1LK2B

1.35a crystal structure of h-2kb complexed with the gnysfyal peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A peptide that antagonizes TCR-mediated reactions with both syngeneic and allogeneic agonists: functional and structural aspects.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk2B00
1G1CA 4YXLL 3A6CH 2Z9TA 3PE9A 2AJUH 3VWJC 2D4DA 1A8JH 1EFXB 3UBXA 1G9ML 3BHBA 3D39B 1K3IA 2OXGA 3MRHB 1S7VA 3TVMA 4WU7B 2DKMA 1U8MB 3STZA 4PJEB 4YDLC 1D5IH 5DJXA 4TQEH 3DX9B 3QG6A 4JO3H 4MWFA 4NQSA 5K59E 4KKNA 5J6HA 4GW4B 1GGCH 3UDWC 3KGRA 4S2SB 3KG5A 2ZOLB 1A7OH 3S35H 4U1IB 1IM3B 4J3WA 1FFRA 5FDWA 4UB0L 5IMKA 1S78D 4XPGH 2FIKB 3F12A 1EDQA 2BZDA 2F54A 5D72H 1HINL 5BXFB 1CXHA 1GPOH 5BV7L 4PJBB 3DWTA 3AXLA 4V1DD 5F70A 3W39A 4U7SA 5JR1H 3DGGB 1VA9A 5D7SH 3BRFA 2BSSA 4M5ZH 4OV5A 4L9LC 4PP2A 1RURH 5EPMB 4UTAL 3G6AA 2FH8A 4JFFA 3I2CL 4EI5D 3D87B 3CVHH 5AYUL 4IRSD 1RJYB 2VZSA 4NYLA 3WFCH 5ITBH 3MNWB 3LIZH 2FATH 4U1KA 4LVHB 4OUUB 4LLQB 4XMKL 4NZUH 5L2KA 3WUWG 3MRFA 3W2DH 4TTDC 3QIWC 3GSXB 1TVBB 4X4XB 1LP9B 3KLAA 4JJ5B 3P77B 4MQTB 4WFEE 3KYOB 2GUOB 4KTEL 1P9MC 3SHSA 3ARFA 5I1GH 4KKBD 3TBYA 5AAWA 3OGCA 1IAIH 2OJEB 4GG6F 1F6FB 1W0VB 2W0LA 3ALWA 3KLSA 5C0FA 5MEQA 4XP4H 1T83C 3QIUA 4HWEL 3X14B 1QKZL 4XTRD 2IANB 2XN9D 1PSKL 2NLJB 2EIDA 1K8IB 5HHQA 1LEKB 3GMNB 3SDAA 4ODHH 3MOBH 1YC8A 1SYVA 5C86A 4HWZA 4B53A 1JGDB 3BJ91 5I1EL 3MLXL 4N1HB 4HCRA 1ZLSL 4DKEH 2IFFH 3JV6B 1FDLL 1A6WH 1FZOB 3HAEH 5FECA 1AGFB 2D9CA 3DV4A 3FT3B 3GSWB 3O11B 4O2CB 1IEHA 2AV7B 4JM2A 2BJMH 5ANMB 3D39E 3V6ZA 4X7EC 4L8BA 2F53D 3EOBB 3LKQA 3PG2A 3O2VH 1FL6B 2XV6B 4GQPH 3LN5A 5D8JH 5ID0A 1RUAH 1FZKB 1A5FH 3P40A 4IMLB 3MYJB 3KJ6L 1ONQB 3MR9B 2YKLH 3C5SA 4WJ5B 1TQCC 3RI5F 5E2JA 4F7PA 4FQXA 3HCVA 4QEGA 4TOYL 1BQUA 4XGZA 1NAKL 5EN2B 5I17B 5CKGA 3IFNH 4V1DE 5FOBA 3HLAB 3TH3T 3VW3H 4P5TB 4IRJC 3ROLA 1JTPA 4KXZH 1CICD 5E5UB 2JLLA 1TDQA 3KPMA 4KK9D 3WIIH 1YNTA 4UILL 3KLDA 3RZCD 3FB7A 4NQDA 4NO0D 3HC3H 1NBYA 3TBTA 4HKBB 2Y4SA 3F7YB 4LVNB 4LRIC 3UBXB 1X5GA 4E9LA 1A6UL 5IOPB 3KPSA 1R5VB 3QUZD 5E4IA 1AKJD 4HIHA 5H2BB 3RDTD 1ZGLM 3GBNL 3Q6FA 5H37H 1Y6MR 1A2YB 3CD4A 3RWEA 4JG1H 1DVFC 4KRMB 4CADB 4U05A 5CJQH 1DQTA 3U4AA 2Z92B 1U58A 4NM8H 2C9AA 1WC7A 2VZUA 2VOTA 2C7UA 4JPKH 2XOTA 4WI4A 3MLZH 4GAJL 5HHVH 2X4PA 4YDJA 5F6IB 5CWSB 2AERT 2GI7A 1NBZA 1OD7A 4WEUD 4CUCA 2XA3A 3S88H 1CTOA 3RWHA 1NCWL 1KTDB 5A2IH 1EHLL 1V5JA 4XP9H 4KQ4H 3WL9B 1PLGH 2WP3T 2PYFA 2ARWA 2VKXA 3BPCA 2C3XA 3NFNB 1T0MB 4P59H 4XC3L 1KLFA 3GSNL 2HTLD 4XCEB 4G6FD 4NC1C 4GMTL 2WANA 3B43A 3MV9D 2SEBB 4GAGL 5C7XL 2F9BT 4MA8H 5EA0H 2DDQL 4MZ2A 3BQUD 3RY4A 4HFUL 4L9LB 1MRFH 3FTGA 3WJLC 5FV2A 1KG0A 4X5XA 3OB0H 2E7BA 2VXVL 4YDIL 5EZLB 1JPTL 1LDPL 3X14A 5EZIH 2WBJD 3TNNB 4YHLH 1BFSA 1J87A 3JWOH 2VLJD 4OKVB 1A3RL 1AI1L 4JKPL 4X6DA 3MRHA 3AM8C 3BAEH 3EJZD 1MREH 1N7MH 4DVBB 4O4YH 1CFTA 1B88A 1DUYB 5IKCA 4Q6YA 4JCLA 4C54A 3NZHH 1EFXD 1DCLA 1RZKH 2CQVA 32C2A 3BWAA 4P3WA 1J5OH 5EU4A 5DMGC 1K4CB 2FDBP 4YX2L 2P43B 4QRTB 5IWLA 4XCNB 4LK4A 3VXRE 4AIXA 3WEXB 3WS6A 4J7RA 3EJYC 4PRIB 4MVBD 1VFBA 1GZQA 1T2JA 2IBBA 2H26B 4X6CA 1I3GH 4PB9H 4FXKA 1KFAL 3C60A 4PJIE 2NY5L 5DA0B 2BVEA 4QRPE 1F97A 1X6LA 4X9GA 3IDJA 1BJ1H 4WENB 4JDVA 4NKQB 3ESUF 1KB5H 3EO9H 2FECL 3D2UA 5E8NA 4EVNA 5J9PA 1XIWC 3EYSL 1FG9C 3W39B 3ULVE 1IRAY 1OLZA 1C5CH 1ZA3B 1AD0B 3BGFB 1T5WA 5C6WH 4JRYE 3QH3A 2IBZX 1SHMA 4U1JA 2XIDA 4LSUH 5IQ7L 5EUKA 3JTTB 4GBXA 4JFEB 3VD5A 3UJTL 3DHMA 2IPKB 2WLZA 4TSBL 5CINL 1X5XA 1IKNC 3VFVA 1IAIM 1LO0L 2DBJA 1BIIA 3NN8B 1M6OB 1CI5A 4U6VL 1MAKA 1KTLB 1TNMA 3HZYB 4R0LB 4X99B 5GSRB 1VACB 3T0DA 3RZCC 5C0JA 5DDHB 4N8CL 3NCBB 3IFLL 1QRNE 2GQHA 3L7EA 5SX4I 3V2AR 5GS1B 1MFDL 5HDBF 2YK1L 2R69H 4AENA 2BVTA 1RUKL 2I27N 3RTQC 4Y1AE 1KCUH 4IMKC 4CNIB 4TVPE 1N2RA 4ZS7H 1VGEH 2ZUTA 4GKOA 4MD5B 4YR6B 3U1SH 4Y4FC 4O51A 4QHUB 3PWJA 3RWIB 5FA3B 4I3GA 1IM9A 1VEMA 2N56A 3LKNA 4OZFG 3QISA 3WXWH 4EEEA 4C4KO 1KPVB 4X5WA 1FL3B 5A2LH 4UIKH 1XGTA 2ZCLL 1FL5A 4EIZC 5AUMA 4G6KL 3MLRL 5JW3H 1BF8A 4W4NA 3ZTNH 1E4WH 3V8CA 3NACL 1ZT7B 5ELIA 1J05B 5FHBL 1CXIA 1RHFA 4Z7WE 4MA3B 5ITBL 1G9NL 4V1DB 1XGUB 2YXFA 5I0ZA 5EIQA 4OLVH 5E8EB 5L88L 3RNQB 3ARBA 4IOFC 4NKIH 3GO1H 3P3YA 3BUYA 1JE6A 4QTIH 4GO6B 4DN3H 4JHAL 3Q5YA 1J1XL 1CGVA 3PWPE 5D7SL 1YN7B 4LSTH 4RBPK 3GGWB 1ETZB 4P0DA 4LNRA 5GS0C 2CMRH 2CKBH 3LRHA 1EGJA 2Y72A 3R0MA 1KB9K 3RUGE 1A6VH 4JFHE 4YBLC 2AXGB 5FDYA 3DVIA 1S9YA 3QWOA 3EO1B 3KPLB 3I9GH 3GHBL 1BZ9B 2C4FU 1ZGLB 4NKDB 2XTJD 5JHDE 2EDHA 3KPSE 5BMFL 3CH1B 3VFUB 1CDCA 3RL2A 4L4VD 3HMXA 2B4CH 1GVIA 4M5YH 5D1ZD 1DFBL 3PUCA 5HGAA 1FSKC 2HVKA 2IMNA 4CU8A 3CU1A 3WDHA 3MROA 2H8PB 1L6XA 4P2CG 4H5SA 4WEBH 5EORL 5IHZA 1I75A 1U93B 4P4KA 1OARL 2B2XL 3O8XA 5GS3A 1BAFH 4LLWA 1A9EA 2XKNB 2CLRB 5F1NA 1SBSL 1YECL 1VGKB 4NHCH 1ZVHA 3GUTB 5DUPH 1JN6A 2L0DA 3KYKL 3V7AE 2GW5A 1A7NH 1GZPB 5JUEH 1MHPL 1WLHA 1SQ2N 3ARGB 4PRIA 4LCWD 3RAJH 4JQVA 1YY9C 1MELA 1JWUA 1AKJA 4FFWC 3VFPB 1F4XH 2R29H 1A6ZA 3EZ8A 5MEND 3V52L 1HHIA 6CGTA 4NC1E 5C70A 4TUOB 3RKDD 5DR5L 2VZVA 4MHHG 1EO8L 