4O5LH

Crystal structure of broadly neutralizing antibody f045-092
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
240
structure length
234
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCRASGTFYKYAINWVRQAPGQGLEWMGGIIPFFGTTNYAQKFQGRLTITADGSTNTAYMQLDSLRSEDTAVYYCAGPSITESHYCLDCAAKDYYYGLDVWGQGTTVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F045-092 light chain
publication title Receptor mimicry by antibody F045-092 facilitates universal binding to the H3 subtype of influenza virus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 234
sequence length 240
ec nomenclature
pdb deposition date 2013-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o5lH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o5lH01
3A6BL 1G7LB 1PZ5B 4HV8B 2AJ3B 4G7YH 1UWGL 3GHEH 4GSDH 4UOJA 1QLRA 5DGRA 1MCOH 1QBAA 2X10A 1BREA 4TYUA 4MWFB 3CPLB 1JWMB 2YXFA 3QXAB 5F7WC 1X5FA 4MJIB 3C5ZC 1E4JA 2NNAA 5BZDA 4JO3L 1MHEB 3RGVC 3CH8A 3NIFF 3QZWA 2JB5H 5EU6D 4F7MB 3LKPA 2BY1A 1NH6A 4QRPE 3U48A 5TJWK 1W72B 4OFIA 4I3RH 1UM6H 2WINB 2CKBH 4JPWL 2NY0C 4L8BA 5ICYA 2AXGB 4JFXB 5I73B 4JDZA 5FF6B 5IGXL 3FO9B 2CDFA 1EAJA 2ZCHH 1KNOA 1LD9A 2X2YA 3IDNA 4XPGL 3JBG7 4UT9H 4KKAC 2RFXA 4WO4C 5E0QA 1ZHLA 5ENWA 3ULVL 1WWAX 3NIGE 4NM4L 2AKRB 3LKQA 1OQXA 3UBXA 8FABB 3G6JE 1HI6B 4RMRA 4NO2A 5F1SA 1JWUB 5DJ6A 1XGYL 1AQDA 1T21A 2B0SH 3HMWL 3BH9B 3C8KB 1BEYL 4U1GB 3MNWB 4URTB 1XF4B 4J3XA 1MFAL 2VXUL 4OLEA 4QOKE 1YEKL 3U0PA 5C0GA 1T0MA 2XACC 3PIQA 4F7TB 5JHLH 2NY1D 2VXVL 3QJHB 4BSWA 3NIDE 3RVWD 1DP0A 1O7SA 4NCC2 5GGTA 4JRYD 1FHGA 4F9PA 5L6YL 3D25A 1ZTXH 1QBLL 4YZFF 4M61A 1OLLA 2BSSB 3VWJD 1HYSC 3IETA 3DX9B 5KSBE 4LLMB 1T7VA 2C7UA 3OWEA 3FJTA 1CD0A 4NQDB 1QD0A 5E2TL 5MERB 5IF0A 2WIMA 3QUXC 4N0YH 3KJ6H 1WC7A 1LDSA 5JW4N 5KS9B 5C0EA 1H3UA 1UWXK 3D39E 1CDUA 5BQ7B 4P2QD 1PLGH 2JCCB 3LPGA 4M5ZH 1FYTE 4PRPE 5D7IE 3MA9H 4YC2B 5C92A 1I9IL 3MBEA 4AK1A 5I1KH 4J3SA 3S5LB 1LO0L 2BVPA 3BI9X 3HZMB 3FRUA 4PP2B 1OCWL 1SYVA 4IRZL 4P2YA 4PJGB 3DX7A 2Z91A 4Y16D 4RA0C 1KJ2L 3K46A 4C56A 2X4TA 2EYTB 1JYWA 3LN4A 1K4DA 5GJTH 5LCVH 5E4EC 3VG0L 2GI7A 3MRMB 1IC4H 3TH2T 3GRWL 5HHNB 1FVEB 3H3KA 3MTRA 3O2VH 2XV6B 1BQLL 1E6OH 1N0XH 4X0KA 2VO5A 3S4SG 2Z0BA 1YEGL 2FRGP 4Z7VE 3W0WA 3KPOB 2J6EH 1JGDB 1JCKA 2CDEA 4Z0BL 4G8IB 2QSVA 1SM3H 4LSQL 1T0NB 4UILH 4BQ6A 1T83A 4XNMA 3U36B 5E2VL 4R96B 1YNLH 1JHLH 3H8NA 3ROLA 5LAXB 4JLRB 3GSNL 4N8CL 1BAFH 5EN2A 1XIWC 4I48A 3ECBB 4PUBL 3SDDA 3NCFB 4L9LB 2HMID 1U92B 5GRYA 4ZOEA 2HFGH 1E27A 4OV5A 3MXVL 4GG6E 3RL1B 3Q3GB 1JVKA 4JJHA 3WN5B 1P1ZA 3FQNB 4LHQB 1J9CT 3WL9B 4WCYH 2LAGB 1NEZB 4XP4L 3UC0H 3MV7E 2IJ0C 25C8H 4XHJC 2H6PB 2EC8A 3L5WA 3B8YA 3WS6A 5T1MA 3X11B 5HI3C 2XT1B 1OSPL 5IW1A 2DM4A 1V7NH 2A77L 4UOW1 1AY1H 1HIMH 1CFTA 4HIJA 3JV6A 3BT2L 2BHZA 1JRHH 3BWAB 3C60D 5I8CA 5F1OB 4NQCE 3BD5A 2WBJD 3S96A 5CBAB 1T03L 1F4XH 1I8IB 2XZQL 3ROOA 4O02H 1DUYA 3V52L 1MAML 1R3JB 1M7XA 3O11B 4MNGE 2RB8A 5KTEL 4EI5B 3GM8A 1NCUA 4G8FB 1OARH 3HG1D 3DMMC 4X98B 4G42A 3G5ZA 4PJXE 2HN7B 3NH7H 2R0KL 4M3JA 4I3GA 4JO4H 1EVUA 1MJJA 5HYJA 1EEUA 1BMGA 4WUKH 1C5CL 3V2AR 3FONA 1UCTA 2Z31B 3EDDA 2MCPH 1AXSB 1QBML 3K4ZA 2OP4H 5AEAA 4P2OD 1QSFA 5DEZA 5CP7B 1RUKH 5FUOL 3HAEA 1CS6A 3A67L 1F90L 5ID0B 2VLRD 4AENA 2ADGB 1A1MA 1GHFL 4XP5L 2OL3B 1T2XA 2FH6A 1OSZB 1IAOA 3MRGA 3WIFB 2IAND 5JQHC 1ZSDA 5DTFB 1N5AB 1GIGL 3K0WA 2O93L 4JO2L 5GRZA 4PGCA 4LPWA 5SV3A 2QQNL 1UH3A 4LSRL 5FV2A 5C0AD 3U2SB 3P40A 3MOAL 5C07B 1N3NA 4M1CD 3RUGB 4M8VA 4Z7WB 3UTSE 1AGFA 5IHLB 1KN4H 4P3DB 4XTRD 2IH3A 3X12A 5E6YA 1CR9L 4OZIE 1FNEB 4YR6B 4C57C 4CRPA 4MD5A 2A9MH 1NBVH 5AWNH 4FOMA 1YC8A 1GC1L 2AJSL 3IFOA 3LQMA 2C3HA 2E8YA 4ZO7A 1IC5H 5LQBH 2ICWB 4JY6A 4WI9A 1WIOA 4KTEH 1B0RA 5HD8D 3SGEI 5BS0B 1UWXH 2EH7H 4DFHA 3ZHLA 5D7JC 5ISZB 1EAPB 1CN4A 5GQBA 2R1WB 4ZNEA 3QSKB 1H3WM 1A14L 1MIMH 4NZRH 5F3HB 3VW3L 1MI5D 3JV4A 4EUPH 4UTAL 1WV7T 1S7WB 3F7PC 3O6LL 3OJVC 4NZDA 4EBQH 2WUBH 4RGNB 2UVFA 4Y19B 4OZGB 3SCMA 3MGOA 3QEQD 3UTTB 1BQHA 2V2WB 3GSUB 3O0RL 1CG9B 1FH5L 1CGUA 3M1BB 1R5VA 3LEYH 1X5HA 4L3CB 2PN5A 2XN9E 2EDWA 5A3ID 2XKSA 3OKMA 3PQYD 1TJGH 1KPRA 3B43A 3RNQA 2IH1A 5I15L 3H9HB 4E41E 4IIQC 2WWMC 3PNWB 5HVWA 1MWAA 4LHUA 1KB5A 4Q9RL 5CHNB 3CCHB 2I27N 1IM9A 3DX8B 2VDQH 3NABL 3LKSB 2HT3D 3H3PL 2WBWB 3BP4A 4NC0B 5DR5L 2HRPH 5CD3A 1YNKL 1Q9OA 4DGIH 4PJDA 4ZFFA 2XA8H 1RIVL 4UIMA 3EOTL 2D4FA 1L7IH 1AR1D 2PKDA 4YK4C 2G9HB 2ORBL 5K59E 3O2WL 3B83A 3VGAC 3GKZA 3MUHL 3QUZD 4PJDF 4RFOH 5D2NE 1N64H 4U1KB 3O4LE 3T0DA 4M1DL 2IMMA 2WM0A 1RJYA 4JPKL 3SQOH 1FIGL 3JWDC 1EMTH 1VFBB 1MF2L 1OTSC 3T3MF 3X13A 3L3OA 2DTML 3CFKA 1A7PL 1OTUD 3OKDA 4DQOL 3H9SA 1I1YA 2SEBB 4B41A 5B3NA 1QR1B 1XGRA 2IC2A 1JGUL 2HT4C 3FZUD 3V6FA 4LVHC 1A3RL 5EULV 1OPGH 2DB8A 3JUZA 3MJ7B 4I18A 5GS1A 4WENB 3CDCA 1AO7D 3ZE0F 1FGVL 2G5RA 3LPFA 5TDNA 4PRDB 5GHWL 2BJMH 3TVMD 3BPNB 4BYHA 3O2DA 3DYPA 2FX7H 1U3HD 3QUYD 4D8PB 1MIEL 2W38A 4R2GB 4XZUB 2P5EA 4UNUA 3FOMA 2W65A 3U4EB 4PJHE 4Y2DA 5JR1H 3CMOL 4N0FA 3IFPB 1T5WB 2VH5L 3F8UB 4FTVB 4MDJA 1HKFA 3ARBD 4DN3L 3ARFB 3ARDD 1D6EB 1YMMB 3HNTH 4JFOB 3WD5L 1I85A 2FX9H 2XNAA 