4O5LH

Crystal structure of broadly neutralizing antibody f045-092
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
240
structure length
234
Chain Sequence
b'EVQLVESGAEVKKPGSSVKVSCRASGTFYKYAINWVRQAPGQGLEWMGGIIPFFGTTNYAQKFQGRLTITADGSTNTAYMQLDSLRSEDTAVYYCAGPSITESHYCLDCAAKDYYYGLDVWGQGTTVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F045-092 light chain
molecule tags Immune system
source organism Homo sapiens
publication title Receptor mimicry by antibody F045-092 facilitates universal binding to the H3 subtype of influenza virus.
pubmed doi rcsb
total genus 41
structure length 234
sequence length 240
ec nomenclature
pdb deposition date 2013-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o5lH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o5lH01
4POUB 4L8CA 2V5YA 3L7EB 3NH7L 5CD3B 5D2NA 2P42B 1YNKH 1EEZA 3BYYA 1MIEH 3KLDA 4PJBF 3P11H 1PYWB 3BKMH 5C0RL 2CUIA 2V2WA 3BW9A 4CMMB 3CVHH 3HB3C 4FQCL 2HRLA 1FGNH 4IIQC 3C08H 1G0XA 1A4KB 3LV3B 3ZKSD 5DVMA 1V8HA 1J8HB 1LEIA 3PWPD 1BECA 1I9IH 4HK3N 4YC2B 4YFLI 1ONQA 1TZHA 3S3JA 4EJ1C 3EGSB 3BH8A 3LEYH 4HWEH 1P69B 4Z7VF 1GOFA 3W39B 4DEPB 5EBWB 4XHJC 4LCIL 2GJ6A 4MS8C 3V8OA 2P45B 5C2UB 5GSRA 5JOEA 2FNBA 1H3VA 3MV8B 4A6YL 4FTVD 5CBAB 2Y9RT 3O11B 5CJXC 5IHUL 1M7IA 2Y07H 3IFPA 2XKNB 1OGTA 5E8PB 1E0OB 1OGAA 5IQ7H 3W2DL 4RGNE 5FEBA 2EIZB 1MF2H 3SGDI 1MLBB 3ARUA 3V0AC 5A2FA 1NCWL 4FQ2H 3RI5F 1QSFA 2E7MA 2HFEB 3BH8B 4WU7A 1RZJC 4YHOH 4IOFD 1CR9H 4LLVA 1OTTC 3NABH 2F74A 2CK2A 3HMWH 3BZDA 4NZTH 4TN9A 4PJGA 5EOTA 4WW2A 5TQ2L 4NZJA 3O8XC 3MBEA 1AY1L 4NSKB 2XTLA 4O00A 3EOTL 1OWRM 2BSSA 2EYSB 1G7JB 2PO6B 1ZK9A 1VPOL 3ZDXF 5BVJB 1AH1A 1A9BA 1S7UB 2FO1A 5BMFH 4JDTL 1QR1A 1R5VA 2PCPA 3A6BL 3RNQA 3ZKNC 2AKRB 1BIIA 2ZUYA 4M7LL 1S7QA 3RIAK 1S5HA 4X80H 1XR8B 2C26A 3LKRA 5D8JH 1KULA 3KJ6L 1JPST 4P9MH 5HBBA 1BVZA 4FNLH 4FG6D 4HKXB 5DQ9B 1D5IL 1BZ7A 2HT4C 4UT6L 2VLKA 4ZUWB 5E6ZA 4HV8B 4ZOEA 2BY3A 1QVOA 4BM7A 2I9TB 1HIMH 2OJEB 1IRAY 3X3FH 1PY9A 15C8L 3W39A 4YLQT 4PRDB 4U1IA 4RQQB 2VXSL 4ONGH 4M9OA 3VGFA 4KQ4H 3QNXB 2ICCA 4ZAKA 4K23L 4TYUA 3SKNB 2HKHL 4LKXB 3UP1A 4FTVB 3VGAC 2VQ1A 1T1ZB 4Y4HA 4ZQKA 1UCBH 3T3MF 4ONOA 5JLZA 1FFPB 4NQDD 3H8NA 3VFUB 1ZXQA 1NKOA 2XQBH 3P3YA 1OP5H 3MLVH 5FUOH 5IW3A 1PFCA 2KUTA 1ES0B 2JIXB 5KANG 5I1AA 3D0VA 1X5AA 3KPOA 5CSGA 4X0KA 2V9TA 3IDXH 3C2SA 4U6YB 3ROOB 1QLRA 1N5AB 2A9ML 4ODVH 2AJ3B 5IVXE 2ESVE 5DVNA 4D0DA 2QBWA 5MERA 2VLKB 3G5YA 2XNAA 4L9DA 1JWMA 3Q6FB 1QNZL 3P73B 3LEXB 1Q9LB 1T80A 4AIZA 4ZFOA 3BQUA 1EAJA 4FQJL 2F5BH 2C5DC 3DURA 1S5IL 1NAML 3MJ8A 2HMIC 3C5ZC 2EDLA 4R6UA 3HG1E 2HWZH 3PWPA 3KAAA 3MRRB 5D6DC 4XPHH 3DO3A 4OD2A 4GW5A 1SJEB 1NLDL 1WAAA 3RGVC 4G6AC 1BBDH 2XQBL 3TJEH 3TCXA 2DKUA 4WO4C 1GIGL 2VDKL 4KDWA 3D39D 1U8HA 1ULVA 3GO1H 2PYEE 1SMOA 4QXGL 3OKKA 4YWGL 3UYOD 5IP4A 5F9WC 1AXSB 3WS6A 2IWGA 3BGMA 4U1MB 5KVDL 1GGIH 3MRNB 3DI3B 4QRPE 2X89D 2HFEA 2HKFH 4LIQE 4YUEL 4NN7C 5EO9A 5C0FB 4QHMA 1KENH 1CL7L 2FZ3B 4BK4A 1FFNA 2G5RA 4CUCA 4MJ6A 1V5JA 4OF0A 2Q76B 4KK6C 3TZVC 1MCDA 2Z31A 3ULVL 1UWEL 4UT6H 1T66C 2XXMB 3X12A 4U6XA 4EN3C 3C60A 3U9UA 2VDQL 3OWEA 4KUCD 4X99B 5DJDB 4JO3L 1FLRH 2OJZH 4TULL 4HF5H 1V7MH 2ZKHL 3ES6B 4G8GA 2C3WA 2JELH 3OG4B 3PGFL 4ZNEA 1KJMB 3FO9B 4LL9A 4MXQD 4JDTH 3BKYL 3ABZA 3IVKB 4ELME 5CKGA 3TT3L 4EQ2A 1NGYA 5E2JA 1DUYB 1HOCA 5GZOC 2PXYA 5H8DA 4HGKC 3DYOA 1QFUL 4KV5E 4FRWA 3LN4A 5A16B 1YPZF 4Q2ZB 3CDCA 5ETUA 5AZEL 5GGUA 2V2WB 3BW9B 3SKJL 2FH6A 5DUBB 3WS6C 3FQUB 5IEKA 1XH3B 4TRPH 4LSQL 1YEIH 3QUKA 1YEGL 4DUXA 2Y06H 1XGTB 3GI8L 4JKPH 1YYLH 2AXJA 2VLMD 4X7SL 3ZE2E 1AGDB 1YNLH 3LDBB 3O6KH 4UILL 1VB9A 4AL8L 1MF2L 3UTSE 5C0BA 5CCKL 5I71B 1NFDE 3WFEL 3U0PB 1DANU 3ZYOA 1CVSC 3MLRH 2L7JA 2AXGA 5ICZA 2EO9A 3HS0B 3HAEB 4QGYA 3TO4D 1HILB 1WIOA 1BIIB 2P44B 5DVLA 4FXLA 1JPSH 1S7SB 4L5FL 4JFZH 4XNMA 5FCUH 4K71C 1HKLL 5D7IB 3ARDA 2CKNA 5IB1B 2IH3B 1E27A 3IF1B 3ZE2F 1WK0A 1RQ5A 3THML 4NKOB 4RGMB 2I5YH 1FGNL 2QQKL 4JG0L 3KHOA 3BUYB 4UOW0 1J0YA 3KPTA 1FC2D 3K2UL 4I0KA 1T04A 3FRPA 3RBSA 2A6IA 4XPTL 1I1AA 2FL5A 2IPKB 4LEOA 4NFBA 1KIPA 3RNKB 1TZHB 4ZFOL 1N5YH 5F1NB 2DYPB 4XBPB 5F1SA 4Z0BL 4PJIB 4LBEB 4NIKB 5BRZD 1LE9B 3PGDA 3QNXA 1VFAA 3T8XB 3EDJA 5TDNB 2YN3A 4OZGA 3M1BB 3QEGH 1OM3H 5CEZL 1DQDH 1NCTA 1WV7T 4U0RC 5D1QA 2FJHA 5TE4L 1YPZB 1T2QL 3CFCH 2WLYA 3A6OA 5DK0A 5DD5H 4TPRL 4ZUWA 5IG7B 1XIWC 3R0NA 1MUJA 1U9KA 3RWEB 5IVXB 1I1YB 5T3XD 5T1LA 2BSTA 2Z93A 3QDGE 5BXFB 4NO2B 4UT7L 5IBUG 2XZQH 4LCCA 1J0IA 3DSFH 4W4OA 4Y2DA 5FO7B 4MXWL 3MBEC 5HI4D 4MA8H 2ZSVB 4BELD 4NO0A 3MRHA 1PYWA 5JNYA 4JO4L 4JCMA 3MUHL 4JB9L 4XP5H 3SDXA 3QIBC 4C54A 1DQLL 3LQAC 2P24B 5EIIB 2NW3A 3AS3A 2J3SA 1U8KB 1XGUA 1CL7I 1DLHA 3KLHC 1I7RB 2BVQA 2LTQC 5D2LF 5J4MA 5AUMB 5D71L 2VAJA 3B9KD 4E42A 4XNQA 1C1EH 3W9EB 3CX2A 2P48B 4AG4H 1MFCH 4YHKL 1HSBA 3RGVD 3RL1A 5F7YC 2R2BA 4WI3A 3BZ4B 5DT1H 4R3SB 4XPGH 5L7XH 4P23A 2HJLA 2CDGA 2V6HA 5GIRB 2DIBA 4XVUD 4JO1L 1U41A 3U0WH 1FZJB 1L9MA 3QEQA 3VFGH 3GSXA 5BVPL 4NO3A 4WI9A 4HXAL 4XNUH 4HUKB 1I7UB 4WI6A 1EH9A 4WCYL 4MB5A 2RCSL 4DKAA 2OL3L 2VXTL 1CTOA 3I2CL 4WHTB 1N4XH 1WBYA 1XF4A 5HHOE 