3QHFL 3EYQD 3WKML 3OKEB 3C6SB 5CJXC 2WUBL 3WMSA 1CIDA 3LPGA 1MJUH 1JNLH 1BJMA 1QSZA 3H9HB 4K7PL 4RMRA 3VGAC 4Y4FA 3UPAA 1JUFB 4MNHA 3ZE0E 1KEGL 2EH7L 1AO7B 2DJSA 3ELAT 4LVHC 4P5MB 1FVDB 3ZTJH 1EEYB 3BZDA 4PRNB 2A9NH 4RNRA 4PTTA 5SWSD 3FTGB 3I02A 5FHAL 2F54E 1I85C 5EOCH 4CMHC 4PB0L 3DVGB 4NFBA 1QFHA 3L3JA 2OJZH 4MSWA 5DD1L 3PQYE 2J6EL 1FZMB 5B8CB 3CZJA 5DMKB 4ENED 1KIQA 4JFYB 5DD6A 3HRPA 1T80A 1BQLL 4GRWB 3H3PL 3HPLB 5KOVC 3GMQB 2HT4D 2FLRT 4ZDHA 4HAFA 4H20L 4EN3A 3O2DA 3BEWB 2J5LC 4JG0H 2J7LA 4YPGB 5BS0A 3O4LB 3MRCA 4WV1C 4WNQA 5H94B 2YEZA 1AJ7H 2Z31D 1RIHL 4M4RA 2MWCA 1WBYB 1KIUA 3IKCA 4NUGH 3WS6C 2HFFA 3T8XA 4AH2B 1SYVB 3GSOA 5D2NB 1IEBA 3KS0H 4TUJB 1RMFL 3BH9B 3T77A 5GGVH 4JREB 3VDAA 1U8KB 5EWIL 1H0DA 1FZOA 3MLTA 3OKLB 3RRQA 1QRNB 3LS4H 1U3HC 1BQSA 4L4VB 2HG5B 1T20B 4K3JH 1U8JB 1NC4D 1YEIL 3NAAL 4JB9H 4MAYC 2LE9A 3OAUL 4I77L 4F7TA 2H2SC 1MOEA 3V4UH 2LTQC 1FGNL 1AC0A 2E9WA 2GSGA 4IHOB 3DXAD 3WJLA 3H3PH 5LGJB 1BFVH 2CJUL 5E9DE 2VABB 4TVSa 3VGBA 3L6FA 1XGRA 1I4FA 5MEOB 3FB8B 3FMGL 1QQDB 5DJDB 3V52H 4JY6A 2NY1C 2X89D 3PWVB 9CGTA 3R06A 3TNNA 4QHLA 4PJHF 3MV8B 1FNAA 5KZCD 4KXZI 4R4BA 4XP6L 3T1FB 5J1AB 5DK2B 1ZTXL 3RX7A 1AHWB 1CICA 2CLRA 2FIRT 1JTTA 4FQQA 3AREB 3CNKA 2HT3C 3PGCA 3T4AA 2IBZY 1GC1L 4NQEB 1UZ6F 4KK6D 1IGYB 3P30L 5DVKA 2KZ1B 5C07B 5I8EA 1IAOB 2A74B 4PRID 2EXYD 2V7HB 3RA7L 2FWOA 4PV8B 3MRIA 1ZHNA 1CFNA 1PDKA 2FL5A 4FQCH 4KKLD 4TUOA 3T04D 5BMFH 4HT1L 2XY1A 2A77L 4O2FB 1H3VA 3QCVL 2AW2A 4MA1C 5HDOA 3CVIH 2FIKA 2AK4D 3RAJL 3DBXB 3JWDL 4Z7OF 1LEGA 2APXA 3AREC 1AO7D 1FCGA 1IQWL 4NOBA 3EO0A 4LMQE 4TRPL 2QSQA 5TF1H 3BN3B 1ZOXA 1BZ7B 4XP1L 4E41B 5CD5C 3MA7A 3PABB 3FZUD 1RQ5A 3V9FA 5F6IC 1DZBA 4GBXC 5FYKE 2UVFA 4UAOC 4N9GA 5F72S 4JHAH 3SDCD 4YDKH 5HSFA 1G7IA 3Q3GB 4U1MB 5I8OH 1PX3A 3T0AA 1P84J 1TFHA 1QHPA 1WFOA 3CX2A 3TNMA 3MUJA 1EV2E 2NY3D 1QP1A 4FHBD 1XF3B 4J3TA 3C5ZC 5J8OA 1I8MA 4G6KH 3SO5A 3GFUA 2X41A 4L8SA 3REVA 2ZCLH 4U1SB 1N8ZB 2C3GA 5CEXB 1A6VL 4GAYA 5J89A 5MEQB 4AIOA 4M48L 4MCZA 3QEUA 5HYEA 4FRWA 3IVKA 3ILQD 1U8OB 1X5HA 4GW5B 2NLJA 4KTYA 1OW0C 2BRRL 1A9EB 5TE7H 4S0SD 3MRNA 2CUHA 2GFBA 3P4OA 4U2YA 2GAZA 3RVVC 3M07A 1JN6B 2X4NA 5DRNA 1FNSL 2DMCA 4N8CH 2HFFB 4AH2A 1D5ZB 3SDAC 2WIIA 2KL6A 2GJ6B 4LLDA 4TSBH 5CINH 1U8KA 2QADD 3MJ8A 5AZEL 4G43B 2P8LA 3ARGD 3STBA 1EEUA 4P2QB 2H6PA 4XNMA 1HYSC 3BESR 2Z31B 5FECB 3D3VB 4P9HC 3DOSA 4OLZH 1KJ3L 4Q9RH 4GRMA 5ESAB 1RJYA 3DI2B 4LSSL 1IVLA 2EEAA 3CZFA 3EFDL 4IEFB 4NYLB 4PJHE 4WJ5A 5M94B 1S5HB 2YWZA 1CN4A 2PYEB 5JA8B 3B6SA 1VGEL 3EYSH 5D1XC 4LCWA 1KB5L 2MTPA 3EO9L 4LLYA 3QDJD 4HEME 4MA7L 4M6NH 2JCCE 4FZEH 3MR9A 3UPRA 4DVRH 5D7JA 4PUBL 1T03L 5DJDA 5JIKA 5T1DL 1IGTB 4U6HA 2VAAB 2E8ZA 4ZMAT 1LVEA 2BHZA 3L3JB 1WEJH 3GDBA 1DDHA 3RDTA 1J5OL 1XCQB 3JTSA 4B7LA 1AGEB 5E6YA 5I6XB 3U9PL 3C9NB 3LQMA 2NY1B 3ZHDA 1JGDA 1PZUB 1UWXK 1BFOA 1QPXA 4M6OL 4PJXF 3STZB 1FFPA 1W0WB 1B9ZA 5TE4L 1A7RH 3NIDF 1FORL 2GJJA 1T6WA 1P4IH 3OKMA 1H5BA 4LP5A 2XY2A 3GMMB 1ZA6A 2P24B 4D0CA 4HFWB 2MKWA 3VXNA 2DLIA 3I3DA 1I1AB 3MLYL 4WO4C 3MACL 4P2RB 3QFDB 5KS9F 2WWMD 2P8PB 3GBMH 3ULUF 4M6MH 1QSEB 4NKMB 5JXED 4L3CA 3AMKA 2VDRL 4LFHD 2VDNL 2VXUL 2IEPA 3I3EA 4XPBH 1KB5B 1MRDL 2ORBL 2EDNA 3NZHL 3FT4A 3I84A 5DJ6A 5GISL 4HXAH 4YHPB 4NN7B 5C0IA 3BZFA 1SVZA 4AG4H 1CLZL 2DQEL 4NJ9H 1XF3A 5I1KH 5CD3B 5ACLA 3PP4H 4Y5XB 4PRHB 1IBGH 4JPVL 1ZT1A 1QR4A 1I8MB 3MRDA 4R4FH 3I02B 4OLXL 4NOFA 3TJHC 3IF1A 1BREA 4XB8A 1JPTH 1XGPA 4KROC 5CCKH 5DQJA 4OZGB 3G08B 3HE7A 1UKTA 4WTZA 1N64L 2W9DL 5FCSH 1IC4L 1HH6B 1NGZA 3MUHL 5LBSL 3E1F1 3L5XL 5FGSA 1IC4H 4Y2DA 1CLYH 3DRTA 1FVCA 3LD8C 1WCBA 5C3TA 3TT1H 4LHUG 4Z7UB 5IROA 4XPTL 5E8PB 5FO8A 1F6AA 1P7QA 3TBWB 3H2WA 3LB6D 4X6DB 4JN1L 2CIIA 1H3PL 2NTFB 1F00I 5HHPB 1CXKA 4O2EA 3AB0B 2A6IB 4HKZA 1ZSDB 4HF5L 1S7SB 1D5ZA 2NY4C 1S7RB 3S6CA 1Y6KR 4PPTA 5L2KD 5GGVY 2NY5C 5CFHA 4FQJH 3RU8H 3HR5B 4ELMB 1W0YT 4DUWA 3WLBB 4MMXC 4KV5F 3JVGC 3GI8L 1IKFL 4PJ8A 2WIIB 4G7YH 1UACL 1N4XH 4L1HA 3QEQE 5JO5A 4I0PB 3TH2T 1IGCL 1Q0XH 4NRXB 5D70L 5DT1H 1HKLH 5LAXA 5FAAA 1H9VA 4MQXC 3H6JA 1S9XB 1HOCA 1T0MA 3ULUL 4OF3A 5EH1A 3MGOB 2AJXL 3F8UB 1P7KB 1SEBA 2MSPA 5CGMA 4P2OD 3KJ6H 1G7QA 2ZZUT 3SDDC 1QNZL 1B0GB 3VG9B 3E6FB 3CFDB 2ESVD 4LL9A 5KSAA 4JFFE 2VWEC 4TSAH 3QJHA 3R06B 2OZ4L 4HV8A 1LO5A 3TESA 5FYJD 4LPUA 1CBVH 5C07D 3KS0J 3T4YA 5TDNA 1DQLL 5CMAB 3AREA 4OZGF 3VMOA 3SDCA 2NY3B 3VFWA 3X3GH 3MRMB 1S8DB 4WI9A 4ODHL 4DVRL 5DHVH 3O6FC 1NAKH 1L0QA 3ZDYF 3X11B 4FZEL 3I50H 2GY7B 3QNZA 3ARXA 4X9IA 3KLAB 1JZ3A 4UZGA 1B2WH 3Q6FB 2A1WL 3PWLA 4QHKI 5D93B 1MJ7L 4MNGE 4YEFA 4NP4H 4PG9A 5IB3A 4G42B 4Y5VB 4R97B 1HEZA 4BH7B 1HXYA 4M43H 2W91A 3MRCB 5L0QB 1T66C 4NQCB 1BWWA 3IDIA 2BJML 1HILB 5AZEH 5DJ0A 4XNYL 5J6HB 4HUXA 1I9EA 3EO0B 3SY0A 3IU4L 5E5MB 3D0VA 3B2VL 4NT6A 1U3ZA 5IMMA 2JJVA 2WMPA 4O00A 1Y0LB 4OZHF 1H0DB 4PRPB 4PRDA 4JREC 4MQ7B 3C08H 4KRPC 4D2NA 3DV4B 3FT3A 4LF3B 4O2CA 4HWEH 2VN4A 3B6SB 1J1PH 5JR1L 4XP4L 3QUML 4CL7A 1HI6A 4LLYB 1G7MA 1F4AA 1HIML 1BX2A 3PWUB 5HYJB 4KKCD 2YPKB 1QRKA 25C8H 1OAUH 1J10A 4EDXB 5I1GL 3QWQB 