKDA 1FDLH 1VGKA 5IV2B 1VGKB 2JJTC 2YKLH 5HI3D 2X4PA 4OCSH 1HQ4A 3AY4A 1JNLL 4CUCA 1MEXL 3LEVH 3Q5YA 5DDHA 4ZYKA 1XH3B 1CGSH 4XVJL 2X9XA 3TPUA 3KPLA 3OKYA 2WWKT 4DJMA 4K3EL 4KROC 3LKRA 4B41A 3WD5H 2WBJC 3LKRB 4PD4K 2HP4A 5D72L 5DR5H 5TE6H 4PJ5D 3CK0L 4NCDA 4I4WA 1QSFB 4FMKA 2R69H 5EOQH 4YWGH 4FXGA 1IGTA 2O5ZH 4FXGB 2AS5M 1IGTB 5I30H 3G6AA 3PHSA 5HHXL 3G6AB 4L8DA 1KEMH 1DBAH 4YHKH 1F90L 5E4EC 3S37X 2Z4QA 3DMMC 4ZUVA 4ZUVB 4FZ8H 1MFAH 1YNLH 2PTUA 5KSVA 1SJXA 2GTWA 2NY2B 1BOGA 3U9PH 4XCYB 5ICYA 1QLFA 2IPKB 3MRNA 4HX1A 3MRNB 4WHDA 3RU8H 4HX1B 3QRFM 1KPRB 3CFBB 3U7WL 4XPGH 1BZ7A 1ETZA 1NFKA 1J8HE 2PW2A 4PJHE 3U2SA 3MLSL 3MV8D 5ACMA 3SGJA 1R3HB 3SDDA 1QR1B 3SDDB 3GKZA 1B6UA 1MCIA 1KTKE 5EO9A 3EYQD 5E2WL 4XNXH 4KHTL 1SJEB 3SE3A 1U9KA 3MRPA 5IBUG 3JWDL 3I50H 3NPSC 1E28A 5I0DA 4R26L 1E28B 1KB9K 2APFA 2YD5A 4UT6H 1MCWW 4UAOC 5B38B 1S3KH 3WKMH 1A21A 2BNUA 5JW5B 1EJ6A 4JKMA 2VN4A 4P0DA 1KJ2L 5GXBB 1CS6A 5LGHH 5CGYC 3BXNB 2QSCL 4JN1L 2D7MA 1GGUA 1U8JB 1VADB 3Q1SL 5ALCH 4Y5YA 4PJIE 3QDHA 4TNVK 4Y5YB 5EBMA 2V5TA 1G6VK 4RZCA 2VDNL 4ACPA 1Q9WA 4PGDB 4F57L 4F9LA 2ZSVB 4UV7H 3LKQB 1OAYL 4OAWB 3HZVB 5L88L 1U3HC 1ZTXL 2OXGA 1HSAB 1EAJA 4HKZB 5DVMA 4PJ9C 5E8DL 1AGBA 4UV4L 2VLKD 2FWOA 4TSCL 3KNBB 1HYRC 2FWOB 1DANU 3W9DB 3X14B 4YNYA 5J56B 2V7NB 2VWEC 4TNWF 2EE2A 3MA7A 2XFXB 1MAKA 4QKXB 3FO1A 3FO1B 3QXDB 5ID1A 1B2WH 4OLUL 3QWRA 5F3HA 4MXQD 4YX2H 3TWCL 2HFTA 1VFUA 3OR7B 1CWVA 5IMMA 4XMKH 4G9FE 1P7KB 5J06A 3GHEL 3KPRE 1IQWH 2NXYC 1KN4H 1S7QA 3F58L 4CVWA 3H9ZA 2IBZX 1A8JH 4M7JH 4NKOA 4PY7B 1I75A 4PJCA 4PJCB 1MH5A 5DZNA 1MH5B 2J8UE 4MSWB 3NFSH 2X4QB 4GMTL 4PJGB 4TYUA 1A5FH 2C3GA 4KK5D 5D6DA 1MRDL 1TQCC 5EU5A 4M6NH 1KPVA 3BMVA 2XV6B 1KPVB 4WFHE 2BNQE 2BVUA 1G7HB 3VFOB 3O45A 4Z78A 1LO0L 1MFBL 3MRQB 3TJHC 2XN9D 2UY6A 3INUH 4KRPC 4JFDE 2CO6B 1NBZB 4EDXB 3MRBA 1TZIA 3MRBB 4AYFA 3KPQA 5IEKA 5L2JA 3HE7C 4GS7B 2HFEA 2J3SA 2HG5A 2HG5B 3ZDYE 5BV7L 1FORL 5K9OB 2NZ9D 4S2SB 4PGEA 4OLYH 2COQA 2L0DA 1RZ7L 3CXDL 4NNXB 3UTPE 1NAMA 3DBXA 4JPIA 3DBXB 3GUTB 4WU7A 4JVUA 4JM4H 3RTQB 4JCLA 2BFVL 4HKXB 5ADPL 3OXRB 4UTBH 2AXJA 1H15B 3DGCR 3ZLQC 5T5FH 1RIUH 2DLGA 3ZT6A 5C7XH 1CIUA 2HKHH 3P0YL 1YEHL 3T65A 1T04A 5T3XH 3T65B 1T04B 4HJJL 4WV1C 4I3RL 3R06A 3FN3A 1MHPL 1S78D 2HLFC 4WUKH 5DK0A 1OSPL 3PP4L 1MCDA 1R6VA 3QUYD 2IALA 4PRHD 1EVUA 3NA9L 4QTIL 5BVJB 3GSWB 5DJ6B 1ZANL 5D5MF 4RDQF 5CCKL 4K3GA 2QBWA 1BGXH 2ZUQC 2LU7A 5IB4A 2BVEA 5IB4B 4QHNB 1FSKB 4HWUA 4PTTA 4PTTB 1RUKL 3OKLB 5GGQL 4WWKB 1YUHA 4IOFD 1LE9A 4PJAA 4Y5VB 3RWEA 3D3VA 3RWEB 3D3VB 4TVPD 4AJ0A 3NGBB 4LRIA 4QYOA 5JNYA 2ILLA 1DBKL 5JNYB 4G6FD 1AP2A 3QUMH 5FCUH 1AP2B 2B1AH 2FX9H 5AZ2L 4CJ1A 4CN1A 4A6YL 3G6DL 3HFMH 5C0BE 1F4XH 5FAAA 4EUPG 2Q86A 2B0SH 5JW3L 1NMCB 1K4CA 1NCCH 35C8L 1K4CB 2BY0A 3UCRA 4QRRE 4NRXA 5DEGA 4NRXB 1OAZL 4L8SA 1WFTA 3MCLL 4L8SB 2EEAA 2R8SL 1RJZB 3SO5A 4PJ8B 1CBVL 1IM9B 4XXDA 3L95B 5TPWL 4XXDB 1XR8A 3RIAK 3VGEA 2EICA 4ODWA 3LKOB 1OGAD 4ODWB 1VPOL 1GAFL 2RJMA 3U36A 3STZB 3GSRA 3ZSTA 3C8HA 3GSRB 4WHYG 2XZZA 2PUQT 3JWDC 1U3JA 5IVXA 1ITCA 2X4RB 3VWJA 3C5ZD 4P9MH 5JPNA 4FQXC 4G8GD 4LSTH 4M1CC 1UC6A 4ZFOL 2AJVH 4LPUA 4GXUN 4M4PA 5FYJL 3S36H 4KMTL 3B9VA 3BWAB 5FIEA 1XGPA 2BHYA 2AJYL 3JV0A 1XGPB 3C6LB 3GMMA 4WUUB 3GMMB 2GSGB 1KPUA 3L1OL 2GSIB 2YBRB 4OIAA 2NY0B 5LBSH 4HUNB 3BPLC 4X5XA 3S3JA 3BISA 4QRPB 3BQUB 4QLRA 4PJEB 1KCVL 2BHUA 1RZKH 1K3IA 1VERA 3MRHA 3OJMB 2QQQA 3GZKA 4LCWA 3DURB 5DZLA 1IEHA 3GSXA 1LNUA 3BZEB 5LCVH 1LNUB 2DD8L 4AEHL 3W9EA 2D4DA 5JQHC 4NJAH 1AJ7H 3N1PC 3MRCA 4LSVH 3DARA 4ZOCA 1LGVA 2YZ1A 4CW1A 4AQ1B 1BP3B 3TGXA 4CW1B 1LILA 4TUKH 3TNNB 4LEXH 2FJFA 4P2OA 5F7YC 1HK6A 4X80L 4ONGL 2V9QA 4NN6C 3H7BA 4NQCA 5F96H 4NQCB 3C2AH 3JWNC 4L3EA 4N1EA 4BFEA 4ZAKC 3MGTA 4E41A 3MGTB 4E41B 1MJ7L 1LHZA 1TDQA 4X6DB 3MRKB 2VDPH 3UYOD 2EDOA 3L3GB 4LU5H 3OTTA 1F2QA 4G7VL 3FOMB 2AEWA 3C09B 1BHGA 3EYOB 3P2TA 1BEYL 2PCPA 2PCPB 1IC5H 3LPGA 3VCLA 4M6MH 2LTQB 3EDEA 3QIWC 4I18C 4P2QD 1WSST 3VDAA 2IH3A 2YA1A 3O6KL 3B83A 3P11L 2FR4A 3HUJF 2R0WH 1D3CA 4K71B 5L6YL 2KPNA 1CYGA 3IKKA 3ULUF 3AAZA 3AAZB 3B2VH 3D0VB 2WBJD 5H94B 1PX4A 4Z0BH 5D1ZC 3M8OH 4APQD 1D6EA 2IANE 4JVPA 4LHQB 3MR9A 3VGAC 1GZQA 4V2BA 4Y4FC 3REVB 4G3YL 4Y8DC 3DMMD 4DCQA 3QDJE 5F6HJ 4OGAC 4WI8A 2AXGB 5F7DA 5D6CA 3TH3T 3MV8B 5F7DB 5D6CB 3VXNA 5AUMB 4TQEL 4G9DA 2BXYA 1PGRB 1FGNH 4M5YH 4R4FH 3BO8B 3KVQA 1DN2A 5DJ8A 3P4NB 3C9NA 5DJ8B 3C9NB 4L8BB 4RA3A 1I7TB 1W8NA 1I8LC 1MREL 4S0SD 3MGOB 5JOEA 3UTSD 2V17L 4OT1H 1O5DT 3RWHB 3RNKA 2UWEB 4WI3A 5HHQA 4KK6C 3ZDXF 3WIIH 3HNSL 3W2DL 3JTTA 3JTTB 5A2LH 2EDEA 1CLOL 3FO2A 3U0PA 3NZHH 2ZG2A 3QNYB 5GGVH 2CPCA 1JUFB 1RZIA 3BN9C 5I75C 1RZIB 3L5JA 3ARBD 2J4WH 3V4UH 1JGUH 4QT5A 5D96C 4MZ3A 4L29A 5IROA 4RQQB 1P4LA 5FB8A 4GG8A 1P4LB 5FB8B 2JCCA 4GG8B 1NFDA 2YRPA 1NFDB 3UJJH 3PHOA 4F58L 4K23L 2YWYA 1XF2B 5FYKL 1JPGA 4BUHA 