2YPVL

Crystal structure of the meningococcal vaccine antigen factor h binding protein in complex with a bactericidal antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPSSIYASLGERVTLTCKASQDIHNYLNWFQQKPGKSPKTLIYRANRLVDGVPSRFSGGGSGQDYSLTISSLEFEDIGIYYCLQYDEFPPTFGGGTRLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Defining a Protective Epitope on Factor H Binding Protein, a Key Meningococcal Virulence Factor and Vaccine Antigen.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Immune system
molecule keywords LIPOPROTEIN
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ypvL01
5IMOB 4QRRD 1JYVA 3UAJD 1A3QA 2JTDA 1M71A 1MWAA 1XGQB 4Z0XA 3C8DA 3ILQC 3TNMA 2FJGA 3MFGB 2AEPH 1KFAH 3WMSA 2ZJSL 3UROR 2HH0H 4HGWA 5JXED 4PR5A 4UQ2B 3O2DH 4I9WE 4Q6IC 1WV7T 4JFYA 5FKAB 3NA4A 1MNUL 4JPWH 4P3DB 5HHMB 3GI9L 2UYLA 1NEUA 4F57H 5CJXC 3P9LA 4MZ2A 3D87B 1NLDH 5AEAA 3W0WB 1Q0YL 4XRCB 2H8PA 1RMFL 1JYXA 3OKYA 5JIHA 3PHOA 1LE9B 4QHKI 1IQWL 1KLUA 1S9WB 3AC0A 2QBWA 3IRZA 4O9HL 5HHVL 5DJYB 1Z9SA 2A73A 4G8EA 1A7NH 1AXSA 5DGRA 3U0WH 1UGNA 4C83B 3O6FD 4WFEE 1ACZA 3IB4A 3E6HB 4OCYL 5BQ7B 4UNTA 4RFNB 4QO1A 1MCIA 3IFOB 4KRMB 2WUCH 3NH7L 5FECB 3WN5B 4YHML 2BNRD 3QDGA 2N7AA 4N0FA 1HINH 1E4XI 3B9VA 4RMQA 4WEBL 4G7VH 4PLKC 3QDGD 1T4KB 5DR5H 5HVWA 3SCMD 1U8MB 3RUGF 3IXTA 5H94B 4Y1AB 5FGBA 4POZD 1NANH 2MSPA 3MV9E 2NXZC 4EDWH 3TBTA 5H94A 5D2NA 3F7YA 2I24N 3HMXH 1R0AL 5C0FA 1FAIL 2PTTA 4HULB 5FYKU 2WIIB 4OZHE 2UZXB 2HH0L 2P47B 5CEYA 2P24B 5EUOE 1M6OA 3F7VB 1I7TA 3U4AA 4PJEB 5LJYH 1VFOA 2AXGA 5MENA 4LEOA 5CZVH 4JHWL 1D5XB 4NQCE 3LY6A 3QUYB 1P9MC 1N0LA 4EI5A 1CGUA 3HC0A 4L4TA 2Z8VC 3CVIH 2Q87A 2OZ4H 3RHWF 3ZZ1A 1VERA 1PJ9A 3IDXH 1MIEL 4N9GB 1OAQL 3OKEB 3OKKB 2WV3A 2W0PA 4DUXA 4RDQG 5E2VL 4PJCF 1BQHB 3VFSB 3TIEA 5DA4A 4APQD 5GXBB 4KU1A 1HOCB 4Y2DA 4U1HA 5F8QC 5FEBA 3NA9H 3CSGA 3CDCA 4JKLA 4P2QD 4LDOB 4NZDA 5D7LD 3EUUA 3GMPB 5IFAH 3ZKMC 2ZCHL 4HD9A 1U58B 2V9TA 4XPAL 3GNMH 4U1GB 5H37H 5J6GB 5DA0B 4FXGA 1YEKL 1IGIL 4ONGL 3ROOA 4X4ME 4K9EH 3BKJH 3LD8B 1EO8H 1OAXL 1S8DA 2APXA 2V7HA 5CJQH 5FECA 4JZJC 4RSVA 1S8DB 4Y5VB 4JG0H 1KIPB 1NAMA 4KI5D 4YBQD 1L7TL 4ZYKA 1EAPA 3S5LG 4MAYB 5KS9F 1OW0A 5L7XH 3DVIA 3W5MA 1KJ2A 5C0NC 2W59A 4HT1H 4ZS7H 3RWCA 1ZWIA 5E2UL 4LPVA 5F7UA 4FTVB 2OX5A 1FL5B 4PJAA 5BZDB 3D0VB 4DEPB 2MTPA 4X98A 2C4FT 3X17A 4K94C 1ADQA 3TA3C 4HKXB 3U1SL 3BMWA 4MAUH 3MRHB 3OMZA 5DUML 2WLZA 5F21B 3JTTA 2FX8L 1E0OB 3CPLB 3KPMB 1P5VA 2DYPB 3MRHA 5AUMB 4FQPA 4EN3C 2RFXB 1NLDL 2DYPA 2ARWA 5SWZE 1MFAH 1BREA 2CLVB 3BQUB 3HFMH 1Y18A 4PJGE 4PJDF 4WY7L 3VI4F 5J13C 3QCTL 1FNGB 4WHCA 3GJEA 1S5IH 3SCMA 2IADB 3O2DL 5EUOB 1CICD 2Y9RT 4GKSB 4ZUSB 1CDYA 2QQLL 3VXPB 3OKEA 1KFAL 1FV1A 2MQ3A 3EAKA 3EZJB 3FQRA 5TF0A 4GRWF 4WUKH 3WUZA 4NC2B 3GMOA 5HYEA 2RR3A 1R3JB 3KPRE 1U3HD 3IDNB 4Q58C 4ETQA 3I50H 2ERJB 2J8UE 5L8KB 4HX1B 4Q97A 3TC9A 2APFA 1LDPH 2E8ZA 3BIBX 5JR1H 4HJJH 1D3CA 3Q1SH 1ORSA 1T1YB 1HYSD 3VE0B 4M48L 5E5UB 5HGDB 3O3DA 2FYYA 2YPVL 2F8XC 4XPBL 4WU7B 5BW7A 5GS0C 3D69A 4H8WL 3IDYB 2R4SH 1MRCL 4ORZC 3S98A 4PRBA 3WJLA 1VENA 3MNWA 2WP3T 3IJHB 4ZAKD 3VXQB 1KXVC 4IRSD 4FHBD 1SM3L 3HPJA 4PV8A 2XN9E 1OM3L 4NNXA 3THMH 4Y5VC 1XIWD 3OHXB 1FFPB 4NP4L 4HIIA 3HI1A 1D6VH 4GW4B 3EZ8A 3JTSA 2UUDH 4RGOH 3QDAA 1A7OH 3I3EA 1GYAA 2APBA 2CKBH 4GKOA 3GHBL 2LV4A 2XTLA 4LKCB 3RGVB 2PO6A 5BOPA 1C5BH 2K3TA 2NNAB 5LAXA 2CPCA 2VXUH 1H8SA 2NZ9C 4P4RB 4AIZB 5C0ND 4WW2B 4JFEE 3ARBB 4HH9A 5AWNL 4JY5H 5J57B 5H8DA 4LOUC 1MFCL 4P9HC 2JJTC 3DJ9A 4DKAA 3MRDB 3S36H 4QXGH 4R7NA 4V1DE 2LAGB 4RGNB 5EOTA 1UM4L 1H3WM 3UC0L 3LMJL 3KYAA 1ZLWH 2R1WB 2ZUWA 3MOQA 4ZD3L 3VFPB 1QD0A 3QDJE 4IHOB 1I3UA 3QDMA 3O41A 5BRZA 4OZHF 3VFNB 3CDFA 2OTUB 1ZLWK 5B38A 1EH9A 2YD9A 2R4SL 2ADJB 3GKWL 4JFQA 3I84A 3C2AL 3P9MB 5EUOF 3QHZH 3MRQA 3HB3D 4GS7C 1X7QA 3SBWA 5CEXB 4TVPL 3MCLL 3NPZB 4JM4H 2H2SD 1R24B 1Z9MA 5DFVC 4XCYA 4P2OA 5SX4H 4NJ9L 3PWJA 3ZYZA 1C1EL 1M05B 5E8DL 2NLJB 1CR9L 1MVUB 1J0JA 3L1OH 4DN4H 2NY4D 5DVMA 1CE1L 4PGCB 4R97C 1B88A 4LSTL 3ZE2F 1S7RB 5CWSB 3WD5H 1A47A 2R0LL 4P5KB 5D72L 1P4BH 4HWZA 5BVJB 1N2RA 1EMTL 1WVZA 2Z8SA 1H3TA 2HFGH 3QIWD 2UVEA 3X13A 2EXYD 2HVJB 1JFQL 4IRJA 3PL6B 3RX7A 1JZ2A 3CMOH 4C4KT 3RWDB 3RRQA 1NQBA 2XZAL 4GT7A 4XNMB 2ZUXA 3W81A 2C3HA 1OD9A 2DQFA 3KR3H 5IB5B 4M1CD 2J8HA 1HZHL 3LKOB 4LSSL 4OZFB 2OBGA 5IB5A 5T1MB 1J12A 5IG7A 4YUEL 5I73B 5C0EA 5GGTL 1UJTA 5HDBE 2BVUA 5CINH 2QLVB 1CGVA 3G6JE 1X9QA 4Q6IA 2DLIA 2QADC 5LAXB 3UBXG 2R9HC 2DF3A 3B3IA 4CVXA 5IROA 1AGEA 4WI4A 3HE7A 5L0QC 1SHMA 4Y1AA 1U92A 5IBUG 5E2UH 2NTFA 4K3DL 3WLBB 1SEQH 3MRRA 1XF1A 3BZDA 1JK8A 5L2KE 1INDH 4ORGA 1IGYA 3I02B 1QFWL 3LPFA 5AZ2H 5DJ8B 4TUOA 1NGQL 2AJSL 1EEZB 1L0YA 1MHPL 3S4SB 5JR1L 3HI6L 4JM2C 5CJOL 1DFBH 4X7DC 3M8OL 2RJMA 1VGEH 4IBLT 2Z8WC 2FEDD 3BIKB 1KF9B 3D39E 2ESVA 1DN0A 4N1CA 4IOSD 3OKDB 3L7EB 4QHNA 3RVXD 3QEQA 1BX2A 2ZUVA 4C56D 1U8NB 3ALPA 4D94A 4V1DB 3S37H 1KB5H 2IBBA 4ZTOL 1SJHA 2F5BH 4WUKL 3P4MB 1FZKA 1J87A 5ICYB 1UM6L 1IGFL 1RUKH 3HC0B 5E1AB 2ADJA 4OD1L 4O02L 2A6IB 5GISH 4ALAH 5TQ2L 1ZA6A 4OLEA 4NYLB 5HGBA 2VABB 1ZA6B 5GS1C 