1LK2B

1.35a crystal structure of h-2kb complexed with the gnysfyal peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title A peptide that antagonizes TCR-mediated reactions with both syngeneic and allogeneic agonists: functional and structural aspects.
pubmed rcsb
source organism Mus musculus
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk2B00
4TULH 2DKUA 5IEKB 2CPCA 1GGTA 1U58A 4Z7WB 1MCPH 1T5WB 3RI5K 1K8IA 4HIXL 4LSRL 3V6ZA 2DMKA 2YA2A 1G7PB 4GMSL 1YNLL 5KVEH 1QACA 5DC4B 2FX7H 1MEXH 3S96B 3P4NB 2R0KL 3DX9A 1OGAE 2BVYA 3OAUL 4XWGL 1AD9A 5K9KA 5BVPL 4WIQA 1EJOH 4PLNC 1NBVH 2ZUXA 4ODTH 7FABH 3D0VA 4EIZC 5IOPA 3DVNB 4JJ5B 4DJMA 2Y5EA 5BS0D 5BMFL 3R8BB 4X5XB 3WXWH 2VLJE 2BSED 1RUML 1O0VA 2IANE 5MHSD 3ZKXB 3NVQA 1DSFL 1QFWI 4EVNA 1NAMA 3IAGC 2FLBT 4K23H 3U4BH 4GRLC 2PTUA 2RBLA 1GCFA 4JGUA 3IKCA 4BFIA 3T65A 3QI9C 4IRSC 1MFNA 5TDPB 4LCUA 2IGFH 4DVRL 1H3PH 4R4NC 3FQNA 4I77L 4X6FB 2JJVA 5F8QC 1MRFL 3AXLA 3KPPA 3P0GB 3MLUH 4L3EE 1A3LL 4QRRB 3O81A 5L0QB 1U92A 4U0RB 1MHCB 4HUVA 4A6YB 2EYTA 1HWGB 1FZOB 3ARDC 4BFGA 3B5GA 1DQQA 1P4BL 1KBGH 1K3ZA 3LKRA 5E8OA 5ITBH 4MYWB 4ZNEE 1Z9MA 4E42A 1EAJA 1S7WA 1F5WA 1NMCC 4NO3B 2WIMA 1CYGA 3T0WA 2EDWA 4Q2ZB 2DF3A 3LEXB 3O2VL 2J2ZA 5E2WL 1RD6A 1JF1B 3WKNA 4FQCH 5J13B 3BYYA 2HT4C 1DL7H 1M7IA 5LVEA 1KJMB 2IQAB 3MACH 5CJOL 3L5HA 5KSBA 4I9WD 4NQVB 3RZWA 3MRFA 1WQVT 2VLME 5IIEA 3DRQB 4ODSH 1J0YA 1G6RB 3D39D 2VLRB 3SDAA 4QRPD 4HLZG 2VABA 4OD3H 1WIUA 1LNUA 4NO5A 2GT9A 4YX2H 4YK4B 3NCJH 5HY9A 2X42A 3R0MA 1WV7T 1G6RH 5TE7H 1H3UA 4CVXB 5F88B 4PGDB 4F7EB 4OUOA 3MREA 3RGVD 5FUOL 3UYOD 2Y36H 5CFHA 2GITB 3MRRA 4N1EA 3FAXA 3QUZB 4LASH 5EWIH 2UUDH 2OTWA 4P2RE 1ZT4A 2G5RA 3RIAF 1T5XB 3L1OL 3O4LA 5TH2A 4PRPA 4NQDE 4F7CB 1X5KA 5HHMD 3RZCB 1BBDH 3MROB 4LSTH 5KSBF 3LB6C 4YHMH 2PW2B 1OARL 4FXLA 6FABH 5SV4A 4D8PB 1H3TA 1A9EB 2NX5D 3K4ZA 3EGSA 2R69H 4UTBL 3C09B 4WVRA 3S37X 3RBGA 2NY4C 1R3HB 3B9KA 3WO3B 3DSNA 3A0OA 5DRWB 2CGRL 3TJHC 1DQLL 1A21A 5DZLA 4BFBD 3FO2B 2ZUWA 4HC1H 4HPYH 5KS9B 3RP1A 1S8DA 3D2UA 3UEZA 4Z7NF 5HYSG 2ITCB 1G9NH 2WINB 2EDLA 5HYQB 5FYJH 4KKCC 1YPZF 1LEGA 5T3ZH 5JIIA 2H9GB 5C0CE 1T7WA 2BRQA 3KXFA 1VFUA 2DQJL 1LK3H 4NHCL 1PGRB 3D85D 3MV8A 4KJWD 4P2CG 3PWPA 1M71A 2G75B 3AM8A 2HG5B 3BP5A 3MCG1 3MGOA 1TITA 3WEXA 3BDYH 5DHVA 3LEYH 1L9MA 2VISB 4EUPG 1SMOA 1BZ7A 4YIQB 4FA8A 5J11B 2GSIA 1NGYA 3FQUB 4LNRA 4BSWA 4NYLB 5BXFB 5EBWB 3IGAA 4PJ8B 1CFQA 3ARGC 4C4KT 1I85C 2BC4A 3VG0L 3MNVB 3WFDL 4PREB 3B3IA 1WK0A 4OF0A 2CRMA 5MENB 1SYVA 5DGRA 1J1XL 4O5LH 1K4CA 3EJZC 1QOKA 1P4IH 4EN3A 3LN4B 3O6FD 1KPRB 3BVNA 3ZKSD 4DTGL 5L88H 1P84J 4C57C 2XPGA 3QDHA 4MJ6A 5DA0B 3BD3A 2V2WB 3W9EA 2E7LC 5AG8A 1JK8A 1T2QL 3IF1A 4PD4K 3MRLA 3ZZ1A 2CDGB 4IHOB 3LKSA 2DQGH 3HC3H 1RU9H 5JNYA 4UILH 1DVFC 3RWCA 3DARA 5D2LF 3RL1B 2EKSB 1KB5B 1UM6L 3OB0K 1HXMA 3V7MA 2Q76B 4ZDHA 4HUWA 1KCLA 5JQHC 5HD8D 4P3WA 4MSWB 3GI9L 1ZE3C 2F53B 2J1KA 5C09A 3RFZC 4ERSL 3FFCD 1FJ1B 4PPTA 4E0RA 1KLGB 5D7JA 1L0YA 1C12A 1KB5H 4JDTL 4X6CF 2QSTA 1DN0A 2DKMA 4JLRA 1UXSA 2DQFA 2VZSA 5KJRH 2ORBH 1H15B 3THML 1XIWC 1ORQB 3CK0L 1GYAA 2CRIA 1GAFL 1JZ6A 2F5AH 2DIJA 4PY8J 4RRPG 1YY9C 3VGGA 2FIKA 1TZHA 1TPXC 3S96A 3U2SB 5AZ2L 3QSKB 1VHPA 3DI3B 1IGTB 4QT5A 1KB9K 1D5ZB 4IBLT 4YBLB 5I2IB 4PJGF 3HRZB 4Z7VA 3OTTA 1BQUA 4YHOH 2AGJL 4I0PB 4JJ5A 3QBTB 3MOAH 2CKNA 5D71H 1U8IB 4X5XA 5F7UA 3NZ8B 3EO9H 1IILE 2VDKL 5D96C 3NGBB 4XNXH 5C92A 4Y5YA 1GVIA 4GKSB 3DSFH 3QAZC 1Y6KR 1G1YA 2MCPH 5HYEA 5DHXB 3FMGL 3LV3A 1YEJL 3WNKA 1VENA 2MHAA 1DQDL 4HF5H 5JXAL 5FM4A 1BFOA 3LRGA 1FZKB 1ZLSH 5JXEA 3AAZA 4G8GA 1T03H 4NZUH 3U36B 3EO0B 1EEZB 4JFQA 3IXTA 2HJLB 4LCCC 5EB9A 1BLNB 3G6AA 2NCMA 4DKEH 3LS4L 2P24A 4H8WC 1MQKH 3HHRB 1MHCA 5E9DB 3UTSB 3TA3B 3T2NL 4C56B 3RVUD 3WJJA 1FZOA 3N9GH 5B39G 5KVFL 1WZ1H 1L7TL 3G9VA 4GW1B 3FO1B 3MCKB 4Z7VF 3IRZA 4ISVA 4NO3A 3CLEH 1TQBC 2FECI 2DJSA 1A0QL 1NGZB 3IDIA 1M7XA 1XF4B 2CLVA 3VXQA 3BISA 1IVLA 3Q3GA 1FN4B 4U4BA 1KJMA 1XT5A 4P9MH 4L4JA 4PGZA 4ONGL 2PETA 3B9AA 4OLEA 1JGVL 1OT2A 2EH8H 5D7SH 1OW0C 4G43A 2NY6C 4D3CL 3U0WH 1MFAL 2CLZB 2VLRA 3HNTH 3Q6GH 3GBMH 2FJFB 3KYAA 1JGDB 3VWKA 2X4NB 3RRQA 4O58H 1J87A 3MCLH 1U3ZA 2LTQB 4EI5B 1URLA 5F7NC 2G2RB 4CJ0A 1OCWL 5JOPD 5I18L 2VDOH 4IJ3B 1AQDA 3CSBA 2H2PD 4KKAC 5DA4A 2N4IA 5F88A 1MH5B 2V2XB 2ATKB 4NBXB 4YHZH 3TP4A 3QNYB 4MXVF 1RHFA 4XBGA 5F1NA 4DVBA 1WEJH 2J5LB 3IXAA 2GAZA 3WS3A 1NMBH 3O4LD 3ZKMC 3NABL 3MLWL 4XP4L 4PRPD 3S4SG 4L4VB 4F7CA 1PG7H 2HA1A 4HKXA 4RGNB 4BJLA 4QWWD 4HLZH 3FO0L 4JHWH 3VU2A 3VG9B 4YHLH 2ZKHL 1KPVB 4D8PA 4GG8B 2HWZH 5IW6B 4U3XA 3SY0B 5H94B 3EYUH 3C87A 1IAOB 3GHBL 1TZGL 4PJEF 1NBQA 3EOBB 1R3HA 5MP6L 3B9KD 1TJHH 1YNKL 4NBYB 3DHMA 4JFDA 4TOYH 2KKQA 5DVOA 1I8IA 1R3JB 4JKMA 3CAFA 3BGFC 4HT1H 4IIQC 1FL3A 2Y7QA 3CIQA 3P9MB 4BK4A 4ELME 4QHNB 1GGBL 1KPUB 4EZMA 1S5HB 3VI4F 4CMHC 2GTZB 3F6IA 1N5AB 1MHPH 1Q0XH 3FN0L 5M95B 3D2UD 5MEQB 4GJTB 3LQAH 3MJ9A 4LLDB 3KPRB 3V6OA 4YWGL 2VDPL 4KTYA 4TVPD 1ZHNB 3SKNB 2AEQL 3KXFD 5CWSA 1IEBA 4XXCC 4JHBA 5GGTA 3O3DB 1D6EA 3Q1SL 5TFSL 4DFHA 3WIHA 3PWPD 4OB5H 