1LK2B

1.35a crystal structure of h-2kb complexed with the gnysfyal peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title A peptide that antagonizes TCR-mediated reactions with both syngeneic and allogeneic agonists: functional and structural aspects.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk2B00
2EEBA 3SKJH 4XI5D 2ICEB 1F8TL 3O4LB 2R4RH 4KUCD 2F54A 3MRCB 3B9VA 3FMGL 1CDHA 1X7QB 1Y18B 2ZNWA 1A7BA 3OXSB 1EZVY 1CFNA 1LP9E 1ZMYA 5C0BB 3BPNB 2NY2C 2XQBH 4HWBL 3KPRB 4PTUA 3QO0A 1B2WL 3MGTA 1Q9WB 3GZKA 2WBJB 4LEXH 4U0QB 1DANU 3OF6D 5D7KD 2Q8BH 1UT9A 5HHQA 4ODTL 4XP9L 1X4ZA 5IB4B 1BQLL 3D87B 2XWBA 4CUCA 4IBLT 4KJPD 3FQWA 5EUKB 5LGJB 4PRPB 4WUKL 4KPHH 1BX2A 2BVEA 1DUZA 4MNGB 2DQDH 2R23B 5DUPH 2VZ3A 4JG1H 4X7FC 4Y16D 3P73B 1A8JH 4ZO6A 1P4BH 1I85A 3RWJA 5I1GH 2JIXA 2WINB 1FN4B 4RGOH 2FX9H 1NGQL 1OTUD 2C3VA 2DBLL 2FEDD 5I71C 4ZFOA 4KRLB 4IRJB 3BEVB 5C6TH 3T0EE 2BK8A 4LVNB 2CO6B 3HZMB 2NNAB 5JW3L 2V9RA 5EU5B 3S5LA 2Z8VC 1KTLB 5GRVL 4PRAB 3RNKA 5IQ7H 2XA3A 4WEMB 3MLUL 5I1KL 4UNTA 2MPAH 2H26A 5DJXB 2EDKA 3QIWD 1BEYH 3FN9A 3ZZ1A 4MNQE 5IK3B 1AGBB 5JXEA 3MLWH 3C5ZB 3S34L 4JJ5A 1A6WL 1R5VB 3V6FA 1LO3H 4NM4H 3TYGL 4Q9CA 4NT6B 3LD8B 5ICZB 3FFCA 1B88A 5ALBL 5DD0H 3MNVA 2IPTL 4LHUD 4RGNE 3W9EA 5E5MB 1NMAH 1CG9A 3QIBA 4YDIL 4U1HA 5DMYA 4PGEB 3F5WA 2AV7B 2W0FB 1BIHA 2H3NB 2Q20A 5J8OA 3T0XA 1WZKA 3VFUB 5EA0H 2NY6D 1NDGB 1A6VH 3DMMD 3WFEL 1GZQB 1OQXA 4YWGH 3N50A 2NZ9C 1JGEA 2ESVB 3M1BB 4GMTH 1JHKH 4P3DA 4H1LG 1YN6A 1QNZL 3FTGB 1JV5A 2AK4A 1LEGB 1OAUL 4F33A 3SDAB 4R90H 2BNQA 1VA9A 1X4XA 2V7HB 2GTZA 4Z7UF 3GK8H 2YA2A 5TQ2H 3RBSA 4PRHE 4Z7WA 1J10A 1K4DB 1FORL 1ZTXL 4I18A 3VFTB 5JA8B 5K93A 5IESH 2BDNH 1G7PB 1AC0A 1NBQA 5KJRL 1R24A 3GI8H 1G7QA 4CMHB 1NAMB 4RISL 4PLOB 4GKNB 4W68A 3BZFB 2Z4QA 3GBNL 3HNTH 3X3FH 3U7YH 1S7UB 2P7TA 5ADPH 5H8DA 43C9A 1SQ2N 1U3YA 2D7NA 3B2VH 5I76A 3J7HA 2VXSH 5MEOA 5D7IE 5E2VL 3MNWA 5D96C 2RQ8A 4KXZH 1BP3B 5AG9A 2F9BT 3F7PC 4ZFGH 5BRZD 4IMKC 3L3KB 5I8CB 5I73B 1FYTE 1LD9B 1A4JA 1U8MB 2HT3D 4XC1H 5CIPH 1P7HL 3WDJA 3MBXH 5GGUA 5SWZE 1JNNL 4OSUL 4YAQB 5FFLA 1S7VB 3UTTD 1YNKH 2BNRB 3VWKC 4NQCA 5IUSA 3RY6A 4YHPB 5SWSA 3ZT5A 1IEAA 3ZKQD 1NAML 5DRXA 2DLFL 4J3XA 2LABA 2NY1B 3ZDZF 1O5DT 1F6LL 5FDWA 3C2AH 4MLSA 5H94B 3H8NA 1CGSL 3DX6B 2G9HB 4M61A 4XXCA 4XBGA 3OAZK 5ISZA 3W5NA 2QHRL 4WRLA 5J1SC 3NBNA 4TSCL 3QUYC 3OJMB 1ZSDA 5EOQL 3W11C 1F3DJ 4ESKA 3QDMB 1JBJA 1NFIA 2X7LA 2YD9A 2VNCA 2AK1H 3SCMD 4K7PX 1KB5H 5CZXC 1CL7H 3IF1A 4HIJB 2OSLB 4JO4H 1YYMH 5ESAA 1J88A 4K3JH 4NWTH 2O5YH 2DI8A 5E1AA 2AAVA 5ITBL 1UACL 4DGVH 4E9LA 1CN4A 4WTZA 5I1HH 1R3KB 5E8NB 4X9GA 2NXZC 1ACYH 3N1FC 5D1ZD 3EYUL 4JY4A 2JELL 5GGVH 1F4WL 3OJDA 3QEHA 5FUCE 3M45A 2DI9A 4XP4L 5HHOA 3D3VA 3QRGH 3TN0D 2W65B 2EDRA 3KPSD 4GRWB 2RJMA 1A7RH 3H7BA 1AIFB 3P9MA 2XWJA 1BZQK 2LTQC 5GS0L 2EO9A 3RWGB 5DO2D 3WL9B 4FTVE 2VKWA 5F7DB 4AM0B 3LV3A 5EU4A 4GAFB 3KPLB 3B9AA 1NFDF 3LCYA 4W81A 1CZ8L 4HJGB 1FLRH 4JZOA 1GGIL 5C0AA 5HI4C 2YPKB 2PXYB 4G3YH 5KAQG 2YK1H 3B9KB 1G7HA 3LKOA 4N9GB 3O6ML 5KANG 5CWSA 3KJ6H 2G2RB 1NPUA 4OJFH 3HB3C 1MJUL 3NGBC 1AY1L 5D7LD 1NC4B 3VWJB 2E9BA 3MROB 4WY7L 5BV7L 2O5ZH 3C8HA 3LOWA 1UM4L 3GB7A 5CBAB 3LQAC 1G9EA 5I15H 2X4UB 1LNUA 3IFPA 2AERT 2W9LA 4MS8C 4LK4A 1MFBH 1L0YA 4LPYA 4ORGA 3TCLA 5E8OB 3VH8G 3LPWA 4M6NL 3RL1B 1ULVA 3TPUA 3RHWF 3PP3K 3ARFC 5H37H 1ZT4A 4DAGL 4WFHD 1C8PA 1HQRA 1WIOA 4G8GA 5CIPA 3DIFB 3U82B 1WISA 4AZ8A 4QF1A 5FKPA 1DQML 3OPZL 4UIMB 4KI5E 4LIQE 3QPQC 2JTDA 4JHAL 4DQOH 1I7RA 2YRLA 3BKYH 1JWSA 5DHYA 5GJSL 2VE6B 4UILH 4DWHA 4F7CA 4N0UA 3K4ZA 4MA1B 2VXTH 4PYHA 4HUNB 1UKSA 1VADB 5DJAB 1E4WH 2CLVB 5GGRA 5IM7B 3VFWA 5LGHH 4P2RE 2A0LC 2EDDA 5SWQA 1DLHB 3BKCH 3WBDA 3MRJB 5DJ8A 5DJDB 2GJJA 4AH2A 2FIKA 3AGVA 5EZOL 4CDGC 1SJVA 3HMWL 4O2CB 3ZE1E 3TO2A 4OFVA 4PGZA 5JOPE 2R29H 3HNSL 3HI5H 5DT1L 3H0TB 3QULB 4N0CD 1RV6X 4X7SH 2OR9H 1CXKA 2V5SA 3EYQD 3PWPA 2UZIH 2NY0C 3O6FC 2Y7QA 5HD8C 3OHXB 1YYLH 3MXWL 1IKNC 4R2GC 5FA3A 4Y4FC 5TDPB 3QDJB 2ZCHL 1DBKH 5DUMH 1ZLWK 3DSFH 2BOCA 4ZUUA 4Y5VB 3KLDA 1SM3H 5IVXE 3DHMA 3KYMA 1RY7B 2PYFB 1R5WB 3DGGB 2AJUL 4OGAC 4R0LC 4XZUA 3DLQR 3TVMA 3KYKH 4JFEB 1GC1L 2FLBT 4OLVH 3EOBA 4ZAKD 1YECL 2H32B 3VXMB 2EDQA 1Z6JT 3LS4L 4HDIB 2A73A 5CSZA 5C0CB 3WUWG 5I1IH 1V5JA 2WM0A 2GAZA 4L8SB 3T3PE 4FXGA 3GIZL 4WV1A 3ULUL 25C8L 1J1XL 1A6TA 4NZRL 4RMUA 3SGDH 5F3BA 5DZNA 1R3LB 3PQYE 1CT8B 3IFNH 3S9DB 4KRPC 4LSUH 3S35H 4YDVA 5IW6B 5D7JD 1OP5H 3QO1B 3ZTNH 4LPCA 4UI2A 2VLLA 5HYSB 4BUGA 4CVXB 3EOAA 4PP2A 2WZPD 4O4YH 3P4MA 5KSAD 3S88L 3P11H 5GZOD 3SDXF 2GSGA 4QRRD 1KN2L 4D0BA 1LK2B 3VXUB 3GO1H 5EFIB 3TM6A 4P3CH 1K4CA 2X1OA 5DI8A 5EO0B 4QXGL 3D69A 4N8CH 4HEPG 4AK1A 1IAKB 2OZ4L 1K9TA 1INQB 2VZOA 1UJ3A 4G8EA 3SGJA 1WCBB 1BGXH 2IH1B 3QUZC 4HH9B 4L8DB 4UV4H 4BK5A 2XYCA 3C5SB 1S7XA 4HPOH 3WNPA 2VN4A 2ITDB 5DQDH 1U8QA 1R3JA 1JRHH 3K0WA 2DIBA 1C16B 1HILB 1KJMB 2OTUB 2VKXA 4HKJB 4U6VL 5D7SL 1MIEH 4ERSL 2YKLH 4M9PA 1ED3A 1GIGH 1NC2D 2JB5L 1NDMA 4URTB 5CP3H 5DSCA 2VZSA 1PG7H 3QQ4A 4QTIH 4HWEH 2DQHL 4OD3H 4OLXL 3D39D 5E2TL 