1LK2B

1.35a crystal structure of h-2kb complexed with the gnysfyal peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title A peptide that antagonizes TCR-mediated reactions with both syngeneic and allogeneic agonists: functional and structural aspects.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk2B00
3BO8A 3DVGB 1MRDH 3LEYL 4LK4A 1U58A 1LE9B 1S7VA 3GJFB 2CKBH 4XVUD 5GGQL 1QBBA 1XFPA 3AS0A 2OQJB 1EEZB 4O2FA 2F58L 3U7AA 2ZCKH 2D7QA 4Q58C 1NKRA 3PWVA 4QRQA 2NY1D 5C0FA 3OKLB 4XPAL 2A6DB 1MCCA 3BO8B 2IEPA 4NZTH 2IMNA 1FO0H 1S7VB 1UM4L 2MJWA 4LP4A 1F6AA 4ENED 4Y4FA 4JKPH 1F6FB 5I30L 5J89A 3Q5TA 3OAYH 3O3UN 4PRPD 4O2FB 1DANT 1MJUL 3D0LA 1J0IA 3TNMB 5C0FB 3PWVB 4N68A 4QRQB 2X4UA 2AJXH 2Y7QA 3L5WA 3VFTA 1UKSA 2XKSA 1F6AB 4L3AA 4QKXB 4Y4FB 3EYSL 3D87B 3MV7A 1QRNA 4PJGE 4PFEA 2X4UB 5C0CD 2Y7QB 3L5WB 4FFVD 3TM6A 3VFTB 3D6GA 1Z3GL 2YUWA 3MLVL 2YPVH 1KUMA 3RDTA 3OXRA 2GSGA 3MV7B 3UTPE 3QHZH 2LFGA 4NWTL 3SGJA 1CXLA 3RHWF 5BVPH 5IVZA 4JCLA 3MRMA 3DUUB 1T4KA 3RWHA 4XHJD 1FGVL 1G7MA 3T0XA 3ECBB 5I8OL 4M5ZL 3RDTB 2QQKH 4G6FD 3OXRB 1JGLL 1EO5A 1CU4L 1IFHH 3UPCA 5T3XL 5IVZB 3WL9A 1FAIL 1XF4A 5I15H 3MRMB 4FQPA 1T4KB 2F5BL 5GGSY 2J12B 2AP2A 2ZG1A 5C0GA 2FJFA 2OTWA 4P0DA 4RISL 5IHUL 3CU7A 3MNWA 2YN3A 3BEWA 2D7MA 3TT1H 3X3GL 1KIQA 4IHOA 3WNKA 7CGTA 1JMZA 1XF4B 3QDGA 3VJ6A 1UB6B 3WJLC 3ULUD 3HE6D 5FYLL 2FJFB 2OTWB 2XXMB 4IJ3B 5C0GB 1K85A 4OCLC 1M7XA 1FZJB 4D9QE 4CVZA 3MLRL 3MNWB 3AMKA 5D71H 5EWIL 4PB0L 4E5XA 2P1YA 3FMGH 3ESVF 2VDRL 4XP6L 4HPOH 3BEWB 4JHWH 1NCWH 2DQFA 4IHOB 4LSSH 5D5ME 1T2QH 3QDGB 3FOLA 3VJ6B 2W0PA 5DZOA 2FECI 5JOEA 3HZVA 3MV9E 4CVZB 5CGMA 4E5XB 3AREA 4NCC2 5JXED 2Y5TA 2DDQH 2VDQH 2DQCH 2DQFB 4OGXL 4NFBA 1SJVA 5CZVL 1Q8MA 1SMAA 1T2JA 3TLRA 4PRDA 3HZVB 2APXA 2BVPA 3HE7D 3LCYA 2WBKA 1NBQA 2D03L 2UUDK 4WHTA 1F3DJ 3AREB 4PJCA 4OFPA 4P23A 1S5HA 1G7IA 2NY2D 4QHKI 5D72L 4ODWA 5IBTH 2R0ZL 4PRDB 5DD0H 1NANI 1AKJD 2BVPB 4LCWE 3OKMA 2O26U 4WHTB 4IIQC 4G6JL 3SPVA 4PJCB 4WTXA 4HJJH 3P11L 1KBGL 1H3XA 3BSZH 4P23B 1S5HB 3H42L 1CXKA 1D5BA 5KANI 1NGPL 5CEZH 4ODWB 4PLKC 4BZ2H 5C6TL 3BMVA 4NM4L 5EIIA 5IKCA 1ZE3C 2IALA 2G2RA 3QUYD 4NZDA 4A6YL 5D1XC 5ICYA 1WTLA 3SPVB 4HSQA 4GLRI 1XR9A 5KVEH 1L6ZA 4OZHE 5FYKD 1D5BB 5FHBH 3D69A 3O4LA 4KUCF 3H3BC 4JFYA 4URTB 5IVNA 5EIIB 1RZFL 2IALB 2G2RB 5GGRA 1F4YH 4UOW0 5ICYB 4KJWC 5I19H 3D3VA 3AS3A 1LDSA 3VGDA 1XR9B 1QHOA 2BDNL 3V0VA 1NAMH 5TDPA 3S3SA 3RDTC 2EDNA 3D69B 2AQ1A 3GBMH 3O4LB 4W81A 3H3KA 4JFYB 2VMFA 3HZMA 1ACYL 5DJZA 5GGRB 3SGJC 2W0LA 3MODL 4Z7OF 4JN1L 3D3VB 1Q0YL 3BT2H 4D9LH 4RFNB 1U8NB 3FB5A 1P53A 1K4CA 3RNQA 3QQ9D 1WEJL 3UTOA 3QAZC 5K59F 1YQVH 4QYOA 4KFZC 4AY0A 4LVHB 5TDPB 1OTTD 1A6VL 2NY7L 2YPLE 4WU7A 2QKIA 4JFFE 4Z7UF 3MOQA 1EVUA 3HZMB 4IRSD 1P4LA 2BVYA 3BUTA 4OD1H 4RGMB 5E4EC 1MEXH 1AXIB 2BFVL 4JHAH 4XGZA 4OM0L 3FB5B 1IGFL 1K4CB 1K3IA 1NCCL 4PJBA 3RNQB 2CIKA 3NCJL 4IJ3C 5IBLD 1T7WA 5E5RB 3V6OC 4LKCA 4YQXL 5FO8A 4WU5A 3MOBH 4PP1D 1VB9A 5L88L 1P4LB 3FRUA 4RA0C 3AFLA 4PJHE 4MQTB 1MFDL 4PJBB 5I73B 1BZ7A 3FFDA 1GPOH 3O8XD 3M07A 1AHWA 3MO1A 3A6BL 1NLBH 4TQEH 4LKCB 2Q76B 1INDH 3GUTA 3TYFA 4TUKH 4WU5B 5M94B 3MYZA 4NCC1 3SQOL 1XGYH 3FRUB 3WFEH 3L3DA 1YZZA 1J8HA 1XIWA 5DD1L 4Y5VA 1BZ7B 3FFDB 5CWSA 4GMTL 4DEPB 4LRIC 1XAUA 5TQ0H 1AHWB 3MO1B 2VIRA 3A67L 3AREC 1OSZB 3TYFB 2HJKA 4A6YA 2ORBH 5DT1H 4QLRA 3HNSL 4KK9C 1G7PA 3LKNB 3L3DB 5HHMD 4O02L 1J8HB 1XIWB 5TDOA 4Y5VB 5CWSB 2VIRB 1MNUH 4NRXA 3SBWA 5T1DL 1JHKL 4KRMB 2XTJC 5C70A 3RVUD 5D4QA 4A6YB 3FTGA 5JW4Q 4P23C 3VWKA 1G7PB 3MLPA 2AK4A 4DVRL 5TDOB 4ZS6D 1A3RH 4NQTA 4JM2A 4POZC 2RGSA 1BZ9A 1AXTL 1U8PA 2D9QB 3DVNA 3VXRD 2QR0A 1WBYA 4RAVA 3CFKA 1L7TH 5F6HJ 2YD3A 3FTGB 1NBZA 5I1IL 4UT9H 4KRNA 3H2WA 3VWKB 4ODVL 3BGMA 2AK4B 1H3PL 1BFVH 2R4RL 3QUZA 1FE8L 1MSPA 1EFQA 2EE2A 3H3PL 3S36H 5FO9B 2H2PD 4YWGH 3DVNB 4IMLA 1VFAA 2QR0B 4LSQL 5EZLA 5IB4B 1WBYB 4RAVB 3CFKB 2W0FA 4RMWA 1JZ6A 4OGZA 1NBZB 4XBEL 1CDYA 1GHFL 2B1AL 1QACA 2XACC 3QUZB 4GG8A 3P30H 1QOKA 1FFRA 1KIUA 2P5WA 1VFAB 5EZLB 3THMH 1CK0L 5KS9A 4OSUH 2W0FB 4B0MM 5FUOH 1XH3A 5BZWA 1IGTA 4UB0L 3DSFH 3PIQA 4LVHC 2DLFL 1LO4H 1VEMA 1YNTA 5D70L 3G08A 4GG8B 3FAXA 3B9KA 4KAQH 4PJFF 3B5GA 1S7SA 4RGMC 5KS9B 3BP4A 5GGUA 3RWDA 1XH3B 1KFAH 5BZWB 4EUPG 1Q0XL 1ONQA 3PIQB 1YNTB 3QPQC 3G08B 2WWMC 1PKOA 5FGCE 4YBHA 3B9KB 3PWUA 1TNMA 5GGUB 3SKOA 1JYVA 4JFHE 5MEPB 3BP7A 4G8GD 3RWDB 5I73C 3ZTJH 1ONQB 1NFDA 4I77H 4JFQA 4OLXH 4X9IA 1CN4A 5E56A 4TRPH 3U79A 1SEQL 3ARUA 1A7PL 1UVQA 1I8MA 5I8KH 3PWUB 3QEQE 5JQ6L 2D7OA 3BP7B 4DK6A 2QJDA 1A14L 4WO4A 1IGMH 1JP5A 4PB9H 1NFDB 4LMQI 4JFQB 4UT6L 4LQ1A 4PJ8A 1VADA 1UVQB 3B9VA 2H26A 3OGOE 5BMFL 1I8MB 4DFIA 1BLNA 3S5LG 4N8PA 5KVGH 3PGFH 5DTFB 5FKPA 1DUYA 4PUBH 4HPYL 1XIWC 3RKPA 4Y5VC 4WO4B 5CIPH 5GHWL 4PJ8B 1VADB 5ADPH 1IM3A 3KYNA 2H26B 4P59L 5BS0B 4FP8L 4IMKC 4D2NA 5FKPB 4RMQA 3ULVH 4KMQA 2Q6WA 1DUYB 2CDEA 1IC7L 4YHYB 4FXKA 4KY1L 2IGFL 1HHIA 2HFEA 3SOBH 2X9YA 4YAQB 1Z9OA 4K7PH 1DP0A 2DD8H 1R5VA 3EKCA 4WW2A 3T04D 5I9QC 5F88A 3SBWC 3L3JA 4GG6E 3KYNB 1KENL 4U3CA 3BAEH 3R8BB 