4N0RA 4W6WB 5FXCH 1DLFL 3CXHJ 5JZ7C 4LKXB 5I8EB 3MLXH 1P7QD 4HH9B 4KMTL 2H32H 3VXPB 5D5MB 2IPTH 1J1PL 4EN3C 2DLTA 4OKVB 1T1YA 3KGRA 2Y5TB 3RU8L 5SWZD 4YFDB 1T2JA 5EORL 4UDUA 3WDJA 5GGSB 5CINH 2VITB 1N8ZA 1RJLB 2PETA 3QO1A 3HLAB 1NL0L 2P5WA 5INDB 2ED8A 3GJFB 3HC4H 3CU1A 4OLUL 2YD7A 3PGDA 4GRLB 3KPRE 2UWEA 4H5SB 5MENA 1Z5LA 1I1CA 3GSOA 3MACL 2QQLL 2AJVH 4N8VA 3ZYJA 2QEJA 1NAMH 3QUML 1A9EB 1JP5A 4HF5L 1XH3B 3D2UA 2UWEF 4JM4L 4LNVA 5K9OB 1AD9A 1A6VH 3FOLA 5D7LB 4U6VL 1NMAH 3CX2A 3KYOB 4UQ3B 1WZMA 5K9QI 3D0LA 5CP3H 4D9RD 5M7QA 5D72L 4QWWC 1KBGL 4JQVA 2HLFD 3TA3C 1JPFA 1MVUB 3PL6D 2VERN 4ODTL 3FB7A 4P99A 4X99A 2HJKB 5IEKB 1N7ML 1HKLL 2WZPD 5C0RL 5I8OL 4MYWB 4X9BA 1BIIB 4KWUA 2A6DB 2BZDA 4AYFA 1IGMH 4YHPB 1MELA 5K9KA 4GBXB 2BNQD 3BDXA 3IJSB 4ZS7L 3S8WA 1NUNB 1I3RA 3QH3A 5JORA 3VDBA 5IMLA 5CS7A 2IPUG 3ZT6A 4XNZB 3V0WH 2R4SL 4QF1A 4OV6F 4LCUB 2ICCA 1S7TB 1JNHB 4PD4K 1C16B 5E5MA 3UZVB 3MRNB 3HZYB 1ZGLP 5DJZB 2R0ZH 5DXWA 4LQFH 4AM0B 4AQOA 2YUXA 4R0LB 4KJPC 4J3WA 1ROWA 5F6HI 2F8VA 4OM1H 1BF8A 1I9RL 5DMYA 3C6LC 1R3IH 1JHTB 1XEDA 4LL9A 2DQHH 5L2KD 1PKQB 5CEYB 3RWJA 4JFFE 2FWOB 3KPNB 4R4ND 2G2RA 5HGAA 1UXWA 2AI0H 2VLKD 1TNMA 2D7PA 2IALA 3SKMB 1ZHBA 3KXFD 3V5HB 4ZFOA 3EBAA 1ITBB 5KVGL 4OLZH 4FXKA 4P23B 3QWOA 4ELKB 1FL6B 3W9EB 4K9EH 2AK1L 1IM3A 5ADOH 1CF8H 3IF1B 3Q5OA 1AD0A 4HS8H 4X6CE 4M5YL 2BCKA 1LO5B 5EU5A 2NZIA 3PJSA 4R4BB 2BHYA 3DX6A 1KJ2B 4MJ5B 4F7PB 3SBWC 4LSPH 4NDMA 2K3TA 3C6SA 3MRKA 4G8GA 1FORL 2X6MA 1U8OA 4LU5L 4L9DA 4KJYA 4JVPA 3HN3A 1FNGB 4F15B 1K5NB 5F7LB 3MRRA 4Z7NE 3E6FA 1NFIA 2BSRA 1Y0LB 4ODVL 1XGPB 3GB7A 5I0DA 4POZC 2F5BL 1QR4A 3HNVL 4DAGH 4R4FH 4XH2A 5DO2D 4PGBA 2YPVL 2MJWA 4PRHA 4XCYA 4YNYA 2OXHA 3T2PA 1CICB 3V8CA 3HR5B 2QJDA 2CO7B 4OFYA 1VFOA 5A43C 3KPLB 4Y16A 1PG7H 4NFCA 3CSPA 5E99H 4ZAKA 3N9GL 3CDGA 4YBQC 4CMMA 3RKDC 3GMQB 1NANH 1EJOL 1NDMA 1MVFA 3CXDH 1GGBL 2ARJA 2Q76B 5CBEA 4OLWL 3T4YA 4HCRH 4I4WB 3VXUD 4X6EA 3SOBH 4IOSD 4KKLD 4M6NL 4XPBL 5MEPA 3PWUA 3VI4E 5FK9A 3QIBA 3IS0X 5E2JA 1F58L 5K9JH 5DJ0B 4CJ1A 1I7RA 2VDOH 4S1RH 2Q7YB 3IDYB 3RWGA 5GS3A 2XZCL 5DHXB 3TV3H 3BEVA 3P77A 3STZB 4XWOD 2DQEH 3QIWA 2CXKA 4NGHL 4Q6IB 2R1YA 2DQTH 5E00A 3G6JA 1KPVA 4XVUD 3SJVB 3EFFB 4XT1C 1GGCL 3NIGF 4M9PA 3RBGA 2Y4SA 1NUDA 1OAUH 2R1XA 5C09E 1YQVL 4JREC 5EBMA 4QOKA 5TQ0H 3QG6B 3G6JF 2ED7A 3QNXA 3GMMB 2V2TB 2LTQB 3VI3F 1S9WA 2CLVA 1Q9KB 5IQ7H 4G8EA 4MJID 1ZGLM 4AMKH 5EIIA 4PRIA 2FBJL 2B7DT 4KUCF 4XMLH 4UQ2A 3NIDF 1DBBL 3C60A 3NCBB 2YN3A 2PTTB 3RWDA 5KSBA 5CMAB 4S2SB 2I26N 3AFLA 1TTGA 3KDMA 5IB5A 4RRPG 3V79C 3H42H 4LPCA 3CFDB 1EVTC 5IM7A 4NT6A 2Y36L 3U0WL 5KSBF 3QPXH 1G0DA 2IAMA 5IESH 3CVIL 5D70L 3MBEC 4PRPA 5D7IA 3WFEH 1ZA3A 1H15B 2Z8SA 3FHAA 1BVKB 5JA8B 4HD9A 2F53E 1CDBA 3OKOB 3ZKND 3WDHA 2R0LH 5D7IF 1TQCB 4HWEH 4IJ3C 1NCWL 3NAAH 3Q5TA 3MLUL 4TOYL 4QHMB 2ICEA 4KJWD 4TVPL 1J87A 3KYMA 3C9NA 3I2CH 3VXNA 4MXWH 4HUXB 1HXYA 4MMZC 3ZLQC 5D2LA 3NFSH 3VD7A 5ITBL 3RIAF 5I1LA 4NO3B 2BRRH 3FAWA 1C1EL 3MRJA 1FYHB 5I17B 1VADB 2DJSA 2E8ZA 2IANA 1FZOA 4R90L 2Q6WA 4GMSL 3HCVB 2GUOB 3F62A 4MB5A 1IAMA 3JWDL 3UJIL 4HPYH 4X7SH 3RL2A 3OAYK 3RAJH 1T83C 4NQDD 1PG7X 1TCMA 5CJQH 3BHBA 3DO7B 1UZ8A 1D5IH 3IDIA 3FB5B 4Z7VF 3TBTA 5D6CA 4FZ8H 5TE4H 1LEGA 1DE4A 3SDDC 2CGRH 4WNQA 2PXYB 4E42A 12E8L 3I02B 3SDCB 4LSTL 3F7QA 2FR4B 3Q6GH 4XCFL 2E7MA 4OLXL 1UQSA 4KDWA 1AGDB 1M7IB 5BXFA 3MXWL 1S5IL 4NBYB 1VCAA 3L1OH 1CVRA 2BOCB 1QRNE 5EA0H 4GG6F 1IC7L 5FYLE 3WS6C 3G5VA 4FQXB 3MV7A 5FYKL 2FGWH 1DQLH 5JXED 3L6FB 4Y1AD 3UDWA 3TPKA 4ZSOB 3TH3T 1WBZA 4F8QA 4QTIL 5FHBL 4UU9B 4N5ED 1F4WH 2EDKA 4WHTB 1NFDE 1OD7A 1RIUH 1YY8A 3VXMB 5JHDA 4KZDL 1OAYH 3BP7A 5DD6B 4I5BA 4RAVB 4NQCA 4OUUA 3RWHA 3SE4A 4LCWA 1H8NA 1NGYB 4JKKA 2X1PA 4MAUL 1W0WB 2VWEC 1ODAA 5EBWA 4JFPA 4UT7H 4KKCC 3V6ZB 2VAAA 5EFIA 2ZNXA 3FQWB 4MNGA 5IW6A 1EERB 1TNNA 1CXLA 3CUPA 2OK0L 1S78C 3SQBA 2AJZB 4TSAH 4PJ8B 3VFSA 2XWJA 3BVNA 1MQKH 2A6JB 4MCZB 2IADB 3SKNB 3P4MB 4RMVA 3VFPA 1R24B 1BJ1J 3MV01 5F21B 4GUPA 4PJXF 4G43A 4UZGA 2EXYC 4X4ZA 3MRFB 4EUPA 2XTLA 1AKJB 3FT3B 4LPUA 1F4AA 1KULA 4NPYA 4QGTA 1A1NB 4UV4L 1BOGA 2E9IA 3B5TA 3RZCA 1J0YA 3P0VH 4J3VA 3C5ZB 2O5YH 4H88H 3ZKXC 3RGVB 4QRTA 5J3HD 3ULSB 3DVGA 1NGZB 3IFLH 1FO0H 3OZ9H 4N8PA 4XP1L 4ELMB 5C71A 1FVDB 4PJEA 3SY0B 5GS0C 2HKFH 5FYLH 3V95A 2F19H 1IAIL 1FIEA 1UVQA 2OJEA 2NY0B 1DDHB 3DPBA 1E4XL 5SX4H 4L3EB 2WAHA 1NKOA 5FA3A 4Y7MA 4J8RB 4OF5A 4RMTA 4EI5D 1RFDH 1UB5A 5ANMB 4HK3N 4PJ5E 3DURB 4LP4A 3MLVH 4OZIA 1DVFA 4OCWH 4YHKH 4ESKA 4GKNA 3FCTB 1JV5B 1R5WA 1CD8A 1F02I 1IC1A 1GOGA 4ZFZA 4D0CB 4J1UA 4NRYA 3L3JA 3P9MB 3VE0A 5F9OH 1MCDA 4QHLB 3ULUD 2XY2A 2Q20A 1JZ2A 1BX2A 4YHLL 1ZLWK 2FIRT 2Z31D 3IAPA 3MV8E 5E8PA 2HTLC 3RY6A 4FQHA 1H0DB 2D7OA 4MQTB 5T3ZL 4AL8L 3E3QC 4JO1H 4K8RH 5DRWB 4M02A 1MCPL 3PGFL 2N56A 3MLWL 1M6OA 2H3NB 4WEBH 2L0DA 3CVHL 4JHWL 1FBIL 3SCMC 3GI9L 3U30C 5CEZD 1QFUL 3ARBA 2E7CA 1K8DB 1FAKT 3L3IB 4NM8H 3UXFA 1XFPA 1IT9L 3QUXB 1WBXB 1RURL 4HJ0C 5F1IA 3VGHA 2BVQB 3E0GA 3U7AA 4GAJL 1XR8B 4XVTL 2CDGB 5DT1L 1P7QA 2DLGA 2HTKC 3CDFA 5C0IA 1HQRA 5EOCL 1KIRB 2PCPA 1J8HB 4HWBH 2ITDA 3D0VA 4AT6A 2YWYA 