3N1GC 4O5LL 4OZGA 2QTEA 1AGBB 1ZHBA 5FKPA 1YEGH 1DQQA 1SJHA 2WBJC 2YPVL 2GJ6E 5EOTA 3MLUH 1S7XB 4JY6B 5GHWH 2BFVH 2V5SA 3L3OB 3WV0A 2FATL 4HS6B 5K9JH 4GQ9H 3QA3A 2I24N 3WFCL 5KG9B 4JFXB 4Y16A 4L8CA 4ZD3H 2DOCA 5HHNB 3J7HA 2CIIB 4I4WA 4W4OC 1YQVH 3RWDA 1FL5B 5KS9B 4IRJA 4N1CA 4K8RC 1LEIA 4S1SL 2X4SB 4I18B 4F57L 2N7AA 4QNPF 5ICZA 5CJ5A 2MJWA 1ZV5A 5D5MA 1X5ZA 3TWCH 3ARDA 3BO8B 2V17L 5J12C 1T22A 3VFSA 5CP3H 3UJJL 3ISWA 2ZNWA 3BW9A 2HN7B 4R2GC 5TE6H 1GHFH 3VGDA 3VGEA 2H6PB 2R39A 4XNMB 1INQA 1KC5H 5I15L 4HS8L 1CFVL 2ITDB 3KPQA 4Z9KB 1UA6L 2J12B 1RUMH 3U0WH 5JIHA 4Z7QF 3CFEA 4FQIH 4XXDB 3BRGC 4JO3L 4PLKC 4DEPB 1WC7B 3ZKNC 4P5TC 1EMTH 1D5IL 4MX7B 3WIHA 5KSAD 1LO5B 1ZA3A 1OQXA 1MJ8L 1MCEA 4ZFGH 1NFDA 3EO1A 5I1CH 4HPOL 3CFDA 2VXQH 2BMKA 5IW1B 3WHE1 2ZOKA 3RGVA 1E28B 3VFWB 2NR6C 5GPRA 1FC2D 3NTCL 3L3IA 1NGPH 1ZTXH 2IG2L 1V3KA 4XNUL 4DGYL 1MPAH 1RULH 1S7UB 5D2NE 4HMEA 1OP3K 2HRLA 3TO2B 2ATKA 4EKXA 4KMLB 4ODTL 3W9EB 3NA9H 3TPUA 4M1CC 5ALBH 1NJ9A 4PJEF 2CO6B 3HPLA 3DX9A 2H9GA 5KVEH 3MRKA 2CJUH 4JFZH 1PKQB 5FM5M 4RAVA 3OKYA 4ZPTB 1YPZE 4D8PB 2ZOLA 2ATPB 4Y1AA 4GRWE 4H25A 1YEFL 5C0BE 1G0YR 3UZVB 4I0KA 1ZLWH 1I9RH 3K3QA 1U8IA 5IB3B 4X5WB 5GGQH 4G9DB 1EJOL 2VAJA 5FKAA 4EI5A 3RPKA 1NDGB 1AQKL 4W4OA 2G5RA 3GRWH 3MV8E 4KK5C 1BBJA 4TPRL 1CVRA 3TA3A 4M00A 4Y0GA 1LK3H 3RIAK 5FYJH 3TYGH 4IRSB 4XNZB 5BJTB 1U8JA 1D3CA 2UYLB 3SGDH 3U36B 2YR3A 4PJ8C 2GCYB 4YZFF 1UWEH 2VE6A 5GGQL 3UX9B 1QFUH 1M71B 2DQDL 3VCLB 1JPSH 5IEHA 3VXUE 4GRLC 1JYXA 3K8MA 4XMLH 4N0RA 2R56L 4AEHL 4G9FA 1ACZA 4MJ5A 3Q2CA 4IHOA 3U6RA 4NHUB 2OQJB 4DWHA 1NC4A 1VESA 4J1UA 2LQRA 4CVZA 2Z93A 1QBAA 2ED9A 1JP5A 2UY6A 3OL2A 2WV3A 1TPXB 1W8NA 4MXWH 3WFEH 4JHWL 2EZ0D 5CBAB 2BSRB 2Q6WB 2QKIA 5SWZD 3NTCH 5D5MB 1ZLUH 4G6MH 1ORSB 4WNQB 5H94A 4YK4B 4P57B 3BO8A 4R0LA 3I75A 4EBQL 2VH5H 1OCWL 2BOBB 2VLKA 1OGTB 1OAXL 2LVCA 3GSOB 4OCWH 2IAMA 2OTUB 2IQAA 1R3LA 1HN1A 1MJUL 5T1MA 1MJ8H 2CR3A 2NZIA 2NXZC 1UG9A 1AR1C 3FJTA 3FFCE 1EO8H 3QHFH 3V6OA 4K7PX 5DJYB 4OFYD 4P5KA 4FQIL 1RIVH 4L4VA 4I2XA 3RTQA 1N26A 4NZDA 5ABDE 1F6LL 1NCDH 2R1WB 4NO3A 4RAHA 4KZDL 3ZLQC 2CKBA 4FN0A 4HK3J 1WTGT 2N7BA 2E7CA 5JXEC 4ZUTA 3UJJH 3UTQA 2FSEB 2F53B 5GS2H 3C6LB 1AE6L 3QFJA 2PW2A 4X4YB 4G6ML 5FOBB 3P0YL 1XGUA 5KOMC 1X4XA 1WBXB 2VZ1A 3DNKA 3NCCB 2F53E 2GIYA 4PRBB 1BFTA 5T1KB 4WUUA 1ZWIB 3GZKA 4ZUVB 2XFXB 4JCMA 4ZYKA 4XPAL 3VWKD 4WU5A 3QQ9C 1N6QH 1PGRB 5LWYH 3QDGD 4X5LA 3GSRA 5I19H 4PBWD 3TIEB 2R56H 3T0BA 1FO0H 4U1SA 3MXWH 1HH6A 3S9DB 4JRXB 4BFGA 5C0JB 2CH8A 4HLZH 5FYKU 1SM3L 1T7VA 4JFHD 3DURB 3K0WA 3QQ3A 3CFBA 4M7ZC 2YRPA 1TZGH 1QACA 2EIEA 4GLRH 5J6GB 4Q74A 1RY7B 4HWBH 2AQ3A 5DLMH 2HH0L 5FYLE 3FL7A 5B39B 1DBKL 4N0CC 1RUQL 3MYZA 5DJAB 1I8LC 4ACPA 4XI5C 4JFDE 5DUML 1RZJC 5DEGB 1LNUA 1MCOL 1XR9B 4JHZA 4ZSOE 1XFPA 1ZXQA 4MCYA 5IK3B 5C0ND 3PGDB 1U42A 2IAND 2QSTA 5D1ZA 4XNXL 4Y4KC 4L8DA 5L2JB 1I7ZB 1R24B 2BNUB 2XWBB 3MLRH 5JW3L 1JGUH 1QRNA 4NNPH 4Y2DC 4PJ8D 4WWID 3U7WH 2EDEA 2R8SH 4Y4HA 3P9MA 3EHBC 2EDYA 2VE6B 3U46A 4GKZA 2DMBA 4I0PC 5T3ZH 4L29B 4PJXB 4LCWE 5IBUG 5C0CA 5DEFB 4M8VA 4F37F 2VL4A 5IB5B 1N5YL 3CH8A 1R0AL 4L3EA 4UV7H 4HMDA 5F8RC 3M17B 4HC1L 2R69L 1MFCL 2P5ED 2DQCL 5GRVL 4IM8A 1E0OB 3WHXB 4WWKA 1KTKE 4HUKB 1EEZB 1DDHB 1KCSL 5C0DB 2AEPL 3VWJD 4PJIF 1BVLB 5IVXA 2HKHH 4MAUH 1EGJL 1JWSB 3GIVB 1OGAD 1AXSA 2ZUYA 1CBVL 2EZ0C 4YEEA 1NJ9B 1TQBC 2GITA 4CU6A 4GT7A 4P2QE 3GIZH 3HC0A 4L9DA 3AS3A 4UTBH 2NY0C 5C1MB 1FNEA 1Z9LA 3LQAC 3ARDC 3MFFA 4HUUA 1QEWB 4I2XB 5E8OB 5AEAA 4H26B 3HHRB 5GRUL 5T1MB 5T5NF 5C2BH 2XI9A 3FFDA 2ADGB 3CXHK 2ED8A 4PGCA 5BVJB 1HWHB 4BFIA 5GZOD 3HZVB 3HG1B 1XIWB 3VRIB 3GMPA 1NL0L 4P5KB 1I1RA 4WUKL 3BGFC 2R1WA 1QFWI 4NO3B 5IJVA 3NIFF 1PQZA 3CX5K 5CP7B 3O45A 3QI9B 4HC1A 5E5MA 1BOGA 3FT2B 3RY6C 5GGTH 5HD8D 1NMCB 3NH7L 3CPLA 1D5BB 1I3RA 4ZQKA 2R4SH 1P5VA 3VFRA 4PJBA 1S9WA 1PEZA 4CMMA 3VCLA 2AEQH 5D7JC 4P99A 4LVEA 3MRQA 4LIQL 1YUHA 2AXHA 4IRSC 5FF6B 4RMTA 4RFNB 4RCAA 4LLQA 2X1QA 4QRPD 1XZ0A 1R3JB 3ME0A 4PGZA 2AV1A 2QJDA 1F4WH 1HHGB 4QRPB 3VU2A 3U30C 4NHUA 2DRUA 2E9JA 4LPWA 5DMIL 4XPTH 5ITFA 4JY4B 4R9HA 3MRDB 3KXFD 5BQ7A 2QSVA 4OLYH 5J1TC 3FQUB 3LKSB 4JFPB 1J0ZA 4PJCE 5I1IH 1LE5A 3CU7A 2AXFB 2DDQH 3OKKB 5TDOA 5EO9B 5E2TH 4OI8A 3I6LD 1OD9A 4YDVB 4QXUL 3RWJA 3KPNB 3QDAA 2F19L 5IROC 3B9KB 3CDFA 2EIZB 4JZJB 5ERWB 5IMOA 5GIRA 2XT1B 5D2NC 3KPRB 4BQ6A 4ZUSA 4YPGA 1YNKL 2HFGH 5BS0B 1KJ2B 3SDAB 1A6AB 5KZCB 2Y5EA 5IB1A 4PLOB 4G8FB 2ZCKL 3GM8A 1J0JA 4F2MB 1YN6B 5GGTL 5ISZA 3L5IA 4D0DA 4LSRH 2XWTA 2DN7A 3O8XD 3QPXL 2KZWA 3EOTL 3NFPB 4F80A 3CCHB 4IRZL 4B41A 4G6FB 4LNRB 2XA8L 3SOBH 2VZOA 5C6PB 3SE4A 1P7KA 1B2WL 1SEBB 2GSIA 5F88B 3AGVA 1T5XB 3C6LA 4AIZA 1DBBH 4GRMB 5B4MD 4I0PD 1E4KC 3FAWA 4K94L 4DJMA 4PJ7F 5HI4D 5I8KL 2YD3A 3NGBB 5HJ3B 4WWKB 4LCWB 1EZVY 5ECJE 3C6LD 1FVEA 1I7RB 1DQLH 1XGQB 1G9NC 1A6UH 3TZVA 3C60D 4P2QD 1BQHA 4NSKA 2HLAB 1OB1B 3U9PH 1FE8L 4CRPA 3IXTA 3GMOA 2OS7A 3MJ7A 4RGOL 1FE8H 1GIGL 3MROB 2R2HA 4ONHA 2X4QA 4XMPH 4I5BA 1G7HB 5C09A 4TSAL 4UV4H 3MRMA 5I75B 1K5NA 2AEPH 4HKZB 5CGYC 2EC9U 4BSWB 