1JPGB 2HJLA 3MRGA 2HJLB 2BVQB 4MX7A 5FYLH 1X5GA 4MX7B 4OFYD 2VC2L 5B3JE 1RIVH 3HPLA 4YE4L 3TO2A 4JFPB 1A6TB 2A6DB 1ZA6B 2R39A 1M71B 4KAQH 2H9GA 3N85H 3BE1L 3PWUA 4HCRL 1BBJA 1IT9H 1CFQB 5I16B 5GZND 2XA8H 4DEPB 3U48A 1NMAH 1HHGB 5F97E 5CKAA 4PJ9D 2ARJA 2ARJB 1U8MB 4NRZA 1AY1H 2EO1A 2DLEA 4NRZB 2DQTH 3GMQA 4IDJH 4TSBL 3GMQB 2YPKB 3CIQA 5FUZH 2FJHA 1FGVL 1BM3L 3PHQA 1CXIA 2ZUTA 3W5NA 4UT7L 3TVMB 1FFOA 4N0UE 3IF1A 3KLDA 3CVHH 4J23A 1LWRA 5D5MB 3VXRD 1T1YA 1S8DA 1T1YB 3S5LG 4DGVH 1S8DB 5I18L 4TNVF 1XIWC 2IFGA 4XGZA 4E42B 4QHLB 1PLGL 3MXWH 2XN9B 3B9EA 4ZTOL 4JO4H 1NLDH 5KVEH 1QFWM 2E27L 1BVKB 1FYTB 2V5SA 3QRGH 1TCMA 1B3JA 1EEQA 4HGKC 4RMWA 5CIPA 4FQLL 5CIPB 4L9LC 1S9WA 4I3GA 2VAJA 1S9WB 3F65A 5FF6A 4MJ4A 3O3DB 4BQ8A 5DEFA 3VXUD 5DEFB 4KKAC 4KKBC 5IWLC 4Y4HC 1FVEA 3CX5K 5D70L 3TA3A 5IFHL 2CDEA 2FECI 1E6JH 2CDEB 4JY5L 4Z7NF 4LSSL 1FO0L 3V9FA 2BNRE 3TJHD 3BGFB 2PYEA 2PYEB 4PJFB 3P73B 1HYSC 3QEQB 4M9PA 2OJEA 1H0DB 1NBQA 1K6QH 2OJEB 1LP9F 1RURL 1NC4D 3O4LE 4PGBB 3X3FH 1OP3H 4NUGH 2HFGH 2VH5L 5DJZA 5DJZB 1FVDB 3C60C 3IFPB 3QPXL 4G6JL 3U30C 1UM4L 1ZT7A 4UQ3B 3ZT7A 3IYLW 1DJSA 2G60L 1OAKL 3BH8A 4JPWL 3FTGA 3UP1A 1OTSC 4NO0D 1A6VL 4IIQC 1IFHL 2Q8BL 2AK4E 2VDOH 1QRND 1T2QH 2AJZA 3IJHA 2AJZB 3IJHB 1EEUA 2GT9B 3KPNB 2XWJA 2XWJB 4DW2H 1FZMB 4S1RL 5TJWK 1Z9LA 2GK0B 4B50A 1JZ2A 2PO6C 5GRXG 1WCBB 3OAYH 4XXCA 1J88A 5C0EA 2VXSH 3GSNA 4HKJB 4P4KA 2E9BA 5HHOD 3KYOA 4LCUA 2O61B 3KYOB 4HH8A 2B1HH 2XT1B 1I9JH 3F6IA 1QLEH 3IXAB 4X6FB 1M7XA 4YEEA 2R0ZL 3DGGB 4LIQE 3JV5A 1E6OL 2VLJE 1EMTL 4KH2A 3OB8A 4FZEH 1WWAX 3JUYA 3GSVA 3MCG1 4RAUA 4M1DH 4RGNC 5E8PA 5E8PB 5T33H 4ZG1A 2F54A 5J11B 2BVTA 2CD0A 2F54B 5GRUL 1LEIA 1GHFL 1EV2E 3R1GH 1S9XA 4O2CB 1S9XB 4NWUH 3U0WH 1OARH 4CVUA 1OGAB 1CD0A 1CXHA 1F3JA 2XPGA 4NN7C 5D7JB 3BH9B 2F53D 4NQXB 4JRYA 2VLLB 5ECJE 5CHNA 4ISVB 3EFFA 5D2LA 4NBXB 4PV9A 5D2LB 1RUMH 12E8H 1MUJA 1IM3B 3QAZB 3VD3A 4UOJA 1A7OL 1D9KD 1HEZA 4MNHB 2BOCA 2BOCB 4P5MB 1K4DB 3UO1L 1XGUA 2XXCB 5T1MA 1GPOL 4YHOL 3CXHJ 1WWWX 4O58H 4JR9L 4HUXA 1P7QA 1JFQH 5KOVC 1IZKA 3V5DA 1IARB 1GRWA 4WI7A 3V5DB 1CDUA 5MHSE 4DKFH 2LU3A 4MJIB 5IF0A 3RGVC 2HWZH 2NQCA 5J6HB 3DRQA 4BQBA 4PP1D 1RVFH 2X4SA 1N64L 4JDZA 5HVFB 5GJTH 2I9TA 2QHLA 3X3GH 1FH5L 2VOTA 2I9TB 1EO5A 4Q9CA 2OR9L 1U91A 1U91B 2VABA 4JM2D 2GY5A 2VABB 3IS0X 1R3KA 2ATKB 1CQKA 3IU3A 5DQJA 1WBYB 4ONFH 5DQJB 3RIAF 1HI6A 1XGYL 1HI6B 3C8KA 1M7IA 3C8KB 2UZXB 3L3JA 3L3JB 4JQVC 4XMLL 3T0XA 5KJRH 1YY8A 3GJEB 1YY8B 3MOAH 2O5YH 1UB5B 4Z7OF 5JDSB 1OT2A 4ZDHB 4R90H 2P7TB 5AZEL 4NFCA 5I66A 5I66B 5DMKB 3I02A 1J8HD 3P40A 4JY6A 1P1ZA 5HDQH 1P1ZB 1ZHBB 1K85A 1FNEA 5K9JH 1NUDA 2ICEA 3E0GA 5F7FA 2ICEB 3RL2B 4M5ZH 3H9YA 4TVPH 1E4KC 1NGQH 1J0ZA 3M17B 3VRJA 2XOTA 4G7YH 4RFOL 1JHKL 1NGXA 4P2QB 3GMOA 1NGXB 4GW5B 4H5SA 3GMOB 4GG6A 4GG6B 4H5SB 3RI5K 2CDGA 1IQDA 3OL2A 2CDGB 1IQDB 4ZAKD 1JHTB 2FIKA 2HFFB 4U6VH 2FIKB 4PRIA 3VMNA 4KRLB 1QBML 2UY7A 5I73B 1BAFH 3S88H 2AV1B 4GXVH 2X4UA 2EKSA 1WISA 4YHZH 1BJ8A 1P2CA 2HLAA 3MBXH 2H32H 3BPNC 5H37H 2CKBB 3BVNA 1U8QA 4O2FA 1I9EA 1A3LH 4JM2F 2NW2A 4L5FL 2ORBH 3DVGA 3DVGB 1CK0L 4MJ5B 3NCMA 4KPHH 5E2VL 3H9SA 3QXWA 3DI2B 3V8OA 4FQJH 2D2OA 3LY6A 5ESQB 4N0RA 2HRPH 1F4WL 4R4NC 4UMGA 3BJLA 3QQ3A 1GGBH 4H26A 4RWYL 4YHNA 4YHNB 4G8FA 4IOIB 4OLEA 3VH8G 2IBGA 1R5WA 4YGAB 1ES0A 1R5WB 1SY6H 4PJHF 4Z7VE 2J6EH 2OL3A 3VWKD 2OL3B 1U8OB 4Y7MA 3EHBD 3BFOA 2DM7A 4HAFA 4JZJA 3K7UA 1QPXA 2Z9TA 5E8NA 5E8NB 4NNYA 1OP9A 2PR4L 3FHAA 1MHHA 3IJYB 4NNYB 3V0VA 3V0VB 5J12B 5F9JB 4G9FD 1I1AA 3QISA 2VQTA 3IDXL 4U1NB 3HC0A 3VU2A 3TBVA 3HC0B 1KENL 3ABZA 1TETH 5ITBH 2QADB 3Q2CA 4JHAL 1F5WA 4JFOA 4U31A 2ARJQ 1XR9A 4LLAA 1XR9B 3VDCA 1JWMB 4LVOC 2H2PD 2AABL 3GI8L 4LVEA 4P2RE 1YYLH 2GJZA 1JNJA 3UC0H 2UV3A 3LH2H 5IBLC 4HIXH 2JELL 1T03H 1Q0XL 3QUXB 1NAML 3P0VH 3LCYA 3UJIL 1G6RA 3ZYOA 3ZHLA 1G1YA 2VB5A 4ZMAT 4PJIF 1J5OH 2XKNA 3QHZL 4WFHD 3WN5C 3ZKXC 4JG1L 1REIA 1DEEA 5D7LA 5LGKA 3QQ4A 1DEEB 4RX4D 2R2BB 3QQ4B 3TN0A 4BFGA 5DD6A 4LCIL 4HQQH 4LPVA 3TPKA 2CLRB 2CH8A 2H3NB 2X89A 1TVBA 3RGHA 1RZFL 4XPFL 4QGTA 3DX7A 3AY4C 3DX7B 4BSJA 3PWPE 1NBVL 4QY8B 5AYQA 1WCQA 5J0BA 1QBAA 1RUAH 5DRNA 5MENE 5F9AC 2R29H 4NHCL 1HILB 2IC2A 4I0PD 4OLWL 2IAMC 4HWBL 3GEWB 2X1QA 2EDLA 4MXWH 4R0LC 4C55A 4DFIA 1I3GH 3V6ZA 3JSSA 3ZSSA 4Y1AA 4Y1AB 3FQNB 2NY1D 1HN1A 2RHEA 4POZC 1EBPA 4D0CA 4D0CB 4RRPG 1YMMB 2G2RA 2G2RB 3UPCA 5DS8B 4CU7A 2J8UF 4LRNL 1VFMA 3MFFA 3MFFB 2CKBH 3TZVC 4UIMA 5TQ2L 1OVZA 3NFPA 3PGDA 2EH8L 3MACL 3WNNA 4I5BA 4I5BB 4EOWL 1XF5B 3GB7A 2WQRA 2OTWB 3GB7B 4KV5E 2B20A 5F7LB 3WNPA 2R0LH 2EDWA 3BP4A 1FZKB 1LO4L 2J5LB 4G6AC 4XP1L 1BFVL 1ZKAA 4LASH 4OQTH 5DMIH 3RJDA 1LK3H 3GSQB 5CILL 5DLMH 3MV7A 3MV7B 1NC4B 4M48H 2B8OT 3ZDYF 5C0BD 4F8TA 3MNVB 1K9TA 4ELMB 4DKAA 2Y9RT 4MYWB 2HT4D 4B7IA 3WFEH 3BD4A 2C3XA 4QRRD 4PJBB 5CSZA 3QEUB 4HFUH 1HYSD 1QEWA 5EZOL 