1YEDA 3OAYH 4F33B 5I18H 3EGSA 4PB0H 3RX5A 2J8UE 4FQIH 3GIVB 4RGMC 1KUMA 4PJBB 2QBWA 3P4NB 5BS0D 2OX5A 3B2VH 4IOFD 2H1PL 1C12B 5KSUB 5ISZD 4D0DA 4ZTOH 1BLNA 2Z4QA 15C8L 1FRGH 4XNYH 2NXZB 2GW5A 4JM2A 1DCLA 4WW2F 1GAFL 3V7MA 4HX1B 2OTWA 5FO9A 3ZDZE 1BQUA 3SE3C 4Y19D 3TN0A 4OF7A 3UTTD 5D2NA 4JM2F 5FGBA 2H32A 3G6DL 5KSAC 1CFSA 5GISH 5K59F 2YD4A 3MA7A 1TMCB 4M48L 4LDLB 4JRYE 1ZHNA 4TULL 1F6LL 2VB5A 3SDYL 1EFXB 4WFFD 1X5ZA 4ZOAA 5CSZA 3O45B 1VGEH 2P45B 1U42A 4MX7B 5LBSH 1AP2A 1MCBA 4RAHA 1AE6H 5JDSB 2F5AH 3H7LA 4N90D 4HC1H 5E6ZA 2ZPKH 5J4MA 3GSXA 5E9DD 5GS1C 3U4BH 4QLRA 2NW2A 2HT2C 4D9QD 2PTVA 4KAQL 2VNCA 4QRRD 2BNQA 3RIFK 5DJYA 4UINL 3HS0B 1Z0NA 3UJTH 3UTZA 5B4MC 4P2QE 3VFRB 5IR1B 3MREA 4WIQA 4YLQT 5T5FL 1X6LA 3IFNH 4PTUA 1F2XK 1A6ZA 2P49B 3VH8A 4Y2DC 4UMGA 3F7VB 4EZMA 1MRFL 4PJHA 3J7HA 5HDQL 1CIUA 1RUML 4JFQB 5JTWA 2APFA 1IGTB 5JQ6H 2B5IB 2FBOJ 3STLA 3BZ4B 3I6LE 4PJHF 4N0UE 2X4SA 4NC1C 5E8OA 2WV3A 5IUSA 5DMGD 4L8DB 5E8NA 1NC2B 1I85C 1SBSH 2P43B 2C5DC 5L2JA 2VLLB 2CMRL 3OR7B 3DMMB 1FVCB 1QTYT 2X9XA 2MPAH 4JANA 3HPJA 4GKSB 2NXYC 4U3CA 1FGNL 5GGTL 1QA9A 4OZ4B 4NKOB 3BKML 1SQ2N 1H8OA 1UH4A 5IT2H 3IKCA 5GSVA 2X1WL 1T6WA 2OTUA 2GSGB 4FXLA 1KTLA 1JYVA 5F88A 3M17B 4MD0A 4HG4J 4O2FA 2G60L 4LKCB 4R2GD 5IG7B 4YGVA 5ESQA 3S5LG 5C0FA 4P5KA 4NKMA 4HKJB 4J3UA 3O4OC 3OXRB 5DD1H 5IMMA 1R3HA 5DQJA 1ZLWH 1KCUH 1ACYL 3CNKA 3MNVA 1ZOXA 3E8UH 3EYQD 3ARFD 1CK0L 1YMMD 4JQVC 1MJ7H 4LLQB 4DEPB 1U8NA 1A9BA 4RAUB 4YFLI 3BO8A 4LVOC 5AYQA 1AIFA 1KT2A 43CAB 2D0HA 2HVKB 3OF6D 2G75A 3RVVC 5CIPH 5EBLA 2A83B 3D9AH 2I9TA 4F7EA 1GPOL 1RUQL 5EG6C 4XCCL 1MOEA 3KPSD 1VACA 1HXMA 1FJ1B 1SYSA 3LKRA 2XRAL 4P0DA 1P7KA 5D7JB 1KEGL 4ZUSB 4QY8B 1HK6A 2DQJL 2YEZA 5I0ZA 2VAJA 3VGFA 3SGKC 3AC0A 1CD1A 3GO1H 4GRLD 2XFXB 4KI5D 3WNLA 3V5DA 5LJYH 2IBZY 5HYQA 5DD5H 2M8XA 1U93A 3U6RA 5A2IH 2BNRB 4NQVA 4MA3A 1M4KA 4J6RH 4HUWB 1NEZG 4DZBB 5D7LD 2DD8L 4TRPL 4PJCB 4QKXB 3WEXB 3ZYZA 5DMKA 4LEXH 2UV3A 2M1KA 3IU4L 2VLRE 1JF1A 3HB3C 3QXDA 2CK2A 4L8CB 5HVHC 2PYEB 3P4OA 2YPLB 1FAIL 5EC2A 3GGWB 1VPOH 5HYSA 2EDOA 1S8DB 4GAYA 1T1XA 1KLFA 4WDIB 3FB6A 3C5JB 5IVZB 4G5ZL 3NPSB 1CFNA 5T33L 3ULVD 1XF3B 1T2QH 2IBBA 2I07B 4GBXD 3C5SB 3VRIB 5HHME 3O6MH 4HULB 2RHEA 1QO3B 3CH1A 5GSRB 1DQML 4X6CA 3GMOA 2P8MA 3WKMH 4HLZG 4MQ7B 1B88A 2NYYD 1G7JB 4WUUA 3GK8L 4IBLT 5J12C 1CGYA 4X6CF 1CDYA 5D1ZB 3T2NH 5HHXL 3SKJH 2Y6SD 4M1GL 1JGEB 1JPST 2X4OB 1W2KT 5DA0B 4JZNB 1VGKA 5F9WC 5GGRA 4JZJA 4R9HA 4OFDA 3P30L 2AK4B 4CKVX 5B39B 4HFUH 2Y07H 1A8JH 4MSWA 1U2CA 3DIFA 4BKLB 2RAMA 2VXTH 4OGYH 2CIIB 3NGBC 2HH0L 4JFDB 1A3LL 3QDJB 2DKUA 4BZ2L 4Z7NF 4OCLC 2H8PB 1BZ7A 1RZIA 1UGNA 2W60B 3QEQE 3BDBA 5DI8B 5C70A 1BQSA 1WK0A 3QEHA 4ZAKC 1TVBB 1K2DB 2Y7QB 3ZYOA 4YXKH 3TWCL 1XCTA 4P23D 1YNTB 3VXRB 4HH8A 4M8QB 4RNRA 4LOUD 4HAFA 4PJ7B 4K94H 5LKNA 4XNQA 3L7EB 4AEHH 1ZEAL 2P7TB 2EE9A 7CGTA 4XWGL 1CLOH 5GS0L 3FFCE 4YHOH 3S37H 1N5YH 3L3HB 1BGXL 3VRJA 4HS3A 5KN5A 1QSEB 1I3VA 2YZ8A 3QDME 3CFEA 5HHVH 3QIBC 3PHOA 1S5HB 4XNXH 3HMXA 4FQJH 3Q1SH 3LHPH 4OIBA 4JDVB 3NZHH 3VI4F 1NMBH 1TCRB 2Z9TA 5MEQA 1MCKA 4IOIA 2NLJB 2AVGA 4F57H 1BHGA 3QIWC 3TCLB 3REVB 2VZUA 1FZKB 4LLDB 3K8LA 2J8OA 5E7BA 3BN9D 5HGBB 1I1AD 3OB0K 4MVBD 5CLTA 2UVEA 1SEQL 2EDNA 2OR7A 3VFWB 4ZS6D 4EN3B 4PG2A 1CICD 1JK8A 1D5ZB 3KYNB 4KVCH 1DQJA 3QEGH 2B39A 2IPKB 3CSYA 4OD3L 3TBVA 2VDPH 2V2XA 4TSCH 4HPOL 1YYLH 4Q0XL 5JXEA 4DVBA 4Y1AA 1PJ9A 4XPFH 3T0EB 1UXSA 3TYGL 3WFBL 1A7RH 4KTDL 5MP6L 5E6IC 3UPRA 1ZA6A 1WICA 2FHFA 4L4VE 3SDXE 1RK1B 3QO0B 4OBRA 4U1JA 4RBPK 4Z7UB 3TBWA 1FN4B 3VFMB 2EXWD 2ZSVA 4XPHL 5ECJE 4LLUA 1MRCH 4ISVA 1MWAL 1MJUL 3H7BA 1KB5L 4YFLF 5D9SA 1IAKA 2NY2C 4U1IA 5JA9A 2YK1L 4LSSH 2XZAL 4NQEB 5INCB 4GJTB 2UZIH 3I6GB 35C8H 3BP5A 2YC1A 1RZ8A 4NO0A 1I3GL 3EOBB 4KY1H 5DC9B 5B8CA 5CJOL 4K23H 4S1DD 2X89D 5AYUL 4WHYG 1KEML 2MHAB 5D7SL 2WUCL 4NN6B 3OKKA 5JIIA 1LHZA 3GBLA 2X4QB 3MFGB 4FP8H 1U58A 1DBJL 3CC5B 4UOW0 1ETZB 2A0LC 4XBGB 4RFEA 4XMPL 3CZFA 1YC7A 1ACZA 4J23A 1SJHB 4P5MA 1U3JA 2WSKA 5ESVA 1MFNA 3KNBB 5DJ8A 3RA7L 2YRPA 3FRPG 5DGQA 1FL5A 3ESUF 4Q74A 4XMKH 3KLSA 2APVA 1CDGA 3W39A 3KHOA 2N4IA 3QFJB 4AEIL 4WWKB 2X70B 2E3VA 4Y4FB 3ZMRA 1RVFH 3P11L 2PW1A 2V7NB 3KPQA 4PTTB 3BIBX 4NIKB 2VR4A 2VMFA 4K55A 4U6YB 1EA9C 1FFPB 2G5BB 2C1OA 4H1LB 4XVJH 5EZJB 4MXQD 1D5BB 2NY7H 1S3KH 2XA3A 5CSBA 1FE8H 2RCSH 1OAXH 5C6TH 1VFAB 4OB5H 2E27H 1QRNA 5J0BA 1YEFL 3UDWC 4ZO6A 2GJZB 1ZT1B 1YEIL 4QYOA 1DBKH 2X4RA 4PJ9C 3S36L 3DYMA 2DOCA 4NHCH 4Q9QL 1NFDA 4XNUL 2AJYH 1N6QL 3SE4C 5C8JA 1JMXA 1HHHB 2APBA 4I0PA 5BOZG 1UB6A 3PXJA 4V1DB 1HCVA 2VXSL 1KN2H 5CZXC 3RPKA 1NFDF 3B6SA 3RDTB 1A5FL 2VISA 3MYJB 5TDOA 1DN2A 2VL5B 3D85B 5JLZB 2R8SL 2V5RA 3JTSB 1A4KA 5HHOD 4U0QB 4DUVA 2HJFB 4Y4HA 4PJIB 1CTNA 1B4JH 2R4RH 3SDCD 4IRSB 1P4LA 3V0VA 1QLRB 3IJYA 4KPHH 1HEZA 4UV7H 4WI3A 5TF1L 3MSPA 1TETH 3ES6A 3RZCC 1O7VA 1U8HA 2RBLA 2DQUL 5E08L 4DJMA 1ZKAA 5DWUH 2NNAB 5BZDB 4IRJD 2FB4H 5I74B 3QZWB 3WV0A 2EEDA 2VLKE 3PWLA 3ZTNH 5JW3H 5HYEA 2B1AH 3OB0H 1ZLVK 3K8KA 4P4KA 4TNWF 2BXYA 5DUML 3VXMD 3O6FA 2QR0A 4KK8D 2HLAA 4KJQD 4L8BB 4PBXA 1T5XA 4UUJA 3BPCA 4JDZB 2APXA 3HI1A 