5E9DA 3A6BH 3D0LB 3ARWA 4KJQD 3QDMA 3RA7H 3E6FB 1C5CL 5DUMH 3D69B 4GKZB 3QZWA 4BKLA 4R2GD 4MA7H 3MUGB 5GHWH 1VKXA 2IFFH 5EIVA 4LLWB 1OW0A 5F7EL 3RZCA 1SBBA 5E2WL 3BRGC 3MRPB 4MAUL 2V9QA 1JGVH 3UPCA 4A6YA 4Y5YA 1I8MB 1BM3L 4G6JH 5LCVL 1WZLA 3T4AA 4G9FE 2B20A 4O02L 2IC2A 1IL1B 3S37L 2Z8RA 4PJ5A 4LSRL 1A8JH 3D85D 3U7WL 3EFDH 3RTQA 3V6FB 3T2OA 1P4IH 3UTZB 1M7DB 3ZTNH 5FECA 4PD4J 3BUYA 4MNQA 4F57H 1DEEB 4MJIE 3S9DB 2XT1B 4YXKL 1YECH 3E1F1 3QIWB 4KVNL 5J3HD 1O5DT 1SEQH 3KPPB 4HKZA 2P8PA 2KPNA 2AABH 1RI8A 2DS4A 5D7SL 5E94A 4Z0BH 3EO1A 1ETZA 3X14A 3SE9L 3S88H 3G5ZB 3GI9L 3U4EB 2AQ1A 2FHFA 5T1DH 4DGYL 4TUOA 3T0VA 1AGFA 1MJ7H 3GBNL 2VXUL 2LE9A 3MXWL 2BY2A 2AV1A 2IANE 2W9EH 5HY9A 5DDHB 3BPCA 2NY4D 4ODUA 4JKKA 4JY6A 4N90D 2C1OA 4HWBH 1G7IB 3V5KB 3LQZB 3VFPA 2ARJQ 5F97E 3PIQA 5C09D 4N1CA 2EEDA 3GHBL 2FLBT 1YECL 4G7VH 5JW4M 2A83A 4M6MH 3D2UB 4NO0B 3G5YB 3WFDL 2AJSL 3HZMA 2AABL 3PXHA 4FP8H 4HJGB 4C59B 3Q6GH 1I7ZB 4DVRL 3QFDB 4V2BA 2P8LA 1HI6A 5H35A 5C2BH 4OBRA 2JJSA 4OFYD 4DUVA 5C70A 1G1YA 2KQMA 4ZSOB 4JQVC 1NBYB 2VTFA 3CFIC 1HNFA 3I75B 4KHXL 1DANT 2XWBA 4WJ5A 5EU4B 3WFCL 3QIUB 5E4IA 5DJ8A 2ARJA 4JKPL 1A14H 4CW1A 1CE1L 4KFZC 2BVTA 1QTYT 5EU7C 4PJEF 3WNKA 1C5BL 2EIBA 5IK3B 3T0EC 1GCFA 1CLZH 1BJ1H 1S8DA 1KPUA 3UTOA 3O9WB 4JZOA 1FP5A 1H3XA 4MVBC 3MBXH 1FFQA 3T2QA 1BGXL 5D93B 3ARBA 4PD4K 3GSNB 4ONFH 4M7ZB 2XTJD 1FZOB 3IAQA 3GSWA 4J4PC 4D0CB 3RWGA 1FAIH 3T0XA 2YMXH 3TA3C 2VAAB 1CI5A 2CR3A 4NQCB 4RBPK 4OZHE 4MA7L 4PJ9D 3SKUD 3S5LA 1OD9A 2OL3H 5IR1B 3SDYL 5B8CA 5DJCB 1IAOB 4K8RC 5BZDB 3LHPH 1MRFH 4FQQB 5DEFB 3FO1A 4BFBD 5KSAD 1F11A 5F71A 1BZ7B 2FYYA 2QSCH 1JGDB 3GEWB 3IRZA 5IR1A 3H3PH 3I6KA 2L7UA 3IETB 1H5BA 5D96B 4MWFB 3BD5A 4R8WL 3MTRA 1HQ4B 4ZUTB 1CL7H 3RWFA 4D0CA 1U3HC 4GW5B 2A6JA 2LAAA 4E41B 3MRCA 4UV7L 1UB5B 1JL8A 3HS0A 3NA9L 1IAIH 2AJYH 1K8DB 3QXTA 2F8VA 2NY6B 5JHLH 3TPKA 3DX8A 4MQ7B 3WFBH 4I4WA 2F74B 3R8QA 3MJ6A 4MJIA 5F3BB 5FYKH 2V7HB 3TNMA 4X5WA 4AH2B 4LCWD 1WZ1L 2XG4A 1H8SA 3C6SA 5I18L 5HI3D 4NKQB 3O6FA 3QHTC 1CXEA 1QOKA 2Q8BL 2IPTL 2JJVA 3RWIA 4P4KA 4Z7VE 4KAQH 3Q48A 4OIBA 3S36X 2X4QA 4G8FB 3BKCH 1TNNA 1DQLH 1CD1B 4N0CD 2P8MA 3MYZA 3AAZB 3B2VL 4MXWH 3CSBA 3PDOB 4C56E 1ND0A 3GMNA 1BJ1J 3EAKA 2VE6B 4H5SA 1A6PA 3MROA 4DZBB 5C6TL 4D9LH 1GJIA 4R7NB 4HLJA 1YQVL 4GKSB 1Q9WA 2DLHA 3MJ9A 1FZKB 1HKFA 1ZEAH 4WV1C 3H9SE 8FABB 1M6OB 1DQDL 4PP2B 5DQDH 5BZWB 4GMSL 4JANB 4G7VL 5INCB 1DP0A 3HE6B 4NKDB 3DRTA 4U0QB 4WWKA 4F58L 1NSNL 2YS4A 3VE0A 3W11D 4N9GB 2H2SD 4C56A 1A6WH 2ICES 3H3KA 5JHDD 1IC1A 4EVNB 3MRNA 4XX1E 3UAJC 3KYKL 1NAMB 2EDKA 3WJJC 1A6AA 1LK3H 1L4IA 5C09B 4NRXB 4EI5C 5GPRA 5IF0B 4XC1H 1UM6H 1XCQB 1KIQB 2VJXA 4HIIB 4K7PY 1G7HB 1R3IH 4S1QH 4UINL 5ICXA 4JLRA 2BOCA 1X4XA 5EH1A 5B4MD 5TQ0L 5T1DL 4OUUB 2BMKB 1WISA 1A6AB 4YHIA 4WUKL 1YEFH 1FFOA 4J8RB 5D1ZD 1Z5LA 5FDWA 1JTPA 3PWPB 5IW1A 4L8DB 3BIKA 4NBYB 5EU7E 5FF6B 4YDKL 1QSED 1ZGLB 5E4EB 2CDGB 5I0DA 5HHOD 1DLFL 5CJ5A 4OKVA 4L4VB 1UZ8A 5TPWL 5EA0L 4LVNB 2XPGA 4XP9L 2QSTA 4KVCH 3ZKMC 3T4YB 1P9MA 1F3DJ 1BP3B 3LQAL 1JZ3A 2X4OB 5HGBA 1QFPA 2VLLA 4LKCA 4PJAF 3AUVA 4JM4H 4TUJB 1QD0A 4XP1H 4BUGA 2JJSC 4HIJB 3BWAB 3RVXC 1F42A 4X7TB 1XGPB 1YYLL 1Y0LB 3SDCC 2I60H 3I02A 2EC9U 3SE3C 2AGJL 4RIRB 4U6TA 3AB0B 5IB4A 5E6IB 2CO7B 4YJZL 1U8IA 1AI1L 3D85B 5EBWA 3SDAA 2JK5A 3EOAA 1NCWH 4B0MM 1GPOL 2DI9A 1YPZE 2GTWA 4UTBL 5I8KL 1V7ML 2ZKHH 2ZSVA 5FOJA 3I02B 3LKSA 1RZ8B 1W0WB 5EZIH 4HUVA 4GSDL 1AGBA 2G9HA 4B41A 4NYLB 4HBCH 4UDTA 1GAFL 3QDGD 4TSBH 4I4WB 3VXSE 2RAMA 2X89A 3W9EA 4J7RA 2YXFA 2X4TB 25C8L 1JE6A 2H9GB 1RULL 3KPSA 4K8RD 4PB0H 4F7MA 3NCBB 2J6EL 1RZ7H 5EZJA 4LHUA 4NGHH 1RIUH 5EIIA 2R15A 1HEZB 1UWEH 2GJZB 3BP6B 3SDXB 5GGSA 2CO6B 4HCRA 1P7KA 1D6EA 4ZMAT 5I1GL 3TN0A 4HSQA 3P11L 3N1QC 1VCAA 2DYPA 4APQD 2NXZB 4JRXD 3MA9H 5IVZA 3T3PF 4PJAA 2R56H 4X4ZA 1P2CB 3KYOB 5CS7A 3GMLA 4RNRB 2ZPKL 1V05A 3FB8B 4P2QB 4Y16C 4AEFA 2BVYA 4Z7UF 1UH4A 4XP5L 5F9JB 2COQA 2M8XA 1HXYA 4M93B 3LPWA 1I75A 2V17L 3VGBA 5JXED 1PEWA 4M61A 3I3EA 4N68A 4ODTL 3RWDA 5C0CE 3PP4L 2BNRD 2F5AL 1R3HB 4I8DA 4HWBA 3T0ED 4UT7H 2P1YA 3QEHA 2HJKA 2ZG3A 3HAEA 4KHTH 4IDJH 1B6UA 2ICWB 1H3PH 5EU6E 1TJGH 4G8EB 5JO5A 2J8HA 1ACZA 3OAZH 4Q74A 3H9YA 5I1JH 3FFCB 2AJZB 1HWHB 1A7NH 2DLFL 1P4BH 4LSVL 4LEXL 4OFDA 5CBAA 3DX9B 1YDPB 3QEGL 5K59E 3UJIL 4PGDA 3QUKB 3DXAE 4PV9A 4HGWA 1X7QB 3HE6C 3KPSD 4L8BA 4OFPA 3B5TA 4J6RH 3EYSL 3T65A 4WNQA 3RY6A 4RNRA 1V3JA 5H37H 2VZTA 1DQMH 4H8WL 4GRWB 1A4KA 1ZGLA 1VFUA 4OZ4B 1NFDF 2HKHH 4AZ8A 1T4KA 4MJ5A 3X3FL 4Y4FA 2X9YA 2C4FT 4LF3A 1J9CT 2AJYL 4PGCA 3OAZK 4JDVB 5ACMA 3TVMC 3Q5OA 3X13B 2HT3C 3MLUL 4NWTL 2FX7L 3L3DB 4HWZB 15C8H 1VERA 2OL3A 3UDWC 1FVDB 3L95B 3L3JA 5IHLB 2IALA 1KTKE 2G2RA 3Q5TA 4I3SL 3CMGA 3MX0A 2PW2A 1RULH 4MJ5B 4OLEA 2ESVB 2FIRT 3UO1L 4IOSD 2VXQL 4EZMA 4BSJA 3HRPA 2BERA 2YHGA 4QOKD 4HS6A 1NEUA 4PJ7E 4Y5VA 2HTLD 1QBLL 1RU9H 4RX4D 5L8JB 1JFQL 1HCVA 3I6LD 1YNTA 4QRSB 3GGWB 1NFIB 5DLMH 4JHWH 1X44A 2OR9H 1SM3H 3SGDH 4P46C 3L3OB 3BGMB 2I9LB 3HMWL 2KL6A 3QH3A 4POZC 3WNOA 5T33H 1CR9L 3KDMB 4KKBC 1SYVA 2VRAA 4DCQB 3EOTH 2APTA 4MD4B 3VD4A 4XP6H 2B4CL 1JTOA 4NQCA 2G2RB 