1PG7X 1F4YL 4ZFFB 1JGLL 2BOBB 4WI9A 2J6EL 3V6ZB 2F54B 3DUHA 1IRAY 1MFAL 2F53A 4R26L 1FAKT 4L8CA 1BQLL 4MA3B 2F53B 4PJ9D 1YEIL 1MHHA 5EIVA 3T0AA 3QXDA 4NSKA 3OQ3B 4LPUA 1IZKA 1T1XA 5ILTH 2H45A 5SX4I 1H3VA 1MIEH 3UJIL 4QXTA 1IC7L 1KJMB 1P4IH 3K4ZA 5E8OB 2VUYA 1DZBA 1GIGH 3M1BB 4HPOH 1G7PA 2BSTB 3UTTD 3BYTA 3QUKA 1F2XK 1FGVH 2HLFD 5C0RL 5DQ9A 4OLVL 3WXWL 1N4XH 2A6KB 2VITB 4Q9RH 4XB8A 4ENEC 5T3ZD 4I3RL 1UB6B 5DK0A 2P49B 4YBHA 3SDDD 3VG0H 4DGVL 1BOGB 4PJ7F 3CFBA 1YMMD 3H42L 4DZ8B 2GYSA 3QQ3B 3MYJA 3D3VA 3GM0A 1GZPB 4Y88A 1BQHG 3WIIH 3D5OF 4XVUC 4LVHB 5FHAH 2QQKH 3OPZL 3WIHH 4X98B 4QRRB 1N4XL 5B8CC 4WFHD 1DVFA 1CFTA 1HI6A 1T7ZA 4ZXBD 4NZJA 1TVHB 3BH9A 5KSAB 4NNPL 2E5EA 3GDBA 4PJAE 4XP1L 1WGOA 3OKDA 1SJVA 4HH8A 4HPOL 1OQXA 5CJBA 1WBYB 3RVXC 1P84K 4YLQT 1P2CA 2VLJB 5A1AA 3KYNB 5D8JL 3HLAB 3T0WA 1HSAB 4QF1A 3PP3H 3O0RL 5GRXG 1NEZG 3GSUA 5JW5A 3EFFB 5D7JA 1VPOL 5GS2H 4OZIE 5CGYC 5IB4B 1WIOA 1U8JA 2VZUA 4NPYB 1A5FH 1HKLL 3V6ZA 3HNSL 2VL5A 3EW3B 3KPSA 3TVMB 1NMCB 5C0CE 5CFHA 5KVGL 1CXFA 3RAJL 5IT2H 4JPWL 5IUSA 3JUYA 4NQSA 4LVEA 4F7PA 4MD0A 3CX5J 4MDJB 4YHKH 1IGCL 2Y5TA 4BUGA 4MD0B 4P5TA 3GBLA 1I1AA 4Y16C 5GISL 1T7YA 1IM9B 4YHKL 1TFHA 1NGWA 3TPUA 3MR9A 4M43H 3CFJA 3GSWB 4WUUE 4WDIB 3TPUB 5IEKB 3D69B 1LNUA 1BF2A 2EDBA 2HT3D 4EDWL 5T1KD 1QHPA 4WI8A 4C55A 5TF1H 2JIXD 1FL3B 3JV0A 1X5GA 2M1KA 1YQVL 1G6RA 3FFCE 1NCDL 4G6JH 5DO2D 5I1IH 4OFIA 4G9FB 2R0KL 3GUTB 4HUWB 3DX9B 4Q2ZA 5LGHH 5I16A 3V4UH 1UVQA 4JM2F 3GUTA 4WHTB 5JPMA 1XF2A 3NABH 1Z3GH 3W82A 1TVBB 2BNRE 3LQAL 5JUEH 2BCKB 4FTVE 2E9JA 2OR7A 3NFPB 1E6JL 1EBAA 4QTHB 4HH9B 5CBAB 4LVHC 5TQ0H 1U3HB 4Y1AD 5J11C 4XHQA 2JJSA 3C60A 1H5BA 2VLKD 4XCFH 4YE4L 1YEJH 2VXQL 5FO8A 4LSSH 4GSDH 3PIQB 3FFDB 3BESR 5ANMB 2P8LA 5C9KA 5KJRH 3KXFE 2ICWB 2NY5L 4ZS6D 4GLRI 3D85D 4Y4HC 3KPPA 1J1OH 1I4FA 4M1GH 1DQJB 2BNUB 3HB3C 3K1KC 4NKDB 3TA3B 4EI5D 3ZE0E 4BKLB 3QR2A 5F1IA 3LKRA 2COQA 1SY6A 3CU7A 4NZTH 2AJ3B 5SV4A 2XPGB 4GS7B 4BKLA 2CLZA 3IF1B 3VJ6A 5HI4D 1RU9H 3ZTJH 1MFEL 3QZWA 2N1KA 5HHOA 4HC1H 4JFPA 4LARL 2VOTA 1R3IL 1BD2B 1EV2E 3ECBB 5MENB 4OLXL 5A3ID 1XZ0B 5GRYA 3MRPB 1F00I 3GKWH 2CK2A 4ZNEA 1ZGLA 1BQLH 3FO2B 3I6LD 1B6UA 1CI5A 3QO1A 3QXWA 5EBGA 1MJJB 1ZGLB 1OP9A 2YC1B 5GGSB 1HKFA 5F7LB 2Z91B 2KZWA 2YC1A 1Z5LA 5HDOA 2NXYC 4UQ3B 1MI5A 2Z91A 1DBBH 1QKZH 2IGFH 1H0DA 3BMVA 4OCSL 5KSBF 2HT4C 3GIVB 5JZ7C 1BD2D 2CKNA 4O02H 4V2BA 1PEWA 2V5SA 4D0DA 4JO4H 5HYSA 1ZS8A 5IV2B 4QRPB 3MV8A 1EJ6A 3MRLB 3FFCA 1YPZB 2X05A 2ZOKB 5AWNH 2ESVE 3LN9A 3FFCB 2C1PB 1MCPH 4J1UA 3FFCD 1MVFA 4X6CF 1WWBX 2ZOKA 1JPTH 5D7LB 1ZT7A 5C7XH 1C7TA 2XZCL 3RGHA 3FB7B 3H9HB 4EDXA 4KK6C 5AZ2L 2OL3H 1NMBL 3FB7A 4HC1A 3L5IA 3CVHB 4NGHL 2N7BA 1BFSA 1RJZB 1T22B 4XWGL 4U0QB 2B1AL 1S7VA 1HIMH 4NP4H 4DGIL 2BSSA 4K2UL 4IOIB 4PJFE 4MHHG 5C09E 5C09B 1YEDB 3ALXA 3WNNA 3BKYL 2UWEA 4Z0BH 2NY4B 3B6SB 1SEBB 5FUZL 3RVWD 5F6IB 4X5XB 2DYPD 4OCXL 3VFGL 5EDXA 1CDHA 5JA8B 4QOKD 5FA3A 1IEBB 4H8WH 3PP4L 5J1AA 2AV1B 1HZHH 2YPVH 4WENB 5F1KC 3TN0A 1FIGL 4F9PC 2ID5A 1YPZE 5BO1H 4XHJD 1LDPL 2BXYA 4Z7WE 3U2SB 3FB5B 5DWUH 4LSVL 1HDMA 5J9PB 3ES6A 4F33A 1J5OL 2DMBA 2DRUA 4F3FB 3WD5L 3WIFB 1ORQA 1BJ1J 3T0EB 2VLLA 3WFCH 3TYFA 1N6VA 4EEEA 1ZSDB 5A3IC 4WGVB 1S7TA 4MZ3A 5EUOA 2ZUTA 3EDEA 2YUVA 5FK9B 2YEZB 4WTZG 1KCKA 2DIBA 2DIJA 3MJ7B 1E4KC 1U95B 1N64L 1AKJD 4Y89A 5GRJL 3L5WB 4LNRA 3JV5A 3PV7A 1KELH 1OLZA 2EH8H 2XWTA 3CLEH 5DD0L 3LPGA 4N8VG 3TN0C 2O5ZL 1VGKA 5I76B 3Q6GH 1TCRA 3W11C 2OR8A 5DTFB 4X5WA 3QIUD 1EEYA 2D7PA 3VGGA 1ED3A 2JJVA 4J1UB 2NZ9D 5C07B 3QULB 1MCNA 3LH2H 3RWHB 5IMLA 1A0QL 1QSED 1XGUB 3R4DA 3LMJH 4R97B 5SWSE 5FCUL 3MLRL 2XTJB 4Q0XH 5FOJA 4JFYB 1OVZA 4POYA 5I73C 3KPOA 3MLXL 1QSFE 1CXEA 3BEWB 3I6KB 4HT1L 4I5BB 3A6CH 3OBAA 2Y23A 3MJ6A 2X4QA 5HVFB 1FN4B 2NYYD 1MFCH 4U1JB 5EU4B 4L8DB 2APVA 3U46B 3PWPD 4UBDD 4BFEA 3MOBL 3FO1B 1QLFA 3SDXE 1QFPA 2DD8H 4NZUL 4JRXB 2Q8AH 4X7SH 1AD9A 4GW4A 1PSKH 4PG9B 4KMTH 3ZDZE 1WZMA 3BH9B 3LN4A 5D1QC 2R23B 5T1DL 3BKJL 3I9GH 1GXEA 1IC4L 5FA3B 3B43A 4X99B 5DJDB 3MCG1 5CD3B 4XAKD 3EDKA 4BQBA 1CF8L 3KPRD 1FORL 4MQXD 4JKMA 3TT1H 3STBA 5DMYA 4OLYH 3EBAA 1DBBL 5H35B 3QDMD 4LIQH 2Z93A 1I3GH 4F33B 5MEND 5TDOA 2I26N 4MNGB 3IAPA 4Y0GA 3V5HB 4LSPL 4NPYA 4UT6L 3DUSA 3MLSH 4AEIL 3T0EA 5EU7C 1FGNH 3O2WL 3T2PA 1X6NA 4F15C 3QWOB 1S5HB 2R4RH 2HMID 2W07A 4NN7B 4YO0A 3MRIA 1J0HA 3K0WA 1H5BC 4XBEL 4J3UA 1JNHA 2AK4E 4F7PB 3MMEA 2DJ4A 3V0WL 4F37F 4UUJA 4EI6A 5IHUH 4NRXA 4E5XA 1W72H 4JZNA 4P2RD 3UTOA 3O2VL 3T1WA 3IVKA 1D5XA 1A9BA 1WBZB 3VFNA 2HFFB 4U1NB 5HGHA 4GAJL 2D03L 3PV6A 2XWTB 2D0FA 5A16A 2Q8BL 5BVPH 2YD7A 2X41A 4OJFH 5FUOH 3RWJA 3LKPB 4MVBD 3B8YA 2CDFA 5JORA 1AGDB 4PD4K 5D7JD 4EKXA 4KJQD 2E7MA 1KCVH 1ED3B 4Y5YA 5DMKB 4L3AA 4PRAB 2VXTH 4UU9A 4LCIH 4P4KB 3FT3A 5FUCE 2XY2A 3H3PL 1HHIA 1A9EA 2YZ1A 1IJ9A 1QFUH 4S2SB 4X4MA 3TH2T 1HXMA 5E8EB 5IB2A 2G2RB 3X3GH 3KAAA 1NPUA 2E9IA 3HFML 3I6KA 5FGRA 3UTQB 3WFEH 3C87A 5I1CL 2G2RA 3NIDE 4U1KB 4PUBL 5FUCC 1Q94B 4PJHA 1IEAB 1TTFA 4ELMF 5EU6D 3T8XA 1A3RH 5DJYA 2AP2A 1LP9E 1Q9KA 1DLHB 4FQIH 3U46A 2JJSC 2AK4B 4LF3A 3BD5A 4ELKA 5FO7B 1U3JA 5DVLA 