1U3ZA 2CDFB 1PZUB 5TDPA 1KNOB 1LD9B 1A6WH 3IDNB 3R8QA 2RFXB 1ZHLB 5ENWB 2B2XL 1DVFC 2N7BA 2X4PA 2UZXB 3VWKA 3LKQB 4PJ8D 3UBXB 4U6TA 2QQQA 3O3EB 4NO2B 1RUAL 4W81A 5E9DA 3TZVA 1IQWH 2OI9B 4M6OH 5DJ6B 1AQDB 4RBPH 3V0AC 1W0VA 4QRRA 2V5MA 3U0PB 3C2AH 4JREB 4OQ1A 5C0GB 5T3XE 1T0MB 3EO1A 3MV8A 1AKJD 3PIQB 3RY6C 4BSWB 3HI5L 3X3FL 1KFAH 2AJUL 2UZYB 1XCQA 3FTGA 3D25B 4PGJA 2IGFL 3SO5A 2BMKA 5DVMA 2KQNA 1UM4L 3C5ZD 3U7WL 4M61B 3RGVD 3HR6A 4G7YL 5C0DA 3T04D 5IFHH 3IETB 1AXTH 2R2EA 2EDTA 2C7UB 2DRUA 1UG9A 5BMFH 5F3BA 4OF0A 4HC1A 5IF0B 1WC7B 2NY0D 5C0EB 1VDGA 2J4WH 5IB3A 3DJ9A 2PO6C 4L3ED 1EEQA 4KQ4H 5DMIH 3GBNH 1RIHH 2JB5L 4ZFOL 3O3BB 4WO4D 4KKAD 3MBEB 4NNXA 3PV7A 3HTLX 1MLCA 2BVPB 3WXVH 3S7GA 3GUTA 4DGVH 3FRUB 2O5ZH 4U7MA 4I3RL 3GKWH 1P4IL 1SYVB 1UM6L 3MV9D 3DO3A 3U9UA 3DX7B 2Z91B 3D69A 3MV11 3OB8A 4P48A 2FJHA 3ARYA 5C2BL 4CADA 2X4TB 5IHZA 3QXWA 2ZCHL 3G04A 4OZFA 1K4DB 2H9GA 5F7EH 4UT9L 4PBVC 3BGFC 5BV7H 5JPNA 2J8UF 3PHQB 4HK0A 3S6CA 2IBZX 4KXZH 3V8OA 5TPWH 4JM2C 2FD6H 5AAMA 3G5YA 3QI9C 4LEOA 4X0KB 2B0SL 5T3XH 5HXMA 4LDEB 3MJ9H 3TN0C 3V6OE 8CGTA 3G6AA 1HYSD 4GH7B 5D2NC 5FGBC 4HKZA 3NN8A 5JHLL 2CDEB 3DROA 2P4AB 5JDJA 3NVQA 4XNMB 2AV1A 2ZUQC 1CLYH 1IEHA 5FDWA 3MRHA 4NSKA 3QUXD 3WMSA 3ZDZF 4F2MA 2EDLA 1WWCA 1ZTXL 1YYMH 5EN2B 4I48B 3SDDB 2ZOKA 3T1WA 1OAQH 1PFCA 1SY6H 4JHZA 2XWBA 4BH8A 1E27B 4OV5B 4OFPA 2GTWA 1P1ZB 3X14B 1JZ8A 2BFVH 3KJ6L 4Y5YA 1F6AA 4D2NA 3PP3K 4KK6C 3QXVA 1I1RA 1PLGL 4NNYA 5C3TA 3L5WB 5CSGA 5T1MB 1FFOA 3QAZB 3L3KA 1TZHA 3MA9L 2FL5A 1YECH 2QSQA 1QFWI 5IW1B 1RHFA 1YMHA 4DCQA 3FN9A 3X3GH 1X5GA 5I1KL 1CFTB 4HIJB 3SGJC 3JV6B 3WFDH 1S7RB 2NXZD 3DI2B 3IRPX 3S96B 2A1WH 1JGLH 2GIYA 1DUYB 4TSBL 4XPAH 5JUEH 3VGEA 4P2RE 3S35H 5CIPA 3K4DA 5F96H 3FQTA 5GJTL 5LCVL 2ZUYA 1JZ5A 3DGGA 1IC4L 5DHYA 3WKNA 5KVDH 3O2VL 4NKQB 4G42B 3G5ZB 1DANT 3PGCB 4JR9L 4XVSH 2EICA 2R0WH 3UCRA 4PGZA 1E6OL 1I1FA 1MJJB 1XIWD 1N0XL 5HYJB 2LU7A 5F7MC 3FONB 3NA9H 4R3SA 4L1DA 1NGXA 1MCHA 1E4KA 2FO4A 2I60H 1SM3L 2NMSA 4UILL 1F3RB 1QSFB 4NQDE 4OAWA 4D3CH 3BX7C 3TBSA 1YNLL 1JHLL 5KS9E 3LKOA 4MHHG 5E1HB 2AEWA 2YD3A 3RI5K 1BAFL 2JCCE 4AENB 1A1MB 3H9YA 1NCDH 4XHJD 1W72H 5SX5K 3ZKXB 5FB8A 1MCFA 1Q0XH 3OAZK 2GT9B 1IAOB 3MRGB 3SPVA 3TGXA 1ZSDB 4JG1H 4PGCB 3LDBC 4QRQA 5F1KC 1U41A 3UO1H 2OS7A 4PD4J 4WCYL 1N3NB 3UC0L 1AGFB 2V6HA 3W5MA 1MFBH 4OLYH 3AY4C 2CLRA 2IH3B 1NC2D 3X12B 4HHAA 1A4JA 4K9EC 4MD5B 1AY1L 1CIDA 1HIML 4OUOA 3DMMD 1JRHL 5E1AA 3OR6A 3QCVH 4BFIA 2AJXH 1NUFA 1LDPL 3LEVH 2Q87A 1F4XL 4NN5C 4NN7B 2AEPH 3RNKB 4Y5XC 4LAJH 2WWKT 1MHPH 2APTA 2Q86A 1OARL 2O26U 4FQQA 4A2MA 4OTXL 1JN6B 2ZCLH 4ODXA 1V3JA 4OF6A 3TM6A 1CXKA 4WUKL 1V3KA 5HGDA 3CLEL 4QRUA 5DSCB 3D3VD 3SCMB 2MCPL 2B4CH 3MGOB 5JOFA 3MOBH 1BQHB 3TO2A 1NAKL 2OP4L 3U30B 1J5OL 1CGWA 1Q94A 4OM0H 5I66B 2F8XC 1R5VB 5IJVA 2HKHH 1IL1A 4GMTL 3OKMB 1IQDA 3L5XH 5E2UH 1KPRB 3RNQB 2IH1B 2J7LA 1KCSH 5HVFB 1P7HL 1I1AA 4LHUB 2VC2L 5KBNC 1KB5B 1EHLL 5DYOA 5D4QA 4BUHA 1IM9B 3BWUC 4OCSH 5JNYA 1NCAH 5IQ9A 1KN4L 3BP4B 2JTDA 3BKCH 3QHZH 1K9TA 5J57B 2HP4A 3TIEA 2VDLH 4MNQE 4PRNA 3VD3A 5CD3B 1Q9OB 5D7JD 2A9ML 5EO1A 1NBVL 3Q6FA 4HZAA 4PJDB 4ZFFB 4FQ2H 4UIMB 2VZVA 5LGKA 1K85A 4CW1A 4U1LA 3BPOB 1IC5L 2ENYA 5LQBL 1PSKL 1QP1A 4NUJA 1UJ3A 4KTEL 5ALCL 3PP3H 2EH7L 1WAAA 3P73A 2FNBA 1RJYB 2W0KA 3KYKH 3ZHDA 3P0YH 3X13B 5GGSY 3L3OB 2EIEA 3CFKB 1MIML 4NZRL 2QKIA 4YDVA 4AG4H 4PGEA 4H0HB 3H9SB 1KIQA 4RIRA 1I1YB 5L8LB 3DVFA 1XGRB 4NCDA 4MZ3A 4EBQL 5I75B 3TJEH 2WUBL 2YPLD 4PYHA 2WWMD 3V6FB 1P6AB 1NSNH 3I50H 4OD2A 5CEZE 4I18B 1W0YT 3ARTA 2AQ3A 3ZO0A 5TDNB 3UYRH 5C07E 5T5NG 4LVNB 4Z7WE 3LEYL 4KUZL 3NZ8A 1TFHA 4OJFH 1TJGL 1Q9LB 3KR3H 5D93C 2P5EB 1TJIH 2J1KA 2FX8L 4KZEH 1LE5A 3L95A 3LPWA 3FOMB 2W65B 3B9KA 4TVPD 4Y2DB 3VFNA 4N0FB 1T7XA 5CLWA 1I7ZA 3CXHK 5DZOA 1PKOA 4MDJB 4MXVE 3QDMA 3GMNA 3EW3B 5BS0E 4HLZH 2HRPL 2AK4D 3LMJL 3D18A 2A2QT 3L5JA 1OTSD 5SX5H 2EDQA 4EXKA 2XA8L 3OAZH 1AFVH 4FFYH 1L7IL 1RZGA 1P2CB 4BFGA 4U6XA 5EOQH 2P44B 3K2UH 1A2YA 2DM2A 5JMRA 3QDJD 4N1HB 4LCCA 4RFOL 4RGNE 1FLTX 5EZLB 4PG2C 4JGUA 2MNUA 4OZGE 1N64L 2HT4D 5T1DH 1EHAA 1T1YB 1RZJH 4UDUB 4X80H 1L9MA 3SQOL 5A2KH 2VQUA 1N8ZB 3QO1B 4EI6A 2OL3H 3VXRD 2YSSA 1G6VK 2F74A 2HG5A 5E2WH 1FNHA 4KXZI 2P5WB 4D0BA 5IHBA 4HEPG 5IIEA 3PGDB 4WWID 4KVNH 5CEZH 2IWGA 5MENB 1Z5LB 4N90E 1GCFA 3GSOB 2EDEA 1NLDH 4J4PA 5E56A 5DRZA 4N8VB 1OPGL 4XCNA 1KTDA 3ETBF 3O4OB 4J3TA 5FYKD 1QSED 3D2UB 5E95B 4UTBH 1AD9B 3FOLB 3KLHC 2BJML 4CUCA 3BKYH 2KL6A 3QP3A 2JIXA 3V4UH 2BY2A 3D0LB 3SDXF 5F70A 1CFVH 2B1HH 4H25A 1JPFB 5HHOA 1LO2H 3FB7B 4M62H 4LSVL 4LVOB 4X99B 5JZ7D 1H3TA 5JR1L 2ZZUT 2ENSA 3NTCH 4QTHA 1V5JA 1EHXA 4LRNL 4EN3D 1F4YL 2J5LB 3DHMA 5B8CC 1I3RB 3HNTL 3QH3B 5JORB 5IMLB 4Z77A 2FX9L 1REIA 4QF1B 2W0LA 3MLXL 4P9HC 5E5MB 1I7TA 4GQPH 1T04A 1UFUA 2IPTL 5IVNA 5DEGA 2AQ2A 3EYFA 1G6RH 3T0BA 5BRZA 1N0LA 3QUKA 4HT1H 3R06A 3N1GC 1LO3H 1N26A 1MEXL 3TIDA 1CDJA 3ZE1F 4Y2OA 3EKCA 5CINL 3WHE0 1IJ9A 3MFFA 4N9GA 3WUWA 1A7OH 5CUSL 5EOTA 3RWJB 3GNMH 5DEFB 3HC4L 2C4XA 2G2RB 5HGAB 3C8HA 1UXWB 4QWWD 2DQGH 4RWYH 2ERJB 3WHXA 4HQQH 3TA3D 4NQED 5HVHB 1TZIA 3U83A 3MODH 