5EOQL 3EUUA 4P3WA 6FABH 3TPUB 3SKJH 5EZOL 4YBQC 4NKMB 4JZNA 4WU5B 1W0VB 1WQVT 2X7LB 2ITDB 3HI1B 2CUHA 1TVDA 2R2BB 5SX4I 5GZNC 1IGCL 1BD2E 2PTTA 2DQIH 4HH9B 4UDUA 3LKOB 5FGSA 3SCMA 1MFNA 4FQ2L 5SX4H 5TPWH 3L6FA 4ODXA 1KEMH 3STZB 1SY6L 2XY1A 3CIQA 4DZ8A 2IH1A 4L8SA 3FHAA 4NC1C 2D7TL 1OPGL 3DHJA 3DV4A 4L4JA 2FJGB 1MCEA 4XWGL 2FSEB 2DTML 2I9LA 4KTDH 4XB7A 3G08A 4YK4C 1YEKH 1C7TA 4Y19A 3NFSL 2F54D 2E6JA 4U1KB 4UU9A 1D3CA 3NCEB 4WEUD 2QQQA 5F6HJ 3VXUD 1QUNA 2DQFB 5F6HI 4YBLC 4I2XA 2NY5L 5IT2L 5JXEA 1F4YH 4MWFA 2CJUL 1T7VA 1UM6L 4PRPD 1UKQA 3M07A 3STZA 2AJUL 1EO8L 3EDFA 2H6PB 4RBPH 1X5KA 3BKJH 4N8CL 4CN4A 3I3BA 4WTZG 3QEHB 2MKLC 2E8YA 3HC3H 4Y0GA 1WBXB 5JPMB 3GHEH 3C6LB 2FHBA 1HE7A 4HK0B 4JZNB 1NSNH 5EB9A 3S3SA 3BKML 1TZIB 3VE0B 4X8JA 2DWEB 1PW3A 3MRDA 1CGVA 3GI9H 3K80A 5IMMA 3NFSH 3OZ9L 5DQDL 1FORL 4P57B 2IAMB 5E5RB 3LKNB 3ROOA 1AGBB 3D9AL 2DTMH 1DE4B 4I3RL 1D5XB 4MA1B 3PUCA 1JUFB 3MLTB 3CVIL 5FXCH 3X14B 1IGJA 3ARGC 1MJ8L 4YHPA 1NBZA 5C0JA 3K46A 5BS0D 1HHKB 4IRZH 4LASH 2HAZA 5D9SA 2JK5B 3P0VL 1BEYH 4MJ2A 4Q6IB 2DIAA 2R0KL 3SE8L 4OFYA 3WO4C 1G84A 5ALCH 1NMBH 1CFVH 1T0PB 5AYQA 1IC4H 1Y0LA 2IGFH 3ZMRA 2FX9H 3WDIA 1CFNA 5I9QB 1KPUB 3WIHL 3O3BA 3U7YL 4K7PX 3FCTA 3ZT7A 7FABL 3AY4C 1EHLL 1PD6A 2EXWC 1F00I 4ODTH 3K8LA 3TH2T 1NCNA 3RVTC 5E7BA 4PG2A 4HJJL 4X6DB 5I1IL 2R4RH 3PIQB 4F7EA 4OZFG 3P9LB 5HI3C 3M1BA 3ULVE 5DHXB 2IANA 4JY6B 1CBVH 1KTRL 5CAYB 4KKLC 4BZ1H 3U36B 1WWCA 3ALPA 2AEPH 2QHRL 1YEEL 2Y6SC 2VQTA 5IVOA 2APVA 2E6PA 1BVLB 2YUVA 3O3UN 1J8HE 1KJVB 5L0QC 5CWSB 1A6UL 4ZTOH 4JPKH 1JGUH 1IM9A 3VXUE 4LLQA 3U4EA 3DUUB 3TBSB 5AD0A 3WIIH 1KCVL 2RBLA 3QUXC 2FIKA 3HNTH 3W81A 1DBKL 4ZG1A 2O5YH 4XVTH 4C56B 2VIRB 2XA3A 4PBXA 5DO2D 1NGZA 5BJTB 3OXRB 4O4YL 5JW4N 2DQHH 3CFEB 3GMQB 3LHPL 2DQGL 5CZVH 2D0HA 5DC4B 2FBJH 1QSFB 5EZJB 5IV2A 3F5WA 4OF5A 4Q0XH 4YBHA 4YE4H 4MMXC 3RJQB 4HBCL 1RUAH 5GGQH 4YFLF 5FF6A 3JWDC 3RGVA 3W11C 4Y4KC 3QI9D 4UQ3A 5ESQB 2WSKA 1TLKA 3KLAB 4MJID 3N1GC 1KJVA 3T4AB 1DJSA 5IQ9A 4LEXH 4LPUA 1W0WA 4PJFA 3BP5A 2VB5A 3TT1H 1A7NL 4HDIB 3N1MC 4P46A 3UTPD 5FGRA 5D2NE 3I9GL 3NIFF 35C8H 2Y25A 4PJ7F 3VMPA 4HFUL 1NUNB 1QA9B 1MRCL 4E0RA 2OK0H 1TZGH 5IMLB 4PJ9A 1QRNA 4XNYL 3BEVA 1F5WA 2X4QB 4HJ0D 2D2OA 1KIUA 5DRZA 5E9DE 5D1ZC 5JZ7C 2GJZA 1NC2B 1JTTA 4LKCB 3VA6A 2YEZB 3QNYA 1T1WB 2BJMH 4BSWB 5INCA 3ARDB 5LG1A 3RZCB 3GJFA 4J3UA 3ZKMD 3DYPA 4LPYA 4RZCB 1KV3A 5CD3A 3PWJA 4PJFF 1I9EA 4OM1L 4H26B 2EH8L 4DKEL 4UBDD 1TNMA 5TDNA 1JNHA 3VXQB 3Q1SL 4WUKH 2BY1A 4D2NA 1AJ7H 4LLAA 1AD0A 2EYRB 3DTXB 4M1DL 5I30L 4MNHA 4JJ5B 4PGJA 3CDYA 1Z0NA 1IZKA 4YX2H 1K6QL 4LCYB 2C7UB 5CJ8A 4QCIB 4MCYB 3RUGA 1RK0B 3VI3F 1ZA3B 2Y72A 1RZ7L 3Q3GA 2CRMA 1NGXA 1PX3A 5F7DB 2F53B 2DLGA 2DM4A 2EDTA 1BBJA 4M8QA 3CAFA 3WLWC 1Q9KB 5D2LE 4L4TA 5D1ZA 4AEHL 3VI4E 4Z7WA 5DYOB 1DUYA 1HOCB 1KLFA 3KPSE 1IC7L 3Q2CA 1H3TA 1FVCA 4TNWF 2NY3D 5ABDE 1GGUA 3RGHA 1A4JA 1G1CA 3DRTB 4WWKB 4Z6AT 2AQ3A 1OSZA 4L3EA 4G7YL 1I1YA 2ZCKL 3H42H 4XHJD 4OD3H 4DKDC 8FABA 4CGTA 2OP4L 4AL8H 1LDPL 4MDIB 2FGZA 2KZ1B 3UCRA 5IK3A 2WLZA 3O3EB 2QHLA 3S97C 3OGCA 4WHDA 1AI1H 3KPMB 1FNAA 1KLUA 5LCVH 5D7LB 1DVFD 1J18A 4WFHD 1KN2L 1RFDH 5LVEA 3WL9B 4LSQH 4QRRE 2NY1D 1BZ9B 3HLAA 1IAII 2IBGA 4MAYB 2C9AA 3UROR 1TJIH 2YPLD 3E8UL 1YC7A 3QUYC 3RWEA 4YFDB 3WHE0 4BZ2H 4H1LB 3AAZA 4KJWD 3CFKA 2M1KA 1MIMH 3CSGA 3S4SG 5D1QD 5JW5A 3V0WL 3RTQD 1S7QB 2HT4D 1U6AL 1X7QA 4M48H 4OLXL 4O58H 2W65A 5IGXL 2DM2A 2PCPB 3MYJA 4PP1C 5DLML 3RNQB 4PG2C 3I84A 4OLWL 3U1SL 1U8IB 4FQ1H 5F6IB 4P23D 1V3KA 2IBZY 4F9PC 1CIUA 3MV8E 3DX9A 2XXCB 2HJFB 1UJTA 5IROA 5T1LD 2C1PB 2BXZA 4NJ9L 4NHUB 2WWMD 4PS4L 3GBLA 3VXRD 3KLAA 4XCCH 3NOIA 1XGRA 2Z91B 3HR6A 2AV1B 5KJRL 3C8KB 1IGIL 4X99A 4M62H 4X7FC 5LXGL 4D9QE 1NFIA 3VH8G 1KBGL 2OJEA 5T1MA 2YUXA 2DB8A 3NTCL 5J0BA 3T3ME 1EHAA 2XFXB 4UI2A 5B39G 1XGYL 3QCTL 4FG6C 4U3XA 3OG6B 1JV5A 5KN5A 2QSCL 5DJAA 1I8IB 1MPAL 3D25B 1TJHH 5E94B 2D03L 5E6ID 5I1LA 4L4VE 4NCC1 3HPLB 5B21A 3I6GB 5C08A 3KPQA 5JW3L 1MFAH 2X4PA 5DC0A 3FO0H 2Q20A 4KXZI 3KYNA 2WBJC 3L3JB 1XGUB 2AKRA 4MCZB 5I1AB 2R2CA 2ZUWA 1ZHKB 5GS2H 2AJVL 2F53D 1UA6L 2ERJB 2W0KA 1QKZL 1RJLB 4JE4B 2YKLL 5J57B 4UOW1 5FYJD 4FFZL 4EI6B 3DVGB 3NZ8B 1NC2D 4HLZG 3MPCA 2E6QA 5E8OB 4UNUA 4D9RE 3WSQL 3D18A 2PYEA 4DGIH 3PV6A 4PJDF 3WE6A 3GSRA 3KPQB 5T3XL 3TYGH 4IOFC 3O81A 3IB4A 3ROLB 4O5LH 3F8UB 4PP2A 4X98A 3BKCL 3V2AR 4QHUB 2D3VA 4M3KB 4DQOH 4MD5B 1NGWA 4CVZB 4KJPC 1N6UA 3HCVB 4RCAA 2PXYB 2XWBB 1K8IA 5JPNB 4K3EL 5CEZD 3DMMA 1XF4B 4R90L 3OZ9H 2J8UB 1OTUC 3QSKB 2FECL 1NBVL 5GGRY 4PRPA 5KVEH 4NC1E 2W59A 5C07D 4ORGB 3QQ4A 4YXHL 4U4BA 3O2VH 3FT2B 5CEXA 4GLRH 4FQIL 5T5FL 2VXSH 4ISVA 1GGBH 4XVSH 3QCTH 1AXSA 3F7RA 3QPQC 5J56B 5LAXB 1MCRA 4DK6A 1EO8H 3WUZA 1JPFA 5HGHB 5MEOA 3LQMA 4PUBL 2Q76A 3N50A 1MJ7L 4NQEB 3L5WA 2FZ3A 4OI9A 5HYQB 1JPSL 4L5FH 1V7NH 2YZ8A 5CSBA 4PJGE 4XCFH 4JFOA 5EWIL 2BHYA 3S36L 3WD5L 1JZ5A 2PYFB 5DMKA 2UUDK 1RK1B 4PB0L 4MAYA 4JRYE 1J1XH 4PJEB 4QRUB 1KT2B 5DJ8B 5DEZA 3AC0A 4LLUB 1D5BA 3SDYH 1B4JL 1MAJA 3H7LA 4M7LH 2NY1B 1JZ4A 2EECA 4KRLB 4X6DE 4FS0A 3TYFA 1TVBB 2EDEA 3GSNH 1Q72L 5E00A 1FDLH 3OKMA 1U92B 