4WO4D

The molecular bases of delta/alpha beta t cell-mediated antigen recognition.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
242
structure length
242
Chain Sequence
GAVVSQHPSRVISKSGTSVKIECRSLDFQATTMFWYRQFPKQSLMLMATSNEGSKATYEQGVEKDKFLINHASLTLSTLTVTSAHPEDSSFYICSAPGGVGAFFGQGTRLTVVEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d
publication title The molecular bases of delta / alpha beta T cell-mediated antigen recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2014-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wo4D02
3FO1B 3UTSB 2B4CL 4HJ0C 1DBJL 4M03A 4X6BB 5D1ZC 1GGUA 1VADA 4YLQT 5IVZA 1QSFE 3MRGB 3RWDB 5CSBA 3LB6C 4Q9QL 3K4DA 4P9HL 2CRZA 2AQ2A 4Z7VF 3PV6B 1N8ZB 3GJFH 1RUKL 2Z8WC 2Q6WB 1A4KB 1ETZB 4QGYA 3LN9A 1CG9B 2E6JA 3UTSD 1JWUA 3Q3GB 5BZWB 2OR9L 4XH2B 5ANME 1A2YB 3RL1B 4PRBB 3BD5A 3IDJB 3SJVE 5J13B 2GHWB 4X5XB 3IDUA 3N50A 4K94L 3RVXC 3RNQB 5J8OA 2X4OB 2L7JA 2BSED 4JPKH 1CS6A 5FCUL 2X70B 3O8XA 1CD0A 1C16A 1DUYA 4DZBB 5C0JA 3RJDA 1CK0L 2HT3C 5E9DA 5I9QC 4NZJA 1MCEA 4OM1H 1F58H 3CZFA 3MODH 5CCKH 1EEQA 3CLFL 4KRMB 3VFPA 4X9FA 5IFHH 3TBWA 4PGDA 5ESQA 3SDAC 4N90E 3ULUL 3QEHB 2FJGB 3K2UL 4N0UA 1LK3H 3H9SA 2AXFB 2B1HL 4ZFZB 3TWCH 1HHIB 3QI9A 4DGYL 2EYRA 3L7FB 4RMQA 4L9DA 4G9DB 4AM0B 3MRDA 2Q3ZA 4I2XE 1G1YA 3DMMA 1YDPB 2EE9A 2BJML 1Z9LA 3DX9B 2RBLA 3L5WA 4U1IA 3WJLC 3UBXB 2A6KB 1MFCH 3V4VL 5MHSE 4HLZG 2HFGL 3VJ6A 2ZUXA 4DVBB 3SKJH 3RZCB 4ONFH 3WCYA 3MGTA 4GAJL 4Y5YC 3UC0L 1SY6A 4GKSB 1G7PA 3O3UN 4KKAC 5BOPA 5MENB 3VFGL 3ARGB 2UYLA 3N1QC 3QJHB 4YE4H 3RPIB 3IT8D 3NMEA 4WEBL 5I66B 1JHTA 2FBJL 5GISH 4FP8L 2W65A 3H9YA 4UQ2B 2XPGB 4GAGH 1SHMA 5CBEB 5JXAH 2D0GA 4HWZA 4U1JA 2R1YB 2ZPKH 4EOWH 2D2OA 2BCKB 2X9YA 3L3GB 4X6DF 3RZCD 3MLRH 5L0QC 4FQ1H 3RKDC 3LS5L 4IMLB 5KG9B 5KSBF 1UXSA 5GHWH 2KZ1B 4F8QA 1DBAH 1H3GA 5D1XD 5MEND 3AGVA 5MEQA 3ARGD 3MNWB 1GRWA 4KMQA 4XRCA 2Y06H 4JFDE 3T1FA 1CGSL 4LSUL 1TQCB 4KK5D 3IJHB 5JPNA 4JHWH 4OFDA 5B22A 4HFWA 5ENWB 4D8PB 5IG7A 1HWGB 3IGAB 4G80A 3DO7B 1JE6A 2P24B 2H2PC 2EDFA 1B0GA 2E8ZA 5F3HA 4G6FB 1JI1A 1C7SA 1VFUA 1YYMH 2BX5A 4EI6B 5E2TH 3TH4T 2G5BA 4O9HH 1Y6NR 3PQYE 5EBWA 4YHMH 1L9NA 1R3KB 2B0SL 3NOIA 1RJYA 2K9UA 3CUPB 2EDLA 1F6FB 3KWWB 4IOIA 5CFHA 4YR6A 4L3EB 2VH5H 1KACB 1BAFL 3NIGE 2F5BL 3F5WA 2F19L 3H7BA 3KPRE 4HJGA 5DZOA 4HS3A 3WO4C 4G6FD 3LIZH 1VFBB 3TN0C 1RHFA 3GJEA 4ZTOL 5C0IA 1QFWH 1YPZB 3PWNA 4QHMB 5KAQF 2ZZUT 1MCQA 2X42A 5HHME 1GGTA 1BJ1J 3V6FA 1FL3B 4FQHB 2YUVA 4X99B 4K2UH 2Z0BA 3AS0A 4MDIB 2B4CH 3IU3A 4LQFL 3P3YA 1DBJH 2AABL 5SWZE 4L3ED 3TYFA 2CXKA 1KB5L 3S4SG 5C3LD 4YHLL 1NCAH 1LNUA 3DX8B 4YPGB 2VJXA 4Q9QH 4I77L 1Z3GL 1FQ9C 3S88H 4P9HH 4R0LB 3K81A 5DRNA 4DVRL 2Y5EA 4JZJC 5ACLA 3LS4H 4QT5A 1VEOA 1K4CA 2B39A 1DQQA 3EO1A 2FCBA 4WCYH 3AAZA 5HHPA 4JKMA 2I07A 3HZMB 4UTAH 1MAJA 4YNYA 2OR9H 4F7TB 1PYWA 2VWEE 3PUCA 2YD9A 1A4JB 1NJ9A 1WVZA 2OMNA 4LVOC 2BNUB 4LCCC 4K94H 1BZ9B 4MQ7A 2P42B 1FO0L 3D0VA 1IGJA 4M6OL 5JIPA 4GG6B 1NCDL 3SGEH 1ZGLM 1G7IB 4ZUVB 4K23H 3GSQB 2HFEB 4Y2DA 2AEQL 2E9IA 2DQFA 2JCCB 3CLFH 1AGDB 1EBPA 3GRWL 5L2KB 3QNXB 1NFDE 3NH7L 4PRIA 4MZ2A 4LLYB 5BW7C 4PJ9B 1CD1B 3ULUH 3BKYH 3MROB 5JW5A 4PY7B 2VITB 1JV5B 4KROB 1MJ7H 3WKML 5LGJB 4N8VG 4Y7MA 4AEHL 4N1EA 3ILPA 5F21B 4DGYH 5B3JE 4MAYA 2FLBT 1JGDA 4NN6B 1FFPA 4PRNB 4XMKL 3QR2A 3B5HA 3K74B 4MB4A 1RIVL 1OQOA 4R26L 5IM7A 1MWAL 2BJMH 2J4WL 2ICWI 5L2KD 2OK0H 3OB0H 3S34L 4Y19B 3D69A 3IRZA 5DUPH 5FGCB 3DV4A 2IFFL 1XGPB 3V4VH 5ITFB 3CVHB 5D71L 2HFGH 4KROD 3VRJB 3OXRB 1ZHBA 3P4OB 3DYPA 2EICA 4M00A 5ERWA 3WNKA 5IMKB 4XBEH 1A02N 4U1HA 1UJ3A 3DVNA 3ET9F 4GAJH 2B5IC 3C2AH 5LG1A 4KUCD 4UTBL 5I74B 2WW8A 2OJEA 4HULB 4WEBH 4FHBD 2FBJH 1HIML 4FP8H 3T8XA 2W07A 4FQIL 2XKNB 3SDXA 3DROB 3C6LC 1HHJA 1YQ2A 1CXIA 1EH9A 2C3VA 4Y19D 4Q9CA 2Q8BL 3OHXA 3OG6B 1OSPH 3IJYA 3T0EE 5M7QA 2V2WA 3P9LA 5TE6L 3UYOD 3HC0B 3LS5H 2F53E 5JHDB 2HJLB 3L3HA 5IMLB 4HZAA 5I1AA 1U8MB 2D7NA 1MJUH 4JZOB 4B53A 1A1NB 4UU9B 5GJTH 5HI3C 1R5WB 1UWEL 1T2XA 5DZNA 1CGSH 3JVGA 3MNVB 3EYQC 5EZOH 4LSUH 3VI3F 2VKXA 1QHOA 1RZGB 5D6CA 1XZ0B 3VFNA 1XCTA 3WFHA 5E6ZA 4U3HA 3TJHD 3P77A 3VXRA 4NC1C 3O6LL 1NAMH 3BP7B 4NJAL 5HPOA 2GCYB 2Y36H 4K7FB 1TJIL 4OZIA 4OCYH 4PTTB 5HVGB 5JHDD 5EU3B 4YK4B 2B0SH 4XVSL 4NKMB 3MOQA 2YD4A 3ARFB 4RX4D 4OZFA 2F74A 4IEFB 3OB8A 1Y6KR 4U7MA 3WDHA 3Q0HA 1DQML 3WUWA 1BAFH 4RAHA 2F5BH 1A6TA 1BLNB 2AEIT 5CJOH 3W9EA 1CDUA 2PCPB 4MA3B 4NPYA 2XWJB 5D7JC 1A5FL 3EJJX 4ZTOH 2DWDB 3MUHL 3VXPA 5E2VL 1WBZA 1W72B 2CO6B 1U8HB 1Y18B 3MUGB 1D5MA 1QSEB 1MCNA 3UTSE 3ARFD 3FTGA 4E41B 5FYJH 3L5IA 5DS8A 1RI8A 3MLZL 5DQ9B 4LQFH 3UROR 5FXCH 4KK9D 4KKNA 1MCOL 1KB5H 1QRNB 4JFPA 4KRNA 4MMZC 5DVOA 3L3DA 4BFEA 1GVIA 1JPFA 4I77H 1Z3GH 5FO9A 4ZFFA 4OCLC 2WINB 4BZ2L 4Q97A 4TUJB 4DVRH 3P9MA 3STZB 3BUYB 5T1LA 1QSED 1XIWC 3QUZC 1HCVA 3QUXB 3BRDA 5CJBA 1A7NL 2MHAB 4E41D 1X5AA 3ZE1E 4BQCA 2E9JA 3P4NA 3V6OA 3ZT6A 2GSGA 3CMOH 5DJ2A 4CVUA 1WGOA 1QRND 2V7NA 4ZOEA 2Y6SD 3R0NA 2YBRB 5E8EA 4FQJL 2P5WB 1FO0H 1T2QL 4M6OH 1QG3A 2HT4C 3U48A 1NCDH 3KPLB 5I1KH 4U31A 3DECA 1P4IL 4U1NB 1TVBB 1HH9B 2AEQH 