2IALB 4OI7A 1MSPA 3WLWC 1NAML 1J88A 1YN6A 4X7TA 1ZHBB 4CNIA 5KVFH 3S98A 1A6VL 4FTVE 4JPVH 4B7IA 4RFNC 1NMAL 3QWOB 3JTTA 3IDJA 1IM3B 1WFUA 3O8XA 1UZ6F 5DK0A 1AD0B 1NUGA 2BCKB 1YN7A 2K7PA 4PJFA 1UH2A 5JW5A 5EU5B 1RU9H 3PJSB 3DX6B 4U33A 4NDMB 1B90A 5C7XH 2Z35A 1QFHA 3SO3C 4I0PC 2DI8A 3C6SB 3MRKB 4G8GB 1IGML 4KJPD 5A40E 1U8OB 5T3ZD 2NY5H 3LCYA 2CUMA 3SKUD 7FABH 4WHYH 4KJYB 1Q9WA 4M7JH 5F9WB 3C6LD 3HI6H 3RQ3A 2GKIA 5IROA 3V0WL 3MRRB 3E6FB 1NFIB 2BSRB 3QFJD 1BVLA 1SVCP 1IGIH 2KZWA 3CLFH 2W59A 3MOQA 1G9NH 4WO4A 4Y4HC 2R0ZL 1UCBL 4LQFL 2E9BA 3RZWA 4PRBA 4UI2A 1SJEA 3NGBB 4XH2B 2CUHA 4PGBB 4K8RC 2DWEA 3BXNA 4OM1L 4PRHB 1BFVH 2GJ6D 3ZKQD 3MV9A 4H8WH 4YNYB 4DZ8A 2R2CA 3VI3E 4Y16B 3IT8D 4ZAKB 2DQHL 2C4FU 3CDGB 2BK8A 4CMMB 3V4PH 2D7TH 2Z8RA 1NDMB 2DF3A 3ARGA 5JOEA 3BP6A 4POYA 2YWZA 5JIHA 4RMUA 2ARJB 3DHJA 2AI0L 5IBTH 1CL7I 5FM5O 5F9DC 2W9LA 3T4YB 4P4KC 4X6EB 4CVZA 4FG6C 1RJCA 2DQFA 2ITCA 5AD0A 3O6FC 5MEPB 4BM7A 3PWUB 4OLZL 4AIZB 1L0XA 4Z18A 5FK9B 4V1DD 3QIBB 4K9EL 5ADOL 1CF8L 1I7RB 3VFGH 3PWJA 3RWGB 3QUMA 1P5UA 3D85D 2OMBA 4TUKL 4QHUB 3DV4A 3K1DA 5D7KD 4LSPL 4JG0H 3P77B 1T1ZA 2W9EH 3QIWB 2RJMA 4LGPB 1WITA 2R1YB 2X4NA 3K80A 2CPCA 3GJEA 2X40A 1DANU 1OLZA 4H20L 4HGWA 5E00B 3TZVC 5E24E 3G6JB 4I0CC 1GGIH 2R1XB 4W70A 3AMKA 5EBMB 4YQXH 4JY5H 5GGUA 1PW3A 4OF8A 1RZ7H 1QYGH 4H26A 3QNXB 4M43L 1MHCA 3MJ9A 1S9WB 1UA6H 2CLVB 4YBQD 3RKDD 3IXTA 3UP1A 4G8EB 3OJDA 3IU3A 5EIIB 4PRIB 1EHNA 5JOPD 3L3GA 4JO3H 4R4FL 4UQ2B 4DAGL 3C60B 3ELAT 5ALBH 1BP3B 1ZVSA 1A6AA 1KENH 5SWQA 3RWDB 1YEEL 5KSBB 3HRZA 4L5FH 5E99L 4BELD 4JKPH 3KDMB 5IB5B 2EKSA 1SY6A 4EQ3A 5IM7B 1LGVA 4NT6B 2OLDA 4YEFA 2IAMB 2ADJA 3CXDL 3TNMA 4HFWA 2VUYA 4PRPB 1T89A 5D7IB 1ZA3B 2QHLA 4HCRL 4PS4H 2DIJA 1XIWA 3KPMA 3SOBL 5AG8A 5EO9A 4DKFH 2UUDK 2DWDA 3ZL4L 1CTOA 2BVUA 2VRAA 4OSUL 1XZ0A 4P4RA 3HMWH 2GCYA 4P2OB 5JO5A 1IEAA 5K9JL 4U49A 1B6UA 3LV3A 2ICEB 2VXUH 2VDOL 3AXLB 4S1RL 3KYMB 4U7KA 5B39G 3VXNB 3LRGA 3IDGA 4IHOA 5D2LB 4H0IA 3NFPA 3TV3L 2O5XH 3ET9F 5I1LB 3I3DA 4NWTH 2DQEL 3MRJB 3LB6C 2DQTL 3ZZ1A 4E9LA 3DOSA 1GGUA 2IANB 1FZOB 2Q6WB 3OXSA 4XB7A 1OAUL 4K07A 3RL2B 5DS8A 2WWKO 5GZNC 5FO7A 5HPOA 3SGDI 3RY5A 3ALWA 3LQAH 3BHBB 1UZ8B 3IDIB 2NX5E 1HSBA 5IQ7L 3TBTB 5D6CB 4GXUN 4AMKL 2EIBA 4GLRI 3U46A 4WNQB 4E42B 1WFTA 3MZGB 5E94A 3MBED 1J7VR 2UYLA 4Z7QE 1UQSB 1NCTA 3N0PB 4DKEH 2A9NL 4LSDA 3CMGA 5BXFB 3H42L 1PYWB 4Y5YC 4IRZH 2WINA 3QRGH 3UYOD 1MFEH 5J6HB 4IS6A 1S9XA 1FL3A 3QPXL 4JFXA 4KMQA 4C56D 3MROA 1G7QA 2X9YA 3MV7B 1EEYA 4LLVA 4WTZA 1XGQA 4WY7H 1BECA 1Z9SA 3O41A 3WFEL 1MI5B 1WBZB 5F8QC 4P57A 1OTTC 1BZ9A 2WMPA 3GRWH 1JTOA 2HA1A 2CK0H 3LQZA 5CJ5A 1YY8B 2MKLC 2R0LL 5JHDB 3D3VA 3BP7B 1KG0A 4HWEL 4I5BB 2EDFA 1HI6A 3MQIA 4OUUB 3SJVE 3C09C 4OZHA 2VZ3A 3RWHB 4LCWB 3ZDXE 1LNUB 5EBWB 4JFPB 3W0WD 3I2CL 4P2RA 1J05A 4MXWL 2VAAB 4U6HB 1CBVH 5EFIB 3NFSL 4MNGB 1MY5A 2AGJH 5IW6B 4LSQH 5GRVK 3P0GB 3CUPB 1U8IA 3BUYA 5E2VH 4NC2B 3VFSB 2XWJB 3BVNB 5C0CD 1F97A 4MD4A 3SDDD 1WZLA 4UDTA 1JF5A 3VFPB 4HKBB 1BBJA 4ZYKA 1KPUA 4HPYL 4X7SL 4GUPB 4G43B 3DX9A 1IARB 1NCCH 4EUPB 1FQ9C 1Z0MA 4L8SC 4YFEA 5CJQL 5D8JH 5ABDE 2R2HA 4NPYB 1D5IL 1XMWA 5B21A 1P4BH 1BOGB 4Y0GA 3VDCA 5KS9A 1LWRA 2YA1A 3RZCB 2MKWA 2NTFA 4FZ8L 5TE4L 2CGRL 1CXIA 2BSTA 1R5IA 4YHNA 5KS9F 2DYPA 3DVGB 1QHPA 4LCIH 1TJHH 2A77H 3Q6GL 1F3JA 2P1YA 2JCCF 1D5XA 1K3IA 4ALAH 4PJEB 4ZUTA 1UVQB 4YHZL 4QXUH 2OJEB 3L1OL 3AAZA 5EA0L 2XZQH 2NQCA 4DKAA 4OIAA 5FA3B 4KKCD 2X42A 3V52H 1DQLL 4HMCA 1I4FA 2BX5A 1UB5B 5KTEH 4PPTA 4ETYA 3G9AB 5DJXA 3TFKD 1U91A 4PG9B 4OZIB 1DVFB 32C2A 4O2EA 2OM5A 4GKNB 1S78D 1DBAH 1R5WB 4JGMA 1RIUL 4L29A 2D3VA 4P3WA 4IIQA 4YDJA 1OAYL 4J1UB 4NRYB 2J12B 3L3JB 3VE0B 4F37K 5KVEH 1HINH 2HVJA 1BX2B 1MFCH 2BP3A 3UZEA 2OMNA 4UT7L 5IFAH 1C5DA 4P9HL 3INUH 5E8PB 2EXYD 2AXJA 2DM3A 3EO9H 3LRSA 3S88L 1QSFD 1QBMH 1KELL 4FQHB 3KLAA 3W5NA 4TSAL 5CGMA 2AAVA 1MQKL 2MOVA 3PWNA 4R26H 1M6OB 1J86A 1GHFH 3MZTA 3QG7H 3GSQA 4HDIA 4H1LG 4JJ5A 3TJHC 2UUDH 3TO4A 5DJ2A 1KLGA 3ARBB 1Q1JL 1U8LA 4R8WL 5GS0D 2MQ0A 3MOAH 1GZQA 2VR9A 4PLOB 5F1IB 3P0VL 4OT1H 1HN1A 2ZWLT 2O5YL 4ODUA 4JCLA 1P7QB 1T0PB 1TVDA 2YA0A 5FGCB 3WE6A 3QRFM 5C0IB 1J18A 1HQRB 3IFLL 4K94C 4NZTH 1FO0L 2PCPB 3OZ9L 1H5BA 3D0VB 4AT6B 2HKFL 1YEDB 4M7LT 5FYLL 3OL2A 3UMTA 4M00A 3EGSB 4PGDA 1FV1A 3NFNA 1P53A 1JBJA 3OJ2C 3SKOA 3IDXH 4WFGE 4NWUH 1RFDL 5J8OA 4D0DB 2HTLD 3EJJX 1BLNB 4OCWL 4MNQA 4YHKL 1D9KA 4Q97A 3I3BA 4OGAC 5C9JA 1INQA 4JM2B 5F9OL 4XI5C 2W0FA 4NHUA 4UTAH 4OBSA 1YPZB 1UJ3C 2OTWB 5FO9B 3TN0B 3AVEA 3LN5A 3DXAE 3RI5F 3SCMD 5D2NB 2H32B 4RQQA 1CFSB 3VA2C 4X4MA 3MA7B 3O0RH 5LGHH 4JO1L 4K8RL 3VGGA 5B38A 2VLJA 3QZWG 4HJ0D 2ADGA 3EZ8A 5CSZB 5HSFA 4LQ1A 4WEBL 1AP2B 4LRIA 3DUUA 5EPMA 5F7HA 2HTKD 4LHUD 3GSXB 3T08A 4NM8L 2BNQB 2DICA 2PW2A 1IM9D 2A6KA 3EOYG 5DJYB 3BD3A 1LQSR 1BFTA 3UTZB 4JEGB 2VZSA 4Z7WA 4L3EE 2BVEA 1BJ1H 3NABH 2XKNA 3IVKA 4HGKC 1KCKA 3MREB 4HJJH 4P3DA 5D71H 5EWIH 5ANME 1Z9OA 3EZJB 1M7DA 3F12B 4PTUB 4JKWA 3UBXG 3VH8B 4Z7WF 4YR6A 1NGWA 3B9KC 4HWBL 4JFEE 5IB1B 1OB1A 2GITA 4HWNA 1T3FA 4PJHB 3GDBA 3EOTH 3VMOA 2YPKA 4G9DA 2ARJQ 4PB0L 4RMQA 5I18L 1CI5A 4FQIL 