3VWKC 2GAZA 4N9OB 4XWGL 1T7XA 2Q6WB 2CDEB 4K55A 3B6SA 4RAHA 1J05A 4FXKB 5FHAH 2Q3AA 3HMWH 4LHUA 2HFEB 3T0BA 1OSPL 1R5VB 5F88B 1JHTA 5CGTA 2QQLL 5EZIL 2XNAA 5SWSE 1JZ7A 5ICZB 2GAZB 1KYOJ 4HH9B 1UJ3A 2Y9RT 1ZV5A 3KXFD 4KTYA 3EOTH 4F9PA 3PP4L 4KPHH 3INUL 4LHUB 4TSCH 1FV1A 1KTDA 4X6FA 1CFTA 4GW4B 1JHTB 1XMWA 2DQIH 3S88H 2XNAB 4GSDL 1UJ3B 4ZUWA 2C5DC 4LIQE 1OW0C 4BFBD 3T1FA 1U0QA 4ZTPL 5DHVA 1MRFH 2EDHA 1X4ZA 2APWA 1FV1B 1KTDB 4X6FB 3GI9H 1CFTB 4APQD 5HDQH 4EIGB 3LH2H 5JQHC 5C0ND 4M62H 4MLIA 3AS1A 1QSFD 1F45A 4ZUWB 5E5MA 4LLDA 1A6WL 2DQJH 1LK2A 4FQ2H 3T1FB 4YDKH 1EXUA 3MCG1 4G6ML 4HFUH 1I3RB 3UTSD 3BJ91 5FF6B 2WQ8A 3B9KC 4DCQA 2XPGA 1RK1B 4W6WB 1NPUA 4M48H 1IKFH 5E8PB 2EEDA 4DKEH 4AH2A 4YDIH 1IM9A 4JQXC 1OAXH 1KIPA 5HDBF 4HWBH 4B7IA 4CDHA 1FVCA 3EYQD 5E5MB 4LLDB 4P46A 1FRGL 4R7DA 1LK2B 1FLTX 4WWKD 1EXUB 2NYYC 2QL1A 1A9EA 3IYLW 1BP3B 4JQIH 2J2ZA 3GI8H 4UZGA 3LSOA 4DCQB 1P2CB 2ICES 2XPGB 4J3XA 1MY7A 3S3JA 4AH2B 1JNJA 4AZ8A 1HHKA 1X5LA 1KIPB 4I0PD 4KVNL 4X80L 5BO1L 4XBGA 4P46B 3BHBA 1A9EB 1Q9LA 4CADA 3LSOB 5JDJA 5M7QA 1TVDA 5F96H 4HBCL 2E27H 7FABL 1G9EA 1S9VA 1ADQH 5DC4B 1H15A 1MHHA 4NQUA 1HHKB 3MLTA 4M8VA 4WO4C 3KPRD 4G9FA 1JPFA 1EJOH 4XPTL 5ISZD 3MRHA 2NW2A 5FM5O 3LEVH 4PLJD 4OCXL 4QRRE 1Q9LB 3NAAL 4CADB 4PGZA 1A6UH 1M7IA 4MSWA 3NIDE 3ARGD 1Z0NA 4UT7H 1S9VB 2ZCLL 1H15B 1MHHB 1SBBA 2ZNWA 4YHYC 3MLTB 4AENA 4OF7A 1OM3L 1QFHA 3QPXL 4G9FB 1MWAL 4M6OL 1JPFB 4H0HB 5FYJH 2NW2B 5SX4I 1I1AB 1M7IB 4MSWB 4XNYL 4WUUD 1LDPL 4JRWA 2COQA 4ZMAT 1YQ2A 4LRNH 5J1AA 3OAUH 2I60L 4NNYA 5D93C 2ATKA 4RGOL 4AENB 5SWZD 3QIWA 2IQ9L 3RY4A 3DMMA 5T3ZH 1N6QL 5HYJA 1MI5E 1A02N 3C87A 1DBBL 2P8LA 4NKMA 3T77A 3MZGB 3KHOA 5J8OA 4JDTH 3K8KA 1CL7L 1E4WH 5J1AB 4JO4H 43CAA 4NNYB 2OR9L 2AJUL 1OHQA 2HRLA 2ATKB 2OBGA 4LSPH 4XVJL 3QIWB 4WENB 3DMMB 4IM8A 5HYJB 1TFHA 3SDDA 4N0CD 2P8LB 3T77B 4JPVH 1G9ML 4G7YH 4C4KO 3RWEA 3LZFL 1NDMA 1N7MH 1UJ3C 43CAB 1UACH 2BCKB 1QFOA 2KDGA 5KSBF 1UQSA 4KQ3L 1J18A 1FIGH 3MLWH 1GOGA 5EH1A 3E2HB 3B9DA 4K3DL 3SDDB 5ACZB 2VDOL 2D7PA 1GGUA 1I8LC 3W11C 4ZUTA 1KPRA 4BZ1L 1IAIH 4LLMB 1KLGA 1WZ1H 1UQSB 2ZJSL 4GBXC 3LV3B 4GAJH 3EDFA 2CMRL 3HFMH 3S4SA 5CJBA 4BKLB 3TYGH 4BSWA 4KK8D 1H3TA 4P3CL 2KZWA 2IFFL 1QBAA 1QSZA 4ZUTB 1KPRB 1YJDC 3U9PL 1KLGB 4OLWH 2VLRB 5DMJB 1GIGH 5DS8A 5C0BE 3VDBA 4NFCA 3BH8A 3PGCA 3EGSA 3MACL 3S4SB 1MUJA 2FECL 4BSWB 5I75C 2EZ0D 2I26N 4XXCA 3IT8D 4ZUUB 3QDME 4P4KA 4U6YA 3U7YL 3KS0J 1S9XA 2C9AA 5E6IA 1RUPH 5DS8B 2HFGL 4MNHA 4Z0BL 1UWGL 3BH8B 3PGCB 3LS5L 3EGSB 2WUCL 4NO5A 3TBWA 3V9FA 1MUJB 1MWAA 5HHNA 3RAJH 5I0DA 4NRZA 3UJTH 2YMXL 5HI5C 2IBBA 3TO4C 3MC0A 1TJGL 4P4KB 4U6YB 5ENWA 2P48B 3ZHLA 3FHQA 4XVSH 1S9XB 2PYEE 5E6IB 4O9HL 2Y5EA 4MNHB 3LKPA 4C56A 1IBGL 3FN3A 4NO5B 1IAOB 3TBWB 2OXGA 1LEKA 4NYLA 3IFNL 1MWAB 5HHNB 3NABH 5D7KE 4NRZB 1AFVL 4HS6A 1DLFL 1CFQA 3WXWH 1L6XA 4Z7WE 5DMGC 4OLVH 2OZ4H 3N9GL 3DRTA 1LO0H 5ENWB 1B88A 1K6QL 1JVKA 5FXCH 1PDKA 4K8RH 4WFFE 5SX5H 3AXLB 2KH2B 1LEKB 3VGHA 1BGXH 2BNQE 1I1AC 4NYLB 1NEUA 3O6LH 4XPFH 1UXSB 1BQHG 4HS6B 5FA3A 4OFYD 5GGRY 1ZLUK 3QIUB 2VDML 1MCOL 4W4NA 3QJHA 1XGPA 1GGIH 2DQTL 2ITCA 3QRGH 2FH6A 3DIFA 1RZIA 3SQBA 1B0RA 2XTLA 1MCSA 4EI6A 5GGQH 4Q6IA 5FA3B 4HMEA 3T0WA 4PRPA 1EX0A 1A6AB 4UI2A 3VXUE 1NFKA 2F58H 1IT9L 1KEGH 1I8IA 2PTVA 2NY3D 5F9AC 3RVWD 3QJHB 4GAYA 1U3HC 1XGPB 3N1QC 3QIWC 5I1AA 1UM4H 3BZFA 3DIFB 1RZIB 1B0RB 3HN3A 4EI6B 1B4JL 4Q6IB 3HRZA 1WIUA 3HMXL 4PRPB 2WZPD 2XKUA 1YECL 5I74B 3NCMA 2X1PA 4GAYB 5C0CA 3P77A 3GBNL 1TCRA 5E1HB 1INEH 5JZ7C 4WHYH 3E2HC 4R4FH 4FXGA 5GRYA 3BZFB 3UO1H 3TBTA 4TVPL 1V7NL 4ELMA 1DFBL 4HEPG 2YK1L 4XC1L 5GS0D 3VFPA 3HRZB 5K9QI 3VU2A 1RZJL 3PQYE 3KPSE 1VFUA 1MHCA 2HT4C 3GSQA 5C0CB 5LCVH 5A2FA 4P5TD 3P77B 4DUXA 1TCRB 4RSVA 2FL5A 4Y1AA 3UTPD 5IUSA 4I3RH 1NMAL 1R3HA 3ARYA 4FXGB 1Z3GH 2ZKHL 1UA6L 5GSRA 4R90H 2NPLX 2Z92A 2WM0A 1IKNA 2A9MH 3ZKND 1MHCB 4I2XA 1JK8A 2CJUL 3GSQB 4OCRL 3JVGC 2HT2D 4P3DA 4Y1AB 2FL5B 3V4UH 4JG0H 2X4NA 3ALXA 1R3HB 1FGVH 3RWJA 1RUML 1Z9SA 3OAYK 4M5ZH 5GSRB 2Z92B 2NTSP 3K4DA 5JO5A 5DRXA 4X4YB 4I2XB 1JK8B 5LGJA 4P3DB 3HZYA 2DLTA 2X40A 3BE1L 2OMBA 3PHOA 2R4SH 3GNML 2X4NB 2F5BH 3G6DH 3RVVC 3HE6A 3RWJB 4XXCC 1QFWI 2VZUA 4P4KC 1P7HL 5JO5B 1YY9C 4Z7UB 3MFFA 5DRXB 2X44D 2XWTA 5LGJB 5KAQF 4D9QD 1EZVX 1OP9A 3HZYB 1WK0A 3PHOB 1WFOA 4KKAD 3HE6B 5FYLH 3C8HA 1ZLSL 4XP4L 5DGRA 1NUDA 4G43A 4KKLD 4PB0H 3SHSA 3P40A 3MFFB 4XP6H 5E2TH 2XWTB 1D9KA 3CJJA 4BQ9A 4XCCL 3P0VH 2Z93A 3CFCL 3MOAL 4GH7B 3TT3L 5JW3H 3QIUC 3RVTD 3LVEA 4J8RA 4DOHE 3HE7A 3MRRA 3MGTA 4Z76B 3HMXA 3F5WA 5E2WL 1QKZL 1A7NH 1D9KB 1RVFL 4P2QE 4OGXH 2YS4A 1TTFA 1SM3H 2H6PB 3AU1A 3BP6A 3UAJC 2Z93B 3V4VH 2ZSVA 1YPZA 4U1IA 3C8KB 4KXZI 1G9MC 1AKJA 3QFJE 4J8RB 3HE7B 3MRRB 3TP4A 3MGTB 4LGPB 4MA8L 2ADFH 4HT1H 4PTUB 3F5WB 5INCA 1PG7L 1KTRL 2WUBH 4JFEE 3D25A 3MRDA 3NFSL 3QO1A 2NY2B 4LCWD 1NCDL 4PJEA 1E28B 3BP6B 4G8FA 4XTRD 5GRXG 2ZSVB 1YPZB 1LO2L 2WMPA 4U1IB 4KVCH 5TGBA 2DQDH 1AKJB 4V2CB 2YA1A 5I74C 4MWFA 3QUYA 3MLXL 4EOWL 4L1DA 5MERA 1SQ2N 4JY4A 2R2EA 4G6JH 2X4OA 2ZP0T 1VPOL 5INCB 4OZFH 