1Z9LA 3PWUA 3VA2C 4KQ3H 3QDJA 4PRHE 2IAMA 1ITBB 1G9NH 1JF1A 3JXAA 1MHEB 1X4ZA 2R29L 3O3AB 5E8PB 4YHNB 5F9DC 3O4LE 4PRPA 5DHVA 1GZQB 1MELA 5GS0D 3DURA 4JDTL 1T1ZB 4Z7UA 4R9HA 5SX5K 4ZFOB 5FO8B 4S11A 4F7MB 4YDJA 5DZNA 3DX7B 1NGPL 3QO0B 4GFTB 3KPQB 3U0WL 5ACLA 1NCDH 2YA2A 1SMAA 2YSSB 3QDGB 1DQML 1U93B 2DQHH 1T0NB 4GQPH 1V7NH 1DQDL 2PTUA 1D6EB 4CW1B 4YDLC 3MXWL 5JW3H 1T0NA 3G04B 1O5DT 1RMFH 3NCBB 5FB8B 4KKAC 2X6MA 2QTEA 4GRLD 1IGTA 2P5WE 4OLWH 3WLBA 2PTTB 3KDMA 8FABA 4HMDA 5DHYA 3G08B 4F8QA 1HHKA 2KBGA 2A77L 3STLB 1RUAH 3KYMB 5D7IE 3X12B 3CFIC 4FQ2L 2IG2H 3G9AB 2GSIB 2W60B 4MXQC 1UACL 5CCKL 4ZO7A 1QPXA 4NQVB 1PZ5B 2P7TA 3CPLA 2C3VA 1RVFH 2HA1A 5CILL 4MWFB 3SGJC 3QEQB 2BSED 4DZBA 2D7NA 6FABH 5HBBA 2MKLC 3Q2CA 3GEWB 1OPGL 3PV6B 1KJ3H 3QIBB 5EZJB 4YX2H 9CGTA 2XRAL 4DZBB 2HT4D 4LRIC 3T0BA 3GJEB 5F3BA 1AO7E 3IKCA 5JLZA 4J7RA 4M5ZL 4RFOL 3BWUC 3EO0B 4GW1B 4JCLA 5E08L 4XWOC 4R4BB 5C0BB 4A2MA 1J0KA 2XZZA 4BH7B 1UCTA 1S9VA 5D7JC 2PO6C 3CLFL 3B4NA 5CIPH 3WJJA 1BAFL 4WW1A 5DJ2A 5KW9L 1UA6H 4DOHE 1MAML 3ZYJA 3ULSB 3QBTB 4PRIA 3OJVC 3DTXB 1IEAA 1OCWL 2EO9A 3MNZB 3PWPB 3UTTA 3DECA 3N9GH 3LIZL 4Z7QE 1U2CA 1AHWA 3UPRA 4G3YL 1WISA 3FN0H 4LF3B 4JQVC 5FHAL 3I85A 5DUPH 5C0AA 1H15B 3C8HA 1R3KB 2ZKHH 2APWA 4PJIF 5E4EC 3RNKB 1QNZH 1TETL 3VXOA 4Z7OF 1PY4A 2IEPA 1H15A 4JFXB 5D7SH 3GO1L 4FXGB 3S5LA 4NNYB 3FHQA 4YXKH 4NIKB 1W0YT 3KLAA 3V4VH 3NACH 1IAOA 2VAAB 5JMRA 4WHYG 1J7VR 3VGAB 5C6PB 1JMZA 4NC1E 4QRUA 3MO1B 5IVXA 4TVPE 2Z0BA 3BT2H 1W72B 4NRZA 3NN8A 3G6JB 1Q38A 2R1YA 1F3DH 1I1RA 5FGCE 3QQ3A 4LVOB 1GGTA 2QHLA 1A3LH 3JWDL 1U8PB 3MA9L 1IC7H 4GMTH 4R4FH 5HVHB 2VKXA 3JV6B 4KROD 4HFUH 5EA0H 4UMGA 5CMAA 1QLEL 2IAMD 3V52L 2DJSA 5E94A 4LEXL 3O9WB 2A1WL 2XY1A 3DWTA 2ZCKH 3ULUE 5EWIL 3G5YB 1DLFH 4PJHE 4R0LA 3PDDA 1WBYA 3BEVB 2BVPA 2WQ8A 5HGAB 2P8MA 2CO7B 3MLUH 2YUZA 3UBXI 4F57L 3GRWL 3KPNB 4JN1L 5DJCB 2AEIT 1WEJH 4PRDA 3WNKA 3VWJB 2NY2D 1DCLA 4JFOB 2ADGB 3T3ME 3TM6A 4NQEE 3HE6A 4GKSA 4ZUSA 2FO4A 3NZ8B 2VTFA 4HK3N 1IGFH 1RUKL 1UM6H 2Q3AA 4W68A 3K8LA 2FO4B 1NEZA 3PABB 1DBAH 1EBPA 2NW3B 4O2EB 2ZUQB 3TYGH 3OAUH 4OT1H 1FCCA 3MSPA 5EC2B 2BY3A 1FH5L 2NW3A 5CEZH 5C08A 3T1FA 1YNLH 3DETD 5CD5C 1S9YA 2JELH 2BP3A 3S3PA 3BZEA 3BPCB 4HSQA 3QSKB 2PCPA 4CMMB 2AJSH 2AJUL 3FRPA 1ZKAA 2Y06L 5K9JL 3MR9B 4QHUA 1KULA 3VD5A 3AU1A 1DDHA 1TQBB 3UPCA 1BJ1H 1UADC 4J2XA 1CFBA 3UZVB 4XMLL 1QYGL 4AMKL 1HH6A 1AY1H 1FC2D 1NDMB 4RGMB 5GRUH 2AJYL 3NOIA 4X4YA 4PJ5A 4QHLA 2QSTA 5JHLL 4BFBD 1UYWL 32C2B 1D5MB 4IOFD 1KC5L 1TPXB 4TPRH 3O3BB 1EERB 4OIIH 5F7EL 1PAMA 2AXFA 1JV5B 1CK0L 35C8L 4GRLB 5I1DB 3VD9A 3F58H 3QCVH 5D70L 4ZPTA 4KRLB 3C6LB 4N0YH 4P46D 5IBTL 4JVWA 5E4EB 2D7TL 4S1DD 3EFDH 3CMOL 2ZSVB 2FGWL 4MVBC 3INUH 2W1NA 4LPCA 1T21A 3DSFH 5I75B 1VADB 3T04D 1D5BB 3SKJH 1T21B 5FYKE 3C60B 1H5BB 1RZIB 1SYVB 1A6PA 4R3SA 4F15B 3CJJA 3PL6C 4DK3A 5GGVL 3TNNB 5SWQB 2BVPB 5HGAA 3W5NA 4DN4L 5L2JA 5B38G 5I30L 3RBGA 2CXGA 4AEHL 3SE8H 4KWUA 4WNQB 4Z5RB 2J12B 1B2WH 2GAZB 1F4WH 1XGPA 4UV7L 3GSOA 4WNQA 4Z5RA 3SDAC 2QQNH 3I2CH 3PDOB 4I0CC 2YK1L 5DMGC 4HUXA 5BRZB 2DQJH 3AROA 1NL0H 5DD3H 1I9RH 4WCYL 2V9RA 1FZJA 5LBSH 3QFJD 4PGEA 3FZUD 4P23C 1NFKA 1YZZA 3RWJB 3QUMB 4B53A 4NFCA 2V7NA 1D7FA 5C08B 2WUBH 4U6VH 4PJCA 4MNQB 3LKQA 2VO5A 1P7KA 4FTVD 4P4KD 3UC0H 5CEXA 4ZFGH 5KZCD 1CD8A 5DQJA 3BPCA 2F54A 4GRWE 1BP3B 4FQ1L 4M6OH 3RUGA 1KOAA 2ADFH 3QO1B 5BRZD 4JQXA 2HRLA 2GFBB 1M05A 2HWZH 3C9NB 1MJUH 3AU1B 3S36L 1D9KD 4YH6A 5FHBH 3VH8G 4J3XA 1RIHH 2VR4A 3WFBL 3RJDA 5J13B 4LLMA 2AV7A 4FP8L 2OL3A 5GGSA 4TUJA 2Q7YA 3WJLC 4HHAA 1J9CT 1AH1A 4JPVH 2QADB 1FNFA 4HUUA 4JY5L 4PJ5B 4QHLB 4U6TA 3UP1A 5E03A 2OLDA 1OTTD 1QRNB 2PNDA 4KI5E 1O7SA 4Z77B 2P5EA 3CVHL 4BSVB 1NCCH 1E6OH 2YKLL 2W38A 1RZ8A 4YNYB 3GSQB 1G1YA 4OZFH 2Z31D 3MRLA 2X9WA 4KKLD 4Y4KB 3RVUD 3SQOL 3RWGB 5HYJB 4UDTA 3HCVA 4P57A 2AKRB 4PRHA 5GS0H 1MI5E 3BDYH 4BQ8A 1ZT7B 2DM7A 1SM3H 5IW3A 3KPLA 3U7YH 2ZSVA 2ARJB 1OARH 5F7DB 1DUYB 1MRDH 2YA0A 4R2GC 3G04A 4DZ8A 2Y6SD 4KK8C 1Q0XL 1DBKH 5ISZB 3QT2A 3MX0A 5K59E 1CD0A 2NTFB 4NKMB 1CICA 1ZHKA 2ITCA 3EYSH 5DJXA 3S4SA 4FABH 2ORBL 4PGBA 3DHJA 4M6MH 3VCLA 2R2HA 1IGYB 3I02A 4YDIH 2D9QB 3UCRA 3TO4C 3VCLB 3KS0H 1NCNA 4OFPA 2YPKA 4P9HL 3RY4A 4OD3L 1FO0L 3REWB 2BHYA 2QHRL 3ARWA 5IEHB 1YN7B 3WHXA 3QNZB 3SOBH 3IDGB 4W70A 4I2XE 4ZNEE 5BXFA 1SJHB 1NDGB 4S1SH 3O4LB 1DANT 2EDFA 5CKGA 5GIRB 4QHNB 4Z8FL 3QEUB 3BXNA 5KSUA 5FO9A 5I1EL 1U8IA 2NPLX 1F4XL 2DL9A 2OTWA 3C2SA 4KVCL 4DKDC 2FECL 1L7IL 1EGJH 5MI0C 4OF0A 1UWXH 2ITDB 1M1SA 4BH7A 4HV8A 1S9VB 5IQ7H 3BD3A 3WXVL 2EE2A 3BZFB 2NZIA 3DROB 4F7CA 5I71B 1N6QL 4DVRL 2VQUA 3P77A 5DS8A 2OJZL 2KUTA 1BPVA 2CD0A 4YBLC 4ZDHA 4JR9L 4MAYC 3MV9D 5IJVA 5IW6B 4HCRA 3P2TA 4Z77A 4ZUVA 3DLQR 3QXAA 4AIOA 3CFJB 4D0CA 3QPQC 4G8IB 4HWNA 5IWLA 4BH8B 3QXAB 3Q6FA 2G5BA 3QH3A 3GM8A 2ZPKL 4G8IA 3LEVH 5DQ9B 3NIFF 1FL6A 2XA8H 3ZLQC 3T65A 1YMHB 4QHMA 2B4CC 4L4JA 2VITA 4G80A 1KNOA 2VAAA 1ZLSL 3RIAF 3RVUC 2D0GA 3LEYL 5L9DL 1WF5A 4LHUA 4H0GA 1KJ2H 3T2QA 2J8OA 1JIBA 3TESA 3WKML 1CIUA 3MOAL 4ISVB 2G75B 2H41A 4G6AC 2BVEA 1YDPA 4S1QH 2JF1A 3WFHA 1I8KB 