2NLJA 2NLJB 1ZEAH 1JYXA 3FAWA 3G5YB 3MODH 3UAJD 43C9B 4P9HL 1IGFL 4HJ0D 2R0KL 4M8VA 3U0TA 3U0TB 4BYHA 4R7NA 4R7NB 4KUCD 5SX4H 4O5LL 1UCBH 4MCYB 5E1HB 4C56A 5A40E 5ACLA 5HHOB 4WFGE 2NY6C 2VLMD 1WAAA 1JGDA 4G8IA 5ID0B 1JGDB 4G8IB 3SDAA 3SDAB 4NJ9H 3Q0HA 4NP4H 3O3BA 2EDDA 1X5KA 3IB4A 3GSUB 3MCKA 4PRBA 4NPYA 1MAJA 2ZG3A 5HYJA 4QOKD 5EBGA 4ALAL 5HYJB 4HS8L 4P3WA 4R2GD 2EIZA 5F44A 4RISL 3E2HB 3O41A 1FP5A 3O41B 4PLJD 3B5TA 3WS3B 5A2FA 3T1WA 1NBYA 3QG6A 4HLZG 4XT1C 2YD6A 3QIUA 1F02I 2R1YA 1IC4L 4N8PA 5CP3H 2R1YB 2XKSA 2FECL 3M45A 2QR0A 4J7RA 5CJXC 1JMZA 2ZSWA 2ZSWB 3KDMA 3SDYH 2ZJSL 4CDHA 1G0YR 4N5EC 5C2UB 3WIHH 3IGAB 5ESAA 5ESAB 4WY7H 4WEMB 5E8OB 3LD8B 4MB4A 1BD2A 1BD2B 1CFVL 4UQ2A 1MCCA 2DQIL 4KUCF 4KQ3L 4X99B 3TBWB 3RY4A 2X4NB 4JZNB 4ONHB 3T3ME 4MGXA 2QHRH 1JF1B 1KJ3L 3ZE1E 2BSED 4U1MA 3O6FD 3O8XC 4HG4K 1MFCL 2KDGA 4QHKJ 3WLWD 5ILTH 4NQEA 4N90E 4P99A 4ZQKA 3B9AA 4NRYA 4ZQKB 1D5ZA 4FXKA 2Y36H 1D5ZB 3G5VB 2EXWC 4NQDA 3RL1A 4NQDB 1SM3H 4UTAL 3HPJA 3JV4A 3JV4B 3LS4L 4M1GH 4OLXL 4AEIL 3VFUB 2QJDA 1AGEA 3BEVB 2YUXA 3R0MA 5EZLB 4X7EC 2CDFB 1BQHA 1BQHB 5E2JA 4GRLB 3K2UL 1CR9L 2X1XR 5J6GA 5J6GB 4BQ9A 5C71A 4U0RB 2CUIA 2W9EH 2IAND 2R4SL 3CJJA 5T1KD 4WW2F 5GGRB 1NCDL 3I3DA 4NUJB 5DT1H 4QHKI 4ZO7A 1ORQB 3QDJD 1IL1A 1I9RL 4OD1H 4JFEE 1QZ1A 3B2UC 1GIGH 3D2UA 1U8NB 5HYFA 4X83A 1WC7A 1WC7B 4N9GA 3CDGB 4N9GB 1QSEE 2ATPA 1D5IH 4GRWE 4NOBA 4EI5C 1PSKL 5MEQA 5C0ND 5MEQB 5I1IL 2I26N 3FQUB 4KRMB 1VGEL 4LNRA 5GS1C 1NDGB 4LNRB 4LLYA 3PL6A 4LLYB 2DMCA 4P46A 4OI9A 3VGFA 4JFHE 4X7SH 4U1GC 1YEKH 1YA5A 3MJ7A 1A6UH 2D7OA 1DBML 2ED9A 4OCRL 5I8EA 3V5HA 3V5HB 1U42A 4OKVA 2IGFH 4OKVB 3T09A 3H7LA 2YOCA 3SOBL 4JFYA 4JFYB 3K8MA 4M93B 4X6CB 3FQWA 2EYSA 4UT9H 2BHZA 5CBAB 5JQ6H 4CGTA 5E00B 3W39B 3DV4A 4H20L 4RMQA 3DV4B 5B38G 4ZPVA 3SE9H 5GHWH 4ZPVB 5F8RC 1EHXA 1Q94A 3LMJL 3IAPA 4OZGE 3TP4A 3VWKB 1CD1B 5I74C 4FMFA 3FONA 3FONB 4LGPB 3NFNA 3QUZD 3NFNB 3PABA 4QNPE 3PABB 2ZUYA 4YXLL 3PWNA 5F9DC 3RI5F 1R0AH 2YEZA 3EDDA 5D7KD 4PLOB 3DUHA 1AHWB 2CRZA 3AM8A 4PUBL 2Y06L 2J8UB 2F19H 2MCPH 2ADFL 5FO7A 4GW4B 5DD5L 5EDXA 1YEEL 4FQPA 1YEDB 3LN4A 2YSSA 1JPTH 4XNZB 2EYTB 4LOUC 1FVCA 1JWSA 4YK4B 2B5IB 3MUJA 4CBPA 3ZT5A 1T1XA 4Z95L 1ZLVH 2HN7B 1L4IA 3VG0L 1T66C 4MD0B 4BZ1H 5DQDH 5LGJA 4MAUH 3VD9A 3X12A 3X12B 1QP1A 4JRXB 4WTZA 4Z7WA 1CXKA 2BMKA 1QUNA 5E6YA 4CRPA 2BMKB 4Z7WB 4BH7A 4AL8L 4KKCC 1DQDL 4H1LA 5K9QG 5B3JF 2W0LA 4I0PB 2ZOLA 3BUTA 1IGJA 1IGJB 3TJEL 2BNRD 4WTWA 3RA7H 4XBEH 1YJDH 1INEH 3MLRH 5F3BA 5CD3B 5F3BB 5I1EL 5ENWB 2FJGB 3EYUL 2VRAA 2XTLA 2G75A 2G75B 5JIHA 2D9CA 3T08A 2NY1B 5E94B 3S36X 3SO3B 2XZCH 3HI6L 3GSNL 2AW2A 5C08B 3E6FA 4YQXH 4Y4KC 1G7QB 1X9QA 1WJ3A 1CT8A 2IAMD 2YA0A 1ADQH 3CPLA 3VD7A 4ZPTA 4P5KB 2HVKA 5LXGH 2HVKB 4N8VA 3ARSA 4N8VB 3SDXA 4XP5L 4TPRL 4ERSH 3MBEB 3SDXB 4YZFE 3RZCA 5ANMB 1HIML 2AK4D 1KCUL 1SYSA 4NSKB 1FIGL 5DRWA 5F89A 1UH3A 5F89B 4DGIH 3MLZL 3THMH 1D5XB 3HAEB 3MJ9H 4N1HB 3C08L 3SKOB 3HZMA 5EU3A 5EU3B 1FRGL 3CFJB 3OSKA 3WHXA 3QI9B 4QGYA 5IP4A 2MTPA 4GBXA 2MJWA 3UYPA 4BZYA 2X70A 2E7LC 2X70B 4W68A 1U3YA 3E8UH 3SGDH 3B9KD 3BMWA 3D9AH 3D18B 4MA7L 4EZMA 1UWGL 5J1TC 3IDYC 1PG7W 4XPAL 2RCSH 2P24B 3LIZL 5E24E 3CFEA 3ZL4L 5LKNA 2P5WE 2WLYA 4ZUWA 5EUOE 4Q0XH 5KW9H 1YNTA 2V2WA 2V2WB 3VXQB 2P49B 1BMGA 2DM2A 5DXWA 3VW3L 1YEFL 1RULH 2BRQA 1QKZH 3IFOB 1EH9A 3CVIH 2HTKC 1NDMB 3K80A 3OKDA 4GUPA 2VMFA 4KTEL 2MOVA 3ILQD 4RCAA 2FBJH 3I6GA 2Z31C 1MCOH 3P9LA 4JFZL 4XP4H 4HBCH 4LSPH 1KXQE 3ARGD 1N59A 3W0WA 4C83A 1JF5A 3MJ8B 3QZWA 4LSQL 1V3MA 5TF1L 3OX8B 4PBXA 5JHLL 4KY1L 1IAII 4XCNA 5I2IB 1I7UA 2W60B 4D94A 2JTDA 4QOKB 4R2GB 2UVEA 4L1DA 1NAKH 4P23A 2CIKB 3IKCA 1I7ZB 3IKCB 3VXME 1RK0A 4HXBL 1PVHA 2ESVE 4U6XB 3MC0A 1IZJA 2VL5B 1MNUL 5B8CA 4J6RL 5B8CB 2WAHA 2NY6D 3EFDL 4XB7A 2A6IA 5I15H 4LSUL 2A6IB 2Q1EA 3GI9L 3OB0K 4XVUD 1U93B 5B39A 2P8LA 2FLBT 2YD7A 5D2NC 4CVZB 2Z93B 2DYPD 1PEZA 1Q9OA 4HWZB 5HBBA 1UXSB 2DLTA 4G6MH 4WDIA 3MOBH 2XQBH 1LE5A 1LE5B 1DUYB 1GGCH 3BKYL 4K8RD 1N0LA 1SHMA 2DL9A 4X9HA 4Z8FL 2IQ9L 2X7LA 3TT1H 5KVDL 1YECH 1EGJH 3AREB 1H9VA 4L4VE 4F7PB 2W9DL 1FBIL 3RAJL 1WQVT 3NACL 1JN6A 3FQXB 4HGWA 1IAOA 2I07B 3O6FB 4HGWB 4P5TD 1I1CA 1TQBC 2Y4SA 1TPXC 1RZ8B 4YBQC 4G6KL 5DJ0B 5GS0C 5I1LA 1KT2A 4BQ6A 1KT2B 3GO1H 3BZFB 2IFFL 1KTRL 5SWSE 3UJTH 1BQLH 2FHCA 2DBLH 4FQIL 2Y7QA 4YDVA 2Y7QB 4LKCA 5J1SC 3BI9X 5ICXA 4ZOEA 4PJ5A 1EK3A 3CXHK 4F15B 5BS0B 5BS0A 2YZ8A 1QFWH 4O4YL 3F7YA 4FQQB 1YPZE 3VG9C 5F9OH 3RKDD 3S4SA 3L6FA 2ICWB 1BWMA 5KSAA 2CMRL 5AWNH 3KHOA 2DM3A 1EJOH 4PY8I 5EU6A 3EOTH 5EU6B 2MHAA 5IT2L 4K7PX 4LDLB 4DVBA 4ENED 1JHLH 2O5XL 3PV6A 4DAGH 2EXWD 2OQJA 3VMPA 2UZIL 3D5OF 3QDGA 2FGWH 3B6SB 1UZ8B 4M6OH 1HWGB 1XGRA 4NWTH 3RVWD 3MLPA 1J86A 3IU4H 3QDJB 4Q9QH 2FD6L 1JTPA 3QNXA 1P4IL 4LHUA 3QNXB 3V6FA 3DRTB 3V6FB 5TDNA 2JF1A 3WXWL 4U33A 3F8UB 5D1QC 4Z7UA 5DHVH 4Z7UB 