2W9EH 3KPOA 3V5KB 5GRXG 2P49B 1S9VA 3QG7H 4KJQC 4HKBA 5I1DA 3SDCB 3TGXA 1R3LB 1MFCH 3RWEB 3NIFE 1ZT4A 3GMPB 1VADA 5FM4A 5MENB 4CADA 4ZAKC 4WI6A 1DQJB 3W0WB 3HR6A 3REVB 5ACMA 3O3EA 2GYSA 2XA8H 3IS0X 4KJWC 1NPUA 5HHME 4Q9RL 2PUQT 3LN4B 2NY2D 3NCMA 3PGDA 2DM7A 4R26H 3DRQB 5KW9L 3KR3L 2H45A 3L95A 4JGJA 4PGBB 1N59A 5CEZE 1U95A 2G60L 5EDXA 1H3WM 3I85A 1KELH 2VLLB 1BOGB 3FT2A 4U6YB 4FA8A 1HH9A 1WBZA 5DJZA 4HKXA 1OAYH 2QQNL 1TJHH 1I3RB 1Z3GL 2JIXA 2AXJA 3LDBB 3OAYH 1IQDB 2PR4H 3UJIH 5BOPA 2JELH 4RNRB 1RK1A 1SMAA 3CDGA 4RGMC 1DUZB 1UB6A 1KIPA 4FQ1L 1HXMA 1U3HD 3OGOE 1JGEB 1WWWX 2X70B 1P5UA 3F7VA 1CFQA 5IVXF 1J1OL 4AM0A 1BLNB 3FB5A 3O4OB 5ILTL 4KTEH 5CCKL 2X4UA 1S7XA 4YDVA 5FUOL 1WZ1H 5EUOE 4OLXH 3ZKXC 2YUVA 4ZDHB 4PTUA 4JQXA 3UTOA 1U8PA 1U3HA 3W2DL 1AGBA 1M7IA 1SEQH 4FQ2H 4H88H 5GQBA 4JFXA 4JRYD 5IIEA 5HYSA 5F3HB 3EJZC 5CSZB 4Y89A 4EDWL 1OSZA 3ZKMD 4AG4L 2ICEA 1ND0A 1C08A 1DLHA 4V2CB 2W59A 1A1OB 3VWJB 4ZO8A 3ARFC 2IANE 2IANA 3I2CH 4UTAH 1N5AB 1U2CA 3EIFA 2VDRH 3BQUB 4HUVB 1D5MB 1B0WA 1G1YA 3Q6GH 5ERWA 5C0BA 1SJEA 1RSFA 3C2AL 3IT8D 1MVUA 5C0AA 1BD2E 3L7FA 2JB6A 3DX6B 4WW2A 2Y1VA 2Z8RA 5EFIA 4YNYB 3EYVA 2AJYH 3MNZA 4ODWB 2EH8L 5DF0A 5T3XE 5ICZB 2H32B 4G8EB 3VGHA 3QHZH 2HT3D 5KTEL 3KPPA 1QVOA 4UB0H 2VO5A 4LQFH 3VH8G 3ARPA 4Y4HB 4JZJC 3CVIL 5IB2A 3O45B 3QI9A 4OF0A 1JF6A 2VERN 2ICWA 2MPAL 3C60B 5GRUH 1E4KA 3FQTA 3KPRD 4POZD 3OG4B 4EJ1C 4KJPC 5K9OA 4KUZH 3QFDA 3RA7H 1E4JA 4Q0XH 1KBGL 4HQQL 2F8VA 3GMOB 4OM1H 1CT8B 4MX7A 2A38A 4HWNA 4FQLL 1W72A 1WBXA 2M8XA 1LMKA 4EBQH 3MV7D 3QH3B 1NSNL 3O3AB 3L3OA 3NCYS 3PDDA 4NWUL 2XZZA 2G2RA 2DQCH 1YEDA 1B4JH 3N1PC 5K9QG 3FRUB 4UT6L 3O6FA 2Q8AH 3OXRA 3S3SA 5CGYD 5E9DD 2RHEA 3O3UN 1A6TA 1LP9F 3KHQA 4LSSH 4XVJH 5DQDH 3BXNB 3SGKA 4NRZA 1IC7H 4PJEE 1IGJA 2B4CC 4AEHH 4Z7WB 1JGVL 4WU7A 4NN7C 3KYAA 4RFNC 4NNPL 3QIWD 5E1AB 4PJBF 5EBMA 4XCCL 3L5WB 4YHML 3BIAX 5EU6A 4N0CD 1I1AC 4LDEB 2FZ3A 2OL3A 4MWFB 4NQSB 1RK0A 1J0YA 4HXBH 5L9DH 5DS8A 2YBRB 4U1NA 5TFSL 1QBLL 4J6RL 3U4BH 3T0ED 1PW3A 4XH2B 4KPHL 3RNQA 3O6KL 4M7ZB 5EU6D 4WFHE 3TYFB 5FYJL 1LK3L 1UJ3C 1J8HD 3QIWA 4WFFE 5IF0A 1MY5A 1NCUA 3WO3B 3F58L 5J06A 2FD6H 1JZ7A 3OJDA 3QULA 4XX1E 3BVNB 5E8EA 1DUZA 1UB6B 4JANA 3SPVB 3P73A 2MCPH 4LPXA 1WGOA 3GSUA 4NBXB 4UOW1 1EJOH 4JRYA 5B21A 3EHBD 4HS3A 4PY8J 4LP4A 1MUJB 3LKQB 3FQXA 1I9RL 3NA4A 4YQXH 1MIEH 3LD8B 5ITFB 4ZSOA 3D3VE 3VRLF 5HVHC 4Y4KB 3G9AB 2ATKB 3FZUC 5T1LB 1FO0L 5J7CC 1CZ8H 5BW7A 1T1ZB 1ZT1B 1NGYA 5DZLA 4ZTOH 2WZPD 2APVA 4GAYB 4PS4L 4J3VA 3AB0C 1QBML 4PJ7B 3NA9L 5C09B 5GJTH 3GSXA 3THML 4O9HH 4N5ED 3WJJC 1CL7L 4WDIB 5FHAH 3SGDI 4L3ED 4J4PA 1NLBH 2PO6D 3BEVA 4I48A 4HHAB 5CBAA 3OXSB 2BXYA 1R6VA 4HV8B 1FFNA 2A9NL 2C3VB 1KPRB 4ODXB 1T7ZA 3RWGB 1JPST 4OIBA 4BQ9A 1WAAE 4H1LH 4PJCB 2WINA 4NNYA 2NY0B 2VLRA 2XZQH 3P9LA 5TF1L 4OGYL 3EYVB 5E2WL 1S3KL 5TQ0H 4HX1B 1FHGA 2I60H 2QBWA 3CVHB 4ZFGL 3FRPA 3QXAB 4NDMA 4BQ8A 4GXVL 3PQYD 4JJHA 3A67H 3MLWH 4NQXB 2ADGA 5KANG 5BVJA 2ITCA 5H37G 4HT1H 1GZPA 5IM7B 1QVOB 5FA4B 2B7DT 4X8XA 2ZUQC 3ROOA 1YMMD 3B3IB 4MJ2A 4YDLB 3UC0H 3KDMA 3WIFB 5D96B 2B1AL 4U0QB 2WUCL 5F96H 1DVFA 1ADQA 1F4XL 2R29L 2VZ3A 3V6ZB 5IEHB 2OR8A 3O2WH 5DSCB 1Z9SA 2AK1L 3LVEA 5EB9A 5TQ0L 1JMXA 3TBSA 1HYRC 5D7JB 5SWSE 5T1KA 2O5YL 4AL8H 5DVOA 1F3JA 2I26N 2EXWC 1PD6A 2W0FB 3O6FB 2UWEA 3VXSE 1NGWB 3OR6A 2PKDA 1MQKH 4UI2A 2UWEF 2HVJA 5IEKB 1C5DA 4GUPA 4RGMB 4GQ9L 3PV6B 1FLTX 5EOQL 3L5HA 1BFVL 4EN3D 2F8OA 5EBLB 2W07A 4M3JA 4PY7B 1VFAA 3WNKA 4A2MA 2IAMB 2R9HD 3CSBA 3KXFA 2CIKA 4PG2C 3ZL4L 3NPSC 2R15A 3W9DB 1DN0B 1EHNA 4O5LH 4YGAB 1QFUL 3FO9A 1PG7L 1Y18A 1MI5E 2OMNA 2EYTA 4KHTL 2E6JA 1RZJH 2PXYD 3RFZC 3S4SB 3BOVA 1M7DB 3BKCL 3P4NB 5CZVL 3QUMH 2RQ8A 1BJ8A 2R0KL 4GH7B 3F58H 1LEKA 5GGVL 3WE6A 4XWGH 5DD0H 5ESQB 3DTXB 1CCZA 3CMOH 3AM8A 3O0RL 2ADJA 1U58B 1PY4A 3DGCR 4NUGL 4CN4A 1JRHH 4DKAA 5JQ6H 4OJFL 1XCTB 3K8KA 2BNUA 4OCXL 4YHPA 5TFSH 1ZLVK 1F8TL 1MWAB 3IU4H 3MZGB 4MAYD 3T0XA 1CD1B 3OKNB 5LXGH 5I16B 3OKLA 4OZHA 4WO4D 4WUUB 1T83A 4KUCD 4JFFB 2HTKC 4F7CA 4C59B 1DTUA 4IJ3C 1NGYB 1MUJA 1NANI 3M8OH 1B3JA 2KBGA 2HP4A 1OP9A 4J2XA 3SKOA 2RGSA 1RFDH 2ZPKH 4X7SL 3O41B 1MY7A 3SDXB 5K59F 1HI6B 1YYML 1BM3L 2A9MH 1GL4B 2IH3A 1KENL 1RUKH 4D9QE 3I50L 3P77A 1O7VA 4QGYA 4DGYH 4RFOH 1PG7W 4BSVA 1F3DJ 5FYLH 5D6CA 1JPFB 1MCHA 1CDYA 2NY4B 2VLRB 4M8QB 3IFOA 3CLFL 4Z76A 4QXTA 4ZXBA 3ES6A 1RVFH 4GKNA 1K6QL 2X89A 2X2YA 4B0MM 1V8HA 2V9QA 4QF1A 4F9LA 4OSUL 5IFHH 2I9TA 2DLEA 4K2UL 3VI4E 4JFQA 2ZKHL 1FO0A 1JWSA 3GIVA 2P5EA 4QYOB 2I9LA 1QEWA 2X4RA 2OL3H 3T4AB 2D0HA 3HN3A 5FA4A 2AK4E 5SX5K 3B83A 1C5CL 1KXVC 5I8EB 3O6FD 1CFVH 1QFWH 3RUGF 1DQDL 2AJXH 1G6RA 4K3EH 1F58H 3KNBA 4URTB 1JIBA 2YSSA 2C7UB 5DT1L 5GS1C 1I3GL 2CKBB 4PB9L 4PJGE 4XNQB 3QAZC 1DVFB 1SBSH 5F89B 1V7NL 5DEFA 2ICCA 4HBQA 2VC2H 2P5WB 2E7HA 4GBXD 2IAMD 3Q6GL 2NNAA 3VXOB 4KK8C 1KTDA 3A6OA 1PX4A 3NCJH 2YPLB 4E5XA 4L8SC 1CL7I 4M5YL 4DGVH 1J11A 2FNBA 2D03H 2JB5L 3FFCB 1EEZA 4F9PC 5K33A 2AGJL 3ZE1E 3I6KB 5GHWL 4F8TA 5C92A 3IETB 3HNVH 4IOFD 1EVTC 4IBLT 3SE8H 4NCDA 2HRPL 5IHUH 4JFPA 1S7TB 