2IADA 1J1OH 4RMWA 3GRWH 3NH7H 4JG1L 3EZJB 4JFOA 4HGWA 1AH1A 3QUMA 1TTGA 3L3IB 5GS3A 1HWHB 2WIIB 3WKMH 5I76A 5DQDH 1IKFH 1H15A 2KQMA 4J8RB 1YEDB 3QO1B 3DXAA 1QR1A 2X1OA 1PAMA 3UZEA 2P5WD 3O2DL 4OTXL 1G84A 3C9NB 2CQVA 1DUZB 4UZGA 3F8UB 2VB5A 1RIVH 4H1LG 3FFCA 4R26H 3B4NA 4HIIA 1YNLH 4G6AD 5C2BL 2XXCB 3S34H 4UOW0 4JG0L 1ED3A 1M7DB 4GO6B 2IFFH 3CFDA 1DUYB 1H3TA 4JFYA 5IMOA 3WIHA 5E9DB 2UVFA 3ARDB 3STLB 5KS9B 2FHBA 4D0CB 3G04A 4MS8C 2VLKA 2FIKB 1I7TA 4XWOD 1S3KL 3VFPB 2BY1A 4UTBH 2ICCA 4ODUB 3EGSB 2AK4A 5ESQB 3LY6A 2QSCL 4PLOB 3VG0H 1NCWL 4JO3L 3VXTA 4CN6A 1U3HA 4FQIH 3JXAA 1CXFA 1KFAH 1R3IL 2NY0C 1KELL 4Z78B 2OL3A 2Q8BH 1PZ5B 1CL7L 2EDOA 4PJFF 2F15A 2O61A 1R6VA 4OBRA 2QQKL 3P2TA 5E9DD 1BIHA 5TE6H 1JTTA 3ARDD 4XTRC 2EE3A 3MRCA 5GGUA 3IFNH 3BYYA 4X6DA 2FGWL 4NZUL 1MLBA 3S9DB 5CKGA 5KSBA 1A7PL 2FATH 1UWEH 1T1XA 4WFHD 4L8CA 3VJ6B 1XF1A 4G8GA 4GW5A 3ETBF 1LILA 3LKNB 4KZEL 5C9KA 4KHTH 4EN3A 1T04B 3NAAH 3O6LH 4RFNC 4OM0H 2LU7A 4NJAH 2ZCKL 4JGJA 1BZ7A 4BSVA 1TJIH 2ZNXA 2VDOL 1WBYA 1BJ1H 4C57C 3W11C 3PP4L 2VLJA 3HNVL 4ZYKB 3BPNB 3ZT5A 3E6HA 5ILTL 3L5HA 5CLWA 3DRQB 1LEGB 1DQMH 2A0LC 2DMKA 1HSAB 4XPAL 2LE9A 4M6ML 1WLHA 4NM8L 4X5WA 5JQHC 1LGVA 2VZVA 3SKOB 3JTTB 1U2CA 4H5SA 3GGWA 3P30L 4L4TA 4LHJB 3U4EB 4XRCB 1QOKA 4WI8A 3QPXL 3D9AH 3G6JF 5IEHA 5E2VH 3F6LA 3MACL 2J5LB 1NLDL 3VXNA 2ARJA 4LKCA 1CL7I 1C8PA 4XPHH 2GFBB 1QUNA 2OP4L 5F3HB 3FB8A 4RCAA 3MYJA 2XN9B 2JTDA 3ARBC 3QAZB 2VXSL 4OUUB 2G5BB 4J3UA 3VWJB 5EBWB 2D7MA 1TZGH 4Q6IC 4Z76B 5JW4R 2FEEL 2FX9L 1YEKL 4PJBA 3PDOA 4H88L 4BZ2H 2BVEA 2BY3A 5GGQL 4X83A 3QDMA 3VD3A 1M71A 1IAII 2R0KL 3MRMA 4J6RL 1A7NH 2I9TB 4LSVL 3TNMB 4XC3L 4HS3B 3X12B 4M7LT 2PTVA 4C54A 5DDHA 2XN9D 2NLJB 3GJEB 3RVWD 4GG6E 5DRWA 4FQJH 4OZGB 3QG7H 3IAGC 4NKDB 4P5TA 5FKAA 5F3BB 1BGXL 3WFDL 2J8OA 1BIIA 3V6FB 4QOKA 4ZPTB 4TNVK 4J3OC 5GRXG 1RFDL 5L2KE 4ZFOL 3IU3B 5E4EB 2A6DB 3U83A 5FM8A 4JG1H 3PHSA 1N5AB 4IJ3C 2C1PB 5E1AA 5IR1A 4J23A 1YNTA 4NT6B 3MV11 1E4JA 3KPNB 2EKSB 1G6RA 3O2DH 5DFTA 4OTXH 4P3CH 1I8IB 3EO1B 1KJ3H 4H26A 1YQVL 4HKXB 4CDHA 4UB0L 5ICXA 4JHZA 3RUGF 4U0RC 1EVUA 1NJ9B 1FIEA 4P57B 5FGCE 5C2BH 2YA1A 3KHQA 1JYNA 4JG0H 2FEEI 2PKDA 3D0VB 4GQ9L 1V05A 4XCYA 4P23C 1UKQA 2Q76A 4HDIB 1EFXB 4IMKA 5IVXA 1BMGA 4DN3L 3MGOA 4LSQL 3EYVB 5EO1B 4YBLB 3BT2L 4JO2L 5E94A 2OYPA 5EC2B 1MFDL 3IFLL 3CZJA 5IROC 4WI6A 3MCKA 4PRIB 4ELMA 1OAKL 4LAQL 5C0BA 4NNXB 1NCWH 3D85A 4WI7A 2LABA 3RWFB 5MEOA 3FRUA 4DGVH 4EUPA 5F1IB 4JM4L 3G9VA 4QLRA 1IJ9A 2APWA 5IW6A 4XPBL 2P8MA 1KELH 1J1XL 4J1UA 3WDIA 3RDTA 1ND0B 1AE6L 1EFXD 3D0LA 1FFPB 5JHDE 4JRXA 2QQKH 2WAHA 1OAXL 3QSKB 4X4ME 4PB0L 3FQXA 1LK2A 1XH3A 3V8CA 5DHVH 4NZUH 3QFJA 4YDKL 1HDMA 1K3ZA 4PRID 1Y0LA 1NDMA 2NW3B 1A7PH 2YC1B 3K8LA 1E6OL 2QTEA 3G6AA 2NY4C 4RGNC 2FL5B 4LPVA 5EU6E 4JQIL 1W8NA 3FZUD 4M7JL 4QO1A 1ZHBB 3GK8H 1YEIL 4NQCB 5ERWB 3UX9B 2MNUA 1RZJL 4KZEH 4EQ2A 3DVNB 1A22B 1UKSA 4WHTA 4IHOA 4FOMA 4HW6A 1V3JA 2RHEA 4LKXB 1WTLA 4K3EL 5JLZB 3RVUC 2WQRA 1N59A 3K7UA 3DI3B 2C3VB 3PP4H 4IRZH 3S3SA 4DKDC 5D2NB 5D70L 4HEPG 5ILTH 3WXVH 3VWKA 2GY5A 1H0DB 4UUJB 4YDVA 1TMCB 3IJYB 4NQCD 2V2WB 3OKLA 4M6MH 4NM8H 1RMFL 1LEIA 4YO0B 3HFML 4ORGB 2V5SA 1E0OB 5FECA 2XRAL 4HBQA 4R4NC 3IF1A 3P30H 2XA3A 1F6LL 3MLYH 3QNYB 1QSEE 4XVUD 1PKOA 3MACH 3I6KB 1NLDH 5IJVA 4E41E 1LO3L 4Z0BL 3O2VH 3BMVA 2IWGA 1I9JL 1F3JA 3WFHB 3SBWA 2OP4H 2BSSB 1LVEA 5GGSA 1KLUA 2NYYC 1XCQA 1U0QA 1AJ7L 4U05A 2VXSH 4B50A 4G7YL 3MRNB 4NYLB 4WTXA 3CU1A 1A9BB 2BOBB 1OSZB 1GOHA 2P8LB 1AKJB 5JW3L 4LSPL 3D2UA 2X7LB 1ACZA 1DQJB 4MQTB 2CD0A 4OZFB 1AXSB 3MLSL 2VN7A 2R0KH 4Y4KB 2CDFA 3MNZB 4J6RH 1MCIA 2X4UA 3ZTJG 3F12A 4FQCL 1EUUA 4LSVH 4J3TA 3W9EB 4S2SA 2ZSVA 5DQJA 4NPYB 1S5HB 2E9WA 2OSLB 2P5WE 2V5RA 2VIRB 3VXPB 3CXHK 5E99L 4LLUB 2XXMB 1BGXH 4RAUB 3WFDH 2HRLA 1AKJD 1BM3H 2XOTA 2E9BA 4PLKD 4X6EA 3WNNA 4NP4L 5A16A 3D39A 4OF5A 1VESA 1Z9SA 3BZ4A 3QZWA 4YHNB 1WUNT 4Y4KD 5IHZB 3CSYB 2GYSA 2FSEA 4GFTB 3MJ8B 5IOPA 3KPPA 4XXCC 4I3SL 1P7HL 3FMGL 4OCMC 5CIPH 4Q7DA 4ZFFB 1T6VN 5F44A 3AFLA 1QFHA 4PBWD 4BK5A 3P9MB 4LSTL 4BELD 3QXUA 5T1LB 4HXAL 2B2XL 1MHPH 4JO4L 3RTQA 4Z7VB 3A67L 1YQVH 4UB0H 1PEWA 1D6EA 4GRLA 2CKBA 4APQC 1A6ZB 1L4IA 3P4NB 4D2NA 4FQPA 2NNAA 1XF3B 4L8SC 1J8HE 2GSGB 1T0NA 2VABB 4GS7C 4LSRL 5D6DA 3HG1A 4MDJB 4RAVA 1S9WA 1C1EL 3VA2C 4GQ9H 5CEZD 5C08B 5KS9E 4DKEL 3RWCB 2P4AB 4DN3H 2WLYA 3BH8B 1LO0L 3TPKA 4LSQH 4PD4K 5T1LD 5C9JA 1BX2B 4OB5L 4JO2H 3TBVB 1MFDH 1MHEB 3QDGA 1J1PH 3Q1SL 2RCSL 4WFHE 4M1DH 4LAQH 1KCRL 3SDCC 3BGAA 4R6UA 4FQ2L 3UPAA 2X41A 3WS6C 1P1ZB 1FFOA 2RGSA 3EDEA 5I76B 1WISA 4HUNB 1TJGL 3MV9B 4RMRA 3QCUL 4WU7A 1ZEAL 1QR1B 2BSRB 1J1XH 1JZ8A 3MZGB 1P5UA 5C08D 1AE6H 2IF7A 5M95B 4P4KC 2VLMD 1OAXH 2PW2B 2ZJSH 4PJFA 5A40E 5CGYD 3VFUB 3MJ9L 3OKMB 3X3FL 2V17L 2HJKA 2DIAA 3O45A 5EH1A 1ED3B 3QULB 3NFNB 4FQXC 5BJTB 4NGHH 2NTSP 4OI7A 4JQIH 4DOHE 4X9IA 4JFYB 1RZJH 4ENEC 3LQZA 1EBAA 1ZLWK 4Z77A 4KUZL 1U8QA 1MH5A 2VLKB 3OAZH 1KTDA 2Y9RT 1UA6L 5E8NA 1J0KA 4AIZA 5IQ7L 4DAGL 3JZ7A 4K3EH 3KGRA 4OFKA 3K4AA 2M26A 1OB1B 1T22A 1XR9A 4LU5L 5D70H 3T3PE 2XWTA 4BYHA 5JORA 5H8DA 2AV1A 