3K46A 1VFOA 4LLUA 1G6RL 1IC7L 3ZHLA 3O4LA 1KXTB 4X6CA 1Y18A 2EE3A 3G6JB 5FYJU 1T21B 2J7LA 5DQ9A 4MSWA 3KDMA 5MERA 5IB5A 5FGSA 1HE7A 4U1GB 3BHBB 4I3SH 1OB1B 3KPRA 1VENA 4YGVB 2XWTB 3PNWA 5IF0B 3WSQL 4BFGA 1LP9B 3BW9B 4UINL 1CVSC 1MHCB 4L1DA 5KG9B 2EDJA 5DRWA 1I9JL 1TITA 4WU7A 1AE6L 3QEQA 3C08H 2WSKA 5JPMA 4M43L 4OQ1A 2QJDA 2CK0L 5KVMC 5IBUB 3V8CA 12E8L 4ZXBB 1RZJL 4XAWH 3G5XB 2XN9D 5I75C 4HEME 1IFHL 5E00A 3QH3A 3RUGE 5SX5H 3S96B 5L9DH 1TJHH 1I1AD 1A6UL 4GRMB 1T66D 4U1SB 1DVFA 4HF5L 5FECB 1V7ML 2VUYA 3HZMA 4S10A 1CICB 4YIQA 3STLA 4P46D 4NUGL 5IJVB 1A6PA 5EU5A 3MLRH 1I9EA 4PRIE 3GGWB 1A1NB 1JTPA 3QAZB 5IOPB 1T1ZA 1X5IA 4FZ8L 1A9EB 4MVBD 3T0EB 1CQYA 4QYOB 4PRBA 4R9HA 5IK3A 1U9KA 4XCEA 2P47B 3C5ZA 2IQAA 1LO2H 4P4RB 1QSVA 2I26N 3EYFB 3SGEI 4Y5YC 5CSGA 4JM2F 2X4TA 5DC4B 3M8OH 4ODSH 4NT6A 2C5DC 3IJSB 4HC1L 4HBCH 5C0IB 2J6EL 2LU4A 3HC3L 5J3HD 1XF1A 3TLRA 1VERA 4CU6A 3LZFH 1IGIL 3H9SE 4X9IA 1YEKL 5JOEA 1GGTA 1MPAH 3OJ2C 4K8RC 4LSQH 3CFCL 4KTEH 1YZZA 5MHSE 3WS6A 3IDYC 4BELD 2VIRB 5EC1B 1U8KB 2QADC 2C3GA 4ZS7L 4NZUH 3P0VL 1AGCA 1WZ1L 1EERB 2W0FA 3KPMA 1UC6A 4RGNB 1E4XI 3ETBF 2BVOA 1FNLA 4HKZA 2E6JA 2OJZL 4TN9A 1FGVH 2ZSVB 4NC2B 2P8MA 3MLYH 3LEVL 5HYQB 3EAKA 2NY5L 1UWGL 1A3LH 5HVHB 1EAPA 1EA9C 1LEGA 4HUWA 3IYLW 1U91B 4DZBB 2R8SH 1RZFL 2CRZA 2BVYA 2D9QB 2WLYA 3V4PL 1BREA 3TO4C 4P0DA 1QLEL 2VDOL 5AUMA 5HGAB 1B4JH 3IDXH 4N0YH 5MENA 1QR1A 3SE3A 5DEGB 1G7PA 2ZG3A 3GSQB 4OUUB 3PWLA 2E5EA 1J18A 2A83A 2E6QA 4PRHB 1BD2A 1MRFH 1PY9A 1VDGA 2VSCA 4NC1C 4Z5RB 3E0GA 1NCTA 4PLKD 3SDDA 4GAJL 3BZFA 4K9EL 4O5LH 5DMIH 4BSWB 5HY9A 5JIHA 3C6LC 5JW5B 4KHXL 1N3NA 4MZ3A 2ZOKA 3IETA 1AI1L 2R2EB 5FOBB 3WNKA 5TE4L 1HCFX 1F90L 5JHDD 3HRPA 3QG7H 4KRNA 2ATPB 2EE6A 3RDTD 5EUOE 3CLEL 4O2FB 1UWXK 3G5YA 3V6OC 5HGBA 2CDFA 4WNQB 4UBDC 4AMKL 4QRPE 3O9WA 5D2NC 5D7IB 5DRNB 3R4DA 2EDTA 4LCIH 1P4IH 5FDYA 1N64H 3PGFH 1TLKA 3VFSA 5JZ7C 5HYJE 1D5BB 1N2RA 1FYTB 1A7QH 2YD3A 1SJEA 2G75B 4OCRH 4YHPA 4HMDA 1K3ZA 4OCLC 5SWZB 4L29B 3SO3C 2FD6L 5E9DE 2AJYL 4JGJA 4MHHI 5TJWK 2Q7YB 1PSKH 1ZHBA 5L88H 1X5YA 1CGXA 4CW1A 1MAMH 1RIUL 4ZD3H 3ZKND 2G9HA 4R97C 2R1XA 3GM8A 3QUXC 3JWDH 4UQ2A 3BN9D 3GMQB 4JHWL 2DQJH 5JW4N 1X5GA 2D4FA 3PDOB 2NY7L 2X70B 3GMRB 2CLZB 3Q3GB 4UOW1 1JGVH 3UBXA 1U8IB 3ARUA 2YPVL 1D9KB 4XRCA 3VGAC 4XCYB 1D6EB 2AKRA 4OAWB 3OF6A 5F96H 1S9YB 4MXVE 3RWCB 1OAZL 3WFDL 4E42B 1F4HA 3K1KC 2NY3C 5E2UL 4XPAH 4OZHE 2VDMH 1CIUA 1QFWM 4XPFH 1INEH 1F3DH 3ARBB 1EAJA 1Q38A 2AI0H 4MZ2A 3X14B 5E8NA 5A16B 3TF7C 4UV7L 2VOTA 4QOKE 5DEFB 2CR6A 2LFGA 1IAIH 3BRDA 1BPVA 1JF5A 4XVUD 1SMAA 3INUH 3L5JA 3FQRA 3BSZH 3UYOD 4G8FA 2J12B 3RKDC 5FHBL 3G6AA 5BZWB 3UYRL 1MHEB 5C70A 1A64A 3QIUD 2VQ1B 5A2JH 1SYVB 4ZPVA 5I1JH 2VXVH 3NZ8A 5KSBE 4ELKA 5CZVL 3TZVD 3WN5C 1X5KA 1KN4L 2AEPL 1GGCL 2N7BA 3OBAA 4OLYH 3QIWA 1T6VN 3WD5L 4FTVB 1BAFL 1YY9C 5EWIH 5DA0B 3VE0A 1X5ZA 5GRWA 4LGPB 4PR5B 4R3SB 4Y5XC 2YA1A 3LIZH 4TNVF 1NC4A 4M4RA 1PBYA 3HUJF 4DVRH 1MEXL 4LSSH 3NABL 5F7UA 2DQEH 4LHUA 2BY2A 3IFLL 3IDUA 1VGKA 3OAYK 3O3DA 3PP3H 5IIEA 5LAXA 3SKMB 2R4SL 4LARH 3NPSB 2FECL 5GZND 4K3DL 1A14L 1QA9A 2APBA 2J4WH 4YHLH 4ONOA 4WU5A 1B0WA 1YNTB 4HX1A 5DUBB 3H9YA 4L4VE 1C12B 1CE1L 2HJFA 2X89D 2ZOLA 4OB5H 3ZKXB 4WDIA 1NBZA 3DMMA 3HCVB 3R06A 2FECI 4PJHA 1DDHA 2E6PA 2NY2B 2CIIB 4YK4C 2E9JA 1EFQA 3DO7B 1SJXA 5IB1B 3SE8H 4PUBH 4HMCA 2OL3B 3PDDA 2P42B 1U93A 1XIWC 5HHPA 2VAAB 3PV6A 2HVJA 4I77H 4QHLB 1Z3GL 3S7GA 3T09A 4OLUL 4XMPH 1GGYA 3E8UH 4YXLH 3WO4C 3MZGB 2Y4SA 4NPYB 5DEZA 4WJ5A 4NO2A 2QKIB 4JN1H 1HKLH 2I25N 4ZS6C 4FABH 2XKNA 3CFDB 4LHQB 3IDIA 4UT7L 3SGKA 3ZHDA 1RK0B 5HHME 3MBEB 5TE6L 3TNNB 1NCCL 2EICA 5DJZB 3X13A 2PYEE 5I71B 4BM7A 3QEUB 2CUMA 2DKUA 5DJ0A 4CJ0A 2E7BA 5EZJA 4WI2A 3MYJB 4F7MA 3NAAL 2OL3L 2OQJB 1C7TA 5E95B 4LIQL 4Z8FL 2EDBA 4M93C 5I0DA 4B50A 2YMXH 3QHZL 1AGFA 4L3ED 3BWAB 2DDQL 2N4IA 3AROA 3CMGA 2PYFA 3NCJH 3OB0K 4NN6B 4ZTPH 3TA3B 4XB8A 3QZWB 4JFEA 5ACZB 3ZKSD 3QUMB 3CLFH 3BYTA 1VEPA 5IVXB 1D5ZB 2H32A 4MYWB 1EJ6A 3B83A 3G08B 3ELAT 5LXGH 1IC5H 5E94B 3RTQD 1FNSH 4M48L 2HA1A 1WBYA 4NC0B 4S1DD 3O2WL 4JFZL 1H5BA 1M05A 3L3DA 4UDTB 3S98A 5K9QI 2R2BB 2H2PC 2Y07L 3WKNA 1KJVB 2NY4C 2Z8WC 4I0PD 5I9QC 3PQYB 5E8EA 4RAUA 5HYSA 1YEGH 1MHHB 4F7TA 1OQOA 1PY4A 3SCMA 3THML 4HK3J 2QSCL 1PX3A 4HS8L 4OCSH 4ISVA 4C58B 1V3LA 5BS0D 3QUML 2FL5B 5MI0B 1DQTA 1F11B 3HE7C 4GH7B 4JCLA 3ILQD 1EEQA 4H1LH 2HG5B 5EPMB 1IAKA 4NC1E 2HLFD 5D1ZA 1WFNA 5INDA 3EGSA 4L8DA 4Y4KC 3MRFB 4JANA 1XT5A 4YXHH 2YWYA 3TN0A 1VFBA 1QFWL 2FDBP 4NKIH 3TV3L 3KPSA 1FZJA 2ZG1A 3V0WH 3QFDA 4X6BA 4PP1D 1JZ6A 3WKML 3V6OE 2XQYG 3DBXA 1JPGA 1ZA6B 2E3VA 3SOBH 1MCKA 1WT5C 5CGTA 5J4MA 1DQLL 5KZCD 3H3BC 5F8RC 1CXHA 5D2NE 3AXLB 1RUAL 4DGYL 1HCVA 4IDLA 4RAHA 4LBEB 5F7LB 1YA5A 4I48B 4UNUA 5I66B 4IRZH 4Z7WF 1QFPA 5EIQA 3ECBB 5IW3A 1IGYA 3IVKB 3UC0H 4X4ME 5D7LA 4LQFH 5J1AB 1QP1A 3MACH 3MFFA 9CGTA 5C2BL 3MV7D 4PJAA 3BHBA 1FV1A 1DTUA 3HPJB 1NGPH 4YHZH 3VWKB 2CLRB 4XBPA 3VW3L 2DTMH 2G5RA 4DKEH 3IS0X 2E7LC 3F6IA 3BO8A 3F65A 3H3PH 2F58H 4X9BA 1HXMB 3V0VA 3RKPA 2EH8L 2IAMB 3FCTA 