4CNIA 5EZIL 3WS3B 1CLYL 1P4IL 1YEHH 2R1YA 3ULVF 3QXAB 3V6OE 4TNVF 3E8UH 5I66B 2OLDA 2C3XA 3PWLB 4OAWA 1FO0L 3TO4A 1M7DA 3MCKB 5JUEL 1G7IA 4RGMC 5CZXD 1TQBC 1PG7L 4OTXL 1DSFH 5DMKB 3DROB 1MSPA 4AMKH 1HXMA 3VMOA 1ZHNB 2EDBA 4QF1A 3BRDA 3IU4H 5JXAH 1MVUB 4M7ZC 1HSBB 3ZHDA 1INDH 2DOCA 2OP4H 1A7OL 4WU7B 1SM3L 5CKAA 4R7DB 2ZUTA 1QLRB 3T1FB 3ZHLA 1CFTB 3IXAB 5I2IB 1J87A 3QUYA 5C0IB 1ACYL 4HG4J 2VN4A 3PHQB 5F7HA 3VFWA 5T3ZH 5E1AB 2Q6WB 5T3XE 1CE6A 4HC1L 4U0RB 4AEHH 1GZQA 2ICWI 3SO5A 4O51B 5HHQB 3HE7A 3RVWC 5BCAA 1QEWA 1B3JA 4H0IA 3FQNB 3QZWG 1PSKH 1M1SA 3O6ML 3QXDB 1KELH 4LAQL 1Z3GL 3DROA 1GGIL 5IVXA 1JMXA 4OT1H 1Y6KR 3GJFH 4M6NH 2P8MB 4P2OB 2FJFA 2P5WB 3MCKA 3EYVA 4FXGB 1KNOA 4Q6YA 2OTUA 1GIGH 4XVUC 3QNZA 3ROLA 4LHJB 5I19H 1J10A 3TV3H 3G6DL 3V5KA 5F72S 2C1OB 3FQRA 4ODHL 4S1DD 5F9AC 4XPHL 3T8XA 4QRTA 2VISB 4Y2DD 4H20L 2WP3O 4OQTH 4NQCD 1EX0A 2L4OA 5HGAA 4QHLB 3FHQA 3H9HA 1FL5B 4PRIA 5GGTH 5KS9B 4P2RB 1OSPH 2VDRH 1R3LB 1ZHKA 2DLFH 3R0MA 3HC0A 3FOMA 2EH7L 3HE7C 4P9HL 4HPYL 4QT5B 4WUUD 2DWDA 2FATL 5EO1A 3QUXD 4DN4H 5IJKA 1TJGL 2X70B 3RGVB 4WTZA 3RWFB 3MODH 1KSRA 3HC4L 2XN9A 2X4RA 4NO3B 4BQ8A 4PGDB 3KPLB 1WEJL 4LOUC 1JGVL 2F5AH 3CH1B 3BAEH 5J6GB 4X4ME 3TT1L 2XG5A 1P4LA 1CD0A 3BD4A 3VGEA 1O0VA 4UUJA 1AO7E 3OKEA 4NM8L 4JRYA 5IVXF 3ZZ1A 3GK8L 3TNNB 1J5OH 1IQWL 3C8KA 4QY8A 3BPNC 4I18C 2VDNL 3RVUD 1K8IB 3O6FC 2DL2A 3PDOA 3WLBA 1RAMA 1UJ3B 2XN9B 5F44A 5EC2A 1OLZA 1EUUA 5CZXC 3K2UH 3STLA 4G8FA 1U8JA 2XWJA 4C83B 1R3LA 5FYLH 1IGIH 4EKXA 1UM5L 4EQ3A 4UNVA 3VWJA 2Q3AA 1D5IH 1S7WA 4R96A 1SVCP 1AQKH 3BD3A 3KYOA 3ULUC 5IBLD 5FCUL 3RVXD 5EDXA 1N26A 1FZMB 3O4OC 4M6OL 1SYSB 2AEQH 3TBTA 1P84J 1NJ9A 2GY7B 1AIFA 4HIHB 2FRGP 3TFKC 5BMFL 4UUJB 3RWCA 1MRFL 1IT9L 1NDGB 2A83B 1E4WH 4H0HB 2YA2A 3B9KB 5L2KE 1UENA 2CDFB 2NTSP 3QDAA 1G6RB 2DICA 2YMXL 4QXTA 1FAIL 1FNHA 3SJVD 1QR4A 4KQ3L 3ZTJG 1ADQA 3WXVL 1NMAL 1Y18B 5EO9B 2XACC 1BQHB 4GJTB 2F54A 4ZPTA 1DE4A 2R23A 3MRFB 2MPAL 3EJJX 4ZXBB 2OYPA 4P0DA 1U8NB 4L3CB 5CJQH 1A02N 2FX9L 4KROB 4F7TA 4GBXB 4CMHB 5E99H 5D2LA 2NCMA 3LKQB 4U6YA 4XZUA 1CE6B 1HSAB 1T2QH 1CE1H 2HLAB 3CFCL 4P2OD 1QSEA 3W2DH 2G5BA 5CD5D 4KPHL 3CNKA 4NHUA 4PRHB 3FN9A 1QLEL 5FA4B 5CEYA 2YSSB 2LU4A 1T5WB 1LK2A 3GSNL 1CF8L 3U9PL 1OGTB 1IC7H 4OCLC 2L0DA 5DVKA 2JELL 4HKZB 2BNRB 5H37G 5DRXA 3QWOB 4ISVB 5E2TL 2Z31D 5AZ2H 5HGDA 3C9NB 1S9XB 1MAML 2UVEA 3N85L 3QFJB 3WJLA 1MRDL 5BXFA 4HIJA 3VI3E 3O2WH 4MXQC 3UYRL 1JF5A 1ZV5A 2O5XL 1JNHB 3DGGA 2FR4A 4PRPB 1F58H 1RIHL 1VEMA 5DD0H 2Y7QB 1U95B 4OZFA 1QACA 4P2QD 5DJDA 3SHSA 1EGJL 5MENE 4LLMB 2X40A 4P5MB 4XCFL 5TE7H 4KKCD 3BHBA 2DYPD 3BISA 3P73A 2ADFL 3WNPA 1KTDA 5I66A 5J6HB 5I30H 5FHAH 4JN1L 1MH5B 1R3KA 2DMBA 5GGVY 5T1KD 2V2XA 4I3GA 2DM3A 4XNZB 4Y5YB 3TWCL 3FQNA 5ADPL 1I8MA 2EIEA 2X70A 3FN0H 4WO4A 3BIAX 4LARL 1FQ9C 5KVDH 1PSKL 1MCPH 5ERWB 2VXUH 3SDAC 1WZKA 1YJDH 1S7TA 5F96H 4UIMB 5EZLA 1OARL 1DQJA 3FL7A 3PHSA 3P4MB 3SBWA 2X5PA 4N0UA 2WWKT 4PJDE 5C8JA 3MRLA 5IWLC 4F2MB 5FFLA 2A9NL 5ADOH 5M95B 1MRDH 4K2UL 3SJVA 3DRQB 2DMCA 2D9CA 3FQXB 1X5GA 4Q9RL 2HWZL 2W0FA 4ZPVA 3FB6B 4DCQA 1ZANH 4XPBL 4MSWA 2DJ4A 4ZUVB 4KKNA 3VRJA 4UBDC 3UXFA 5IB1A 1SJXA 3BE1H 1ZS8B 3E3QE 3GRWA 4F9LC 4JQXC 4XB8A 3I9GH 1MCWW 1I3VA 4GFTB 4LDEB 2HTKD 3M45A 3IDIB 3OTTA 3SGJC 4RAUB 1CDYA 1DBBL 3LS5L 1CYGA 3PDGA 5D7LD 2K7PA 4HIEB 2OXHA 2IMNA 3WIFB 1OWWA 1ZA6B 4KQ3H 2NY0B 3ARFC 3SQBA 1G7QB 2P47B 4MD5A 4ZS6C 3DUUA 1A9EB 1B4JH 4JKMA 1CLOL 5DFVC 3IGAA 4NP4L 3IDMA 1SJHA 4I0PB 1K5NA 2BSED 4IM8A 4N5ED 4M5YH 1T6WA 4J4PD 1UXSA 3V4UH 2VXTH 1LEIB 1E4KC 4UNTA 2GJ6E 4P59L 4QF1B 4BFIA 1NCAH 2EDQA 4LSPL 4WFHE 1S9WA 5I1EH 4JPKL 4HXAH 1UKTA 3MLPA 3IVKA 1WC7A 2R0WL 4NRYB 4PRAB 1XAUA 2AV7B 2B1HH 3HZKA 4R8WH 2AI0L 4HZAA 1JWMB 4ZS7H 2R1YB 3RFZC 1JYXA 1T03L 3GO1L 3I6LE 5IMOB 5HI5D 4BZ1L 2WZPD 5E8DL 2P46B 4RMRA 3HI6H 3SKOB 3ARFA 1LK2B 3UPRB 2J8UF 3O8XD 3OJDB 1XR9B 1KB5H 1XIWB 4H25B 3EYUH 1S7VA 3V6BR 3FQTB 2ORBH 3MCLL 3K1KC 5ICYB 3HZKB 5JLZB 1MCJA 3QUZC 1KGCE 3OXSA 4EI5B 3D18B 1DVFB 1P9MC 1URLA 4DTGH 4L3AA 4FZEL 4I2XE 5CEYB 5DEGA 2FIKB 2P43B 1KFAL 1AQDA 2GJJA 4C56D 2YD7A 2DM7A 4JAMB 5DWUH 3VWKC 2ZUUA 3CUPB 5HJ3A 4OQTA 1RUKH 3BDYL 3DETD 1EEYB 3LSOA 1AGEA 3W0WD 4HQQL 2OSLA 2WAHA 4FXKA 1U8NA 3V0VB 1W72H 3PP4H 4G3YL 1NCBH 2GTZB 1WSST 5DHVA 4K2UH 5FUOL 2AJSH 1S7TB 1XT5A 3KS0H 4BZYA 4QYOB 1J05A 1O7SA 4LCCC 1FCCA 1OAQH 5DJZA 3HG1B 4LIQH 5C0GA 1I1FA 1X4ZA 5L9DL 5FGBC 4WFGD 4D9RD 5F9OL 1KJ2B 3S35H 5JIPA 4KTEL 4PGBB 3CUPA 5HJ3B 1SYSA 1UWGH 4WWKC 5LXGH 43C9B 3ZYJA 2I5YL 2QSVA 1OSZB 4L3EB 4NNXB 3RX7A 3ULUD 3NZ8A 1IC5L 2JLLA 3Q1SH 4HKJB 4K71B 5E8NB 3NN8A 4PGEB 4R26L 4HMCA 4Z9KB 3CC5A 3X11A 2D9QB 3LKPA 3UYRH 3G9AB 3NH7H 1MQKH 4P23C 1FE8H 2CK0L 3X3GH 1BF2A 2AW2A 3VG9B 5IB2A 5EOCH 1KPVA 1JHTB 1E6OH 2BRRL 4PRID 1NGPL 1WFUA 4G8IA 1ZWIB 1UG9A 4HCRL 4QTHB 5F88A 5E8EB 4C4KO 4YHML 5L88L 2EO1A 4P57A 3S34L 3ZTJH 1E27B 1YMMD 1HYSC 4U33A 1DR9A 3D25A 5HGBB 2Z31B 3CCHB 4KKAD 4JZJB 3C5SA 4RSVA 4JFDA 1TJIL 5DQ9A 5D1XC 4GXUM 2KDGA 1Z9MA 3SE3A 2DWDB 2MPAH 3FB7B 3UTTB 1OCWL 1MRCH 4KK8D 1KG0A 1DSFL 5I8CA 1RZJL 3PWNB 3DXAD 2DD8L 4P5TC 2I60L 