4I1NB 3T2NH 2DBLH 4U1GB 2IADB 1BJ1J 3TIEA 1JI2A 2VMFA 3OKKA 4QRPA 3EFFB 3QNYB 5DDHA 25C8L 2QL1A 5LBSH 4YFLF 1UB5A 1HIMH 4LHQB 4IOIA 2CRYA 3FQUA 5D7KE 1ZEAL 2YWYA 3BMWA 4OCNC 1ZGLA 5HVFB 2OQJA 1RZFL 3LEVH 4PJCA 3TO4B 3KYNA 5E2UH 3MRNB 1CE6B 4ODUA 2IALA 4XTRC 3HG1A 3K46A 2MHAA 5MENE 2CRIA 3ET9F 4OCMC 2Y23A 3ARFD 3WS3A 1FH5H 4LSVH 2VDLH 3PP4L 5DVLA 1MNUH 1JI1A 1CLZH 1E27A 4QXWA 3R1GL 3NACH 4U1GC 1Q94B 2E9IA 5SWZE 5JDSB 4XPBL 4YNYA 5EU7C 4MAYA 2B20A 4BFBD 3L3GA 1MCPH 3WSQH 4PREB 1WITA 2LU4A 4ZUSB 2EO1A 1OTUD 5JPNA 3K4DA 4ZO7A 4HUWB 4JPKL 3UTSD 4M6ML 1T20A 4BM7A 3TO4C 2GSIB 1EVUA 4HS3B 4J23A 5AZ2L 4K9EC 1R3IL 2HWZL 4MXQD 4FFZL 2H26A 4X6CB 4ZS7L 4F15C 1FG2B 1D6EA 4LRNL 3BPOB 4GRLB 3KLHD 1KCUL 1MLBA 3MBEB 3U79A 4EIGB 4K8RH 4NJAH 1LO3H 3FN3A 4IS6B 1MFDH 3UPRB 1E6OH 1CQKA 3IFLH 3D48R 3SBWA 2F53A 4HIEA 3V6FA 1WF5A 4YHNB 3WIHL 3SDDA 2M1KA 1UXSA 4MGXA 4U49A 1VFOA 2BNQE 3VFVB 3OSKA 3G5ZB 1FO0B 1QUNA 3WIIL 2A0LC 1S5IH 3AC0A 3JWOC 1TVHB 1QO3A 3G04B 4RMUA 1J88A 4CBPA 1KULA 4HW6A 2JJSA 3W0WD 5C07A 1DQJA 1N2RB 4K94H 5EUOF 4JFDA 4NJAL 1OSPH 4U33A 3EDDA 4MA7H 1JHKL 4I0CC 2Z8VC 5SX5H 2XKNA 1P1ZA 4KRPB 4WW1A 1A5FL 3MREB 3QDHA 4QHMB 3RX8A 3B3IA 1MQ8A 3EOTH 4ZFOB 3K1KC 4HUMB 1WIUA 4QHNB 4APQA 2J8HA 5F9DC 5CHNA 5FK9A 3RGVD 1WFNA 6FABH 2P47B 1SYSB 4U1IA 2CK0H 2VQTA 3GK8L 4Z0XB 4BZ1L 4NQCD 2E7LA 1CD1A 3OKNA 5I71B 5TPWH 1KCVL 1T5WB 4X6DF 1D5BA 4ZQKB 1NMBH 4P46B 2VXSL 4FQHA 4Y2OA 5FIEA 3JWOL 4XRCA 3GI9L 1OB1A 1MAMH 1UZ8A 35C8L 1LO3L 3G6AB 1I8IA 3TJHD 4YWGL 1NFIA 3LRGA 3ZDXF 4WFGD 4NPYB 3TNMB 3IRPX 1YEKH 5J0BA 5FGBA 3NABL 5DVNA 3UTZB 2GY5A 4M61B 3TPUB 4OUUA 2DICA 2DMKA 3S37H 3SKNB 3R4DA 4FZ8H 4ISVA 1ETZA 3JV5A 3S34H 3PP3K 3T2NL 4FNLH 3T2QA 5IIEB 2H2SD 4MNQB 1JHTA 2DWEB 5DRWB 2ATPA 4XHQA 1IAKB 2PO6C 4UINL 2BNQD 1QFWM 5FA3A 4G8IA 3F5WA 4MNQE 2VQ1B 5C07E 2KQNA 1KF9B 1UH2A 3UTSE 1G6RH 1HNGA 5GIRB 1S7SA 2L4OA 3OMZA 4HZLB 4L4TA 4ZODA 4HWZB 1A6AA 2Y07L 3MRLB 3SCMC 3QQ4A 2A74A 5C8JB 4M7KL 3QNXB 1UWGL 2DM2A 1QZ1A 1I7UA 5EIIB 5IM7A 3AS0A 1F58L 2HJLA 1U91B 4HUWA 2VIRA 5ANMA 3SEPA 2GJZA 2CPCA 1KGCE 1FORH 3ARWA 3DARA 3U2SA 1A7RL 3FONB 3KDMB 3UBXI 5IVZB 3WIFA 3HNVL 1Q1JH 5E08H 2ILLA 1W72L 1FNGA 4QO1A 5IBLD 4PYHA 1MIML 3OKEA 3G5XB 2YC1A 3GSQA 4YGVA 3QRGH 3U7AA 3VXUA 3C8KB 3U46B 2ZKHH 5HGBB 4K2UH 5C9JB 3D39D 5I9QB 1LGVA 3PGFL 3O9WD 3ZDZE 4OSUH 5JW4R 3JVGA 4LLUB 4PRAA 5D96C 4CGTA 4WHYG 4HG4J 1REIA 2YZ8A 1U6AH 4H0IA 1X5IA 4RFEA 5DGQA 3FB8A 1JHLH 3ROLB 4UUJA 4PGEA 3BE1H 3HMWH 4PJDA 3VI3E 2G75A 5KN5B 3U0TA 3UPCA 4RFOL 2BVOA 2K1MA 5LQBH 3QNYA 3MV8A 4HC1H 2BX5A 1KENH 4ZAKD 3MGTA 3TVMC 1QFWL 3F7YA 2KPNA 2V2WA 1MHEB 3ECBA 2CD0A 3MV7A 4Y4FD 4QRUB 1ZK9A 3O4LE 3IAPA 3OAZK 1BFOB 4W70A 5I9QC 1K8DA 1DN0A 4OKDA 1HE7A 3H0TB 2MCG1 3MQIA 3TBVB 2ERJB 4C55A 3U7WL 4OFPA 4ZOAA 5EU5B 2Y25A 4QRSA 1JGUL 2C1PB 4JZNA 1I1YA 3BGMB 4LAJH 3LRSA 3EJYD 5JOFB 2R2CA 3BZ4A 1MVFA 2FJFA 1RVFL 3CSYA 1ACYL 1DBJL 4XAWL 5DK0B 5F89A 3BEWA 3TJEH 2Z4QA 3LEYL 5JIPA 4LBEB 2FZ3B 2F54B 2OL3B 1OM3H 1X5LA 3FQWA 5GRJL 1MCOH 2AAVA 1JYNA 2E7LC 3DECA 3ALPA 5B3JE 3K8LA 1I8IB 2YD7A 2EE9A 1UCBL 5JOPE 3WLWC 1YYMH 4J8RA 1PZ5B 4PJ9C 5DFVD 3BKCH 5DHYA 5FOJA 1G7MB 5HHXL 5DZNA 1FLRH 3T2PA 1ZHKB 2XRAL 1HKFA 3CCHA 3N9GH 4H0GA 3LEXA 5I0DA 2HJKB 3UTSA 4G7VL 1RJZB 5D6DC 5HDQH 3ZL4H 4DKFH 1VEPA 1T1YB 5FO9B 2NXYD 4PTTB 3WBDA 1M05A 4Y2DD 4TUKH 3IFPA 1Z5LB 3CFKB 1MCDA 2QADB 4YHOL 5MEOA 3NCEB 1MHCA 3Q5OA 5LWYL 4PR5A 1ES0A 1T2QL 4NN6B 4JZOB 2P48B 1A9BA 5DVMA 3DV6B 1M1SA 5IB4A 4JM2F 1U8PB 3A0OA 1OAQH 2XTJC 3VFMA 3ARUA 1NAMA 5J1AA 2EDBA 2R0LL 4LVOC 5IUSA 2Q3ZA 3BP5A 4GKNB 1CDJA 1XR8A 3BI9X 4Q6IB 2R0ZH 2ICWJ 1U36A 4LPVA 1EHAA 1GPOL 4TRPH 3UTTB 3RWGA 4TSCL 3T1FA 3LV3A 5E6IB 1U2HA 4IDJL 1CGXA 1KGCD 4GKSB 4R96B 5D5ME 4ORZC 4NQXA 3L3GB 2HJLB 1A0QH 2WBWB 5GGRA 5C3LD 1YY9D 4QRTA 2F5AL 4RMWA 2ITDA 4KZDH 2FRGP 5D7IB 1UH4A 5I18L 3NCYP 3UC0L 2XXMB 4DAGL 3X3FH 1EZVX 2YD6A 3RWCB 4GS7C 1KLUA 1J0KA 3WNOA 2ITCB 1UVQA 2YPLE 4M1GL 4TQEL 3D25A 3DBXA 3L1OH 4OCYL 4X6FB 4JGMA 4JFDD 1BF2A 3C8HA 4K7PY 2X5PA 2I60L 5J9PB 3MJ6A 3TN0B 1OAXH 1MHPH 1QSEA 1B0GA 5F88A 2EDRA 5DUPL 5DJ8A 2DM4A 3S3JA 5JW4Q 1I3VA 1UFUA 5I74B 1INEH 5GRWA 2LABA 5I71C 1FNFA 3QUZB 4AQ1B 1WV7T 1HWGB 2I5YH 1H3TA 3HUJA 1ZLWK 4EVNB 4XP6H 4RWYL 1DBAL 4PRAB 1RHHA 3QEGL 4F33A 3TO2A 4HHAA 2O5ZH 4U7MA 2FCBA 5I75C 4OIAA 1M4KA 1GGIH 1F90L 3CXDH 2B1AH 3QCUH 3L3IB 4NSKB 4E42A 1UXWA 5I2IA 3TLRA 1TVHA 2UV3A 3G04A 4IIQC 5EBLA 4P23B 5GRZA 4YHIA 2D9QB 1GC1C 4DQOL 3VDBA 1A6TB 1CR9L 3KYMA 4JR9L 3TZVD 3JTSB 1XCQA 1FFQA 3HE6A 5MERA 3QUYC 4H25B 4G8IB 5TDPA 1MIEL 3H3BC 1WCBB 5FFLA 2BNRB 2DQDH 1UM4L 2Q7YA 3NAAH 1KCRH 4TSCH 3T0EC 1F3DH 4Y5YC 5FKAB 5EBMB 4Q9QL 4NQCA 2HT2D 2KQMA 3Q0HA 1S9KC 4XHJD 3QR2A 2NXYB 1Z0MA 2A6KB 3BZ4B 3CSYB 3SCMA 1HHHA 4QTIL 4DN3L 4YDJB 4I9WD 1NBVL 3SY0B 2UZIH 3QUKA 1IGML 2V2XB 5DD5H 4ALAH 3O4OC 3FQWB 1KPVA 4FTVE 1HHJB 1DANU 1F42A 4L3AA 4Y19A 4OLVL 5FB8A 1E4XI 1AJ7L 3EDKA 5AG9A 1T2QH 4ODVH 4HLZG 4HXBL 4LCUA 3WL9A 5JORB 2Z35B 5JNYA 1YEFH 4F7CB 1DLFL 3L3HB 2CUIA 2AV1B 2CK2A 3H9YA 