2V2XB 3ULVD 1W0WA 3P3YA 2ZUYA 3R1GL 5CJOL 2M26A 5HGHA 2EYTA 1KELH 4G9FD 2QSVA 3LVEA 2A1WL 3QUYB 1HSBB 1UQSB 2OX5A 5BXFB 1PJ9A 3UTOA 5JR1L 5JW4Q 4CADB 5GGTH 2Q76A 1CFVH 4Y89A 4JHBA 4PGCA 1UXWA 2DLIA 4IEFB 1BWWA 5EU6E 1DL7H 4WEUD 3O8XC 1XF2B 4ZYKB 2MKLC 3HLAB 3OWEA 4JFFD 3RUGB 5C86A 5JORB 1UVQA 3MUZ1 4ONFH 1CICA 3VGEA 5FM5O 3EYVA 2IG2H 2W91A 2Z93B 1EHLH 3ARGC 4TUKL 5LJYH 1KIPB 3BH8A 4Z7UE 4P23C 4Q6IC 2LQRA 1YQVL 4PRIB 5ALCH 5AZ2L 2VLME 4P4RA 3WV0A 3HNVL 3BAEL 1YEDB 5E8DL 2FO4A 1I8IA 4BSVB 4JO2L 1FL5A 1W72L 4KDVA 5C0IA 3W0WD 2LTQB 3MZTA 4WWKC 3BKMH 4H25B 1RIHH 1X5AA 3K4DA 4H1LA 1NANI 3LRHA 2CUIA 4HULB 1ZT1A 1WSST 1W0YT 1ZANL 4G42A 4PS4L 1SBSH 3I6LD 1CFSB 2NY1D 1KLFA 1OTTC 3H9SB 5BMFH 4E41E 4LSPL 1BQHG 4Z77A 4TTGA 2XTLA 1IJ9A 3JVGA 2DN7A 1RUPL 5GS0D 1NBVH 3NGBB 2XA8H 5AYUH 2V2TB 3U79A 2HT4C 2QQKL 1P6AB 3BVNA 2GJZB 3UTQB 1CF8L 2V17H 4JFYA 1MFNA 1DBJL 5F70A 5KVEL 3IS1X 2NQCA 1E28B 1TVBB 3E6FA 3F58L 2N56A 3TT3L 4CGTA 3RNQB 3ARFB 4GOSA 2R0LL 4D3CL 5IMKA 4F58L 4N5UA 2OK0L 5FF6B 1W8NA 5DFVD 4NNPH 4X6FB 4PJ5E 3I9GH 1O7SA 5D7JA 2MSPA 5IG7B 2UWEA 3ZDZE 5F7NC 3D2UB 3OMZA 4F2MB 4C56D 4Z5RA 4BH7B 1INDH 2GK2A 4QRRA 1P53A 4YNYB 3C6SB 2IH3A 1O0VA 2D7TH 1UWXH 3QJHB 3ZTJG 3F6LA 1EHXA 4TVPE 1A6AA 2ATPA 5KSUA 2PR4L 4O51A 2F5AL 5CP7B 5D6DC 4LVOC 2GYSA 4M6OL 2IALB 4JPIB 5DJCA 1MCRA 1UZ6F 3DTXB 4O9HH 2PW1A 3RZCD 4MXQD 3QWRA 5F1IA 3WIHH 4LLVA 2KZ1B 4FFWC 4KAQL 4QRPB 1F3RB 1D5BA 4J3VA 2ZG2A 1FL6B 1NC2A 2NY0B 4WI5A 3I6GB 4NBZB 2D9CA 3EHBC 1AGDB 1P5UA 1UB5B 2HTLD 1HNFA 2WK2A 5HYJB 4PJXF 3D39A 4Y4FB 1KIUA 3M17A 5TPWH 4IS6A 3C9NA 1C5DA 1EFXB 4JM2C 1S7SB 2Q8AL 4OZIE 1U8HB 3LKRB 4N1CA 5E9DB 5EO1A 2ZJSH 1UEMA 2J5LC 1NGXB 1EDQA 4F7EB 3VFNA 4G43B 4NQTA 4NRYB 4HIEB 4GAGL 4L5FH 4OM1L 2AXGB 4ZOAA 3G6DL 4D9LH 5E6ID 4XCYA 1QFUL 2GUOB 3B3IB 4YHYB 1A9BB 3D25B 3HE6C 4EJ1C 1C5CH 3HRZB 3UPCA 2OXHA 1YDPB 4NKOB 1U8LA 3AREB 4LOUC 4LCUA 5DGRA 4I5BB 4M7JH 4ZUTB 3X14A 1C5BH 2O61B 5A16A 2XN9A 3O3AB 1Y0LB 3DRQB 4OZHB 4NJ9H 4DZ8B 2PCPA 4XCFL 1F4XH 4M1CC 1A4KB 1CXFA 2CO7B 3BE1H 4KDTC 1AR1D 4QOKB 1RURH 3HI6H 3WYRA 3AS1A 4P9HH 4EN3C 3OG6B 5JUEL 1QSZA 4P46A 2X4RA 5IBTH 1JPTL 1ZHKB 4OIIH 5I18H 4PJIA 4MHHG 4JQVC 2UY7A 4X80H 1FYHB 4P2OB 1QLFB 4KV5F 5T1LD 4BZ2H 3VH8A 5DJYB 3GMNA 1NGZB 4Q6YA 5KSBB 1T4KA 4XNXH 2VXQL 4P57A 1DQDH 1DLFH 1B3JA 3GSNH 3UP1A 4MJID 5BVPL 5E08H 4OM0H 4OV6F 4R8WH 2AVGA 2VLJE 1IZJA 3LMJL 5CCKL 2EDEA 4I2XA 1CTNA 2AP2A 2E8YA 1RZKH 4QGYA 1DE4B 3OSKA 5HVFB 3QHFH 4OD2A 4CAGA 3DURB 4YPGA 3UJTH 2PUQT 5FKAA 5H35B 1QYGH 2DLEA 4J6RH 5IKCB 1DQJB 1F4YH 2RFXA 1T0MA 2Q86A 2XY1A 4ODVH 4EXPX 3QRFM 4S2SB 1HHIA 4YDJB 2DQTH 2P24A 4G6JH 3KHOA 3VXNB 3VD9A 2GT9B 4F9PC 1S7TA 4MCYB 1ZEAL 1BQSA 2CIIA 1SJHA 3DUUA 2CDEB 3TIDB 2VN7A 3WIIL 3LY6A 4JFOB 4NUJA 1KEMH 1WAAA 5JQ6L 5DURD 2DS4A 4M5ZH 4U1IB 4WWID 1OP3H 5DK0B 1DUYB 3CCHA 5LGKA 1OSPL 3CC5A 2BMKB 4JFDD 3U36A 2RR3A 2XFXA 4GW1B 3U2SA 4M6MH 4JFHD 1OGTA 1GGUA 4G8IB 5I75B 4NO0D 5GGSY 1UM5L 2NYYC 3P9LB 3KLHD 1T3FB 3B6SB 4J7RA 3KLSA 1TVDA 1HH9B 3MBEA 4CVWA 5D1XB 1QRNB 5F88A 4JPWL 5DJZA 2BCKB 1NCDL 1A2YA 1U8PB 3NFNA 4LEOB 2O26U 1LE9B 4LU5H 5HHMB 1NKOA 2WANA 5JHDA 3BPCA 1YMHB 2PYEB 1LO0H 2F8VA 3IJHA 4KK8D 4J3SA 1XF5A 3WUWA 3SDXE 4BQ9A 3ZL4H 3FONB 4NOBA 2VABA 4QRSB 3I3BA 3KNBA 3BOVA 4EQ2A 2Y5EA 1GHFL 4RMVA 1OLZA 3PABA 1JNHA 4Y5YB 2OJEB 1A7OH 4GG8B 5J7CC 1XR8A 4XNUH 4LDEB 2W07A 2GITB 1EGJL 2UUDK 4HXBH 4C59B 3BQUB 1KCRL 4W4OC 2GY7B 1BIIB 3VFMA 3SO5A 1C1EH 3P9WB 5KW9L 1F3JA 3DROB 3GSNA 1F8TH 3LRSA 3QXDB 4ZO8A 1ND0B 1NCUA 3K8MA 4NQDD 4JFPB 3HG1E 2BSED 1RUKL 4HFWA 4P5TC 4NBYB 3L3IB 3PIQA 3ZDXE 1BJMA 3QCVL 5TH2A 4DN4L 3PQYA 4HWBH 3P4OA 3MA7A 3OKOA 3U1SL 2W9EH 1B2WH 3AS2A 3IAQA 3T4YA 5J6GA 5GS1C 4JPVL 4ODXA 4Z18A 1SY6L 5HDBE 3TO4B 4HIXL 4LASL 4PLJD 2JJSC 2AABL 1OGAE 5H2BA 3HMXL 5I16B 1LE5A 4WUKH 2Z31B 5AD0B 4K8RL 1JHTB 1AP2B 4JO3L 4MMXC 5DF0A 3IAGC 5F7EL 4EI5C 3OKDA 4MAYD 4OCYL 4G80A 1NGQH 3UJIL 1S3KH 2KKQA 3C6LB 4MNQD 3QIUA 4V1DE 2E8ZA 3RVUD 3GIVA 5TDNB 1RMFL 3JTTA 2G5BB 1JGLL 1TZIB 1VPOL 1GYAA 4FQCL 3G04A 5I66A 5L0QC 5K9QG 5C0EA 5C08E 5D2NB 1GOGA 3ECBA 3OXRA 1JN6B 3NIFF 1FFNB 1A6WH 3IVKA 2D0GA 4QRTA 5IB2A 3GMOB 4U1KA 5ALBH 2WQRA 4LLYA 1Z9SA 1NLBL 1Z9LA 3HPJA 4QY8A 1EZVX 4TSBL 3ZKMD 1XZ0B 3OG4B 3VGBA 2GCYA 3BZEA 1HYSC 3SO3B 2P4AB 4YDIH 2R0WL 3N9GH 4HKXB 1C08B 3BXNB 4NP4L 1J05B 2IAMA 1VGEL 3AS0A 5GGRY 2X89A 4IJ3C 4NFDA 4P2QE 1KG0B 4R97B 1NGYB 4NZTL 5DVOA 2GJ6E 2ADFL 3WFEH 5C8JB 2X4NB 5A2FA 3MXVL 1F00I 3VFRA 5IMMA 1QNZH 3RPIB 4BZYA 4JR9H 1IKFH 4R6UA 1HSAA 1OAUH 1YC7A 2NX5E 3VGAB 4DVBA 4ZUSB 2CD0A 4TTDD 3D85D 1KTDA 3DXAD 1G7JA 5LWYL 5ILTL 1L7TL 3F7YA 4PJCA 2KH2B 1FORH 1RFDL 1ZTXH 4NSKA 1EXUB 4EBQL 5JXEC 2FO1A 4A6YB 3CPLB 4OIBA 5D72H 4HWBA 1RZGB 4L8CA 4U6XB 2AJVH 4GW4A 5F1NA 2BRRL 2VC2H 4RISH 1T1WB 2YN5A 1YEDA 2A6KB 1EBAA 1VHPA 3ARRA 4L9LA 1BM3L 1KSRA 5DHVH 3QIBC 4PB0H 3FO1A 4HPYL 4N90E 1CD9B 2A6IA 5I1DB 1A1OA 1H0DA 2WAHA 3I02B 2VDKL 4IMLB 3WN5B 3HN3A 1XGQA 4BFIA 3MSPA 3D6GA 5ECJE 1JJUA 1W8OA 3QPXL 1P7KA 1I7ZA 3OKKA 4L3EA 4PJGA 1K5NA 