3V4VL 3GKWL 4TRPL 3OR7A 1GOHA 3H2WA 3KPLA 1OAXH 1BREA 4PJ8D 4K94C 4EI6A 5GGVL 1NCCH 1A1MB 4MX7B 4UT9L 1IL1A 3BKYH 4PJGF 1ADQH 4RFNB 4JFXB 3AS0A 2LU7A 3O4LD 4RFOH 5C71A 3FQUA 1A9EA 3BRFA 1Q0YH 5I17A 3PE9A 2VXQH 5INDA 1P6AB 2ADJA 3UTTA 4WI8A 5C9JB 1CDCA 4X4XB 4JFPA 2LAGB 4MNHB 5I1KH 3WD5H 2O5YL 2H32B 3MV9E 1X5XA 1VFOA 3PF2A 1JNJA 4L9LC 5TQ0H 2NZ9D 1JBJA 5FYLL 5CHNB 5C0CA 5I75C 3IDJA 3JXAA 2MWCA 4XPGL 5D72H 3MLWH 4WEBH 4OI8A 2P7TA 3MV01 1KC5H 2H26A 3BGFC 1FNEB 3KYKH 3VRIA 3RKPA 2NNAA 4CKVX 3B9VA 4LGPB 3W9DA 4N1EA 5IVNA 2QQLH 2AK1H 3BFOA 1DUZB 2WUCH 5JORA 4NO0D 3MLSL 1OAQL 1CDIA 4BQBA 4XMLH 3UJIH 3QCVL 5B3NA 3OAYH 3ZE1E 1IGFH 1VFBA 3S3PA 4RRPA 3QQ9D 4DGVL 3GB7B 5DZOA 4PRHA 5F93C 4P2QE 2Q1EA 3PHQA 5BOZG 4XNYH 3FT3B 4U1LB 2VH5L 4N8VA 4I13B 5IFAL 3BDYH 2WBJD 4KHTL 2F54B 1GL4B 3SGJA 3QUZA 3QJFB 1IJ9A 5DFWH 1U58A 4OV5B 2CMRL 3QAZC 3UBXG 5E08L 3N06B 3O6LL 4NPYB 4LLMA 4P5MA 4IRZL 4PGEA 2QKIB 4K3HA 5E5UB 3IDXL 3WMSA 4NM4L 5GRXG 4UAOC 1RD6A 4MCZA 4P2YA 1BAFL 3DXAB 1UA6H 2ZG2A 5I6XB 4I3RH 2XY2A 3IDGB 3E0GA 3FMGL 1U8LB 4M43L 1VFMA 1ZSDA 3T0EA 3IFNH 1XF1A 3MRBA 2WM0A 3QNYB 1HHIB 2J6EA 4DKFL 5D1XD 4Y4FC 3CVHB 1EXUA 1FL6A 2PYED 2D31A 3TBVA 3VXTA 5J1TC 5MHSE 1I1FB 1KT2A 1A6TA 1TETH 3TLRA 4ZFZB 3B9DA 3QI9A 1XGYH 5KG9B 1NAKH 1VEOA 4XRCA 4D0BA 4NYLA 3L1OL 1DBML 1K2DA 3PGDB 4N0CC 1LE9A 2R0WH 2LTQB 4J3OC 2JTDA 4WEBL 4PJIA 1JF1A 3DOSA 25C8H 3JTSB 4HH9A 3O3DA 4TSAH 5GRUL 2VDLH 4O2CA 4QWWD 4F8QA 4Y5VC 1LO4L 2P5ED 4ZAKB 4OCYL 1A7QH 4RAVB 3V4UL 5I71C 1KJ3H 3MFFA 3B9KA 4CDHA 2ESVD 4PR5A 5FHBL 1EEUA 1QRND 1C08B 4JKWA 1W2KT 4XVJL 3TIEA 5JHDE 1YJDC 1QHPA 5EBLA 1KNOB 3F5WB 3BIBX 1A7OH 3NVQA 1NDMB 1MCOL 4M7KL 1ADQL 1FHGA 3HA0A 3H9SA 4YDJA 5DTFB 4XNMB 1QQDB 1AFVL 1L0XA 2B5IB 2F19L 3B9EA 1VESA 1OP3H 3U30B 5ISZB 3VW3H 2DD8H 4BZ2L 4F8TA 1IGCH 1NPUA 1KB9K 3IXTA 1AE6L 3HG1D 5GGVH 3LIZH 1YYMH 4JM2B 3TEUA 2ZOKA 3NABL 12E8L 3FQWB 4NPYA 4QRQA 3MV7E 4OLVL 2DI7A 5FCSH 1G9EA 2AXFB 4H1LH 2J5LC 5C7XL 1G6RL 1T22A 4MGXA 2BFVH 2MCG1 3L3DA 3LY6A 2BOCB 2IAMC 1G9NH 4GRWE 5GRZA 3LKNA 3ZL4L 4DZ8B 3NIDE 2OJZL 2WINB 5IQ7L 1PDKA 5CP3A 3BEWA 4XVJH 1MHPL 1FE8L 1T0MB 4X6EB 3WFDH 4LFHD 2E7CA 4HIEA 1N7MH 4LPTA 1AGFB 2JF1A 3VWJD 1RZ8A 3SJVE 5T1MB 1CD8A 4ZO7A 4OCXH 1Z9SA 1AP2B 1FSKB 3ARXA 5C86A 5FGBA 3FRUA 3NZHL 5DRNB 4L8BB 5F1IA 5HHOA 5J9PB 1LD9B 5DHVH 8CGTA 1G7PB 3O2DA 4KTEH 4I77H 5E6IA 3FN0L 3S98A 2VITA 4RGOL 5EPMA 1K6QH 3CPLA 4HS3A 4FZ8H 1MCFA 5KSBF 4FQCH 3RVWD 4BH8B 3WXWH 4HUWA 2GJ6B 3DVNB 3HC0B 1SBSH 1YY8B 1FYTB 3HUJF 5D96C 1ORSA 1MAKA 1INQA 4YEEA 4HBQA 1F58L 1RIHH 1LP9B 3LDBC 1XF3A 5DD0L 5EPMB 3TJEL 3VFMB 5E1AA 3O2WL 3DGCR 4X98B 1UB6A 1ZEAL 2PUQT 4KJQC 3U36A 4A2MA 5J7CC 1TQCB 4M02A 2DQJH 2PW2B 3FRUB 5DRNA 3ULUF 3AB0C 4M9PA 3PV6B 1Q8MA 3ARTA 4NCC2 1CFQA 3SDDC 3B3IB 5DRZB 3ZYZA 2E9JA 4N0YH 3MNWB 1KIRA 5D1XA 3VXNB 1QZ1A 2X42A 1NLBL 3JTTB 5C3TA 3VXRB 5I16B 3KR3L 3RQ3A 4RGND 4TSCL 4XPAH 4N5UA 2H6PA 4P5TA 3MFGB 4HT1L 3SDXF 5DWUL 5J11B 3UTTE 3EO9H 4EUPA 2VDMH 4KDVA 3L3OA 1VADB 4Z95H 2ARWA 2ENYA 5T33L 1LMKA 3PL6C 2R2EA 3QIUC 4YGVA 3SKMB 4KV5F 4JRWA 3BJ91 5D7JC 2XNAB 4MDJA 3FO0L 4Y4KB 4XAWH 4KI5F 2EDWA 4KMTL 5D70H 1NCDH 1LO0H 3AY4A 2VLME 2VC2H 1XZ0A 1ZT1B 1HZHH 4H8WC 5HYEA 1IBGL 4X0KB 1WWBX 1KXVC 4IRSD 5HYQA 4HW6A 2ZUSA 5IB2B 2EDRA 5JIIA 2IFGA 1X5JA 3KXFD 1OAYH 5FV1L 3CSPA 4QHNB 3D48R 4KUZL 2AS5M 4WTXA 3HAEG 3MOBH 4M61B 1TDQA 5EU6B 4IJ3B 1WAAF 2R29L 3HKFA 3IDNA 4XI5C 1KEGL 5M7QA 2KQNA 3CSYB 1R5IB 3L3IB 4QCIA 4Z7OF 1BQSA 2CKBH 4OSUL 3VRLF 5C0AB 4PRPE 5SWQB 5DJYA 1UEYA 3QFJE 1N6QL 3HE6D 1GGCL 3RHWF 5DR5H 4OJFH 1WT5C 3RAJL 5JPNA 2VLLB 1OTSD 1QLFB 3SOBH 4B7IA 1NCDL 5CHNA 3CZFA 3QXUA 4G80B 1BZ9A 4PJBA 4AEEA 3S37X 1FJ1A 1FO0A 5TGBB 4PJEE 1BQLL 5DURB 2DBJA 2PW1B 3OKOB 4RAHA 4LPXA 1MWAH 1BOYA 2XA8H 5HVFB 1ZTXL 2P5EE 4JFEE 4OIIH 1H8OA 2DDQH 2IALB 5DMYA 5EC2B 4JFXA 3DX6B 1P53A 1J0KA 1AIFB 3BEVB 5CSZB 4ZAKD 3LRHA 2R0LL 4D8PB 2FATH 1FVCB 5DA0B 3TBTB 1FZMA 4ZSOE 1Z6JT 2E9WA 5C2BL 4LLYB 5I1HL 1PQZB 5DA4A 1JGDA 3RKDD 1CDJA 1LO5A 3PXJA 4XPFL 4GMTL 4LVEA 3IJYA 3L3KB 4UB0H 3CFKB 1K4CA 2IADA 5BW7A 1JI2A 1WLHA 2ZPKH 3KWWA 4H88H 5IVZB 5F7NC 3REVB 5IUSA 1D5ZB 4G42A 1A1NB 1M05A 4JFEA 3GNMH 4KWUA 3CLEH 5KN5B 1TZIA 2A1WH 1UFUA 1D6EB 3EYOA 3EDDA 5HI4C 4LU5H 2BRQA 3HR5A 1RJZA 2VZ1A 5D4QA 4OF8A 5E8PA 3VFSA 1SBSL 4JZOB 5GXBB 2AJZA 2XI9A 4JN1H 3GBNH 4E41D 5HD8C 5KS9A 5KSAA 1AKJB 1Y6NR 4ZTPL 4OT1L 5EUOB 3W0WE 2LU3A 2WANA 1BMGA 3QT2A 3QJHB 5FM5O 1H8NA 4X6CF 5BQ7A 1ERNA 2C3HA 5FO9B 2MQ0A 1FNEA 3P0GB 5K9KB 4UTAL 1WC7B 4NRYA 2ADFH 4X83A 3S4SB 3S8WA 3Q5YA 1IM9B 1QLFA 4IIQA 4D8PA 5L2KB 5D1ZB 1X5YA 2E3VA 2JB5L 3RP1A 3TIDA 1BBJB 4M8QB 1RUPH 4KVNH 2HT2D 4GMSH 43C9A 2GYSA 4HJGA 4ZXBC 4OD1L 4CMMA 3CDGA 3VDBA 1WCBB 1FVEA 2VR5A 2NY0C 4V1DA 3TIDB 1E6JL 3WEXA 1P7QD 4HWNA 1FLTX 2APBA 4NN6B 3BVNB 4WW2C 4Y5XA 5C7XH 3SEPA 1OGAD 1BM3H 4G6JL 3GMOA 3ALWA 1RURH 4X6FA 5E2UH 1AGCB 1KFAH 2WQ8A 2X4OA 4LRIA 4NQVB 4H26A 4TOYL 5GS1A 2H2PD 3U9UB 4LVNC 2B2XH 3DHMA 2BVPA 2R1WB 5F7MC 4KAQL 3MRKB 2OTUB 1X6NA 4W81A 2EDYA 2PR4L 4JQIH 1AFVH 1LEKA 2IAMA 3RA7L 3RZWA 4X8XA 4JRXA 1DBJL 5E1HB 4HMEA 