3VD4A 2FRGP 4LCCA 4ODXA 4G8EB 4ODXB 4OZHB 1J1OL 2F58H 1OQXA 5EC1A 1OM3L 3E3QE 1T0MA 1CLYH 3RRQA 1EPFA 4K94L 1NCBH 3RUGE 5JMOC 3DUUB 5IUSA 4F80A 5C0RL 3EO9H 1G6RL 4L3AA 4DK3A 2EDNA 4MB3A 2Y1VA 4CADB 4MNQE 4OCNC 4HMCA 4YDKH 1QHOA 1MHCA 2ZCKH 1MHCB 3HI1A 4OB5L 3CNKA 1OCWH 4X4ME 3CFKB 3OKNA 4U6YB 3PXJA 25C8H 2OZ4L 1TIUA 3GMRA 4EI5D 5KS9E 4K3JH 1MJ8L 3PNWB 3T3PE 1HOCB 1JPSH 5CINL 1CE1H 1KB5H 1FAKT 5T1DL 1N3NB 1NL0L 4P2RD 3V6OA 3QIBC 2W0PA 3CFDB 3ARDA 2DN7A 4FNLH 2OXHA 3RPIA 2H8PA 3RPIB 2H8PB 1JZ6A 1J1XL 3DX6A 2QTEA 3DX6B 4UIKL 2BCKA 2GKIA 2BCKB 1RUPL 2E9WA 1BQSA 5J57B 1P7HL 4M6AA 4N0YH 2EXYC 1YDPA 2MQ0A 1WGOA 3HI5H 5E6IA 4MA3B 3QJFB 3NH7H 4IMLB 4NGHL 3G9VA 3HS0A 4LEOA 3HS0B 4IJ3B 2M26A 3PWPD 1BWWA 3QEGH 1FDLL 3QP3A 1VESA 1G9ML 2RGSA 2YUZA 5MEND 2YKLL 4WEUD 5IGXH 4Z7VF 5ISZA 4TUJA 1NMBH 1QFHA 4TUJB 5IW3A 1YN7A 4XWOC 1MIEH 4HPOL 3S35X 1PD6A 2JJUA 1ZS8A 4V1DA 1ZS8B 1FQ9C 1X5FA 4LCYA 7FABH 3HE6A 3TT3H 3HE6B 3FB8A 3DPBA 3FB8B 4R4BA 4R4BB 5DR5L 3S34L 3OF6D 1Z3GL 1KTLA 1VA9A 3T0WA 2R69L 4Y19E 4YUEH 4YWGL 5IHUH 2O5ZL 5JPMA 1KEML 1P9MA 4YHKL 2VDQL 5C3LD 4HC1H 5CEYA 4PRPE 1A6ZB 5DC4B 1CFTA 1MCQA 1MFAL 1CFTB 4NKQB 1DSFL 2VXUH 3MYZA 5EOCH 1FL3B 1A7BA 3EJJX 3F7VA 1T3FA 3O2DH 3VFTA 4LOUD 43CAA 2YD9A 3EZ8A 3RWFA 4F7TA 3I84A 4F7TB 3U9PL 4GKOA 3SPVA 5GGSY 3RWCA 3RU8L 2FL5A 2FL5B 4LPYA 1FJ1A 1FFNA 3ZO0A 1A7RH 4XPTH 4WO4C 4OLVH 4BH8A 4BH8B 1L6XA 2N4IA 3D39D 2C1OB 4B7LA 3IFNL 3HC3L 4LK4A 2L7UA 1JBJA 1I7RA 2CXKA 1H5BB 3QCTH 5F9WB 4KKCD 1H3TA 1VKXB 3MRJA 3KLAB 4XNXL 2C3WA 1QO3A 1YYMH 3ARFA 4NOFA 2JB6A 5LG1A 4XMPL 3I50L 2AXHA 5F1SA 2AK4B 4BELD 1S3KL 4XHJD 4UNTA 4X9BA 1FFPA 1PQZA 1OTTC 1FFPB 5C9JA 5FGBC 3X13A 1G0DA 1UYWH 4OCXH 4RGMB 2V2TA 3LEXB 2V2TB 4J1UA 4J1UB 5A3ID 5LGHL 4NQTA 4GSDH 1I8IB 1OAXH 5EIIB 5ALCL 4HWEH 4HEME 3GK8H 4K3DH 3B9KB 1MWAB 4MAYD 4WHCA 1KYOJ 4HJGB 5KSBB 2W91A 2Q8AH 4KV5F 5D9SB 5FDYA 5EN2B 1TMCB 4AH2B 3GBNL 4FQHA 4AG4H 3IJSB 2ZCLH 5FGCB 5HD8C 5C92A 4KU1A 1KIPB 1T83A 1S7RB 3SCMC 4IRZH 5AYUH 5HGBA 5D93B 5HGBB 4ZSOA 3O11A 1LD9A 3WFCH 1KLUA 2BY3A 2KQNA 3I2CH 3D87B 4D8PB 3I75A 1S7VB 1E4XH 5DTFB 4YX2L 2C7UA 2C7UB 2HTLD 4XMKL 1WEJL 4EIZC 4S1DC 1C5DB 4IS6B 3MO1A 3O0RH 1NCWH 2A9NH 1IQWL 1KIRA 5GIRA 1KN4L 4K94C 3W11C 4RNRB 5F1IB 4MXVE 3BDYH 1WBZA 1A64A 5JHDA 5JHDB 3GFUA 5J4MA 4NDMA 2ADJA 4HV8A 4NDMB 4G8GA 5H37G 3TO4C 3NFSL 3H0TA 5IEHB 3H0TB 4RFEA 2DTMH 1A5FL 4FFZL 2KUTA 1DQLH 1HSBA 1HSBB 1AKJA 4M6NL 1Z5LB 5BZWA 2VDKH 1NSNL 1ACYL 5LAXB 1HKLH 4JKLA 1QYGH 4AEEA 3CC5A 3JWOC 1DE4A 2W0KA 3CC5B 1DE4B 3ARUA 4PB9L 2RB8A 3C5JB 1JWUA 4NFBA 1JWUB 5SX5K 3S96A 3S96B 3QO0A 3L5WA 3L5WB 3S37H 3U4BH 5DI8A 4XCEB 1DVFD 1JI2A 3HC4H 5I8KH 4NC2B 5K93A 1JV5A 3WBDA 3FMGH 4OLYL 2VKXA 1NEZA 4MNGB 4Y16B 2EDQA 2YUWA 3OGCA 3MRMA 4RMUA 4JM4L 1OAQH 1W0VA 3I9GH 5INCA 1CICA 2Y07L 5DK2B 1CICB 1ACZA 2PTTB 5HYIA 5T5FL 3FRUA 1RIUL 5E5MA 3O3EA 3IDIA 4PJCE 4F33A 2FX8H 5T3XL 5IVOA 4FTVA 4P5TB 4FTVB 3E3QC 4WUKL 4LLDB 5C0CD 2C4FU 4YPJA 5D7IA 5D7IB 1N26A 4ZNEA 2C3HA 5HJ3A 5C07A 3T3MF 5C07B 2JJTA 1L7TL 4QXTB 1T0PB 3ZE1F 3T0ED 4IRJD 2G5BA 3WJJC 2G5BB 3GIZL 4NFDA 1VEPA 1IGIH 2DWDB 1QSED 4OZFA 4OZFB 2J8OA 4U1HB 1Q8MA 4N1CA 2W38A 5BO1H 1AO7A 3ARYA 3OPZH 1U8KA 2AGJL 4OCWH 3BP7A 4PRAA 3BP7B 5IFJA 4KZEH 5IFJB 4I1NB 5I8OH 3QUML 1IVLA 1QSVA 2B1AL 4WCYH 2FX9L 1IAIL 1C1EH 1RJLB 2WBJA 4JFHD 1BIIA 2N56A 3HFML 1NUNB 5B4MD 4FXLA 5GISH 3RDTC 2FYYB 2GHWB 3G5ZA 4AT6A 2B0SL 3P3YA 5I1KH 5IMLB 1I3VA 3UTZB 3UTQA 2P48B 4K9EH 1HZHH 5GRJH 1NCCL 5I76A 3DMMA 4L4TD 4HPYH 4YHYC 3U4AA 3TIEA 5IOPA 1YQ2A 1CD9B 4KDTC 1JPFB 4OQTA 4MHHI 3PQYA 4IRSC 1ZGLM 3PQYB 5KANG 4JPKH 4LQ1A 1JTOA 5L8LB 1NJ9A 1NJ9B 1HHHB 2DIJA 5CP7A 3BAEH 2I9LB 3O9WB 4EIGB 1T20A 4LPCA 15C8H 5HTSA 2P8PA 4P9ML 5I9QC 5BQ7A 4LSTL 4XAKE 3OAUL 2EDJA 2AJ3A 3D3VE 2AJ3B 5C6TH 4YDIH 1JRHH 1RJYA 1TJHH 4Y2DC 1RJYB 3ROOA 4GRWF 5J13B 1ZOXA 5FXCH 1UJTA 1INDL 5FV2A 1MF2H 5LBSL 4X4ZA 3WKNA 3NN8A 4UAOB 4P2RB 3LPWA 2YD8A 1NFIB 2BSRB 1OF2A 1JGLH 5FM5M 1BECA 5DYOA 4Q6IC 3V4VH 4K8RH 4NKMB 1RZKL 2J88L 3HNVH 1KCRH 2O26U 4OFYA 3VA6A 3NAAH 2KL6A 1QFUL 1D5BA 3KXFD 5LCVL 3FL7A 2A77H 3MTRA 3VFVB 4NJAL 1X5HA 3MREA 1AJ7L 1ZLSH 5SWZA 2YC1B 1I9IH 1U3HA 5SWZB 4QHUB 4JFQA 3LRGA 2D9QB 4PJ9A 2C1PB 1LP9A 4KRNA 1G7MB 2GITB 4XP6L 4TUKL 3L3IA 4LEXL 3L3IB 3CLFH 3D69B 1WTLA 5L2KA 4OZGF 5F96L 2HT2D 1KG0B 3OKEB 5CP3A 3C2AL 2XA3A 2XICA 3SGEI 4M7LT 4QNPF 5TH2A 4PD4J 5HY9A 2VDPL 4WUUE 1JVKA 4LU5L 1RUQL 1AD9A 1MQKH 1BF2A 3DROA 4FG6C 4CKVX 3DROB 1V05A 1DANT 2ED8A 1MFDH 2OYPA 5GSRB 3VXPA 4QRQA 5LQBH 3MOQA 1IC5L 2W1NA 4QRPE 4M6ML 5T3ZL 3TLRA 1FE8H 4UDUA 2UUDK 4UDUB 4TUOB 3H9HA 4XWOD 4R6UA 2Y5TA 2R0WL 1I1FA 2X9WA 2Y5TB 1I1FB 5C3TA 2NY2C 4W4OC 3O6LH 3WS6C 1ZAGA 1MIML 3VXUA 3B2VL 4WU5B 3AC0A 3TBTB 1FLRH 4WFFE 4Z0BL 3M8OL 4AIXA 1L6ZA 4GMSH 3GRWH 3UBXB 1KLGA 3MRDA 3MRDB 3ROLB 4MVBD 3R4DA 