3DI2B 3KPOB 5DRZB 1HINL 3VXSD 3ULVH 2GK0B 3QP3A 3I84A 1N59B 1JNNH 5IT2L 4WO4D 2H9GB 4E41B 1A1MA 1EK3A 5EO9A 4GRWF 1PQZA 1QBAA 2CPCA 3F7QA 5CSBA 4D0DB 4AEFA 6FABH 3TH3T 1NAMH 3WXWL 2RCSL 3RTQA 2OTPA 4I18C 2D7OA 4POUB 1KULA 4JFXA 1KB9J 1GOHA 4HK0A 2X40A 4XVSL 5IEKB 4LCCA 5EZLA 4G7YH 4P99A 4X6FA 4TSCH 3S36X 4HXAL 5EIIB 1U58A 5EOQH 4I0PA 4KK9C 3MUHL 1YNLL 5K9OB 4HZLA 3OZ9L 4J3TA 1KPRA 4FQLH 4U1LA 1HEZB 5EBWB 1JI2A 4PJ5B 3IU3B 1WBXB 3VXQA 1XIWB 3BDXA 4MD5B 4M8QB 4WHCA 4GQPH 5T3XE 2XICA 5ITBH 5BS0A 1QHPA 1UACH 3QDGD 4WCYH 3GMPB 1G9NH 1IT9L 4YFLF 3QHTC 5CP7A 1LO5A 1KC5H 2FEEL 1F4WH 4Y1AE 5E03A 3X3GL 5IMLA 1I1FB 1AD9A 5FOJA 4S11A 1HNGA 4LLAA 1T1XB 4RX4D 1FAIH 2QQNL 4J23A 1JPFA 3O6LL 3RY6C 3SDYL 2W60A 2FEEI 3QXVA 3L7FB 4R26L 5GS0H 5K59F 1FL6A 4JLRA 5ENWA 1CDBA 1P4LA 1I3GL 1AGDA 1RZ7H 3LPGA 1CBVL 1MCHA 4RAVB 4F57L 4S1QH 4DUVA 3REWB 4R7DA 1GGIH 5C7XH 4XXCC 3BISA 4M93B 3BGFC 4MJ2A 3BFOA 1S7SA 4PJ8D 3MREA 1C7SA 1NBYB 2FR4A 2HKFL 1MJUH 1AY1H 1IARB 1D5IL 1U6AL 1KLGB 1NGXA 1WEJL 5DHVA 5BV7H 3MV7A 4G43A 2VH5H 4OZIB 1UM4H 4P49A 4HIEA 4NO3B 2VAJA 1I9IH 4AEIL 4TVPL 2GFBB 3ULUF 4NO5A 1TCRA 5CD5D 5FM8A 3SE4C 2X9WA 1T0NB 2Y5TA 2VWEE 3O2VL 3HUJE 3QFJD 3B3IA 2C4XA 4M6NH 1A9BA 4PY8I 2W92A 3ES6B 4X99A 4MMZC 4Q7DA 5D1QC 2D2OA 4NCC1 4NDMA 3MRBA 4POZD 2IBZY 3AC0A 3OPZH 1LEIA 2NR6C 2O61A 4G9FA 3MRRB 3LN5B 4M7LH 4IRSB 2NY4B 3VFPA 1S9KC 3LS5L 4JZNB 5I9QB 5T3ZL 2MHAB 4P2RD 4DZ8A 4PJBE 1EEZB 2H2SC 5GJSH 4Q9QL 1MUJA 5IFJB 5T5FH 2C7UB 3BP5A 2AQ2A 3QWQB 4WUUE 5DD1L 3L7EA 2J3SA 4KMTL 3VFGL 4LSVL 4JFFA 5BJTB 1N0LA 4AT6A 4GBXD 1FNHA 4RFOH 5I1EL 3C5JB 4JB9L 3HE7B 4DN3H 3FOLB 4KROC 4P2OA 3QJFA 3WNMA 1FVEB 1PD6A 1UM6L 3ROLB 5DJYA 3VXPA 1J0JA 1S8DB 5EZOH 4Y4KB 3HMWH 3GSRA 3UO1L 2X4OB 3SJVE 1YEFH 4UU9B 4QTHB 3G9AB 2F54E 2AS5M 4YC2C 3AMLA 2ZUUA 3HC4H 3KPTA 4XBEL 4X5XB 1AJ7H 2VLJB 2ZCHH 1NCAL 3GSXA 3VDAA 1YY8A 4H8WH 1U95B 4JVWA 4K3HA 4PRDB 3GEWB 3NACL 1ZGLP 4PTTB 3L3HA 4FQQA 1FVCB 5I8OL 3QQ9D 3UPAA 2FHFA 4MCYA 3QA3B 2NZ9D 3NMEA 4ONHA 2YXFA 2FRGP 2KL6A 3LS4H 3HAEG 4JFOA 3FQTB 1UWEH 1BF8A 2VDLH 4YUEH 4DGIL 3KLAA 2ZUWA 5JXAL 3STZB 1LK3L 3B2UD 5JNYB 1DEEB 3RX8A 3QG6B 3MA9H 1A3RH 1X5JA 4N68A 3WJJA 3WJLA 3MFGB 5KOMC 4O02L 4DK3A 4G8IA 3MO1A 5EBMB 3MRQB 5LBSL 3S3PA 1JGDB 3MRMA 5IGXL 4C56A 1F4AA 1QRNA 3PGDA 3F7RA 2ZUTA 3MGAA 3S88H 1N7ML 4PJAF 4U2YA 4LEOA 1J0IA 4E5XA 1IBGL 2CMRL 3RPKA 1G7LA 5CEZE 4QXGH 2B0SH 3FFCE 1IC4L 3ARGB 3TFKD 2IGFH 2OZ4H 4ODHH 1FFOB 1A7NH 2DRUA 3FONA 4J3UA 4LQ1A 3IJYB 2EYRA 4FXLA 1HH6B 4Q6IB 4AEHL 4LPTA 3Q0HA 1T7WA 3UZEA 3T3MF 3RZCA 3SDXB 4AG4L 4ALAH 1BFVL 5JPNA 5K33A 3AU1B 3DHJA 4GG8A 4NKMA 1BHGA 2HFEA 1BZ9A 5DK2A 4U6VH 4ERSH 1FBIL 1KBGH 1QRKA 1GRWA 4WV1C 3CVHH 2HJKA 3CZFB 4C4KO 4DW2H 4Z7OF 2GITA 3BQUA 2RBLA 4PD4J 3BN3B 3DYMA 5E2TH 5B38B 2ZUSA 3NIGF 4TNWK 3OKMA 5MEPB 2IPKB 1G6RH 2AK4E 1IC7H 4YBLC 3HI1B 3QXDA 1JYVA 1MQKL 1XCQB 2BNQE 1JZ8A 3CFEA 4YXKL 3L3IA 4MXWL 4BZ1L 4F7PB 2W9DL 5FUOL 4Z7WE 1MLBB 3NFPA 3W11D 3LPFA 3HG1B 4UINH 5DZLA 5E6IA 5MP6L 5FYKE 1Q9LA 5CZXD 1A6ZB 4QEGA 1I4FA 1I9JH 1RK1B 4J1UB 1AE6H 3RVXC 3P30L 4N8VA 3JWNC 1UJ3C 4M43H 3SGJC 2IPUG 5DVKA 2CK0H 2R1YA 3O0RL 4X7TB 12E8H 4RWHA 5AD0A 2NXZD 3BDBA 5FGRA 1XR9B 5DWUH 2BSTB 5FV1L 4AY0A 1OGAB 3W39A 1A6UH 1JMZA 5T1KD 2F74B 3NFSL 1JMXA 1WICA 5J1TC 1ZHLB 4O58L 1W2KT 4LLQA 4HF5H 1PG7W 4RDQG 1V7MH 2EYSB 2HFGH 2J1KA 3SGEH 1F6AA 2AGJL 3CSYB 4M4PA 5FCUL 2P8PB 3LN4B 3BPLC 3CX5J 1TZIA 3MRNA 5T33L 4FZ8H 5EZIL 5T1LA 3NCYS 4M1DL 4V1DB 4WFEE 4NQCE 4F9LA 3QQ3A 1N4XH 43CAA 3FZUC 1LMKA 3KXFD 5SWSE 4QHNA 2XACC 5ITFB 4MJIA 2WWMC 2AW2A 4G6KH 1XGTB 2UWEF 3U4BH 4HC1H 4JKLA 3HC3H 5C08B 5KVFL 1ORSA 4NQVB 1IGIH 3ZLQC 1E4XH 4JKWA 5ISZE 4MDJA 1TTFA 2OZ4A 1JZ7A 1XZ0A 4MS8D 2M8XA 2VR9A 2ADGB 5F9AC 4NRXA 2CKBB 1RJLA 1T20B 4UOJA 4FN0A 1WZ1H 3BRGC 1ITBB 5ESVB 4JM2B 3PJSB 5JIIA 5A2LH 1PZ5A 2OJZH 1NGYA 4KWUA 1HIML 4A2LA 4PJ7A 3TYFB 1HHGA 3QPQD 1Q8MA 5DS8A 3CVHA 3LEVH 1DVFC 1JF1A 2NY5H 1UWGH 4OZ4A 3P40A 3RPIA 4KVNH 4MB4A 4CRPA 2GJ6B 1HOCA 2BHUA 5IFHL 3BH9B 1G6RA 4ZUSA 5HHOE 4MA3B 3CFJB 3D3VE 1B4RA 5ESQB 1QLEH 2VDOH 1FE8L 3HE6B 1SVZA 2BY1A 3VU2A 1JWUA 2DMCA 1E27A 5DJ2A 5KVGL 4JFDA 2NX5B 3C5ZC 3OKLB 3DX7A 1J12A 3MOQA 4IOIA 3T77B 3HC0B 1K2DB 4OF6A 3BP6A 4A6YA 4X0KB 1RZGA 4JRXD 4NO0A 1HQ4A 3LD8C 2CKBL 1BQHA 4EEEA 1NMCC 1T1WA 2BC4B 5C0AE 4K9EH 1J8HD 1IGCL 1ZXQA 5I8EA 4BH8A 3HPLB 4UQ3B 4KHXH 3FB8B 3V6ZA 1AI1H 2YD7A 3LKSB 1OAYH 4EN3B 5TE4H 1JFQH 3NN8B 3O6FD 3HR5A 5HD8D 3CLEH 1MJ7L 4XPHL 2KBGA 5I19L 1U2HA 1MVUA 4LP5A 4GXVH 4NKDB 4R2GD 4NGHH 4AMKH 5IVNA 1T7VA 1Q0YL 5JHLH 1BFOB 3A6OA 3DRTB 4PREB 3IXAB 4OV5B 5IR1A 1R3IH 4MQSB 1URLA 5EU3A 3MJ7B 5FCSH 1J7VR 1ADQL 2CDGB 2I5YL 1UZ8B 4G8GE 5IEHB 1QO3B 1UZ6E 4TNVK 4NBXB 3GSOB 3KR3L 5CUSL 2FD6H 4FFVD 4HV8B 1R3HA 2AJYH 2BVPA 2EIZA 4JKKA 4OI9A 3IDJB 4FMKA 4DOHE 3SE3C 4Z9KB 2C1PB 1T2JA 4UT9L 2AJ3A 4N0UE 3O4OB 4PJIF 1RZIB 1KCLA 2HN7B 2HVKB 4CMHC 4NQDA 4KRPD 4HC1A 4WVRA 4HUMB 3JTSA 3ZE2F 3SDDC 2FJGB 1WTLA 4X4XB 2H8PB 2X4SA 1VKXB 4GLRI 3PG2A 2NY7H 4HJJL 5EBWA 4K2UH 1S9VB 5ETUB 