1AI1L 2PTUA 3VI4F 4BK4A 2AJSL 1RMFH 4C4KO 3HFMH 4X6DB 2VLKD 3CCHA 2XRAH 1YA5A 3TV3H 1CU4L 1MLBB 2VXUL 3NIFE 5KSBB 2C26A 3O3BB 5E00A 4KKLD 3UTPD 5L8LB 5SV4A 1QQDB 2W0KA 1J18A 1LO3H 2KBGA 4NN7C 5FA4A 4JANA 1HH6A 4GW5B 2E6PA 1NBZA 2VAAB 3G6JA 3MRLA 3ARSA 1I9JH 4HMCA 4LLVA 5BVJA 1LO4H 5J12C 4ODVL 2XN9E 4EN3B 1JGEB 1QFUL 4F57L 3O3DA 1JWSA 4OGAD 1AJ7H 4Z95H 5IJKA 2VO5A 1MVFA 1P4LB 4G7YH 5MERB 4KDTC 4OQTA 2YD8A 3BXNA 3FQRA 2JIXA 3JV4B 4PLJC 1JPSL 1CGTA 3FQUB 3KXFA 5JW3H 1XF5A 4LSPH 1F8TL 3A6BL 3GHEH 4X0KB 4I3GA 3H6JA 1I4FA 4U49A 1NAMB 2P44B 3T0VA 2YUZA 1QPXA 3MLSH 2MPAH 1N4XH 1RIHL 1AO7B 1C08B 1KLFA 4RBPH 4JY4A 1JNJA 4FQCH 1CGWA 1KJMA 4NUJA 1QVOA 4EN3D 2ORBH 4L4TB 2I5YL 1F45A 4OZGE 3FN9A 2P5EB 5IEHB 4RGOL 4MNHA 2VC2L 1RHHA 4EI5A 2X10A 5E99H 3T3MF 3VXNB 3GMLB 5DMIH 3W39A 4LNVA 3KNBA 3PDDA 2IBZX 4NP4H 5L6YH 2ZSWB 5I1CL 5D1QC 3DGCR 1A1MB 2R69L 1F02I 3BZFA 4QHNA 1AO7D 4NBXB 3TZVA 2OR7A 3RVVD 3HCVA 1NEZB 3MRJA 3GO1L 4PJ7F 3RI5K 1RJLA 4U2YA 3W81A 3GUTA 4NO2B 4I3SH 4L4TD 3FMGH 2P5ED 5BXFB 1JN6A 2D3VA 2FR4B 2EXYC 1M71B 4HXAH 2B2XH 2CK2A 3A67H 5GGVY 3PL6B 3H2WA 5T1MB 4FXLA 2ZUVA 5C0GB 2DLFL 5DJ8A 1QO3A 1JF1B 3WFZA 5DDHB 3DJ9A 2BMKB 5EU5A 3H9HB 4BH7A 2OS7A 1CT8B 1C1EH 1RAMA 4A2MA 4LPXA 2VZ1A 2H1PL 3GMNA 4GW4B 5JZ7C 2CDEA 3PXHA 1LO0H 1FFRA 4OB5H 2R4RH 1FAKT 5EO0B 1MCWM 2DL9A 3LN4B 3OR7A 3MO1A 1E6JL 1RU9L 3SE4C 2V2XB 4OCRL 3GBNL 4N0FA 2WWKO 1ZVYA 3Q1SH 2HFTA 2RCSH 2GJZA 4OZFG 1KCRH 4FQ2H 2GTWB 3G08A 3OSKA 3RBSA 4OAWA 5DHYA 3TT3L 3U30B 3WUWG 2DD8H 1UM6L 3TPUB 1E4XL 5DO2D 3QCUH 1ZEAH 4UBDC 4JFFA 3C5JB 2BNQA 1OP9A 4PIRF 4NO0B 5JQ6L 4WNQA 5L2JA 1X6NA 4U7SA 1HQRB 1F2XK 2XZQH 3GSVA 4POZC 1BECA 4HC1A 3X3FH 1TCRB 2V17H 4WW2C 4IRJB 3GSOA 1HHKA 3NVQA 5DLML 3MXVL 3QEGL 5BS0B 5CJXC 3EO9L 4GLRH 3RL2B 4UDTA 3E6FA 4NQCE 5DD1L 4RDQG 2Q76B 4O02L 2J6EA 4KV5F 1S7SA 4C56E 1T20B 3TBSB 3OX8B 2ZCLL 3QIUC 4Y1AA 2WBJA 4KUZH 4NHCH 3E0GA 3NFSL 4NO0D 5DMYA 1D5XA 2Y5TA 3MCKB 5CP3A 5IQ7H 5BCAA 3PDGA 3FRUB 1J87A 4JN1L 5D2NE 1EXUB 3LD8B 4IRJD 4CW1A 2V2TB 5DJDA 5BS0D 5IW6B 4FXKB 4JDVA 3HI5L 3C87A 5J0BA 5F7WC 3G5YB 2NPLX 3GEWB 4O51A 5D7IF 1DBBL 4PRHE 2AJSH 4NNYB 2IANA 3MRBB 2XTLA 4D9QD 4Y5VC 3CJJA 1VDGA 2APBA 1OLZA 3QFJB 2VZTA 1NDMB 2EIEA 2VISB 4S10A 4UT9L 4WHCA 1E4XI 1VB9A 2VDLH 5I8EB 3V95A 1YN7A 2CUMA 5B38A 5E08H 4ODVH 4OLEA 1QFUH 4F57H 1T1WB 4MAUH 1FZMB 4GMTL 5DA4A 3B2VL 2MKWA 1GCFA 4PV8B 1I1YB 1MIMH 2VLLA 4HK3J 3SDAA 1N59B 3QFJD 2EECA 2PYEA 5EUOF 1JPSH 3RX8A 4BKLA 1CBVL 1F8TH 3A6BH 2NXZC 2C3GA 3VWKB 2WWMC 4L1DA 3RWIA 3TBYB 4BH8B 4CKVX 1HILA 4W4OC 5C0AB 3TM6A 3OKLB 5HPMB 2GAZB 4MD0A 3ZKMD 3DYMA 2I60L 1PG7L 3U36B 1ZXQA 4K3DL 2KUTA 4ZUSA 1BBJA 4PG9A 1MCSA 3IF1B 1IZKA 4X9HA 2I5YH 2OI9C 4WFGE 3MRQB 3WJJA 3DETC 2NY2C 3WJLA 4RGOH 2VC2H 4QRQB 4LMQI 1MNUL 1T21A 1NLBL 3GDBA 5IUSA 1QACA 2IPUG 1ADQL 1OQXA 1F3JB 3NN8B 2BRRL 3VWKD 5I1CH 5K59E 4Y5YA 1KLUB 5C0AD 2OJZL 1XCQB 2H32B 2EDDA 5CEZE 4OF8A 5C86A 4NQSB 1FIGL 1UCBL 4P2QA 4X4ZA 2G60L 3TH2T 1TXKA 3REVA 43C9B 1N0XH 1TQBC 1MCWW 3BKJL 1HXMB 5FK9A 3NCMA 5T33H 2VZ3A 1QLRB 4Z7VE 3OGOE 5FHBL 1JYXA 3D87B 4O2FA 2CR3A 3L3OA 3X3GH 5BO1L 4X98B 1H3PL 4CJ0A 5DK2B 3FB5B 3UAJC 5DQJB 1I9IH 2DLFH 1PLGH 3J8F7 5C08E 1QTYT 1GZQA 2OXHA 5KANI 2VLME 5C0NC 1B0WA 3HZVA 2H1PH 4ZG1A 2QKIB 4B7LA 1JGLL 4TQEL 3D2UD 4LVHB 4X6EB 4FABL 1L0XA 2CXGA 4NZDA 2QHRL 5EN2A 1YJDL 4XZUA 5J6GB 5CSGA 2A77H 5BMFL 3JV5A 2X9XA 3BZ4B 3QZWB 1RU9H 1FG2A 2ITCA 3GBNH 4OCRH 5DRXA 1XMWA 4UQ3A 3WLBA 3U46A 4CVXA 1D9KC 1FFQA 5C8JA 2FSEB 5DJZB 2R39A 3MV9E 3QT2A 1UM6H 1Q72L 3QUKA 5KSAC 1CGXA 1MLCA 3I84A 3CFJB 2V7HB 2V5TA 3ULUE 5JQ6H 5INCA 3RTQB 2F8OA 2OXGA 3JUYA 1D6EB 2G2RB 3P4LA 4K07A 2EZ0C 2NNAB 4PG2C 2DS4A 3QWRA 4QRUB 5ADPL 4Y4FC 1BVKA 1WZ1L 5DLMH 3HG1B 5SWSB 3MXVH 3QEGH 3TN0A 1S9WB 5CJQL 3SCMC 1TIUA 4OCWL 3VGDA 4HF5L 3T04D 5DD1H 4O02H 4N8PA 1S9YA 5HYJA 1J10A 2E7HA 2ZCLH 5HYQA 5HGAA 3RTQD 1AY1L 2CUHA 4R9HA 3UTPE 4TUOA 2FX8L 3KR3L 1JHKL 4NM4L 5FYKL 3MA7B 2DI9A 2V5MA 4JN1H 4TTDD 2CDGA 4TSCL 4HHAB 5SWSD 3HG1D 4PJGF 3QIWB 3HI5H 3LEYL 3QHZL 1T5XA 4X7DC 4KZDH 3DRTA 1P7KB 3GMRB 4NN5B 4UAOC 2Z93A 4PJFB 1Q9LA 3MV7A 3DVGB 2HT2C 1IGTA 1S7QB 1FNSL 4X7TA 5B4MC 2HJKB 2C9AA 4LFHD 1KIUA 4J3XA 3O45B 4LCCA 1AGFA 1DLFL 3IKCA 2BZDA 5JIIA 5GGRA 5JUEH 5B8CA 12E8L 1OAYL 3EJZD 4NFBA 4G9FA 4G3YL 4YWGL 4L9LA 3QIWD 5DHVB 2FHFA 5EZJA 3VXUB 5I73C 1KTDB 4NHUB 2VMFA 5E8NB 3MPCA 4AIZB 4GMTH 5AWNH 2NY1B 3RWEA 3IFPB 1PG7X 3B8SA 5I2IA 3CAFA 1T2JA 1R5IA 5TH2A 5GRUH 3CMGA 1RULL 1AO7E 2Z8SA 5JORB 1JRHL 4BJLA 1FCCA 3I75A 1UWXH 3E3QC 3BJ91 4N8CL 2AEPL 1IAOA 2ID5A 2V5YA 1T7ZA 1PG7H 3VXUD 1I8KA 2H6PA 4K3DH 3CCHB 2P5EE 2NY1D 5DMGD 1FH5L 4G7VL 1A6PA 3ULVC 3QDJB 1UH2A 1CTOA 4OZHF 1MNUH 4NQEB 1NLBH 5FA4B 4JANB 1HH6B 3E2HB 1G0DA 3G6JB 1MVUB 1ADQH 4KRPD 4LLVB 3T2QA 1BWWA 5BVJB 2Y72A 1CLYL 4TNVF 4YDLB 1JWSB 2Z31C 2OJZH 3S96A 4ZNEA 5DD6A 5H37G 1XGTA 1G7LB 5FUZH 5FYJE 1FIGH 1BOYA 3AROA 2G60H 4AENB 1HKLL 3BXNB 3FQRB 4JDZA 3C6LA 3BKJH 5L7XH 3KXFB 1XF5B 4YDJA 1N3NB 3QDJD 4G8EB 3CXHJ 4M61B 4P46C 4RZCB 1ZTXL 3W2DH 1NFKA 4Y8AA 5FHBH 4NQED 4PJ5B 