3SOBL 3LRGA 4OM0L 2X4UA 4F33B 3U0TA 3PDDA 3MBED 4QHNA 4ZUVA 3O0RL 3NCJH 4JREC 5C0JB 4FQXC 3FB8A 1QRNB 2DKSA 1UJ3C 1F11B 1J1XL 1BQHG 5E8DH 1KCRH 4XNUL 4MQXC 4Q9CA 3KYAA 2X4SB 4NQSA 4XMKH 3F7YA 5ESAB 3J8F7 1IM3A 1IAIL 3UBXA 1HN1A 1JGLL 5HHQA 2NW2A 5ITFB 4FQLH 5KAQG 1S9KC 1BX2B 1IAKA 3RPKA 1F90H 1KUMA 1HDMB 4RMTA 2H8PB 3NFNA 5CGYD 4Z7UE 3U0TB 3TYFB 1KLGA 2EE2A 2YXMA 4X9HA 1GGBL 1ROWA 2OMBA 3CFBA 5ID1B 2FDBP 1DVFC 1UH2A 4F58H 4MQ7A 1QHOA 5A2KH 4WV1B 1JNLL 2D4FA 5IB5A 4X6DF 3O2DH 5CLTA 2MSPA 4WGWB 3TBWB 4PV9B 4OLYL 2JCCB 4G6KH 3FAWA 3VXSA 4KRPC 1YPZA 4N90E 1A2YA 4AIXA 1BAFH 4FQXD 4LP5A 3JSSA 4OGYH 3GFUA 3C9NA 2EDJA 3OAUL 4QXUL 4F37K 5CWSA 4ZYKB 1IFHL 2ADGA 3FFCA 5ID0B 2B2XL 4GW4B 4QYOA 4X9BA 2JE8A 3JV4B 4DN4L 5FA4A 1LP9F 5BS0A 5TDPA 2R0KH 3SE8H 3C8HA 1MNUL 3QQ3A 4ETQB 5C08D 3BP5B 1FRGH 5FB8A 3P0VH 1UGNA 1Q38A 3TO2A 4WTWA 4Q97A 3VXSB 2YPKA 1YNTB 3GBMH 1CDBA 1Q9OA 4MNGE 5K9KA 4HPYH 2HVJB 4RGNB 4XGZB 3CK0H 2R1XA 3LMJL 2V17H 1WICA 4JANA 5SX5K 1A1OA 3LPGA 4MXVF 3AREB 3PNWA 3ZKND 2I9TA 3L7FB 1PZ5B 4Y2OA 1QP1A 4HLZH 1AKJA 1JP5A 1MWAB 3WFBL 5JW3H 1L7IL 3QULB 5HHME 4EUPH 5JHLL 4MYWB 3QQ4B 5EC1B 1YJDL 2QQKH 3F7QA 2WIIB 3HNVL 3VG9C 1MCPL 4JM2F 4PREA 5TF1H 2D0GA 4ZUTA 2W0FB 4ZPVB 5DJ2B 5TFSL 4PJBE 1WVZA 3RI5K 4YK4B 3O6MH 3KXFE 3L5XL 2H32H 4G9FB 2CJUH 2A77L 1ND0B 2AK4B 4G6MH 2VNCA 1VDGA 3FO1B 4L1HA 3OF6D 3L7FA 3VXRE 5IBUB 2ZSWB 1Z3GH 4YBLB 5I1KL 3EIFA 1EHNA 2NTFB 4JPIA 5I1CL 1X4YA 4MD0B 4P9ML 1F4WL 4NZRL 5SX5H 2JCCF 2PXYC 3TVMB 5DZLA 1U2CA 4GQ9L 4M00A 3IJHB 5IGXH 5LGHL 2XRAL 4M3JA 3UTSB 1NFKA 1INDL 5E24E 3O6KL 4UILH 3P30L 1UKSA 5HVHC 1DBJH 4GAYB 4TTDD 5JIKA 5LWYH 3W5NA 3NAAH 4Y19D 5C07B 5B3JE 5EG6C 1INQB 2B8OT 3ARGD 1BD2B 3IDUA 2DQEL 1FYTA 4NZUL 4PJAE 1CLZL 3D2UD 3QXVA 3O4LA 2IEPA 1BZQK 4I2XB 3VWKD 4EN3B 1MI5D 2VDPH 3JWDH 4RIRA 2E7LA 3QHFL 3KYNB 4NQUA 4XCYB 2QSQA 1H9VA 4X7TA 2E8ZA 1IARB 2BNRA 1MCIA 4NUGL 3GGWA 4C58B 5FGCB 3G9VA 2R9HD 4YHYC 4JFFA 1E4XI 4UMGA 5BO1L 4QHKI 1F4XH 1ZT4B 4KK5D 5F8QC 1W8OA 2ZCKH 2DN7A 3MGAA 3W0WA 3IJYB 1EERB 5BZDA 4FP8L 1JFQH 4Z7VB 1R3HA 1IAOA 1N0LA 5EA0H 3SCMB 5EU6A 1A3LH 4GS7C 2WQRA 1FN4B 1OGAE 4Z7OE 5IMMB 1GGCH 1TTGA 3BGFB 4GUPB 1FVDA 3L95A 4NQDE 4P48A 5I76B 3NFNB 2ZUXA 4L4TD 3KHQA 43CAB 2VDLL 3MGOB 4Z7WE 3V4PH 5FKPB 5SV3A 5BVPH 2YBRA 3FCTB 1L0QA 1IC5H 2ID5A 2R29H 1KEGH 2WBJB 2YPLE 3EKCA 1FGVL 4XVSL 1EV2E 3ULSB 4J3VA 3C60D 1VKXB 4N0UB 1U8OA 3K8KA 4YWGH 2A2QT 4S1QL 3G5ZA 4UINH 1FO0B 5TGBA 4WHYH 4C57C 2P5EB 4I5BA 5FM4A 1HH6B 1MCNA 3S7GA 1M05B 1A22B 4YAQB 3B8YA 3O45B 2EEAA 4YHKH 2I26N 3S88L 1FH5L 4HAFA 4QRRA 1MREL 4KMQA 2EE9A 3WBDA 1BHGA 5IMKB 3LKSB 5EBMB 3HAEH 1I4FA 1L7IH 4TVPD 2BOBA 4YHZH 5DD1H 4RDQF 2GY5A 1KCSH 4HK3J 4KI5C 3L3IA 4ONHA 5EFIA 3U46A 4JO4H 3LAFA 3MRGB 4JJ5A 2PNDA 3VXNA 1CXHA 2ZP0T 1ES0A 2JIXA 4OZHA 4PJCE 3QUYB 1T1YB 1VFAB 4MQTB 3IDJB 5I76A 2CGRH 1RMFL 2DRUA 3GBML 4HQQH 2VDML 5DDHA 3MROB 1CDHA 3RL1B 4H5SB 5DRXB 4R97B 2YUWA 4JFPB 3ARED 2DJSA 4PJ8C 1T20A 4LQ1A 3JV4A 4QTIL 1CQYA 2W07A 4XH2A 3LEVL 1KJ2H 4XNXL 4IDLA 3EW3B 5TH2A 1JRHL 1HSAA 3RHWK 2DQFA 4HULB 1U8HB 2NXZC 4APQC 1KCSL 4LP4A 1F6FB 4Q6IC 3CVHA 1MFAL 5BRZB 2DQJL 4YXLH 5SWZE 1ZOXA 5I0ZA 4L9LB 4HV8A 2O93L 5LGJB 2JB6A 1U36A 5EUKA 3K4ZA 5TH2B 3JV0A 4NJAH 4WW1B 1SJEA 1VADA 2I27N 4Z5RB 2BSRA 2VUOA 5CIPB 2CH8A 4WCYH 1W72B 5MI0B 2WBJA 5HDLA 4P2RA 1QFWM 1OAUH 5I74C 2PTTB 4GAYA 2HH0L 3RZCC 3D87B 1K4DA 1PEZA 3CLFH 1T1YA 3WIIL 5CGYC 4NKMA 1OP5K 1IAKB 3C5SB 4Y8AA 1FFOB 4J8RA 3MMEA 3UBXI 4JFEB 4FNLL 3NCYP 2EXYD 3UTPE 4R4NC 3BZFB 3RIFK 4YDLC 2WUBH 1S9YA 1U91A 5KTEH 4PRIE 4E42B 4JFZL 1JGLH 4P59H 1CXIA 4K3GA 5DK2B 2WW8A 4HX1A 3QEQD 3REWB 3VWJC 4P2OA 5B39B 4ELMF 2VN7A 1T7XA 3LOWA 4HGWB 1MJJA 3SQOL 3VH8B 4HXBH 1UADC 1NCUA 4H25A 4Q58C 3QIWA 1YEJH 3TN0B 3CX5K 4KJYA 1G9NL 5M94B 5ACLA 5AYUL 4RDQG 1H0DB 1YNLL 3ALXA 1TENA 2Y06L 3GI8H 3D39B 1FPTL 1CT8B 3MZTA 3HMXA 5ACZA 5IJVB 4GO6B 3T77B 2D7QA 3IFOB 1GGYA 3MRQA 4TSCH 2OR8A 4TPRH 5JTWA 4CW1B 2F58H 3V7AE 1Z0MA 4XI5D 1I85C 1GC1H 3T1FA 3HZVA 3OKNA 1YEHL 4Y4FB 2DKMA 1EFXA 3NAAL 4XP9H 5D7IE 2PYEB 5EORL 4H1LG 5DMIH 4HUVB 3QHZH 2ZG1A 5SWQA 2HRPH 4S1RL 4OLUL 4LVOB 4ODWA 5E5MB 1BLNB 3F62A 4U1MA 1FLRL 4YHIB 4LLQB 4RA0C 3Q6GL 4DVRH 4P2OC 4NZRH 5DJ6B 4D94A 4KJWC 2AK4A 1A6VL 3AM8A 4OCWL 3F65A 2BSSB 2PO6A 3IU3A 5HYJE 2I07B 3CPLB 2YWZA 1CK0H 5F3BA 2XQYK 4JQVA 4PRBB 4UTAH 3H7BA 3KJ4B 4U1HB 3THMH 3WJLC 2JIXD 1I8IA 2NXYC 5C0RH 4F3FA 3LD8B 1PGRB 1R5WA 1U0QA 4JRXE 4GBXC 4CMHC 3ES6A 1M71A 3O2VL 1TTUA 3UTSA 1CGTA 1HKLH 3RPIB 3CU1A 4BA8A 3TJHC 4F3FB 1TFHA 4K7PL 4WI2A 5GS0D 1EIBA 1AO7A 4LCUA 2A1WL 4WHCA 2MCPH 1AQDB 5D7SH 3CJJA 4HAGA 1H0DA 2HG5B 1HHJB 2CRZA 4KTDL 3SGKC 1T2XA 5AUMA 5FB8B 3E6HB 4NNPL 3ZL4H 1W72L 1YQVH 2EZ0D 1OAKL 2WNGA 4NM4H 5GRVK 4O9HH 5KW9H 2BJML 3K1DA 5DJCA 4Y16A 1I9RH 3MOAL 3O6LH 5TE6H 1NBZB 2SEBB 1WTGT 3DI2B 4IS6B 3MCG1 4ZYKA 5ID0A 4K07A 3SDCD 2HFGL 1KN4H 3LN4B 1Y6MR 5GS0L 4AQ1B 4PJ8B 3SN6N 4DGIL 2DLIA 4I18B 1ZLVK 4WJ5B 1OP9A 5EU4A 1RUML 4UU9B 1A2YB 5C6WH 3HCVA 2GITB 1U3HA 5DHYA 3QULA 3V6ZA 4CVUA 5IG7A 4LHUB 3FO9A 1LEKB 3ZE1F 3MRIA 3U7AA 3WL9A 5EBLB 3FT4A 