4MD0A 2UVEA 3CH1A 1OAZH 4U33A 5E2UH 3HTLX 1A7PL 1TVHB 4FQXD 1HDMA 3O9WC 2SEBB 2WIIA 3PWPE 5BVJA 5J0BA 1DBML 3K4AA 4JQXA 1OCWL 5I73C 5B8CA 3QT2A 2EXWC 3EFDH 3MODL 1IGFL 1NMBH 4V2CB 5KN5A 1G6VK 1I1FA 3QUZD 4FFZL 3MJ9H 3KPNA 3MRIB 1ZKAA 3VI3E 2WWKO 4Y1AB 5FHBH 4K07A 3PXJA 3UYRH 3TCXA 4PRNB 1ZLVH 3M07A 4KI5F 2CR3A 1WAAF 3MUGB 1JHLL 4R4BB 1AO7D 2A38A 1QQDA 1KN4H 2AEPH 1GGCH 2NTFB 2FATL 5HGDB 5CMAA 1J1PL 1QBLL 1TCMA 1UB6A 1QD0A 4Z0BL 3KYNA 1G9MH 3MLZL 4MB5A 1Z9MA 2HWZH 3R0NA 4QWWC 4XPGL 4JN2B 4KV5E 1S5IH 4ZFFB 2FH6A 1MEXH 2EDFA 1IQDB 5T3XL 2DIAA 3WFBH 4Y19B 4OZIA 4L4VD 3IFLH 5BW7A 2GFBA 3FT2A 1NUNB 2A6JA 4LRIA 3UDWA 2UZXB 4MQTB 1QVOA 4K3DH 1XF4A 1A14H 2LV4A 2VLRD 3JV4B 2IFGA 4U1JB 3ILPB 1U8OB 1CE1H 3WHE0 5ID1A 3HUJB 4KGLA 4PJDE 4FQ1L 4ZFZA 4Q2ZA 3CDYA 3MRRA 3LN5A 4IRSA 4DKAA 3QCUL 3OV6A 1OTUC 1N6VA 3O6KL 5GSVA 4LKCB 4MA8H 1IM3B 1EJOH 5AWNH 1N5YH 5JDJA 3WHXB 4N1HB 5CJ5A 1ZGLA 4PJBB 3GBML 1Z3GH 5BJTA 3BD4A 5CINL 3DXAA 1PYWB 3QIWC 4WUUB 5E6YA 4N0FA 2PXYC 5CD3A 5HJ3A 1AXSA 3FOLA 3QUKA 3VRJB 2ICWB 2YC1B 3ROLA 1ZHNB 4ZSOA 4FRWA 3B9EA 1AC6A 2Z91B 1EEUA 4P59H 2IANB 4UTBL 5TE6H 4LKXA 1J1OL 3O4LE 5KS9B 1WVZA 1YEJH 2O5XL 3L3GB 3U9UB 4X6CE 1RPQA 4OLWL 3SJVB 3H2WA 3I2CL 4K8RD 1N6QL 5SX4H 2F54B 2NY6C 3KPRE 4N1EA 2QADD 3DMMC 1YMMD 3MJ9A 3MRGA 3QHZH 1U95A 1CFNB 1IGJB 2DDQH 3LHPL 5TQ0L 4Q97A 4PRDA 1FH5L 5CEYA 3VXSA 4EKXA 4XT1C 1NEZB 3QEQE 5TFSL 3UZVB 5L6YL 3QO0B 3MGTB 4MA1C 1Q1JL 1KCSL 4PJEA 2PTVA 1KPVA 4XPBH 4OGXL 3OAUH 2B39A 2V5YA 4M5YL 2VSDA 2XWBB 4NNYA 1V05A 3JWDC 5C07D 3FQWB 4PB9L 3FN0H 5EIVA 4JFZH 1IMHC 1A3QA 3QR2A 3VDCA 1X5HA 2NZIA 1BX2B 1U92A 4ONGL 1DUZB 4AL8L 4LL9A 3WUZA 1OT2A 1R0AL 3SGKC 1EUTA 2F5BL 4L8BB 5ACLA 4Z7VA 3PWVA 3VCLA 1MOEA 1FL3A 1Q72L 3RWJB 2JIXB 2J88L 1JGDA 3GM0A 4ZFOB 2XZCL 1KEGL 1QEWA 3THMH 3V7MA 2QSCH 3CDFA 3RNKB 3PL6D 2GSIA 2DMBA 5ANMB 3QDGA 2H26B 1MREL 1CFQA 3MRDB 3NCMA 4CDHA 2FGWL 1TTUA 3TP4A 1FO0B 5DYOA 4JJ5B 3V6FB 3IU4L 5I6XC 1HH6A 3FFCB 2GIYA 1KIQA 3ET9F 3NA9L 3MNVB 4RX4A 2DQUH 5F6HI 2P5WD 2BX5A 2HKHL 3WKMH 3MRKA 2VUOA 3W9EB 4L8SC 1CG9B 3QIBB 5JDSA 2CJUL 1XGYL 1H5BC 1MI5B 2H41A 1HHHA 3F5WB 2V5TA 3RUGF 4TRPL 4ZFOL 1MFAL 3MR9B 3SPVB 4JZJA 2IPKA 4PJCF 1MCOL 4PJ8A 3T4AB 5TDOA 1JGEB 5J89A 1R6VA 1T5XA 4X8XA 3QUXD 3HZYA 4P3DB 1YN6B 3SCMC 1JV5B 1H8OA 2AK4B 4F33B 1LGVA 1MELA 5C2BH 4KTYA 2BNQB 1MLBA 1YEEH 1GXEA 5MENE 1DN0A 1G7IA 3NIFE 2C1OA 4LF3A 3QFJA 4EOWL 4U3HA 3K74B 1A6ZA 1BD2E 4RWYH 4Z7WB 4I18B 5D1ZC 2EDYA 3MJGX 4DEPC 4PJ9B 1D5XB 2NY3D 3MV9D 1R24B 1UA6L 5EU6D 4AIXA 2D31B 1G7QB 3QXTA 1AHWB 1CGVA 2A77H 3TN0C 1CE6B 3H42H 1OAKL 1SEQL 4O2EA 4R4FH 2A1WH 3C87A 4U3XA 2Z4QB 2EDLA 4LCWD 4H20L 5DO2C 5FYJD 2VITB 3R0MA 3PHQA 43C9B 5BO1L 1T03L 1WJ3A 4L4TD 5MEOB 4NNXA 4GBXA 4N9OB 1B6DA 2ORBL 3T2PA 5K9JL 2P8PA 3SKJL 3AMKA 4TUKH 3ZT7A 3DX8A 1P7QD 4BKLB 1V3MA 4NCDA 3TJHD 3QQNA 1OWRM 5D93C 1AXTL 5DMKB 1YQVH 5AZ2H 5CFHA 5GGUB 1YY9D 1NANH 1G0XA 3HNVH 3BAEH 4U1GC 2A9MH 4JM4H 4MAUL 2XQBL 1XGTA 1W72H 2W1NA 1SVCP 1ZV5A 5FYKL 1T89A 2FSEA 1MRCH 5SWSB 4U6HA 5HSFA 3I75A 2EIBA 5DK3A 5DRXB 1M7DA 2VDNH 2Q8BL 4NQED 4CNIA 3CXHJ 5BQ7A 3H9ZA 5FO7A 4PJFA 2B4CC 1CTOA 5FDWB 3B5HA 3Q5TA 5BOZG 4MD4A 1ZANH 4M61B 1VACB 4XBGB 1OF2A 5ISZB 3BGFB 4LSPH 4UZGA 4KPHL 1ZSDB 2DQDL 1SEBA 5D7KE 4YDKL 5DUPL 1TDQA 1NFIB 4YQXH 2V7NA 2EIEA 4Q74A 2EC9T 3TYFA 35C8H 1P4BL 1KCKA 4H26A 2QQKH 3NZHL 4RGOL 4BQBA 1RZ8B 1DBJH 1CICC 5C6TL 3CSGA 4OLZL 3FAXA 4GKZA 1VB9A 1XGPA 1II4E 4HUXA 4MA3A 3QAZC 3F58H 4LLWA 5IQ7L 4WI7A 4JY4B 4U7KA 2R0LH 5L8KB 3OJDB 1BEYL 4D3CH 1DSFL 3QEHB 4KKAD 4D8PA 4F58H 2OK0H 1PKOA 3E6HB 2DL2A 3D3VB 3OKLA 4PV8A 3HC0A 4HAGA 3TBYA 4I8DA 1E6JL 5E4EC 3TIEA 4ZS6D 4N0CC 3H7BB 3P9MB 3RQ3A 2XWJB 3RX7A 2D7MA 3GHBH 4HS6A 4YHNA 4Y4HD 3LV3B 5EU4B 4UQ3A 4KQ4H 2HT2D 4JZOB 1NMAL 5C0AB 1FPTL 5D2LA 5CJQH 2DQIH 4JCMA 5FO9A 2F53D 1RI8A 5T1DH 1G7HB 2F5AH 4RGNC 3RX5A 4KROB 2AXHA 1AQKL 3BZDA 4F15C 1FZOA 5CWSB 3JVGC 5T3ZD 4IIQB 3ULVF 4D9QE 4PREA 4OZFG 4OV5A 5LG1A 5HVHC 1ZT7A 1T1YA 4KAQH 1LNUB 3IFPB 1IE5A 1J0YA 5IEHA 4R90L 4YC2B 3NTCH 3TPUB 4PY8J 4PJHE 3S4SG 1NKRA 1ZT4B 1JZ4A 5EBLA 1HQRB 5CIPB 5K59E 1FNGA 2PN5A 4QF1B 2X9YA 2C1PA 5IESL 1RZIA 2BDNL 2NPLX 1XAUA 2QQQA 3KJ4C 1I7RB 3GI8L 4ZUVA 3VRLF 1W72A 4XGZA 1JWSB 5DHYB 3NOIA 4DOHB 4F7CB 4Y8DC 5GZOC 2IQ9L 3H3KA 4HIHB 2CRMA 1VKXA 1LQSR 3V4UH 5LQBH 3U7YL 1FP5A 2B1AH 1B6UA 2QL1A 5ADPL 3MRHA 4OM1H 5F9OL 3K8KA 3B2VL 3R8BB 2VXSL 3RVTD 5A40E 1PAMA 3T0DA 4OTXL 1TNNA 3VMPA 2FX7L 1W0VA 2BVTA 5DJ8B 1M6OA 4XP1H 1MCIA 3RI5K 5SV3A 1TVHA 3TNMA 4ZFGL 1KENH 2FIKB 4PV9A 2YBRB 3AM8A 3TO2B 4RRPA 1KB5B 3HAEH 3TBSA 4JPKH 4ZO9A 4XCFH 3PWPB 2LVCA 4KXZI 5D70H 3MBXL 2AEQH 4AIOA 4TULL 3VFOA 1KFAL 2Y7QB 3MV8D 4FMFA 5FA3B 4FQ2L 4Q9RL 1JPTH 2YRZA 2EIDA 4LDOB 2BOCB 5IFAL 2HH0L 5HGDA 1JCKA 3KYMB 5FV2A 1KGCD 4XZUB 3TVMB 3KXFA 4LGSB 3EOBB 2E9WA 1N5AA 5BVPH 5GISL 3MLPA 1GOFA 1IQDA 3L5HA 1FRGH 4P9ML 5CSZB 4Y19A 3U0WL 3VJ6A 2B5IC 5CCKH 2DWEA 2GAZB 5FO8A 4FXGB 3BYYA 4WV1B 1YYML 4K3JL 2O5YL 1A6TB 2I9TB 3S36H 2WV3A 5F3BB 2AV1A 3ARBC 4KTDL 2EZ0D 2Q3ZA 1TJGH 