1Z0MA 3O3AB 1AIFA 5BO1H 3B9KC 2LFGA 2JELL 4E42A 35C8L 1QVOB 2DQHL 1XAUA 4I18B 4RIRA 1NGYB 2D7PA 2Q87A 2W9EL 3F7YA 4O5LH 3H3PL 2W0PA 4QF1B 5FUCC 3QI9C 4NC0B 2R2EA 5L9DL 5J1AA 5IK3B 1FVCA 1IGCL 2QADB 3KXFD 3O6ML 4R97B 4TQEH 1KEGL 3ARXA 2VL4A 4G43A 4FABH 3W39B 2Z91A 2QHRH 5JDSA 1YJDH 3KNBB 3DMMC 4PB9L 5J56B 3BZFB 4PJ5D 5BMFH 2ADJA 1CIDA 4OV6F 4M93B 4CNIB 5ISZE 1ZSDA 4K71C 3QXAB 3VH8B 1O5DT 1GYAA 3GSNH 3MRJB 1RJLB 4KAQH 2YMXH 1Q72H 3FO0L 4DW2H 1S8DB 2XQBL 4RMTA 1BQLL 5FO7A 5KZCD 1KCLA 2HP4A 2QADD 5K9QI 1CFVL 2FECI 3SO5A 3BH9B 4F2MA 5F96L 1E4KC 5BS0E 1L6ZA 4ODWB 5DJ8B 3S5LB 3TO2B 5C6WH 3VA6A 4N0YL 2EYTB 3RUGB 5C2UB 4PJCF 4PP2A 3RNKA 5TF1L 5CJQH 4GMSL 2EO9A 3HZKA 3T4YA 1EUTA 5I71C 3GMNB 4XP5L 4AH2B 3HRZA 1WCQA 1D5ZB 5I16A 5TGBB 1F3RB 4D9QE 3HPLB 8FABB 4KVNL 3UYPA 3MSPA 4KI5E 1GGIL 4XAWL 3OR7B 5FYLD 3LQMA 1N7ML 1AY1H 5FO8B 2GJZB 2QLVB 5C07B 3GSRA 2FX8H 1KN4H 1JHKH 4NM4H 5FYKH 4K9EL 3DX7A 1I7UB 3PE9A 4WFED 2X1XR 2N4IA 4TSCH 4K3JH 2PW1A 4ZDHB 4HH9B 2BNQB 3LEYH 3QHZH 4MQSB 5HYFA 4WNQB 4NJ9L 1XIWA 2FNBA 3QUZA 1I1RA 1AGEB 5DJCB 3QFJE 3IDNB 3G5XB 4MHHI 1FNSH 1ZA6A 1GGCL 1BQSA 3GSOB 4POUB 4UI2A 5C07D 3WFBL 1DLFH 5CAYB 4UILL 3EOTL 1T66D 3PHOA 3QZWG 5D2LF 4KKBD 5DEFB 12E8H 2LTQB 2HKHL 3VI3E 1OAUL 4G3YH 4YWGH 2NY3C 4ODTL 3F7VB 2BNQD 3IAPA 3EDKA 4Z7WF 2VDPH 1MJ8H 4JFEA 5D1ZB 4HUUB 4K8RD 25C8L 3LRSB 4DFHA 1WWBX 3HRPA 3VFWA 1SJXA 3I2CL 3O0RH 2YZ8A 5DJDB 3CFEA 5C0AE 1JRHH 4JKLA 4JPIB 5T3ZD 3KPOA 1REIA 4OFYA 1M7IB 1PX3A 2AEPH 1KIQA 5AD0A 5F8RC 4EIZC 3GBML 5C0FB 1PSKH 3UYRL 1FLTX 4HJ0D 4KMTL 5CWSB 2QHLA 1K8IB 2C3HA 1IL1B 1YYLL 5D1ZD 4FA8A 1FH5H 1KB5A 4TYUA 1KIRA 5JOPD 2ICEA 4G7VH 2ICWA 2OBGA 4QRSA 2H8PB 3DARA 3LB6D 1MCRA 1C5BL 1F5WA 1ZLUK 1YN7B 2BVQB 4PPTA 4QXTA 5J9PA 5B38B 1HHHA 4X9BA 5I9QB 3JTSA 1YEHH 3GMQB 3TIEB 3QXTA 4XXDA 1JGUH 4GKNB 1FLRL 1M4KA 3B5GA 3GKWL 4MX7A 2VLLB 4XCFH 4OGXL 2VR4A 4Q74A 5GGTL 5HVHC 4X6CF 1J05B 1U8IB 5H35A 2BVUA 5IKCB 3BP4B 4QHKI 1JF6A 1ZTXH 5INDB 1FO0A 2A74A 4V1DB 5DK0B 1OP3K 4RGMC 3L7EA 4Z7NF 2FZ3B 4K3HA 2DQHH 1NMCC 3MV01 2A6IB 4NQXB 4LCUA 1UC6A 2FH8A 3N9GL 3GRWA 2R1XA 5E4IA 5F89B 4PTUB 2W9EH 4PJIA 3H3PH 4PRPA 5L9DH 4M9OA 4HT1H 1CGUA 3OKKB 3BQUB 5HYSA 1IGCH 2EIDA 3PWPA 1KNOA 1YY9C 3BIAX 3KYNA 1KEGH 4J4PC 5E5UB 3U7WL 3CD4A 1KT2A 1TTFA 4IIQC 1VFMA 3FT3B 1MAKA 3O2WL 4PB9H 2DN7A 4MXWL 4V1DD 4A6YL 4YFLF 5FFLA 3KAAA 2BFVL 1ZAGA 4U0QB 1QNZH 3CDGA 1INQB 1FHGA 4P2QB 5C0EA 4M3JA 1G7QA 3UPRB 1BFSA 1MWAA 2UZIL 3REVB 5CEXA 4B7IA 3BHBA 3V5KA 4PJ8B 3NFPA 3TNNB 1RV6X 5EC1B 4WV1B 3DIFA 2IGFL 2XQBH 3BQUD 5ELIA 1BQLH 4O2FB 3L3OB 2A1WL 1FRGL 3UDWC 1CFVH 4JPWL 4XX1E 2IAMC 4P2RA 5F96H 1TZHA 5SWSE 1RZFL 3CFBA 4MJIA 3HKFA 5I1HH 4N0YH 4E5XA 1DFBL 1BD2B 1EO8L 1PFCA 4P2QD 1GZQB 5IB2A 4GMSH 1XF4B 3Q6FA 5HGDA 4XP5H 4DCQA 5FCSH 4PJ8D 5FIEA 4LHQB 5LCVH 2YA0A 3BD4A 5DI8A 4YAQA 1GGIH 2LAGB 4XAWH 1INDL 2MSPA 4XI5C 1FG2B 2ITCB 5MI0C 3KYKL 5DRXB 3WLBB 4CVXB 3ARBA 5C8JB 3ZO0A 1EFQA 1YEFL 4M43L 3JVGC 4QYOA 4K9EH 5E7FA 4F7EA 3PP3K 3NCFB 4Q6IA 3AB0C 3QUKB 2UUDK 5TPWH 1FNLA 1ZVHA 3FO9A 1BD2D 3PWUB 3FB6A 4GAFB 4JAMA 4LP5A 5E7BA 3LKRB 4JJ5B 4NJ9H 3BPCA 5EORL 1WCBB 4RRPA 3GSXA 3IS0X 5C0CA 2H2PD 4S1RL 2ADIB 1VKXB 1I1FB 5FB8A 1GGCH 3CFKA 1BVKB 2J88L 1F4XL 4ZUWA 3F7QA 3LCYA 3WFBH 2LVCA 5TDNB 4UILH 3EOTH 1S9YB 5IHBA 1OAUH 4ERSH 3VXUE 2DI7A 2W0LA 1D5IH 1S7TB 2Z92A 4OFVA 3FQTA 4JFQB 1NCBL 4LOUC 1GC1C 2ITDA 1FE8H 25C8H 2ED9A 3BP5A 5EZLB 2EDNA 5AG9A 4XP9L 3C09C 3ZKXC 3N1MC 1J0JA 3UZQA 1JNNL 1A6AA 5BQ7B 4KJWC 1T5XB 5IFJA 1UACL 1OL0A 2VWEC 3BD3A 4JZJB 4OT1L 3V0AC 4Z7UF 1C5DA 4OV5A 2P8PB 3PWLA 1A0QL 4MNGE 1MHHB 2F5AL 2XZAL 3NGBC 3UYRH 1YYLH 3QDJE 1HHGA 2BP3A 5F7KC 3B83A 4LCCB 2NX5B 1K2DA 4NQEE 5AZ2L 3ULSA 1O7SA 1T5WB 1FNHA 4IDJL 1C5BH 4P23A 3O6FA 2CGRL 1QKZL 1OVZA 5HHOB 2Z35B 4ZS7L 4Y4HC 1Q0YL 4G8IB 3SGJC 1IEBB 1VEPA 3GMMB 5EZJB 4P9ML 2XNAB 3V6OC 4OKDA 5DSCB 5IROA 1FLRH 3WE6B 3R1GH 4PGCB 3GKWH 4I48B 5MEPB 4U3CA 3FB7A 3DURB 4OGXH 4XHQA 1MCLA 4K7PL 2YHGA 1FZJA 3RI5F 2IPUK 3U6RB 1DLHB 3FKUS 4KPHL 4XCEB 3UBXI 2NX5D 5IF0A 3GIVB 1NBYA 4PJ5E 2UZXB 4A2LA 2HN7A 2X4PA 3VRLF 5E5RB 2XTJB 2XQYG 3KDMB 3L3KA 2C1OB 2GUOA 5HHOD 1W0VA 3SE3C 1CFQB 3L3JA 4LF3B 1I8KB 2H6PB 4I0KA 3Q5TA 4YXLH 3N9GH 3NTCL 4NSKB 1M05A 4HBCL 1JNLH 1NCCL 2Z9TA 1JPTL 5LJYH 1IE5A 4PYHA 3SY0A 3A0OA 5IEKA 4R4BA 1ZHLB 1V7NH 2CK0H 2DTML 2XZZA 4IOSD 4AIXA 5DJ0B 4PR5B 2DLEA 3O2WH 4YJZL 3TIDA 2XTJD 2B5IB 4MXWH 3DGGB 4MD4A 3EAKA 3TFKD 4A6YH 1OTUC 2BFVH 3S96B 3QPQC 2YKLL 3CPLA 3K46A 4LVNB 1UGNA 3T0EC 4JDZB 4KDVA 1OGAA 4PJ7B 5SX5K 1ROWA 3PGFL 1D6VL 3VE0A 1QD0A 5C6TL 1JWMA 1P6FA 2YPKA 2A1WH 3OQ3B 5B39B 2A83A 1FRGH 4JPWH 4WFEE 4PJAF 4JM2F 4E42B 1U3HC 3RUGE 4RIRB 4PJXA 4W81A 4OD3L 5B38G 3SO3B 2ADGA 3QIBC 1OM3L 3HUJF 1DFBH 1X5XA 5HDOA 1EO8H 1CDBA 5I75C 1G7MA 4P48A 2XY2A 2PN5A 1MEXL 2P7TB 1S7VB 2WUBL 5EZIL 1QLFA 4KTYA 4D0DA 3MYZA 1LP9F 3RIAF 4G43B 3KJ4B 5JDSB 4YQXL 1Q94B 1OTTC 4KJPD 5L8JB 1Z9MA 2KL6A 4H8WL 1IBGL 5C07E 3G5ZB 4ZSOA 1PZUB 2H26A 2VLRB 1INDH 1YMHA 3BP6A 3KYKH 4LBEA 1IM3B 1YEFH 4M43H 4EXKA 1GH7A 4JN2A 1JTPA 1Q9OB 5M94B 1IGML 