3STLB 3OHXB 4FQLH 2X4SB 2ICWA 5E8OB 3BAEH 3RTQA 3HZVA 2D03H 1EUTA 5E8NB 4TPRH 1KIUA 5KSAD 2ZOLA 4MA1C 5L2JB 4IEFB 4MXVF 4ZTOL 1UKSA 2DTSA 4JPKH 5BZWA 1FCCA 1MFDH 1FIGH 5C6WH 3OG6B 1WSST 2R1WA 4G9FA 3TA3A 5F3HA 3H9SD 2X5PA 1WUNT 4DQOH 4JANB 4HUVA 4LCCC 3HPJB 4NZUL 1CVSC 1MAJA 1HH9B 1QA9B 3HUJA 3RKPA 4HG4K 4OZGA 4CU7A 5GISL 1G6RA 3MRBA 4KRPC 5ADPH 3BH8A 5GSVB 1FGVH 3EFDL 1KTLB 4OZGF 5B4MD 1OP3K 4L3CA 5F88B 4MD0B 1VGEL 4O2FB 4BSJA 1AE6L 2JK5A 5ESQB 2F5AL 4P5KB 5C0FB 5LGJA 4HC1L 3MGTA 4J4PC 2ZPKL 4FXGA 4NKMB 1J8HE 4Y4KA 3AROA 4Y2DD 4C59B 3PDGA 2KH2B 5IMMB 4IDJH 1E28A 1PG7W 3LDBB 5DQJB 1XGTA 1CD9B 1AI1H 1CZ8H 3MNVB 1KGCD 3T65A 3UJTL 3C6LA 1MPAL 2F54E 3DSFL 3CVHA 5KVMC 1CCZA 4I9WE 3QFDB 1U8NB 1A9BB 4XAWH 3HKFA 3WD5H 3BO8B 1L6ZA 4HW6A 4KK9C 2XQBL 1AIFB 1FFRA 1KT2B 5H37G 1DLFH 2WIIA 3EDFA 2VDNH 1EZVX 4ONFH 4ZO8A 2GJ6A 3LOWA 5EBLB 5ICXA 4LSUH 1RK0A 2KZ1B 2I9TB 4F7EB 5DLMH 1J1PH 5JQ6L 2NXYD 4NN5B 3WO4C 3FL7A 2YD8A 4RISH 4QRSA 1VACB 1JZ3A 4GKZA 1HXMB 1SYSB 5FCUH 3LKRB 1SBSL 4BQ8A 3DECA 4BH7A 1U3YA 1P7KB 1YEJH 4PREA 3SGEH 4Z76A 2YEZB 1GSMA 4WEUD 4J3OC 1OAKL 2P5WD 5I1IH 1CD1B 2OR9H 2OZ4H 2JJTA 3V5DB 5MEND 5EB9A 5HYQB 4PB9H 1U93B 3U6RB 2YKLH 4NQVB 3D2UD 4HF5H 2GAZA 4MA3B 5IT2L 2LAAA 2EDJA 4JM4H 3U9PH 4EJ1C 2BVYA 5DMKB 2HWZL 4PJAA 1TQBC 2E5EA 4KK5C 1JF1B 3QXDB 4YE4L 3BUTA 1ED3A 3U0TA 3P4OB 1Z9LA 1U0QA 3MC0A 1VKXA 2AABH 5EC2B 4UNVA 3PE9A 1EO5A 5HYSB 4P46C 4GAYB 1T1XB 2FCBA 3VG9C 5DD1L 2PR4H 3RVVD 3FB6B 1CFNB 3RIAK 3OBAA 1KCUL 5I8OH 4U0RC 4QXWA 3E8UL 4FTVA 3CX5K 3O8XC 4IM8A 4OIIH 3TNNA 1MJ7L 3CH1B 1AHWA 1MJ8H 3B9VA 4X6CB 3GMOB 2P8MB 1WJ3A 3PL6C 3R1GL 4ZXBC 5GS2H 3LN9A 2R4SH 1JI2A 4WUUB 1X4ZA 2XOTA 3AB0B 5TGBA 2ESVD 3ARPA 1UACH 4F58H 3QULA 1VGKB 5GGRB 4S0SD 4A6YH 4JZJB 3I75A 5IROC 3HAEG 1EO8H 3MO1A 2FO1A 4WU5A 1D6VH 3ISWA 4MSWB 3DIFB 4NJ9H 3BRFA 1RZFL 3M07A 3GO1L 3HB3D 4X8JA 1JPGA 5SWSA 4LF3A 1SJVA 1ULVA 4FS0A 4H5SA 5DD5L 1BZ7B 2ILLA 1G7IA 3WSQH 3QEHB 4J6RL 1IGCH 4KI5F 1XCTB 1BD2A 4LEXL 2ZUXA 3BZFA 1WIUA 4RNRB 3ARGC 5F7NC 3HRPA 4AIOA 2EE3A 4XNQB 2BNUA 2NR6C 3SE9H 5C08E 4B7LA 5D93B 1MVUA 5I1HH 1VPOL 3HE7A 4KKNA 3VRJB 4HS3B 5KN5B 1IKNA 4MHHI 1T2QL 3CFEB 4BFEA 4G8GD 3PHOB 1FORH 4LFHG 3O6ML 4F7CA 3IJSA 1JMZA 3RPIA 2BHUA 2FJGA 1GGYA 3VFVA 3WS3A 3THMH 1OP3H 4ZD3H 3WKML 4LBEA 4G7VH 4IOIB 5I1DA 2BDNH 2NTSP 1WZ1H 1N6UA 3GSWA 3T2NL 3MRNA 3HZYA 3G5XA 3SKJL 1V7MH 4AM0A 2KDGA 3HNVH 4R0LA 2H26A 4PRHD 1BQHG 2YPVH 4NQUA 4KDTC 2QTEA 1HH6B 4Z9KB 1JK8B 4OFYD 2BNRE 4PV9B 4M93C 1DQJB 3WNNA 4ZAKD 3STBA 1OAZH 3VJ6A 3TBVB 1WWBX 2AERT 4IMLA 4PJCE 5EO0A 2V2XB 4K7PL 5D1XA 2VOTA 4MJ2A 3QDGE 4Y1AB 4DVBB 2VXTL 3LSOA 4OGYL 5GGVL 3KPNA 5CGTA 4LHUG 3SE8H 2PYEE 3MRIA 2WLZA 3UPRB 1ZA6B 4OLWH 2EECA 4FMKA 4JGJA 3SKMA 5CKGA 4U1JB 3TBWB 1Y6KR 4YXKL 4M6NH 2ZSVB 4S1QH 2X1OA 4LLUB 3QIBD 5EUKA 4MDIA 4ISVB 1MHHA 3FO2A 1F58H 4K94L 5D9SB 1R3KA 3GMLA 2YD2A 1IAKB 4AEHL 4CJ0A 1MCWW 4U1IB 4TN9A 1T89C 4R7NA 1CLOL 5L9DH 1BM3H 2VIRA 4YHOL 2CR6A 5C0CA 3S37L 1AH1A 1YDPA 4TVPE 1OT2A 3EUUA 3IXAA 2R2BB 4ZUUA 2YC1B 3BP5B 3QIWD 5DJDB 3RBSA 4XC3H 1RZ8B 4NO0B 4XNXL 3AREA 1JF6A 4FQJL 3Q1SL 4KROC 2R56H 1EX0A 3LHPL 4F3FA 4QOKD 1YQVH 5B8CB 1DQQA 1FFQA 3LZFH 4KUCD 4M6MH 1UWEH 3N85H 4F57L 1H3PL 3OKKB 2CXGA 2EZ0C 2ICES 1U58B 3QEUA 4PRID 3IDUA 2V9QA 4JFDE 2FBJH 4RFEB 3CZFB 1CGSL 1J1XH 3ABZA 4K3DL 4P5MB 4JRWA 1DBBH 5E6ID 4JKLA 5ESVB 1MCWM 5DJ8B 3GI8H 3QEGL 3BW9A 1FL5B 3W2DH 3W39B 2VDPL 3VXRE 4TSCL 1YYLL 1KC5H 5HI5C 2NX5A 2Y36H 4XPFL 2HJLA 2CJUH 1A3QA 2IAMD 4WGWB 3D39D 2PW1B 3KPQB 1A7RL 2FECL 1AQKH 2XXCB 1PY9A 2NY2D 2EIDA 3PP4L 4JFHE 4PRPD 3O81A 1NGQH 2C1OB 1TPXB 1NLBH 5DZLA 4RFNB 1MRCL 3MBXH 3P9WB 3VFUA 4ORZC 1ES0A 4Z7QF 4TVPH 1JPSH 4LSSL 4TTGA 2DL2A 3CFCL 4QYOB 35C8L 1ZLUK 1WCBA 5ITBH 1C1EH 4HS6A 4XXCA 5GPRA 4XBEL 5C8JB 3SO3B 2A0LD 4I0PB 1PAMA 4GMSH 1UB6B 3N06B 2YD6A 3RP1A 2RR3A 4K23L 5E5RB 3B6SB 2VISB 5TDOB 4AEEA 3EYSL 2L4OA 3ZDXF 2VXQH 1QG3A 2UY6A 1EEZA 1A4KB 3T0EE 2VZTA 2JLLA 4CBPA 3OG4B 5FHAL 4KHXH 1H8SA 2I9LA 4N8VG 2FIKA 4BZ1H 2YOCA 1CLCA 4NCC1 3V0VB 4Z7UE 3W11C 3IJYB 2V7HB 5CMAA 2H2PC 1IILE 1E4WH 3H0TB 1U8PA 1ITCA 3SDAA 2B4CC 3UROR 3ES6B 1U8HB 3BJLA 3GEWB 4YPGA 5H8DA 3QWQB 5IK3A 3WJLA 5ITFA 1RVFL 3HHRB 5I1GH 1IC7H 3MV7D 5IJKC 2BC4A 1URLA 3BGMB 4XP9H 1ND0B 4XVJL 1JTTA 3OX8A 4P4KB 3GMPA 2XTJE 4S1SL 2NY7L 1S3KL 1XF2A 3MLYH 4FQCH 5CJXA 4PJ9D 5JHDD 2BSED 3O6FB 2QR0B 3BYTA 3MCKA 1FE8L 2RCSL 4NQCD 1OAXL 2HLAB 4WI8A 5C6TL 4LCWD 1T5XB 4OB5L 2DMBA 3BPCB 1JNLH 2K9UA 2E27L 2VDRH 3HI1B 4JN2A 4CMHB 5CZXD 5TDPB 2DS4A 4JDTH 5FYJE 2ICWJ 3V7AE 4OGXL 5DQDH 2X4PB 3VWKB 1S9VA 5CGYC 4C83A 1DBKL 2NW3A 4NHCL 1INEH 2AJYL 5E9DB 3TZVB 1W0VB 3F58H 4QRRB 1KN2L 4NYLA 4PR5A 3EO1B 3MV8B 2CR3A 3NA4A 3MLZH 4GAFB 4ZPVA 1XCQB 4UV4H 3FTGB 2YXMA 3RZCD 2BMKB 2W07A 5HI4C 3VFOB 5CZVH 2R4RL 3OKLA 3TO4C 1B2WH 3ZKMC 1LO4H 2R2EB 2FR4A 4IMKA 2MCG1 4NNPL 4XP1H 4UV7L 4LARH 2DQCL 5F3BB 3MUY1 1AGBA 5DUBB 4HWZA 1M7IA 3SE3A 4NRZB 2UY7A 1I8MB 5DK2A 1TLKA 1TETL 1ZT4A 5KSAA 5IB3B 5DWUL 3NMEA 1KCVH 2FB4L 4N5UA 5IWLA 2BRQA 5JW3L 1KB9J 4NNXB 2B1AL 4P3CH 1MLCB 4ONOA 1DVFD 1H5BC 3SEPA 2JJWA 