4HPYL 5F9JB 3SKOB 1MHHB 2ZUVA 3HZMA 3VXUB 3FQXB 1AGDB 4G9FB 2FX7H 1SMOA 3BKYL 4N0YH 5DGRA 1DL7L 5KVMC 3LKRA 1I3UA 5T1LA 1M05B 4RQQA 3SE3A 3H42L 4CAGA 2PETA 5EOTB 1NAMB 5BV7B 5GS0H 5IJKC 4PJGA 4LLMB 2VDKL 3OTTA 1MFEH 4NQVB 4LDOB 3SDDD 1MF2H 3QIBB 1MFBH 3DMMD 3IDMA 3OPZL 3IDNB 4NFDA 1A3QA 1KPRA 4ODXA 4S1RL 3T4YB 3QEHB 4HPOH 4LARL 5KVDH 3GNMH 5DYOA 4LSQH 1FYTA 5KS9E 5EU4B 1JGVH 3WKMH 4LLVA 2QQQA 4MYWB 2Q86B 4GKSA 5T5NG 3QG6B 1V3MA 4KI5C 4YAQB 1XCTA 4NZJA 1BOYA 5KVFH 1TQCB 4JVPA 2F74B 2MPAH 3LRSB 4QKXB 4R90H 1UA6H 1BP3B 4L4JA 4D0CB 1KC5L 2YSSB 3MXVH 4LMQI 3VXTA 1T5XA 1IM3A 2D0GA 2PYED 2GTWB 1UZ6E 3ARRA 1B4JL 2QQLH 4BH7A 4RDQF 3QHZL 4YXKL 5MEPB 1G6RB 2EE6A 5E70A 5DS8B 3QDJA 4CVXB 1S5HA 3CMGA 3PWPA 2EKSA 1RHHB 3PIQA 2K9UA 4N9OB 4NT6B 3SE9H 3WDJA 1ZHLB 2AEWA 4PJDF 4P9MH 3CLEL 4HIJB 2Q8BH 2AK4A 2DJ4A 5MHSD 2HLFD 4MQ7A 4ZD3L 4WHYH 5L0QC 1VFMA 4AK1A 3QFJE 3DUSB 2GTZB 1D7FA 4O4YL 3CFCH 1FN4A 2CO7B 5J12B 4EDWH 1KTLA 5K9JL 5SWSA 3TN0C 3FRPG 5I66A 2ID5A 1GGTA 1LP9A 2GK2A 5EZIL 4NQEE 1WIOA 1ZVYA 3BHBB 1ZT4B 4P5MA 1J1OH 1UWGH 1F4YL 2PXYC 5LGHL 3HG1D 3OGCB 4HFUH 12E8H 4YR6A 3S36X 2NW2A 1A7QH 1CXEA 4TULL 3HE7B 3RVUD 2EYRA 4Q6IA 1T6VN 3G6DL 4RMVA 1Y18B 4R6UA 1U0QA 4I3SL 4BK5A 2C1PA 4JZNB 1NMAL 3WFZA 5J13C 4ZG1A 1MI5A 1CIUA 4YPJA 3MLPA 3FO0H 2C1OA 4YE4H 5HGHA 1QRND 2X4SA 4LCUB 3H9ZA 5CILH 4KUCF 1HSAA 2J6EA 3IYLW 4N0UB 4YBLB 2D3VA 5AG8A 1CGSL 4Z7OE 2V6HA 3GJEA 3MOQA 3SDAD 5KSVB 3CGTA 1FG2A 3S37L 5BZDA 3WCYA 5BXFA 1KEMH 5LAXB 5A16A 1CXLA 3FONA 3U1SL 3DUUB 2PTUA 2WK2A 5DQ9B 4M93B 4FP8H 4Q6IC 3VFOB 2OP4H 2FGWL 3MMEB 4LOUD 3U4EB 5I73C 4AZ8A 1NUGA 3HZMB 2AXGA 5L8JB 2IFGA 1TETL 4JG1L 1H8OA 3CK0H 3PWUA 4PTUB 5D1XD 4LGSB 1ONQA 1PJ9A 4X6CE 3FCTB 3I6GA 4ZTPL 1GAFL 5F3HA 4POZC 3HS0B 3CH1A 3VFUA 1UJTA 2V9RA 2ICEB 4CW1A 5ANME 3MJ9A 3H9SE 4ZO9A 5EN2A 1DP0A 4QHLB 5CKAA 4NWTH 2OZ4H 3P2TA 5SWZB 4HK0B 3N06B 3BSZH 3PQYB 4JFED 3ARDD 4O2EB 3I75B 4OD1H 1EFXA 4XC1H 4YBQC 5LCVL 3MFGB 5F1NB 2ZJSL 3MV8D 1XF2B 2A73A 3ECBB 3TVMB 3OF6D 4PLNC 3QUZC 5JPNB 2DQIL 3RDTC 4D94A 3O11A 3GSWA 2ARJB 2ZJSH 3RVTC 4XC1L 4OQTL 1CGTA 1MRCH 5BRZA 3VXMA 3KWWB 5EUOA 3PHQB 1KLGA 2F58H 5HY9A 4HUXB 1LP9E 3D2UD 2H3NA 4KK8D 4NC0B 1KT2B 4RGOH 1GOHA 2FO4B 3ZYOA 1BD2D 3L9RB 4R97C 1QR1A 1UM6L 1VB9A 3OR7A 1W72B 4DKEL 2X4PB 3BAEL 5LJYH 1XF4B 3BP6A 3HLAA 5IG7A 2UYLA 1H3PH 3OKOB 5TF0A 2F19H 4G3YH 4OGXH 1ZWIA 5D7IE 1PSKH 3G5ZA 5HPOA 3C5ZB 3DETD 1VCAA 1X4ZA 1DBBL 3ZKND 1VKXB 5L6YL 3TT1L 1A1MB 1L0XA 2FGWH 3LEXB 1EFQA 5DD3H 4U3HA 1KYOJ 2F5BH 4HAGA 5AZ2H 5FCUH 5KBNC 4P2RE 5EA0L 4FFYH 1CWVA 1NCCL 1NCAL 4PJGB 4RDQG 4X4ME 4KROD 5DTFB 4JY4A 1R5VA 3S36L 2ADFL 3V95A 5TDPB 3X11A 3ULVF 2R2EB 3V5DB 4P59L 4RGNB 3DV6A 5IB4B 3TBTB 5MI0B 4OZHE 2NY6C 5ADOL 3UAJD 4PY7A 5CILL 3R1GH 2Y36H 3KPSB 4Z7WF 2DQEH 4NJ9L 1ITBB 5GRYA 2VDLL 2XG4A 2EDDA 1NCWH 5GSVB 4ZPTA 2P1YA 1MRDH 4Y19D 4OKVA 1FCCA 3NH7H 5FEBA 2VDNH 2VXTH 4W68A 2I9TB 3MUGA 1LWRA 3RUGB 3S36H 1SJXA 2DKSA 3IS1X 3E8UL 3MLZL 4GAJH 3G6DH 4B7IA 1RD6A 3QNXA 1NCCH 2FEDD 5DC4B 1WT5C 1NGQH 3MLYH 5IJKA 1KJ2A 3SPVA 4M02A 5F44A 5A16B 5LGHH 4L4TB 5DD3L 4MZ3A 5I30H 4Z0BL 3BKJL 3BP7B 4HDIA 3BZEA 2JJTC 2WSKA 1AY1H 2XWTB 1AP2A 5DURB 3IDYC 4U7KA 3M1BA 1MEXH 5FGRA 4S2SA 4G5ZH 4XBEL 15C8L 1K4DB 2FHFA 3LH2L 3BGAA 3H9SD 3RWFB 3C6LC 2AP2A 4ORGA 4Z7VB 1EXUA 2CDFA 3SKNA 4X7FC 1INDH 5CEZH 2Q8BL 1EK3A 3ZDZF 4WDIA 5E99H 4IIQA 4GW1A 4X5XB 2EYSA 3WUWA 2F58L 3WNNA 3QYCA 4DGIL 4MDIA 5C0DA 3GJFA 4XWOC 4YXLH 4CVZB 1GGBL 4NO5B 3RGVB 3HNTL 2CUMA 4O58H 4P49A 4PGEB 2NX5D 4KVCH 1S7TA 5HHMD 1CQYA 3C8DA 5F7YC 2A73B 3V4PH 4MNGA 2FBOJ 5ICYA 4M03A 4OCSL 2NY2C 1MI5B 1A2YA 3TPKA 4EI6A 5D7IF 2XPGB 2ARJA 2DI8A 2DQJH 4LSQL 1INQB 4RWHA 1CE6A 4Y1AD 4HFWA 3VXNB 5D71H 4EI5B 2HKHL 4MAUL 1MFNA 1GZQB 4HIIB 3QZWG 3QUXC 3OPZH 4JDTH 4CVXA 5I1EH 4EQ2A 3HNSL 5A40E 1X5YA 3FB6B 5DJCA 3P0GB 3QUKB 3ULVH 2JCCF 5IT2L 3FN9A 5FO7A 1HHJA 3U83A 5DUMH 1JZ4A 2ICES 4IRSA 3TC9A 1GYAA 2BVQA 1W2KT 4DK6A 1CGUA 1RUQH 2BRRH 5TE7L 4FP8L 4KFZC 3O6LL 3GGWA 4KROB 5DLML 5JXAL 5SWSB 1IAIL 4N0YL 1RJZA 4PJHB 4Z77B 2V5TA 1H3GA 4ZUVA 5BS0E 3HB3D 1YYLL 2E9BA 3KPRE 1XF5B 3UTSB 5E00B 4LIQE 1WFTA 4E0RB 1TZIA 4UOJA 1A02N 1OSZB 3NMEA 4X99A 2X10A 2XZAL 3FO0L 3DRTB 1JHTB 5GGUA 5BZWA 3CVHL 3EOYG 4Z8FH 3O0RH 3SGJA 1IAKA 1VEOA 2FB4H 3DMMC 1V05A 5GJSL 1BVLA 4P57A 5E56A 1JJUA 1DEEB 1B0RB 3TA3D 4HGMA 3MBEC 4MD5A 1RZIB 3VRJB 1Q9LB 3SCMD 2FHCA 5D72L 4OQ1A 1S7RA 1ROWA 3MCLL 1IQWH 2X4OA 4Z95L 4K7FA 3PL6D 5AUMB 1V3JA 4WTZG 4WGVB 3BPNB 1CR9H 5JHLH 1NCDL 5F1IB 4M7LH 5I19L 4PY8I 5C09E 3O6ML 1CK0L 5JLZA 3CFCL 1R24A 4H1LG 4QNPE 3DSNA 3AU1A 3MPCA 4FFVC 4PJCF 1F90H 3QCUL 3IJHA 1MQKL 2VISB 4UT9L 4X4MA 1P6FA 4KDTA 2IH3B 4LPYA 1DBAH 4AL8L 3BD5A 5D7LE 4F3FB 1EXUB 4ONGL 2YN5A 4MJIA 5FUCE 3STLA 4OFYA 3S96B 3CPLB 2NX5E 4R7NB 4HIJA 3T0WA 2E6QA 3ARQA 3K7UA 2G9HB 5F7FA 1GOGA 1QYGL 1G7HA 4FOMA 3WNLA 2CDEB 5EBWB 4P23D 4KHXH 3BYTA 5HI3C 1DQMH 2WUCH 5F96L 4PFEA 3IKKA 3QJHB 1L6ZA 4EOWL 3LKPA 4TYUA 4YHIB 1KACB 1CK0H 2AI0L 4PJEA 3HE7C 1FGNH 2GITB 2X1XR 4P2YA 1NEZA 2JE8A 