1ZT7B 2M2DA 1BJMA 4NRYB 2EIZB 1OY3B 4MLSA 1AGCA 3EFFA 3JUZA 4XMLL 1ZA3B 2KZWA 4QXUL 3GKZA 3VD4A 5HY9A 3HMXL 1UZ8A 4S1RH 5I8OL 2VLRD 1B6UA 4F9LC 5A2KH 3IDYB 5I18L 4CL7A 4NWTL 5D7JB 5T3ZE 5J6HA 4ZO8A 4E9LA 3UMTA 4MQXD 5I17B 1AXIB 2YXFA 1T1ZA 1ZWIA 4IS6B 3CVHL 3KYMA 3AU1A 1EGJH 1I75A 2IQ9L 2W60A 5E6IB 5JOPE 5CP7A 1B88A 1MHCA 2VSCA 2CR6A 1VEMA 5D5MA 1MCPL 2VAJA 3GSRB 3VFRA 3TCLB 3ARQA 3T4AB 2YD6A 1OWRM 3DX7B 5A1AA 2FO4B 3EZ8A 2O5YL 4XXCA 5D7JD 4LLDA 4QRRA 2Y07L 3CFCL 1JNNH 5J13C 3VFOA 4OCNC 3KPMB 1DQTA 3MRIB 4OT1H 2EEBA 3HR6A 4ISVB 4ETQA 3NCYP 3W5MA 3IVKB 2F5AH 4PRDA 3OKEB 2XZAH 5E6ID 5FA3A 1RZ7L 2PO6A 5D7IB 1EJ6A 2ESVA 5K9JL 2IEPA 3MV8A 1LE5B 5AZ2H 4H0GA 4QTHB 3UTOA 4IDJH 2DJSA 3FOMA 4HPOL 3X11A 2LU4A 4Z7QF 2CGRH 1QKZH 2AXGB 5JA9A 4ZS7H 1Q0YH 1W0YT 4P9MH 4M1GL 1GPOH 5LGHL 5EA0L 1DN0B 2AQ1A 1TVHB 3VFTA 5GIRB 2HFFB 3EKCA 1ITBB 3C8KB 2OLDA 1F4AA 2X09A 4P5TC 5GJSL 3WS6A 1G9MH 4YC2C 2YOCA 1FZKA 4KPHH 4V1DE 1JP5A 2QSVA 5EUOB 4MCYB 5EOQH 3BEWA 4KVCH 2N7AA 3RA7L 2HT4D 5EIIA 3B2UC 3TO4C 4BZ1L 4P4KA 1KIQB 3VG9C 3QISA 5DUBB 3RZCC 1Q9WB 4ZFOA 3SEPA 3FN3A 4XNXL 2B8OT 3PV7A 3NTCH 1BQHA 3I3BA 5DURB 4U6VL 4HBCH 2ICWB 3ARGC 1C5CL 1NCCH 1F3DJ 2F54A 4CAGA 4ZPVA 1I7ZA 4XP6L 4FQXA 3I02B 3FQWA 2CH8A 4J3SA 2IPKB 2BVOA 1W72L 1HHHB 1WWWX 4KK5C 4H1LH 3B5TA 4YIQA 4HFUL 3PGCB 3S35L 1ZHKA 2H3NA 4TULL 1RVFH 4XT1C 4F37F 4MX7B 2DKMA 5DVMA 4ZFGL 4A6YB 4HUKB 7CGTA 4JFHD 2QQNL 1L0QA 5DURD 4NKQB 3T0XA 5KVDL 1WZKA 2JK5A 1U9KA 2NY0B 2B1AL 5DEGB 5C6TH 1TQCC 4Z8FL 3L7EB 5EU7E 3T0AA 3B6SB 4Q9RL 1S9VB 4JQVC 3VD7A 4BQ9A 4LCUB 4OD3H 1BD2E 2Q7YA 2DLHA 4TSBL 3V0WL 1FVEB 3DI2B 2NXYC 4WO4C 5J89A 3RDTC 1MEXH 2WUBH 3ARZA 5EZIH 3M8OL 1KCSH 1OP5K 3OBAA 4YQXH 2NY0D 1B9ZA 3AMLA 4LDOB 5LAXA 4CVWA 1IBGH 5D8JL 3O9WB 1EZVX 4N9OB 4LLWA 4RFNB 1KJVA 1TPXC 3CDGB 4MWFA 1GGYA 1G7QB 2OMBA 4XCCH 3VXMA 3NFPB 3RHWK 2EDYA 4XNQA 2WP3T 1IGMH 3DIFB 2J8UF 1WK0A 6CGTA 2CRMA 4XMLH 4U1MA 1BJ8A 2QQQA 4PJHA 4HCRL 2IH3A 3TC9A 1B4RA 3ULVF 1M7XA 4MJIB 3O9WD 5I8OH 2ARJQ 3BIKB 3GIZL 4NWTH 3W82A 3ZDXF 5IB2B 1EEZA 4HXBL 4NQUA 1CE1H 4DCQB 4QXGL 3W11D 1I1AB 3NZ8B 2Q8AL 2ZUYA 5CILL 5D1QA 1JMZA 3ARBB 4Z9KB 4JLRA 2VZOA 4JHAL 2DQTL 4ZODA 5GSRB 1S9XB 4MJID 1A64A 2XG4A 2O5YH 4NQDB 4RQQA 5T1KB 3ARTA 1FL5A 3VDBA 2Y07H 3CFCH 1VHPA 1DEEB 1U92A 3SBWC 3AUVA 3MOAL 2F8XC 2H2SD 2X4TA 4PJGB 3MLUL 1FGVL 1I1AD 1E28A 4FQLL 5BRZA 1KULA 5C0CB 4H8WC 4UT6L 4XNUL 1RZ7H 4Z7UA 5FB8B 1FVDB 3CFKB 2NX5E 1TZIA 5K9JH 4JVUA 3ARBD 4XGZB 5T3XD 1F11B 3UP1A 1QFOA 1SM3L 1RURH 5HHOE 4NQDD 4PJ9C 2G75A 5T1KD 4HPOH 3K8KA 1EVTC 4QY8B 4NRZB 3DX6A 1CFSA 3X14A 1V3KA 3O3EB 4M1GH 2Z92B 5EA0H 2GSIA 3NIDF 1F4YL 3SE4A 4G8FA 3JWOL 1L0YA 4JFXB 2ITDB 2MMXA 3NCEB 2YPVL 3CVIL 1CDHA 2VXTH 4HQQL 5C0CD 2O5ZL 2ERJC 1PQZA 4WI3A 3IDGA 3QXDA 3B3IA 1N26A 1G9EA 2XTJE 2XKSA 2YPLA 4RMSA 5JO5A 4PJDE 3RA7H 2R29L 3OXSB 1BP3B 4BZ1H 2AJUL 4OV5B 4ZUTA 5AAMA 2X4QA 4XNXH 5EOCL 3S35X 4WW2A 5CLTA 5CJXA 5I74C 1C5CH 2A6JA 4GKZA 4GAYA 2X9WA 2W9LA 4BSWA 1W72H 3O11B 3V5DA 4GRLC 4OZHB 3CDCA 3QIUA 1CICB 1NUNB 3TJHC 1DANU 3S35H 4TULH 2CIKA 4PREA 5IWLC 4ZFGH 3FAXA 5F9OH 4PJ7E 2QQNH 4NBYB 4FZEL 2EDEA 2ED8A 1S7RA 2IQAB 3ARUA 5IF0B 1NBYB 3W9DA 2PXYB 2X4PB 4NCC2 5DYOA 2B1AH 5E56A 4JRYA 5E5MA 4Z8FH 1ZLSH 3DUUB 1A7RH 1T0MB 1W0VB 5F7HA 3L3JB 1HEZA 1CICD 4DKAA 4Y5VA 2L4OA 3LHPL 2OX5A 5I1JL 1NC2A 4PJAA 1M05B 1IQWL 3V0WH 3PWJA 4BM7A 2FJHA 4P4RA 4EJ1C 4RGNB 1CLZL 2GW5A 4BFIA 3SY0B 4HWBH 3L6FA 4YK4C 1FN4B 3M8OH 5IEKB 4R4BB 2J1KA 3REWA 3PWVB 4ACPA 2AI0L 5CEYA 2VLRE 32C2A 2PXYD 3ARFC 4PJEA 3GSUB 2EE6A 1YECH 4MD4B 5F9JA 1LMKA 4S0SD 4KC3B 3VGEA 3CPLB 1UG9A 4KK9C 4F7PA 2IPTL 2R56L 3BPLC 4X4XA 2DQDL 5D7LE 3MJ9A 5J7CC 2BHUA 5GS0H 1A14H 3P0VL 2YD5A 3CU7A 4UV4L 4FTVB 5F9WB 3ILQD 2NY4D 4RGND 4OLYL 1QBLL 3D48R 4QRPB 4GUPA 1JWMB 2YPKB 4ZOCA 4AMKH 2A83B 4LLQA 3TP4A 2R2HA 1HK6A 1TVDA 1DN2A 1HI6B 1JNHA 2SEBA 5EO9B 4PGEA 3WS3A 4C83A 2E6QA 3CC5A 4Y5XB 3UCRA 1AD9B 2ADGB 1K5NB 3GIZH 2VTFA 3RVUD 2Y6SC 3QQ3B 1OGAD 3ZTNL 1K8DA 4PJCB 1T03L 4D0DB 1ES0B 1DANT 3BOVA 4CVZA 2NTFA 4FTVD 2GK2A 2A9NL 2EH8L 2VDRL 2UWEE 4W6XB 3TBTB 2HVKA 4QRPD 2Q8AH 3FONA 1XGUB 5D9SA 4ZSOB 4CDGC 2H26B 3O41B 1YMHB 2JB6A 3BP6B 4AYFA 2CKNA 1YMMB 4X4YA 4LBEB 3QUXC 2DQTH 4JHAH 2A2QT 3ISWA 4JPKL 4R4ND 3T1WA 4HAFA 3K4ZA 2BK8A 3JWDH 2R9HC 2VUYA 4O2EB 2ZNWA 4OM1L 3E8UH 3MOAH 3EFFB 5CCKL 3MLUH 1FGVH 1PW3A 1BPVA 4JJHA 5F88A 5IFHL 5F9DC 4XC1L 5D7IE 3IDMA 4L4VB 5HYSG 4UT6H 1P7QB 2FO1A 4ZUUB 2NYYD 4M5ZL 5DTFB 1LK3L 4QKXB 1YMMD 4WJ5A 5BV7C 3T77B 2B7DT 5J6HB 3PHQB 1SM3H 3GMPA 2DBLL 3ZTJH 5FKPA 2P49B 3AU1B 3QJFA 5D2LB 1BOGB 5SWQA 2W60B 5HI5C 3PNWB 4KGJA 1FZOA 1PKQA 3BKML 1F3DH 3JWOH 3VFRB 3U0WH 1VACA 1NFIA 2YPVH 3CVIH 4Z7WB 3RKPA 4HQQH 4L4VD 1D9KA 4H20L 1MFCL 1P7QD 4YUEH 4I0PB 4U7KA 3MA9L 3F7PC 1U8KB 4LQ1A 5E1HB 5EUOE 5F1SA 5F9AC 1VERA 2MQ0A 1FYTA 3FT2A 4TOYL 4UIKL 4YHKL 2YEZB 3LMJH 1WJ3A 2R29H 1CWVA 1W0WA 3QUYB 3SDXF 3TZVC 2AJUH 4GG8A 4APQB 5FDWA 2LAAA 5KSVB 3ARDC 4JFHE 4PG2A 2BNRB 4L8SB 1YEGL 4GS7B 5HHXL 4Y4FA 1P84K 3VXSB 4GW1B 4LARH 3SCMA 2GITB 3RP1A 3S4SB 5IESH 4NQVA 2XQYK 