4WNQB 3D25B 5EPMA 3MRDB 3P11H 3EHBD 3FCTA 2C3GA 4LFHD 3RUGA 4PJEB 1Y0LA 4G8FB 1IILE 3HI5H 2BRRL 5F7EH 3CSYA 5J9PA 4MWFB 5J06A 1P84K 5MERB 1X5ZA 4JY4B 2R2EB 1FH5L 2X4OB 4Q74A 1CYGA 1S5IL 4K7FB 5EPMB 3RY6C 4Q2ZB 1LK3L 1PX4A 3RUGB 1Y0LB 1T3FA 3V52L 5GS1A 4RMSA 2Z91A 1DN2A 3KAAA 3CSYB 5J9PB 4LCUA 1PG7X 5DJYA 4QRUA 4HC1A 1NC4B 3IETA 4XNXH 5IT2L 3TBVA 2Q8BH 1T3FB 5GS1B 1AP2A 5FYJE 5IHBA 1IKNC 3LHPL 5C2UB 4RMRA 3X3FL 3MODH 4LCUB 1FNLA 2PXYD 2WLYA 5DJYB 2YPLD 4QRUB 3KS0H 3IETB 4JFFD 4X7FC 5IMOB 1FLRL 3HR6A 1B0WA 2NY7H 5A3ID 1YEGL 1TJHL 2V9QA 2R0KL 4UDTA 4H8WH 2IPKA 3BD5A 4HF5L 4MAUL 1PJ9A 5IIEA 4R9HA 3B9EA 3WHE1 3HE6C 3VFGL 3NCJH 5BV7L 3O8XA 5IFJA 1JPTL 3ARSA 2SEBA 4UDTB 1HKLL 1S78D 2IPKB 3UROR 1FNSL 2GFBA 4JN2A 5IIEB 1D5MA 5HXMA 3C5JA 5F9WB 1GRWA 1GH7A 4HS8L 1ZA3A 5IFJB 1CTOA 3A6BH 2SEBB 5C8JB 4WGVB 1D9KC 4YLQT 2BSED 2GFBB 4JN2B 3SO5A 3QISA 2VB5A 1D5MB 2FATL 3DETC 3C5JB 3WO3B 2VL5A 1L9MA 1YEJL 4AG4L 1ZA3B 3UJIL 2GK0A 1N0LA 3OBAA 4ONGL 3A67H 1L0QA 4KGJA 2UWEA 3RZCD 3DRQB 3HC3H 1C5CH 3BW9A 3NZ8B 4JFDB 3ZZ1A 1HEZA 2LTQB 5FYKU 5HHMB 1UWEH 1JNNH 5TDNA 2VL5B 1HILA 4LPCA 3GSXA 1U93A 2GK0B 2NXZD 1HE7A 3RI5K 3VXRA 4PJAA 1RZJC 5T1DH 3MV7E 5C2BL 1FL5B 5E9DB 4MQXD 2B5IB 1H8OA 3LKRA 3BW9B 1FN4B 1PYWB 5GGVY 1HEZB 4DVRH 3ZDYE 3H9SA 5TDNB 1HILB 3GSXB 1U93B 3VXRB 4PJAB 5D1ZC 2M8XA 3LKRB 3OWEA 1X5HA 3H9SB 1V3KA 5B38A 3IAGC 1R0AL 4HIJB 3K1DA 1E6OH 2AK1L 4LSQH 1QPXA 4HCRH 4EQ2A 5CZKA 1MCBA 3AS2A 2P49B 3K2MC 2AEPL 1ZANL 4ZFZA 4M7JL 2B1AH 1YNKL 5GS1C 5B38B 3WS6A 3M8OL 1D6VL 1DSFL 2M1KA 1KJVB 5B22A 3NTCL 2IPTH 3C2AH 4P48A 3V6OE 5JA9A 4H1LH 2O5ZL 5GRZA 5F7LB 2VAJA 4G8EA 3KDMB 5AG8A 4DW2H 3PHSA 2DLFH 3STLA 3DHJA 5HYQA 4KJQC 3BPNB 4XCNA 2D7TL 2MCG1 2IF7A 2V5SA 1RUQL 3HLAA 4EN3A 3RTQA 3KR3L 4J3OC 3Q5OA 4G8GA 2W9DL 2B0SL 2QLVB 3DBXB 4G8EB 2VITA 1KTLA 5IBLC 3CSGA 4X83A 2NY6D 4OCNC 3STLB 2AJZB 4JFHD 5EU5B 3ARBC 3ISWA 3ROLB 3HLAB 2R0WL 2MQ0A 5D96C 1PAMA 4EN3B 4PV8A 4R97C 3RTQB 2Q1EA 4PJIF 4G8GB 3WUWG 5KG9A 3KWWA 2DIJA 4ISVA 2CIIA 1QG3A 2VITB 4OAWA 1KTLB 3QEQD 1JF5A 2WK2A 4CL7A 4CU8A 4HUUA 4WUKL 2P4AB 5B3JE 1YEEL 3BX7C 4FQLH 3K8LA 3NH7L 3VFSA 2F8XC 4L3EA 5ILTH 5JQ6H 4PV8B 1RIVL 4Z77A 4B5EA 5KG9B 2XTJE 3KWWB 4ISVB 4MAYD 5LWYL 1OAYL 2CIIB 4OAWB 3W9DA 3GBLA 1PZUB 4HUUB 2ADIA 1UM6H 3TJEH 3VFSB 2H41A 3BYYA 4L3EB 5JTWA 1CLOL 1QLFA 2LTQC 3MUGA 4HPYH 3LKQA 2DM3A 3W9DB 3KPQA 1CDJA 3WIIL 2ADIB 4QT5A 3GGWA 1FCCA 1N8ZA 3L1OH 4LOUC 3ARRA 2B5IC 4OCSH 5HVWA 1QLFB 1F13A 3MUGB 4HLZH 1IC7H 5E70A 4ZS6C 2OP4L 3W9EA 3LKQB 2VZ1A 5GGTH 3VXQA 5T3XE 3KPQB 4AYFA 1MFEL 3P4LA 4QT5B 3O4LE 3GGWB 1OY3B 5TE7L 1A8JH 3EFFA 1UWXH 4YZFF 1WAAE 1T21A 2N7AA 2QSQA 4JR9L 4U6XA 1WWBX 4OLYH 4XWGH 1S8DA 4PJXF 5I66A 3D3VE 1O7VA 3CMOH 1LP9A 3EDJA 1OD7A 2XN9E 3VXQB 5SWSD 1RFDH 4K07A 4KI5D 5C0EA 1OSPH 1T83A 4JAMA 3O2DH 4K3EH 32C2A 1MFBL 2A74A 4U6XB 3V4PH 2DOCA 1S8DB 4N90E 3ARFA 1JYWA 1LP9B 2X41A 3PP4H 3EFDL 4NGHH 4N0RA 2QHLA 5C0EB 1OT1A 4U1MA 4APQA 4JAMB 1NMCB 1EEYA 32C2B 1VFBA 4MVBC 2A74B 3I6GB 1QSFA 1AD0A 4P99A 2X1WL 5DGQA 1VFOA 3ARFB 3LIZL 3BPNC 3WS6C 5JHLL 3LRGA 3AROA 2VISA 3UTSA 3UX9B 5BV7C 2J6EH 3CCHA 4FNLL 1FSKB 1CLCA 1HCVA 2X2YA 1EEYB 2E6QA 3IFLL 5C07A 2DKMA 1AD0B 3ZKXB 4BFIA 1J9CT 1JPGA 5E4IA 3LQAH 1A6WH 2DYPA 4L4VE 4ZUVA 4WWKA 4L8BA 3IRPX 2VISB 3UTSB 4M43H 4ODTL 2XZAH 2L7JA 3GSNL 4M8QA 4EN3C 3JWNC 1RIUH 3RTQC 2G5BA 2EH7L 4M5YL 5GISL 4ZNEE 4KTEL 1NLDL 2R69H 4I0PA 4M93B 5C07B 4OUUA 2FYYA 4BFIB 1JPGB 1JTPA 4ZUVB 2DYPB 1P69B 4WWKB 4L8BB 1J8HE 1W0VA 3ROOA 3OKDA 5JXAL 4L1HA 3ZE0E 1WITA 2NY5L 2G5BB 2DM4A 5I16B 4I0PB 4KVNH 4OUUB 1IL1B 3KPRA 5ISZA 5KW9H 4MB5A 1Q9WA 2HKFL 4H25A 3ROOB 3OKDB 5J1TC 4LLVA 3EO9L 2EE3A 4TTDC 3DX9A 1EUTA 3ARGA 4M1CD 4EDWL 1ZTXL 4K23L 3GRWL 4QRRD 1I9JL 1RUKL 2VR9A 3DJ9A 5I1HL 4C83B 1J8KA 3KPRB 5D7LA 4BQ8A 2VDLL 3IFOA 5ISZB 4XPTH 5F7WC 5DRWA 4H25B 4LLVB 1MCRA 4WUUA 3SKNA 5AYUL 3DX9B 1NKOA 3ARGB 3T3PF 3WV0A 3HNTH 4CVXA 5ESVB 1DJSA 1TZIA 2X1QA 5SWZA 1OM3H 2A0LD 5D7LB 3IFOB 5JIHA 3UYOD 1QNZL 5DRWB 1NH6A 2E9BA 1OTUD 2NXYB 3SDXA 3ULSA 3SKNB 5IVXA 1LDPH 4QRPB 5HVFB 4CVXB 4JPKH 2I60H 1MI5D 1TZIB 4KZEH 2FX9L 5ACLA 4PRIA 4N5ED 1CLYL 1EPFA 3KYKL 3OAZH 1UH2A 4YGVA 4XCEA 4LHJB 1X5GA 5FGSA 3SDXB 3ULSB 5IVXB 2A38A 3S34H 1SVCP 3QNZA 4NP4L 3W81A 5KS9E 5EUOA 3OJDA 2W9EH 4PRIB 1DBAH 1PEZA 4PGBA 4OI9A 4QGTA 2BVQA 4HIXL 1T83C 4YHLH 3VXNA 4YGVB 2ZG2A 2WV3A 1NMCC 2G75B 2XQBH 4MZ3A 1G9MH 4CJ1A 1KULA 5DLML 4WI6A 2YBRA 3GSNA 1XGQA 1IEBB 5CKGA 3FHAA 4TUOA 4BQ6A 5EUOB 3ARFC 3OJDB 1IEAA 2EIEA 2MHAA 3ZDXE 4KQ3H 2W59A 4PGBB 1NGXA 2BVQB 1QFWL 3BISA 3HZKB 3UBXI 3VXNB 2VDKL 2VDOH 2XICA 3QXAA 2Y72A 2YBRB 3GSNB 3TJHC 1XGQB 3H7BA 1NCAL 3IJYA 3ZKXC 3QEUA 5CP3H 1T2XA 1CGSH 4HUXA 1IEAB 2MHAB 2MPAL 2CMRH 1NGXB 3GFUA 4PRNA 1OLLA 1NFDE 3IDXL 2IFFH 5HY9A 4HZLA 4PRAA 5C0BD 3QXAB 1QRKA 3PHQA 4M93C 3D48R 3EAKA 3H7BB 3IJYB 3OPZH 2EDDA 3QEUB 2DMBA 5DD3H 1EJ6A 3GRWA 4UV4H 3O6FD 5JIIA 4Z7VF 3QDMD 4K2UH 4W70A 4PRNB 4Q9RH 3GKWL 1E4KC 5HY9B 4PRAB 2E5EA 1JGUL 1SMOA 4R2GB 4GXUM 3PHQB 2XIDA 5BS0E 1WLHA 1EGJL 2PTTA 