3U46A 4YDVB 5GGVL 4YBLB 4B7IA 1U8OA 2OR8A 4RA3A 2VLLB 2P5EB 3H7LA 1UEYA 7FABL 2VL5A 4GRLB 3EOAB 2APTA 4PP2B 3P4MB 3ARDD 4HS3A 2GSGB 1A7RL 1YJDH 5FUCC 4D0BB 2QLVB 4XP5L 1JIBA 1JWMA 4XHJC 4QHKI 4R4ND 4PJDB 2GI7A 4P46C 4ZODA 1DN2A 3FO2A 1K4CB 4A2MA 3O8XD 4M7LT 5ABDE 4ZQKA 1CR9H 5EULV 3LKQA 2BJML 3KPSE 1PYWA 1PKQA 2RGSA 1UJ3B 2Z8SA 1CLZL 4G8EB 3VFVA 5TGBA 2YK1L 2ICWA 5KVDL 1WFOA 2AXFA 1U8QB 5GS3A 1UFUA 3KJ6L 1UM5H 1ZHNA 3LEXA 4OJFL 3RA7L 3D18B 4P23D 5B39G 5EOTA 3O3BB 2IANA 4I9WE 5J3HC 2O5ZL 4C83A 1ED3B 1MWAH 1J8HA 4R96A 1KJ2H 3BZ4A 5AYQA 4D94A 3AY4C 5KS9A 1IGTA 3QQ4B 3L3GA 4U7SA 4YFDB 3GJFK 3WXVH 4WWKD 3O6FA 5D7LE 4LLUB 4UB0H 1MY5A 4KK5D 5I30L 3BPLB 3HAEA 4G6FD 4PJAE 3FRPG 1PEZA 3ZKXC 1MFEH 4X6CB 4M62L 5DFWH 5DQ9B 2YWZA 4MSWB 3KDMB 5MERB 1GHFH 5IB5B 2K9UA 1IGJA 2Y6SC 4QXWA 3TH2T 4DQOL 1MF2L 2VTFA 3BKYL 2OYPA 3RWFB 1NEZA 5JO5A 3MCKA 4UILL 1I3RA 1K8DA 4KI5C 4WFHE 1WC7A 3PNWB 3T3ME 3BI9X 1OL0A 5DRWB 4WU7B 3QEQB 4LVEA 3EKCA 5JPMB 4QXTB 3MGOA 2R39A 5LGHL 2GY5A 3Q1SH 3FAWA 3BKCL 2XZQH 3RGVB 4NM8H 4OGYH 5B3JF 4JRYD 3ULSA 5IHBA 4OLEA 4Z7OE 3FT3A 5E00B 3QH3B 5KTEL 1GPOH 4L8BA 3MBEC 1RUKH 2AJXL 3O3UN 3NIGE 4PLKC 1NUFA 2R29L 3HI5L 3QCVH 4DN4H 5CGMA 1DVFB 5SX5K 5HDQL 3SDCB 4X7SL 3W5MA 2UZIL 4YIQB 3STLB 1Q9KA 2B2XL 1D6VH 4JPVH 3VRIB 1Q0XL 3F7VB 1CDIA 5CJXA 3OKYA 5DMGC 3VXRD 2CSPA 1YYLL 4X4YA 4HIXH 2B20A 1XMWA 4LASH 1U36A 1I75A 1T1ZB 5ANMA 1JPSL 1WFTA 1OY3B 2V2WA 4FQXA 2AABH 3MRDA 1DBKL 4PRBB 5C3TA 4XCEB 2IQAB 4K8RH 1FO0A 3FFDA 4NN6C 2BXYA 4JO3H 2X4TB 3TA3C 3QUZA 1RVFL 4P9HC 5F7EH 4MLIA 4OLVL 4PJ7F 4APQD 1NMCB 1LDPH 3UYPA 5DD5L 1XEDA 5E8PB 3UJIH 2X4PA 3SY0A 1L7IL 2LU3A 3EHBD 1AGCB 1MI5A 1AO7A 3KPMB 2YZ1A 2AQ3A 2OM5A 1VPOH 3WEXA 1WLHA 3TBVA 3IFNL 2BVOB 4FQCH 2I07B 3MR9A 4HKZB 3SPVA 4LSUL 3S35L 4FG6D 1MWAA 3IDGA 4QXUL 3T4AA 1KJ2A 3ZTNL 1WBZA 2P8MB 4X8JA 2DQFB 4Y2DD 2YPLA 2CH8A 1RZKC 3QI9D 1EAPB 2BSSB 4JDVA 4WW2A 3CNKA 1JGUH 4HUWB 3WNLA 1IEBA 5DD6A 3GO1L 4P2QD 4TSBH 2OP4H 3FB7A 5AUMB 1MCPH 1OAQL 3JV6A 2UWEE 4P48A 4P3CL 5EOCL 5MI0C 2R0WH 4S1RL 1JI1A 3QDAA 3RBGA 2VLRA 2XT1B 3DWTA 5MENB 1QR1B 2R1WB 2EDOA 4N8CL 4NP4H 1YEIL 1BJ1J 4PJ9A 2BFVH 1D5XA 4QRRE 3PWLB 5DMJB 1S7WA 2D31A 3CU7A 3F62A 3MUY1 1AHWA 2A83B 4XVUC 4LOUD 1QSED 1BD2B 1CE6A 2JCCB 5DQDL 3SDDB 5SV4A 4H5SB 3EO9L 3VGGA 3MLTA 5HY9B 3CZJA 3G9VA 4Q0XH 3QIUC 1TZHA 1N3NB 1MIEL 1IM9D 2ZOKB 2VITA 3IETB 2A74B 1GIGL 2R2HA 4NQSA 2ZZUT 2YRPA 1CU4L 5JW4M 1PG7L 3ESVF 4ETQA 4HWEL 4QTIL 2DM4A 1I7UA 3G5YB 2WW8A 5HGBB 2CDFB 3CXDL 5ILTH 1L7TH 3O9WB 3WIFA 1QSFD 4EBQH 1ZAGA 1MCJA 3EZ8A 4BKLA 1EEYA 2Y25A 5DMKA 5E56A 3VFSB 7CGTA 3GSWA 5C09B 4U6YA 2BRRH 2C26A 2B1HL 3D39E 4KU1A 1N2RB 4KKCD 1SJEB 1T83A 3S5LG 1BM3H 4CJ1A 1FNEA 5DZOA 1ZS8A 4HPYH 1MJ8L 1BFTA 4JKPL 1ZHBB 4Z76A 1IAIM 2IAMC 4CW1B 1NLDH 5AAMA 1WFUA 1VACA 2QQLL 2R1XB 3QPXH 1YMMA 5JOFA 4UQ2B 2PO6D 4Z0XB 3UJJL 2DJ4A 4JY5H 4U1NB 1NCWL 1KTKE 5L9DL 1BVZA 3SEPA 3UBXB 4XRCB 2AKRB 2VLKA 1X44A 3P4LA 1LDSA 1RZ8A 2DAVA 2XN9E 1AKJD 5FYJH 3WXWH 2RCSH 4AQ1B 5C07A 3ZYIA 3B5TA 4MDIB 1KCVL 3MLRL 5GQBA 1CGWA 5HI5C 1CLYH 4XVSH 1QBMH 4EDXA 1IL1A 2M2DA 3E6HA 2DLTA 4Y16B 5T3XD 1CGYA 1LO2L 4HXAH 1UYWH 3FQRB 5C0GA 1I1YA 1YNLH 4HIIA 1BLNA 3M8OL 4G8FB 4PJIE 2NYYD 3O45A 1J8KA 3G6AB 3AAZB 4KJQD 4L9LC 4NFCA 4OCXH 4ZPVB 2AEIT 3NZ8B 4ELKB 4OZIF 3ZE2E 1MPAL 3PGCA 3PL6A 2ADJA 5BZDA 3QIWB 5C9KA 3C2SA 3ARYA 4NZUL 1IT9H 4OI7A 3VE0B 4OI8A 1CI5A 1V7NL 3IGAA 5IVZA 4H0IA 3TT1H 5ID0A 5GJTL 4I2XE 4IIQA 3X3GH 4BK4A 1I8KA 4EUPH 1OP9A 4K3EL 2QQNH 1A3LL 4XVJH 2P5WA 3SDYH 4LHUB 4R26H 1VGKB 3O3DB 1NH6A 5IIEB 5LAXB 2NLJB 3ZSTA 3DVGA 2X42A 2V5MA 4S1DC 2W0PA 1P2CB 5CILL 1QA9B 4BQ6A 1CD0A 2ZWLT 3EOYG 4WU5B 2C3XA 4KKLD 1I1RA 4HX1B 2K3TA 4LCCC 3IDXL 2I27N 2HJFB 2ZOLB 4QCIA 2NY6B 4N0YL 4WDIB 4WFFD 3SKOA 1NBZB 3DMMB 3T0BA 1RHHA 2VJXA 3R06B 4CL7A 1U8NA 4EI6A 5C9JA 2ATKB 4PJHB 1LO4H 4I0PC 1DDHB 1WAAE 3KYOB 1PFCA 4P3WA 2HKFH 3VXTA 3MQIA 4P5TD 4YX2H 4FQIL 5M95B 1U93B 5HHPB 4HIHA 4O5LL 5DMIL 3PV6B 2HVJB 2UYLB 4FP8H 3O2VH 4KH2A 5HPMA 4IM8A 3ILQC 4WJ5B 1BBDH 3EYOB 4NO2B 2HLFC 5FHAL 2XKNB 1FAKT 3MV9A 2RIKA 3IDIB 2ADIB 2YBRA 4LP4A 1KB5A 1QLRA 5JHDE 4LCIL 1P4IL 4HWUA 3X13B 3KWWA 1N64L 5T3ZH 4WGVB 4LCWA 4PBWD 1JK8A 4EI5D 1UH2A 5DD1H 5F3HA 4L4TA 4YFLI 5E2WL 4LSVH 4OCRL 1F2QA 2F8XC 3L5WA 1TQBC 5DJ0B 4WTZG 4PJEF 3TWCH 5EZJB 4F7MB 1RJCA 5HYFA 1HZHH 4GKOA 3IDNA 4JB9H 1DR9A 5BRZB 5L88L 1AGFB 1FCGA 1P7QA 1UM6H 3BRFA 1H15A 3JWDL 4M7ZB 4O00A 5I6XB 1OARL 3GHEL 2XTJC 2VXUH 2FZ3A 3LB6C 4Z7VF 4HG4J 5J13C 3UTTB 4Y5XA 2DQJL 3C09B 1QACA 4RA0C 2ERJC 3RWIA 2XKSA 4OIAA 1JGVL 1YUHA 2BVQA 5I1LB 1RQ5A 4YHYC 5F96L 4NQEA 1WBYB 4XBEH 4YO0B 1H5BB 2I9TA 4XPAL 4ACPA 3ULVC 5FM4A 3AREC 1M05B 3EJZC 3L3DB 1INEL 4EUPA 2IMNA 1NCAH 1G7MA 4HG4K 3ESUF 3VI4E 2H1PH 2P5EA 4GFTB 4RAUB 5E8EB 2HMIC 3CFKA 1MAJA 4F7TB 1RJYA 3INUL 4GRLA 3SCMB 3BT2H 1P1ZB 5I17A 4QLRA 2IBZX 3S35X 2A9NH 4PJDA 4NZJA 4ISVB 5GIRA 5I1JL 2VXVL 4X6EA 3UTSD 3T0VA 3E2HC 3RVWD 4ODBD 5FAAA 4DGIH 1CS6A 4P2OC 5D1ZB 4DEPB 5INDB 2XXMB 3EGSB 4JANB 3L5XH 3TN0B 1VFBB 5JXED 3KPSB 