5I66A 4JDVB 1NGPH 3V95A 5C8JA 1HNFA 2FEDD 4LDLB 4KVNH 3OHXB 4ZFGL 3CFIC 4JGMA 1DBAH 1Q38A 1E28A 5M94B 3N06B 4K9EC 1Y0LB 4PJXE 4JFFB 3ZDXE 3ZTJG 2BVPA 2VLKE 3I2CH 2ENSA 5INDA 3BGMA 1NGQL 2LV4A 1X6LA 2AVGA 4OZFB 1IM3A 1S3KL 2EXYC 4NYLA 5BXFA 3CH1B 2VN7A 3QFJB 3SJVE 2NY7L 2YPVH 4JO4H 4HWBL 3SHSA 3K74B 1G6VK 1LWRA 4WTWA 2BFVH 3HUJB 5DYOB 5K9QG 5DMKA 1T7XA 2XQYG 1NCDH 1M7DB 4XI5D 4XVJL 4CU6A 3EAKA 4HJJH 2ADIB 4LHJB 5F7DA 4J3SA 3LN4A 2VDNH 2HTKC 3EYSH 1S5IL 1S7RA 4P57A 5EG6C 4YBQD 1QPPA 1FDLL 1WZMA 3JUYA 2CLRA 4PJBB 2V2WA 3RWHA 4EUPH 2XXMB 3TO2A 1XGRA 2N56A 1U8PA 2BY3A 3KPMA 2Y06H 3E6FA 1OP3K 3S35L 5TF1H 5CEXB 5GIRB 3WSQL 3TF7C 2A0LD 1S9XA 2ZNXA 4UB0H 2YZ8A 2Z91B 4OLYH 5IV2A 3RL1A 2H45A 1JWUB 3CVIL 4PGBB 1ZLVH 5I17B 3IDMB 5KVMC 5LGKA 5ANMB 4LSRH 5DZNA 3SGKC 1VFAB 1ZS8A 3G04B 4PJCA 2B5IC 3O3UN 5C0EB 5GS0C 5DR5L 1QLFB 4PJIB 4XWGH 1OB1A 5BVPH 1NGXA 2ICWI 2R39A 2OLDA 5JLZB 5DD1L 1UWXK 3T3ME 5JDJA 1R5WB 3S36X 2Z31A 3WV0A 3TZVB 5IR1B 3QHFH 3FFCE 5F1SA 3T0EB 1RUMH 2AERT 2GJJA 4KJPD 5CLTA 4NDMA 2X5PA 4WEBL 5IP4A 2FJGB 4B53A 3U2SA 2XIDA 1U8KA 4Y19A 3MV9B 5IBLC 3CXHJ 2C3VA 5A2LH 2DM7A 4HV8B 4LQFL 1NCAH 5E2VL 3C9NA 5JUEL 2B0SL 3H9HB 4DVRH 4JFXB 4I77H 5FKAA 5DC9B 1MRFH 4YUEL 5DLML 3HG1A 2NMSA 4LVNC 3C8KB 3EJYC 1BAFH 4YEEA 5E0QA 2X4OA 5C70A 3OWEA 3MQIA 2X1QA 3VDCA 1BM3L 4Y2DC 1JE6A 5D5MB 1KT2A 1I7TA 1X5HA 1ZHBB 4MZ2A 5JW4N 5JXED 2H26A 4PGJA 3CX5J 2GJZB 4G8GD 4APQC 2EDKA 2Q8AL 4OLWL 3O2VH 4O2FB 3WFCL 2Z8RA 3QUKA 4R2GB 4LF3A 3QIBC 4KRLB 4MWFB 5CJOH 3M8OH 1KENL 4PY7B 4ODUB 3UTSA 5E6IB 3TA3A 1OM3H 2R9HD 2Q6WA 2A6DA 3OMZA 4NP4L 2VE6A 1QO3B 3FRPA 2IPKB 1B0RA 1I7RB 3AU1B 4TPRL 3BJ91 3SDDC 5JTWA 1CCZA 2YBRB 1XF4A 3VFPB 3O11B 3O9WB 1F42A 5CP7B 1ACZA 2GK2A 5ESAB 5CEZL 4MD0B 1J8KA 1F8TL 1BHGA 3F7PC 4XTRD 5F7KC 3RDTC 1OOAA 1IT9L 3EYVB 1JBJA 1KTLA 3KYOA 1F4AA 1IKFL 3AS1A 4OF5A 5IW3A 4P5KA 1Y18A 5E5UB 2NY1B 1J1PH 1CGUA 5EOQL 2EIEA 4KK9D 4OCNC 2VLRD 3O0RL 4JAMB 1A2YA 1OTTD 3VWKD 5IVNA 3L3HB 4OLVH 1KIRA 4ZAKA 3PHQB 2AAVA 2X4RA 3MMEA 3F7YB 3JV6A 1K8DA 1N2RB 1OARH 4RAVB 4R7DB 3O2DL 4XPHL 1HQ4B 1M6OB 5J6GB 1B9ZA 3HR5A 1FL5A 4HDIB 5EUKA 3U30C 1CLOL 4P2QA 4YDIL 2EYSB 3QIWB 1W72A 2IEPA 3L3OB 3QUZD 1T0NB 2K9UA 5JOPE 5DJXA 2CGRH 1DQLH 2UV3A 4N90D 4MHHI 4H20L 1SVZA 2ZCHL 4M1CD 2FBJH 3VMOA 3KLAA 2Y6SC 3VRIA 3CZFA 4YLQT 2AJYL 3HE7A 4GG8A 2DL2A 4JY5L 5HHPA 5L7XL 1U93A 2BMKB 5I73C 3MUY1 5CZKA 1DUZA 5IB2B 1KTDB 2YXFA 3VFMB 1UKTA 5BW7A 3LPFA 4JFDD 1IKNA 1NUFA 3E6HB 2DQJH 4NHCH 1BECA 3B8SA 1N7ML 1KFAL 4XB8A 4FNLL 1DANT 2NR6C 1HH6B 5E94B 2X40A 4BKLB 4RA3A 3ARWA 3FB7A 3HMXH 5F89A 5D70L 3QEHA 1UH3A 4OQ1A 4K7FA 2ADFL 4WEUD 1OAYL 4LKCB 4YXKL 5MEQA 4WV1B 4LLDA 1AHWC 2X09A 3SKNA 4JQXC 4XP5H 1Q9WB 3NTCH 2HYMA 1RJLB 1QHOA 5F7EH 4PJHF 3WFDH 4ZTOH 5DRNA 1KLFA 4PJDB 4Y8AA 1DE4B 1J1XH 4X98B 2DM2A 1IEAB 5EOTA 4DTGH 4XX1G 4ZOBA 2R4SL 4L3CB 4XCEA 3B6SA 1HDMA 2F19H 5T3XL 5J6HA 2FEEI 4DAGH 4M93C 3OXRB 5DWUL 2GSGB 3LDBB 1JN6A 3TNNA 1U3HC 5DD0L 4KAQL 1TDQA 3BW9A 1B6DA 3ZHKA 1XGTB 1TVBA 3F62A 3MZGB 4X5LA 3PGCA 1YMMB 2EDHA 3UJTL 4XWOD 4Y4KC 4FQ1L 4O9HL 3VXUA 1A1OA 3VD3A 3CSGA 4NN7B 4MQTB 4U6VH 4Z7OE 3DO7A 3CD4A 4I5BB 3VJ6A 1QFHA 2VXTL 3GI9H 5JZ7C 4MQ7B 4ERSH 4P46B 3P11L 2FR4B 1L0XA 1TNMA 5L2KE 4YH6A 1NDMB 4JDTH 3OKOA 1NAMH 3FB8B 4WI4A 3W0WB 2GJ6A 2J4WL 2Z91A 3SGJA 3GK8H 3AREA 1H8SA 4M48L 5EFIB 5D1ZA 4FXGB 2D9QB 5I17A 4WGVB 3CK0H 3VFTA 12E8L 4AT6A 3CFEA 2ZUSA 1K5NB 4H1LA 1MCRA 1LP9E 3RVTD 2NY2B 1J8HB 4TRPH 4URTB 5F1OB 5AZ2H 4PJIA 3IRPX 3V5DB 4W4OC 3VGFA 5F97E 5JORB 3GMNA 2Z31D 3MRNB 5FHBL 2YC1A 5IMLA 4HMCA 2IALB 5IR1A 5FV1L 4QLRA 3S9DB 2J6EA 3T0EA 2PYEB 2VDKH 4NQSB 3U9UB 5T1LB 4WWKC 2ICWJ 3U0TB 4G42A 3KS0H 4Z7WE 4Y19D 1OAKH 3MV9A 4MZ3A 4FFWD 1MCBA 1VGEL 5ELIA 1HCFX 5IMKB 3GSNA 1CGWA 1TXKA 4BH8B 5EIQA 3RWFB 4M4PA 3L3JB 2HJKB 3HG1D 4X80H 3GIVB 3D48R 2RGSA 3LS4H 1X6NA 3QUML 1MHHB 4WTZG 3T2NH 1F6FB 4WI7A 1MAJA 3MR9B 1YPZB 3MRHB 4G6MH 1YEDA 4S1SH 5B3NA 1X5ZA 5LQBL 5F3HB 3RQ3A 5CIPH 4F7TA 1MCEA 1KIPB 2V9QA 1GGYA 1I8KB 2AV7A 3PGDB 4N5UA 4CN1A 3VA2C 4PJAF 1A0QH 2HKHL 3RX8A 4FQ2L 4O2FA 3KLHD 3JWDC 3QI9B 4IRSB 4MWFA 4PB0L 4PY7A 2XG4A 4ODUA 3UTSD 4TSCL 3TA3D 2BHUA 5DJAB 4UV4L 4AIXA 2BRRL 1SQ2N 4FHBD 1VFBA 4QRRE 5EU6A 5F9JB 5IVOA 1QO3A 4D3CH 1MFAH 4FP8H 5ECJE 2HFFB 3AU1A 3GSUA 3ARDB 3MLTA 2O5ZL 5IKCA 4UDUB 1JPFB 2WV3A 5TDOA 3VFPA 3O9WA 4KDTA 1G84A 1ZSDB 1BFTA 1OCWH 3NFNB 5I18H 4LOUC 2YWYA 2BVOA 2DLTA 3GMLB 4PB9L 5ID1A 5D1QC 1Z3GL 4R96B 3OB0H 3HAEA 3RPIB 2JIXB 5DS8A 1CXFA 1YEEL 2YEZA 3BN3B 3NABH 3MLWH 4R8WL 3QJFA 4XP4H 5JO5B 4EI6A 4ZAKD 2XZCL 1PEZA 4ODHL 3UTTB 1JRHH 4RMWA 4OZIB 1OT1A 4QF1A 3MFFB 1C16B 3MGTB 5ENWB 2ZKHH 4N0YL 2MQ0A 3C60A 5J6GA 1PYWB 1WBYB 4WJ5B 3BUYB 5CLWA 1L7IL 3GHBH 4P2QD 2EYSA 2DYPA 5DHVH 3QIWA 1NCCH 1S7SA 3CFDA 1A6ZB 4NQEA 1BREA 3EYQD 3MV01 4XMKL 2HRLA 3CNKA 1ZLWK 4UIMB 4AIZA 1RK0B 5KTEL 4XCYB 5EBLA 1B90A 4G8EB 4XAWH 4L4VD 3TEUA 5BZWA 5DJ0A 1GGBH 4ODVL 3I50H 4MXWL 3HZVB 3O8XC 3HE7D 4ZXBA 3BN9D 5KANG 3SDXA 5CEYB 2IWGA 3NA4A 1JI2A 4NQCA 4YWGH 4ODWA 5K59E 2VDPH 4G8FB 1G7HA 