3C8HA 3FOMB 4CADB 2C4FU 3MLRL 4FQ1L 1BFOA 1J88A 2VL5B 1ORQB 4WWKA 5AZEL 1DBAL 1WICA 3QUYD 3NIGF 4FG6C 2Y06L 4APQD 2Y25A 3SDCB 2HG5A 4P2OC 2BNRD 3G5VB 4X7CC 1CE6A 4JHWL 4RRPG 3FN0L 4U1LB 3VXSD 1CXHA 4LSDA 4X6CB 4PV9A 4OZIF 1MCKA 1HZHH 1YYML 2CLVB 2VQTA 5CZVL 5KW9L 1QYGL 3BVNA 4OKVB 2FH6A 1SJHA 3LHPH 5I1JH 1VENA 1OF2A 1DL7H 1NGXB 3SDCD 4ZPVB 3MBEA 1QBBA 5F6HI 1CLZH 1DDHA 2ZG1A 3PJSB 1AGBB 1FL6B 2CLRA 1J86A 3AREB 2W59A 5FEBA 4N8VB 5EBMB 3BPNC 2AI0H 3U1SH 4CN1A 4HUXA 1T89A 1U8LA 2BC4A 3LIZL 4P5KA 4JKKA 4WU5A 5E0QA 3LKOA 3OKDA 4XBGB 3DUSA 5LBSL 3T0WA 3I50H 2IPTH 2R56H 5I6XC 3ESVF 2DQDH 3RWHB 3BJLA 2ADFL 1FNEB 3WD5L 1MI5B 3EJYC 1MELA 5CEZL 3P0VH 4UV4H 1UXWB 4HKJB 1CD9B 4KK8C 4OLYH 1QBLH 4EVNA 3WUZA 2MTPA 5DMJB 3HS0B 4ENED 3ARED 1WTGT 3QEQB 1BVLB 4B0MM 2J8UA 1MCDA 1NCAL 3VXQA 3KPSB 4JREB 3IETB 2HJFA 1NFDF 2C4FT 2ZOKB 3S88L 3WL9A 3OF6D 3NCYS 3VWJC 3LQAL 1MI5D 3ZTNH 3LS4L 1XGQA 4TN9A 1T03H 3KLDA 4WCYL 1GHFH 4DJMA 2A9NH 5HHQB 2EH8H 2VDRH 5B3JF 4UTAL 5J12B 5LAXB 5T3XE 4HKZB 2Z31A 4DEPC 4FNLH 5B21A 3QEQD 4NQDE 4MWFB 3PGDB 3KPSD 5TFSH 5E8OA 2L0DA 1G9NC 4XNQB 3OJVC 4DZ8B 4F3FA 4K23L 4PJGE 2AQ3A 5JXED 4AZ8A 2YSSB 5I19L 4P46A 5FYKE 2A73B 4OD2A 4NO3A 4O2CB 4PRAB 1CFBA 1KJ2A 4U1MB 1I3RB 1XGRA 1MJJB 2IH3B 3B9KA 4XC1H 1UVQB 3C6SB 5TDPA 3WHE0 3BKYL 1ZGLP 3OR6B 1QFWI 1OOAA 4M5ZH 4W4NA 5FUOL 1MJ7L 5E4EC 4M3KB 1EEZB 5DVNA 3ZDZE 2DBLH 5HBBA 4PLJD 4I4WB 4OLUL 1U2HA 1FGNL 5C0DA 4E0RB 4J7RA 2ED7A 5D1QB 3HA0A 2OK0L 3BKMH 2DQIL 1EZVY 3WJJC 2E27H 4JLRB 4YXHH 5HVWA 2HTKC 4PP1C 4H20H 5DUPL 1DVFB 1RK1A 4PGBA 4TVPH 1KG0B 3MA9H 1NUFA 4WUUA 5IV2B 2XKUA 1U92B 2X4NB 4XBEL 4TOYH 4UIKH 4YHKH 1OP3H 5C0RL 2QL1A 4PFEA 3C2AL 1NC4A 5HHNA 5ID1B 5D1XB 5J11C 2DF3A 1ZT4A 2ENYA 1ADQA 1SEBA 2R2CA 5ESAA 5BRZB 4WI2A 3UTTA 5D1QD 2E3VA 1E4KA 1JPGA 4Z7UB 1X5HA 3OKOA 4P2CG 1YEGH 5HHXH 5D93B 3CH1A 3FHAA 1NCUA 1FV1A 3SGEI 1DVFD 4S1DD 2G75B 5HGGS 5I8CB 2CLZA 1OSPL 4OZHE 3FZUC 4WUKL 3QNZB 5DK3A 2DQEL 5IMMA 2GIYA 3DX6B 1CFSB 4LCWB 3FOLA 3HLAB 4P5MA 5GS2H 5KOMC 3WEXB 3H0TB 1BHGA 3V6ZA 1FNAA 5AZEH 1CIUA 1OAQL 4FFWD 1MJUL 4WDIA 1HQ4A 4LCYA 5BRZD 5GJTL 4XBPA 1EEYB 1P2CB 2NY5L 4XB7A 4YHIB 5EZOL 1KBGH 4U4BA 1AHWA 2VE6A 3EOAA 3QXDB 5HGHA 1T3FB 1QLEL 3FN0H 3TH3T 3IXAA 2BSTB 3OZ9L 2CPCA 4J3VA 4KK6C 5JO5B 3QO0B 4HLJA 5LXGL 4OZFH 1NAML 2Y36L 5CZVH 4LCWD 4ZOBA 3OJDA 4HUVB 5KW9H 1QYGH 4MJ6A 4GSDL 4OCYL 4ZUTB 4NCC1 3DHMA 5I15L 3VXOA 3WSQL 5EPMA 3BGFC 4HUMB 4X8JB 4ZQKB 1LEKB 3MUZ1 4GAYB 2OTUB 4MSWA 3V5DB 3WMSA 1QSFA 4ZMAT 5IB4A 1UJTA 3QIUB 1XT5A 2AXJA 3O6KH 5CJOL 3X17A 1U36A 5J3HC 5BOZG 1A3RL 4LHUA 3X13B 1OTSD 4TTGA 1I3UA 3VFVA 2AEWA 4I8DA 5E2WL 5LBSH 2B20A 4MLIA 5C70A 2UUDH 5E2UH 1JBJA 4H1LB 2ADFH 1U93B 3L95A 4FTVE 3WD5H 5CEZH 3ALPA 4QRPE 1S7RB 5FYJL 4RNRA 1H3VA 3C5ZB 3W9DB 5ANMA 4MCZA 1VFAA 5E5MB 3SJVA 3SKNA 3RIFF 2EDBA 1RZIB 2PR4L 3QIUD 1MF2L 4PJBF 3ECBA 1NC2B 3F62A 4PJAB 4JM2B 4MD5B 5CZKA 2HVJA 3MR9A 2FJHB 3NABH 4PJCE 3CSPA 2DYPA 4H0IA 3L6FB 1IGIL 2X5PA 1MREL 2D7TL 3HUJB 3LQAH 4HKBA 4G5ZH 2DIJA 3MLTA 1UH4A 4ZSOE 2PYFA 2PNDA 5CEYB 3C5ZD 1F4WL 1YMME 2DQJH 5F9JB 1LP9B 5SX4H 5C09B 3SE8L 3CMOL 5KJRH 4GBXA 2O26U 4R7NA 4F7PB 1UCTA 4Y4KC 3D1MC 1ZGLB 4QHLA 5B8CC 1NC2D 3LKQA 3TVMB 4JM2D 2X1PA 5I1KL 2QR0A 3BWAA 4I2XA 4L9LC 3UTZA 4FRWA 3IKKA 2NXZB 5I19H 2DKUA 1BQHG 1J1OL 4LLQB 4L4VE 1IGFL 1JNHB 2SEBB 1OAZL 2X1WL 4C83B 3MFGB 3CC5B 3PIQB 5C09D 3VGAC 2XG5A 5FUOH 2OI9B 4ESKA 2FWOA 5DQDL 1IKFL 4GXVL 4MNQA 5DC9B 2NY2B 4NDMA 4WRLA 1CLOL 3P9WB 3TVMD 5D2LE 3VFSA 3DYOA 4CVZB 1P5VA 4RFEA 4OLUH 3LAFA 1FGNH 3WIHH 4J4PA 4U6HB 2NXZD 4LEXL 4M62L 3VGFA 2YK1L 4IIQA 2B4CC 4R96B 5D9SB 1G7JA 1EERB 2JB6B 4Z7WE 5LQBL 4F33B 1YNLL 2DQIH 4D94A 2ZUWA 3MZTA 4LP4A 5IVXF 2OTWB 2XACC 3VDAA 1EO5A 2RAMA 1TQBB 3OGCB 3QWOA 4HJJH 2GJ6E 4UINL 4YHPA 5DXWA 4P9HC 3DETD 5SV3A 2NY2D 4Q2ZA 5ECJE 4ELMF 5C0RH 3BX7C 5D7SL 2OL3H 1OARL 2GJJA 5IIEB 5F88B 3P73A 4F58L 2BNRE 3UDWA 4JFDA 5I0ZA 3VG0L 2IAMA 2LV4A 3VXSE 1KFAL 3QWQB 4K94C 3N1GC 1UQSA 3GMPB 4UNVA 1U8PA 3QG6A 5H2BA 1FJ1A 5CBAB 1G1CA 5ITBL 4G6JH 2FEDC 4WUKH 2DQEH 3HMWL 5FKPB 3PQYA 1KTLA 2ATPA 2CRIA 3KLAA 1NGZA 3IFNL 1W8OA 4P0DA 3ZHLA 1FZOB 1OAQH 4ELKB 3ZLQC 1NFIB 1XR8A 2DQUL 1CFNB 2FATL 4HS6A 3ULUC 1PD6A 2NY5H 3UAJD 4YX2L 2DKSA 3HE7C 3NA9H 3EOBA 1FBIH 4MB5A 3RU8H 3L9RB 3KVQA 1QLEH 3FT2B 3BZEA 5KSAB 4X6CE 4R4FL 3KPRA 2ZOLA 4FQQA 1KC5H 3OZ9H 4P2YA 5C0ND 2IFGA 4KHTL 4LIQE 4PY8J 1EX0A 5LXGH 3NAAL 4OM0L 1J5OH 2AVGA 2HMID 3BDXA 3NPSC 4Z7NE 4GSDH 1IQDA 5I15H 3SGDH 4XNZC 3LV3B 4S1QL 3WSQH 1JK8A 4R90L 3ES6B 4KQ4L 5TE7H 3U2SB 3SOBH 4QHUA 3MRPA 4EQ3A 1WZLA 3FCTA 5ALBH 5F7YC 5KSAD 5H94B 5GXBB 1ZT1B 5F1OB 5HI4C 5ICZA 1A3RH 3WKNA 4QTIL 3UJTH 1H3WM 3P11H 2HA1A 4UOW1 3D9AL 5E2WH 1MI5E 1JUFB 2ZG2A 3QRGL 2UY6A 4LEOA 1CE6B 3IJSA 3VFMA 4YGAB 4M6NL 5EU4B 4XPHL 5GGVL 4GG6F 3ALWA 1WBXA 3RHWF 4PV9B 4L8BB 3QEQE 2AJXH 4Z0XA 1HSBB 1CGVA 5C7XL 2KKQA 2W9DH 3QH3A 3KPSE 4UAOB 2PR4H 1NH6A 3H8NA 3BVNB 1EJOL 4I9WD 1MF2H 1AR2A 3GI9L 2NQCA 1TZGL 2BOCB 4YZFF 4DUWA 3LEXA 4XHJD 1IAKA 1S7WA 4HIHB 3QEUB 1OF2B 4HIEA 4YBHA 3FL7A 2NY5C 1FFNB 