3D39B 3QCVL 4X4XA 4X4XB 4MQ7B 4EUPH 3HE7A 2MKWA 1X5YA 4NQCE 3HE7B 4Q7DA 3TESA 1QBBA 4NO5B 2IF7A 2NW3A 3SQOH 4E41E 4R4FL 3MLTA 5JORB 4PYHA 4X6DE 4F7CB 1A47A 1KB9J 3QQNA 3DHJA 4JG0H 4YFDB 5ADOH 2P5WD 4NO0A 1BVLA 1F11B 3HZYA 1QTYT 2DKMA 3HZYB 4ZO9A 5JXAH 1R24B 2QKIA 3P9MA 1QFPA 1MCLA 3OKMA 2AK1H 3VFSB 5IG7B 1FNSL 1AFVH 4LL9A 4WV1A 4WV1B 4LMQE 1VFAA 4O51A 3NZHL 5GGVL 4O51B 2XYCA 1CXEA 4G43A 5E2TH 3VFMA 3V4UL 1NGZA 3VFMB 1JGUL 1NGZB 2E7BA 4YZFF 4I9WD 4MAYB 4M4RA 2APTA 2DL2A 4UOW0 4J3XA 5DZOA 3UJJL 1UB6A 2ZUQB 1MLCA 1U6AH 5ETUA 3BD5A 2EC8A 4WTXA 4MZ2A 2M8XA 4RAHA 3UDWC 2A6KA 4U1JA 1EEYA 2P5ED 3SDCD 5FYLL 2HMIC 3MV8E 5ERWA 3VXMD 2FZ3A 1RIVL 3VXSD 1GGIH 4I13B 4HKBB 4P59L 3O4OC 1A4KA 2ADGB 3PGCB 1A4KB 1CE6A 3VJ6B 1CE6B 3CH1A 2DB8A 3CD4A 4C4KT 3EOAB 1IT9L 3FB5B 3F5WA 1IKFH 2XA8L 1NMAL 4OZIA 2CRIA 4OZIB 4AY0A 3WCYA 1EFXB 4GAGH 5HHNB 2RFXA 4A2MA 2RFXB 4JFFA 2F53A 5MEPA 5MEPB 5I1GL 1AY1L 1RY7B 2UWEE 2DQTL 5EUOF 4QWWC 4U2YA 1CDIA 1FZOB 3K4DA 3LS5H 5FUZL 5SX4I 5IFAH 1VCAA 1FAIH 2APBA 5TDPA 5TDPB 3GMLA 1CGUA 4HUVA 2C4XA 1N0XH 3CVHL 4MA8H 1TTGA 3DSFH 2GJ6D 4MD4B 2Z35B 3L7EA 1RIHH 3HR5A 2AERT 4X6EA 3HR5B 4S1DD 3MLUH 4JJHA 1NFDE 3IETA 5HYSB 4UBDD 3VRLE 3RWDA 3RWDB 1FV1A 4GS7C 1FV1B 4JO4L 1YMHB 3BSZL 4FQXA 4FQXB 4UB0H 5D1XD 5JXED 5SWSD 1U36A 4JAMB 4OFKA 1CG9A 4U3CA 1KJ2B 1KF9B 1RZKC 5E95B 2H26B 4H25B 1AGCB 3GJFA 3RTQC 2R1XB 2AEIT 1N5YL 4ZNCD 5F71A 3IAQA 3LKPA 2BC4A 2Y23A 4GFTB 3DIFB 5D71H 2VZOA 1K2DA 5EBLA 3FCTB 1K6QL 1V7NH 1L0QA 1ZV5A 3X3FL 1T5WB 3EJZD 2XNAB 2HFGL 3O2WH 3ZMRA 5IB5A 4J4PC 5IB5B 3BGMA 5KSUA 3SJVA 4X7FC 3SJVB 1XF3A 5KSUB 1OPGH 1XF3B 1H3PL 3FQTA 3FQTB 1FSKC 5C0CB 5ALBH 3ZTJH 2WUCH 4PJHA 4WWKC 5CEZL 2XWTA 3TYFA 4FP8H 1KCKA 2XWTB 4FQ1H 3TYFB 1CI5A 3VXOB 5IHZA 1M6OA 1T2QL 4Y5VC 5IHZB 1H3UA 2XN9E 1L0XA 3FOLA 3FOLB 2IBBA 3S98A 1C7TA 3T0EB 4DW2L 3V79C 2VDRH 1BQHG 1FYTE 4NZTL 4HIEA 4N68A 3RVUD 3C87A 3OKOA 4XX1G 3BP5B 4ZAKA 4X8XA 1ZVYA 2JJSC 3FT3B 3RBGA 1LO2H 3CK0H 1X5IA 2NY7L 3HCVA 4NC1E 1YN6A 1NMCC 2B1HL 1UXWA 4Z77A 1I9JL 1QLEL 4OUUA 4ZXBB 4OUUB 4CVXA 4KJQD 2PYEE 1YPZF 4PJFE 2V2XA 1M1SA 1NUGA 32C2B 3QEQE 3QIWA 5DJCA 4I18A 3QIWB 4JHWH 5DJCB 4I18B 1JL8A 5IMKB 4PJIA 1F4AA 4PJ8C 3ULVE 1HNFA 4L4TB 5HDOA 2GY7B 4PG2C 3MNWA 3CZFA 3TCLA 3LQAC 3QEHA 5T33L 3QEHB 4XWGL 5DFTA 2GFBA 2GFBB 3R1GL 4MDJA 4NWUL 3U0WL 5BV7B 4AM0A 1RU9H 1OARL 3DX8A 1HXYA 5D1ZA 5EZIH 3DX8B 1HXYB 1AR1C 4AM0B 2J1KA 2VXVH 3QDMB 1K8DA 2DJSA 1FZJA 1R3IH 2YPLA 1FZJB 3FT2B 3VGAB 4Y4FA 2DICA 4Y4FB 2PXYD 4EN3D 2JIXA 2YS4A 5I17B 12E8L 4KHTH 3C6LC 4X6BA 5CBEB 1DFBL 2ZOKA 2ZOKB 4YO0B 1CN4A 5IBTH 2NY0C 2EECA 4S10A 3WXVH 4HD9A 1YEIH 2E8YA 3KPRA 4O58L 3OB0H 1R3JA 2XTJC 1I8LA 3RUGF 5DJXB 3BQUC 1G7LA 1PYWA 1KJ2H 1G7LB 3WUWB 1PYWB 4JY4B 2V7HB 4FFVC 4DKFL 3O81A 3V7MA 4JN1H 4WNQA 4WNQB 3MV9A 5GZOC 3T0DA 3MV9B 4D9QE 4OQ1A 4MD5B 4HUUA 4HUUB 3VE0A 4R8WH 1RVFL 2R1WB 2X9YA 3A6CH 2VDNH 1S9VA 3T2NH 2RIKA 5CSGA 5GJTL 2F54E 3X3GL 4F57H 2BNQA 5KS9F 2AV7A 4DQOH 3KXFB 3T3PF 2L4OA 4Y19D 3CSGA 3QWOA 4ZFZA 4ZFZB 3MLVH 1OGAE 1H8NA 4JFDA 4WVRA 5HI3C 5E7BA 5IESH 2OI9B 4A6YA 4QXWA 4PRPD 4A6YB 2ID5A 5EO0A 5IK3B 3JVGC 3ZHKA 4RA0C 4PS4H 1F97A 5D2LE 1U8HA 3L3HB 5KJRL 3FT4B 3MOAL 1IGMH 2O5YL 3HHRB 4LPXA 1G9NL 2Z8SA 3MUGA 3VFPA 3MUGB 4LAJH 3VFPB 2VAAA 4N8CH 2H2SC 2R9HD 2VAAB 3SE4C 3TIDA 3TIDB 5JLZA 4G80B 1T1ZB 5C0FA 2NXZD 5C0FB 5LJYH 3IDJA 4XBGA 2AQ2A 3IDJB 4XBGB 1F4YH 4LLWA 5K9JL 4LDEB 4LLWB 3F58H 2LTQC 3LSOA 4M5ZL 5IB2A 4TVPL 1TZHA 3PWLB 5IB2B 4LQFH 4GRWH 3BEWB 3W81A 4ETYA 4G7YL 4WTZG 3MRIB 4K71C 3L3DB 4MJIE 4AZ8A 5I1DA 4U1LB 5I1DB 3FFCB 4JO2H 4U6VL 3VMOA 4ZFOB 4OBSA 4P57A 1MI5B 3S88L 3QBTB 4GXVL 4TTDD 2J12B 3BT2L 1MFBH 2NYYD 2P47B 4PGCA 1G7JA 1FNAA 4PGCB 1XIWA 1A3LL 1Q0YH 1XIWB 1W72H 3AVEA 2ORBL 3P30L 4POYA 3AXLB 4WFEE 2DQCH 3EYQC 1FORH 4Y5XC 4L9LA 4L9LB 3WE6B 3WSQL 2ITCA 4XCCH 4PYGA 5IWLA 1KNOA 4Y4HA 4N8VG 1KNOB 3A6OA 2HRPL 4G42A 4LBEA 4XRCA 4M7KH 1RSFA 3GBLA 1LO3H 2BFVH 1GGBL 5ADPH 4UINL 3IT8D 2NR6D 3JBG7 1GJIA 5E2UL 5C70A 4NQSB 2W65B 2WIIA 1SY6L 3SDDD 3HAEG 3AGVA 4DKEL 3S6CA 1IJ9A 4BSVA 4BSVB 8FABA 5HPMA 8FABB 3Q6GH 2VKWA 3MV11 4I3RH 2YXFA 4GG6E 3UZVB 5IJKC 1JZ8A 1P6AB 1HE7A 3CFCH 1OD9A 1A1NA 2FIRT 1A1NB 3SBWC 3RNQB 4QTIH 3C60A 1C08A 4H8WH 1ZANH 4CAGA 4EI6B 4QRUA 5CCKH 3QXUA 5DHVA 4QRUB 1TETL 2EDHA 5ITBL 3BPCA 3ULUL 2AQ3A 3RVXD 4PJ7B 4IIQA 2V9RA 5DA0B 3WEXA 1YYLL 4I3SL 4L1HA 4QRSA 4QRSB 3MMEA 3LH2L 1ED3A 1PG7X 3ES6A 2LAGB 4HIXL 3ES6B 1T03L 1KIQA 1BBDL 2VSDA 4OGZA 1KIQB 3SDCB 2P5EB 4NM4H 3TBSB 1J5OL 2PO6A 2YD4A 3VXSB 2PO6B 5A43C 4M8QA 1WBXB 4M8QB 1HCVA 1INQA 1Q9KA 1Q9KB 4HQQL 2YN5A 1CF8H 4ETQB 1NCUA 4ZD3H 5MP6H 4R7DB 4DTGH 3RKPA 4X9IA 3ZZ1A 4QXGH 1LDSA 2CLVB 3LZFH 1KB5A 1LK2B 3TVMC 2R29L 3V8CA 1QQDA 3UTTB 4ZOBA 4AMKH 3NIGE 1EBAA 1MLBA 4ZUUA 4K2UH 4R96B 2VTFA 5GRVK 1I3GL 4PBWD 3U1SH 2A0LD 2GJ6B 