3VFMA 1OLZA 2AEQH 3WIFA 2FX9L 3LKNB 1QVOA 3E6HA 3H9SA 4Y1AB 1XF2B 1FVEB 1PW3A 2MNUA 4PJGB 3Q1SH 5TFSH 4MCYB 1HYSD 3RVXD 2NY4B 1AQKL 3QDMB 3BEWA 4BQBA 2X9XA 5E94A 4RNRB 3CFCH 4ZFGH 3WNPA 5GGVY 4L29A 5CBAA 4OGXL 4J4PD 1VACA 2ZWLT 3V0AC 2GK0A 2Z4QB 4G9DB 3UXFA 2Q7NA 2VDRL 2X4PA 5HGBB 5ABDE 5D72L 2X44D 3KPRD 5ILTH 3GM8A 1KEMH 4H0HB 3G5ZA 4OF8A 5I74C 5KS9E 4HWBH 1Q9WA 2R23A 2MQ3A 3VDAA 2E9BA 1RHHB 3UMTA 1F4HA 2Y5TA 3HR6A 5EZJA 3G08B 5EOCL 3UPRA 1U8NA 1HHKA 3KAAA 4XVJH 4AEHH 3SDXF 4Q0XL 4X6EB 4YNYB 1S5IH 1SYSB 4LPCA 4IMLB 4DGYL 4L3CA 4R3SA 3F7VA 5E99L 2V9TA 3MRDA 5JA9A 5CILL 3MBEA 3OB8A 3QQ4B 1F6LL 3TFKC 3QFJD 4CW1B 4YHPA 2B1AL 2KZ1B 3S35H 2WBJC 1NH6A 3WSQH 4W6XB 4S1DD 4HZAA 4N0RA 4AK1A 4AH2A 1XGTA 1MCDA 1RMFL 1EX0A 4YHNA 1D5MB 1WISA 5JIPA 2I5YL 1YMMA 4WO4C 3CVIH 4ZUSB 1PZUB 3VXUD 1U9KA 3ESVF 4HHAA 4NJ9L 4WUUB 4HAFA 3NIDF 4LDOB 5FYKD 2HLAA 4KDVA 1QTYT 5MENE 3O6ML 5DR5H 1SM3L 4P46A 4P23A 5SWZA 3FRPG 3I6LD 5DD1H 3U7WL 5DQ9A 3QXTA 4WW1A 4FQHB 1HI6B 3U1SL 3VI3F 1FNFA 2GJ6D 3IT8D 4RGOL 2C1PA 3ARED 1INQB 1RJZB 1D5BB 4Z7QE 4C83B 4DK6A 3GSNL 4POYA 1DVFB 5CMAB 4KVCL 3BKJL 3NFPA 4LNVA 2EEDA 5D7KE 1JI1A 3FZUD 1BIIB 3VXMA 1EHAA 4JRYB 5KN5B 5L2JA 3MFGB 1S9YB 32C2A 3GKWL 5JUEH 2P8MB 1T6VN 2B0SH 2UWEB 4RMRA 1I4FA 2F53E 3QWOB 4BZ2L 5L8KB 3BPNC 3FN9A 1B2WH 4YUEH 5ESQA 5DLMH 1KLUB 2Q3AA 3T0ED 2EC9T 1AE6L 1ED3B 1PX3A 4KFZC 1F3JB 3U9UA 1Q72L 4PJEB 4NFDA 1RZ8A 3P0VL 4JKLA 4PP2B 3VGDA 1BM3H 1HSBA 4PRBB 3X11B 2PXYC 3MV9D 3T3PE 1XIWB 3SPVA 3KJ4C 5F9OL 3RAJL 1SEBB 1TPXB 2XNAB 1G7MB 1MAML 4GQ9H 4JRXB 3RWFA 2Q8AH 4OLWH 4R0LB 2HJKA 3OR6B 1I1AC 5EIIA 3C5ZC 3D69A 3D9AL 2GYSA 4PJFB 1U2HA 1KENH 3ILQD 1CD1B 4OCMC 3UC0L 2NNAB 5CS7A 1NJ9A 3MR9A 3MX0A 2VLLB 4JFYA 5A43C 4NP4H 5GGSB 5D96B 2GFBB 3QAZB 4KHXL 3VCLA 4UT7H 1J7VR 2VZ3A 5JOEA 4TPRH 1I8KA 5EIVA 3OPZL 4GRLA 3IU3B 3OR7B 4Z95L 4D94A 5HHQA 3LRSB 1J05A 1KELH 2AJ3B 3ARRA 4R2GD 2O5YL 4IRSA 3ECBB 2AXFB 1AP2A 2DLFH 1F8TH 3QDJA 2VXQL 1WC7B 5B3JF 2IAMA 4LCCB 1ZHLA 2SEBA 5GRJL 5EU6D 5EOQH 4XCCL 1NANH 3ARFB 4NRXA 5IB3A 2MQCA 2HFFA 5E9DE 3UTSE 2BY2A 3JV4A 2QV2A 1JIBA 3OGOE 4C56E 1DBKL 4UDUA 1JPFA 2AV1B 4XP1H 3PQYA 2VR4A 3SKJL 3O9WD 3ET9F 1ZSDA 4HJGB 1FG2B 4XMPH 3BO8A 3PGFL 5EU3A 3U46B 1XF3B 1OP3H 3I02B 3BWAA 2NY1D 3X12A 5C08A 4U1NB 3D0LB 1UQSB 2EE3A 2NW2B 2YZ1A 3TYFB 3MSPA 2QADC 2O5XL 4RSVA 1YDPA 4YGVA 4XVTH 5C0JA 4I3GA 1IJ9A 1RZJC 5JO5A 3MJ9H 4H20H 5IESH 2NY6B 2ZCHH 1GC1L 3GRWA 4Y4FA 4F2MB 4MQXC 2E7CA 2OI9C 1ZEAL 1Q0YL 1PKQA 3CLFL 4PG9A 5I76A 1EO5A 5GS1C 1I9IL 1C16A 3JWDL 2AJYH 5IMOB 5JPMA 3C60D 4JY5H 1KC5H 2YD2A 1UWXH 3DETD 3PV6B 3DRTA 5CGMA 1UM5L 4P4RA 4HEME 3O2WL 4WI5A 2DYPD 1HEZB 3QIWD 5GS2H 4Q9RL 4NQED 4LLMB 5C9KA 5FO7A 1CIDA 4IRJC 3FJTA 2V5SA 3T1FA 3GSXB 3FOLA 1KFAH 2LAAA 3JWNC 3EYFB 1WF5A 4FXKB 1I75A 4OCYL 3D6GA 3MNWB 2CRZA 3CPLA 1UB5B 3HZVA 1EHNA 3BKML 5D70H 1YN7B 1N0XL 2VDQL 1YEKL 2ADFH 3EFFA 3IB4A 4L4VE 4ZXBD 4YXKH 4FQPA 5CJBA 4RISL 4Z0XB 2EDNA 1BJ1J 4NQCD 4RGNE 4H1LG 3IJSA 4U7KA 3BEVA 5CAYB 4L4TB 4EBQL 1IL1B 4JZOB 4L8DA 3H9SD 1XF2A 3NCMA 3MOBL 3J8F7 4NGHH 4CVZA 2H3NA 1P5VA 3V0VB 4HBCL 1ND0B 2VWEC 3TIDA 4XVUD 5T1KB 4O02L 3TYGL 4K8RC 1CFTB 5DRZA 4IIQB 4G9DA 3A6OA 2R4SH 4UAOC 3IDGB 1Z2KA 1CFSB 2XWTA 4D0CA 1J0ZA 3UO1L 3WHXA 1YY8B 3UBXB 4M7JH 5DI8B 5DD0H 1D7FA 4KAQH 3KPRE 4R90H 1H0DB 4R7NA 2EKJA 3DX8A 4QXTB 1KJVB 4U1LA 2FGWL 4KI1A 3S7GA 3UJTH 1YNTA 5F71A 5F7FA 4XBPA 5C7XL 4O9HH 3S88L 2L0DA 3PIQA 4G6FB 4MA1C 2ZPKL 5E6YA 2DD8L 5EC1B 4QYOB 3MBED 2VXTH 5J1TC 4CW1A 2RHEA 3DVGA 3P11H 4CADB 4JFFE 5EO1A 4KV5F 2YR3A 3P77A 2G60L 2IMMA 3BPCB 4M7LL 2EDQA 3DVIA 2NYYC 2ZG1A 3QFJE 1YYMH 4M48H 3KR3L 1YMMD 3B8YA 3ARGA 1I85A 4JM2F 4NOBA 5JW3L 1FVDA 3HUJE 3HS0B 3BZFB 3B4NA 4HIJB 5DHYB 12E8H 1B6UA 2R29L 2X70A 3UJIH 3Q6FB 4ZO7A 4LSUL 4P46D 5DMGC 1PFCA 4D0BA 4P23D 5SWZD 4U1JA 2I26N 2A6JA 3LS5L 1BVLA 4PJ9C 4PJBE 1WT5C 1XCTA 5EZLB 4PYHA 5FHBH 3DURB 4POZD 3T4AB 1BX2B 1Q9OA 1D5BA 1RJZA 5EO0A 4JFOB 3O4OC 3VGAC 3R4DA 5HGAA 2VNCA 2DQUL 4ODXB 2YUVA 4K3JL 2VZ1A 1UACL 3PG2A 4J1UB 3MZTA 1BIIA 3VXMD 2NTSP 3QWRA 4WFFD 5ANME 4OBSA 4K3DL 4PRNB 3V5HA 2DM4A 2X1PA 3U9PH 3HAEG 3GEWB 1ZT7B 2B5IB 2W9EH 1YMHB 2HFGL 3B43A 4I18B 5HJ3B 4S11A 5B8CC 3W9DA 4PV8B 4ZUWA 1GOHA 5F1IA 4S2SB 3QG7L 4L8BA 2QQLH 1UM4L 3QUMH 3X14A 4OGYL 5J1AB 4MVBC 1SBSH 5FECA 4U31A 4JO2H 1R5IB 2AXJA 3WLBA 2P8PB 4JFPB 3T0EE 4LPYA 5E00B 4G6KH 2H32B 4M9OA 3MGAA 5D6DC 4JJHA 3KPSA 1HK6A 3MJ6A 4OTXH 1PY9A 4HFWA 4M3KB 4DOHB 1C7TA 1DEEA 2LU3A 4EXPX 4FQ2H 5I16A 2PR4H 3SO5A 1SJEA 4U6HB 4PB0H 5DEGB 4TSCH 3G5YA 2UYLB 3JBG7 3TCLB 1WAAA 5FF6B 4HS6A 4UV4H 4L1DA 3JXAA 4NZTL 2X6MA 1TZIA 4J8RA 4IOIA 2AEWA 4PJHB 1JZ5A 4DK3A 4Y2DB 4GRLD 1ZKAA 1WCBA 5D5ME 3OKYA 5M7QA 2I27N 3LRSA 4K2UH 1W72H 5J12C 2R1YA 3N1PC 1H3XA 1QFWL 5A40E 1AR1C 3QI9D 4IRSD 2BCKA 1OD9A 3QDJD 4R4ND 4APQB 4F9PC 4NIKB 1EO7A 3VRJA 1UJTA 2Q86A 3BZ4B 4LLYB 2IPTH 5KSUB 3T04D 5DVMA 3EUUA 1Z3GH 3DUUA 2W65B 3SKMA 4F8QA 1MREL 4OQTA 4JPIB 5A16B 5FO9B 3IFLH 4MB5A 4HH9B 2XZCH 3PQYD 4ODHH 1R5VA 1FG2A 1JPGB 4GUPB 4JM4H 2D4FA 1XF3A 