3K1KC 3GUTB 4KKBC 4PFEA 1RULH 3U9UB 3D69B 4V1DE 4OCYH 5FYJH 4U31A 2FJHB 4CADB 3JVGC 1A6WL 3G04B 4OZFB 2H9GB 3IGAA 3NCYS 4L4TE 3EYUH 1D9KC 5JPNB 3VFTA 4HK0B 3KWWA 4WFEE 3RHWF 5D7KE 2EYSA 3EDKA 2V5SA 3FFDA 3KPPA 4AL8H 4PJIE 1MCPH 3PGFH 2A6JA 3G5YB 4DUWA 4LEOB 1IQWL 1NJ9A 4M6OL 2F9BT 5DQ9A 2M26A 4GRWB 1OM3H 1HHJA 2WNGA 3FB8A 3G6AB 43C9A 3C2AL 5IB4A 1CXEA 4HKZB 3NN8B 3DXAA 3EJYC 1M71A 3DROB 5C0BA 5DFVC 2AV1B 3CU7A 4HJGA 1KFAL 5FDWB 1RZJC 4AIXA 3BDYH 4GRMA 4JPIA 1H3VA 3QQ3A 4F2MB 1YZZA 2PO6D 1ZLUH 1T1WA 2P8PA 4H1LH 4LRIC 4I2XA 5DK3A 1JUFB 2ZOKB 4K3JH 4XVTH 1D5MA 4E41D 3FN0H 4WTWA 5DT1H 5EH1A 5IFHL 4NO5A 2XWBB 4BH8B 1AXTL 3UYPA 5EOCH 5C0JA 3QYCA 2GTWB 5BMFL 3FQXA 3KPSB 1F6AB 4PLJC 2J4WL 2XYCA 3ZHKA 4NNYB 1KCRL 4KQ4L 5DMIL 4WFHE 3GBNL 1JHKH 1RIHL 1FFOB 5I30H 3L3KB 1TZHB 2FL5B 3C8DA 2BXZA 5I71C 1J11A 4F37F 4NOFA 5K33A 4DCQB 5T5NF 4DGVL 2DIAA 2O5ZL 4JFEA 3GKWL 5L7XL 4JM2D 3QI9D 5KANG 4F9LA 1OF2A 3C09B 4U1MA 5EZOH 3RTQC 3TN0D 5CIPB 3O4LD 5F7EL 2V17L 2XQYK 1B0WA 4EOWL 3A6OA 5DHYB 3BKJH 2EYRA 4YO0B 1TVHA 4KHTH 4UB0H 3BN3B 5TPWL 4Y8AA 4QXTA 5TFSH 1F4HA 1IVLA 2FD6L 4KV5E 2NPLX 1I1FB 4U3XA 2Y9RT 4XXDA 6CGTA 5T3XL 4U7SA 3S3SA 4MLIA 4P5TA 3MJ9L 4RGNC 1ZXQA 4R3SB 4X7FC 4NFDA 1NGXB 3D1MC 3EYVA 2OZ4A 2FO4B 4OAWB 3TBSB 1CLYL 4QHNA 2P42B 3LVEA 4KK6D 1YYML 2EDDA 4PY8I 1RUPH 4JB9H 4JRXA 2EO1A 3LKNA 5FB8B 5J9PA 1OAQL 1SY6L 5T5FH 3SGKA 4M7KH 4Y4KC 4JN1H 4GG8A 2ESVA 3BIKA 4QRQB 1MRFH 1QLFA 1NBZA 2BFVL 1JL8A 3ARWA 1UYWH 4FABH 1ZWIA 4RGOH 2F54A 2CLRB 1YECL 4HHAB 1A4JB 5KSUA 3X3GL 1LK2A 3PWPE 2ZKHH 5I16A 1OOAA 5E1AB 4BFIB 1IGYB 1K3ZA 2BOBA 2IFGA 2A1WL 5DC0A 1JGLL 1NMCC 1VERA 1VESA 1KLUA 3RVUC 3CFBA 4XPAL 5JUEL 3S35L 1FGNH 5F96L 4HBCH 1QQDA 4MJ6A 1G0XA 2GQHA 3O6KL 4FNLH 5CZKA 3BKMH 3GMRB 2Q86B 2NY5C 4FQQB 5KVDL 3NOIA 1H9VA 1YQ2A 2CKBA 1VHPA 1SJXA 4ODXB 4XVSL 3B8SA 2R0WL 4A6YA 1EFXA 4B50A 3GHBH 2JJTC 3A6CL 5HGDB 3DRTA 1G9NC 1OL0A 4K7FA 5E8EA 2FLRT 5JOFB 1I7UA 3TO2B 2I60L 4D3CL 2FEEL 4H8WC 1Q94B 3V9FA 1U8MA 5IJVB 9CGTA 3MRLA 1IL1B 5DHVH 1CK0H 1IQDB 2E7HA 1NCDL 1W72L 1Q0XL 5GXBB 5IR1A 3T2QA 5ESAA 1HDMA 5F97E 1I1AB 5DYOB 1DUZA 3GSNB 2IG2L 3UO1L 1MNUL 3BESR 1IEBA 3T8XA 4JFQA 5JPMA 4M6AA 4WJ5A 1WBYA 1GPOH 4Z6AT 5JNYB 3V4VL 1MFBL 5IQ9B 2YBRA 3GSVA 3LY6A 5HHMB 1AHWC 1NBQA 3ZT5A 5DJAA 2YMXL 3TIEB 3BSZH 4PRNB 4TNVF 3MLRH 5EO1B 3Q6FB 3QCVL 2AJXL 2I5YH 4CW1B 4U1LB 5HYJE 3LEVL 4QRPA 5FKAA 4EUPG 2AEPL 1UJ3B 3Q48A 1MHPL 1QFWM 1QSFE 3P73B 1RPQA 3R4DA 4HIIA 1T66C 2ZCLL 4YDVB 2QKIB 3IU4H 1FZJA 1K6QH 4PGEB 1KIQB 4RIRB 4X6DE 2B20A 1I9JH 3QNZA 3B5GA 1FAIH 2B4CL 5FECA 4HXBH 3MOBL 5HY9A 2Y23A 4M7ZB 4OM0L 3BQUA 4ODHH 3NZ8B 1ZV5A 4GT7A 5E2UL 2J6EA 4G3YH 1FNSH 1DQMH 1KCSL 5C08A 1LE5B 3L95B 4D94A 3HE7C 5I1AA 4XPTH 3B9KB 2Y72A 4WUUD 1IKNC 3VFNB 1S9YA 5E6IA 1I7ZB 3K7UA 2P8LA 5I8KL 2A83A 1IAII 3QDMB 4XAKE 3GMNB 4OCSL 1NCAL 1ZHKB 3QHZL 1KTKE 4X4XA 1IE5A 5I2IA 4KDVA 2VDLL 3RY4A 4XNZC 1II4E 3D18B 1INDL 1WLHA 3D39A 5EU3A 4ZUSA 4FQ2L 1FYTA 2N7AA 2DLEA 2JJVA 3ZSTA 1RZGB 4U6XB 3BMVA 4R0LC 1A2YB 3BZEA 2ZG2A 4G6AC 2ATKA 3HFMH 2VKXA 5MI0B 1J12A 2PNDA 2BNRA 3KYKL 1SEBB 4P9MH 4TNWK 3TWCH 3P0YL 5D1XC 4DZBA 4EI6B 1MCLA 1PGRB 3WXWH 3H3BC 2YSSB 4X5LA 2F74B 2HG5B 5F72S 3WYRA 3QDGA 4D0BB 3LQAC 3VXSE 5IIEB 1CT8A 3W9DA 5EU4A 4ZG1A 3M8OH 1HHGA 3TJEL 1JFQH 4PJCF 3I3EA 2PYEA 2Q7NA 4G6FD 3N1MC 5HGHA 2ATPA 1NSNL 3I50L 5DRZB 5I76A 1P84K 4XCNB 1BGXH 1KTDB 4GW5A 1MH5A 4GS7C 5CCKH 1CE1H 4Z7VA 1HOCA 2JIXB 4OCXH 5DRXA 4OJFL 4LVEA 4X8XA 4H25B 5E8DH 4XC1H 1TJIL 3O3DA 5HHOB 4KZEL 1OT1A 3QQ9C 2FSEA 1G7JA 1C5BL 3R0MA 2DBLH 3HE6A 5DUPL 3DETC 5KSVB 3O3UN 3AREC 3T1FA 1ZAGA 4GG6A 4QTHB 5JXAH 5HTSA 1U36A 2IF7A 3ARRA 3WO4B 5C09D 5T1KA 3RX7A 4F15C 2IQAA 3WIHH 4Z77B 4W6XB 3ORJA 4DUXA 1ZE3C 1XT5A 3VCLA 4E0RB 4NKIH 4IRJB 5F9JA 1AFVL 1Z2KA 4FFYL 4Q0XH 1FZMA 4WI2A 1A64A 3K2UL 5DEGB 4TUOA 1X7QA 4PJ9A 5BRZB 3JUYA 3QUKB 5MP6H 3R06B 4ZQKA 5T1DL 4YHIA 1F11A 1RZJL 1AGEA 5FIEA 3TIDB 3ARVA 4X80L 2R9HC 3O9WA 5F93C 1UKQA 3MFFB 3KLHD 4N9GB 1C8PA 1C7SA 5E2WL 3WUWB 4EXPX 5EOTB 1NC4A 2JKXA 4WV1A 4M8QA 1TQBB 1FLRH 1BJ8A 4LPYA 3IJHA 5D1QA 1KF9B 1A6UL 3VH8G 4KVNL 2P5EE 1DBMH 4PJXA 1TZIB 1NLDL 4HSQA 4V2BA 1MRDH 1X4XA 1Q72H 4N68A 5IOPA 3BPLC 1FNFA 2LVEA 1YN6B 4X7TB 4CNIB 5TE6H 3VG9B 2DN7A 4UTBL 3KLDA 4EKXA 3QPQC 4NO0D 3WFCH 3BKYL 1RY7B 4U0RB 1I3GH 3OV6A 3ILPA 3JTTB 3IDJB 3V4UL 1X44A 5FO8A 3O8XB 5J56B 3VXQA 1L7TH 2B1HL 5DK0B 4JDVA 1YN7B 4PJFB 1LO2L 5JW5B 4I77H 4ERSH 1DQTA 2WUCH 4YGAB 1OGAE 2VDMH 3BMWA 5IVXB 1LEKA 4XXCC 4Q6IC 1FZKA 2Z35B 3MRCA 3NTCL 2NZ9C 3EOAA 4OQTH 3VMPA 2ED9A 2AEQH 2CQVA 1Q9WB 4APQA 5DD0H 5DFWH 3UBXI 4QT5A 3UTSA 2LTQC 3QQ4A 4FZEL 1EJ6A 1BVLB 3QA3A 4E5XA 4WO4B 3T0EA 3P11H 4PRBB 1SJEB 5KZCB 1EBPA 4C4KO 1G6RL 5IFJA 2Z92A 2DWEB 3BXNB 4CL7A 3BRGC 4HT1L 5J06A 3MV9B 4DZ8B 4RCAA 1LO3L 4HUUA 5T1LA 3O2DH 3WLWD 2PUQT 4O51A 4POUB 3SDAC 2KUTA 3FKUS 1LE9A 4FFVC 4XGZA 3T0WA 3LS4L 1A7OL 3WJLC 3GNML 1YY9C 3ARGB 4Z7UF 1QRND 3BP6B 5FYLD 4RWYL 4HQQL 3MODL 4CVZB 3K3QA 4OI9A 4OFKA 5CJXC 2ITCB 4PLKC 5AD0B 5KVFL 2VN4A 1JPTH 4JHAH 4JPVL 3WBDA 4I0PD 4YWGL 5IV2B 4HZLA 5EC1A 5FV1L 