2EXWD 4HGMA 4KHXL 2FHCA 4YC2B 2WUCH 3U0WL 3UPAA 3EJYC 4PGJA 4MZ2A 3GIZH 2F8OA 2X89A 2BXYA 4JCMA 4X7CC 1F3RB 4LEXL 4X9HA 2ZOLB 1EO8H 2RIKA 3D1MC 5D7KD 5F7UA 3K8MA 2PTTB 4ODHL 5GRUH 1WBZA 1AFVH 1NANH 3ARGC 4OFYA 4N0UE 2VXSL 4WFFD 3GSRB 4XMLL 2BNQD 4H1LG 1IAMA 4JFXA 4PJDF 2B2XL 1TZGL 2NXYC 1QPPA 2YHGA 3GHBL 4QXUL 1WBZB 4OGAD 3NGBB 1RZKL 1F3JA 1AXSB 5CBAA 5JW4M 2VSCA 2Z9TA 5KSVA 4DAGL 1MCOH 4J4PD 5JMOC 1OF2B 5BW7A 4D3CH 4ALAL 3LEXA 4L4TE 1OTSD 3NCYP 4JFXB 5TF1H 3VXOB 3VXUD 1U8JA 1NBVH 1P4IL 1Z6JT 2Z8WC 2EDTA 1BIIA 4M7ZC 1F3JB 4DKFH 4QTIL 5CBAB 4GQ9L 3HAEH 2VC2H 2RAMA 5KSVB 2Z4QA 3T1WA 2V2TA 5M95B 4UQ3A 1X4XA 3LEXB 3FRPG 5BJTB 5C92A 3CXDH 1U8JB 4U05A 5F1KC 1B0GA 4BQBA 2E7HA 1VENA 3CDFA 1G7QA 1BIIB 4W4OA 1DQMH 3E6HA 2Z4QB 3KLHD 2V2TB 1MAML 4UQ3B 5A43C 4P5KA 4P5TA 4R4ND 4X7TA 2NY4D 3M45A 4L4JA 5HVGB 3KPSD 1BMGA 3P0YL 5FECB 1DFBH 4XC1H 4YUEL 1G7QB 4H26A 4RFOL 2X4TA 5CGYC 3E6HB 2AERT 2C4XA 4JKWA 4RWYH 5I1EL 4P5KB 4P5TB 4X7TB 2ICEA 5BZDA 1JZ8A 4JJHA 1UA6H 1K4DB 3EYOB 4H26B 2NY5C 3OZ9L 3QCTH 3SE4A 5HHQA 4M9OA 1KCSL 4LEOA 3MJ9L 5I2IB 2F19L 3Q1SL 2R2HA 4MB3A 2ICEB 2VLLA 5BZDB 1XF3A 1II4E 2ICWI 2VH5L 4R2GC 3RWIA 1NC2D 2R2BA 1EFXD 3QJFA 3KNBA 5HHQB 4LEOB 4OKVA 3QXDA 4X7EC 1XR8A 3C2SA 3GIVA 3BKJL 4YC2C 4UAOB 3D18B 5E6ZA 5GXBB 3WE6A 4G9FE 3GNMH 1HNFA 3C6LD 3PL6A 3KPNA 2VLLB 1MAKA 1CGXA 4KV5E 4X98A 1C08A 2VXUL 1GXEA 4CMHC 5D5MA 1KV3A 2R2BB 3DO3A 3KNBB 4OKVB 3M1BB 3B5HA 1XR8B 3GIVB 2H1PL 4LLYA 1GC1H 3U9UA 3IDYC 3PL6B 3IS0X 3KPNB 1FL6B 3BGFB 4X98B 2YA0A 2ZCHL 4I3SL 4XP4H 1ZLSH 5AZ2L 4BJLA 3RIAK 5FV2A 4S1QL 5GJTL 4HX1A 5CKAA 4LLWA 4Q6YA 2A9NL 4Z8FH 3MLUL 4LLYB 3WCYA 2F9BT 1M71A 1I1YA 2CK0H 1NGYB 3SE8H 3U9UB 1JV5A 4GKOA 3CFCH 3MOAH 5HYJE 3U0TA 3TT3H 4P2QD 4WCYL 1OAKH 2MKLC 4HX1B 4LLWB 3GKZA 2IFGA 3QFJD 1HQRB 4LCWA 1M71B 1I1YB 2EC9U 4JPIA 4AEHL 1JV5B 4JGMA 4JFED 1KXVC 5DUPH 2O61B 4NQCE 4UTBH 2EDKA 3ZL4H 5BW7C 5CEYA 2AEQL 1CFNA 1PG7H 4M7KL 1OAUH 1TNNA 3T08A 1FL3A 5T33L 4R26H 3WXVH 1T7YA 5B39G 4JPIB 5F6IB 5KTEL 5BQ7A 4YIQB 3ZKMC 2CDGB 3MLXH 1ZA6B 4OZHA 5AZEH 2FZ3A 4Y5XA 5CEYB 2VLRE 1CFNB 1FL3B 3MJ9A 5C6PB 4MGXA 1ORQA 2YXMA 3T0AA 4KRLB 2ZWLT 5TQ2L 3F7YA 3BPLC 3JTSA 3WJJA 2BRRH 5BQ7B 4W4OC 2XZQH 1LD9A 2EIZA 5IBUG 3KJ4C 2B1HL 4OZHB 1FH5H 2FZ3B 3QB7C 1FNAA 4Y5XB 4JJ5A 3MREA 2V5TA 4XB8A 3DOSA 1VA9A 4IRZL 3HG1A 4LGSB 1ORQB 1ZHKA 5HHXL 3L3KA 4Y5YA 3V52H 3N1FC 3F7YB 5J56B 4KZDL 3ULVF 3JTSB 1P9MA 3N50A 1LD9B 2EIZB 4DGYL 5I1KL 4AMKL 2PXYA 4G7VL 2YPLA 5FYJD 4JJ5B 2DJ4A 1XF2A 4JFFA 3HG1B 3VXTA 1CR9H 3FB7A 1ZHKB 4UBDC 4E41A 3L3KB 4Y5YB 2JB5L 3KYOA 3C6SB 1FFOA 1KNOA 4UAOC 1JIBA 1VGEH 2PXYB 3NFPA 2YPLB 4RX4D 1XF2B 4JFFB 1ERNA 3VXTB 3BPCA 3FB7B 4E41B 1FLRH 1N26A 3KG5A 3KYOB 4A2LA 5I76A 3UYPA 3VDAA 3O6KL 2DS4A 4O5LL 1NBYB 4PJHA 4X7SL 4GFTB 1MRDL 1KIRA 5FV1L 1P7QD 4HF5H 3KYMA 2CKBL 1KNOB 1I8KA 4NKOA 3BGAA 3NFPB 4HUNB 3HS0A 2K9UA 3MV8B 4KKAC 3PL6C 1G9NH 1UM5H 3VFGH 3BPCB 5DJ0A 5BV7H 1DBJH 5CJXA 4OBRA 1B6UA 3B9AA 4YFDB 5I76B 3MLZH 3C08L 3FN9A 1RZKC 4PJHB 4NZTL 4I0CC 1GOFA 4YPGA 3CZFA 3KYMB 4F37K 1FNSH 1A7OH 5DJXB 1AE6H 3HS0B 3SGDI 4RMTA 5LBSH 1A1MA 4AIZA 1J11A 2AJYH 5HYEA 3ARDA 2AJXL 4YPGB 5IJVA 3CZFB 1H8NA 5F71A 3F7QA 1A1MB 2CPCA 5D2LA 3BIAX 1YEIH 3D85A 3WEXA 2H3NA 5D1XD 1I9IH 2R9HC 3ARDB 1Y6NR 4OBSA 1R5IA 5IJVB 4CDGC 1GVIA 2VQTA 4MHHG 2K1MA 4XMPL 4DVBA 3CMGA 1L0XA 1F02I 3VGEA 3MV7D 3QHZL 4HQQL 5D2LB 3D85B 4H0GA 3WEXB 2W38A 4HJ0C 3V5KB 2JJVA 5BVPL 4K9EH 1I1RA 1BVKA 1R5IB 3L95A 4NO0D 1F8TL 2G5RA 4DVBB 3RDTD 2QQKL 2FX7H 4Y1AE 1GAFH 2GJZA 1KXTB 4N8VG 5J13C 4E0RB 1IFHL 2AXHA 4BUHA 4UDUA 4F7EA 4D94A 3W39A 4FQJL 4JRXE 5LGKA 2FSEA 4FTVB 5I15L 4HS3A 4K71B 4Y5XC 4TPRH 3L95B 2XG5A 3WFDH 4I2XE 1KJ3H 3BRGC 4FFYH 4Z7OE 3CH8A 4GT7A 2GJZB 4HH8A 3JTTA 4WJ5B 3ZT6A 5K59E 4UDUB 4F7EB 3W39B 3RVXC 1X7QA 4LLQA 2FSEB 1KF9B 2AK1H 4HS3B 3RL2A 1CF8H 1T66C 3BZEA 4Z7UE 5T5FL 3WYRA 1ZANH 4M7JH 3DYPA 5D71L 3KJ6H 3IGAA 3AY4A 3FMGL 3MXWH 3JTTB 3HCVA 4HPOL 4JHWL 1D6VH 1NCWL 1I9EA 1H9VA 1DSFH 1X7QB 4LLQB 4LSSL 1T2QL 3RL2B 2IANB 1CFVH 1FO0A 3BZEB 4U2YA 2E7LA 3DECA 5I71B 2CKBB 4LHQB 1WFNA 2XWJA 2D7TH 4D0CB 3HCVB 2DQCL 2ZUUA 3IU3A 4JKLA 4NT6B 3HAEG 1FO0B 1TQBB 3CLFH 2W9DH 2B0SH 3K4ZA 4ZO9A 3QEQA 2NY6B 4RFEA 2XWJB 5LXGL 3QHTC 1DQLL 2O5YH 4ZPVA 4UNTA 3IU3B 4PLNC 4KK9D 3GMPA 2DL2A 3RFZC 3QG7H 3BKCL 4OFDA 5IBTL 1GZQB 3VCLA 4PJGF 1J1XL 4ACPA 1RHFA 3QEQB 5CJXC 1BAFL 3QSKB 2XTJD 4JB9L 1A5FL 4ZPVB 1YPZE 1YEEH 2IPUG 4TVPE 4P23D 3GMPB 3GSVA 5CEZL 4G5ZH 4BZ2L 1HH9A 5LWYH 3VCLB 1A21A 1MIMH 5E1AA 3K46A 3RJQB 4POZD 4ZAKD 1LO3L 3LN9A 3ARDC 4PJEE 3PDGA 1GJIA 4W68A 4Y0GA 5KVEL 3CH1A 4IOFC 4E9LA 3GSVB 4GQPH 1CLOH 4X8JA 5FHBL 2GY7B 1WWAX 4GG6A 5K9JH 4KK6C 5HVHB 4F7MA 5DJCA 1JWSA 1IJ9A 2C4FU 5E1AB 3NIFF 1RHHA 2OM5A 3V5DA 3BZDA 3CH1B 3D9AL 5T3XD 4ZDHA 1LWRA 1NAML 3MRJA 3N0PB 2VAAA 4GG6B 3O4LD 2HTLC 4F7MB 2X1OA 2EEAA 5DJCB 2PO6B 2DWDA 4Y2DA 3X13A 1JWSB 3CK0H 3U2SB 1RHHB 3D3VD 4D9LL 4K71C 1ZEAL 3V5DB 5TE7H 2XN9D 4JFOA 3WDHA 5JW5A 1YQVL 1EBPA 3MRJB 4JR9H 4I4WA 3RKDC 2VAAB 1KJ2L 3FT3A 5FYLD 2BHYA 