1UEMA 3LAFA 3SDDB 2DJUA 2HH0L 2QJDA 4N0YH 3GSOB 3RVWC 3TVMC 3L7FA 1CDUA 1IQDA 2HT4D 1L7IH 1JYVA 3CZJA 3RDTB 2NW2A 4NPYA 4XMKH 1FBIL 3TYFA 1XCQB 1ZWIB 3VFGL 5KTEH 3SCMC 1AFVL 4Y4FD 3MRMA 4F2MA 3TC9A 4WEMB 5FM5M 3FONB 4HZLB 4ODVH 1D9KC 1T4KB 3H7BA 4MXWH 3QH3B 4HEPG 3HPLA 2OP4L 5EZIH 1GHFL 1NUNB 5FOBB 5KSAC 5HI3C 1HEZA 2FX9H 5MI0B 1CICC 1S9WB 3NA9H 2ED8A 3QUYC 3GDBA 1NFDA 3FT2A 2JCCF 3JVGA 3U30B 2WSKA 1AQKH 1T1ZA 3TN0C 4ETQB 4ZSOB 3QNXA 3ARXA 1YN7A 4OGXH 1PKOA 2VDRH 1C5BL 5D72H 3LB6D 2DB8A 3A6CH 3OX8B 1EBPA 1QEWB 5ACZA 4HD9A 3MJ8A 5IJKC 1QBML 5FO8B 5FYKH 5I73B 3QQNA 2ADJA 1MPAL 2NY4D 3WUZA 5E4IA 5EOCH 4IMKC 2EO1A 3DXAA 5H35A 4PRAA 4B5EA 5T1KA 3TJHD 4YFEA 3QFDA 3L3IB 4Q0XH 3LKPB 1S7TA 1JZ7A 5KBNC 2AABL 4DGYH 1LE9B 3CX2A 5B38G 4UBDD 5E99H 1AGBA 3L3GB 2APVA 3WLWC 4KPHL 1FFRA 3TPUA 1YEIL 4V1DB 3UBXA 3BP7A 2B1AH 2HTLC 3SKOA 1L0QA 1AHWB 1IC7L 5GRYA 4KKCD 4GMTL 4PG2C 4LCYB 2DM3A 2D0FA 4NRZA 3CFBB 2X4SA 3EO1A 5DRXB 2H6PB 4NJ9H 5BOPA 1RZKC 2VQ1B 2GCYB 4PJDE 3GI8L 1RPQA 1CLCA 1JRHI 4Y89A 2XXCB 1SM3H 3V5KB 5CD5D 5CD3B 3PDDA 2VC2H 2FD6L 3U7WH 1RUAL 2VO5A 5H8DA 2VQUA 3GSWA 4KK5D 4M93B 4NC1E 3U1SH 2BNQE 4WWID 2BX5A 1U3HB 4L8CB 3ARGD 4XPAL 4MJ4A 1TTFA 4ZMAT 4K8RL 1WFUA 2ZOLA 4XRCB 3GSNH 1KIQB 2UZIL 5EDXA 3CVHL 1G0YR 1HINL 4KVCH 3EJZD 1KTKE 1JWSA 2XN9A 4OFIA 3BKJH 3OSKA 4Y4KB 3I75A 1Q9KB 3EZ8A 4XNQB 3P40A 3VFRB 5GGRB 3VW3L 3PL6C 2XA8L 2YPLA 1JPSL 4BZ2H 3ME0A 4WHTB 5FM5O 2ZOKB 2UZXB 3WN5A 1X5IA 1OF2A 2JJSC 5TE6L 1ZLWH 1LEIB 1AE6H 1QP1A 2MTPA 1DVFD 3KPNB 3W0WE 2E27L 4ODXA 3P0VH 4MQSB 1A64A 3MXVL 4J1UA 3RNQB 2ICEB 4H88H 4QXGL 5DUML 3BKYL 3QWRD 1QSEB 3G6JA 1ZVHA 4FTVA 3SGKA 5DURB 1ZT7A 5LCVH 3RAJH 3DV6B 4G5ZL 1IGYA 1J8HE 1U8OA 4HUNB 5HXMA 1HH9A 1ZGLB 4JREC 4KMTH 2C4FT 3FOMB 1FC2D 1NKRA 5HHNA 5GZOC 1JTPA 3ULVD 1TMCB 2ARJB 3GJFB 5D7LB 1X5AA 4WFEE 3UC0H 1LO2L 2FJHB 3JTSB 5EPMB 3ALXA 4Q97A 1ZA6B 4OGAC 1Z9OA 1P7QB 3AUVA 1G7IB 1Q9LB 3QO1B 4F58L 1EPFA 2PYEE 2J8UB 4KHXH 4U6XA 4WWKB 1B0WA 5ITFB 1SJHB 1YY9D 1MFEL 4NKIH 5DZOA 4IS6B 5FUZL 3GJFH 4JRXD 4NFBA 4XC3H 5D7IB 3LKOB 4Z95H 5JW4R 1FNLA 2VKWA 1W0VA 2OMBA 2R2HB 1I7ZB 4OQTL 4JN1L 5DJZB 3HAEH 1CDCA 2EIDA 2HVJA 3FRUB 3PABB 5HGGS 2VXQH 1YECL 3DYMA 5CEZD 5GRJH 2L7JA 2V2TA 5TDNA 3CSPA 3WDJA 1N8ZA 1NUDA 1J9CT 1MCFA 4H0IA 3GKZA 3HB3D 4Y2DA 4ENEC 2VDML 1YPZE 3SKJH 2AJVL 3F8UB 3RBSA 4OCXH 2IADB 4N1CA 1YJDL 2X1XR 3I3DA 4NM8L 4AJ0A 2AS5M 1YUHB 4LLYA 3NIFF 1EO8L 3QIBA 4NJAL 3S97C 3LIZL 43C9B 5IF0A 3MLZL 2YRPA 4JPIA 2O5XH 2NXZC 5A16A 1JGUL 4X6DF 1TTUA 5T5NF 3EHBC 1GC1H 3DUSA 1MI5A 5EZOH 1ZEAH 3KWWB 1Q0YH 1JPGA 3CLFH 1I9IH 1KG0A 2G9HB 4PRDB 4XPBL 2FLRT 5JA8B 4ZTPH 4RGMC 4M62L 1W8OA 3ISWA 1UM5H 1QPXA 5JW5A 3O2WH 3R0NA 4HG4K 2FECL 5JQ6L 4Q9RH 3SEPA 1XCQA 4CVUA 1PEWA 3LQZB 1ADQA 1F4WL 3GMRB 5MEPA 2NY6D 3WUWB 2OQJA 3QXDA 5D1QB 3GSVA 4C59B 2VLJB 1T4KA 2ZP0T 3BKMH 2AK4B 1N0XH 9CGTA 1IAKA 1QBLL 2XWBA 2VDQH 1YEKH 3OKMB 4NC0B 4WDIB 4OCWL 2DQCL 5D2NE 4YHIB 5D2LE 3UTTE 3V8CA 4OZIE 1QRNA 4EBQH 1NC4B 1AI1L 3P4OB 4JFHD 1XZ0A 4X4ZA 3MOBH 2R2CA 4Z76A 5SWQB 1T1XB 4H25A 5ICYB 4L3EB 3M07A 4HBCH 1A6WH 5KVDH 5DEFA 3VH8A 4ETQA 3LMJL 4LLUA 4O02H 3BYTA 4X6CE 4U0RC 3WYRA 4FQLL 1JYXA 1IC5H 1AGCB 4FN0A 1EBAA 3HZKB 1NEZB 4WHCA 4HW6A 1PSKL 4B50A 3O8XB 4DN3H 4RQQA 4DCQB 3GB7A 4RAUB 1JF6A 2WIIA 4X4XA 5FO8A 4KGJA 1F13A 1CR9L 3C6LA 4FABL 2XWJB 4LPXA 3DXAD 3PUCA 4XC1L 5T1KD 1UWEL 4MNQA 2FGWH 4Y1AE 1MELA 1E27B 1NANI 4PJGE 5BJTB 4NZRL 4YFLI 3S88H 4X4YB 3CFKA 4FQJL 4CMMB 5C0FB 3QDME 2DQTL 1UVQB 2DD8H 1JNLL 5D1XB 4TYUA 4F9LA 3QDGE 3EKCA 1FGVL 2BP3A 1ERNA 4DWHA 3ZDYF 1FFPA 3MRQB 3BSZL 5BRZB 4Y5VB 4RFNB 5JPNB 4OI8A 2G60H 3GMMA 4NNYB 1E6OL 3MV7B 4LBEB 3MRCA 5I74B 1AGEB 1OY3B 4G80B 1A6UL 2KQMA 4G9FB 1A8JH 1EV2E 3KR3H 5DRXA 1EUTA 5E8EB 5DO2C 1KV3A 4QXUL 2MWCA 1BZ9A 5HYJE 4G6FD 4MAYC 4P48A 3M17A 1U8MA 2BXZA 4N1HB 4LSUH 3X13A 1IAMA 1HILB 1HXYA 5CHNA 5HVWA 4ZOEA 2CRYA 1I7UA 5FGCB 5GSRB 3LS5H 5DJ8B 5JIHA 2EXYD 3ROLB 3RNKA 1KTRL 1I1FB 1U3HA 4L8CA 1NDGA 1B4JL 1AR2A 2WBJB 4QOKA 1QA9A 4BSVB 3BHBB 3AS2A 4YPJA 5C6PB 1KIQA 2DQUH 3GMPB 5AUMB 4IOFC 4H5SB 4K3JH 1UACH 4WI8A 1EXUB 2HTKD 1G9NC 3FCTB 3G6DL 2FATL 1Q9KA 1NFIB 3HFML 3VFRA 2OTUA 4WUUE 4K3DH 2FYYA 5GZNC 4Z18A 3SE8L 2BNRA 1BQHG 4WHTA 1LHZA 2ZOKA 4GG6F 2B4CL 3WIIL 3H3PL 4KMQA 3QG7H 3H42H 3GM0A 1ZV5A 1UM4H 3ULSA 4AG4L 4DEPC 1RZKL 1F6AB 1JWMA 5C0CB 2PN5A 4O2CA 4JN2B 5KG9A 1BFSA 5I8OL 1FNGA 5DT1L 4FTVD 4YR6B 5GS0D 3BZEB 4X8JB 4XNUL 4WU7B 2PF6A 2NY0C 4EXKA 5C0BE 4JRYE 5KANI 4LHUA 5J11C 1MRCH 3OKKB 4JB9L 4LGRB 1UZ8B 2FJHA 2QSVA 4R4FL 4TUJA 2UWEE 3BPNB 4U2ZA 3WKML 5DTFA 3QRFM 2DQHH 3PDOB 2GUOB 5HI4D 2X2YA 1JZ3A 4QXWA 5JHDB 3CCHB 2J8UA 4HUXA 4CNIB 4K7PL 1CQYA 2CDEB 3RWDA 4PJEE 1P2CB 1T1WA 4EDWL 2PXYB 5DFVC 4UTAH 2YD5A 1T04A 3OXSA 4N8VG 3KJ4B 2JJTC 2JB6A 5IROC 2C3GA 4M3JA 4XBEH 3BUTA 2NTFA 3BDBA 4YDJA 1AO7B 3L5IA 1I1AB 4JRXE 3H7LA 1BF8A 3EJYD 1FFOB 5C3TA 2VXSL 4PJFE 1XR8A 3RVVD 5DK2A 1CWVA 3VXOA 3LKQB 2OR9L 3WDIA 2DWDB 3DROA 2YK1L 2NY5L 4Y2DD 5CEZE 5IVXA 1SVCP 4PTTB 1MY7A 5DJDB 1R3IH 3TGXA 1NLDH 2C4XA 2IADA 