2YRLA 2BVOA 1NKRA 1KSRA 3FAXA 5D96C 3QUMB 1RU9L 2D2OA 4RMSA 2PO6A 2XN9A 2CRZA 3DV4B 2R8SH 4ORGA 4MB3A 1G7MA 4K3EH 5EU6E 1T1ZB 4E41A 2X4NB 4Y4HD 3GJEB 4MAYA 4HGWB 1UEYA 2E7LA 1SJHA 4K8RD 1S7QA 2NY5L 7FABL 3CK0L 4M7JL 4RA3A 1CFQA 3DTXA 4RZCA 5GGUB 3HI6L 4H26B 1Y6NR 1NPUA 1MHCB 5EZIH 4NRXA 3IXTB 3P9LA 3G08A 1IGIL 1U2HA 3OJDB 3CLFL 5E4EB 1G9NL 4WW2A 5E08H 2Y1VA 1NCBL 2M2DA 4KGLA 2PXYC 2JJSA 3JZ7A 1PD6A 5GJSH 3L3GB 3OKYA 4UIKH 3SDCC 5HYSG 1RI8A 1BFVL 1ZVSB 4H8WL 1A6AB 4IMKC 4U6YA 3QI9A 4P4KD 5SWQB 4JZOA 3HRZB 1EGJH 4FG6D 1D5BA 5FCSH 2XWTA 3O6FD 5DUMH 1EXUA 2EKSB 5ACZB 3V4PL 5GGQH 2W92A 3O4LA 2D7TL 3R0NA 3MLPA 4A2LA 2YUVA 2CUIA 4FQXC 2ADJB 3TNMB 4HFWB 2DLHA 3AU1A 4ZFGL 5IWLC 2LABA 3AUVA 1XR9A 1QKZH 3SN6N 5TQ2H 4OD1H 1UEMA 1W8OA 1PDKA 4PJ5D 1XIWB 3VWKD 3I9GH 4MA7L 1I8KA 3KPMB 4P59H 1JI1A 2DWDB 4PP1C 1C08A 4G8GE 3TZVD 4KK8C 1XZ0B 4P4RB 4QCIA 2GCYB 5JO5B 1QNZH 1IEAB 3JWOH 3LV3B 4LAQH 3VFGL 3MV8D 2IPUK 1X3DA 3RDTA 1NAMA 3IDGB 2OSLA 3MYJA 4IHOB 1HNFA 3NFPB 3MUJA 2D9QB 2VL5A 3BE1L 5DC4B 5SV4A 1YJDH 4L4TA 4YHMH 4G6MH 4YX2H 2C3VA 4RSVA 2W9EL 2IGFH 1DTUA 4G80A 5CP3A 4PJIA 5H2BA 4N0CC 3HC0A 3OXSB 5IBUB 3SGJA 1GGIL 1G0YR 4PRHE 3QISA 4IRSA 4X9HA 5DS8B 3K81A 4YQXL 4JY5L 2H2SC 1F2QA 3ZDYF 4PJIF 1RAMA 1RZ7L 1QYGL 5FO7B 3CFJA 3TT1L 1UA6L 1HSBB 5AAWA 3TT3H 3LD8C 3U46B 2W9DH 5GRXG 1ZLSH 1FPTL 3FMGL 4MS8D 5E94B 4YUEH 5ALBL 2UYLB 1G9MH 1KENL 3DLQR 4L5FL 2VQTA 5JIPA 4JKPL 3TBYA 1TTUA 2R23B 2IFFL 1P4IH 2W1NA 3H2WA 3S36X 4IS6B 1S9XB 1FL3B 5C2BH 3QHFH 3MROB 4MCYB 1G7QB 3OKNA 4LLVB 1EEYB 1XGQB 4PRAA 3O41B 3GFUA 4PS4L 2Y25A 4P57B 2DKSA 1BZ9B 5FOJA 5F44A 3LQZB 2OQJB 3KPRA 3RJQB 4DKFL 3D3VB 1T4KA 1KG0B 3LB6D 3O3EA 4Q7DA 4MGXA 4F9LC 4OZHB 5DRNA 2X05A 4P2RB 1BOYA 1J05B 4CU8A 5GZND 2R29H 1UM5H 3HPLB 3WLBA 4ZPTA 1U8IB 3BUYB 3AY4A 2O5XL 1R0AH 5J1AA 4NWTL 1BBDH 3GM0A 2LU3A 1XGUA 4PRIE 4MD4B 1K4CA 3EHBD 4UDTB 1YUHA 4P5TC 4ZUVA 3QNYA 1BBJB 4ZYKB 1KPUB 4GQ9H 3D5OF 5H35A 4R7DA 1A7BA 4KV5F 3QWRA 3LQAL 2R2HB 4Y5XA 4O5LH 2QL1A 2NTFB 3HG1E 3PF2A 1LP9B 1G1CA 2A38A 1BJMA 2BSTB 3I84A 1R5IB 1SMOA 3O3BA 2DYPB 2JJUA 2A73A 4YHNB 1OTTD 4YDIH 5DHVA 2DJUA 1F3JB 1ZANH 1D5XB 4DKEL 4QGYA 5IW3A 4ZUTB 3QRGL 4OFVA 1MFEL 3AAZB 2NY6C 2R69H 3C87A 3RVXC 4TSBH 3I6LD 1U95A 1I8LA 1I4FB 3OAUH 4WY7L 5D2LE 5DJXB 1U91B 1U9KA 1FG9C 2A74A 4JFFA 1KJVA 32C2B 4O2EB 2CK0L 4YIQA 3PHQA 2VL4A 1LVEA 3PWPA 2NXZC 4L29B 3T77A 4JR9H 4IIQB 4YDJB 2IANE 2V9RA 1HILA 3N1QC 4KTYA 2HVJB 3CDYA 5C0AE 3GIZH 3PWVA 5F89A 4HCRA 1C5DB 2E6PA 1CBVL 4GW4A 1F8TH 2VE6A 3LRSB 2AGJL 2VZ1A 3ZE2E 4PY8J 4HMDA 3KLAB 3LS5H 2FZ3A 3PWNB 4AJ0A 1JGVL 3B2UC 1X5LA 3DNKA 5CJBA 1BZQK 5F6HJ 1P5VA 3DBXA 3GSQB 3CX5J 4HDIB 4JJ5B 1H3GA 1E6JH 3TO4B 3WNOA 1U6AL 4YK4B 3ILQC 1NCCL 5DJ2B 1KLGB 4LIQE 3VGAB 4Y8DC 1U8LB 1S7XA 3X14A 1HSAA 5D8JL 2YD5A 1P4BL 3JWNC 1KJ3H 1GZQB 2P46B 5KJRH 3FHQA 4ODUB 1ONQA 4CDGC 2EC9T 1MI5E 3WE6B 4LCIL 5EU7E 5KAQF 1TJHL 1H5BB 2DI7A 3BEWA 4QXGH 1S7RA 4ALAL 5JHDE 3TESA 4MZ2A 4LCWE 2AW2A 4LVHB 2DI9A 4QXUL 4X7CC 1LDPH 4JFYA 4PGDB 1FV1B 2B5IC 3NFNB 5BCAA 1IBGH 2DIBA 1RJZA 3SKOB 3U79A 5FUZH 3VGDA 1PX4A 5B3JE 2FEDC 3KAAA 3PQYE 5E03A 4DVRL 4MNQB 1D9KB 4LGSB 1DBAL 4OTXH 1A02N 3PGCA 5C9JB 1INQB 4GO6B 2Y5EA 5KVEL 2W0FB 1HINL 4NHUB 1MFCL 1T22A 3QDHA 3TJHD 3PV6A 3CLEH 4Z7OE 3LN5B 5IFAL 3INUL 2CKNA 4RQQB 3EO9L 4NQXA 1NAKH 3QBTB 4N1EA 1J5OH 2AXFA 1DL7L 1W8NA 2DM7A 5B38B 2VLJB 3EYOA 4R26L 5TH2A 3BGAA 1WTLA 2FYYA 4GMTH 5AZ2H 3QIUA 2CO6B 4X6DA 3QG7L 3DRQA 4LIQH 3DUUB 5EPMB 2CIKA 2GT9A 4CVXA 1MY7A 1M1SA 2VC2H 3FO0H 4PJEE 1EHLH 4X6DF 3C2SA 1WF5A 4ODWA 2PW2B 3BQUC 2A6KB 5C09A 4OT1L 2MQ3A 2XKNB 3IVKB 4RDQG 4DEPC 5HHMD 5F1NA 5A2JH 4HK3J 4WI7A 5HHQB 1M7DB 5FA4A 5I71B 3FT2A 1G84A 1NGWB 4NZTL 2GSIA 1DN0A 3CZJA 4M3KB 3REWA 1OB1B 2GITB 1QFWH 1T3FB 3F6IA 3OMZA 4OGAD 4JQIH 4WI4A 1CDCA 2YPKB 4G9DB 1AO7E 4JFZH 4XI5D 1IFHL 4X4YA 1PSKH 2FATL 3RNKA 3RTQB 3HZVB 3IDXL 1IZKA 4NWUL 5ALCH 5DURD 1HHKA 2ZOLB 5I1EL 2HFEA 2QQKH 5BZWB 2DQIH 1JZ4A 1C7TA 3IB4A 1Y6MR 1JN6A 4G9FB 3TA3B 1HHIA 1BFOA 3WIHA 3VA6A 5LXGL 2DQDH 4HUVB 3AGVA 2ZCKL 2F53A 5MEOA 4N1CA 5DSCA 3HUJB 1SMAA 4TQEL 4XP6H 4BQ9A 4YXHH 4UT6H 5ILTH 1G6RB 3MRBB 3BH8B 5LGHL 5AZEH 1DZBA 4HUMB 5I66A 5J13C 4KUZH 4U05A 4OGZA 3VXTA 3DV6A 3MRPA 3UJJH 3VXSA 2JK5B 5FGCE 4CN6A 5LGJB 2DLFL 2FX8H 3MGTB 5IEHA 3ZE1E 5J6GA 4FXGB 3FFCD 4Y4KB 4DOHE 3B9KD 1QUNA 3DI3B 4OLVH 3NPSC 1E28B 5EUOE 3B4NA 2DKMA 3T4AA 1XGTB 3RVTC 1ORSA 3MLSH 5SWZE 3T65B 3QDMD 3C6LB 5I9QC 3NBNA 3S4SA 4OZFG 5GRVL 3CVHB 5EWIL 4HJJL 2CRMA 5D71L 5C0NC 5GRWA 3MUGA 1OVZA 2YS4A 1N4XH 3TCXA 1Z3GH 3LMJH 2Y06H 1XF1A 2WIIB 4EVNA 4ONHA 3HE6C 1G9EA 4FFZL 5D1ZC 2GJ6B 2VQ1A 5ICXB 1UZ6E 1RK0B 1RMFH 1NMCB 1YPZE 2Z93A 4FQLL 3CSGA 4QRSB 3BAEL 2D03L 4GKZB 4HMEA 4ONGH 4TPRL 1FO0A 4UBDC 4D9RE 4OQTA 5GGRY 4BH7B 5TE7H 1JNNH 1MFDL 4KRPD 4PREB 4Z76B 3BRDA 3H9ZA 4XCEA 2QSCH 2XI9A 3T3PE 1FDLH 4O00A 4J4PD 6FABH 1FFNA 1IKFH 3GSRA 3RFZC 1BF2A 3L3DA 4L4VD 2E7BA 2GAZB 3O9WC 2BNQE 5ADPL 4GAGH 4KGJA 1PVHA 1WT5A 4HEME 4PJAB 4WV1C 2JIXD 4ENEC 5C2UB 5D1QC 5FAAA 1CU4H 4NZJA 4M7LH 5EOCJ 1Q9LA 4JVUA 1ED3B 3U0TB 1GL4B 1VKXB 4KK9D