4Y2DB 2DWDB 3DROA 3X13B 4Z7NF 4F8TA 5D6DC 4JZNA 4N90D 1MEXL 1ND0A 2Z31A 1K9TA 1FAKT 1GGTA 1MFBH 4JFOB 4WEBH 2KPNA 4HG4J 5L9DH 4I4WB 2R56H 3FT3B 5C3LD 3QPQD 1IVLA 2KUTA 2WWMD 2D7NA 4JZNB 4KWUA 2Z31B 4PRHE 3UYRL 2QQNH 1T1ZA 1GGYA 2E7CA 3CFJB 1GPOL 4XNUH 5IV2A 1MCNA 2HVJA 1C7TA 2V9TA 3VGFA 1NLBL 2PCPA 1OVZA 3WNMA 1J10A 4TUKL 2WSKA 4PYHA 1XGYL 1BQUA 5DDHA 4FNLH 4KUZH 4F57H 3WFEL 4L4VD 1JHLH 1TQBC 4NQEA 3H9ZA 2E7LC 2APTA 3IFLH 1T1ZB 5IV2B 5DWUH 5D7SH 2PTUA 2HVJB 2NY6C 3CVIH 1KLUA 2PCPB 4Z7VA 1YUHA 3X12A 1W72L 2O5XL 2ORBL 3FQUA 5DT1L 5DDHB 2UZIH 5F7DA 1U92A 1B2WH 1XF5A 2EH7H 4LVNB 4M5YH 4NQEB 5GISH 4TOYL 1OPGL 1J8HD 2OK0H 4HUMB 3OJMB 4DN3L 4MJ2A 4WI8A 2YWYA 3V7AE 4JFDE 4CVUA 1KLUB 2FNBA 4Z7VB 1MELA 1YUHB 1ES0A 4OM1H 3X12B 5JXAH 3FQUB 2Q86A 5F7DB 4QXTA 1U92B 3B2VH 1XF5B 3O41A 2VKXA 4MNGA 5FO7A 2CUIA 4QRRA 2F54A 5E9DE 1A3RL 5CD5C 4KRPD 4QCIA 1EHNA 4XP5H 3RBSA 5F3BA 3BVNB 1XCQA 1YY8B 1J7VR 1L7TL 1ES0B 3UBXA 4K3HA 2ZNXA 2Q86B 4XWOC 4QXTB 4EDWH 1KCVL 4XZUB 3GM0A 3O41B 4PJAE 2F53E 4MNGB 4K23H 2F54B 2UY6A 5HVHC 3MRIA 1NAMB 2FEEL 3EOBA 3S36L 4HJGA 4YWGL 5F3BB 1XCQB 3VGBA 4R7NA 3H9SE 3UBXB 4X5XA 3G5YA 2BSSA 1YNLL 2DQUL 1BPVA 4BSVA 1MI5A 5JIKA 3CVHL 1RURH 3MRIB 2P7TA 3SE3A 3OX8A 3P30L 2PO6C 3HNVH 3CFEA 3EOBB 4HJGB 3THML 1T89A 4R7NB 1KCKA 3BYTA 4OSUL 1J0YA 3OXSB 5FUOL 2XY2A 3G5YB 1TMCB 3K74B 4YO0A 3DHMA 2BSSB 1V3JA 1CDIA 4BSVB 2FD6H 4KDTA 4HXAH 1LO4L 1MJ8H 1MI5B 2GEEA 2P7TB 4Y2DC 3CFEB 5IB5B 4MXWH 4KAQL 4KI5C 5E95B 4CBPA 1DBKH 4YO0B 5CP7B 1HDMA 2QSCL 3R06A 4NP4H 4HV8A 1HOCB 4OIAA 3B9KD 5DHVH 4I3GA 2Z31C 4M6NL 2Y6SC 5DLMH 1HDMB 3FO2A 4I77L 4OLXL 3R06B 3TH2T 1P4BL 2GJJA 2NYYD 4HV8B 4G8GE 4XT1C 2D2OA 5HDBE 2J8UF 2FR4A 5I8KL 3FQWA 5EN2A 1FDLH 5C0BA 1SYSB 2YZ1A 4FHBD 1VERA 1IGML 3FO2B 1NCAH 1HQ4A 3MBXH 3BDBA 3O6FA 3VFUA 1P7KA 3WIHH 2FR4B 3Q6FA 4LARH 3FQWB 4YHNA 3PGFL 5EN2B 5C0BB 3IDXH 1NUNB 4LVNC 4LSTH 4XMKH 4L3EE 1PLGH 3C5ZC 2A2QT 4UQ2B 1A7RH 5MHSE 3O6FB 3VFUB 3EBAA 3NZHH 5ADPL 1P7KB 5HHVL 1TXKA 3LDBC 2DBLH 3Q6FB 5BS0D 2I24N 3ULVL 4ZXBC 3IFPA 3SOBL 2APBA 2DD8L 3LN5A 3UTZA 3F7VA 2CLRA 1U42A 4GMSH 1NUGA 3MRBA 3BAEL 2XYCA 4KXZH 3SY0A 4F37F 1YYMH 5GJSH 3K3QA 5IFAH 2BNQA 3HMWL 4X5LA 3IFPB 1FVDA 3B83A 2DM7A 3LN5B 3UTZB 5JDSA 3F7VB 2CLRB 2DB8A 1MCJA 3MRBB 4Q9BA 8FABB 4C4KT 1CTNA 4R3SB 4ODHH 4QHNA 3SY0B 4Y7MA 2VXSH 2XRAH 4XMLH 2BNQB 4KPHL 4YJZL 4TSCL 4LHUD 1FVDB 1CT8A 2Q7YA 5I1DA 5DVMA 3VXUA 3TA3D 1LP9E 1OTUC 5IW6A 3GHBH 4QHNB 2EDQA 3ILPA 1Z9MA 2E6PA 4L4TD 4LDOB 3OQ3B 4S2SA 2LU3A 1MRFL 1OT2A 4DAGH 3QXWA 4N5EC 4JLRA 3H6JA 1CD8A 2FLRT 3NVQA 4LPVA 4PG9A 5KSBE 1T89C 3E6FA 5HDQL 4LCCA 3LH2L 5ALBH 1ZS8A 4M62L 2OR7A 2VWEC 1ZGLA 5HGBA 3ILPB 4CKVX 4KDTC 4S2SB 2BK8A 5ITFA 4GBXD 1IQWH 5LGHH 4M1GL 4M48L 3KPSA 1CE1L 4YDIL 4RAUB 2V6HA 3SGKA 1ZS8B 1OAXL 3UTSE 1ZGLB 4HWBL 5HGBB 2JIXA 3AGVA 3MBEC 4O2EA 5ITFB 4S11A 4EBQL 3GI8L 5C07E 5CIPA 1H3WM 4YPJA 3QHFL 2NY4B 4MCYA 3KPSB 1ZSDA 1J5OH 1OQOA 1D3CA 1CGTA 3E0GA 1CFBA 3B4NA 2JIXB 2NNAA 5FDYA 2DTMH 3FN0H 4O2EB 4TULH 3NN8B 5CIPB 3TV3H 5F96L 2E27L 2A73A 5HGAA 5HI5D 1ADQL 3VFVA 1ZSDB 3TO4D 1T22B 1WICA 2ED9A 1EFXA 2NNAB 1F00I 5DA4A 1KCSH 5K9OA 3GO1H 3WFBH 1JUFA 1M6OB 2A73B 5HGAB 1U91A 3VFVB 5DMGD 3VRIA 5JA8B 3MX0A 2HWZL 2QSTA 1NCBL 1EFXB 4G9FD 3KLSA 3FO0H 1JRHI 1N59A 5K9OB 4ZFOL 5DURD 1NSNL 1I1AD 2JCCF 2JJWA 2JJSC 2A83A 4OF8A 1NEZA 5D7LE 1BEYH 3VXPA 1U91B 1BREA 2IPUK 3QH3A 3TFKC 3OAUL 1G84A 3BEVB 4WV1A 3VRIB 5IQ9A 1RZ8B 3ZLQC 4YXKH 2F5AH 4QRPE 5GPRA 1MY5A 1PD6A 1XGRA 5T3ZL 2Q20A 2YUVA 2H1PH 1NEZB 4JDTL 1KJMA 2EDFA 1J87A 3VXPB 4FZEH 1UENA 4HFWA 1CDUA 3BESR 1AGBA 4ZS7L 2R1WA 3QULA 4WV1B 3LAFA 4P2QA 4I3SH 4LSPL 3SDXE 1U3HD 3O6ML 2ZOKA 2FIRT 1XGRB 5GJTH 1LEIA 5HYJD 4RQQA 2A9NH 4DOHB 4PRIE 4JPVL 4ZSOE 4HIEA 1KJMB 3I75A 4OGAC 5KSUA 4HFWB 2X1XR 2W65A 1AGBB 1L0YA 2R1WB 1UACL 3AUVA 1MCWW 3QULB 4IEFB 5FCUH 4P2QB 1O0VA 1I75A 2ZOKB 1JWUA 3MLWL 2XG4A 3L3HA 3G5XA 1DUZA 4UNVA 1LEIB 1GYAA 5JZ7D 1OTSC 4RQQB 4NQCD 4GRWH 4Y2OA 1WZMA 4HIEB 3TH4T 3BUYA 3FAWA 3TO2A 5KSUB 2QEJA 4M3KB 5SV3A 2W65B 2EKJA 1WZ1L 5T1MA 5BXFA 3F6LA 3JXAA 2HT4D 4GAJL 3IKCA 4TNWF 2P8MA 3HFML 1N64H 1JWUB 2XA8L 3GM8A 2N4IA 3L3HB 3G5XB 3OB8A 3EO0A 2AEQH 1B4RA 2L4OA 5FIEA 1G6RH 5ESQA 3BUYB 4X6CA 3TO2B 5KTEH 4P3WA 1ADQA 5GRVK 1FZOA 2H8PA 2VLRD 1GIGL 2J88H 5BXFB 4WI5A 4IDLA 3F65A 3IKCB 3RA7H 2P8MB 3V6FB 4GW5A 3EO0B 1VGKA 1T0NA 3P73A 3SDAB 3SGKC 4X6CB 1MFCH 4KKNA 2A6IA 1FZOB 2H8PB 2CH8A 1BBJA 1RUPL 4C54A 2B1HH 4KMTH 4GW5B 1MHPL 3UJTL 3WUZA 4WGWB 1VEOA 4UNUA 3RVVD 4ZFOA 1VGKB 1T0NB 3MNVA 3P73B 5EC2A 2E9IA 5HHXH 1JJUA 3HUJF 4P4KD 1YY9D 2A6IB 4XVSL 5BVJA 3ULVC 5TPWH 1BBJB 1EEQA 3GMLA 5GRWA 3HPJA 3BIKA 4NN7B 1KSRA 3TZVA 3NABL 4AMKH 1QVOA 1DVFA 2ZZUT 4ZFOB 3WXWL 3MNVB 4OLVL 5EC2B 2OZ4L 4OQTL 1LO0L 3ULUH 4BK5A 4K94L 4LHUG 1NGWA 2DQGH 2V9RA 5BVJB 3JV6A 1BBDH 4BFGA 4K8RL 3DVGA 3MUHL 3GMLB 4YDLB 1M4KA 1T20A 5J57B 1P7QA 4K3GA 3HPJB 3BIKB 2J3SA 4BZYA 5IM7A 1BGXL 2HJLA 3O6LL 4XPFL 3TZVB 1QVOB 4Y4HA 5FB8A 1DVFB 3CDYA 3QIUD 1GSMA 3DSNA 3BOVA 1PQZB 3PJSA 3N1PC 3VD9A 3JV6B 