5J7CC 2XY1A 2HH0H 2ZG2A 3RTQA 3RY6C 3ZHDA 1F4YL 4UZGA 4TTDC 3P0YL 3QIBD 1QR1B 2B1HL 4MJIB 3C5SB 4XNMB 4TNWK 3QA3B 1NCWL 4PRIB 1AFVH 2G5BA 2Y4SA 1R3LB 3OF6A 1ZTXL 1IAIH 1MI5D 5D6CA 1T7ZA 2R0ZH 5J06A 5E8DH 5IW1B 4PRDA 3SDDD 3S5LA 5J8OA 1FHGA 1GHFH 4Q6IC 4QGYA 1H8NA 1OGAA 5GSVB 5IHLB 1OPGL 1IMHC 1IARB 5IVXF 1P7KB 2DJ4A 2P48B 5C0IB 3P9LB 3TH4T 2YN5A 2VLJA 1U8LB 2IANA 1F3DH 3HE6A 3NGBC 5DQDL 5ESVB 4X83A 2C7UA 3UYPA 1NPUA 1AGFB 5I9QB 2OI9B 1C5BH 1I1RA 3QIUA 5GS1B 1VB9A 1T0PB 1QRND 1QNZH 1GGCL 1CFVH 1NC4A 4X99A 2RR3A 1GZQA 1R3KB 35C8H 2EC8A 1QBMH 5E8PB 1LD9B 1MEXL 2FX7L 4C58B 3MUGA 1C1EL 3TIEA 1MPAH 4G3YL 5ICYA 4L3EA 4JZJC 3VD7A 1NBVL 4U1KB 7FABL 4M8QA 1I3RA 3BQUC 3OZ9L 4IRJB 3ZDZE 2XTLA 2AABH 3KDMA 1A5FL 5FV2A 5EU5A 1EEYB 3F6LA 4ZNEA 2PO6A 1S9KC 3TO4A 4KKLC 1P69B 3SKUD 2QHRH 4K23L 3SDYL 3U4BL 1HQRA 2HVKB 1IC7H 2NW3A 4GMTH 2WUBL 3FTGA 2O93L 1GOGA 2Z8VC 1MFCH 3PWVA 5DXWA 1CL7L 4L4TE 4MNQD 1E27A 1S7QB 5T3XE 1A7RL 1H3PL 4K55A 4AY0A 5HDBF 1AD0B 2EXWC 2NR6D 1OSZB 3ULUD 1T2XA 1V7NH 4C55A 5K9JL 1T22A 5IEHA 5CCKH 3GMQB 4KZEL 4PS4L 3CVHB 4UAOB 1W8NA 3HCVA 4NNYA 4LBEA 4M4RA 1KBGL 1RUAH 1E0OB 4EI5C 4LHQB 3REVB 1BQSA 2OBGA 3EBAA 5T5NG 2HJFA 1MJJA 3PWNB 4XPAH 2UY7A 2BNUB 3CMOL 4NNXB 1ZA3A 1CTOA 4RX4A 3RWEA 2UZIH 1NKOA 1NLBL 4FQCL 5IFJB 5HDQH 4ZFFA 3CVHH 1HINH 4PGEA 1W0WB 4P2RA 3DTXA 3ULVH 15C8L 4UQ2B 2HN7A 4NQDA 3H0TB 4MA1B 3ZL4L 3VFOB 3W82A 4ODSL 3VW3H 1S7XB 4PP1D 1ACYL 2Q8BL 3M1BB 1JPSH 2A9ML 3QNZB 1FCGA 1I1FA 3WE6B 1U3HD 4QOKD 4BSVA 3OG4B 3O3EA 5IBUB 3NH7H 2FEEL 2EIZB 1A3RH 1FO0A 4LPVA 2E27H 3GMPA 4OCLC 2I9TA 4FG6D 4WO4A 1ZHKB 1EXUA 3MXVH 5TE7L 3LQAC 4QXGH 4RWYH 4ELMB 3L3DB 5ALBH 5FEBA 5SX5K 4G5ZH 1CXEA 5JZ7D 2BNRD 4QHUB 5EWIL 2ESVB 4U6YB 5JR1L 4BH7B 1EGJA 4PJ9B 4KUCF 1FZJA 4RMVA 1KN4H 1BBDL 4UV7H 1LO2H 5I15L 3KGRA 1D5XB 3KYNB 5C0CA 3GUTB 1CDBA 3PP4L 1P84K 4KRNA 3HZYB 3O4OB 4JN2A 4Z5RB 1RJYB 4N0CC 5MEOB 1U8HB 3ZT6A 1UFUA 1J11A 2DWEB 2JCCB 1RURH 5IHUH 1UWGL 1MFEH 5FUZH 1H5BB 3CDGB 3VFSB 2VITA 4Y16A 4R26L 1NBZB 4OQTH 1UKQA 4JN1H 4KQ4H 5D7LD 2AJUH 5B8CB 1TLKA 2FZ3A 1A1NB 3VFWB 4WHDA 4HC1L 4WGWB 5FYLL 2R8SH 2BSSA 5DDHB 1X5FA 4XPFL 1G9NL 5HGHA 3BH9B 4Y2OA 2XQBL 4HH8A 1JV5A 3REWB 2NXYD 5T3ZL 3LH2L 3LN5A 2PXYA 4M6NL 1AIFA 5DJYB 2AJVH 1WITA 1RZFH 3U4EA 3DLQR 2HT3D 3VH8G 1QLEL 4OZHF 4G7YL 1YJDH 2OZ4A 3IFOB 3QZWA 4DOHE 4S0TD 1I1AA 1JP5A 3C5ZA 1A02N 1EO8H 1A3QA 3MLZH 4Z7UF 1NAKL 1YN6A 2DWDA 2D7PA 1QSFB 2EECA 4KI5D 3IDNB 5E1AB 1X5JA 4WW2F 1MLCB 3FT3B 2V5RA 3FB5B 1FCCA 4PTTA 4KC3B 1VERA 3UDWC 3WO4C 1BZQK 4R4BB 4MDIB 3VXNB 1T1YA 3V7AG 4PJHE 2R4RL 4XPBH 3H3KA 4LLVA 3RTQD 3K2UH 4O5LL 4U7MA 5J12B 1UJ3A 4HS3A 1QR1A 5JQ6H 3D3VB 2FWOB 2IH1A 5F21B 5T5FL 1S78C 4OKVB 4PLKD 4L9LC 3NN8B 2R1WA 5FKPA 4HBQA 1ONQB 2DQGL 3NCFB 4YDKH 4N9GB 3HC3L 1RU9L 3KG5A 4UILL 1QBLH 1U2CA 1G9MH 4OCWH 5GGSY 4AQOA 4NUGH 4GAGH 2IF7A 4WFGE 3BJLA 2ZSWB 4QHLB 1T7YA 1XF5B 4LIQH 3SE3C 4LOUD 1VFMA 1AI1H 1P7KA 3TVMB 4KKNA 4H26B 2ZNWA 2FO4A 4QRSA 3JWOL 5D1QD 4X9FA 2VLJD 1D5IH 2E6JA 2ICES 1MJ8H 1TVHA 2IAND 1H3GA 3SCMB 3C2AH 3HE6D 3IDJB 1DBBH 3MJ7B 1PZ5B 4FQLH 3RJQB 4EQ3A 1UZ6F 1CG9A 1Z5LA 2ORBL 3ZYJA 1D9KB 2YUXA 4HK0A 1PSKH 5CSZA 2UY6A 4ZS7H 5I8EA 1NC4D 4WNQB 4NO0A 3GMOA 1CDYA 5E8PA 1LD9A 3QXUA 5KSAB 2RFXB 3WD5L 4IDJL 4H0GA 5DFTA 4FABH 4L3ED 3OJDA 2ICCA 4XC1H 2FH8A 1CICB 2F54B 1UWEH 2LE9A 5DD6B 3QUYB 4YHOL 1NSNL 2R1XB 4NZRH 3CSYB 3SE4A 3FO9B 4UQ3A 3TN0B 1UG9A 3EO9L 1JNLH 5HBBA 3O8XD 4ZSOE 2DDQL 4XNXL 1BD2B 3TO4D 4HMDA 1CGSL 5ETUA 1FGVH 2W92A 4PTUB 3ARBC 3QQ9D 4JPWH 1VEPA 3V6FB 4D0DA 1A6UH 4WU5A 3EOAB 4BQCA 3FQRA 4GBXB 4OCRL 2Z92B 5B21A 2XFXB 4RZCA 2VLMD 4LHUG 4KHTH 4LAJH 4OIIL 4DKEL 1MQKL 5I8CA 2GTWB 4NT6B 3MRJA 1MHEA 4AQ1B 4RIRA 4KU1A 3N9GL 2EDXA 1WZ1L 4G8IB 3MRBB 1P1ZB 3S35X 3K2MC 5CBEA 2Q1EA 4NKMB 1NBYB 3CLEL 2VZTA 4V1DE 2EH7L 5E8NA 4NNXA 2F5BL 1UXWB 4HUKB 4PJAE 4GQPH 2EE6A 2I07B 4RX4D 3GGWA 1F00I 3IDUA 3UPCA 2D3VA 3P30L 4U1HB 5LKNA 3G6DH 2FATH 1SJVA 4X6DB 3MRKB 1FNHA 3HFMH 4NQDD 5GPRA 2EH8L 3IJYB 5DJ2A 3U0WL 4FQQB 3TFKD 3UPAA 3SE8H 5E1HB 1MCIA 3HNTL 3Q6GL 5DJCB 2YSSB 3MRGB 2B4CH 2V7NB 3VXPB 1OL0A 5HHOB 4HKBA 4K94L 3BD4A 4OV5B 3MCLL 4HCRA 4ZFZA 4Q74A 2PCPB 5E5MB 4MDJA 1EFXB 4AG4H 4WO4D 2CMRL 1ZHKA 4HKZB 1K4DA 3UX9B 4PV9A 2JLLA 3C6SA 1F4XH 5F72S 5I1IL 5I8OH 5DT1H 4YHZL 4ELMA 3ZKNC 3OGCB 3LPWA 3QO0B 4XNUH 4HLJA 5I1DB 4QHUA 3DGCR 1XGPB 4U6YA 5HD8C 4UNVA 2D0GA 3ZT5A 1T21B 3PL6B 1PG7L 1WT5A 4NO2B 3VD9A 4JB9H 5FA3B 3QWQB 3S5LG 4JHWL 1HHIB 3WKMH 5C0CD 3GUTA 3WS6A 1W0YT 3P4MB 1RJYA 5DUBB 1N6QL 5T1MB 3EYUL 4YQXL 4JY6A 2WNGA 3KYMB 1FH5L 1TJHL 5BVJB 4Q9CA 4MGXA 4TOYL 2K3TA 4N0FA 3W2DH 3LRHA 5CJXA 2VRAA 1KXTB 1A4KB 2IFGA 4PJXA 2C3WA 1DANU 3HLAB 1QSEE 2VLKA 5IJVB 5EOCJ 2VAAA 1JPTL 1ROWA 5B8CA 4MLSA 1A1NA 5IQ9A 4RBPK 3WFHA 4JREB 3MBXL 1X4ZA 4HIHB 3LHPH 3SJVA 1MHPL 1YQVH 3B9DA 1B0GB 4GRWH 2VXSH 1S7UB 4OZGB 1NMAH 5D7LE 5JHDD 4LP5A 2OR9H 3CUPB 4U3CA 3T0DA 2NY5H 2Z8SA 2PXYD 1P6FA 4M1GH 5DSCB 1G7QB 1OQXA 3QR2A 4OF3A 1A7QH 4JVUA 2OTPA 4OB5L 1MVUB 1NGPL 5C0GA 1DQJB 1AKJA 4C54A 1FPTL 1I1AD 1DBAL 