5J9PA 5J9PB 3AS3A 4HWNA 5GSVB 2P43B 4NN7B 5IQ9A 5EWIH 2FX7L 4MXVF 3KPSB 3ZE0E 6CGTA 3T4YB 4QWWD 5GGSB 5TGBB 4FA8A 5EU4A 3QNZB 5I6XB 5HI4D 5CSBA 5FYKU 5SWSB 2CKBL 3QHTC 1J12A 1VDGA 2CR6A 4NC1C 2OK0H 1I3RA 4FQ2H 2Z92B 3BGFC 1A0QH 1CU4L 2AAVA 4OCYL 2R0LL 3DO7B 4Z0XB 1F42A 3OMZA 4E9LA 3HB3D 4OQTL 1LK3L 4M3JA 3RGVA 3RGVB 4MB5A 2OSLB 5HGDA 1DQQB 1S78C 5DGRA 5HGDB 3PDDA 5FM5O 2DD8H 1UWXK 2XZQL 1Z0NA 4JHZA 3QUYC 4HIIB 4LLVA 4HUKB 1RJCA 2VXTL 5ACZA 1HHIB 3EJYD 2VZTA 3A6BH 1BFOA 5KZCB 4IOFC 4Y1AE 3KJ4B 4HFUL 4X80H 4JQVA 1RHFA 1YMME 2PYFA 4KXZH 2PYFB 4PJCF 3MODL 3IVKA 3ILPB 2JKXA 1OGTA 4WJ5A 4J4PD 4KK8D 4WJ5B 1QFWI 3H3KA 3TEUA 4ZUTA 3RY6C 1A9BA 4ZUTB 1BLNB 4F37K 7CGTA 4KK9D 2B7DT 1UCBL 1UFUA 4JLRA 1B90A 1T4KB 2N7AA 5ABDE 1DL7L 4XAKD 1E4KA 4NJ9L 3D3VD 3O6KH 5H35B 2WINA 1MPAH 3P11H 5IQ7H 1S7XB 1N6UA 1I3UA 3MV7E 1LVEA 1MJJA 2DOCA 5CGTA 1MJJB 4ORGB 5L7XH 1B4JH 2QQNH 5FV1L 1R5VB 4FHBD 1SJHB 5EUKA 5D7JC 4JANA 4JANB 4ELME 5HYQA 5HYQB 2OJZL 3VXTA 3PV7A 3BPNB 4ZO6A 4PJBE 1XF4A 1PDKA 3C5ZC 5KN5A 4E0RA 4QHMB 5KN5B 5C1MB 1FO0A 1FO0B 4EN3B 3QAZC 3ARVA 3OWEA 4PJ8D 2YD2A 3SDYL 3SY0A 3FB6A 4AIOA 3WIHL 1QLRB 1RPQA 3HG1B 5GGTH 2OTPA 4WY7L 1Q9LA 4O02H 5HGAA 1IBGH 5JO5B 5HGAB 1MREH 2WW8A 4GAYA 4PJDA 1EVTC 2FSEA 2GTZA 5L9DH 1SYVA 1SYVB 2PTVA 5FUCE 3GNML 3L3KB 4KDWA 1CLOH 2XRAH 4N0UA 3EOBA 5F1OB 2P4AB 5ILTL 3EOBB 4QEGA 4HDIA 5HYJE 4YBLB 3C6SB 3K8KA 2Y36L 4P4RB 1FFRA 1N6VA 2NY0D 4WIQA 1N2RA 3MRRA 1KJMA 3K2MC 1SM3L 1FL6A 4M1GL 2ICWJ 3ALPA 5J1AA 1JYNA 1TVHA 4ODUB 1TVHB 1X5JA 3TH4T 3G04A 3BQUD 2BSTA 4JDTH 4YAQB 4BQCA 1JP5A 3NCYS 3ARQA 2MQ3A 3N9GL 1ERNA 3B3IA 4LCWD 3B3IB 5GZOD 3V52L 1YY9C 2JB5H 5IKCB 3CSYB 2A73A 3DO3A 5EOCJ 2W9EL 5FEBA 2YUVA 3WN5A 5F88B 3ZKXB 4HCRH 3X11B 2PKDA 1ODAA 1BD2E 1JNNH 1G7PA 4NKDB 1P6FA 2NXZB 5DT1L 5SWQA 3BUYA 2X4PB 3MXVH 3LN5A 1HQ4B 4P2OD 5E03A 3LN5B 2R2EA 4TSBH 2R2EB 3QFJA 4NZRL 1ZXQA 4OD3H 3QFJB 4NQCD 3O4LA 2D7QA 1V7MH 1GIGL 3KHQA 5DDHB 4ZYKB 5BZDA 3TPUB 4PRNA 4E41D 4C54A 3KPLB 5I73C 4HF5H 6FABH 2IAMA 4D0BA 3RP1A 3GBMH 1D5IL 2H2SD 4R0LA 4R0LB 1FN4A 1QNZH 4LLQA 1KELH 1FN4B 4I4WB 4APQC 1MHEA 4NQDE 1K8IA 4PBVC 4GKNA 1S7UA 1ZT4A 1PLGH 3GDBA 1ZT4B 5F7UA 4DVRL 4X7SL 4L8DB 4XB8A 1A6UL 2Z4QB 3FB7A 5EA0L 4FQLH 5KSVB 4PJEF 2GTWB 5E5RB 4XX1E 5DC0A 5CLTA 4ESKA 3TZVA 1BOGB 4HHAA 3TZVB 4HHAB 4CNIA 1QLFB 4CN6A 5ICYB 4CNIB 1UVQA 4XNQA 1T7WA 4YGVA 4UT9L 1BZ7B 1ETZB 1OOAA 2PW2B 4JN2A 3SKNA 4JN2B 3U4EA 3LDBC 3U4EB 3EO0A 3OXSA 3EO0B 5IW6A 5IW6B 2VLJA 3EGSA 1YEJL 3U2SB 3EGSB 5GHWL 1EHLH 4P2YA 5FHAL 2QSQA 4LSRH 5FA3A 1WZLA 3ISWA 4HLZH 2IH1A 2IH1B 5EO9B 1ITBB 1X44A 1UM4H 3ARBC 3MRPB 2G60H 2QADC 4X6DF 4RWHA 1U2CA 5H2BA 1ZT1A 3PIQA 5H2BB 1IFHH 4KFZC 1RMFH 1R0AL 4FN0A 4S11A 2BNUB 1CFSA 3PGFL 2B4CC 3N1MC 3BKCH 2FLRT 4S1RH 3QUXC 2F19L 2MCPL 5ESVA 5A16A 5A16B 5DWUL 1A6WH 2BSSA 1JPTL 5EBMB 4RZCB 1FIEA 1B6DA 1Q9WB 4X6CE 5GZNC 5IHBA 4RBPH 2R0ZH 2VUYA 4BZ1L 1AGBB 3MUHL 4MAUL 4Y2OA 1EMTH 3I3EA 2VUOA 4YNYB 3EYVA 2VDMH 3MA7B 5CUSH 1E4XI 1F6AA 1NEUA 5ID1B 3Q3GA 5DRXA 5F3HB 3Q3GB 4PTUA 3IRZA 1OWRM 4XBEL 5IMMB 5C6WH 2CRMA 3ALWA 5BVPH 5C0IA 1IGCH 5DUPL 3QHFH 2EE3A 1S7QB 2UUDH 3HMWH 2RQ8A 4NKOB 2DQJH 4MCZA 2UWEF 2E6QA 4OFIA 5CJXA 3TVMD 1V5JA 1T89C 1A7OH 4PIRF 1ADQL 1F58L 5BRZA 5BRZB 1UH2A 5FO8A 1GH7A 5GS3A 2ERJC 5LXGL 4IOSD 5EU5B 1GPOH 4OGYH 2G9HA 4YHOH 2G9HB 1PY9A 4O9HH 1Z9MA 3O45B 4Z78B 3U83A 2J5LC 3AMLA 3BZDA 1NFDF 1FYTD 1TZIB 3KPQB 3VRLF 4JRXE 5EOTA 3MJ9L 3F6LA 4Z7WE 4NZDA 3GGWA 2XZAL 1I8KA 5IEKB 2OCFD 1I8KB 5L2JB 2HFEB 3O8XA 2AI0H 3O8XB 3DV6A 4U6TA 1NCNA 1N64H 4PGEB 1Y0LA 1LDPH 2WBWB 3Q6FA 3TA3D 1FH5H 1S9YA 2JE8A 1HDMA 2QQLL 3AU1A 1NAMB 2YMXL 3E8UL 4UZGA 1I8MB 1I8MA 4JPIB 1T7YA 4WU7B 3D9AL 1ZMYA 1IC7H 2PYED 4LPTA 5GRYA 1XGYH 4TN9A 2YRZA 5FM4A 3QEQD 5MI0B 4NHUA 5HDBE 3ULVD 2Q7NA 2H41A 2IMMA 4Z9KB 5C9KA 4Q0XL 5KW9L 2FBOJ 3MRFA 5C08E 3GMPA 3R06B 4OZFG 3GMPB 4NKIH 5FFLA 5DK0B 4K7FA 4K7FB 5DJDA 3KWWA 1RULL 3RFZC 2IALB 3CVIL 3SDXE 4HWBA 4PV8A 2D31A 1GOGA 2D31B 5ANME 1MCOL 2F15A 3KS0H 4DGYH 4HBCL 1KFAH 4LSPL 5C86A 1YUHB 4URTB 3SKMA 4ONOA 2CXGA 4NQVA 1LE9B 1UWEH 1YQVH 1JHKH 4PJAB 3WLBA 3WLBB 1PY4A 1G7IA 3E2HC 1G7IB 1X5ZA 4K07A 4QYOB 5JUEH 1Y6NR 1NAKL 3RVTD 1XMWA 4EI5A 2WWMD 5DJYA 5DJYB 2Q86B 5GS1A 2EZ0D 4X9FA 5I15L 4L5FH 4DN3H 4DOHB 5FM8A 3BGAA 5DEZA 4WENB 4D9QD 1SBSH 4PJFF 5DEGB 4G6ML 1JNHA 2HJKA 1JNHB 2HJKB 3ULVF 2XQBL 1D9KC 2BRRH 2F54D 1GGCL 1KBGH 1XR8B 3BPOB 2GUOA 2GUOB 3VD5A 4RWYH 5D7JD 5GJSL 5ELIA 3U36B 3DETD 3L3OA 2A38A 4NN5B 4JRYD 5IVXB 5CAYB 1Y18A 1FL5A 1HWHB 4F37F 5JW4Q 3W0WE 3VWJB 3SN6N 2VLME 4HG4J 1JRHI 5JPNB 4PB0H 4L3CA 3HLAA 4L3CB 4R3SA 3HLAB 4ZFGH 3NCJH 3OJDA 4PP1C 3OJDB 4JJ5A 5I74B 2PR4H 4HGMA 4KI5E 1AR2A 1ONQA 3LRSA 4OD2A 1ONQB 3GO1L 4QOKE 3EYSH 2APWA 1KPUB 3CMOH 2DBLL 3SKUD 4JHAH 4JM2C 2Q20A 1P7QD 1MCPH 5L0QB 3U9UA 3OF6A 2VL4A 5E0QA 2PN5A 