4O5LH 1WZKA 3LQMA 2A6DA 1GGIL 4X7SH 3QRGL 1T20B 1P7QB 1IE5A 3G6JF 5IM7B 2HJLB 2I5YH 4Y4HB 3T2QA 5FB8B 3UAJD 3VFWA 4U1LA 4WV1C 1KEGL 4LPXA 3TNMA 4EUPH 3PJSB 5EORH 2OJZL 3C08H 4M9PA 4P2RB 4IIQA 2BHUA 3W0WE 1B6DA 3JV4A 3VRJB 4OZIA 3KVQA 1EBAA 2DQHL 1R3JB 4GXVH 4JPWH 3VFWB 4U1LB 4Y16B 4OZGA 5D1XA 3ARTA 4IIQB 1XT5A 1INEL 1TZHA 3JV4B 4R4FL 1DBMH 4OZIB 3UO1L 2I9TA 2AKRA 1JGVL 4M6ML 3VI3F 1BM3H 5BRZB 1CD0A 3VD4A 5D7IF 4OZGB 5D1XB 2DICA 5LCVL 2AS5M 4LSRH 5BOPA 5F1NB 3DUUA 1HINH 1TZHB 3QXUA 4NO0A 4BA8A 4I3RL 4LCYA 3ECBA 2X05A 3UDWA 2I9TB 4XMPH 4R90L 2AKRB 2R29H 3OTTA 5E0QA 4C58B 5DRZA 4KUCD 4U3XA 2A9ML 4HQQH 3HPLA 3HI1A 4NKDA 4HD9A 3WN5A 1MQKL 4OLUH 2ZPKH 4Y1AD 3V4UL 4JG0L 5I1JH 4NO0B 5FYJU 4LCYB 1F8TH 2BJMH 4JFZL 3SDAC 2JE8A 4JRXD 5CINL 5DRZB 5CJQH 1ZVYA 3MSPA 2HJFA 2OZ4A 3HPLB 1UB5B 2VO5A 3HI1B 4NKDB 3WN5B 4FQJH 3O9WA 1SY6H 1UB6A 2R4SL 3G6DL 3N06B 3QAZB 4FFZH 4HC1H 4O2CA 4Z7WF 4LKXA 1FZJA 3V6OA 2HJFB 4NN7C 2R0LH 2R23A 3O9WB 5E4EB 3CFDB 5IW1A 3QQNA 4JGUA 3P2TA 1G0XA 1N3NA 2D9CA 5T5FH 1JWMA 3MJ8A 4O2CB 3JWOL 4NZRH 4LDEB 4LKXB 1CIUA 1LEGA 2ICWJ 2WBWB 1CICA 4U1GC 3PWPE 2YKLH 4XNQB 5E2TL 4KQ4L 1A2YA 4YDLC 4MHHI 2HTKC 4YHML 2R23B 1X5KA 5EU4A 2VJXA 2AJVL 3P0VL 2IH1A 3TZVC 3V0WL 5IW1B 1DVFC 2YD1A 1F5WA 4RRPA 1N3NB 1JWMB 5JW3L 3MJ8B 1JPSH 4LRIA 4TSAL 3IB4A 2XT1B 1LEGB 4TN9A 4PS4L 1CICB 4HWZB 1A2YB 2XV6B 1A7NL 1D9KD 1HXMA 1N5AA 5EU4B 1QSEE 4I9WE 2IH1B 4Y4HC 1SM3L 1XCTA 1CG9A 4JREC 3V4VL 3S6CA 1A1NA 3DETD 2JLLA 2IBZX 1F11B 1FCGA 1INQB 2DI9A 5LXGH 5BOZG 2ADFL 4HT1L 1DQLH 2WUBL 4NNXA 2Z8SA 4DZBA 12E8L 2EIDA 1HXMB 1N5AB 1DR9A 3VRLF 3BKCH 4X7DC 1XCTB 1CG9B 4LNVA 3T0EB 5DXWA 1A1NB 4L8CA 4KVCL 2DQDL 1J1XH 4TVPD 1F4AA 4Y16C 1MCPH 1GOHA 4ZAKA 2HKHH 1RAMA 1BAFH 3S4SG 2XTJB 4HK3J 4JB9H 5ITBH 4NNXB 1A5FH 4OTXH 4DZBB 5JPNA 2WBJB 2GITB 1J86A 2G60L 3QG6A 4ORGA 3S8WA 3HI5L 1AR1D 4L8CB 1PW3A 5F7EL 3QUKB 5F1IA 1PY9A 1J0ZA 1T1WB 4ZAKB 1LO3H 4ORZC 1U9KA 3GMMA 2BRQA 3J7HA 3MV01 5D1ZD 5JPNB 3B8SA 3QG6B 1T03H 3G04A 1IGIH 4ORGB 2LAAA 1J0JA 5F1IB 1WAAA 1R3KA 4GUPB 4PIRF 4UILH 1UJTA 3GMMB 2KBGA 3QDHA 3FONB 1NC4D 1U8NA 4X6EA 2XN9A 2WIIA 4XNXL 5DFVC 4FN0A 5C7XH 3D9AH 3UDWC 5JHDD 1FJ1B 2Q8BL 3G04B 1EHAA 3AC0A 2FEDC 3K1KC 1T5XB 5L2JA 5HGGS 3HG1E 1R3KB 1D7FA 4I18A 1XGUB 3WN5C 1DEEA 1KTKE 4J6RH 3CAFA 1ZEAH 2LABA 5AAWA 4X6EB 2XN9B 2WIIB 1DCLA 3T2PA 3IXAB 3WBDA 1ITCA 2WINA 4KHTH 1BZQK 1KJ2H 2O93L 4KJQD 4MXVF 1ETZB 4H8WL 5DUML 1FBIH 5L2JB 4I18B 4E41E 4K94C 1DEEB 3O9WC 5IB1A 4K8RC 5HI4C 1QLRA 2YRZA 2B39A 3RRQA 3AM8C 1C12A 2WINB 3WSQH 4JRYA 1TLKA 5I8EA 2Q76A 3ARBD 4PRHD 3MV8E 5F8QC 5J12B 5E6YA 5EFIA 4CJ0A 3RJDA 5HBBA 4WWID 1K8IA 5IB1B 3HA0A 4L4VA 2AJSH 4ZFGH 5HD8C 1QLRB 1CZ8H 3UYRH 5IEHA 1RZGA 1C12B 4MD0B 2L0DA 2H45A 4U1HB 5ERWA 4JRYB 5I8EB 5TE4H 1CICC 4ZNEA 2BC4A 1OSZA 1TQCC 5EFIB 1U8HA 4XB7A 5L6YH 2J8UB 1K8IB 3LKNA 2I9LA 4L4VB 4OZFA 5EU6B 5IEHB 1RZGB 5ERWB 4N1EA 3VE0B 4X0KA 1JGDA 1T5WA 1RJLA 3RY5A 2BC4B 1U8HB 5DVLA 1W72H 2O5XH 3HC3L 4FG6C 2AI0H 3K7UA 1C5CL 4IMKA 1X6NA 2I9LB 4JFDD 3QUMH 4MJIE 4Z0XA 4OZFB 1UWEL 1JBJA 3T0EC 4TOYH 1OPGH 1JNNL 1JE6A 1IMHC 4WHDA 4DN3H 4YGAB 4X0KB 1JGDB 1FORH 1T5WB 1RJLB 4N0YH 3S37L 2PW1A 5E9DD 4LOUD 5D2LE 1MRCH 2ADGB 2WBJC 4XHQA 2B20A 4Z0XB 3U4AA 1RI8A 4NKQB 4DJMA 1AGCB 4KRPB 2Y36L 3U1SH 1MVFA 5FO9A 4ZAKC 5I9QB 3BZ4A 2FBJH 4OFIA 5IB4A 2F53D 1A64A 5DI8A 4IDJL 5I18H 3VH8A 2PW1B 3GSWB 3ET9F 3BFOA 1FVEB 3VA6A 1KCVH 2IG2H 4FTVE 3H9HA 4LCIH 5CZXC 3LRHA 5I8CB 4NNPH 3H9SD 2KL6A 3IJSA 2VDNH 1RIHH 1FHGA 1A3LH 4YX2L 1WFTA 1E6OL 3BZ4B 1EMTL 1N2RA 2B7DT 2EECA 5DI8B 5CSZA 4HCRL 3VH8B 1YNLH 2DQUH 4PP2A 4U6VL 4LVOB 3H9HB 1OW0A 4K7PY 5B21A 3IJSB 3CVHH 4ZFFA 2BXZA 2BVOA 4UU9B 1MF2H 3S37X 1N2RB 2IPTL 3C2AL 5T1LD 1WZLA 2LU7A 2OI9B 5CSZB 4WI2A 4JY5H 4ZOBA 2XFXA 1HIML 1WF5A 4MVBD 4PP2B 3D5OF 43C9B 4UOJA 4DW2L 5EB9A 1N0XH 1HZHL 3N1MC 2IANE 3S35X 3WD5H 4QOKD 4Z7QF 4ZFFB 1IARB 2BVOB 2Z0BA 4I18C 2V17H 3ME0A 1ORSB 5MEPA 1CLZH 2XFXB 4JQXA 1CGYA 3VWJB 4YXLL 2NR6C 3MNZA 4N1CA 4LSDA 4UOW1 2QSCH 3LPGA 4KU1A 3HI6L 4BQCA 4PJ7A 5F7YC 4XX1G 1A6TA 5J12C 1EUUA 1MHEA 5L2KE 2NQCA 4EN3D 2X9WA 3OKNA 3RTQD 4M6NH 4S1SH 2VLJA 4OCMC 1JRHL 3MNZB 1I7UA 3DX7B 1P4BH 4PJ7B 5CMAA 3IJHA 4MNQA 3VXSB 1A6TB 3BQUC 4FQLL 1MHEB 1TITA 1VEPA 5ILTL 5GSVA 3OKNB 5MP6H 4AEIH 5DTFA 3KHQA 2VLJB 5TFSL 1BWWA 4TNVK 1I7UB 1QLEH 2V5MA 4S1DC 5LVEA 1TENA 1UCTA 5CMAB 3IJHB 4MNQB 1C16A 1UM6L 3DGCR 3TJEL 3KGRA 1PEWA 4L3ED 4TTDD 5BS0A 5GSVB 3D2UB 3MROA 3VGGA 5MHSD 1KLFA 1F3DH 2P47B 1A0QH 4YNYB 3SN6N 5FFLA 4YAQA 4FQHB 5AAMA 2PF6A 1C16B 15C8H 4XH2A 5K9KB 2JCCA 1IC1A 4I48A 4JEGB 3L1OL 1FNEA 5HHVH 5GZNC 3SGEH 5F1SA 4MD4A 3MROB 4OCSL 25C8H 4HCRA 3MRPA 2X4SA 3WLWC 4KRPC 1GCFA 1OP5H 5GGTL 1OGTB 4H5SA 3L5XH 4N0UA 4XH2B 4N0FA 2JCCB 3LS4H 3QCUH 4I48B 3CX5J 1BJ8A 1FNEB 4MD4B 3X17A 4WDIB 5ICZA 1F97A 4OLYL 3LPFA 4HH9A 3NOIA 4EI5C 3MRPB 5D93B 3CMOL 2X4SB 4AEEA 2VUOA 1QHPA 1RFDL 4PTTA 4H5SB 4N0UB 3T8XA 2R8SL 3TA3A 4GW4A 2OJEB 4N0FB 4RCAA 1UADC 3O2DL 4K3EL 3H7LA 4KC3B 4KI5E 4LVOC 3V4PL 3QQ4A 4FZ8L 4JO1H 4H1LB 4L4TA 