2HRPL 4H88L 1MCDA 1YPZF 1INEH 1DQLH 4KROB 4HG4K 2EYRB 2AJXH 1W2KT 3DGCR 3MROA 1T04B 3NFPA 5C0CB 2MQCA 1LO5B 6CGTA 3V5KA 3WFDH 1DL7H 4D0BB 5JQ6L 2C4XA 2HLAB 4J4PA 1RZGB 4CGTA 3EO9L 1VFUA 4B41A 1H3PL 4XXCC 1MJ8L 5MP6L 3NA9L 5DSCB 2WW8A 3WSQH 1NDGA 3KYOA 3MODL 5IGXH 4PB0L 5C0JB 4K3EH 1T89A 4K94L 3QUZD 4YEFA 5D2NC 4MMXC 2J8UB 3SE3A 4TYUA 5IMKB 5D7JB 4YHOL 2W91A 2B0SL 2DBLL 4OUUB 1HSAA 2WQRA 4S0SD 4XZUB 1CWVA 5JIKA 5JOFB 4NQED 5L0QB 1IKNA 3IXAA 4YPGA 3S4SG 1NLBH 4XC3L 3VFWB 4D8PB 5JW5B 5C0FB 4UB0H 4PBWD 4D9LL 4NKDA 2BK8A 2AERT 4U0RB 2ITDA 3EDJA 4Y2DD 3UXFA 5CD5D 4JRYE 3OB0K 1BJ8A 2X44D 2DQIL 3QFJA 2CRZA 1TZGL 2J88H 5FYJL 4KY1H 4R8WL 4EQ2A 3DO7A 2VE6A 3P77B 4BSWB 5KSAD 3B2VH 4M7ZC 4QT5A 1HK6A 4NHUA 4Z7WA 5EZIH 4P0DA 2VLRB 1C5DB 4NM4L 1AGCA 1TDQA 1N5YH 1T2QL 5I17A 5A2KH 3SKMB 2K7QA 3W39B 5I1JH 3DO3A 1KPRA 2HJKA 3HMXL 1DN2A 4CVUA 4NC1C 3QXUA 3HG1D 3O6KH 1U36A 4GG6B 1Q1JL 2VYRE 2M26A 32C2A 1AC6A 1G9MH 1H0DB 3U36B 1J8KA 2B39A 1UWEL 3O3EB 4OLZL 5I2IA 4G7VL 3MV8E 4W6XB 3H9ZA 4MS8C 5I19H 5JXAH 5JPNB 1I8MB 1HHIB 2YOCA 3W0WE 3DX9A 1AXTH 3H7BA 4Q2ZB 3ZT6A 1MLCB 3BGFB 3QNYB 1ODAA 4LU5L 2GTWB 4XPFH 1ZS8B 5IV2A 2QL1A 4OIBA 2G75A 3IFLH 4Q9CA 1UEYA 2PYFB 4RRPG 3NGBB 2EDQA 4OCYH 4JFFA 5EB9A 1U58A 3LOWA 1KLUB 2AK4A 1EGJA 2EO1A 2XZQH 2LABA 4JDVB 4JY4A 5KZCB 2NY1B 3T09A 5HHVH 1XIWA 4XP9L 1VDGA 3DYPA 1AJ7H 3O3AA 3F6LA 4YHNA 5E8PA 2CLRA 3MV9B 4Z7UB 4N8VA 3RI5F 2P8LB 2DQTH 1N0XH 1KEML 1S7VB 4FQLL 3SDAB 1VKXA 3S96B 1QQDA 5EO9B 3F8UB 4PJBB 1YEDA 4HPYH 2QJDA 5T1KA 2F5AH 1XR9A 3BKML 5L8LB 1XGPB 4L8SA 4ONOA 4NFDA 5ICZB 3VXRA 3PDOA 5F1IB 3VDBA 4HIEA 5EN2B 1U8HB 1H8NA 5ICXB 5C2BH 4LLUB 5D1QD 4HS8H 3KLSA 2JCCA 4MQTB 2J5LC 5DLML 5E8NB 3TWCL 4U0RC 5D1QA 3D2UA 1ZK9A 3O8XD 5KANG 3EYVB 1GC1L 5KSBA 1KXQE 1KTLA 5T5FH 3FO2A 1ZANL 2EXYC 1S7QA 1WLHA 4MJ5B 1EX0A 4IDJL 3RUGB 1BD2A 3ECBA 4F80A 3QIBA 3AREB 3LQAC 4OGAD 5I8OL 5BV7B 1HE7A 4XI5D 4LOUD 1K9TA 3MUGB 1MI5B 4OSUH 4JRYD 5FK9A 1CL7I 2HJLB 2XN9D 1A6UL 3U9UB 5C0AD 1DBMH 1YECH 3P9WB 1YUHB 4UQ3A 3ILQD 2R56L 4DAGL 3IU4L 5I2IB 4HW6A 2DDQL 5LCVH 3HNTH 1Q9WA 3GMLA 1VACB 1IAIH 1WAAA 1VGKB 5I76A 3GSQA 1T5XB 2CRIA 4TSCL 4NHCL 3ULSA 5JW4M 4HKJA 2P5EE 1DP0A 1FG9C 5BOZG 3PWPA 1MI5D 3T77B 3MJ9H 5C07A 1YJDL 4P5MB 4D3CL 3JZ7A 1XGUA 4I8DA 5M94B 3VWKC 5C0AB 2ARJA 3C09C 3MRCA 2V17H 5HYSG 3IETA 4BZ1H 4QWWD 3B9KB 2CLRB 3S5LB 3L5HA 4LASH 3P0VL 2E7CA 4XP6H 1RIVH 4X7FC 1JHTB 1WWWX 4ZUTB 4ZFZB 5I15L 3BDXA 4JREC 3BN9D 3BP6A 3KGRA 1XEDA 1MAKA 4I3SH 1OGAD 2OSLA 3DMMB 3ARDC 1KBGL 3VI3E 2EDKA 4K8RD 2P43B 4HDIA 1KIQA 5J3HC 1IGML 2DQEH 1IC1A 1P7QB 3TEUA 3TH4T 4DCQA 5BRZE 2DLHA 2NY7H 2L7JA 1JNJA 3SDCA 1QRND 1GGIL 3C6SA 2OI9B 1KEGL 1YY8A 3I3DA 3RA7L 1FBIH 5F8RC 3DOSA 5DMIH 3HR5A 1GVIA 1IE5A 5SWSD 3SDXA 2Z93B 2B1HH 4FXLA 1J11A 1FP5A 1TQCC 3P0GB 5JIIA 3MRDA 4A6YA 5AUMA 3O6ML 1X5AA 1T0MA 3UYRH 4KPHL 1VEPA 1AQDA 4ZUWA 1S9KC 3VXSD 4F3FA 4HCRL 4IIQC 1ORQB 3O6MH 3T2NL 4CADA 1AQKL 3DROA 4F7CB 3VXMA 3ZL4H 4DKEH 3X3FH 3ILPA 1OP3H 3ILPB 3ZTNH 4JFQB 3MZGB 1IARB 1RY7B 1T7WA 3WO4B 3WS6C 2HT2D 4OCRL 2NY7L 5A16B 5EIIA 1RFDH 2B4CL 3MV7B 3B9DA 2QKIA 1LEKA 2VR5A 4KKBD 4OM0L 3S9DB 4LK4A 4G6MH 5B4MC 4P2OB 1LMKA 5I18H 3NIDF 1KBGH 2D4DA 5L8JB 2CQVA 4TNWK 2C3XA 1W8OA 3I6GB 4KZEL 4NN7C 5FYKD 3QZWG 3N85L 4GAGH 4LHUD 4XP6L 1FZOB 4K7FB 5MERA 5LXGL 4JHAL 3SHSA 3JWOC 1FN4A 1TTUA 5CSGA 3IDYC 4P46A 1R3HA 5FF6A 4PRID 3FN3A 4HLJA 3P11L 2HVJA 4IRJB 4JB9H 5JW4R 3RDTB 2ZSWA 1J8HE 1AP2B 1CD1B 1GGYA 3DBXB 1EHXA 1CDBA 2EXWC 2X10A 2VLRD 3ARYA 3MROB 4NWTH 1YEFH 2ZG1A 3BSZL 4WO4A 4F7EB 5GSVB 4M8QB 4PJXA 5KSAC 4KJWD 4CKVX 2YMXL 3HZMA 5T3ZH 1RZJH 4WO4B 4F7EA 4UZGA 1D5IH 2VSCA 4GRLA 4ZODA 5C0EB 1Q8MA 3DURB 1XF4A 3OR6A 5I66A 2ICCA 5DK3A 5JA9A 4PG9A 1KCRL 3WUWG 3B2UD 1CLZL 1HEZA 4XNZC 1G7HA 1LO4L 5ADOL 1YECL 1JTTA 1ZT1A 3ZSSA 4UOW0 1IM3A 3V2AR 3BISA 4X6CB 1MLBA 1GGCL 4AENB 1UZ6E 2MCPH 3GB7A 4ORGB 3PG2A 5FDWB 4JGUA 5E6IC 5KVFH 1ZTXH 3P4NB 1UWGL 4P59H 3STLA 5BZWA 3S97C 1GC1H 1MWAL 2GSIA 2W60A 1AE6L 3VFOB 4TRPL 3TFKC 3GSOB 4U1GC 3NGBC 2NR6D 2P7TB 1JZ7A 4KZDL 4QT5B 2DKUA 2HFFA 4U1NA 1FNEA 1ZVYA 5HHXL 4HS8L 3T0EE 3SE9H 5L88H 1KG0B 1AGCB 3R1GL 2E27H 2KKQA 2IPKA 3LB6D 4WW2F 1VFMA 3FB6A 1KPRB 4HGMA 1LEKB 1I9IH 1RUPL 5GGSY 4PJBF 1LE5B 4ZNCD 4EVNA 2CIIB 4Y5YB 4OCWH 3BKMH 1WIUA 3OJDA 3JBG7 3VU2A 1JZ4A 1EO5A 5JXEC 4UI2A 2WWMD 4BFIB 2YPLA 1P5UA 2A83B 5E99L 5DRWB 4LSQH 3HE7D 4U05A 1B4JL 4PGCA 1CDGA 4WW1B 3KYKL 3QNYA 1OP5H 2EH7L 3UJTH 2M8XA 1MSPA 1BFVL 5IB2B 1AFVH 3T0VA 1T83A 3L3GA 3K7UA 4O00A 3CFCH 1V3MA 2HVKA 3VGEA 3MACL 5BV7H 1MRFH 2OK0H 3W0WA 3CAFA 3MUZ1 4DKFL 1AXSB 5F9WC 4JAMA 4X5LA 2X4SB 4P99A 1CU4H 5IVXE 3TZVC 2FBOJ 4YXLH 4KJWC 2VSDA 1CFVH 2DJUA 4JN2A 2ED7A 2Z4QB 3BGAA 3E6HA 1JCKA 4M1DH 1AXTL 5BQ7A 4O58L 1RHFA 3ULVH 5GJTH 1BM3L 1HILB 5AD0A 1GZQA 1S3KL 2YSSA 2X7LA 4U7SA 15C8L 4JLRB 3EOTL 1NGZB 2F74B 4DN3L 1NC4D 1UWEH 2Z35A 2FZ3B 4IOFC 4N0FB 3V0VA 1E27B 5TDNA 4GLRH 4Z95L 4NRZB 2DWEA 2A74B 4P46C 1YEHL 5D2NB 4QY8B 1OAYH 2A6JA 5FDYA 1INQB 4PRIE 3IXTB 1OSPL 1MQKL 2ILLA 4KK5C 4ONFL 2Q20A 1FFOA 3TLRA 1XCTB 5F3HA 1OAUL 4P9ML 