2O93L 1IGMH 4YHKH 3WS3B 3D18A 1FZJB 4MJ5A 5LBSH 1T2QH 4DCQB 3O3BA 3QFDB 4X6BB 4X9FA 4JQIL 3RWEA 3GJFH 3RU8H 1JPGB 3DBXB 1G84A 1G9NC 1NUGA 1N7MH 4KUZH 4X98A 4Y4HA 2DQEL 1CWVA 2VL4A 2BOBA 1IBGH 1TZGH 3CUPA 4JREC 3ZDXF 1A22B 2F53A 5A43C 4OF3A 1IC4H 2J4WL 4YHLL 4KZEH 5E7BA 2VO5A 1IGYB 5F21B 3MLXH 4GMSH 5D93B 4HHAB 5D7LB 4AEHH 2ICCA 1H8SA 4JHZA 5HDBF 2Y1VA 3MFFB 4PJAB 4ZO7A 1FV1B 4MX7A 3E1F1 3RWFA 4DFIA 5MEQA 4XBPB 5HYEA 1JE6A 4PUBL 3HFML 1FBIH 2X10A 2YD8A 3BO8B 4I77L 3V0VB 1TNMA 4RMWA 4LPWA 3FCTB 4QXTA 3UXFA 1W0WB 3EYSL 5HGHB 3WJJC 3WJLC 5DFVC 4JN1L 3RGVA 2EYTB 1ZVSA 2BXZA 4D2NA 1LEKB 8FABA 2EKJA 1U3HD 2Y23A 4C54A 4UDUA 5D1XC 2EKSA 2Q76B 3T2NH 4PGCB 4BZ1H 3CU1A 1UXWB 4AIZA 4CN4A 4K23L 3FQXA 5FUOH 2DKSA 1I8LC 4PJCE 4G6MH 3SDCA 1XCTA 3L6FA 4TUOA 1BZ7A 1UVQB 3VRIA 3EYVB 3F7VA 2QSTA 3P30H 3FQUA 3BH8B 4PJFF 3IXTA 3GI9H 1WK0A 15C8H 3K80A 3RWHA 2YMXL 1ZLSH 3RZCC 3DVFA 3PDGA 4AENA 2B4CL 5E4EB 3C60D 2FO4B 4GQ9H 1MCQA 1I8IB 1FL5B 3EJJX 3W82A 3MJ6A 5I8KH 2DM3A 4OF5A 3CLFL 3T1FB 4XMKH 4TOYL 3MV8A 5E8PA 1CK0H 4NQCD 2KQMA 4TNWF 4H1LB 1XGRB 4L3EE 3BQUC 4PJGE 1MFCH 1IC5L 2GKIA 5LXGL 4XX1E 1ZT1B 1DP0A 4G42B 4ETYA 1HXYA 4KK6C 5EZIH 2FCBA 1IAOA 4Z77B 1JYXA 1OPGH 2I07A 4NHUB 3Q5OA 4F15B 5F9JA 4HCRH 3GJFA 1CDYA 1K6QH 4HKBA 4ZAKB 5CP3A 2DQFA 3BVNB 4YBQC 3S37L 4JFYB 2BSSA 5CHNA 3ZHKA 2P8LB 4HJ0C 4OZGA 1ES0B 5KVFH 1NSNH 3F8UB 1NCBL 3FB6A 1QKZL 4H8WC 4U7MA 1RAMA 4UUJA 2XRAL 3E6FB 1DBAL 4OZFH 2E7LA 3T65A 3O2DH 1I3UA 5IMKB 2DKMA 5D2LF 2R1WA 4LGRB 1WF5A 4CN1A 2Z31C 2I60H 4NJAL 1YPZA 5D7JB 4ZOCA 3BP4A 2X44D 4FFYL 3CDGA 2UWEB 5D1QD 3KJ4B 5CJ8A 5HHOD 1HIMH 2HTKC 2JCCA 5BS0E 1AR1C 2CIKA 3ARDA 5KSAB 4H5SA 1MLCA 4QRRB 4ZG1A 5J6HA 3V0WL 4L3AA 5M94B 2IH3B 2PTTB 2H2SD 3FHAA 1BJ1H 4EVNA 2A74A 3SOBL 4IDJH 1A6AB 2D0FA 5KSUB 4O51B 3JUYA 3QXWA 2NXYD 1H3TA 2ZP0T 5KVGH 4M1GL 2J8UA 5C1MB 5DJCB 4IRZL 4NYLA 3NCYP 5DA4A 3MCLL 2VB5A 2PW1B 3PP4H 3UC0L 1EH9A 3MOAL 4KJWC 5F1IB 3V5KA 3FRUB 4LLVB 4UTAL 5JLZA 1KT2A 4CVUA 5C09A 2YD1A 3MACL 5J57B 3PXHA 1DFBH 1NC2B 3U30C 4YHZL 3L95A 2DWDA 4QRUA 2DTML 4DKEL 4MQXD 4WWKA 3D39B 2MTPA 2QR0A 3M17B 3H3PL 4IS6B 3LKNA 3C9NB 1MJ7H 1C5DB 1N8ZA 2F58L 2XTJE 3MV7E 3O3EA 2VRAA 4HWZA 4G8GD 5EO1B 3HR6A 2F15A 2DICA 1KELL 2BY3A 4DKFL 4Z0XA 5ERWA 3VFNB 4U1NA 3ARXA 2Z0BA 2ED9A 1BJ8A 3SKUD 4DK6A 4UT6L 1ADQH 1CFVL 4MWFA 2I5YH 3WNNA 3ULVE 2B5IB 1IRAY 3JV0A 4G9FE 1FHGA 4ONFL 3GMLA 2HAZA 1U8LB 4WHTB 4MDIA 1X5XA 2IG2L 4HCRA 4M02A 4LCUB 1EHLL 4HUUB 3WFHA 4C57C 2CKNA 4UT9H 2XN9B 4JRYA 5FYLD 3KLHC 1UXSA 4OKVA 4JFFE 1OWWA 4M7KH 5ALCL 2PCPB 4LCYB 4Y16A 1I1AB 1IQWH 1YQ2A 3IB4A 1BVKA 3EDJA 3K1DA 1QPPA 4CU7A 4RBPH 2EH7H 3AAZA 4YZFF 4HJJH 4OZFA 3VRLE 4P46B 3O2DA 1DBBL 2X4RB 1RIHL 1DANT 2KDGA 3VXRA 4PJIB 2FIRT 2VDRH 3DUSA 4OFIA 3U4EA 1A7PH 2FB4L 3VH8B 3GMNB 1T4KB 3S4SA 4P57B 2HFFA 1IGFH 1J5OL 4FFZH 1YN7A 4APQA 4QKXB 4I2XB 1MCEA 1I9RH 4S1SL 2WIMA 3GMMA 1L6ZA 2NLJA 2XXCB 1GGBL 4OD2B 1VSCA 1P2CA 4YPGB 1JHLH 2J8OA 5FKAB 4YDLC 5ADOL 4PJBF 4PY7A 1SYSA 3P0YH 2RFXB 2XNAA 1T0MB 1TTGA 2Q86B 1J1PH 4NQXB 1QBLH 4KVCL 5DFTA 1HHIB 3V79C 2CXKA 4NNPL 2P24B 3MLZH 3I9GL 2ATKA 1ONQB 3KYOA 3MLVH 5DC9B 1QUNA 1MCBA 4Y2DA 1S7TB 3QI9A 1SJHB 5C2UB 3DUUB 4RFEA 2P46B 2ZUVA 5HBBA 5T3XH 3EO1A 3UTPD 3DVIA 4QHKJ 1UADC 4NUJB 1INDL 2Y36L 4YHML 2OTWA 1LVEA 2BY0A 1HYRC 3PWJA 3ZYOA 3DI3B 4GSDH 3BDYL 4HGMA 3L3OA 5CKGA 2UYLA 4PLJC 2EDNA 5KS9F 3CCHB 3CC5B 4K94C 4OT1H 3U36B 1M71B 1OP3K 3EYOA 4JQXC 4C56E 2XFXB 3Q5YA 5D8JL 5L2KD 1QRNE 3U2SB 2DYPD 1JUFA 3LH2L 1OGTB 3BEWA 1U3ZA 1HI6A 2ADIA 3Q48A 1QSEA 4KHTH 5IWLC 2FX8H 4FQ1H 3CSPA 4O9HL 5F88B 2LAAA 2C3WA 3QCUH 1QFHA 1AFVH 1WWWX 1A2YB 1KIRA 4WFGD 3NFNB 4P4KD 4JG0L 1IM9A 1BOGA 4GG6A 2FJFA 5JHDB 3BPCB 4G5ZL 3RDTB 1Q9OA 3IJHB 5DDHA 5CINH 1XF5B 4HFUH 3VD7A 3WE6A 3WUWB 1UENA 3WLBA 2VABB 5TF1H 3KNBB 5BRZA 1QSFA 3DVNA 4J3OC 3O4LD 4RMRA 1JZ5A 3PABB 1JNHB 3B5GA 1KNOA 3RWDA 1KXQE 3H9HA 1XR8B 4UTBH 1T5WA 3T04D 4W6XB 2WUCL 5C0BD 5DD3H 2P49B 3UTTA 3TESA 1NL0L 1E4KA 3KPRD 5BW7C 2WUBL 5KOVC 3W81A 3ZKMC 3QNYA 4L5FL 2O5XH 4LRIC 4TQEL 5I1LA 5B4MC 3VFMB 1FZMA 2R9HC 5HHXL 2WBJD 4OLWH 4XCNA 4E0RB 1F3JB 2CK2A 1MVFA 4YO0A 1N6QH 3GSNB 1C5CL 3LRSB 2VERN 1WZMA 3PWNA 5B3NA 4PRPD 4M7JL 5AEAA 1RSFA 2PO6A 1C5BL 4HFWB 1H3PH 4PGJA 5TQ0H 3HZVA 4IRSC 3PIQB 4OF0A 5GPRA 4HLZG 5TH2B 4NJ9L 3P4OB 3QXAA 3MA7B 5TFSH 2ARJA 1F4XL 3OKOB 5L6YH 1P1ZA 2MQ3A 3OKEA 3T4YB 5J6GB 3BE1L 1Q1JH 3DJ9A 4ODXB 4LPUA 5B39A 4YHIA 1RURL 4OGXH 4TTDC 3HI6L 3OQ3B 4M5YH 1AKJA 1EPFA 4IRJD 4MB3A 4P9HL 3CMOL 2YSSA 4PB9H 3LKPA 2FBJL 5H2BB 1YEHH 3MJ8A 1XF3A 3S37X 1RU9L 5FGBA 2L4OA 5C3LD 1LE5B 4MA7H 4BZ2L 4AL8H 1R0AH 5F89A 2F5BH 4XNXL 3S6CA 2ZPKH 2YA0A 1NJ9A 3C5ZD 3OKDB 4DUWA 1DLFL 2MOVA 4P5MA 2J88H 3WS3A 2DQCH 4G80B 4OM0L 1JNLL 2XPGA 4DCQA 5B3JE 3TJEH 4R8WL 3QXUA 1RUQL 3QIUB 4GAYA 4K7FA 4GW5B 4WW2F 1WWCA 4LAQH 1I8MA 3MMEA 3GIVB 5GSRA 5C0FA 4DFHA 1QFWI 3JTTB 1RZKL 2AEWA 2D7QA 2I24N 2BHYA 4XPTH 4MJIE 3QHFL 3AS3A 1MHPH 3G04B 1GZPB 4WHYG 5C0EB 4Z95L 4J6RL 3V5DA 4RDQF 4FOMA 1F4YL 1J0HA 3OXRB 3G5VA 4OD1H 4ODVL 1RHFA 