3VA2C 3DVGA 4EN3B 2C5DC 3RVUC 1MH5A 5HYIA 2F54D 2RB8A 5DJYA 1TVDA 2HT4C 5EC1B 4NN5C 1HQ4B 5E1AA 1HHIB 1CS6A 1U3YA 4ZO6A 2BC4B 3MRRA 4G6AD 1HDMA 1NEUA 1AXTL 5C0AE 5DK0A 2R0LH 1C1EH 1IE5A 1EAJA 3MNVA 4PG9B 5DJCB 1JF1A 3VMPA 2ZWLT 5ESVA 1FIGH 5IMMB 4V1DA 3JV0A 3DVNB 1TCRB 1NC2A 4Z7VF 5T5FH 3TT3H 1QTYT 4PGDB 4J3XA 5HYQA 3ZYIA 5EPMA 1NCNA 1R3KA 4N8VA 3R8BB 4DKFL 2Z35A 4JFZL 4DOHE 2J4WH 1OTUC 3ARZA 3MMEA 4PJHA 4ODVL 2X70A 3ESVF 2AVGA 4Y8DC 3MNWA 2NR6D 2P4AB 2VLMD 1K2DA 1CLOH 3HUJE 5HHXH 1QQDA 3QJFB 1UB5B 1HK6A 1ZLVH 1P7QD 1RU9H 5L2KB 2R2EA 3V5DA 3QWOB 3MJGX 3U48A 3ARBD 3DSFH 3NFSH 2VLRD 3ZE0F 2C3VA 3O2DL 4PP1D 2PXYA 2IALB 4MD4B 3F7QA 2KH2B 4NNYB 3VJ6A 2WWKO 1KEGH 4UOW0 3F62A 1B90A 3V8OA 3U4BL 5ADPL 1WZLA 4OQTA 3WKNA 3T1WA 1ACYH 1DBJH 4I5BB 3VXSD 1L4IA 1BIIB 3NN8A 3O4LA 3PQYA 4M1DH 3QAZB 2W0KA 2JJWA 3BQUA 3GSNB 4HUVA 4NDMB 1A21A 3IU3A 2DLGA 3LHPL 2Y5TB 3DIFA 4JPWH 3DX6A 5EFIB 4H26A 4EUPG 2C3HA 1J18A 5JLZB 5FB8B 2FL5B 5DQDL 5HHOB 4G8EA 4YIQB 3VG9C 1MSPA 5D7IA 32C2B 3BWAB 5L8LB 5IB1B 4HS8H 5MEPA 2E3VA 3KJ4B 5EUOB 3MYJA 1N3NB 1T7WA 1ZMYA 4NZTH 2P5WE 5IESL 3E3QE 3U9UB 1O7SA 3PNWB 3RJQB 2OK0H 1I1FA 2VXQL 3SDDB 4FQLH 2UZXB 5I1CL 4WEBL 4OM1L 3PWPB 5B39G 3PGFH 1G7IB 4MXQC 3UXFA 2XTJE 1FJ1A 5C71A 2FJGB 1EHXA 1P2CA 4R7NA 2VTFA 2AJVL 1CXFA 2BCKB 1QHOA 4F33B 1KXTB 1KJ2H 5HHOE 5E00A 3UO1H 1CLCA 4P23C 2CDEA 5JHLL 4LSPL 4MJ6A 1E6JH 1UXWB 4OBRA 3PDOA 5F7KC 4BYHA 2R9HC 4LQFL 1A0QL 3QCTH 1IM9D 5F71A 1LO2H 1JNJA 2V17H 4GSDL 1FRGH 3PWLB 2AJYL 4XPHL 1PY9A 2MFNA 2Y07H 3PXJA 3ZT5A 5CSBA 4RA3A 3UAJC 2VLRE 1MLCB 3S37X 4A6YH 4PV8A 4AENB 3NIGE 1WAAA 3E8UH 4CMHB 4G42A 5ESQA 2NY6B 5FUZH 2BVPB 3X13A 1IMHC 4M3KB 2HKFL 3VGAB 1OAQL 5GSVA 2HVKB 3WFDH 3UZQA 4OZIE 4YC2C 1WBYA 4KRPD 3D0VB 3AUVA 4EZMA 4JVWA 1SJEB 1U92A 2LU7A 3NPSB 1SEQL 4H88L 4HGWA 1JL8A 2EC9T 3DJ9A 5I16A 4PGBA 2X7LA 4G43A 5DA4A 2Y7QA 4JAMB 5HYQB 1XH3A 2HTKD 4A6YA 2H32A 2YHGA 3WXWL 1K9TA 3BP7A 5HVWA 1TCRA 5T33H 5JORA 1MWAA 4FFYL 4JRYB 1OAUL 2QADC 5F21B 5CD5D 5JDJA 1NFDE 5FYJE 5AD0B 1MJJA 2OYPA 3WFHA 1J1PL 3NPZB 1A14L 1HSBB 2NY7H 4MJIE 4NQUA 2OSLA 3V5HA 2DS4A 2YK1H 1BHGA 3HPJB 2VDMH 4HIXH 1I7TB 4X98A 3LKRB 1CVSC 2WLYA 3MRJA 3ULVL 1OGAB 2DQGL 3HNSH 4PJIB 3B2UD 1WAAF 3FO1B 3EOAA 3B2VH 4F37K 2NPLX 3B9KD 1NDMA 1RZ8A 4X80L 3IXAA 1LO0H 4L4TD 3SJVA 3LKPB 1UJ3B 4XNYH 5SWZA 2E8YA 3KPLA 5EOCJ 1TJGL 1PKQE 4I4WB 3KR3H 4YHKH 4CW1B 2A6DB 1DUYA 1CU4L 3EAKA 3VXRD 3QEHA 2CLZA 2DKUA 1GJIA 2EIZA 4P23A 2FEEL 2XQBH 5DRXB 5GZOC 4PJ5D 1JHKH 5E7BA 4W6XB 3NCFB 5TH2B 3VE0B 3ULUH 4HJGB 1NANH 1Q8MA 1NAML 4ZAKA 5HDLA 3MRBB 3UMTA 3PJSA 1UWXH 2BC4A 3K1DA 4HZAA 3K74B 1Q0XL 1CF8H 1YEEL 4TVPL 4Q2ZB 3VFNA 3HMWL 5LCVH 3RVWC 1UGNA 3MRGB 4JO4L 4RIRA 3WDIA 1YEJH 3LPFA 2D4FA 4XZUA 5CBEA 8FABB 1IKFH 3WN5B 3U4EA 2CGRH 3MJ8B 4NRYB 3EDEA 4AMKL 2MKLC 4P2QA 5C9JA 4MB5A 5HHOD 2H3NB 1S7QB 1IL1A 3QRGL 3IAQA 3GKWH 3EYFB 5C0IB 3VGGA 1JWMA 3CDCA 5K9OB 1N7ML 1E28A 3RBGA 4G5ZL 3CK0L 1GCFA 1E6OL 3FT4B 3HI6H 4HJ0D 3Q3GA 1K85A 5JNYB 3IF1B 4EUPA 1YMHA 4X8JA 3QJFA 3BKJH 2KDGA 3HUJB 1X3DA 5F9JA 5AYQA 3ALXA 1MRFL 4Y5XA 1H5BC 1IGCH 1QSED 4M9OA 3O9WC 3CUPA 5GZND 3CC5B 3E6HB 2PXYB 5C7XH 4DOHB 5C0RH 2DQFB 1KV3A 4L8SB 2V2TB 4WUUD 3GJFK 4JJ5A 4PRIE 3LSOA 4KVNH 5F7EH 2MHAB 3UBXG 2BK8A 3RGHA 1UKQA 1YNKH 2HFGL 4IMKA 2EYTB 5HI5D 1OTSC 5EO1B 4R7DA 2DYPB 1YMME 3GMMA 4PJ7E 4KQ4L 3UYPA 4LPTA 1AGCB 3RI5K 5AAMA 1N5AA 5BRZB 3MUGB 1T89A 4JFOB 2NTFA 1Q9LA 5CSGA 5C0AB 1U8HA 2ADFH 3OKMB 1RZ7H 3FOMB 4N90E 4L3CB 3S34L 4I3SH 4K71B 4TNVF 4NQEA 3LEVL 3DXAB 3G5VA 1RIUH 3QXWA 5I1IL 3NABH 12E8L 2CXKA 1N64H 2W9DH 1NMCC 1MVUB 4P3CL 2VR4A 4OLYL 1N3NA 1NBQA 5KSVA 5KVGL 3BH9A 3KHOA 1ZHNB 4PJ8B 3BT2L 2Z31A 3QWRA 2D31A 1F4WL 3EOBA 4YJZL 3VXTB 4WI3A 4WV1B 3D5OF 1ZLUK 2EO9A 5DQ9A 4UBDD 2VKWA 3CDGB 3H3KA 4M62L 4YUEH 1AGFA 2AGJH 5FV1L 2QR0B 5TPWL 4QWWD 1EAPB 3RP1A 4L8BB 1K4DA 3ZHLA 4ODSL 4S1QH 2DAVA 3VXSB 3HC3L 1DE4B 2IMMA 4FQXC 4MQSB 2W92A 4NQCE 2Z93B 5JOEA 1PKOA 2D7TL 2A0LD 5DQJB 3FO1A 2VLJA 5E8PA 5FO8B 1T1XB 4U6HB 5BO1L 2OXHA 4YBQD 4OQTH 2QKIB 3QBTB 1TPXC 2VLKD 3QZWB 1YDPB 3LQZA 2L7UA 1JK8A 4JKLA 1FZJA 4C56A 1PBYA 1BGXH 3P11H 1R3HB 3WO4C 4MJ4A 4QRRE 4JFDB 4R4BB 5D1XB 2P5EE 4K9EH 4H5SB 2X40A 2O93L 3FRUA 3VG0L 4LLWB 1ZGLP 1YMMB 4C56D 1L7IL 2VDPH 1KJ3H 2YMXL 3O2VL 5K9QI 4QHNA 3ARED 4LLVB 5CIPB 4U0RB 5TGBB 2P5WD 4FQPA 1SYSA 1UQSB 3L3KA 5B38B 4HBCL 1JWUB 1JFQH 4JRXE 4OCLC 5E2VH 1WEJL 3KWWA 1A6WL 2EICA 2FX8H 1CFSB 3CFIC 4WHDA 3L5JA 5HY9B 1MCLA 3FQTB 2NZ9D 4A2LA 2YRZA 4MDJB 1FNSH 1A3LL 1S9XA 3BRDA 3GRWA 3DGGA 1TETH 2COQA 3EYFA 4K8RL 5CS7A 1U8QA 5ICXA 1JV5A 3ZE2F 3UTPD 4IIQB 3TYFA 3PP3H 4P2OC 4LEOB 1RFDL 2ZPKL 3NZ8A 4ELKA 2YPKA 4OCRL 4PJBE 3EGSA 1FV1B 3OB8A 4OD2B 2DLFL 1S9WB 4XB7A 5EZJB 5IW6A 4KMTL 3E2HB 4KY1L 3V7AG 4E0RA 1ZANL 4WHTA 1G7JA 2FEEI 2ZG2A 4JFYA 4ZFFA 2PYFB 4XMKH 1N0XL 2BSED 1KN4H 3PF2A 4NCC2 4HS6A 4MSWB 4OCXH 3SGJC 1WICA 2A6DA 5E95B 3B5TA 2Q7NA 5HGDA 2R1XB 3MODH 1FC1A 3S8WA 4ALAL 3TBWA 3F6IA 2EDJA 5I8OL 3S3PA 4JKWA 3KPNA 4M5ZL 4XNZC 4XWGL 1H8NA 5K9KA 4UT7H 4JHBA 3ES6B 