4M7LL 1MVUA 1E4XI 3MTRA 4WI9A 5KOMC 4NGHL 3TBYA 1FC2D 4LASH 4PTTB 4PV9A 1NFIA 3T8XB 2ARJA 3LKSA 3TA3B 5GZOD 4H8WC 2OI9C 3QDJE 5CJ5A 5IP4A 1I8LA 3B3IA 4RNRA 3QQ4B 4L4TB 1MVUB 3ARFD 3T0DA 3VFMA 3P9WB 4GBXA 1I3RA 4MXQC 4AT6A 3TBYB 5FF6A 5L8KB 2J6EL 4PV9B 1NFIB 1RK1A 4PGCA 1T1XA 2ARJB 1F4WH 3LKSB 5J3HC 1UZ6F 5E8PA 4O4YL 1F58H 2VRAA 1OAZL 3B3IB 3VWJC 4RNRB 3TJHD 3VFNA 1WTGT 1VKXB 3PNWA 1Q72L 3LQAL 3VFMB 4GBXB 4AT6B 4M43L 2XZAL 1U3JA 1ITBB 1P2CA 4FQ1L 4M1GH 4PGCB 1T1XB 3V7AG 5EZJA 1RIUL 4QWWC 1AR2A 1CE1H 3C9NA 3WIFB 2R69L 4LDLB 4PJCF 5C07D 3VFNB 3ELAT 4YHOH 3PNWB 4FFWC 1HH6A 2DYPD 5CS7A 4NWUH 1ZVHA 4NQEE 4M6AA 1SYVB 3OL2A 4EBQH 2FX8H 3QHFH 5CEZE 5EZJB 5I75B 3TO4A 2ESVE 3C9NB 1QD0A 4Z7VE 4OJFH 3IDJB 5GS3A 1HH6B 4UINH 5KW9L 4JDZA 4NQDA 2UVFA 4YH6A 5GGTA 3EJYD 4X4XA 2HP4A 5AD0A 3FO1A 4BUGA 3TO4B 1QR1B 4NO3A 1G1CA 2P5EE 3FT4A 2VZ3A 2EYSA 4JDZB 4NQDB 4HG4K 4MNGE 3SGDH 1S9WA 2F54E 5KSAA 1I1AA 3I9GL 4X4XB 5HI3C 5AD0B 3FO1B 3HNTL 5L0QB 1F4HA 4O00A 3MRLA 5B38G 3I3EA 4NO3B 4L5FL 4TYUA 3DYMA 5JORA 2HWZH 3FT4B 1NCBH 3DI2B 5D7LD 3GK8H 4X5WB 3W5MA 1I85A 2EYSB 4OI8A 4Q97A 3KPPA 3G6JA 2GK2A 1S9WB 5DURB 5KSAB 1NSNH 3BD3A 2NXYD 4QRPD 1HHGA 3ORJA 4XNZC 4JPKL 1A7BA 4PJDE 3MRLB 4OFVA 2JK5A 4KZEL 2Y25A 4GKSA 1RULH 5JORB 4NQSA 1A7QL 2HVKA 1U3HA 2X5PA 3OR6A 1JNLH 5F7NC 4OGYH 5DJAA 3KPPB 3G6JB 3ZTNH 4CUCA 2H2SC 1D6EA 2KKQA 1MJJA 2LAGB 3S34L 1HHGB 3BD4A 1R3LA 2JJTA 5DJ6A 1EAJA 3G5ZB 4ZS7H 2BCKA 2JK5B 2YD8A 3MRQA 2VE6B 4GKSB 2W9EL 5CILL 4PRID 1DBAL 4GRLA 2IWGA 4L3CA 4NQSB 2HVKB 1U3HB 2VWEE 4PJBF 3I84A 3O6MH 3OR6B 4YHLL 3QYCA 5DJAB 1IGYB 3TA3C 2XQBL 5ACZA 1D6EB 4NQCA 4W6YB 4Y89A 1MJJB 1QBLL 2KZ1B 5LG1A 1R3LB 3UTTE 4LLMA 5DJ6B 3MRQB 5D7IA 1U8LA 4AIOA 3LV3A 4GRLB 4L3CB 1V7MH 4BKLA 4X9GA 4UIKH 1IAIM 4QRTA 3PV7A 1WIPA 2YPKA 4NQCB 2GSIA 1IGCH 1NQBA 1X5YA 2VLRA 5DJ8A 5EG6C 2C3WA 2VZVA 1CGSL 1ZHNA 1IRAY 1RD6A 5CGYD 1U8LB 5D7IB 5GS0H 3JVGA 4J12A 5ESAA 2YEZA 4D8PA 3SE9L 3ILQC 2XA8H 4QRTB 1VCAA 1W8OA 4RGNC 5F93C 1U36A 2YPKB 3VG9B 4YHPB 2GSIB 2GJ6E 4ZUUA 3JUZA 4F33A 2J1KA 4WEUD 4L29A 2BOBA 3OPZL 3ZYIA 1HI6A 5DJ8B 1ZLVH 2JELL 1ZHNB 5DD3L 4UV4L 1NCTA 3SJVB 5ESAB 2YEZB 5KOVC 4D8PB 4HUVA 1MCFA 3Q3GA 4K2UL 4GOSA 2HYMA 4Q9RL 1CXIA 4ELKA 3H0TA 4P9HH 5C0RH 4F33B 4R2GD 2W91A 4L29B 1C5BL 2BOBB 1HI6B 2XZCL 3DURA 2FGZA 3LRSA 3T3MF 4F58L 1XZ0A 5IB3A 4MLSA 1IAOA 4HUVB 3Q3GB 3W2DL 3GIZL 4KI1A 1MHPH 4ELKB 1RK0A 3H0TB 4JM2F 4X9FA 1W0YT 1EO8L 3QQ3B 8CGTA 5FA4A 1WC7B 3R1GH 3DURB 1Q38A 3LRSB 1XZ0B 3AXLA 3FT2A 5IB3B 2IJ0C 4XBPA 5JOFA 1KGCE 3MGOA 35C8H 4OIIH 5DEGA 1NL0H 1UXSA 2X89D 5GRUL 4NPYA 1RK0B 4OLZH 5L0QC 5CCKH 4OQTH 3QIUA 4CN1A 3EO1A 5FA4B 4AM0A 4K94H 5T5NG 5LKNA 1N5YH 4Y4KA 3WKMH 2OS7A 1L7IL 2HLFC 3FT2B 2HT3C 5FK9A 4FQXA 4NOFA 4XBPB 5JOFB 3MGOB 5KSAC 4EDXA 5DEGB 1KCUL 5LJYH 1R6VA 4NPYB 1C1EL 1YN6A 2B8OT 1A6AA 3O3AA 3DWTA 4C55A 3EO1B 3G6AA 4GJTB 1YMMA 4AM0B 2VXVH 1BD2E 1KN4L 1MLBA 1U8QA 5MI0B 4Y4KB 4D3CL 1I85C 5TF1L 5FK9B 4FQXB 5DFWH 2YD7A 1NBVL 4EDXB 3LD8C 4DKFL 3W0WD 4DN4H 1YN6B 3DV4B 3O3AB 2VC2L 2NZ9C 3G6AB 4MS8C 1YMMB 5SV4A 5ETUA 1MLBB 1U8QB 2OJZH 2IH3A 1A22B 3OSKA 3CXDL 3I2CH 4JHBA 1QYGL 3REWA 1JL8A 2Z8VC 1CDHA 1MCQA 2DQHH 3CLEL 4KJPC 4WI7A 3MPCA 1H8SA 2XQYG 1CDGA 2JJTC 1DQML 4XPBH 3OGCA 2GW5A 3ZKMD 3ZSTA 4EVNB 4JG1H 5KVFH 5ETUB 1DTUA 4GRLC 3NCEB 5A2KH 3LQAC 2IH3B 2BHZA 1NFDF 3RY6A 3REWB 2Y07L 1JGVH 1MCLA 4M6MH 5CHNA 1S9YA 3IU4L 1IC4H 3OGCB 4LF3A 4DQOL 4AK1A 2YOCA 4RWYL 2F74A 4NBZB 3LN4A 3CUPA 1J12A 1KB5H 1MH5A 5I1CH 3VG9C 3ZSSA 4JRXA 4WEMB 1I9RL 5DJDA 2LV4A 5CHNB 5HYSB 1S9YB 3QCTL 1VDGA 3GB7A 3RX8A 4LF3B 2PYFA 4XI5C 3U30B 4X4YA 3MJGX 2CUHA 1YYLH 1MQKH 5F9JA 2IAMA 2F74B 1LGVA 4IBLT 4OF6A 3LN4B 3ULVE 3CUPB 3VD3A 1MH5B 4N8VB 4JFZH 4UBDD 4JRXB 3CC5B 5DJDB 5CINH 5IMKA 4LPYA 3GB7B 4Z7UA 3K0WA 2PYFB 3V5HA 4B50A 5F9JB 3HRPA 2IAMB 3SKUD 3SO3B 3TC9A 4WW2F 2AV7A 2DBJA 3ARQA 3OJ2C 5IMKB 3EIFA 5HHOA 4EXKA 3RPKA 3V5HB 3TNNA 1GC1L 4CN4A 4I5BA 3PWPD 1BX2A 3PL6D 1D5ZA 2CQVA 1FNGA 2AV7B 4CGTA 4F9LA 3JWOH 1YEKL 5GRVL 4LPWA 4NBXB 5H8DA 2DLHA 4J7RA 4Z76A 5HHOB 3QFDA 4TNVF 4G8IA 2NMSA 4KQ4H 2V7HA 2ZUWA 4YHMH 4FS0A 4Z8FL 3TNNB 4XRCA 5F7FA 2Q3ZA 5C09E 2AJVH 2APFA 2MFNA 2CK0L 3V0WH 3SE8L 2H6PA 4I5BB 1BX2B 2P44B 1D5ZB 1NDGB 1FNGB 3C8KA 3MCLL 4TSAH 1FFPA 1IC5H 1BQLH 1OAKL 2UY7A 1QSED 4I9WD 5FUZL 1BVZA 5TE6L 3BN9C 4PS4H 3QFDB 4Y4KC 5DEZA 4PTUA 5MI0C 3HAEB 1CXHA 4G8IB 4NHCL 2V7HB 4WY7H 2ERJB 2OMNA 2QHRL 4FQXC 4YEFA 2VXQH 4XRCB 1EAPB 4Z5RA 1E28A 2EC8A 3VXMB 1AJ7L 3HHRB 5DUPL 4PGEA 4AL8H 1XGTA 4XNMA 4UTBL 1FFPB 1AD9B 1JCKA 2R9HD 1OQXA 3ZL4L 4V1DE 3FQXA 1A1OA 4WNQA 1OAUL 1MOEA 2D4DA 12E8H 4R26L 3WXVL 1P6AB 4ETYA 4Z5RB 1FNHA 5CBEA 4PGEB 1XGTB 4XNMB 4HJ0D 1T80A 2YD4A 1RJYA 5AZEL 3FQXB 1V5JA 5D1ZA 3QEGH 1A1OB 4K7FA 1CXEA 3L3OA 4M7LT 4Q2ZA 2GQHA 2G60H 1RY7B 3FZUC 4MA3A 5CBEB 2AQ3A 2H32H 2VUYA 2XZQL 5JW4R 4JZJA 5F9DC 1RJYB 2OL3H 4X6CE 3PXJA 5D1ZB 1NC4A 3BJLA 3OKOA 3LOWA 4LAQH 3EJZC 4X99A 3RZWA 3L3OB 3LB6C 5JHDA 2AVGA 5HHPB 4MA3B 2R39A 1FG9C 4MCZB 4NUGH 1QA9A 3PG2A 5L7XL 3U30C 4JZJB 3RVXD 