3IU4H 4R7NA 3EZJB 3HHRB 4JVPA 5IVOA 4HHAA 4G6AC 4QRTB 5IB2B 4U1KB 4G6JL 4LLYB 2VDQL 3QNXA 2ESVD 4QY8B 3BGMB 3MRLA 2HKHH 4HT1L 3SDAD 2GCYB 4U05A 1LWRA 3BZEB 3QNZA 4FZEH 3OGOE 4IHOA 1G9MC 1XGYH 4PJ7E 1OM3L 1RIVH 4QT5A 5DJ6A 1GJIA 2JE8A 2WQ8A 1E4JA 1MCOH 2FHCA 4X7CC 5EOCJ 1LEKA 5CAYB 2E27H 3VFRB 3PWUA 5IMMB 3A0OA 1OVZA 1FQ9C 1HSAB 4JFDE 2HLAA 4DVBB 2BZDA 2FBOJ 1OT1A 1KTDB 4JFHE 1TIUA 4LU5L 1AQDB 1G7JB 4L4JA 1EHAA 1G1CA 3F7YB 1KJ3L 1R5IA 2F19H 4PJCB 1HHKA 1LO0L 4NSKB 4Z78A 4WEBH 5GHWH 2QBWA 5JIPA 2VZTA 3ZL4L 2JJSA 1UA6H 4L8CB 1MSPA 5HYSG 4GW4B 5F1NB 4HW6A 1S78D 3A67H 2PW2A 1EV2E 3X11B 1PEWA 4L9LB 3T1FA 5C0JA 3FO1B 2A6IB 2BNRD 2JB6A 4XNUL 1A1OB 1H0DB 2BERA 3WHE1 1F2XK 1XGRA 5CBEB 5K9KB 4HXBL 1XGQB 3BD3A 4ODUA 4BFIB 2ED8A 2ORBH 1C1EL 4JZJC 5K9JH 5E2JA 1P7KB 3I6KA 4PJ8C 1I7ZB 3OKKB 4L3EB 1A21A 4PJGB 1K5NB 4NHUA 1AXTH 3BMVA 3T08A 1PLGH 5L2JA 4WHDA 2ID5A 4ZAKA 1A1MB 3DNKA 4FQHA 4MAUH 3T0AA 2CGRL 1EUUA 3BPOC 3QDMD 4QWWD 5EO9B 1PQZB 5F7HA 5D5MB 5FYKH 2KPNA 2P8LA 5CD5C 1Z2KA 2FYYB 1ES0A 2W9EL 4XAKE 4NQDE 4K71C 3RTQB 2DM7A 1MFDL 3WDIA 5D71L 4JFXB 3EDKA 2ARJQ 4HK0B 1DJSA 5FA4A 4POZC 1FJ1A 4M9OA 4LCCB 2E9IA 5EZLB 3CVIL 4RSVA 2JJTA 1U58B 4I0PB 5GRJH 3O11A 3UPRA 1H3WM 4YDKH 1F5WA 3DX9B 5JW4R 4HZLB 1KPUA 5CEXA 1GSMA 5IV2A 5I2IB 1KPRB 1ZVHA 2UZYB 3GKWH 4U1LB 4J2XA 5KSAA 3LQZA 3VXQB 1WZLA 3NZHH 3WCYA 3SBWA 4EDWH 1S3KL 2PTTA 4YR6B 3WMSA 4GBXC 4OQTL 4OLZH 3N85H 5BS0B 4MNHA 3UTSA 2MKWA 3LQAL 5IBUG 4LLMB 1ETZA 1LO5B 2Q87A 1DSFH 2PXYD 4FXKA 4UAOC 5IMLB 5GGTA 1AD9B 1Z5LB 3B9KD 1E6JH 2Q3AA 5IHZB 4J4PC 3VD5A 3FRUA 1JPFB 4LRNH 6CGTA 1NC4D 1T89C 2W60B 3OB8A 3VWJD 1SMOA 4JLRB 5IROA 5ENWB 3WLWD 3LN9A 4ZTOH 1P4LB 5KZCB 5HVGB 4D9QD 1TQBB 1UCTA 4R7DB 5T5NG 1FPTH 3MLSL 3N9GL 2YHGA 2YS4A 5E99L 1EMTH 3IRPX 3VMOA 1T04A 2R69H 1AQKH 3MREB 4KI1A 2FR4B 1KXVC 4LSTL 2KZWA 1P69B 3GSVA 4BUHA 4BQ8A 4LPVA 5DHVB 4S0SD 3QQ9C 2XTJB 2Z35A 3MV7B 5J13B 3P4NA 1VESA 3EFFB 1IKFL 2ERJB 4JR9L 4Q9BA 2ILLA 4NO5B 1TCRB 3C8KB 4DKDC 2EE2A 2Y5TB 3RIAK 3B2UC 3ALWA 4X99B 4KKNA 1RJZA 2BNUA 4M8VA 4WHTA 4NDMB 3EO0B 3MRBB 2DBJA 4HUUA 3VI3F 1LEIB 2BSRA 2P45B 4G9FB 5ICYA 4YJZL 5D72L 3VFPB 1U3HA 2AJVL 3FB5A 4LCYA 4QHMA 4TSAL 1I1AA 1MUJB 2VC2L 3BP5B 3DXAE 1KUMA 1EBPA 3L7EB 2IQ9H 3ULUD 1HHJA 3BP7A 4JFFB 4WI8A 1L0XA 2R0ZH 5F9OH 1XGUA 4AT6B 4PB0L 4KGJA 4ZSOE 3SQOH 2NW3A 2JLLA 4OTXH 3E2HB 3TFKC 2FX7H 3Q6GL 1MRDH 5GGSA 3F12B 3QJFB 3VXPB 3QDJD 3S97C 5HTSA 3GSRB 4K55A 1FFRA 5HPOA 3U6RA 2K7QA 5F93C 4JDZA 2DQGL 3C60A 3EOTH 3ULVL 3FL7A 1FDLL 4NRZA 5FUZH 4JFED 4C55A 3W0WB 5C92A 4TULH 1KFAH 1MNUL 3VXMD 1NUDA 2JK5A 4D9RD 2LAGB 5ICXA 4X5WA 5C0CD 6FABL 3NIDF 4RCAA 4PJDF 3E3QC 4FQ2H 5IHUH 5TE7L 3VXSE 4Q9RH 4LSRH 4JREB 4XVTH 3L9RB 1RUMH 3GSXB 3O4OC 1YY8B 5IFAH 2HH0H 4K7PH 3WIHA 2APXA 5GRUH 4PJEE 4NQXA 4HUVA 3DSNA 4G7YL 3L3HB 3TH4T 4FQQB 1ONQA 2XQYK 5FYLH 5I74C 5GISH 4ONHB 4FQLL 2Q6WA 4XXDB 4P9MH 3U0WH 3N06B 3RI5F 2A2QT 3VXUD 1Q94A 4JFQA 4Z7VE 5IJKA 3BKJL 3KLAB 3KPQA 2VR5A 3SE4A 3FO0L 4KTDH 4WCYL 1M71A 5DQJB 1G9NL 3AM8C 1HKFA 5BV7B 1KC5L 5D1QA 2XY2A 3MO1B 7FABH 2NMSA 4X6CF 3MRMB 1VEMA 3MCG1 4C56B 2DTSA 3MYZA 3PGDB 3QDGE 1S9XA 4BJLA 1FAIL 2HRPL 4XP5H 2Y06H 5E6ZA 2Y72A 1ZWIA 4E5XB 3DPBA 3MNZA 1CDGA 1G7LB 5E0QA 1RZ7L 3KVQA 3RDTA 3VXOA 4PG2A 1FNAA 4S1QL 2BJMH 4I9WD 4HGWA 5FYKU 2HP4A 5C7XL 5CZKA 2EYRB 1CFTA 1CLZH 3EJYD 2G60H 3SE9H 1KCUH 5KVDH 2DI7A 4GKSA 2VISB 3L3JB 5AZEH 1FG2B 3JWOH 3RZCB 3RA7H 5JPNB 4NKMB 5DR5L 3I3EA 2HFEB 4J8RA 1BZ9B 5DK2B 2D4DA 3D0LA 4CVZA 3CSBA 2VH5L 2VZVA 3GRWL 3DO3A 2HJKB 3V4VL 1I9IL 2W59A 4W6YB 3OR7A 3UAJD 4E0RA 3VGHA 3OKMB 1FGNL 4PPTA 4ENED 5I30H 1MJJA 5F9DC 5GRYA 8CGTA 3TBTA 2RHEA 3FMGH 2VWEC 3CFEB 3UX9B 4M62H 3IKCA 1N26A 4ODWB 4ZXBD 4RZCA 1KLUA 5C0ND 1MF2H 3QFJE 4M7LL 2V9TA 3NFPB 5T5FL 5D9SB 5E6IB 3MRPA 4XH2A 1Q9LB 1TPXC 2IFFL 2H6PA 4ODTH 1I4FB 4XP9H 1DQQA 4PJXA 1BQLH 4N8VB 1CICD 3DETC 4G9DA 3EDEA 3GJEA 4RFOL 2R1YB 4BYHA 3CD4A 1D3CA 3BIKA 2C3HA 4DN3L 2YZ8A 2PKDA 3T0ED 2FJHA 4GT7A 1JP5A 5EC2A 3IDMA 32C2A 3EDFA 5KSVA 5KTEH 1TENA 3W39B 2AJXH 3TBWA 1PVHA 1B9ZA 3I50L 1KF9B 1U2CA 3RL2B 1YEFL 5HDQH 5CGYD 4HK3N 4XNYL 2IADA 2YEZB 1CD1B 2DBLH 1K85A 4LLQB 1CYGA 3RGHA 4GW5A 2B2XH 5JW3H 4OZGF 2NW2B 1AGEA 1F6AB 1Q0XH 3OKNA 3HC4L 3TZVA 1SBBA 3OR6A 3MRNB 1AJ7L 3MLUH 5I1KH 1JPSH 3BJLA 5T1LB 5IB3A 3QQ3B 1GZPA 43CAB 4XWOC 4H8WL 5M7QA 3S34H 2V5RA 4QHNB 5C0DA 4POYA 4RGND 1YPZF 4MJIB 3TYGH 3LSOA 1RVFH 4PGBA 4PJFE 4I4WA 3D9AL 1A0QL 1JTTA 2JCCF 1ORSB 4LLDA 4KMLB 2IPTH 5DD5H 1CVRA 3TEUA 3U30B 3BGMA 4MDJB 1EO8L 4FFVC 1L7IH 1UWEL 4NRXB 4DTGL 1RJLB 3AB0C 2VDLL 4YUEL 2AQ1A 1PZ5B 3MA9L 1A3RL 5GXBB 4YFEA 1AD0B 2J8UF 2EECA 3QZWG 1I85C 4PJ7B 4QXUH 4D0CB 4ELMB 1HHGB 1GAFL 5DC0A 3CVHB 5DS8B 1JF1B 4UIKL 2YUXA 4OZ4B 4PRHD 1OSZA 4GS7B 1HOCB 3EDDA 3HS0B 3GSUA 5CJXC 1U8JA 1MCWM 1P9MA 5DURB 1G6RB 2GHWB 5D6CA 1OAQH 5EOCH 1AQDA 4FQXC 1JWUB 5DJ2B 1E27B 4JFDB 4S1RH 5EH1A 2B0SL 1ZA3A 5L2KA 4IOIB 3DX7B 2DYPA 2IGFL 1YEIH 4ODHL 5GGVY 3BP6B 3IFOA 1A7NL 1YJDC 5KJRH 4NO0B 4KUCF 1HQ4B 4MCZA 4NFBA 3GNML 1D5MA 2ZCLL 1BQHB