2CK0L 2GTZB 4TUKH 4Z7OE 4XVJH 2VXSL 5E94B 4NUGH 4BK4A 4ONFH 4OZHA 4ONHA 3QNZA 3OSKA 1DVFC 1GCFA 4JO2L 3MC0A 3FJTA 1CGXA 4PGDA 3TJEH 4G9FD 4TSAH 2ICEA 4WFFE 3WS6A 5I1GL 2P8MB 2DOCA 2J3SA 3VFTA 2ICEB 4UB0L 3TCLA 2X4RB 4JZOA 4KRPC 3ULVD 2VH5L 5EZJA 4PS4L 4NQDB 1KIUA 1E4WL 4JFOA 2X4RA 4NJAH 4OB5L 1FO0B 1IAIM 4JPKH 15C8H 4UIKH 3NZ8A 3ZKXB 1UFUA 2YR3A 4CDGC 5C0BE 3ETBF 3FQRB 3FZUC 4GW1A 4P23D 3BKCL 3F12B 3SDDA 5DFVD 3U30B 1R3JA 2IPUG 4P2QA 1A7PL 1T5XA 1JRHL 2NY4C 3E3QE 1F02I 2GK0A 2IQ9L 4QHKJ 5CUSL 5FGCB 1Z9OA 4FZEH 2H32A 3MACH 5BV7L 2OK0L 1BEYH 2PCPB 4CMMA 1ACYH 1NAML 2X4SA 3NFSH 2BVTA 2MPAL 4WDIA 4ZUVB 1L6ZA 4YHZL 4MLIA 4GJTB 4PJ7A 4XGZA 4NNYA 1B4JH 4RGNE 2IALB 3DHMA 1F3DJ 1IKNC 1NFIB 3VXOB 2Z4QA 2XOTA 1KJ2L 4JREB 4JRYA 3ULUD 3MA7B 1ZHLB 2PXYB 1KIPA 1CDIA 3E2HC 3GGWA 4ELMB 4QRUB 2A6KA 5IM7B 4HZAA 2HN7A 1WC7A 5ID0B 3BJLA 2EIDA 4Y5XA 5J0BA 3DI3B 1II4E 5IW1B 4MYWB 2CJUH 4DEPC 3ARXA 4MAYA 4TTDD 1IC5L 4A6YL 1QZ1A 3MRNB 3GI8L 3GMRA 4LAQH 2ZCLH 3OAZH 4BQ9A 3O2DA 3JWNC 5A2FA 4X9BA 1R5WA 2FL5B 1YMMB 5KVDL 2EDNA 4I18B 4PG2C 4X80H 4CN6A 4APQA 1KCUL 5ANMA 3V0AC 1QVOA 5KVFL 3BUYA 1T2JA 2IANB 5TE6H 4I18A 5E5MB 3BQUA 2OMNA 2FATH 3KPMA 1PLGH 2PYEE 5C3LD 5SWZB 2Y6SC 1E4XL 3JWDC 4JO2H 1RUML 3GMNB 3TH3T 5I6XB 2VKWA 1F4XH 5ADOH 1WCQA 2GQHA 3UPAA 3PHQA 1CLCA 2EKSA 2H9GA 1C16A 3SQBA 5EO1A 2VL4A 4L8BA 1QFOA 4YWGL 2CUIA 5B38B 3WNMA 5IBUB 4WEUD 1A14L 3KPRB 3L7FB 4OV5B 1FO0H 1LD9A 2F19H 1HYRC 4PLKD 3DYOA 4YDIL 2DICA 4DQOH 1J05A 3K4AA 1CBVH 4XAKE 4QGYA 3HA0A 5EOQL 4WIQA 4IRJC 4XP4L 1MFBL 4XBGA 1EFXB 2LU4A 4PJXF 4E41D 4H1LB 3MNWB 5IEKA 4NWUH 4JHAH 4H20H 1EUUA 5D2LF 4HUVB 2BNQE 1R3HB 2DQDL 2EDEA 1NFIA 1AD0B 2DQGL 4IRSC 1RZFL 4OBRA 3FAWA 3NCJL 1FCGA 1CU4L 3SDYH 2VDLL 1QRNA 3X13B 4ELMA 1YEGH 5DD1L 4TTGA 1TJGL 1WC7B 3BP5B 4NRYA 4WO4D 4M62H 1U2HA 1GOHA 3MJ8B 4IS6A 1JPGA 5J4MA 3SBWC 3BP5A 4HK0B 4NRYB 5GRVK 5E0QA 4HBCH 3LKOA 4OZFA 1UVQB 1YYML 4HK0A 4P2YA 5HYJA 3HCVB 4PJ5D 4QOKB 3TN0D 4WWKA 2LTQC 4K23H 4WFED 3FT4B 1CGSH 3AAZA 4Z7VE 4XXDB 2B5IC 3D1MC 1QO3A 5KG9B 4JQXC 1YY9C 2D7MA 4K7PY 1SJXA 4K7PX 3VXRE 3PWVA 2BVQB 5CLWA 2UZIL 2YZ8A 5D6CA 3B5GA 3HE7C 4YR6A 1J88A 3SE9L 1A1OA 3MLVL 3R0NA 5EOTB 4QCIB 5DDHA 3G6AA 1V7MH 5J6HB 4I4WB 4KUCF 4HQQL 5KVEL 1KV3A 5T1LD 2V5RA 2X42A 4M7KL 5DC9B 4L8SB 1IBGH 3BIKA 5F96H 3EYQC 5E9DE 3SE4C 4PJFF 3DX6B 3F7PC 2YRZA 2AV1A 3EO1A 3LS5L 5KAQF 2GI7A 3WDHA 3IYLW 2PUQT 1MCKA 2DQEL 3V8CA 4PGEB 2CLZB 4KHXL 5HHQA 3FKUS 3KWWA 2BJMH 3R0MA 3VGDA 4LCUB 4X8XA 4LSRL 3HNVH 4ELME 5HHQB 3EYVA 4NM8L 3GJFK 4HWBL 3QXTA 4LASL 1CLZH 2YPLB 3VFVB 3PHSA 5GZND 1NMCC 3HC4H 1TIUA 4HHAB 4BZ1L 1MREH 1RZKH 2HKFL 3TP4A 3FOLA 3UZEA 4R2GD 5L6YL 5BVJA 1ZXQA 1ZOXA 2YXMA 1BFOA 5IR1B 2HJFA 2ICES 5GGTA 2FGWH 3RL2A 3D3VD 4XVSH 5I1KL 5EOCL 4AY0A 5I1LA 3DGGA 2IFGA 5IJVB 2B2XL 4XTRD 5IOPA 3RVTD 4XNZB 5I1LB 4TSCH 3QCVL 2NY2B 2OXGA 3ZYOA 1M7DA 1DVFD 3BO8A 3A6BL 1TPXC 4X5WB 3HC4L 5ABDE 4XAWH 3HAEB 2IPTL 4X7EC 3AXLB 3N1FC 1RZ8B 3IU4H 3QI9A 5F7NC 1UXSA 3QI9B 5C71A 4GUPB 2HTLD 3B3IB 4CVXB 3AFLA 2E7BA 4KQ4L 3Q5YA 5I8KL 3I75A 2X4QB 1JTOA 5I8OH 5EU4A 5TE7L 4J3SA 1YDPB 4WI5A 4YFLF 5E70A 4J23A 1F6LL 5ISZA 1KLGA 1A1OB 2NY0D 1A02N 4G5ZH 4JM2D 2VLJD 3FQTA 3QEGL 4JRXA 3VGFA 4QRRA 1DVFB 1SEBA 5CZXD 4X6EA 2ESVB 3QUMH 2VISA 3MLVH 4PYHA 4D9QE 2HFEB 3VMOA 1T3FB 2EC8A 4OCNC 1H9VA 2OI9C 3KYOB 2O5YH 5F9OL 3C6SB 4ZAKC 1DEEB 2CUHA 4KRNA 5BJTB 3CSYA 3NBNA 2GITA 4M4PA 4QRPE 5B4MD 1C12B 1WT5A 4G6AD 3G6DL 1RD6A 3DUUB 5ECJE 5F9AC 5DI8A 3BIAX 5E2JA 1K6QH 1U8QA 2YBRB 5ESVA 1NGXB 3BZFA 2GJ6B 4NCC2 2AJVH 5INDA 4L8CB 3OZ9H 3VWJD 4GW5B 3AMKA 3LV3A 2DQUL 2NY1C 4MDJA 2VQTA 4FZ8L 3DXAB 1GOGA 3V52H 3VXUA 2V2WB 3PGFL 2W9EL 2JB6B 4FFZL 3D9AL 1MHHB 4EOWL 1BWMA 4R4NC 2W9DL 4WU5B 4XCEB 3FQXB 2UWEF 2JB6A 1UM5L 2FD6L 3T4YA 5CSZA 3GSVB 3VD4A 3HC3H 2CDFB 3SJVB 1QOKA 1T2XA 1TCRB 5CJ8A 1YYLL 3HZYB 2OXHA 3RY5A 3VXUE 4OLZH 4Y2DC 3WNLA 3WDJA 2VUOA 1QEWB 1G9ML 2CO6B 3VI3F 5D2LA 1YJDH 2JKXA 2F19L 1UB6A 5DK0B 1FPTH 3MGOA 1UQSB 3SO3C 3V4PL 1A8JH 2FLBT 3ARBD 3MRKA 1A14H 4NBZB 3D85A 4UNVA 1I8KA 4OI7A 4S1RH 1FG2A 1OLLA 2FIRT 4YWGH 5JW4Q 1GZPA 1MF2H 1CGTA 5GZOD 4RBPH 1OTUD 2F8VA 5EOCJ 5DUPL 1P9MA 4NFBA 1EDQA 2ATPA 1NGYA 5IJKC 3AMLA 5IK3A 2XKSA 4FFYH 4LCWB 1BEYL 1JF1B 1CLOL 2EDYA 4L4TD 1XIWB 3DARA 3QQ9D 4HAFA 4RMVA 2VERN 2HLAA 4PJXB 4X4ZA 2CIKA 5LGJB 4J3WA 1UA6L 4OZ4B 1JWUB 4B5EA 1OW0C 4PV9A 3MV9A 3HPLB 4U2ZA 1JNNL 1NKRA 4IDJH 5DHVH 1ZLVK 25C8L 2WBJA 3UEZA 2JB5L 2LFGA 2ZUSA 2ICWA 2VXVH 4YXHL 4YDVA 2WBJB 5IP4A 5EORH 3NZHH 3IU3A 4GG8B 3FRPG 4Y4KD 4YPGB 4DUWA 5ICZA 5GPRA 4CU6A 3JV4A 5DI8B 3SY0A 1EXUA 2ZG3A 5K59F 3G5XA 3ARUA 2PW1A 4Z9KB 1NGXA 1A1MA 4IJ3B 3LKRB 3EO9H 1MAJA 4NQSB 2FRGP 3O6LH 3QUXC 5B3JF 5C92A 5CCKH 3QZWB 3D25B 2H6PA 3J7HA 4MWFA 4NHUB 3M17B 2NY1D 5F1OB 4FQ2H 2XT1B 4TOYL 1A4JB 3N1PC 4HK3J 4I0KA 2DM4A 4H88H 1G6RL 2EIBA 3N0PB 4P2RA 1KGCD 4P5TB 4YHYC 1CFSA 4JFDB 4JG1H 5HY9A 5J89A 1EAJA 1FSKB 5C08D 3H3BC 2I60H 2AS5M 1FL3A 3D6GA 3RZCD 4U1LB 4NQCD 5HI3D 4HKBA 4GAYB 3X11A 4KI1A 2AXJA 1FRGL 1P6FA 3GIVA 1R6VA 3NCEB 4XHJC 4KTYA 1JWSA 5E00A 4J3OC 5GJTL 