5K9KA 1QFWL 3OR6A 5K9KB 2VIRA 4MJID 4X5XB 4U6HA 3FO9A 4U6HB 3U46A 1RAMA 5F9OL 4GRLC 1Q0XH 1NAMH 3SEPA 1BZQK 5AWNL 2YHGA 3MRHB 4E5XA 4LCWB 3EOTL 1LO5A 1LO5B 1VFBA 2NY3D 3GSXB 1MCSA 2I60H 5FOJA 5MEOA 2F8VA 1JHLL 4DAGL 3W9EB 1X4ZA 5EPMA 3MRCB 3X17A 4M6OL 4NWTL 1ZLVK 4DN4L 2CSPA 1YJDC 1ZHNA 4WFED 1NBVH 3HMXA 4Q9QL 3IRPX 3QQ9D 2FJFB 2XI9A 4P2OB 3G08A 3WIFA 2FEEI 3H7BB 3OKKA 4OLWH 1YY9D 5D2LF 4L3EB 2JJWA 3SGKC 1NPUA 1WT5C 2F58L 5EG6C 2VQ1A 1T0NA 3U7YL 4IDLA 2FATH 5BS0E 1NCBL 2W9LA 3LV3A 4HH9A 4M61A 2R2CA 3UBXG 4FQCH 3EO9L 3VCLB 1JZ4A 4K55A 1PEWA 2IH3B 4LRNH 2FR4B 2PNDA 1NC2A 1WVZA 2BERA 2ZCKL 3U6RA 4Y4KA 5EU6E 1AIFA 1OCWL 2Y25A 4M93C 2EH8H 3NCEB 2DQFA 3KYKL 2DQFB 1X5XA 3MLWH 4K3JL 3BW9A 2IADA 3H2WA 1D6EB 3MR9B 1JPSL 4KI1A 1CE1L 1KB5L 1VENA 1GZQB 1JF6A 1B0GA 1B0GB 5HVGB 4FNLL 1UA6L 1C16A 4DCQB 3VWKC 3EHBC 3LQAH 3H9SD 2V5YA 2XQYG 2ENYA 3VXNB 3SHSA 3ZTJG 4G9DB 4Z7UE 1U41A 3WL9A 1CDJA 2E7LA 4OZHE 3HI5L 3PJSA 3NH7L 1GXEA 1CZ8H 1AHWC 3KPOA 1JYVA 4LLMA 3QEGL 1NLBL 2H2PC 3RNKB 1TZGL 5CZXD 1NCAL 5EZOH 1IILE 5IGXL 5HHQB 4PP2A 1DLFL 1X6NA 1NMBL 2ZUWA 4P9HH 4XNZC 4LLUA 5EU7E 1MIEL 3EIFA 3FO2B 4LLUB 3U0PB 4YK4C 4GG6F 3H42H 5AEAA 1I1AD 3TT3L 4HT1H 2D7TL 4O5LH 5TE4H 2QADD 4QT5B 4L29B 5F6HI 2PETA 2JCCB 4AEFA 2Z31A 2Z31B 2VZ3A 3PHOB 4ELKA 4ELKB 3HRZA 4YUEL 5I1AA 1P84K 5I1AB 4HLJA 1E4WH 3QUXD 2A74A 3MRGB 5JW4R 5EC2A 4HC1L 5EC2B 5DO2D 4I0PC 3HPLB 3TO2B 1OB1A 2VXUL 5EOCL 3REWA 3O2DL 3REWB 2MNUA 4K7PH 3S5LA 4IMKC 2H9GB 3PWUB 4M7ZB 1UH4A 1BBJB 3BHBA 2A83A 2DQUH 3BHBB 3AUVA 2X89D 2ZKHL 1X5AA 4XPTL 4OLVL 2NY1C 5D7KE 3SO3C 5HYSG 5CLWA 1MCNA 2OR8A 5CEXA 2X4OA 4O2EA 5D2NA 5D2NB 5HYEA 5GGVY 2FJHB 3PHQB 3QCTL 4PJXA 4PJXB 1FFOB 3IF1B 3NIGF 1YYML 1PAMA 2DRUA 2X1WL 1BVZA 2KKQA 4DK6A 4KQ3H 5IB3A 2Z8VC 4Y1AD 4GQPH 2EE6A 1XCQA 4XGZB 1F4HA 4JFEA 1CFBA 4OF7A 3BZ4A 1UM5L 3K81A 1YMMD 2BVPA 3LB6D 4MS8C 4R97C 3ZE0F 1UYWL 1MFCH 4GT7A 4OCXL 4LNVA 2ZZUT 3L9RA 3QI9C 5FF6B 1J1PH 4L8CA 1OAXL 1TQBB 4XNYH 1FVEB 2GCYA 1AQKH 2CK0H 2GCYB 4Q97A 3TA3B 2BK8A 3GIVA 3GK8L 3GIVB 1TJIH 4K3DL 5F93C 3ZDZE 2IPTL 1MRFL 2HT4C 2ZUSA 3BESR 4WWID 2Q8AL 4BK4A 4AG4L 2ZCLL 3MV7D 3VG9B 3K2UH 4J3UA 4NZJA 3QJHA 4W6WB 3UAJC 4HJ0C 4Y0GA 2E6JA 3K1DA 5AYUL 1W72A 5CZVH 4AQOA 3WO4B 3CLEH 2R4SH 1N4XH 1UACH 1ZT7B 1UGNA 1ZK9A 3I2CL 4NO3A 4ZTPH 2E8ZA 4NO3B 3BH8B 5FGSA 3AMKA 3FTGB 2DS4A 2Q7YA 1XEDA 3V7AG 2A9NL 4I2XA 3T2PA 5IJVA 5IJVB 1T7ZA 4IEFB 5FKAA 3T4AA 4OZGA 3BDYL 1K5NA 4KI5C 4R2GC 1X3DA 5D1QA 4X7CC 5D1QB 2DTML 2HH0L 2ZCHH 4I77H 3S35H 2O93L 5C0EB 3GSNB 3IDMA 4PLJC 5IMOA 2YXMA 1DQLL 4P4KB 3D48R 4C56D 4NZUL 5T1LA 4TRPH 5T1LB 3DOSA 4LCUB 5D7SH 1UCTA 1AC0A 2VDKL 3LKSA 3SDAD 3FO0H 3LKSB 5KSBE 1T1WA 1HKLL 3CU7A 4J3SA 1KXTB 4ZS6D 3MUY1 5C6PB 3MZGB 4RMTA 3WDIA 1SEQH 4A2LA 5FGCE 4UILH 1DBMH 1N5AA 5HYJD 1HNGA 4Q9RL 3VFRA 3VFRB 5CJOH 3UPRA 3S37L 2WK2A 3U4BL 3GSVB 4RAUB 4WW2C 4WHTA 3HC4L 5I8KL 3D85A 4ZSOE 3D85B 5IVZA 1LEIB 1W2KT 5IVZB 3FMGL 3RVVD 2CK2A 5DC9B 2VYRE 3QIUD 1AXSA 5DSCA 5F7EL 3WHE0 5DSCB 1VSCA 3AREC 1F3JB 2DIAA 2XPGB 4ELMF 1OAQL 2ZNWA 4JRYB 3I9GL 1A4JA 4P3DA 3QIBA 4X0KA 4P3DB 4S0TD 4X0KB 4LDOB 2ZUVA 4PJBF 5CHNB 3EFFB 3WUWG 4PV9B 3O6FC 1Y6MR 1OQOA 2V5RA 1JYWA 4CMHC 5JHDE 1MUJB 3WLWC 2FX8L 5INDA 5INDB 1HEZB 1AXIB 1WF5A 1XGUB 1BD2D 3OZ9H 4Y89A 5T1MB 1A14H 3RWJA 3RWJB 4HUXB 5CIPH 4ODTH 1P7QB 1CDGA 3P77A 4MA1B 1J11A 2LVEA 5FK9A 2ADFH 2DQGH 5IF0B 5DD5H 2UVFA 4NQED 2NY5H 1X4YA 4KUZL 1IGIL 3DRQB 2VLRA 5DHYA 4X7TA 2VLRB 1UWXH 2X4SB 5BO1L 4JDZB 3OPZL 5C0JA 4NQDD 5C0JB 2ZP0T 4OCWL 3A67H 4LIQL 4KZEL 1CGYA 1EEZA 2NY3B 1EEZB 4MNGE 1TCRA 1C1EL 1TCRB 1E27A 3VG0H 1E27B 1R3KB 3ULVH 5E1AA 5TE7H 4S1SL 1A22B 1QACA 3OHXA 4XZUA 5E1AB 3IU3B 4XZUB 5GISL 4RMSA 2VISA 4UUJA 1OL0A 1P4BL 4UUJB 1M7IB 5I1KL 4UU9A 3ZYIA 4GRLD 5I1JH 2F5AH 1Q72H 5GRJL 3KJ6H 1T6WA 4JPVL 1DQDH 4HPYL 1DCLA 4X8JA 3RX7A 4NM8L 2APVA 1A1OA 4FTVE 1A1OB 3TJEH 3I02B 3JV6A 5C0NC 3JV6B 4F9PC 1UZ6E 4DZBA 1C8PA 4JY6B 4JPKL 1FNEB 1RK1A 4XCFH 1ORSA 4TNWK 4XAWH 1ORSB 3BAEL 1OAUL 4WO4A 2P5WA 3ZKMD 5D7IE 2WWKO 4U7MA 3VRJB 15C8L 5C07E 1GL4B 5EU7C 2HJFA 1EO7A 4D0DA 2R56H 1Z0MA 5JOPE 3BP6A 4PRIB 4OSUH 4YDIL 1JRHL 1TJHL 4YPGA 2B2XH 2X4UB 2EKSB 4YPGB 4GLRI 1URLA 1DUZA 1P2CB 2HLAB 1DTUA 3PL6D 4P46D 3AS2A 3VH8A 1FIGH 1HHJA 1BX2A 2JK5A 3BVNB 1HHJB 1U8QB 4U1SA 1MF2L 1XGQA 4O2FB 1XGQB 5FO9A 2OP4H 2N7BA 3UZQA 1XT5A 2NW2B 4G5ZH 4NCC1 4JO3H 1JGLL 5FGBA 1J9CT 4JQXC 4UI2A 3H9SB 3V4VL 4K8RL 3QUZC 1C7SA 4XHQA 3HNVL 2CLZA 2D0FA 4M7LL 1LQSR 3MNZA 3MNZB 1C5BL 2ESVA 2VITA 5JZ7D 3HR6A 2DLIA 4MA7H 3BX7C 3QQ3B 3PQYE 3P4MA 4H26B 2A77L 4AENA 4XC1H 1KC5H 1ZWIA 1A7QH 4G8FB 4J8RA 1I9IL 1BOYA 1ES0B 5KOMC 3TYGH 4PREA 2X05A 5E5UB 1UKQA 1KULA 1F2XK 4X5LA 3CLFL 4JZJB 5I8CA 4YC2C 3SCMA 1PZUB 3VW3H 1MHHB 5DUMH 2FCBA 4D3CH 4KTEH 2FEEL 1I1AB 4QF1A 3TV3H 2A1WH 3TBVB 1MQKL 1YNKH 1XAUA 2AJUL 2NNAA 2L7JA 