5D7IE 4G7VL 1F4YH 5GQBA 5K33A 3C5ZD 3P0YH 4FQIL 1BVKA 1HOCA 4L5FL 4PIRF 2B1HH 3ZYOA 3ZE0F 4I2XB 1NCWH 1T0MB 3I2CL 1JUFB 3KNBA 2VDLL 2PYFA 5BZDB 3RHWK 1QG3A 4L8SC 2JB5H 5C2BH 5E70A 3CXHK 1MLCA 2V17L 3FT3A 4QHKJ 1BWWA 4JO4L 4YXHL 3ZDXF 4LLAA 3ZE2E 2VZOA 1Z0MA 2ADGA 4HFUL 5KSVB 4MCZB 2DLGA 3QUXA 2QR0B 3L9RB 4TUKH 2QL1A 1IBGL 3EYSL 4MJID 3E0GA 5E5RB 2XZQL 4AENB 2CIIB 3OKNA 4F9PA 4JHAL 1OPGH 1ORSB 2FHFA 3PWUA 1REIA 4PR5B 2Y06L 1N0LA 4JKKA 1JF5A 3FFCA 4OLUL 5TF1L 2APWA 2NXZB 3CX5K 2KUTA 4N9GA 3RL2A 1A4JB 4RDQG 5DQDH 1RJCA 3FKUS 5KOVC 4J23A 4NCC1 1KNOB 1WLHA 3SDAC 5DFWH 4XB7A 5J9PB 3MYJB 4NNPL 4NSKB 5IB4B 4QHLA 3IFNH 2P43B 4XNYH 1BOGB 5ERWA 1GGCH 4F15B 3RGHA 4PJ7B 4RGMB 3G5VA 1FYTE 4F57H 3ULUH 5I6XC 1C1EH 1LE5A 4G3YH 5I1EL 2ARWA 2W38A 4GG6B 3VXRE 5HHXH 2H2PC 2QADD 2DS4A 5TGBB 3GFUA 2FHCA 3OZ9H 3IJHB 1XGYH 2NLJA 3QHFL 4P9HL 2BOCB 3F12B 1A5FH 2ATPA 2DRUA 3DGGB 4BFEA 3BXNB 1XFPA 4QRQA 3W39B 2AK4E 3INUH 4NO0D 5GISH 4MJ5B 1X5GA 3SDYH 5KSAA 5KOMC 4HJ0D 5LWYL 2DTMH 1MWAL 3P3YA 2WUBH 4D2NA 1NCAL 1KJ2A 1CICA 1CL7H 2X1OA 4IRJD 4U1MB 3IS0X 5IHZB 1A7RH 4KZDL 3MRPA 1QFOA 2R1XA 1HHHB 3B9KC 4Z77B 1T3FB 1VEOA 4UU9A 1I1YB 4LCWB 5EBGA 3LEVH 4PRHB 5K9JH 1BAFL 2AJXH 5I19H 1PLGH 3DMMC 5HVGB 5IBTL 4F7PB 5FYKU 4KZEH 4PS4H 3O3AA 1XMWA 1GZPB 4OLZH 3QQ3B 2PTTA 5GRVL 2LVEA 3T8XA 5FOJA 4DUVA 3N1QC 3TBSB 3T0BA 5BOZG 3PP3H 3CMOH 1TJIL 5IB1B 4IMKA 1KCVL 5ISZB 1NLBH 3V4UH 4JFEB 4CU7A 4OD2B 5CZXC 1IAII 3M8OL 3AM8C 2GTWA 1OM3L 15C8H 2B8OT 4BQ9A 5DVLA 3ZL4H 5D2NC 5GRXG 3KLDA 1ACYH 4NHUA 2Q8BH 2W0PA 3EDFA 3QRGL 2BOBA 2A9MH 1NBYA 1AXSB 3FFDB 1EEQA 1RUQH 5FDWB 5H2BB 1MCQA 1JFQH 5BRZE 4MNHB 5F9WC 4PG2A 3MV7E 1AY1H 5CJ8A 4NKDA 3QZWG 4G9FE 4MD5B 3T4YA 2CKBA 2IMNA 2FSEB 4XAKE 1CXHA 2ITDB 3L5JA 2QLVB 2W0LA 1WJ3A 4L3AA 3M45A 4MAYB 4KTEL 5B3JE 5KAQG 3IJYA 4HWNA 4KH2A 1J1PL 2WZPD 2M2DA 4EN3C 1NC2A 2OJZL 5ADPH 4YBQC 3V9FA 1Q8MA 2YSSA 3MRGA 5JR1H 3HI1B 2XICA 2OXHA 4OV5A 4OLVL 4U1IB 1HIML 4WFHE 5FGCE 1QSVA 5C0RL 1FIEA 1LEKB 1EFXA 2KH2B 4HX1A 5I15H 1I9EA 2A0LC 3NIGE 3PP4H 4GAYB 4MS8C 3OKDA 4RFEA 1XH3A 2R2EA 4YDVB 3UTZB 4D9QD 1WBXA 5F6IC 2ICWA 2BY1A 4J2XA 5LGJA 1UWGH 2VSDA 2RQ8A 1TIUA 5DMGD 1LO3L 2YMXL 4R26H 3C5JB 2AI0L 4P4KA 3F58H 2FBJL 2QSCL 4OM0L 4ZQKB 4ZFOA 7CGTA 1T20B 4PGCB 4DZBA 3V4VL 5D7JC 5FYLH 1RQ5A 2VYRE 1MUJA 4F33B 2JJSA 5FB8A 1WVZA 4XPFH 5T1MA 3BE1L 1WWAX 2XQBH 4DEPB 2H8PB 1I3GH 1N5YH 4KGLA 5F93C 1FG9C 3LH2H 5EN2A 5IK3A 2AQ3A 3VFVA 4M6NH 4UINH 5ID0B 1UB6A 1PBYA 1CFNB 3GSQA 2N1KA 2X9YA 3TH2T 1VA9A 2VLKD 1QLEH 5I1HH 4G7YH 3JSSA 3RIFF 4QTHB 5DQJA 2OL3L 3BH8A 1F58L 4EDXA 3HMXL 2IPUG 2NY0B 5GGQL 3SJVD 43CAB 2RIKA 5K9OA 4BK5A 4JANB 5GGRY 3I6GA 1NAKH 1LGVA 5A3IC 3S36H 4ZUUA 1QRKA 4BQ8A 1QFUL 4QNPF 4MVBD 4XP5L 1J0IA 3KPTA 3MPCA 4Y5YC 3WL9A 3NTCL 1CT8B 1G7QA 4MX7A 3MLVL 1KUMA 4QRTB 4LGSB 4UUJB 5F7EL 5JHDE 2A83A 4ZTOL 3L5WB 1DQJA 4YEFA 4HIEA 3QXVA 3RIFK 1AKJD 2R4RH 1DBJH 2AKRA 1KYOJ 4KJYB 1RK1B 1S7VA 3T0XA 5D9SA 5L2KA 1JUFA 1SY6A 5IHBA 2F19L 1NGWB 1MAKA 4DAGL 1QSFD 5T5FH 4QHMA 5F6HI 1AO7E 1JHTA 2Q20A 3RWIA 3VRLF 2CQVA 4F7MA 2AK1H 2XKNB 5CZVL 2M8XA 1FV1B 3C08H 4LEOB 2J8OA 1IGJB 5F7YC 5ICXA 3WJJC 3ROOB 1RZIB 3BOVA 5F3BB 2J12B 4W4NA 2YPKB 4MNGB 1IM9B 1LP9A 3QUXD 1ES0B 5C07B 1AR1D 3VFUB 4OAWB 1JGEB 3IYLW 2CIIA 1ITBB 4XP9L 4U6VL 4ZUTB 3A6BH 3ES6A 4MXQC 4ZPVB 1J0JA 4YZFF 1CFBA 3TNMA 4UOW1 3JWOH 4X5WB 4MJIE 5JDSA 5AWNH 4KV5E 4PRIE 4NQXB 1K2DB 1Q94B 4YPGB 1CXKA 1NAML 4LLWB 1A4JA 3GK8L 4YJZL 5IEKA 4Z7WA 5SX5H 4PYGA 2Y72A 1T5WA 3VWKC 1PG7W 3UTOA 3CDFA 1BOGA 1G7PA 4R97C 4Q6IB 4QY8B 5HHVL 4TRPL 5GJTH 3P4NA 3WD5H 1DFBL 4IDJH 3RY4A 1FSKC 4HWZB 3EOTH 4R0LC 3FQTB 4XCNB 1WFTA 4WHYG 1NSNH 3DVNA 4I0KA 3FQWB 4X9HA 4HGMA 1D9KD 2EC9U 3GO1L 3LSOB 5AEAA 4CN4A 4DKFL 3DBXB 2DDQH 4M1CC 3A67H 1CGSH 2MFNA 5MERB 4W6WB 5FUCE 5KSAD 4ACPA 1OAKL 5HI3D 1HZHL 5I0DA 5IFAL 4LK4A 1CICD 5TDPA 4OCRH 4X6FA 4Z7WF 4Z77A 4K71C 4JZJB 1I1YA 3STLB 4X80L 4QRRA 4OIIH 1MCWM 1K6QL 3BQUB 4NCDA 3ARFC 5FCUL 1BEYL 3F65A 4A6YA 2VQTA 4F7PA 3BP6B 4X7TB 2EDRA 4G6ML 1GZPA 4S1SL 1MCSA 1U8JB 2XTJB 4BA8A 5C0DB 4ORZC 1KCKA 4OZHB 2EH7H 1FNEB 4Q2ZA 4LPUA 2F5BH 1HSAB 3LEXA 4HWUA 1JF1A 3ARYA 2IFFH 5CP3H 2IQAA 3P30H 1RY7B 5HGDB 3U6RB 1N59B 5IMMB 4NRYB 5E4EC 4UDTB 4NQVA 4KKBD 4M5YL 3DRQA 2VWEE 3BIKB 1A7BA 1G6RA 3WLWD 4FP8L 2LU7A 2HTLD 5ALCL 2GY7B 3SOBL 2YHGA 3D5OF 1J5OH 4K94H 4MNHA 2WQ8A 5F7WC 5LJYH 2BVTA 4U1GC 2NY3C 3WNLA 2A6KB 1KXVC 2CMRH 3QEQB 5DK0B 5HI5D 1RZGB 4CVXA 4PGDA 4F7EA 1BOYA 4J6RH 5I1IH 4F3FB 3STZB 1M05B 2GITA 1VGKB 2OSLB 3QCTL 5EBMB 2F15A 1NC2D 2FNBA 3QUZA 2AW2A 4HKJB 1T5XA 3ARPA 1J18A 4RA0C 5K93A 4N0UB 1JRHL 3RZCA 4TVPL 1EFXD 3MROA 2AXGB 1H3WM 2PW2A 4M1DH 2FH6A 2K7PA 4KRPD 1RV6X 1N6QH 3EJJX 1G7LB 1A9EA 2LU4A 4NZDA 1CE1L 4LU5L 2V5YA 4E41B 4YQXH 1FH5H 1NCCL 4QTIL 4XXDB 3TBVB 3FQXB 4UNTA 5DRWA 4QCIB 1V3JA 3C5JA 4XAWL 4D9QE 1V05A 4P4KD 3RVTC 3PJSB 1JPTH 3B5HA 3FO2A 1CDJA 3I50L 3MBXH 3TBWB 5KS9A 2ESVE 1U36A 1QR4A 2Z31C 2P5EE 1QZ1A 2ITCA 1I1CA 5IB5B 2WINA 1HN1A 5IM7B 3PDGA 5HYQA 4X9GA 2H9GA 4U0QB 2DBLH 1N3NB 4X6BB 