1UB6B 4MAUH 2BNQD 1MCOH 1QPPA 5GRJL 2OR9L 1SEBA 4QOKB 1EK3A 3GMPA 3QCVH 1AR2A 4Z0XA 3M8OH 1DQQB 4ZFOB 4AIZB 4YZFF 3BN9C 2X7LA 3HI1A 5E8OA 5BOPA 2EYTA 2H3NB 2YD6A 3JV6A 1R24B 2R2HB 4ETQA 3SGKA 2CRYA 1NEZA 4HGMA 4FFVC 2P5WE 1A7PH 5F1NA 3VXOB 1KCVH 4L4TE 1T5WA 4TSAL 4KKCC 3VFPB 3FT3A 2N4IA 1CD1A 1F90L 2FEEL 4HX1B 4P3DB 5HHPB 1ZLVH 3U4AA 4BQ9A 1HIML 1CZ8L 2FSEA 4JGJA 4NKOA 3P4NB 1DBMH 2D7MA 4LSPH 5C09A 4X4YA 4UQ2A 1HK6A 3HNSL 5EOTB 5KVFH 2APXA 4IMLB 3T09A 4WW2F 5IB3B 3MMEB 3MRBB 4Y4HB 1VACA 1EFXB 1KCRL 1T1ZA 5D7IA 1PX4A 5JOFB 4S1SL 2DLEA 5GS0C 4BH7B 4RAUA 1NMCB 1BIHA 1I1AD 4LDOB 2BVPB 2AEPL 3PWNA 4L1DA 2N56A 3T77A 2OS7A 4NFCA 4PJ5B 2BSRB 4PLKD 2FH8A 4LCWA 2ITCA 4PV8A 5J06A 2IQ9L 3UJTH 2FCBA 3PL6B 5MERB 3R8BB 3O6FD 4HJJH 3ULUH 3LEVH 2GITA 3V6ZB 4MNQB 1JPGA 2J4WL 5GS0H 4N8VB 1WEJH 1LO3H 5ISZA 1MUJB 3QEQE 3WEXB 2VLJD 5L0QB 1RURL 1DCLA 3EO9L 2BNQA 2UWEF 1PG7W 5IF0A 3T2PA 4C55A 4XTRC 5K9QI 1HHGB 3OJMB 5IMLA 1NAMA 2DI8A 3MREB 4DK3A 3TIEB 2XZZA 5B8CB 5D1QB 1YN6A 3H42L 5HGGS 5D5ME 4FA8A 3OPZH 2YPVL 1ED3A 4N8PA 2VQ1B 1IGFL 3QA3B 5KSVA 3RBGA 2R1WA 4PP1D 3BN3B 4XXCA 4K7PH 1XF2B 1LQSR 4GUPA 4LF3B 1FZJA 2CK0H 4HWEL 4NQEE 1KJ2A 1LEGB 4RFEB 1WBYB 5EBMA 1VGEL 5IMKA 1A6TB 3MXWH 1MFBH 4K94H 1F6AA 1X9QA 1EO5A 2DMKA 3MLZL 4S10A 2D31B 3TBVB 2N7AA 1YN7A 1T21B 3GSOB 3HTLX 4L9LA 3HPLA 1KOAA 2X1PA 3V7MA 2O61A 3H7BB 3KXFB 3GSVA 1ORQA 1RVFH 4EIZC 4NQXB 4I77L 2AJUH 5DRWA 3VJ6A 4OCWH 4I48A 4JY4B 3MV8A 4EDXB 5F89A 1F6AB 3JWOL 1K4CB 3MJ9L 1NGXB 4KK5C 4PJXB 4GRWF 3PJSB 4GBXA 3N85H 3OF6A 3GSQA 1LEGA 3BSZL 1OLLA 1YC8A 1JZ2A 4TTGA 3UC0L 1U8PB 1CQKA 2OTWB 1N7ML 1X5HA 3BEWB 1ITBB 4LCCB 4KJPD 1VPOH 4HUUA 4LKXA 2CPCA 3RVVC 3SDDB 3FONB 4YO0A 2MOVA 4AJ0A 4NT6A 4RWHA 5TQ2H 1LDSA 3JWNC 5EU5A 2P24A 3MACL 1UB5A 4IRJA 4NKIL 3QUZD 3G6JF 1H15A 3SE4C 1QG3A 2H9GA 4RZCA 4JREB 1I4FB 5TJWK 1MHCA 3ZSTA 3E3QC 1ETZB 4JGMA 5T3ZE 2XA8L 4D9QD 1T1XA 5EZOH 1S78C 4YNYA 2UUDH 2DQDL 4JEGB 5E2WH 5AYUH 2EDHA 2GIYA 1NGYB 1KGCD 2Y4SA 3IRPX 4Z7NF 5ESVA 1CFSB 5GGSY 2EDFA 5E7FA 5ANMA 2QADB 1XR8A 1WF5A 2YRZA 4G8GB 4JKLA 3MA7B 1DLFH 4CU7A 1QA9A 3B2UD 1N59A 4HF5L 3P40A 4HUMB 2BRRH 1XF5A 5KS9F 5EU5B 4H0GA 3G6JE 3E6HA 4J2XA 4O4YH 3SKNA 1YY9D 1TTFA 2Q87A 1EAPB 5BRZE 4JZJC 1YEFL 4PJGB 1JN6A 5F7FA 3OX8B 4XC3H 1BFSA 4WUUA 4DW2H 4LRNH 3SDXE 4K55A 2GFBA 5CGTA 3P4OA 5F7DA 1NAKL 1INEL 1CICD 1REIA 2K7QA 1KF9B 2J88H 3ARFD 1A7PL 3CH1A 1TETL 1NBYA 1X5LA 4JM2D 5GSVB 4WO4D 5C3LD 4MX7A 1ZT7A 3IFPB 2E9IA 3WS3A 1L6XA 4G8GD 5J89A 1FG2A 3OKLA 2YD8A 5KSUB 2E27H 5IESL 4JFFE 1DQQA 3N0PB 4NOFA 4PY7B 4FXGA 3UTZA 4HIIA 4KKBD 1TPXB 2IBBA 1BVLA 3MV9D 1RPQA 4IMKC 2CD0A 3U7YH 3GJFK 3EO0B 3MODL 2VZVA 5E08H 3AROA 1KCKA 4TVPH 2W1NA 3PP3H 3VDAA 3T0DA 4J4PA 1RUMH 4XPAL 5A3ID 4WI5A 1Q9OB 4KROD 2ICEA 3HE6A 5FYKU 1E4XH 5B8CC 4O51A 3FZUC 4P4KC 1GZQB 2C3VB 2CLVB 3K81A 3NCMA 5IEKB 3JBG7 4EXPX 5HYJB 4O9HL 1EUTA 1MJ8H 5D2NB 4XBPA 3D0VB 3VI4F 5DD1L 5ACZB 1QKZH 3QG6B 3QO0A 3OJDA 4OQTL 5IOPB 3CU7A 2W9DL 3TCLB 1UM4H 2ORBL 3SKMA 4LK4A 3D0LA 5D7KD 2CR6A 5GZOD 2PN5A 3EHBD 3J7HA 5IESH 5I19L 1UCBL 3QR2A 2J8UA 4OB5L 4JRYB 5IQ9B 1ZKAA 3M17B 2B5IC 5FYLD 4PRNA 3PHOA 1A0QH 3ORJA 1B2WL 3TBWA 3GIZL 1T0NA 1MPAH 4EXKA 2R0ZL 1AO7B 2Y36H 3GHEL 3P0YH 5KVFL 4M6AA 3TO4B 4XCEA 1T5XA 4EN3D 4JHZA 4BYHA 3B83A 4IRJD 5HVHB 1CFTA 3IXAA 2J6EH 3CFBB 4HWUA 3MLWL 4LRNL 5EUOE 2Z35A 5L6YH 1RIVH 1R5WB 2R1XB 2HA1A 5GS3A 3V5HB 1IEAA 1MVUA 4GRMA 4X4XA 5IB3A 5C9JA 4PS4H 2IMMA 1ZLSH 4LLDA 3DX8B 3C6LA 3RIFF 4DAGL 1K4DB 3LH2L 2APFA 3OB0K 1IKFH 3E6FA 1U3JA 1AGDA 4GSDH 1I7RA 2BVQB 3MV9A 4OGXH 3KS0J 1CLCA 4PYHA 4Y16D 1I1AB 1IM3B 2FL5B 3RNKA 1Q0YL 1XGTA 4PJIF 1HH9A 1A9BB 1S7UA 3GZKA 2YD2A 4E41A 4OM0H 2HRPL 4S1RH 4WWID 1YEDA 2ADGB 5JXAL 5DUBA 4NNYA 4G5ZL 4GKNB 5E00B 1F3DH 4D0DB 1V3LA 4WW2B 1EAPA 3BYTA 4X7DC 5I1LB 2EE3A 1L6ZA 2F58L 4LGRB 2DTSA 3QWRD 3VXUB 4AM0A 3S4SA 5CJQL 2H45A 3ZLQC 3CDFA 4YHOL 5DEFA 1DBAH 5B38G 2W91A 4P3CL 4OZIF 2ED7A 3HI5L 3VFRA 1FDLL 2AXGB 5ICZB 3CXDH 1RHHB 1I3GH 1GXEA 1EFQA 3DRQA 2BNUB 3QDJE 3OB0H 4E5XB 2XN9D 2WINA 2FEDD 4CVWA 1EFXD 5FYJH 1RJZB 5I75B 2A6JB 3P4MA 2Y07L 5ADOL 4BK5A 3UTTD 5C6PB 2IJ0C 3V6OA 1FYTE 5D2LB 1WCBA 2A6DA 3KWWB 2AV7A 3VFUA 3KLSA 1MEXL 1UYWH 2FYYB 4NUJB 4PRHE 3WHXB 5B39A 5JW5B 5ETUB 3V5DB 1D5XA 1K9TA 4HFWA 5CP3H 3ARBD 5ALBH 5IROC 3HN3A 4IOIB 3NIGE 3F58L 3HNVH 1OP3K 1EVUA 4M1DH 2MNUA 3RY4A 4K9EH 5CINL 3GIZH 1A6ZB 2O26U 1J0JA 2EKJA 4TNWK 4KI5D 3IGAB 1LK3L 4P5TD 4XHQA 1JHLL 2YA0A 5HHMB 1DQML 4H8WH 1II4E 4GAGL 5L9DH 5C08B 1QFWI 2P7TB 2RIKA 2ZUVA 3EJZC 4NN5B 3TGXA 3U6RA 3FMGH 5GSVA 1UM4L 5CJOL 1YN7B 2ZCHL 1LE5B 1YMMB 3O3DB 3RZCD 1S5HB 2ARJB 4PJIE 4QGTA 3FTGB 1EDQA 1FN4A 3FOMB 3SGEI 1P4BL 4LSVH 4OZ4A 4PJHE 1I8KB 1KJ2L 4PRIB 3QXWA 4A2LA 5C0DB 4HPOL 3I3DA 3L3KA 2K9UA 4GG6E 3HZMB 3DV4B 1YUHA 4WI7A 1IFHH 3C5JB 2VZOA 2IH1B 3UX9B 2I24N 1Q0XL 3LQZA 2CGRL 5DJAB 5I74B 4X6CE 1DN0A 5ECJE 5F7EH 3IFLH 4MA3B 3RDTB 1YN6B 2EE6A 4OLYH 1A3RH 2UZIH 5FYJU 3IKCA 5D93C 5JHDB 1UACH 4TUJA 2NQCA 3AS2A 2VKWA 3OKEB 3T0WA 3MJ8B 3S96A 3RTQB 3V6FA 3DURB 3UJJH 3FFCD 2HFFB 1JZ7A 5IFJA 4FTVE 3EYUL 4YR6B 3JUYA 1XF2A 