3MCLH 1DDHB 1U3ZA 4P3DA 1JCKA 1IGIH 2I9LB 1MREH 2UVEA 2D7TH 5A2FA 1NFDA 4BUHA 1RIUH 2CLRB 4IRSC 1TNMA 4Y4HA 5DFVC 4HZLA 4X7FC 3SGJA 2CO7B 1F4WH 4HUXB 1F4HA 4P5KB 1EDQA 3SE8H 1HOCB 1JGVL 3C60B 3MRKB 1T83C 1NSNH 1XF2B 3RVVC 4EIGB 2YUXA 1SEQL 2C4XA 3QG7L 1UB6A 1CQYA 4S1SL 3WV0A 1NBVL 1OW0A 4UV7L 3EYFA 5EBGA 1ORSA 3VRIA 1VADB 1K6QL 1OGTA 3C2SA 1IGFH 2BVPA 2J8UB 5IVZB 3SE3A 1OAZH 3QQ9C 3AC0A 1QFPA 3OL2A 3C60D 2YD1A 1EO7A 4GXVH 3WL9B 1B4JH 5K9OA 2EXWD 3EYSL 4CU6A 1CLOH 4CN4A 4P3CL 1KJ3L 3SKMA 1KCKA 5I30L 2DM3A 1T80A 4LEXH 4M62H 2YK1H 1JWUB 2FLRT 5F7DA 5LQBH 4WW1A 3P4MA 3I3DA 3PL6C 5E8OB 5GS0D 2AKRA 2XFXA 3HI6H 3T0EA 3O8XB 3QA3A 3NCJL 1C16B 1X44A 4UINH 2APVA 4M8QA 5E6YA 5C0JB 2F53A 4FS0A 3ULVD 2NR6D 2DL2A 2CIIA 3TJEL 4LVEA 3CZFB 4P46B 5DO2C 2XY1A 5MENE 4OD2B 2XT1B 5D7SH 1KJ2B 5BRZE 1OARH 4RSVA 5JPMA 2D31A 3TBWB 4F58H 4ZO9A 4PGDB 1EK3A 1J0HA 3NZHL 1JIBA 5TDPB 2AJ3A 4N0UB 4DGVL 3H9SB 3DUHA 3QIBA 1RZKL 2AGJL 3QI9B 3LRGA 2XWBA 5GGTA 3ZYZA 2EYRB 5ITBH 3I3EA 3O8XD 1ONQA 4LCWE 1JYVA 5GRYA 3U30C 1T7VA 3HMWH 1T4KA 3MRDB 4P46D 5FM5M 5A3ID 3DMMB 1KPRA 1AP2A 3L5WB 1R5VA 2DWEA 4U1IB 3W0WA 5AUMA 4MMXC 1E27A 2DQUH 1M6OA 3BDYH 4HUWA 5CMAA 4ZDHA 4YX2H 3H9SD 4ZS6D 1MOEA 3GK8L 1P84J 1VGKA 4R4FH 3MRHA 3QI9D 3U9UA 3AY4A 1MCJA 1J11A 4D3CL 3MGTB 1NC4B 1G7PB 3VRLE 2H45A 1ZT4B 1NGPL 1SEBB 1QPPA 1LDPH 2UYLB 2BRQA 1JHTB 3DMMD 2W65B 4JZNA 4Z5RA 3INUL 1D5BA 5IBUG 3OKOB 5GRVL 3UTSA 4F9LA 4S1QH 4IRZL 3ZL4L 4HWZB 4X6BA 4R90H 4KQ4H 2GT9A 4KI5C 4U1JB 4L3EE 3EDJA 3WXVL 3MRGA 1OP5H 2OZ4L 2MQCA 1A8JH 1OCWH 5FOBA 4OZ4A 1JTOA 1UXSB 3V4UL 3V6ZB 1DCLA 1NC4D 3PV6A 2Q6WA 3EO0A 4QTIH 5MEQB 1YPZE 1ETZA 4WDIB 1CVRA 4XBPB 2H32H 4HGMA 3MLYL 3T1FB 4OFPA 3QRFM 1CG9A 1CQKA 3QRGH 5TQ2H 2VE6B 5JPNB 1GIGH 4OIBA 3SQBA 4OQTL 5BZWA 4XH2A 3O2VL 1A2YA 3RL1A 4M6NH 4PRBA 5GGVH 4HFWB 5IG7B 4G80B 2H41A 3RNQA 1B0GB 3N1PC 5C7XH 2X70A 5JHLH 2AK1L 5I1LA 4FZ8L 1EJOH 2RFXA 3GI9H 3ZKMC 1G6VK 3VXOB 5DVKA 5GZNC 1QHPA 2R23A 3MTRA 3CH8A 1RJYB 1FPTL 5ACZA 2R0LL 1OHQA 3HUJE 4MSWB 5JA8B 5CSZA 4IOIB 3QEHA 4NUGL 4YR6B 1P53A 3F5WB 2NY3B 3H7BB 1LP9E 2AXFA 1KEML 5C09E 4HJGB 4ZFZA 1MFAL 5A2LH 4KQ3L 4JEGB 2D03L 3HNSL 1JGVH 1GAFL 4DKFH 3L7FA 5C0IB 4M1CC 4ZAKC 3PXJA 4HWNA 4LSSL 4G9DA 3EFDL 3PWNB 1SEQH 3HE6C 5FGBA 4AM0A 3HI1A 4S1SH 1WEJL 2LQRA 2R8SL 1F42A 1BM3L 1NBVH 1P6AB 2JCCE 3DX9A 3M07A 4KTEH 4UV7H 1VFAB 2WANA 3SJVB 5CHNA 3UBXA 1A6WL 2A6KA 3TYFB 2D0HA 3TO4A 1K6QH 1EAPA 2NY3D 5FYLL 4CJ1A 1NMAH 2HLFC 3RZCA 1LNUB 4M02A 3MXWL 4XCNA 5DRZA 4GKSA 2HVJB 3ARGA 3EYSH 5DRNB 3RPIA 4MA1B 1QBAA 3FO2A 4QT5B 1K4CB 1DQQB 1MHPL 3AAZB 4XP4L 1FSKC 3MLTB 2PYFB 5HHPB 5I30H 4UQ2A 3KLHC 2I07B 5IBTL 5CBEA 4YNYB 3SJVD 1PYWB 4Y19E 4ZOAA 2BCKA 2AJYH 1YZZA 4YH6A 4MQ7B 3EHBC 4IMLA 1IGJB 3V7AG 3LKQB 5HVHB 2VQ1A 2VN4A 3O6FC 3NCJH 2KH2B 3WDJA 1NANH 2QR0B 3DV6A 4XWGH 3BWAB 2JB5L 1R24A 1VGEH 3MNWA 4WI9A 4Y2DB 3TJEH 1DQLL 3VCLA 4XP1L 4CUCA 1V7ML 2DQFB 3C5SA 3WNMA 4RGMB 1UEYA 1J1PL 3IJHA 2VRAA 4M1DL 1U8NA 4QEGA 4JQVA 4LVHC 3NZHH 4K8RL 5ENWA 4D8PA 5JW5B 4ZNCD 5HYEA 4NNPL 3V5HA 1KPVA 3DO7A 3N1FC 1MQKL 2P24A 4HC1L 3OMZA 4MNQB 1IARB 1RZKH 2AGJH 3ILPB 4XB8A 1U6AH 4MAYB 4EI6A 4WO4A 3TT1L 5FYJU 4I3RL 1JGDB 1R3KA 5T3ZL 3CNKA 1MRCL 3T3PF 1RJZA 4Y2DD 2ZJSL 3CUPA 2F9BT 5IM7B 5E95B 2HWZH 2OM5A 3D69B 4WY7L 5HYIA 1FNFA 3DV4B 4NGHL 1HE7A 3S8WA 4KXZH 3NIFF 1ACYL 4QNPF 4MNQD 4F15B 3PG2A 3NACH 2D7QA 4Q2ZB 4R8WH 4MAYD 3QB7C 4U1HB 1UJ3B 4D3CH 1M1SA 5J4MA 2EDRA 4GH7B 4QHMA 1NCTA 1YY9D 3MJGX 1NGPH 4J4PD 2OJEB 2PETA 2C3XA 1L6XA 1FL3A 4X99A 3T8XB 3INUH 3SDXB 3T0DA 3LRHA 1HHJB 3THMH 5KVMC 3BMWA 3ZL4H 5EOTA 2AJVL 4FFYL 1U8PB 1FJ1B 3OHXB 2OZ4H 3DX8A 1X4YA 4I9WE 4ODHH 3MLPA 3P9LB 3BFOA 1KTLB 4R0LA 3V4UH 3L3HB 3QIWC 4N68A 5I1AB 3TV3L 1HYSC 4YEFA 4TRPL 4KKCC 5MI0B 4TVPD 4NN5C 1XR8B 3QHFL 2OTPA 2MQ3A 2QQLL 4Q0XH 5D6CB 4Z7OF 4OQTH 1UEMA 3BZEB 3AB0B 3KPRB 3VFNB 1XCTB 1A4JA 2ZOLB 2BNUA 1LO4L 1QRNE 1IAMA 3P77B 4JKPL 3VXRB 1NUGA 4Z95L 4GG6A 3PQYD 2AK1H 2BHZA 4OZIB 4FZ8H 1G7IA 5HHMB 2HFEA 3ZYOA 3OAYK 3Q2CA 4BA8A 5KANG 4OF0A 4EKXA 1FPTH 3U4BL 2GEEA 2R0LH 5L2KA 3QNXA 4AL8L 3GHEL 1AR1D 1DSFH 2F74B 1B90A 2XA8H 2Y4SA 4OGZA 3NBNA 4PJ9A 1CD1A 4NUGH 4LPCA 2MPAL 4ONHA 1N4XL 3MROA 3WUWB 5IGXL 5GS2D 3KPRD 2VITA 1JV5A 1A6TB 5LGJA 1KEMH 5ICZB 1MFAH 2BERA 4ODXA 4KQ3H 3VXRD 3VDCA 2ORBL 2D03H 3HNSH 1GAFH 4S11A 3IDIA 3HMXA 4LSSH 3O81A 1WBZB 1IKNC 3EFDH 5HHMD 3LKSA 5JOEA 2G5RA 1WEJH 1D5MB 3C09B 5DJXA 2R8SH 2EIBA 3FTGB 1C12A 5DMIL 5DS8B 5L6YL 1NKRA 2WV3A 1A6WH 1SBSL 1XGPA 5ITFA 3CVHA 4JFPB 5I0DA 3LKPA 3E2HC 5FYLH 4YFEA 3L3DB 3OXRA 3P4OA 2AXHA 5IMKA 1JPFB 3MXWH 3OTTA 5FO9B 1S7WB 4YDLC 2ZWLT 3MJ7A 4HIEB 3ZDXE 3ORJA 1NFDB 3SQOH 3L5XH 4XP4H 3GB7A 4W70A 4Y4HB 4KJWD 5IBTH 4YHZL 3S98A 2YN3A 4XMPL 3EUUA 1VPOL 3WN5C 2PO6C 4L29A 5DJ2B 1UKTA 2V7NB 2DJUA 1EHLH 5CD5C 3SKUD 4ONOA 5E8EB 1UB6B 5IWLA 5E9DE 5JHDA 2HJLA 2C5DC 3GFUA 4X4MA 2JB5H 1EA9C 1Q9KA 1BZQK 4JZOA 1WSST 1FDLL 1DQLH 4UU9A 4XP1H 2R4RL 3ZE2F 1V7MH 2IADB 1R5WA 3T2NL 3MNVA 1OGTB 3T2OA 5AAWA 4QRTA 1XZ0A 2BVPB 4JFOB 4Y4HD 4HGWB 4N0UE 4JB9L 5EU6A 1WQVT 1Z2KA 3QUMB 