4I4WB 2G75A 2HG5A 2JCCE 3O3BB 4Y4HC 5HYSB 4ONHB 5K59F 3CFCL 1MIML 2X7LB 1FAIH 1FPTH 2HFEB 3DX6B 4YFLF 4G7VH 4ZS6D 2VISA 5GZOD 1ZOXA 3MUHL 4FQIH 4L5FH 4XGZB 4YIQA 4JANA 4M5ZL 3FQUA 1Z9LA 2VDLH 5ILTL 4TN9A 2OJEB 1KEML 5T33L 4OGAD 4AM0B 5EBWA 2V17H 3T2PA 4EJ1C 1T89C 2P47B 4YXHH 1EAPB 4PJ8A 2P5WE 3WNNA 4U6TA 2VN4A 5BS0B 1AC6A 2E6PA 4EUPB 3MNVA 4PREA 3CFJB 2X05A 2VZUA 4X7SH 4HFUH 4AEHL 4O51B 1CXIA 3RWJB 5MENA 1I9RH 3PHOB 1IBGH 3WFZA 1KPRA 4X4ME 5CGYC 5A2KH 5L2KD 2XZQH 4HK3J 4HXBH 4JHAH 3KLHC 1XR9B 2WBWB 2XKNA 5AAMA 2FO1A 4LEOA 2CDGA 4IHOA 4OLUH 2W9DH 3WBDA 1R24B 1QSFE 1XGUB 4GW4B 3WO4B 2EKSA 3P73B 1KB5A 5ICZB 2HP4A 3OKEB 1U91B 2Q76A 4NNPH 1JGEA 4I0CC 2EYRB 4MSWA 5TF0A 1KCRH 2F53A 4I18C 3VXSB 5I1EH 5JOFB 3JV0A 1FJ1A 2HMID 1KLGA 4NC2B 3D3VE 4NQXA 8CGTA 1K2DA 2YS4A 4ZPTB 2OK0L 5HDLA 3QG6B 3EHBD 2MPAL 1OQOA 1FNSL 1MWAB 4L9LB 2BSRB 4P9HH 1H15A 3VMNA 1P9MC 4J3XA 1ORQA 3PWJB 3ELAT 4KXZH 4ZAKC 3BRDA 2ZUVA 3D39B 3Q48A 3Q0HA 3WCYA 4Z7QF 1SEQL 5LWYH 4MD4B 1MWAH 3FQTA 1IGTA 4P3DB 4A6YL 1D5ZA 3V79C 5I2IA 3HRZA 4KZDH 4I0PA 3SBWC 3EYQC 1B2WL 4KRMB 1YYLH 1U8IA 1V3KA 3NZ8A 4DGVL 4HGWB 4GXUM 3RGVB 3GSRB 4GKSA 4PJCF 5IBTH 5FGBC 4YXLL 4YFDB 2A74B 3QB7C 5GGUB 1JYWA 4RBPH 2R2BB 3BPOB 4JO1H 5HHMB 1FZKA 3UYRH 3DX7B 5HPMB 8FABB 1TJIH 3U36A 4GQ9L 1UEYA 5BW7C 3EO0A 4WI6A 3MXWL 3BDXA 1EEZA 1KCVH 2HJLA 4LCWD 4QRRD 1BLNA 4S1QL 4PRHD 2F54E 4WHYH 5EA0H 3RVXC 5E9DA 2P7TB 4C56A 1INEL 1MLBB 3RUGB 2E5EA 5FHAL 4YHYC 1S9VB 1FLRL 2EICA 1U8JA 3ETBF 4ORGB 3UAJC 2LQRA 4GW1A 3FO1A 1JNNL 3MCKA 3QRGH 2APXA 1BD2E 3L7EB 3R06B 4UT7L 3TWCH 3ARBB 1DDHB 2ZUTA 2E9JA 5I1AB 5EUOB 1ZGLM 1NGZA 3MLRH 3LZFL 1UADC 1KELL 5ISZD 5B39B 4JFED 1FN4A 2DLFL 3QXWA 3CDCA 3O41B 1N59A 5FDYA 2XZAH 3DV4B 4ETYA 5JW4Q 1E4KA 1P4LB 5C9JB 5EC2B 4KTEH 5DVNA 2J88H 3D85B 1WCQA 3K46A 2CLZA 2OJZH 2YD3A 4PLJC 5DC0A 2FJFA 1LO5B 1JGDA 2X4NA 1FORH 4XP1L 4O2EB 1HIMH 4EI5A 5C0RH 2CD0A 3T1WA 2G2RA 3MRIB 4XMPL 5L8JB 4NN5B 1FGNH 1R0AL 4S1DC 5DO2D 1G0XA 2YRZA 1RZGA 5MI0C 1MH5A 1I8LC 1N26A 2V2XA 4MAYD 2ATKA 2OS7A 3QNYA 3NIFE 4JCMA 3CC5B 5IGXL 4MA3B 1VSCA 1FZMB 4ZYKB 1K3IA 1LO3H 4XVTL 3IVKB 2YMXH 3B2VL 1A6AB 3MJ9L 4X6DE 2AI0H 4L4VA 3MUZ1 5IESL 3KPOB 1V5JA 2QSCH 4OM0H 3RZCD 2EDFA 1QLRB 5IQ7L 5GGTL 3V4VH 3N1GC 3DYOA 3WIHL 5HHOE 1CK0L 1KPVA 5I71C 2OL3B 5C0NC 5F96L 1CL7I 1F90H 1KC5L 4JG1L 5IW6A 1AGDB 3SGJC 3SY0A 3BE1H 3AREC 5H94A 4M7KL 1U8QB 3S4SB 1IAOA 4IOFD 5D1ZC 5A2FA 3EOBA 2XKUA 5I1LB 1NCTA 1ZVSB 3WFBH 5E95B 3GZKA 3ZE1E 1R3JA 5FYJD 5HVHB 4IOSD 4CAGA 1O7VA 3P9MA 5GZND 3EFDH 4QHNA 2OL3H 4N68A 5AAWA 1KPUA 1F58H 1S5HA 3QEGL 2GTZA 1N5AA 5GGQH 4J4PA 3DIFB 3BD5A 1AH1A 3KPRA 2X4TB 4E5XB 3PNWB 5C0AB 1QFUH 1ZHNA 4WCYH 3O3DA 4LRNL 4MHHG 4LSSL 4X6BA 2CXGA 4AEIL 4I4WA 4NGHL 3MLVH 1ULVA 2PKDA 1N4XL 1U58B 4JDVA 5HYSA 2BSTB 5AZEL 3OHXA 4DQOH 4JVPA 4IRZL 2NY0D 1G7JB 4EQ2A 1Y0LA 1G1CA 4JFFA 2Y9RT 3DX9B 5AYUL 3MLXL 1AD9B 5K9KB 2OJEA 2F58L 2BNQB 4OZFA 3CH1A 3D0VB 3QFJA 5CZVH 5IOPB 4PJ8D 4M7JL 4XHQA 1XGQB 4OZGE 3HUJA 3ZYZA 2APFA 5DYOA 4KK6C 4R90L 4X7FC 5CJQH 1M7DA 1Z6JT 2N7AA 5DFVD 4ZUVB 1OD7A 5MEND 2ADIA 4FFZL 4AEFA 4EVNB 1NAMB 4JKPL 4XPGL 1F2XK 4TSBH 4XP9H 4PJBA 1A6TB 3HI6H 3IKCB 1XR9A 4BFIB 4DZ8B 3T65B 4LCUB 3ZTJH 1X4XA 3FQNB 4JKWA 3ZDYE 4I2XE 3AXLB 5CEXA 5GIRA 4L9DA 3OV6A 3RWGB 1I9JH 4L8SB 4TSAL 1XGUA 3GBNL 1U92B 4HUVB 1JWUA 1YYML 4PGBA 5ACLA 2EYTB 5D7KD 4YBHA 1KJ2H 3IDMA 5GRZA 5ANMA 4CU8A 3LKRB 3FL7A 1VFAA 4KDTC 4E42B 1S7WB 2EDBA 2VOTA 3G04A 5BO1H 5HHVH 5C0EA 2F53D 3SDCC 3UJIL 1QLFA 1DFBH 2R56H 2N7BA 5JLZA 1RIVH 2I9LB 4Q7DA 3N1FC 1R5WA 1M7IB 3PHSA 3V7AE 3TZVA 2OR7A 5KSBB 4LLQB 4MAUL 1CTNA 1INDL 4V2BA 3GO1H 4LRIC 4DKFH 5IIEB 4PJBF 3PWJA 3KYKH 2Z9TA 2VKXA 3SDAB 4UIKL 2FJGA 2VABB 3KPQB 2XOTA 4M43H 1HZHH 2EDOA 4HV8A 3C60C 5IFAH 4NO5B 3OG6B 3U9PL 2GT9B 3PWLB 2W9EL 4PJ7E 2C4FU 3H9HA 5F9AC 5I6XB 5HY9B 4JFXA 5CIPB 4I0PD 5I1CL 2HAZA 4GG6E 3C8KA 3MREB 1K6QH 2IBGA 2QQLL 2BHYA 5FCUH 5SWSE 1ZLVK 1BEYH 3B83A 4RMQA 4OIBA 1KN2L 1WICA 2DKSA 4PJIF 3MLPA 5D5MA 1SBSL 3VGBA 4PRPB 4JO2L 1ZHBA 2CKBH 4G6KL 4ZXBC 5DD3H 4R6UA 1MIEH 4OTXL 5HPMA 1GC1C 2GJZA 1OTUC 1MCCA 5L9DL 2PR4L 3UZVB 3EGSB 4RWHA 5IWLC 5E9DD 4N8PA 1JL8A 5E6IA 3B9KB 1WWWX 4C56D 4XVUC 3L95B 4M5YH 4LCWE 4ORGA 4PRHE 3L7EA 2IPKA 3DMMB 3R06A 4KKLD 1JHKH 1I7RA 2LAGB 5ALCH 3SOBH 4CJ1A 2YBRA 3O11A 1S8DB 4K2UL 1W72L 1KGCD 3D2UB 2BVUA 5CP7A 1LO0L 5ESAA 4Q9QL 4X9IA 2Y1VA 4MD0A 4JFZL 4CKVX 3EYVA 5LXGH 1LEGB 2M1KA 2CK2A 2EXWD 1QFWM 3KXFB 3MJGX 1P4LA 5C9JA 2IPTL 4YE4H 1T6WA 5ISZE 2J3SA 3MV8B 4JFEE 4P5TC 3PWPB 3DECA 5E6ZA 3QCTH 4HS8H 1M71B 1RIHH 3LQMA 3BP5B 4GS7B 3MGOB 2BJMH 1EVTC 3RU8L 3WEXB 4JAMA 3IFLL 5DHVB 3L3HA 4FZEH 5D2NB 3PHQA 3MBEC 5D2LB 4EI5D 1MRDL 2FCBA 3F7YA 4TVPH 2FBOJ 1VADB 5J0BA 1NGYB 1N2RA 4JM4L 1QFPA 4RAVA 4R7DA 1OTSC 1HQ4A 1VEMA 2YD4A 5F9WB 4BSWB 5BV7H 1M6OA 1A7OL 3IGAB 1CE1H 4LU5H 4ZNCD 4HDIA 1CFQB 1IGFL 4QTIH 3L3OA 1T0NA 3B9VA 3B3IB 2QQKL 3NPSC 4ZYKA 2H41A 4X6CB 1EHLH 3IVKA 1SYVB 1TENA 3ESUF 3DHJA 2DICA 1GRWA 1GL4B 1K4CB 3RA7L 1N64H 5IFHH 4EN3B 1NFKA 3BVNB 1RSFA 4FFVC 4RGND 