2VABB 4HS8H 2YK1H 1ZLUH 5FYKL 3HRZB 5DS8B 3QIUD 1F6LL 1FH5H 2FBJL 2RCSH 1T1XB 3G5XA 1NGWB 3LB6D 4KC3B 4C4KT 4CVZA 3TBYA 5A2IH 5C0EB 3IJHA 4NZDA 5D6CA 1IGYA 4L8DA 1N2RB 3VFNB 2JJUA 3RWHA 2XWJB 4C83A 3VFGL 3D1MC 2V5RA 3BX7C 2V5TA 5I8EB 3DO7B 3OKDB 1DBKH 2A74B 2W38A 4X6CA 3WE6B 1N6VA 4P2QA 2IADB 3MOBL 4O2EA 1F2XK 4PBVC 3REWA 5ITFA 2B1HL 2J7LA 4L8CB 3I50L 4KUZH 4XMKL 4MZ3A 4EUPB 4JPVH 5IM7A 1RJCA 5JOFA 5FKAB 5T1KA 3PABB 4DVBA 2ESVA 2H41A 3HB3D 2JJTA 4AEIL 5BV7B 2VLJE 2YOCA 5HHNB 4G6AD 5KSBE 1J5OL 4XP4H 3ZKXC 5IFHH 4XAWL 2PR4H 4JQIL 4ONFL 2WK2A 2X1OA 1J8HD 2J5LB 2IF7A 3AXLB 5C0DA 2EC8A 3S5LG 3UZQA 3BH9B 4JB9H 3IS1X 4P23B 4LSUL 4PTUB 3BO8B 4Y4KA 5GZND 4NNYB 4JFED 3GMQA 5CILH 1EHLH 3MXVL 1OT2A 1Q0XH 5K33A 1TVBA 3O45A 1CIDA 5CBEA 3ARRA 3NCYS 2XKNA 3KR3H 5DD5L 1FO0H 1CD9B 1C8PA 4XBEL 2JJWA 3H9HB 2I07A 3U83A 5DJ0A 4XCYA 2CLZB 3WNLA 5KVMC 2DAVA 1IKNA 3ULSA 4G6FD 1BEYL 1XGQB 3GSXB 5KSVB 1A6ZA 5HPOA 2HP4A 5I1DB 5K9OB 3O4OB 4HKBB 4HCRH 1RJYA 2VLRA 3CC5B 3IDNB 2EDOA 5FKPA 3FO2A 4WDIA 1U93B 2JB5H 3CMOH 2FEDC 1BVKB 4CVXB 1CICC 3RVUC 4ZFFA 3TV3L 3B9KC 2GI7A 2Z0BA 4PJDB 5L8KB 4PJ9B 4JDZA 1I3UA 3FFCE 5HHMD 1OARH 2X44D 3ESUF 3CXHJ 3V6OC 5IB5B 2CDEB 4WV1A 4OCSH 1ZT1A 4MHHI 2FJHB 4OCSL 2DQCL 3ME0A 4WI4A 5AAMA 1XR9A 4M5ZL 1AJ7L 3D39A 4J3SA 4M5ZH 3TESA 2HTLC 5D7LE 2NY7H 1ZLWK 3NZHH 5IT2H 5I15H 5FO7A 1D5BB 4F80A 3B2UC 3O3AA 4LIQL 1JWUB 3BJLA 3VXMB 1OF2A 1BD2A 1JNNH 4UB0L 4F57L 2O5XH 1EHXA 1HQRA 4WEMB 3VXUA 2APWA 4AENA 1WWWX 1YA5A 5EULV 5E2TH 5AZ2L 1F13A 4PRBA 2D7TH 4W68A 2W0LA 5GJSH 2D0FA 4W4OC 4Y2DC 4YXKH 3E2HC 1F4XL 5DSCB 2OMNA 1CXKA 1XEDA 1RUKL 5EU6D 4JO2H 3HI5H 5H2BB 1YEGH 1S3KH 2VERN 4P5KB 1I8KA 2J4WH 1G7LB 3PQYE 12E8H 4CU8A 2FO4A 2EZ0C 4W6WB 2RB8A 4Y1AE 3DECA 1NMAH 4XP6L 4FFZH 4QXUH 1NGZB 3QP3A 1CLYH 5CILL 4PJ5D 1T04B 4F15C 1ZA6A 2F8XC 1FSKC 3MLXH 1UZ6F 5SWZB 2UWEE 2DIJA 1N4XL 4QHUA 4X6DA 2ZNXA 1C5CH 5DUML 3LD8C 5FHBH 4XP4L 1FVEB 2JKXA 5I1CH 2GUOA 1T03H 1NBQA 1O7VA 1OB1B 3WUWB 1XCTA 3I50H 1S7SA 1N64H 1FNSH 5HDQL 4I18A 4XT1C 3ULVH 1CGWA 4NN6C 4PRHD 3L6FB 4KJYB 4I0CC 5LBSH 3NTCH 4R96B 4JVWA 4M8VA 4Z78A 5L6YL 4FQXA 5GJTL 2N7BA 2D4DA 3MNZB 1DTUA 4X6BA 5I1EL 1A64A 2VKXA 3L1OH 2FX7H 1TQCC 1RZIA 4K8RH 1BD2D 3STLB 3QJFA 1EEZB 5EZLB 4AT6A 4YXHH 4HEPG 1CN4A 1QSEE 5KSAB 3H0TB 5D70L 3ARFB 3BQUD 4KI5E 5DO2C 4APQA 1S9YB 1U91B 3OJ2C 4OB5H 2GK0A 1F3JB 5F1KC 3WV0A 1CLOH 1N0XH 4U3HA 3VXTB 2UZIL 5I73B 1NLDH 4LMQI 4MJ6B 1AXTL 3TN0C 5SV4A 3DMMC 1ODAA 1AHWA 1MIML 1FYTD 1KLUB 1H5BB 5JPMA 2FD6H 5J3HC 5CUSH 1UACL 1W72A 2HYMA 3GMMA 3W9DB 3FONA 5D6DA 4Z77B 3BAEL 3DSFL 2XIDA 2NZIA 3KPRE 1Z2KA 4YDVB 4DJMA 5DD6A 3IJSA 3FO2B 4WDIB 1IEBB 1P5VA 1YEDB 3D39E 4LPWA 1X3DA 4U1JB 4UZGA 3ULUE 1BWMA 4HH8A 5DC9B 4NNPH 2ZZUT 2EH7H 4Y5XB 4BFGA 5J1AB 4O2CB 5DJ0B 1MHEB 1H3UA 4NFDA 3QB7C 4F7TB 3JWOC 4JVPA 3V7AG 4MXVE 4GRLA 2Q86A 2ZCHH 3K3QA 4L29B 1JHLH 5C9KA 5IHZB 4ZFZA 1WBZB 3QDJB 3FAXA 4YC2C 3OKKB 2D03H 4LGSB 5LGJA 2VWEC 2Z31C 4HWBL 3KPRA 2R8SH 4ONGL 1AHWC 4HUWB 1FAKT 3WYRA 4JRXB 1C16B 2W9EL 3BOVA 1CT8A 1A1MA 5FO9A 4NOBA 5I1GH 3NACH 3D2UA 2NY5H 1FGVH 4X9IA 2DQUH 1FYHB 4GG6B 5CEZE 5FKAA 4Q7DA 3RVVD 2NMSA 4YAQA 3MREA 2MHAA 4IBLT 3O0RH 3QDJA 4GS7B 3ULVD 5SWSE 1FBIL 4GXVL 4QKXB 3RU8L 4E0RB 5DK2A 1C5DA 3UDWA 1I7TB 5IIEB 3GIVA 1SYVB 4X7SH 3AXLA 5E8EA 2BVUA 5BW7C 2UV3A 4AQOA 1C7SA 3MRDB 5C92A 2PO6C 3WFHA 1BQHA 4ZPTB 5E9DD 3ARBC 4FQQA 4HWZA 3BPLB 4XBEH 5E99L 4JDVA 1LNUA 3X13A 2OTPA 3TA3A 1OAXL 5FO8A 3NIDF 5CJXA 1CVRA 3R1GL 6FABL 9CGTA 5JZ7D 3GDBA 3O3EA 2Z9TA 4TVPE 4FQXB 5KBNC 1HH6A 5GISL 3O9WC 4PY7A 5ILTH 1WWAX 4M7JH 1KCUH 3JWDL 2VDPL 5CIPA 2IAMD 4ZFGL 3MACH 4PJXA 2O5ZH 1LDPH 3OAYK 2NNAB 4Y8DC 4OD3L 5HGDB 2X9WA 3EFFB 3OKMB 1ZT4A 1XFPA 2NR6C 4CNIB 1AC0A 3OKDA 4LPCA 2YEZA 2E7LC 5I8EA 4JFHD 2J2ZA 1I3RA 1TCMA 3CFJB 2X09A 3RWJB 3EHBC 5JQ6H 5DR5L 2Z8WC 3L3HB 3VG0H 1QSEB 4TULH 5C0GB 1F3JA 1CGUA 1S7RB 2YPKB 1T83C 1T89C 3LEYL 3EZ8A 2VDQH 4ZXBA 1I9IL 5INDB 4JFFD 4DEPC 4J12A 2FB4L 1RVFL 4R97C 3DTXA 5JHDA 3NIGF 4M1CC 4V1DE 1PQZA 3ZE0E 1JHKL 4OLZL 4GG6F 4ZNEE 1JGUL 2QEJA 4Z78B 4HKJA 3L3GA 3QAZB 3G04B 1G7JA 1VGEH 1FL3B 1IGML 2IAND 3L3HA 3V52L 1WUNT 2ATPA 3VD5A 4ZNCD 1I7UA 1EMTH 4R4BA 3ILQD 1PAMA 5LKNA 4DN3H 1HHGA 4DFIA 2FJFB 2P5WA 4PGBA 4FFYL 5I6XC 2UWEB 1EO7A 3WKNA 3NGBB 2VOTA 5KVEL 4IOIA 4IJ3C 5F8RC 3DMMB 1KCLA 3D6GA 4ELKB 3TVMD 5HYIA 1F4HA 1IM9D 3EDKA 3OL2A 5LQBH 4GRLD 2CMRH 1D5MB 4NWUH 5ITBH 5K9JL 5E0QA 3H9ZA 3KPMA 1HDMA 2BP3A 4YDIL 1PZ5A 2RHEA 2H1PL 1KXQE 1NMBL 4JLRB 1P2CA 1A4JB 5HSFA 1KIQA 1B88A 1K3IA 2VZSA 4ZAKC 3MZGB 4TVPL 1B0GA 3ULVC 5GGUB 3G6AB 2AERT 2FD6L 4XMLL 4EVNA 3VD7A 4OJFL 1EJOH 2E9BA 4G6KL 4OZIE 2EDDA 1WZ1H 2P49B 4EEEA 4OFKA 3PWLA 4OAWB 2R56L 5J11C 5E2VH 2J88L 3DVFA 2XZAH 3MV7A 5BV7L 3RY5A 3HPJA 4LFHG 2WWMC 1AHWB 5BZWA 1SQ2N 1FIEA 3TBSA 1MELA 2CXKA 5GS1B 2GQHA 3WN5A 3VXSD 5A40E 1MY5A 3L3GB 3QIWD 5DJZB 2D7PA 1N3NB 4P4RA 5ENWA 1HH9B 4HHAA 3TO2B 1UCTA 1RIUL 4XTRD 4CJ0A 4L8SB 1A5FH 1UZ8B 4G43B 4UV4H 3ZDXE 4OCXL 1HHHA 2EIDA 5HHXL 1HZHL 5IKCA 2UZYB 1ED3B 3KYMB 1KLGB 3MNWA 3IAPA 3DX7B 5FDWB 2UYLA 3QUML 3P2TA 1JPTL 3BWAA 1I3RB 4GH7B