3H9SE 4K8RH 1N64L 5KOVC 4NNPH 2DD8L 1MQKH 2DI8A 3LPWA 4HC1H 1H15B 4M93C 3DXAB 3BP7A 1Q0XL 5KTEH 4ORZC 4K7FA 5CGMA 3RJQB 3TT1H 4UNUA 4I3RH 5EU3A 3SKMB 5T3ZH 2J6EH 1MRCH 2XZQL 4NKMA 4EXPX 2HRPH 3ARFA 2D4FA 3FFCB 4HIIB 2RR3A 5F7DB 4F80A 3CX2A 3NIDE 3P4MB 3ZSSA 2QEJA 2YD3A 5CP3H 4WY7H 2AKRB 4N1CA 2XFXB 3AS1A 4JR9L 3T0EB 3CFDB 3RVTD 1BLNA 1V3MA 2VDNL 5IMOB 1ACYH 4DFIA 4DUXA 2PCPA 4MA3A 1OT1A 3MBXL 2JLLA 3V6BR 3DXAD 2XWJA 5F7NC 1A6VL 1WV7T 4NHCL 1QA9A 2CRYA 3G04B 1C7TA 1I7TB 1Z5LA 1W72A 2D31B 5TQ0H 1Y18A 2AK4B 1QSEA 4V2CB 2P46B 5DJAA 3VXTB 3FFCD 4E41A 1U3HB 4NWUH 2CMRL 1OTUD 5DQ9A 2AJVH 2X4RA 4FFYH 5I75B 2OL3B 3T0ED 2DM2A 3GI8H 1ONQB 1D3CA 2O61B 4KKBC 3HC3L 1T4KB 4YHYC 3MRCB 5GGUB 1WWAX 4YGVA 5D96C 4TUJA 5IT2L 3STZA 1AP2B 4TRPH 4LPYA 1R5VB 1U95A 2NCMA 3LDBC 2AK4D 3W0WB 2XICA 4LPTA 4CMHB 1E27B 3QUXA 4KMLB 1E4WL 3QHFH 1CI5A 2MHAA 1U3HD 4HUWB 1T1XB 5CMAB 2VDLL 2QQLH 3QBTB 4IDLA 4N0RA 5F6IC 4L8CB 4G8GB 3T65A 5EB9A 5E08L 3H7LA 3WLWC 4JKPH 4MAUL 2P5WA 1BZ7B 2ZUQC 4BSVB 3KPLA 1OTTD 4Z5RB 1MIML 4U1NA 1WBYB 1I1CA 1HH9A 3OKYA 1LD9A 2IC2A 4GLRI 1SMOA 2VLJB 4MZ3A 2DJ4A 3U4BH 3W0WD 2GT9B 2IMMA 3E6HB 4AL8H 1SQ2N 1L7TL 3HPJA 4G8GD 3SGKC 1RZJC 5IGXH 2NY6B 4TNWK 3L3IA 2WIIA 5FOBB 4X5WB 4OZ4B 4M7LL 4J8RA 4HWUA 1YEDA 3QO1A 3EO0B 4KJQC 4H5SB 3GGWB 3BN9C 4HCRA 5T1DH 3C9NA 4KI1A 1DUZA 2ARJB 2VLJD 3FHQA 4RBPK 2EEAA 4U2ZA 4LKCB 1L9MA 5F1NA 5K9QG 5IQ9A 5F7EH 1J8HA 2FD6L 3BEVA 1M7DA 1SBSH 4F7CA 3FB8B 4YXKL 2ICWJ 3MYJB 2NY6D 5I1LB 3RX5A 3JV0A 2RFXB 5JW4Q 3ARDA 3STLA 5KS9A 3S97C 1N0XL 2R23B 4D0CA 3GSWA 5ACZB 2FIKA 5GGSY 4PJBB 3PDOB 5T33L 1JZ7A 4ODUA 4X6FA 3S36X 3EGSA 3QCTH 5CSZB 3QDMB 4JFZL 1MCFA 2BHYA 5LVEA 3MRMB 3X3GL 3FFDA 5FV1L 4YHZH 4XMPH 1VPOH 3ULUF 1I9IL 4Z78A 1PZ5A 2JKXA 1PLGL 2GTZA 5DRWB 1BEYL 1BVZA 3KS0J 3HI1B 1S7XA 3S36H 4P2OA 4P5TB 5FKAB 4MVBC 4BSJA 3MREA 1BIIB 1BWMA 4YC2B 4QOKB 1FAIH 3T08A 3MRRA 1FDLH 3QDMD 4PRIE 5CHNB 5DC0A 2A77L 3T2NH 5FDYA 3TO4B 4MHHG 1U3YA 3BQUC 1EAPB 5J57B 3AM8C 3VG9B 3G6DH 4JB9H 4C55A 3R8QA 3LKNA 1N64H 4MNQE 5E1AB 5IR1B 3GNMH 1YNTB 4XCNB 4WI4A 5DRZB 1H8NA 2R1WA 1T04A 4MJ2A 4K55A 1MFEL 1Q0XH 1LQSR 1IC7L 5IBLC 3Q6GH 5ADOL 4P5TD 1G6RB 3FO2B 5IW1A 4QOKD 4H26B 3IRPX 1QP1A 1S7UA 5ICXB 4PJ8C 4ZYKA 4WENB 1MFBL 4X9GA 4WV1C 3B2UD 3TO4D 1UH3A 3DRQA 1JMXA 1LEGA 3SE9L 3OJ2C 1HSAA 3RIAK 4JR9H 5EU7C 4XCYB 2VQ1B 2NZ9C 2VDNH 3SKOA 2AV7A 3DV6B 3JTTA 5IVXB 3MBXH 4PUBH 1R24B 3U4EA 3MGOB 4HWEL 1A6VH 3VCLB 4ONGL 5E94B 3C5SB 4TVPE 4Y0GA 1I85C 3SDXE 1U8NB 2I27N 4ELMB 4UT7H 5C0BB 3D25A 3D85B 3HAEA 3BRFA 2GFBA 4XPFL 5MEOB 3V5HB 1KPVB 4EUPB 2CMRH 1CXKA 3MC0A 1LE9A 2P8MB 2NXYB 2XN9A 4OUUA 4WO4B 4J1UB 2FB4L 3NA4A 2HYMA 3RDTB 3VWJA 4KZDL 3D0LB 1RPQA 2HTLD 4JRXB 3KHOA 3HC3H 4Z76A 2YA2A 1RJZB 1URLA 1TJHL 4AG4H 4AY0A 3FQXB 1LK2B 1WAAF 1XH3B 5DGRA 4ZO7A 1A7OL 5IT2H 1HDMB 1Y0LB 1TPXB 5C0BD 1FP5A 3G6AB 3D85D 3RGVC 1E4WH 5F97E 5CKAA 2I9TA 3TNMA 5JUEL 3H9ZA 4JVWA 4ODSL 3X12A 3STBA 4OLZL 3O4OC 2Y7QA 3VXRE 2NLJA 2NXYD 4WO4D 3RDTD 4WHTB 4IHOB 4OZGA 4OZIE 5AWNL 4JRXD 4NKDA 4F9PC 5F3BA 4ZTPH 3WFEH 4ZPTA 4L1HA 3CSGA 4CMMA 5JOFA 1SJVA 2A6DA 5GRUL 5EOTB 1UADC 4PBVC 5KVEL 1N5AA 4YDVB 1L7TH 4X80L 2C1PA 1TENA 2BXZA 3DTXA 3S37L 4NT6A 4CBPA 1XFPA 1LEIB 4M7LH 5FECB 1RUKH 3KPNA 1X3DA 2EKSA 5F7FA 4JKWA 5EBLA 1I8IA 4HKXA 3FAWA 4L8DA 5IJVB 3BZDA 3UEZA 2AERT 4P57A 5DHXB 1GZPA 2M8XA 1U41A 3GJFA 3WIIL 3TA3C 4U1GB 4WHYH 2FD6H 5GGSB 4YXKH 5FCUH 4GQPH 4HDIA 1EFXA 1H9VA 4JHBA 5FUZL 1WIPA 1CK0H 2VZUA 5I8KL 3EYVA 5EO1A 1ZKAA 5EC2A 5L7XL 3D2UB 3GM8A 2APXA 3W2DL 4ZD3L 4JFZH 4NNXA 1JL8A 3RWFA 4ONHB 3K2UH 2FHCA 4WFFD 2CDFB 3MRFA 5F1IA 2X4UB 3R0MA 3V6OE 3F12B 4PJIF 2B1HH 4ODXB 5GS1C 4S2SB 2ZSVB 2XTJC 1ND0A 1H5BC 4O5LL 3TFKC 3IDIB 3I6LD 1A7BA 1BEYH 1GXEA 2ERJB 3LKSB 5DJXB 4ODBD 1C12B 3QHTC 2NW3A 2BY2A 2YC1A 5A16B 3D39B 4PJ9D 4F37K 1X5YA 2FL5A 4LLMA 4NZTL 3P0YL 1J7VR 3LKPB 2HKFL 1FYHB 4NQCA 3GSNL 4HAGA 5IOPB 3KPPB 2PTTA 4KI5F 3DXAE 4C56A 3MJ7B 3UC0H 2YD2A 4KAQL 2YMXL 1MFEH 3VFGH 4LVNC 1IC7H 4DW2L 5ADOH 4LKXA 5JLZA 3FFCE 3GB7B 1X4ZA 2CKBB 4GRLB 4OF3A 4WTZA 1ZLVK 5D2NA 3D39D 1MFBH 2ZCHL 4KJPC 4L29B 1T0NB 4WGVB 1H0DA 4UUJA 3SE9H 8CGTA 2YD7A 4RAVB 5T3XL 4KWUA 1S5IL 2FBOJ 4YO0A 4ORGA 4GRMA 4PRHA 3SO3C 1UM4L 2VLKE 1Q9KB 3CX5K 4HWEH 1IRAY 5C9JB 4ONGH 3QNYA 4WWKC 2AK4E 3QDGB 3MQIA 3I6KA 3ZKND 4QRTB 3V4PL 2OR8A 3V8OA 4GRLD 5EU6B 1KN4L 1Z6JT 3KJ4C 3F7RA 5HDBF 4XPFH 1FFOB 2BSSA 5ALCL 4I0CC 4K3JL 4WU7B 3RPKA 4FFVD 4HD9A 4NOFA 2FB4H 3MRNA 4NYLA 4S0TD 3VMOA 1A9BA 4MQXC 1KTRL 4NC2B 4X6DE 2BOBA 4J3WA 1OSZA 2P8LA 1AKJA 1TJHH 2I24N 5KSBE 2X7LA 3U0TA 3W0WE 1DQJA 1A7OH 3QDGD 1MPAL 1AXSA 5EU6D 4Y4KA 3MNZA 3MBEC 3BPLB 3UBXG 2F19H 4G8GE 1CF8L 4ODSH 4PYGA 4OLZH 3IDYC 1MRFL 3LQZB 1S5HA 2OSLA 4XPTL 4Z77B 1QA9B 2DICA 1U8QB 1MH5B 2VIRA 2VDPL 1Z5LB 1MJ8L 1T89C 4LLUA 3S37X 1VA9A 4RAUA 1N6QL 4KTDL 4N1HB 5DJAB 2VLJE 1A3QA 3O0RL 5E6IC 2K7PA 2AABH 1T22B 1XR9B 2X4RB 4KRPB 4YHNA 5IHZA 1NEUA 2XWTB 5LKNA 5KVEH 5A43C 3CSYA 4YHLH 2AV1B 4X80H 3MJ8A 1S78C 3S37H 2FJFA 4L4TE 4YGVB 1PSKL 3S3PA 1U95B 3HTLX 4Z7VA 5E00B 3ZT7A 1UWXK 1A6ZA 1UZ6F