1Q9KA 4EKXA 2DLEA 1ZHLA 1S7TA 2RCSH 1T66D 2WAHA 3OKOB 4MX7A 4X99B 5IMOA 3HG1D 3L7FA 1CR9L 5JHDB 5D1QA 1EVTC 3G9AB 1QA9B 3O2WH 5EZOH 1N6UA 1O7SA 2AXFA 1AQKL 4NJ9H 1Q9KB 4PJFA 1YEFL 1AC0A 2IAMC 3MZTA 4IOIA 1VGEL 1ZHLB 4MDIA 1BOGA 1S7TB 4WHCA 3SO3C 3WFCH 4F3FA 4JKMA 4MX7B 4QHUA 3L7FB 1OAQH 3TIDA 2FO4A 5D1QB 2VXTL 4E41D 4PJ9A 5T3ZE 3ARBA 4PRHA 5LQBH 5C08A 5DUMH 3SDCA 2AXFB 1KOAA 4PJFB 3P4MA 4IOIB 4MDIB 2BOCA 1B9ZA 1BOGB 4F3FB 4M1DH 2FJHA 3MV8D 3QR2A 1G9NL 1UM5L 4QHUB 3TIDB 1U58B 2FO4B 4PGDA 1DBJL 4PJ9B 4YHZH 2VERN 3MLZL 3ARBB 4PRHB 3F8UB 4LLUA 5C08B 5C8JA 3SDCB 1A7OL 1WFUA 1AE6L 3P4MB 5D96B 1J1OH 2BOCB 4R97B 5DQDL 5ALCH 5LBSL 3TWCH 4P2RE 2FJHB 3IS1X 2DIBA 2AJYL 1U3ZA 4F9LC 4PGDB 3MRGA 4DGIL 2HMIC 4Y19E 2WQRA 1I3UA 4LLUB 3ZHDA 3DRQA 2ERJC 3NZ8A 3D0LB 4OZ4A 1MIEH 1V8HA 4JFDA 4ZO6A 2V5RA 3CPLA 1RUAH 1YEIL 4OZIE 3MRGB 3V6BR 1I9IL 3ARDD 4MJID 1TTUA 2Z35A 1FL5A 5BRZE 5E9DA 1DQTA 1QRNB 4IOFD 2PR4H 1E4XL 4MMXC 3RGVA 4OZ4B 1FN4A 1PYWA 4OZGE 1CL7I 2VNCA 4KKBC 4KK6D 1TJIH 2NX5A 1T6WA 3CPLB 5EOCJ 2AQ2A 3D85D 1C8PA 4NZUH 1AGDA 1RU9H 2CO6B 4K9EL 1BF2A 2YSSA 5D7JD 2F53A 1LNUA 2Z35B 4G3YL 4PR5A 1JYNA 3S37H 2GSGB 4Z6AT 5C0AD 3RGVB 4XPHH 3S7GA 4EZMA 1QQDA 3AMLA 2FX7L 3NIFE 2HA1A 1GAFL 2HTLD 1AR1C 2NX5B 3RWHB 3S35H 2D0FA 2Y36H 4HIJA 1G7MB 2VKWA 4BK4A 5E2VL 1AGDB 2YSSB 4FTVD 2F53B 1LNUB 2DN7A 4PR5B 4IDJH 4TPRL 5MENA 3WFDL 2BSTA 4ZPTA 1UZ8A 1KJ3L 3OKKA 4HEME 1T0MA 3UJJH 4FFYL 3RKDD 1QO3A 3VI4F 1QQDB 1CXFA 3WL9B 1R3IL 2VQUA 3ARZA 1KEMH 5AUMA 4YX2H 1OB1A 1KJVA 4JZJC 1FFQA 1EMTH 5T1LA 1L9NA 4AQOA 4UIMA 5MENB 1CF8L 5H35A 4G6KL 2BSTB 4ZPTB 4Z7NE 1UZ8B 3OKKB 1WUNT 4KK5C 1T0MB 4U6VH 3I6KA 1QO3B 3KDMA 1KIQB 4OT1H 2ICCA 4RDQG 3KJ6L 2E6JA 3MXWL 2MCPL 4QOKA 1UYWH 1O5DT 1RZ7L 2CRYA 5AUMB 4NZJA 1OB1B 3P9MA 1QTYT 1G6VK 5T1LB 3V8CA 1CFVL 2IAND 3H8NA 4UIMB 3WO4B 5H35B 3Q6GL 1HIMH 3IDMA 5EBWA 4LIQH 3DBXA 3I6KB 5D1QC 5J11B 4NQXA 1GC1C 1UH4A 1HZHH 2P46B 4ZYKA 1U6AH 2AJZA 3FOLB 5EU5A 4QOKB 3TESA 5BV7B 3ROLA 3P9MB 4O51A 3WNPA 2EDYA 3CLFL 1X44A 3IDMB 5EBWB 2Y5TB 4YXLH 5L2KD 1EA9C 3DVFA 3ZKSD 4NQXB 4PJ9C 3HI6H 4ZYKB 2O5YL 1CDCA 1H3VA 3SDCC 5A2IH 4O51B 3QG7L 1UCBL 4R8WH 1HXYA 4G6AC 4ZD3H 2W1NA 3CSPA 1JRHH 4GRWF 1X3DA 1FYTD 1PSKH 2LVEA 4HWUA 4Y4FC 1G7IB 3DARA 5DO2C 3T0EE 2FB4H 4MQ7A 4F2MA 1U8KA 1PFCA 4PY8I 4LFHG 4UV7H 5DVOA 4KKCC 3OKMB 4YHKH 4G5ZL 2ZUYA 1HXYB 2F15A 5TFSH 1LO5A 5CD5D 1MIML 3ZDZE 5DMKA 4ELMF 1F2QA 4MQ7B 4F2MB 1U8KB 4XWOD 5IKCB 2EH8L 3WDIA 3MLYL 5K9JL 1LO5B 3KLAA 5DVKA 4Y88A 3QA3A 3QIBA 4NJAL 1E4JA 5DMKB 4JO2H 4XC3L 5ADOL 5EULV 3RGVC 2AABL 1GGCH 4LP5A 3LMJH 3KLAB 1S9KC 2PO6D 5E2UH 3CK0L 3V0VB 2XQYK 3QA3B 3EJJX 2OYPA 3QIBB 2VDPH 5E99H 4GW1A 2X10A 5IG7A 1TVHA 2XXCB 3QUXA 5DJZB 4YBQC 1A6PA 4GAGH 2FRGP 4J23A 4HWEH 1LVEA 4HK0A 4Y2DD 3ULUF 4KTDL 4QYOB 2R8SH 2BVUA 4GW1B 3X11A 4OCYH 5IG7B 1TVHB 5FYLE 1DDHA 5SWQA 4LAJH 1X9QA 4WU7B 2QKIB 3QUXB 4WEBL 3I6GA 5L9DL 4DWHA 4FZ8H 2R56L 5MEQA 4M7LH 5KSBA 1M1SA 4HK0B 3QDJD 4XGZB 1JFQH 3IDGA 2CIKB 2Z31D 5J7CC 3QCVL 3WO4C 2Y6SD 3X11B 1DDHB 2UVEA 3L5IA 5SWQB 2BY1A 2QQNL 5FO8B 4NSKA 4HUKB 4XAWH 4XNUL 5F72S 2MQCA 5J11C 5MEQB 1OP5K 5KSBB 1G9NC 5HYIA 3IDGB 4P9ML 2EDOA 4KUZL 4O58H 4F57L 4JRYE 2BP3A 1JHLL 4O4YH 3I85A 1OAZH 2A1WH 2OTPA 4NSKB 3GUTB 2J8UE 5DWUL 4XCFL 5D7SL 3CVIL 1Q72H 3SDYL 2FGWH 5EU6E 3F58H 1YPZF 5E24E 4FQ1H 2UZIL 4NUJA 4Z95H 1E4KA 1B2WL 1G7JA 3ARXA 4OUOA 4NQED 2OK0L 5I16A 5I0ZA 2HJKB 3C5ZD 1IL1A 5CEZD 2ARWA 2ESVD 1NGZA 4PJEF 4OM1L 2DAVA 2IQAA 2Y06L 4U0QB 5B4MD 4NUJB 3B2VL 1G7JB 1QP1A 4NRXB 4S0SD 4ZXBD 3BP5A 1S7WA 4C83A 1E6JH 1P5UA 4XP5L 3S3PA 4OIBA 3ESUF 5EU7C 3I50L 3V2AR 3P4OA 1NGZB 3RUGF 2XA3A 5E7FA 3TVMD 1AO7E 2IQAB 2P5ED 4K9EC 5C3TA 4JM2B 1U2HA 1BZ9B 5AYQA 1U8PB 3BMWA 5ESVA 2B4CH 3OF6A 2F54D 4U49A 3VG0H 3BP5B 1S7WB 5HGHA 2DMKA 5EC1A 3T2OA 3I3DA 1HWGB 3P4OB 2APVA 3BGMB 3G9VA 4LVEA 3VW3H 4GAFB 3WFZA 5EOCH 4HGKC 1TPXB 3I9GH 4U33A 5GQBA 4QRPA 4M4RA 2Y23A 4IMLB 2QV2A 3MXVL 1RURL 4L5FH 3O3EA 4RFNC 5HGHB 3HNVL 4HGWA 5EC1B 5IW3A 4EEEA 3QIBC 3F7RA 2BMKA 3DV6A 6FABH 1JZ2A 2MNUA 3MMEA 2FD6L 5JOPE 1BFTA 1VACA 3JWDL 4HXAL 1FPTL 1MJ8L 2P5WB 3LY6A 5HSFA 3O3EB 4ZSOA 3QWRA 4HGWB 1A7QH 4MXWL 1IGTB 2CKNA 5C86A 3VFRA 3PP3H 4BM7A 1DBKL 2QBWA 4LSVH 2BMKB 2G75A 3DV6B 3IDIA 3QUXC 2VN7A 3MMEB 1CD9B 1VACB 4M7ZB 1LILA 1IEBA 2EDBA 1MREH 1I3GH 1S7SB 5KBNC 3BP4B 2VLMD 5CILH 1CD1A 4ZSOB 3UTTD 3VFRB 2NY0B 3WS3A 3HZKA 1F2XK 2AXJA 5GZOC 3PUCA 5IEKA 3IDIB 1QBLH 1N4XL 1KCRH 2AEWA 1YJDL 3ABZA 1T7VA 1UG9A 2BY0A 3MBED 3SKOB 1KN2H 1CD1B 1PGRB 3D39E 3PGDA 5GGVL 4HMDA 3WS3B 1Y6MR 4DGVH 3QZWA 4DEPC 3TPUA 3HKFA 1FDLL 4PJ7E 1AHWC 3VXSE 3RIFK 5IEKB 5JR1L 3L5JA 1SHMA 4ODSL 4P2OA 3ZMRA 3MBXL 2VLJE 3NCBB 1OP3K 4WI4A 2GJ6D 3WIHL 3PGDB 3SE9H 4DZ8A 1MFAH 4LARL 3ZKQD 4UTAL 2HRPH 3QZWB 3TPUB 2C3XA 4MNQE 3CZJA 3TN0A 2A77L 4LSTL 4HKZA 4XMKL 1PLGL 2UWEF 3MRNA 4DTGL 3BWAA 3VDCA 1CVRA 1BLNB 4CN6A 2JELH 1A7RL 4P2OB 3NZHL 3AAZA 1KELH 4DZ8B 2JB6A 2DBLL 1OL0A 4Z18A 3BN3B 2ZOLA 4S1RH 3B2UC 5D9SA 3TN0B 1Z9LA 5EIVA 4PJAF 5F7KC 1KC5H 4HKZB 1IM3B 5HDOA 4KROB