3ULVL 1N59B 4MSWA 2AK1L 1AI1H 1S7WB 4HAGA 4I9WD 4EN3B 1FJ1B 3QDHA 4ERSL 1OWRM 3MUY1 4AG4H 5D1XC 4XMKH 2A73B 3LRGA 4XH2B 3RPIB 1E4WH 2VH5H 4JDVA 2CIKB 4QKXB 1G7LB 5D7LE 5GJSL 3CVHA 2GW5A 1MJ7H 1AGBA 3IFOA 4OQTA 3MLYL 3TJEL 2BVQA 3H3PH 4PJ8A 3WN5A 2FBJL 4N8VB 1G7IA 2FECI 1XH3A 4ZTPH 2X70B 3HAEH 4MNHB 3C08L 1FFNB 3UTPD 3QP3A 1BLNB 5T3XH 1DQJA 3U9PH 4EXKA 4J3VA 1CDJA 3RNQB 3X14A 1VFBA 4YHPB 5ICXA 3AB0C 1OD7A 2ICWJ 5IHLB 1MQKH 2VQ1B 2RCSL 3GBNL 3OKOB 2Q8BH 3VXRB 3QEQE 2KL6A 1DTUA 3JUZA 2BMKB 3KDMB 2D03H 4PG2A 3JVGC 4GAJH 3S35L 3U0TB 4GBXB 1CXIA 1J1XH 3PQYD 1YY8B 2YD4A 1AC0A 3ME0A 1U6AH 5IHUL 3A67L 3ULVE 3V79C 5J7CC 3WL9A 3QEGH 3JWOL 1M6OB 4TRPH 3NZHL 1RSFA 3D2UB 5J9PA 4XBEH 5GGQH 3ARTA 4GAFB 5INCA 4H8WC 4ZO9A 4LKXB 1UWGH 4P59L 4XBPA 4XPGH 4AJ0A 5KS9A 2CXKA 1QSEA 4YGAB 3VWJA 3WUWA 3CSBA 4KDWA 1J86A 3VDCA 4C56E 1UT9A 1PZUB 4MQSB 1GGCH 2EECA 2P45B 4LIQL 3MCKA 5K9KA 1FV1B 1P69B 3S7GA 1CLOH 2BNQA 4LPWA 3UDWC 1RUQH 3QG7L 4ODBD 3DX8A 2OZ4A 2VZVA 1LO4H 4MX7A 3LS4L 2XWBB 3PQYB 4KJPD 1KCRH 1G9EA 4LFHG 4OV6F 3L95B 1ROWA 4APQC 3QFDB 4PJAF 5DD6B 3PGDA 4D0DB 2X1PA 2DD8L 1JHLL 3IDUA 4QRPA 4XPHL 3K74B 2R2BB 3UBXB 3GMPA 2X4NB 5IVZA 4JFZL 1AHWB 3UPRB 4P3WA 3RPIA 5I1HH 3IETB 3U4BH 1SVCP 5E5RB 1IM9D 1V5JA 5ID1B 5EBMB 2Q76B 5FHBL 3MV7D 1LGVA 4MA8H 2R0WL 1TLKA 2PR4H 5J12C 2GUOA 3VXQA 3Q5TA 4K3HA 4NN5C 3H9YA 3QUZA 1JHTA 5HHXH 4YHLL 4O2FA 3IFNH 3QIUB 3QUZB 2X4TA 1UEMA 2W9DH 1I85A 3DVGB 5J8OA 4GMSL 2AAVA 4U6VL 1GHFL 3PGFH 1CYGA 4Y5XB 1P53A 4PY8J 2IH1B 4YK4B 1PFCA 4G6ML 4ODWB 2NCMA 3S3SA 5FYLH 1I3RA 5DD3L 5I66B 1KJ2B 1T66C 3EHBD 3LS5H 4YBLB 1PY9A 3MRNA 3GIZH 1G7HB 1KENH 4WUUA 3V5DA 4EJ1C 1IBGL 4NO0A 1AR2A 1GPOL 2DLTA 4M7KH 4X6DA 3TCXA 3UMTA 3DUUA 1CZ8L 3DXAE 3U2SA 2YD5A 1BIIA 5CLTA 4JVPA 3WJJC 4XBPB 3DUSB 2W65A 2X4OB 4L3CB 4KPHH 1QSVA 4OGXH 1FLRL 3VRLE 4N0UA 5F1NB 1BZ9A 1ZVSB 1CXHA 3FQNA 3TYFB 4GW5A 3RI5K 3QDMB 5BO1L 3WBDA 1P7QD 1CN4A 1FBIL 1F8TL 3DPBA 4JZNB 2YEZA 2R69L 3ORJA 1YNKL 4M1CC 5DVNA 1J0YA 3PQYA 4RFEA 1DBKL 4E41B 4S1DC 2Z31A 3CFEB 3U7WH 1J10A 35C8H 1J0IA 2NX5A 5EZLB 4OV5A 1WZLA 1LE5A 3H6JA 3M45A 3PGDB 4TPRL 1FVEA 3TO4B 1CT8A 1LK3H 2GHWB 4W6YB 4BQ6A 1MVUA 4M5YL 3SDYL 4C58B 2CKBA 4BZYA 2ZP0T 2AQ2A 1OTUC 5CP3H 5KTEH 2Q7YB 3MLZH 3O6FA 4P3CH 4UTBH 3PWPE 5FKAA 4NWUL 2J7LA 4G8FA 4DFIA 4HLZG 1I1FB 1LO3H 4XRCA 2WIMA 3NIGE 2XZCH 4P46B 5FF6B 4UBDC 4XMPL 5BMFL 4YGVB 1CBVL 4ODVH 3VXNB 3RDTA 3WE6A 3LB6C 4D3CH 1QBML 4MNQD 1JI2A 1RZKC 4KFZC 4I3GA 1T5WB 2FB4L 4JPVL 4KXZI 3T2NH 2ADIA 1JRHI 3OAUL 2APTA 1I7ZB 5GSVA 3HI1B 2DWDA 2KDGA 3IFPB 4PJGF 1U8KA 1OTSC 1VA9A 2NY5C 5DJDA 1ONQB 4JQIL 1UCBH 4M6OL 4PJHF 4N8CL 3PWLB 2EDJA 4LCWE 5H35A 3V6BR 3O8XB 1IMHC 1T4KA 4PP1C 4NT6B 4X7TA 4J4PD 3ARBA 1KEGH 1T83C 2A0LC 3DV4B 2DWEB 5T1LA 1AKJA 5I0ZA 1KENL 4NT6A 4X7TB 2EIEA 5E9DD 4EBQH 1PLGL 2LQRA 2MOVA 1S7XB 4PTTA 5DJ8A 4RX4A 1NMAH 5DHYB 1HHKB 5EWIH 1FVDB 1A6TB 5D7KE 4PTTB 3V5HA 1WQVT 5J6HA 5F1NA 1SBSL 5F96L 2FCBA 3LEXB 2HMIC 3PNWB 5HHME 4YHYB 2FIKA 1BZQK 3D0LA 3OX8A 3VXSE 5I15H 3OJ2C 3IVKB 3IFNL 2VB5A 3PE9A 4TSBH 4RRPA 4UNUA 3SGDH 2PR4L 2OR9L 1A9BB 5CSBA 1RURL 2NX5B 1HQRA 2FO1A 3P9MA 1W0WB 3U4BL 2VABA 3VGAC 4NCC1 5J56B 1EHLH 5DEGA 4ODTH 3IJSA 2EE3A 5J11B 4P4KA 3PWJB 1EJOL 4UV4L 3EOBA 1Y0LB 3QCUL 4X4XA 2F54D 1CG9A 5FXCH 4CMHC 3TIDA 1G0YR 1AR1D 1YEJL 4LDLB 2IBZY 4P2QB 3O3UN 4TULL 1ZVHA 1NCBL 1HXMB 3CK0L 5E8EA 3T2OA 3BP4A 3TVMD 2IFFH 4PJ9B 1PX3A 3MZTA 3OWEA 4QRTB 4JAMB 1NBVL 1PKOA 4OQTL 2CDEB 5T33H 1JWMA 3DRTB 4ZOCA 2W92A 3UTSD 2RIKA 4JE4B 1OQOA 4MB3A 5JIPA 4ZFOA 2V2XB 4XPGL 4LU5H 5AD0B 5GQBA 5ISZD 1WTLA 1AGBB 1K2DB 3R06A 2Y06H 4P57B 5T5FL 4WO4C 3C8KA 2DLEA 4JN2B 3HG1E 1NC2B 2QSCH 3QWQB 3JWOH 1YQVH 2Y72A 4NJAL 5IQ9B 2ESVD 3A67H 5F7DA 2F8OA 2Z35B 4LLYB 3E3QC 4FQXD 4DGYH 4YHPA 2A0LD 4X6DE 8FABB 2P44B 3S35H 4FQXA 4CVWA 4Y7MA 4KJPC 1NFDB 1U3YA 5CILH 2Q1EA 3LKSB 1KLGB 5J1SC 4P2QE 3KHQA 5IF0A 3G08A 3TBYB 3O9WD 1WFNA 1RZGA 4MXQD 4TUKL 4HKXA 3MBEC 2EE6A 2C3VB 2BY1A 1NBQA 3M07A 5D9SA 3L5XL 3O9WA 1QVOB 3QJHA 1K4DB 3GMMB 1KEMH 2EYTB 3RWIA 4BZ2L 5ITBH 2DQTL 3MXVH 3HLAA 3ULUH 2ZOLB 1F4AA 1AO7A 1MPAH 4CAGA 1N3NA 1OAYL 5GJSH 1AJ7L 4OUUA 4PJDA 3Q5OA 1DQDH 5DJCA 4WTZA 4FQCL 2GY7B 4Y4HB 2A6IA 3RU8H 3MRJB 2E7LA 3VFWA 1C8PA 4AEEA 3V7AG 3O6FC 1U8JB 1KXTB 2XICA 4RAHA 1FYTE 5F72S 4GMTL 4R4FL 1WSST 4ERSH 3PXHA 4K3EL 2IH3B 2IFFL 4BA8A 4KV5F 4JDTH 3SPVB 4HWUA 3GZKA 3IDIB 4QXWA 2XN9A 4PRIB 3VFUA 1IQDB 2DB8A 3OF6A 4P5TC 1WAAE 3W9EA 4OTXH 2P5WA 1IQDA 3QXDB 4NSKB 4Z7UF 4QRTA 2ZUUA 1MRFL 1LDSA 3DTXA 1RIUL 4GXVL 2WINB 4PJ9C 4XGZB 2P46B 4X7CC 4KH2A 3RQ3A 1OTTC 2EH7H 3P4OA 3UJTL 3RWFA 2PXYC 5EBMA 5D7SL 1QRNE 1QFUL 3BRGC 3G9VA 3P4OB 2EEDA 1IT9H 1QNZL 1X4YA 4BFGA 4NM4H 3ROOB 4HMCA 4JY6B 3CIQA 5EZIL 3T65B 4C56B 4OIAA 3EDDA 3C8KB 2HG5B 4Q9RL 4FQJH 4U49A 5IVXB 2E8YA 3C5ZB 3NCCB 4MJIE 3O3BA 2EYSA 2J88L 5FYJH 1LO2H 1JPGB 5I16B 5GGRB 3OGCA 4U1MB 4Z7WF 4FOMA 2BCKA 5L88L 4K8RH 3P3YA 1EAPB 4YQXL 1P4IL 3HG1B 3GMRB 1P84J 4F7TB 4M4RA 5DEZA 1RK0B 5A43C 4KROC 2FJFB 4XNQB 5E08H 3GKZA 4WW2A 1KJVB 4XNYL 1CFTB 5KG9A 1N6QH 1FNSL 4E41E 1RZIA 