3CZJA 1HH9A 1KJVA 2A9MH 4JFOB 5M7QA 4KVCL 3I85A 1MFDL 5IW1A 2X1PA 5DRZA 3CGTA 5GGTA 4L4VA 1QSZA 2GJZB 5LQBL 3DXAA 5JHLH 3DXAB 4MWFA 1MRCL 3MUZ1 5LWYH 1FE8L 3VA2C 1EAPA 4XPHH 1CL7H 1G6RB 3TO4A 2LVCA 2CIIA 3O6LL 3TO4B 2CIIB 2XKNB 4GO6B 1C12A 1ND0A 1C12B 5D7LB 4HXBH 5F6IC 3TN0B 5DD6B 3BD3A 3BIKA 4YXKH 4Z7NE 1CXLA 4X6CF 1TENA 3OAZK 2DJUA 4B53A 3DWTA 4LSUH 2OZ4A 4JRXD 1G0XA 1TVBB 2Z91A 3GI9H 2Z91B 4KKNA 3N0PB 1IGYA 5SWZE 5DFWH 4QO1A 1H5BC 4I48A 5F9WC 1ZLWK 4I48B 4WI4A 1CDYA 5DRNB 4MJ2A 4J3OC 1JIBA 1GZPA 3RIFK 3SQOL 3WFDH 1GZPB 1CFNA 2DLFL 1FG2A 1P5UA 3P0GB 3V6ZB 1NKOA 1KV3A 4JG0L 1VB9A 1AI1H 1BQUA 4QTHA 1XCTA 4GOSA 2A6JA 2A6JB 4LF3A 4HEPG 4LF3B 4RGMC 5C08D 3UYRL 4RSVA 5JXAL 3S3SA 3NACH 1UQSA 3RX8A 1JI1A 5I1HL 2AK1L 4OI8A 3DVNA 1J0IA 2P42B 5DFVD 5AG9A 1AFVL 1P5VA 4UIMB 3MBED 3RZCD 3NFPB 3PGDB 2FNBA 3B9KC 2VO5A 2AJSL 5E2TL 4RFNB 3SE8H 4KJYA 3I6KA 1TLKA 1B88A 1HCFX 1OW0C 3HZKA 1NGYA 3HZKB 1SJVA 4O4YH 1G84A 4NNPH 3BP4B 4EQ3A 5FOBA 4MNQA 1U6AL 4MS8D 1GC1H 4Z7WF 5DUBA 3D39E 3WJJA 3QI9D 1HINL 5D93C 4X4MA 4BZ2H 3IFLH 4GBXD 4OUOA 3G6JA 4K9EC 4XP9H 4C58B 3G6JB 4WRLA 5T3ZD 3NCYP 5KS9A 2C4FT 1U0QA 4M43L 4ZS7H 4OIIL 3ILQC 1DQTA 1S5IH 2OL3H 5BOZG 3DTXA 3DTXB 1L9MA 1WZMA 5EFIA 1IKFL 2EYRA 3V4PL 3ARGC 1RZJH 3DUSA 1AGFA 3DUSB 3RDTA 5CSZB 4KXZI 1UM6H 4V2CB 5BMFL 2OTUA 5C2BH 1FPTH 4YR6A 4YR6B 5HDBF 1QEWB 5MERA 1HH6A 4ODBD 5MERB 3MLXH 3WXWH 4JB9H 2C9AA 1DDHA 3I6LE 1VACA 1EDQA 1VACB 3K8LA 1TNMA 1R3LA 4KGLA 4NCC2 1IMHC 3LS5L 1IEAA 5IFAL 1IEAB 4YHYB 1FAIL 4BK5A 1IAKA 1J1OH 2F74A 1U92A 2F74B 4JE4B 4KDTA 3RJQB 2B4CH 3DSFL 3ELAT 4IRSA 3SDXF 3SKJH 4C56B 1CVRA 1ZGLA 1M4KA 5KBNC 1RIHL 1XGTA 3W0WD 2HVJA 3STLA 3H3BC 3EYFA 3QO1A 3MLUL 1G6RH 3QO1B 4XVUC 1YEGL 4EJ1C 4LVHC 3O3BB 1K3ZA 3MCKB 4PRBB 3TCXA 5C09A 4KI5D 1S7WA 4NPYB 1S7WB 1S9KC 5HHMB 5HGHA 1AGDA 5DD1H 1AGDB 2EIZB 3CU1A 4K8RC 1MJ8H 4NT6A 4Y2DA 4Y16C 4NT6B 2C3VA 4Y2DB 2OS7A 1NBYB 3QG6B 2X09A 1D6VH 3HMXL 5T1DH 1AC6A 4OV6F 2AEPH 3QIUB 5DVKA 4OZIE 1CTNA 2GIYA 2MKLC 3DYMA 2YK1H 2QR0B 3DVIA 3ULSA 4F7MA 2MPAH 3NIFE 4JFFE 3FJTA 3KDMB 1F6FB 4P5TC 4Q6IA 1JE6A 4H88H 1V7NL 4Q6IB 3RHWK 1ZHLA 4PRDA 1PKQA 4PRDB 1PKQB 4OV5A 3O2WL 5FYLD 4NGHH 5K59E 1DN0A 4UQ2B 3ARED 3KGRA 5DURB 3FRPG 2OMBA 5ALBL 1G9MH 5IV2A 2WUCL 4FP8L 4FQ1L 1NANH 3RKDC 3PUCA 4U1MB 1H3GA 3OGOE 4HPOH 4MQXD 1XH3A 2VDRL 4NQEB 4NRYB 4FXKB 3EDFA 4KI5F 4ENEC 4HS3A 4HS3B 4JREB 3RL1B 5BS0D 1LO2L 3GHBH 3HPJB 3S34H 1Z3GH 1QSFA 4N0CC 1F8TL 3RVWC 1AGEB 2PF6A 5HVHB 3UXFA 1CGVA 3OG6B 2VDQH 5KSAD 3F7PC 1MY5A 4PLKD 5EU6D 1DSFH 4JHWL 4XTRD 4W4OA 3WS6A 3O6ML 4XCYA 2IPKA 3QDGD 1I85C 1KPRA 2VXQH 3CFBA 3SJVE 3O9WC 3WUZA 4D9RD 1RU9L 5EZIL 5C0CE 1IL1B 2VXVL 1R3IL 3NABL 3IFNH 4LHUD 3HC3H 1OHQA 4XPBH 4XVSL 1R3HA 1QR1A 3D2UB 1EO8H 3T0EE 3KR3L 5I19L 1P69B 1HKFA 2H1PL 1SJEA 2NX5A 2ATPB 2NX5B 4KVNH 5J13C 3KPTA 4XMPH 5IBTL 3PWVA 1A7NH 3LN9A 4XC3H 3PWVB 2F9BT 3WXVL 1YEIL 5B38A 3NPZB 1WV7T 3PL6B 4P46B 3K3QA 3V7AE 3CDYA 4LARL 2Z8RA 5JW5A 3MJ7B 3WMSA 4JZOA 2HKFL 4JZOB 2M1KA 5CEZD 4KC3B 3BXNA 5I8EB 1U8JA 1VADA 2DDQL 4L4TE 1D5MA 1D5MB 2Q6WA 2EDXA 2Q6WB 4R8WL 3A6CL 4PGDA 3T2NL 3FQWB 2ZSVA 3WJLC 1SMOA 2EYSB 4DQOL 3LKQA 2GW5A 2ADIA 4OAWA 3HZVA 2ADIB 4HKZA 4Y8AA 1HSAA 2APXA 3ARDD 3GBNH 3MLVL 3QUMA 4P48A 3QUMB 3QDME 1SBBA 2YPLE 5IESL 3KNBA 3HTLX 3W9DA 3X14A 1Q94B 2V7NA 4PS4L 1IKNC 1DBJH 2WNGA 5F21B 3UDWA 1IC1A 3UPAA 2XFXA 1IGML 4Z7UF 3QXDA 5E6ID 1MJUH 4P3CH 1Z9SA 3PWNB 2DWEA 2DWEB 3O4OB 1MFEH 4N8CL 4OZHF 3QXTA 3OR7A 4PGZA 1P7KA 2YEZB 1WEJH 3ZKND 1J18A 4GJTB 3LVEA 1T7XA 1F4YL 4LVNB 5ISZD 5GS0L 4PY7A 2F5BH 4LQFL 5FO7B 4MSWA 4TULH 4V1DD 3CDFA 3LN4B 2YSSB 2X4QA 3HE6D 4PJGA 5EZJA 3MV9E 5EZJB 1GVIA 1FVCB 3O3UN 1JWSB 4FFZH 4JO2L 4OBRA 1OTUC 5D4QA 1WITA 2DQDH 4M00A 1T1XB 2NY4B 4F7EA 2WMPA 4F7EB 4S1QH 4YHIA 3KXFE 1G7HA 1NSNH 4YHIB 1ACYH 3VFOA 5JR1H 3K46A 3MRQA 2LQRA 4PPTA 4PB9H 5LGJB 1L7IH 1NBZA 4EDXA 2YPVL 2AEQL 4GQ9H 1Q0YL 1RHHA 1W72L 5D8JH 1RHHB 4BH7B 4K3HA 2J7LA 4H1LB 5HPOA 2DQCL 5K9OA 4S2SA 2ZOLB 4LKXA 4LKXB 4U3XA 3TFKD 2EEDA 5KVFH 3F7RA 5FCSH 4XCCL 1OY3B 4NNXA 4ZOAA 3PP3K 2IG2H 3GUTA 3A0OA 4M7KL 3RTQA 1LO3L 4HKXA 5ITFA 3OXRA 5ITFB 2Y07H 4XHJC 1H15A 4OTXL 2FEDD 4KTYA 2RBLA 2LAAA 4WGWB 4GH7B 1GGYA 5DD0H 5A3IC 3D1MC 3E6FB 2FO1A 3FHQA 4OM0L 4QXUH 1CT8B 3CPLB 3Q6GL 3FFCE 3ARFD 4ZPTB 1W8OA 3CFCL 3C2SA 4J4PA 3RZCB 3GSWA 3GM8A 5DJ6A 5BVJA 4H8WL 1MI5E 3NOIA 4MAYC 5FYJE 1SYSB 5E9DA 5E9DB 1CGWA 2XQYK 4QHNA 2R2HA 5DRWB 2R2HB 3OKLA 1L7TH 3KS0J 4WWKA 4J3WA 3GIZH 4D9LH 4Y5VA 3HZMB 5GGRY 3ZTNH 4HFWA 1H3WM 3BKMH 4HFWB 4JDVA 3WHXB 4JDVB 5BW7C 2Y72A 2AGJH 4NM4L 2EIBA 4GBXB 5IVNA 5F7WC 1IAIH 1UEYA 2JJSA 2DI8A 2HTLC 1H3VA 3ZDZF 1CF8L 3RIFF 3CFEB 4ZD3L 5MP6L 4DTGL 3QT2A 4ZUWB 4QXGL 1X4XA 3FKUS 1YNTB 4YLQT 3LZFL 2W59A 5I1CL 1RJZA 4PJ8A 1IM9A 3TC9A 3L95A 3WNKA 2EC9T 1MY7A 4AMKL 4BFIA 4PG2A 2ZNXA 4BFIB