2XPGB 4P23C 2RB8A 4BUGA 1E4JA 3W9EB 4JPVL 5EZIL 4MMXC 5I30L 3IF1B 3MRLB 4F8TA 4TQEL 2BMKA 3LKSB 3MNZB 5IB2A 1GIGL 1KTDA 1CGTA 5JNYB 3NA9L 3X3GL 4M6OL 3RWCB 5F6IB 5E56A 5FYLE 1HXMB 2D7OA 5CUSL 4ZDHB 1HH6A 4HUWB 4BKLA 1MIMH 3QCUL 3B9EA 4HSQA 3QDGB 5D1XC 2V7HB 5FYJE 4LKCA 5C09B 5T3ZE 4M5ZH 5B4MD 4WV1A 4Y5VC 4RFNC 5T33H 4EIGB 5D7JB 3A6CL 3PNWA 1C12B 3FB6B 2DTSA 1DN0B 1JHLL 2MCG1 4N0CD 4JLRB 2DQFB 1RJLA 1GOFA 5FYKL 1QSZA 4OJFH 5HYJB 2BSTA 4Y7MA 4PJDA 1DE4A 2R15A 3B5TA 1HKLH 1G7JA 3QPQC 4X98A 1ETZB 4LAQL 2FIKB 1IEAA 2D4DA 1TZHB 4JFFD 5IUSA 2QSQA 5GJSL 3BFOA 2BNQA 4QT5B 5DMIL 5J4MA 3OXRA 5L6YH 4K7PY 1O7SA 2GSGA 4Z7VB 5C86A 4LSQH 1XGQA 2KPNA 3K3QA 1A6PA 4Y5YB 4ZUVA 2IH3B 1TCRB 1PX4A 1RVFH 3S6CA 2KL6A 3LV3B 4ONFL 5HDBE 2MHAB 3I3EA 1BFOB 1A6TA 2Y25A 4I5BA 1X5YA 3BX7C 4DZ8A 4MQ7A 4G6JL 3KPLB 1ZK9A 3LVEA 4OM1H 2J6EL 3AAZB 4G8GB 2FR4A 2VC2L 4I3RL 4U2YA 5D8JL 1WWBX 1NDMA 2OK0H 4PJDF 2IAMC 4JFQB 3RWGA 3IXTB 4L8SA 2YRLA 3FB8A 3G6AB 3W0WA 2MPAH 2P24B 1FNSH 4LKXB 4OCSL 4UI2A 5EFIA 3KHOA 5GS3A 4FXGA 3H8NA 1MFBL 1JVKA 2X4QB 1V3MA 3QHZH 4GH7B 4QO1A 1K5NA 4MNGE 1C08B 4ISVB 1J8HA 3VXSD 5C07E 1SEQH 2APTA 3V5DA 3IDIB 5C0BB 2I9LA 2CLVB 3VXQB 4LPTA 4A6YH 3Q3GB 1GSMA 1S78D 5JORA 3MRNA 3K1DA 3TZVD 2IALA 4LLQA 4I48B 1MNUH 3P2TA 4HWEL 4DGVH 1U6AL 2PYEA 2Z35B 1Y6MR 4G43B 3AY4C 4PJ5E 4NQSA 4Y4FC 2BDNL 5T1LA 1IGCH 4YXLH 3U0TA 3KPQA 1DJSA 4H88L 3VWKB 2YD6A 1A7PL 4R97B 2KBGA 3DOSA 5IMKA 3PWLA 5LCVL 1P7HL 1CN4A 4BH8A 5CIPA 1AJ7L 1FSKB 3MO1B 4KMTL 3L3JA 4I1NB 3ZMRA 3MXWH 1AQDB 3RKDC 5CKAA 3GIVA 4S1QH 5HPOA 4XBGB 1BFVL 5F8RC 3V52L 1MHHA 5DEZA 5F1NB 4DVBB 1INEH 3IXAB 1GGUA 2GAZB 2XQYK 5FHAH 3WS3B 1YPZA 3MRHA 1FLRH 1A7NH 2D7QA 4OD1H 5F3HA 4YAQB 1JNNH 1IGIL 1KIPA 2VXUL 4HKXB 2HT2C 4NKIL 3PGDA 1P53A 1DQML 2COQA 3LZFH 4XC3L 4NWUL 1CXLA 2Q87A 3KLSA 3QI9A 3WFEH 2FL5B 1OSPH 1MSPA 5J57B 5E6ID 4K71B 4JFDB 5DJAA 2AJZB 3L95A 1I8IB 1MCHA 3RIAK 1OAUH 5F9JA 1FL3B 2Y7QB 3DMMA 3K81A 1CDGA 4JM2C 3ARDA 3ARBD 4UBDC 1QQDB 4BZ1L 1CBVL 2XTJE 4GAJH 4OCXL 1R0AH 4OZHE 1Q1JL 3NFNA 5CWSB 1IEBB 1EVUA 5IVZB 4CN6A 1CZ8L 1EFQA 1D6EB 1KGCE 3EYOB 3GMLA 2MKWA 3MTRA 1N6VA 5IGXH 5I66B 4OZFG 5GXBB 4Z7UE 4R96A 5C8JB 1UYWL 5E4EB 3RPIA 2JIXA 5LGHH 3B2VH 4KXZI 5D2NA 1E28B 4Z8FL 5D2LA 5I9QC 5EZOL 3UTTA 3K80A 5FUCC 5CD5C 1VADA 2BVPB 4OZIA 1RZ7L 3MFFA 5IQ7H 5GGTH 4J7RA 1IFHH 4L1HA 3MGTA 4D9LL 5ENWA 3BGMB 3WIHH 5INDB 1CK0H 1IM3B 4KK5C 4ZTPL 5F96H 4JG1H 1PYWA 1WBYA 4WJ5A 4U1GB 4M7KH 3BUYA 2NY3B 1A6ZA 3QEQE 5DMKB 1HYRC 4UIMA 1RK0A 4X6CA 4XCYA 4FFYL 4G8EA 4YDLC 5F7DB 2WP3T 3U82B 1OAZL 4XH2B 1S7RB 4P57B 3QEGH 2QTEA 2CLRB 2YD9A 1MCWW 3RWHB 1X44A 3TO2B 1XGRB 1T80A 5CEYA 1U8PB 3V8OA 3KPMB 4N0UE 3E6FB 3VDBA 4OT1L 3MNZA 1QUNA 4LL9A 4G8FA 1S9XB 3CDYA 1FL6B 1ZAGA 3LKNA 2C5DC 4Y1AA 4LRNH 1FVEA 4K7PX 4LSSH 3K4AA 4PJGA 4AEIH 5IV2B 5JMOC 1DLFL 4MCYA 1IC4L 5HTSA 3ZKND 1N4XH 2C26A 4E41E 4OZIF 3QDMA 4HWBA 1A6WL 5AZEH 5KVDL 4RNRA 5C6TH 3QDGA 4IRZH 2A9NL 1ZS8B 2V7HA 4PJCB 1IC5L 1YC7A 2Z4QA 1LDPH 4OFPA 1UZ6E 5AYUH 5HGBA 1E4WH 1OB1B 3MLXH 1NGXB 2F58H 5CINH 5SV3A 5C0AD 3ULVC 3FB6A 4DN3L 4OSUH 1GJIA 2Z31B 1RHHA 2I24N 3QPXL 3ZLQC 5HYJA 3G08A 1LMKA 2DIAA 4NDMB 4FFZH 3AB0C 4JKPH 4X6EA 1ETZA 4YNYA 3TCXA 4D9RD 4XPGH 1SYSA 4Y4HB 4IMLA 1U8KB 4Y19B 1FIGL 4KMLB 1J88A 3BAEH 3CGTA 2C3VB 5JMRA 1YEHH 3X17A 2BNQD 3QQ4A 2CDFB 3EW3B 3C9NB 5DMJB 5FKAB 2V6HA 2FGZA 4BQ6A 1LVEA 3HG1B 1BJ1H 2WMPA 4BM7A 4TSAH 3G5XB 3GBNH 3T0VA 1TVDA 1D5MA 2IH3A 2X4OB 4GXVL 1TCRA 4ZUSA 5BS0E 3HB3C 4PFEA 1KT2B 1I7TB 4WUUA 3BZDA 4J3OC 2X9WA 5MHSE 3TPKA 4XNZC 2FRGP 4PBVC 2H26B 3KPLA 3S8WA 1CI5A 1OWRM 3DYPA 1WFOA 2AQ1A 4FQHA 3QUKB 3C8HA 1HI6A 4LF3B 3W0WD 3VA6A 2E7LA 3SE9H 4LKXA 3QHTC 4MAUH 1INDH 1INQA 4C83A 2Q6WB 2A6DB 1NCBL 2X4QA 1O5DT 1DVFA 2VE6B 5CMAA 1C08A 4KTDL 1B0RB 4UIKH 1CF8L 2NY2D 1J8HD 2DOCA 4G6AC 3B2UC 1H5BC 3QUMB 3VFNB 4JE4B 5C0BA 4JRYA 3WHE0 1AC0A 1MQ8A 5KN5A 1S9YA 1MJUL 1MFDL 5E7BA 4WFED 3NZHL 2P8MA 2UWEA 3QWOA 1A6VL 5I1CH 4I48A 3VXSE 1EEUA 1KTLB 3KYOB 4CDGC 1KLUA 5FM8A 4P5KB 1Y18B 4K3EL 3H42L 1YJDC 2PYED 2Z35A 1ED3A 1MVFA 1F3JA 5T1LD 4PJEA 3SDAD 1KN2H 4I9WE 4PP2A 2ZJSL 2BERA 4PRBA 3X11A 1A2YB 1XIWA 4ZAKB 1U0QA 1KIRB 3QULB 3AS0A 2X4RB 3H3BC 3MMEB 2DAVA 4ZG1A 3JV6B 3D39E 4GOSA 1K8DB 1PVHA 1SEBA 1MCLA 2XNAA 4XP6L 4QRPE 1G7MA 3MO1A 4JRXA 4R0LA 3OR6A 5L9DH 2YXMA 3HR5B 1FL5B 4PJFA 5CJ5A 5EUKB 4LSPH 3JVGC 4P2QB 1CD1A 1MRCL 1FE8L 2NNAA 1W72B 5ACMA 2DQHL 2VLLA 5DJXB 5GGSA 2DQEH 4YAQA 2GFBA 2UVEA 3KLAB 6CGTA 2UWEF 3W5NA 1OAQL 3VRIB 1EERB 3IU3A 3OR7A 4WTZA 4UTAL 3CZFB 3ULVF 3HE7B 1HHJB 2CO6B 2I60L 3X3FL 2AJ3A 25C8L 2FX8L 1LO0H 5HHPB 4Q9QH 1U41A 3ECBA 2AXFA 4JFZH 4XBEL 5HHME 3UZQA 1U93B 2FL5A 1G9MC 1D6VL 1DUZB 4GLRH 1YEFL 4NWTH 3GRWL 2VAJA 1WC7A 4BUHA 4QEGA 5DUPL 2AJZA 4LCCA 5J1SC 4LVEA 2NX5E 3O2DA 3ARFA 3DMMD 3BIAX 2HLFC 5K9QI 3ARDD 4YHYB 3RU8H 3RUGE 1QQDA 4ALAH 3FB7B 5F89B 2AV1A 3QEHB 3EDDA 2ZUYA 4K7FB 1MCNA 4PJFF 1MRDH 2EO9A 1R3IL 2H2SC 4HJGA 4M61B 1NLDL 2VJXA 1WAAF 3U46A 1XEDA 3UJJH 5D93B 1I3VA 5EUOE 3SN6N 3IDXL 1A7OH 2XY2A 3I02A 5IVZA 3I85A 3EYOA