25C8H 4R26H 2EC9U 2XRAH 2NY0C 4UT6H 4MA1B 4O5LL 5MP6H 5C0GB 1BIIB 5IQ7L 3NTCH 1FDLL 2BOCA 3T0XA 2J6EH 1JYWA 3MREA 4NDMB 4QCIA 1LWRA 3CCHB 4YDVB 4G9FE 3WKNA 4AM0B 3WFDL 4KVCH 2BNUA 2WWKT 4JFHE 4XVJL 4HIEB 3VMNA 1I1AD 3HE6D 1UKSA 1U8HA 2XTJC 3HE6B 4XZUA 4PLOB 5TQ2H 3R8BB 5JOFA 3MRMA 3IXAB 1KB5B 4D8PA 1TQBC 1WK0A 2F5BL 3U6RB 3O41B 3OAYH 1KB5A 4S1QL 5D1QB 5B39B 1JGEA 5FM5O 4RAVB 2I9LA 2VZ3A 2Q8AL 4N90E 5HGGS 5T3ZL 4AL8L 2I9LB 2NW2A 3CZFB 5ETUB 3VG9B 2H6PB 1A7QL 5ESAA 3BZEB 3GBML 2VDRL 4M5YH 4XBGB 3FONA 1I1AB 1EFXA 3CXHK 4DN3H 1QFWH 1S3KH 3DSNA 2ZPKH 1F6FB 2HTKD 1BVZA 5IROC 2J4WL 2OL3B 4LFHD 5F7YC 5D4QA 1NBZB 1QACA 4U1LA 4EOWH 3LH2L 3S34H 2Y07L 2VDML 1NJ9A 5ENWA 2W9EH 3RVWC 4YGVA 2X2YA 4DKFH 2Q6WB 2PYEA 1VACA 3RWDA 1JV5A 4DVRH 4OM0H 4QYOB 3DYMA 5I1CH 2B4CH 1CXLA 3HMWH 5HDQL 1CIDA 3BPOC 3GSRB 2NX5D 3O8XC 5D5MB 1KELL 2EH8L 5F7MC 2PYFA 5DJ6A 4HIIB 2EE9A 3BHBB 4MJIA 5JPMB 1XF2B 4LSQL 1L7IH 1XGYL 5I1DA 3OG4B 1CTNA 3GJFB 4MJID 4LHQB 2DKMA 4Y2OA 3ZE0F 2F54E 2YWZA 3L3JA 4YDLB 5SWSA 4P4RA 2FJHB 1G7LA 4Z8FH 3ARFD 4OZGA 1AKJB 5SWSB 1KCLA 4V2CB 3WFCL 4MXVF 1QO3B 4KMQA 1MJUL 5FKPA 3G6AB 3O2VH 4I4WA 4RISL 1A6TA 4XT1C 4OD3H 5FYLL 3B6SA 1SBBA 2RQ8A 2VJXA 2OJEB 4WGWB 1OGAB 4KZDH 3KNBA 1OAKH 3SO5A 4X5XA 5JOPE 4L3EB 2D2OA 1AE6H 3RA7H 1A6ZA 1GHFH 1PQZA 2JIXB 3S34L 3BI9X 2NY6D 5EFIB 1C5CH 1WCBB 4MJ4A 5D1XA 4YC2B 1FZJB 3HZKA 1U8NA 4YDKH 3B5HA 1JNLH 1F11B 3EO1B 2AJ3A 3HR5B 3BXNB 2CR6A 3P4MA 5F9WB 5I8KH 1JUFB 3OKMB 2BNRA 2GJZA 3B2UC 3BKYH 3IDJA 2DAVA 4IMKC 3MFFB 1F4WL 1EFQA 4KTEL 2OTWB 1FIEA 2EIZA 2NY3B 3ZKMD 3PJSA 1BF8A 1DE4A 1U8QB 1N8ZA 4R7DB 3MLTB 4M61A 5CP7B 4CNIA 2I25N 3WDIA 3LKQB 1UJ3C 2WANA 4JFED 4X4XB 5F6HJ 4GXUM 4XAWL 4GKZB 3B9KD 1HHGA 1JHKH 5DVKA 3S35X 3K4DA 3RWEA 4H1LG 2HJFB 5FYLD 2YMXH 4E0RA 3B5TA 4NUJB 3BP4B 2AV7B 4ZFOL 3FOLB 4J12A 1KLFA 3OKNB 5ALCL 1YUHA 2WWKO 1GAFH 4KTEH 2VZSA 5GS3A 2XWBA 3GSVA 1A7OL 2R2CA 5EPMA 4ZXBC 4QYOA 1K85A 2VLJE 5D70H 2J6EA 1HSBB 5IOPB 1FDLH 4XXCA 4OZFG 2HP4A 1MY7A 5EU5A 4J4PC 2VDQH 5DD6A 4TN9A 4YNYA 5JOEA 4HWBH 1I7UA 3MLRH 3MGTB 5FCUH 5F7EH 2W0FB 1CXKA 4AQOA 1QEWA 4KUCD 1A0QH 3AXLA 2OYPA 2WUBL 2W0FA 5KBNC 3A0OA 1UXWB 3RVVD 4JRXD 4Z7VF 2YD1A 4LHUB 4UDUB 1OAKL 3V8OA 5I18L 3A6OA 5BW7C 1ES0B 4Y4FC 2FJHA 2MFNA 5D5ME 1QYGH 3SJVD 2FDBP 4RISH 3VDAA 1P1ZA 1MRCH 3NPSC 2DLFL 3CFBB 4EUPH 1ES0A 1RJZA 3L3HB 3Q0HA 3C5JA 5HD8D 2C7UA 3GBNH 1I8IB 1W8NA 2EYRA 2A9ML 1X5ZA 3EYQD 3ULVF 1I8IA 3SKOA 5TFSL 1OGAA 4QXUH 5T3XL 1NCTA 5C0DA 1IKFL 1KIRA 2A9NL 1YN7A 3WHXB 3LN4B 1HI6B 4D0BA 4ODWA 4KKBC 1KIRB 4PV9B 4HCRH 5C2BL 2UZIH 4OI8A 3MRFA 4L1DA 3MLYH 5FO9B 5HDQH 3GHEL 4L5FL 2ERJC 5GIRA 4HUNB 3QQNA 4LSVH 1CGSL 3F5WB 2BNRB 2GJZB 4NQCB 3T3PE 1YN6B 1NKOA 2JK5A 4MMZC 4U6YA 3QDJD 5ESVB 4OTXL 4Y8DC 5F71A 1N8ZB 4R7DA 5HGBB 4NKOB 4G8GB 2Y36H 3MLWL 1U8OB 4ODHH 1FC1A 2D4FA 3QQ4B 3VFOA 5TE4L 3QFJB 3VFGH 4PGZA 4OIIL 3TO2A 1F58H 4PY7A 5ESQA 2FEEL 2V5TA 3EJZC 4I13B 5FUZH 5FYJD 3W9EB 3TO2B 2ED8A 3L3KA 4Y19B 5T3XD 4WHDA 3FQXA 1WIPA 2VLRA 2BVYA 1PW3A 1XFPA 3NIFE 4UILH 4XMLH 2JLLA 2LE9A 4WTXA 2J5LB 2I60L 4CUCA 3ZKSD 2EDWA 3GSWA 4PGJA 4FFWC 4XCEA 3LKPA 4MA7L 3TNMB 4IMLB 2WMPA 5DJAA 3OKLB 1MCHA 4O2CB 4DFHA 5I19L 1FVEB 1NCWL 5EOQH 3TO4A 3BT2L 3KHOA 3OKLA 3QG6A 4LCWD 4JY6A 4GAYA 3X11B 4JG0L 3MRKB 3I6GA 2QQQA 4C59B 4YJZL 4S2SA 1YMHA 1JWSB 4PP1D 3FO0L 1NUFA 5CJQL 3OV6A 5AG8A 3UZQA 1JVKA 4F58H 4Y4KC 3KXFA 4HS6A 5B3JE 4YFDB 4EN3A 2HVKB 2I27N 3LN5B 2CGRL 1YEKH 4OZIB 4OM1L 4WHTA 5MEQB 2DDQH 5LCVL 1AP2A 5E6ZA 5E24E 4KC3B 1TVBA 5I0DA 3PWUB 2CDGA 3D18A 2EEAA 1KN4L 4OUOA 4XI5C 5TGBB 4M93B 3LIZH 5JO5B 3EJJX 4XNYH 2GCYB 4XVTH 2YD3A 4R90L 5IIEB 1I7ZA 5CBEB 3KG5A 5KW9H 3SDAD 1JN6B 1U8KB 2LU7A 5IIEA 3OAYK 5C0JA 2VC2H 4LCCC 3SDAA 4D9LH 4X99A 1X6LA 3V0VB 1U8LB 5IMKA 3BGMB 2BOCB 2X70A 4MNHA 5I6XC 5KVDH 3AUVA 1R3IH 3PGCB 4GG8A 3TJHC 1DUZA 3ARGC 4U6XA 2BC4A 2ZCLL 1OAQH 4G6KH 2BZDA 2A6JB 4XVTL 4OQTH 1INQA 5D8JH 1ZHNB 2PN5A 5DUBB 1FFQA 3TBSB 1REIA 4MXVE 4U6XB 4FQJL 4AH2A 1KN4H 3GSUB 5HXMA 5DLMH 3EFFA 1WFUA 4KUZL 5D1XD 3U6RA 1ETZB 4X8JA 1XCTA 5F3HB 4NKOA 4LLUA 2GTZA 2G9HB 2CGRH 2FR4B 5GS2D 1UKTA 1DL7L 3VD3A 3HMXA 1RVFL 3KPSE 1G7JB 4Q9BA 4R96A 4U3CA 4GXVH 1FPTL 3EJZD 4ODTL 2Y5TB 1S7QB 3L3DB 2I07B 1FAIH 1NCWH 1J0ZA 1TTGA 1A4JA 4LIQE 4XNUL 3RIAK 1N0XL 2OR9H 3QDGE 2I07A 4PJ5E 5J3HD 3CSPA 1BJMA 3OXSB 1EEUA 1W0WA 3IJYB 2Z92B 5JW3L 5CGTA 4MQ7A 1GGBL 5DJ0B 4UILL 5DEGB 1KYOK 4ODUA 3ZE1F 3WS3B 3D9AH 1DQMH 5DJ0A 1FGVL 1ZLUH 5DMKA 5E00B 2IQ9H 2E6JA 3LQAH 5JUEL 3NABL 4UQ2A 1EA9C 1XF5A 1EZVX 3TIDB 3OZ9L 2Q3ZA 4P3DA 7FABL 1LP9B 4HWBA 1EVUA 4JO3L 3UTQA 3ULUL 4N1EA 4JFFB 3MXVL 4HKJB 3MLWH 2FWOA 4D9RE 3T8XB 5DURB 4R90H 4KJQC 4M3KB 5D7KD 4EQ3A 2MJWA 5IFJB 3W0WD 3GJFA 5SX5H 4I48B 4PJ7B 5HYIA 3AB0B 4NQEA 4PJIB 4JFDD 4GRWH 2PW2A 3GHEH 1OPGH 4L5FH 2GUOB 4OZGB 4Q9QH 2DI8A 3QAZC 3RZCB 5CBEA 4HLZH 5HYFA 3HE6C 4L9DA 4Y5VA 3S96A 1JGLH 3I3BA 2GY5A 1G7MB 1T2QH 2IMMA 4F58L 2HKHL 4LCIL 1NGZA 2F74A 4K9EC 4NUGL 5TJWK 1G7MA 3FO0H 4PJ8B 1TZHB 2IPUK 4QTIH 1MCLA 4LLWA 5I1EH 2FHCA 4R8WH 2X4PA 2A77H 2JIXA 4R0LC 4JJ5B 43CAB 4FQXB 1AGFB 