4WWKD 5IBTH 5EU6B 1I8LA 1FGVL 4XVTH 2A6IA 4D9LL 1G0DA 4NZRL 3VRLE 3MRLA 4OGAC 3IVKB 1JMZA 4PD4K 4M48H 1OF2B 1JZ8A 1ZAGA 4LCIH 1SM3H 2DBLL 4B5EA 3DO7B 1MFAH 3QIBD 3KAAA 4A6YB 2YS4A 4RX4A 3SE8L 1WWBX 4PRHE 4GG6A 5KJRL 1GRWA 5DJ0B 4HH9A 5IWLC 2A77H 5HVGB 3UO1L 4R2GD 4YHYC 1MJJB 2QHLA 4NUJA 2W0PA 5DUBA 2FX9H 3P30H 4QT5A 4MJIB 2O5ZL 3CX5J 4U1KB 2EDTA 2C3WA 5CUSH 1JZ6A 3F7PC 2NX5A 4YGVB 5C0CE 4OUOA 5DI8B 1Z2KA 4RFEB 1EH9A 3W5NA 2P45B 4JLRB 4QRQA 4OD3L 2UY7A 3J8F7 5F9AC 2D7OA 4K23H 2V5YA 4OFKA 4PJ7A 4E5XB 4MS8D 5JIIA 3ILPA 4ZPVB 3O2WL 4DFHA 1IAMA 2XNAB 4UQ2A 5E4EB 3W82A 4WTXA 3JWNC 4JKMA 4EUPH 1W0VA 2J8UA 5C0FB 2CRMA 1CG9B 4PJDB 4HLJA 1B0RA 1QOKA 1WWCA 1VACA 5KVFL 1BBDH 3E0GA 1UM5H 3KPOB 1II4E 3V5KA 4QTHB 4ETQA 4X4ZA 2K7PA 3MFFB 4DUXA 3HUJF 1OT2A 2BP3A 1TLKA 4KGJA 1AH1A 4TN9A 4LCYB 1NQBA 3W9EA 5IHBA 5KAQF 4QYOA 2B0SL 2ZSWA 5GGTA 2O26U 4DW2H 5KVDL 4N0FA 4NBZB 3MGAA 4O2FA 3RNKA 1I1AD 1QG3A 4P48A 4Z7UA 1XF1A 5JW4M 3P4NA 4YHZH 1S3KH 3QUXA 1BQHG 1QBBA 1L0YA 4K94C 4V2BA 3NIDE 3VFTB 1LEGB 5EWIH 4BUGA 2J8OA 3WFEL 3ULVC 1J7VR 3IDIB 3O2DH 1U8IB 3HE6D 4XBGA 1RUPH 1NLBL 4G80B 3EKCA 1OAZH 3PHOA 4UQ3B 1I8KB 1T2XA 1TJIH 1QSFE 2XACC 3C5SB 2R0WH 4JKKA 1Y0LA 4RGNC 2GTZA 3T3PF 4EQ3A 2CSPA 4BKLA 4X9HA 5ESVB 3LY6A 1UENA 3PXHA 3U30B 5I17A 1Q9OA 4ZUUA 1T1YA 4LEOA 4H20H 4WHTB 3RIAF 2OBGA 5EBWA 4GRLA 4JB9L 1F8TH 4WO4B 2XRAH 1IILE 5JQ6L 4KMQA 1A1MA 3PDGA 2B8OT 3QT2A 5F1SA 5I8CB 3D85D 1HCFX 2IADA 3B9KC 5EO0A 4W81A 1NLDH 3F7VB 3K2UL 1FZJB 1NC4B 1OWRM 1UJ3A 4ERSL 1A4KB 4H1LA 1IC1A 2BSTB 1Z6JT 4N5UA 3LEYH 4HJJH 4MD4A 3IDYB 4J6RH 4N90D 4PRHD 5L9DL 4ZXBD 3LMJH 4NC2B 3BP5B 5TDNB 3DIFB 1IT9L 1YMMA 3DYMA 4AYFA 1LEIB 3AROA 2NYYC 1G7LB 4C83B 5KSUB 1FYTE 4J4PD 4PGJA 2VSCA 1BQLH 5DHXB 1P4LA 4AT6B 2BHUA 1V7MH 4NM4H 1OAKH 3DVNA 4LFHG 5DD1H 3ULUC 5BJTA 2PW1A 3CXDL 4PB0H 5F1IA 2VIRB 3MREA 1NC2B 1Q72L 1RUPL 3TA3B 4EXPX 2Q8AL 3MO1B 2MOVA 4I13B 3QEGH 4APQB 4JDVB 4QRRB 2OR7A 1T21A 5DZOA 3IJHB 1X4YA 1J12A 2XICA 3KPPB 3PNWA 3HMXH 5F7MC 2P5WA 5B3JF 2PW2B 4X4YA 2YA0A 3VI4F 3X17A 1OARH 2B2XH 1IL1B 3RGVC 5EORH 1JNLL 3MJ9H 2FX9L 2XXCB 4GFTB 4UT9H 1Q9KA 4OF6A 3VXOA 4Q0XL 4PRPA 3QUZA 1Z9OA 3ZTJG 1IKNA 3VFGL 4P2OA 1JF5A 4MNHB 4LHUD 2XYCA 5IW3A 4ETQB 1UXSB 4I2XE 3GM0A 4P5TA 1TZHA 4IDLA 5HPMB 4X9FA 3H9HA 3BIKB 4N5EC 5I18H 1Q1JL 4APQC 2J8UB 1BX2B 2OLDA 4KJWD 4Z77A 3RDTB 5HDBE 3PDOB 3MV7E 2G2RB 1EEYA 1SJVA 4QY8A 5E2WH 5IHLB 3UYRH 3SGEH 3RWIA 2JJSC 5JPMB 5HI5C 2X4TA 1OGTA 3QIUB 4ETYA 2DYPA 1WQVT 4WY7L 4X6BB 1ED3B 1AR1D 1CL7H 4LCCC 4NKIL 2VYRE 1DFBH 4DK3A 2Z4QB 1WTLA 2X6MA 1LO4H 5EBGA 1N0LA 4ZTOL 2DQTL 4Y5VA 3U9UA 1PYWA 4YHOH 4L5FH 2VDQL 3N85L 4XI5D 2EE2A 4BA8A 2LVEA 4TUKL 2H2PC 5IG7B 1ZANH 4JM2B 2APTA 5KJRH 1JV5B 1U92B 1JZ5A 5D1QC 1WZ1L 1YEGL 4KMTH 1MFAL 2NW3A 1LK2A 5IV2A 2DLFH 2NTSP 2RJMA 5FO7B 4FZ8L 5EU7E 3EGSB 5F1OB 1FFOB 1DBMH 3DROB 2VN7A 5A2FA 4JE4B 1NCTA 3LS5L 2VDOL 1EIBA 3AU1B 3OJDB 3QULB 4XVTL 4F7TB 1M6OA 5DI8A 1U9KA 3P9MB 5FO9A 4ZSOB 4UT7L 1AGDA 4PRBA 3UJIL 3HCVB 2X05A 1A3LH 4H0HB 4PJAE 3C08L 1QLRB 2ZG3A 1L9NA 1NFKA 3H8NA 4EXKA 3O6KH 2UWEE 3VXSA 4H1LB 3T08A 1FP5A 5J11B 2CXGA 4IRJD 4JDTL 3WYRA 3ARFB 1KN4L 4U6VH 1FYTD 3BD4A 1NC2D 1JGLH 4KKAD 3VFMB 4KI5E 5HHPA 4BQCA 5GS0D 2DD8H 5C0BD 2OZ4A 4HBCH 3S7GA 3TV3L 2XN9E 1T7XA 4M43L 4ELME 4JDZB 5GGSY 3KPMB 1ZSDA 4FQQB 3IB4A 2AKRB 3V4PL 4NQED 4BZYA 5A1AA 5T3ZD 1WCQA 4HJGA 1KNOA 2I07A 4DKDC 2IC2A 3N1QC 1IGYA 3BWUC 3VRIA 3AFLA 4BH8A 1AP2B 4KJPD 3VFTA 4OZFA 2Y6SD 5F97E 1HHKA 1MCFA 2W9EL 1JHLL 1UVQB 2VNCA 3OF6A 3HA0A 1U6AL 4OLEA 4MXVE 1VDGA 1KJVB 3LN5B 3LZFL 1T3FB 2D7TH 4XMPL 5I1AB 4OZGE 5E99L 4YX2H 1OT1A 3UJTH 5IB5A 5MP6L 4IS6A 1RZKL 1KBGH 2CRZA 2O5XH 2M26A 4MDJA 1PG7X 4U0RC 3GBLA 2MMXA 1I1FB 1OGAA 2APFA 2VDPL 3MRPB 3V6FB 1XGYL 4K3GA 4OZ4A 5INDB 3BJLA 1ORQB 1WFUA 4XP5L 1BEYL 1FJ1B 4TNWF 1PZ5A 4F7EB 3QUMB 5GGRY 5I8KH 3BPCB 4ELKB 4NQTA 4YHLL 2P42B 43CAA 1YEDB 3BT2H 2R4RL 2VXVH 4NN5B 4YDIH 4P4RA 4KK9C 1M71A 3N0PB 3E6HA 3V0WL 4ZNCD 2HAZA 4UUJB 5D70H 4PJ9D 5DFVC 4M7KH 1KFAH 4PJXE 1R3IH 5CMAA 3U0TB 4XAKE 1QO3B 1RIUL 3JV4A 1UACH 2IH1B 2RBLA 1QPPA 3GI8H 4XCEA 4J12A 1KCLA 4LEXL 2B1HL 5BQ7B 1RZ7L 1G6RL 4PBVC 1ITCA 3RHWF 3AS1A 3GUTA 5E8DL 3FFCD 4FQJL 3RU8L 2V2TA 4OFDA 2GK0B 3QDMA 1HXYB 3KXFE 1A7PH 4PJ9A 5EO9A 1K8DB 3ARTA 2C1OB 2YPLD 4DVBA 1PYWB 2HYMA 1TIUA 4YC2B 3U7YH 2XZCL 1AI1H 4LSVL 2BSRA 2Q6WA 5ADOH 5C2UB 3V4VH 1PQZB 2UUDK 4OGAD 5HBBA 4JN1H 4G80A 3P4OB 3CFJA 5DMGD 1LDPH 2VQ1A 5E2UL 3QIWB 5IF0B 4UNVA 3WEXA 4LASL 5E2TL 4GW5A 2LTQB 4MVBC 4UU9B 2HFTA 3DO7A 4Z5RB 1ZEAH 1LD9B 1KIRB 1JYVA 1YEKL 4HD9A 4LKCA 2BNRE 5I1LA 5ENWA 1YUHB 4BELD 3HRZA 2JELL 3IDJB 2J3SA 1VFBB 4KDVA 4DTGL 5IHUL 3WNMA 4Z18A 4HKJA 5IFAH 1J8HB 1TITA 1D9KB 3NFNA 4JPVH 3W81A 3DHJA 4KI5F 5EC2A 2XZCH 4BZ2H 4GOSA 3KLHC 3CZFB 3ZYJA 4JM2C 5E24E 1FNHA 2FYYA 1J8KA 4WFHD 4HXAL 4EDXA 1C8PA 1J8HE 3D3VA 1EPFA 2YRLA 2QR0A 4WFFD 3BQUC 3MRJB 2ORBH 2QV2A 2IPTL 3IXTB 4KTDL 4KVNL 5F7EL 3ORJA 1SJHB 3FO2A 2VXUH 6FABL 4OZFH 2XKSA 3HS0A 1KIQB 5DD6B 3REWB 4KDWA 3SJVB 2FLBT 1O0VA 1MRCL 3OJ2C