2XTJE 3CX5K 1VFBB 2BRRL 3TBTB 3D0VA 4ZG1A 3HNSH 2VDOL 2V2TB 1IEBA 5J1AB 5JHDB 3MXWH 5C07E 3MLZL 4P3CL 1B3JA 1MH5B 4H5SB 1W72L 4XC3H 3TBYA 4LVNC 2E6PA 4NQDE 3T4AB 5AAWA 3IDJB 3ZDXF 5CEYB 3PDGA 3CC5B 4KKNA 1INDL 3CUPB 4HXAH 5HHOE 5HHOB 3O2WH 5IGXL 4K3DH 2KPNA 1OGTA 2AW2A 4IRSA 2X5PA 2R29H 4RZCB 4OGAC 4PJDB 1T7XA 4XP1H 3TA3D 4EI5B 3RKDC 3A6BH 2WP3O 4YXLL 3QUYD 2YUXA 5F3BB 3LQMA 3FT2A 3WCYA 2Z92A 2BNQB 5K9OB 2WZPD 3QXVA 1EJOH 4UV4H 4ODUB 3SCMC 1GAFL 3BYYA 3OPZH 4JZJB 4XVSL 5ALCH 1LHZA 3PABA 1A21A 2X1OA 2XV6B 3CFCL 3L5WA 4LNRB 4XCCH 1FNAA 1BVLB 2BDNL 4MX7B 5GGRY 2J8UF 1MREL 5SWZD 4KK9C 4FFVC 4L3ED 3KJ4B 3L95A 4K3GA 2GK0B 4L1HA 4NZUH 4P49A 4Y4FD 5GGUB 1JMXA 1CT8B 3LEYH 4NM8H 4OCWL 3H8NA 4IDLA 4LSRH 5FUOL 4GG6E 1CDUA 1EK3A 1L0XA 3SEPA 1JF6A 3LEVL 3B9KA 5BVPL 2PW2B 1DBJL 1JNLL 2DLFH 2X4TB 4FQ1H 1CR9H 3ZT7A 5IHZB 1LEGB 3FCTA 4PJDE 4ZFGL 2PXYA 5D1ZD 2C7UB 3ARZA 3FOMA 1NUNB 3GSXA 4I18C 1Y6KR 3V0WH 1ADQL 1NAMB 4HGKC 4KMLB 4PJGA 3H0TB 4YHIB 4GXUN 1MWAH 5DMGD 1ND0B 3MO1A 3WO4C 4GMSH 1KIQB 2DN7A 3BP6B 2ADIB 5IW1A 3OGCB 3G6JA 3BD4A 2UWEB 3SGJA 5HPMB 2C26A 2R23A 4JQIH 1NL0L 1DBJH 2NXYD 2NNAA 3CLEL 3ESUF 1U91A 3KLHC 4G7YH 4LL9A 4JQVA 3NAAH 4KAQL 1G1CA 4XNQA 4HUKB 4ZQKA 3SDCB 1TZIB 4WJ5A 2P5ED 4CU7A 5JW4N 1QBMH 5TH2A 3ZHLA 4H25A 2OCFD 4YR6B 1UWXK 3UYPA 1TNMA 5FV1L 3BP7B 5E5MA 1S78C 4KV5E 5DK2B 3BEVA 2F15A 4R4ND 5DYOA 3BX7C 1U9KA 2H26B 2HTKC 5A2IH 1PSKL 4FN0A 2BDNH 2FX7L 3MV01 3QWOA 3C6LD 1ZEAH 4UIMA 4LBEB 3LEXA 5EG6C 1RJLA 4MA1C 4P9HH 4D9QD 3FQNB 5F97E 4UIMB 1BVKA 2FHBA 1MHPH 4JFHD 3ZTJG 3L3KB 4PJIE 3CXHJ 1HHHB 1LK3L 2VDMH 1FNEB 3LSOA 1MY5A 1RHHA 1OP3K 4P2CG 1AO7D 5EO1B 3NCFB 2R9HD 2DQDH 3KWWB 4OFDA 3A6CL 5CHNA 4O2EA 3QUMA 1CK0H 3U7WL 2J4WH 3L9RA 4Q0XL 2QSVA 3IDNA 2FH6A 3ZHDA 1MRDL 4V1DD 1C5CL 3EOYG 4XP4H 2R69H 3HRPA 3OJDB 4EXPX 4HX1A 4WWKD 3VFVA 4DQOL 4BFIA 4PRAA 4UU9B 5HGDA 4HEME 1J1XL 3EYOA 1JPSL 4H1LA 4XWGH 1B90A 1FLRH 3LQZA 1BFOB 4OCRH 4QNPF 4KKCD 4JPIA 3IJHA 3KR3L 1CD1A 1QFWM 4U1KA 1WWCA 4JANB 1MFNA 3VXNA 3WE6B 5KN5A 2EXWD 4Z78A 2JELL 4HJ0D 3U9PL 3D18B 4PJ8D 1M7DB 3BO8B 5CZKA 5CEZL 4PP2A 2MCG1 5D1ZC 3HAEA 3G6JF 3IAQA 3ARFB 5DJZA 2EZ0D 1FFPA 1XF4B 3OR6B 4PP2B 3NAAL 4KAQH 3TYGL 2V2XA 1QLFB 5F93C 4Y8AA 3RVTC 5F6IC 5GSRB 4M9PA 3MYZA 3JTSB 5HYJD 4RX4D 3MRGB 5H37G 4O5LH 5F70A 4TNWF 3RIFK 3KPQA 5E8DH 4J8RB 1QSEE 4JKKA 1AR1C 2FZ3A 4ZQKB 2RGSA 4MCYB 3MV11 4AENA 1WEJL 1NH6A 4LAQL 1HCFX 4WY7H 1WITA 1ADQH 1GGIH 1CQYA 2D7QA 1KN2L 3CDGA 3NFNB 4JFDE 1MOEA 4YHLH 4P23B 5E2TL 4ZSOA 5TPWL 5DK2A 5HHPA 5E6YA 5CAYB 2FX8H 1CGWA 4MA8L 2A1WH 2DBJA 4OLXH 5DDHB 1PYWB 2D0HA 4Y5YC 2FIKB 3D0LB 3OX8B 1FVDA 4QEGA 3BPNB 3P4NA 3BRDA 5IEHA 5DRZB 4LMQI 1PYWA 3WHE0 4S0TD 4HFUL 1GL4B 1T6WA 4OZHB 5HJ3B 1A7QH 5HI3C 1A4KA 1KG0A 1K4DA 3QJHB 4PGDB 1A3LL 3JWDH 2AXGB 1HHHA 1WCBA 5D1XB 4HFWA 1U42A 1A4KB 1V3KA 4ENED 4UAOC 5GGVH 5L7XL 2G5RA 1CVRA 3LDBB 1U8IB 2CUMA 2RBLA 4Y4HA 1C08B 5JDSB 3ZDZF 4U1IB 1G6RH 4NN6B 4NQDA 3O45B 3DSFL 4XCCL 1RI8A 2BY0A 1A7BA 2Q86B 1MCPL 5I8CA 4EVNB 4HV8B 4XCYB 5DRWA 1AGDA 5KJRL 1JRHH 3WNPA 3BPLB 4NHCH 3VRLF 3F62A 4U1HB 1IGIH 2R0ZH 3NTCL 5DS8B 1TETH 2AI0H 4TUJB 4UOW1 3T3PF 2Z8RA 3THML 5IR1A 1ZLVH 1X4XA 3FHAA 1E6JH 3RBSA 1F6AB 4PTUA 4WRLA 1TNNA 3QWRD 5FV2A 1GSMA 3RGVC 4ZOBA 1Z3GL 4NQEB 1R3KA 1TITA 2AJYH 4PJIA 5JHLH 2X89D 1BAFH 4MJ2A 3QUXB 4MHHI 3CLFH 4HS3B 1IILE 1BQUA 1I8LA 1E4KA 5CINL 2VN4A 1ZANH 1RQ5A 5I1IL 4PRPB 3OJMB 4RMSA 1IZJA 4KKLC 4LRNL 5C2UB 2Y25A 2DL2A 3D85B 3L5XH 4M5ZH 2N4IA 4PJ7E 5MEPB 4NQTA 3BJ91 1QA9A 4QTIL 4FFYL 3TPKA 1KT2B 4M6AA 4LCCB 3C08H 4HUMB 5AZEH 2X4PB 1FHGA 3MPCA 2XACC 3TBVB 4S1RL 4ZSOB 4NO5A 1MJ7L 1EHNA 4KK5D 4RGMC 1FFOB 5IF0B 4NKMA 4MDIB 5DJXB 4Q9QL 4ZO8A 4JEGB 3LKSA 5GZOC 5C0CD 3HHRB 4KHTH 3UTZB 3ARQA 5TDPA 2NY5H 1MHCA 4E42B 1K8IA 3K81A 1JZ5A 4APQB 1KPUA 2DM2A 3RAJH 5IT2L 4GRMB 1SJEA 3HUJA 4NQVA 2VXQH 1F2QA 3KYNA 2GJ6E 1OGTB 4IRSB 7FABH 1I1CA 2FD6H 4LEOB 3WEXB 2JJWA 5E1AA 4B7IA 3QUYA 4PRDB 5IB1B 4MAUL 4L4TB 4JKWA 2Q86A 3O0RH 5EU6B 3K1DA 3VXPA 5J12B 1WWAX 2VL5B 5E56A 4N9GA 1F58L 4CRPA 4G8GA 4FQCH 4JHBA 5TE4H 1AFVL 4W4OA 5IVOA 2E7LC 4MB5A 2MQ0A 3D25A 1I8LC 3SJVE 1OT2A 4RAUA 5B21A 4BM7A 2BVOA 4XNUH 2Y4SA 5E99H 3VXUB 2X1QA 1EUTA 1S9YB 5GGUA 3BPOB 1S78D 4ZPVA 3U4EB 4EUPA 5JMOC 2FSEB 5E7BA 1CFSB 4W81A 4JFEA 3TBWA 3W39A 1EHLL 3RWFB 4PJFB 1OB1B 1R5IA 1FVCA 4Y4HD 1P4LB 3GO1H 5F9OH 3X3GL 1RURH 4OAWB 3RTQC 3MA7A 3U36A 1HH6B 1AD0A 1SYSB 2VXTL 3FQUB 4XPAH 2BHZA 4I3RH 4FQXC 3K80A 4N0CC 3B2VL 4MQXC 5D7IA 4F8TA 1IKFH 2A9NH 4JRYB 1MLCA 1IAKA 2P1YA 3KPTA 3P4LA 2AVGA 4ESKA 4PJGB 5A40E 4U1MA 1TZGH 2QSCL 4WV1C 2A9MH 1OP5K 4ACPA 3QB7C 1BOGA 4LP5A 2EYSB 1T7VA 2JB5H 4HIJB 1VCAA 1G0XA 5DJ6B 2VC2L 3TBVA 4RIRB 2F58H 2ATPB 4L29A 4XWOD 4WWKB 3QAZB 1ZWIB 2DBLH 3RL1B 2HYMA 1RK0A 5T33L 3IDXL 5TDPB 4WWID 3RL1A 4MJ6B 1D5BA 1PKQB 4K94H 5MI0B 1NCBH 3CK0H 3WSQL 5IHBA 1R5WB 2FL5A 1PKQA 2AI0L 1I85C 1YMMA 3BP7A 4OM1H 4F2MA 4NNPH 1FNLA 4JGMA 2R0ZL 4EZMA 5CZVL 2NYYC 5FOBB 1XR9B 1OAZL 4R0LB 3RNQA 2GSGA 5SWZA 3H2WA 5F88B 3IU3B 4K3JL 3V4PH 2VQ1A 3OKOA 3TZVD 4QNPE 1BVKB 3RKPA 4AH2B 1C16B