4LFHD

Crystal structure of 9c2 tcr
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
202
structure length
202
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGDPGGLNTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 9C2 TCR delta chain
publication title CD1d-lipid antigen recognition by the gamma delta TCR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhD02
3HZYB 5D5ME 4F7EA 2YEZA 4JM2B 2ATKA 2C3GA 4LVHB 1XF1A 4M7JH 5D2LE 5EIIA 2WWKO 5IFAH 2Y7QB 5BO1L 4EI6A 2ZG3A 4KHXL 1J1OH 4JRXA 4XNYL 4HS3B 2IBZX 4J4PA 5KAQG 2VTFA 1YC7A 2P48B 3T09A 1A8JH 1I7TA 2D0GA 1GAFL 2EDNA 4FQXA 3BPNB 3ALWA 3BE1H 3C6LA 1CDIA 3N0PB 1QPPA 1RMFL 4XP1H 3MV9E 4P46D 1OAKL 3QCTH 1T0NB 1MIEL 2OI9B 5E9DE 5EUOF 5ISZE 4PJ5A 1MCIA 4LGPB 1T03H 3TBSA 2YZ1A 1A4KA 4OGYL 2WBJA 1FFPA 2GEEA 3IDGB 3U7YL 1BMGA 1NUDA 4AIZB 5MEPA 3NABH 2GT9A 6FABH 1C08B 4JG0H 1P84K 1AGCA 5KTEH 4GH7B 4HUXA 4WFHE 1TTUA 4MXWL 5I8OL 1Q0YL 1XGPA 4POYA 5JHLL 2ZKHL 3NCYS 4KRPD 1XF4A 2W60B 1JGUL 3HAEB 4JQVC 2XWBA 1WCBB 4J1UB 3DUUA 2YXMA 3GMLA 2DM2A 2PYEE 1L0YA 3FOLA 2NQCA 3CFKA 4EIGB 2YPLB 1HQRA 2OR9L 4PY8J 2EDBA 4BQBA 2UZYB 5L2KB 3CFCH 1VKXB 4PLKD 3D2UD 3TP4A 3U9UB 3RP1A 2R2CA 3D0LA 4MA8L 4HWBL 4JY5H 4DVBB 3VWJB 4O2EA 5F1IB 3SCMA 2FGWL 3R8QA 4LNVA 1EAPB 1LDSA 3M1BB 1EJOL 2VN7A 5IESL 5HI5C 4M1GH 4Q6IC 1A21A 4PGDB 3CLFL 1IGIL 1KIQA 3MO1A 4KQ4H 1NGWA 1JIBA 1FL5A 1AE6H 3Q48A 1AFVL 1TZGH 4K3JH 3SGEI 2EIZB 1Z5LB 1FQ9C 2LVCA 1KIPA 2D9CA 1TQBC 4JRXE 4N0FA 3SGDI 1JGLL 5ITFA 3I85A 3CUPA 4M5YL 4KV5E 1YJDL 1FJ1B 3MRBA 1NGYA 1JZ8A 2J8UF 2YD1A 3O6KL 5DEFA 4K8RH 4MAUH 1NFDA 1CXEA 3GIZL 1ONQB 1K4CB 1QRNA 2GQHA 4NBYB 5D7KE 3I9GH 4PREA 2R56L 4PJ5E 4FQIL 4F2MB 3FRPG 2XKUA 4Y16A 1L9MA 1I9EA 2YUVA 3H9HB 1NGXA 4N1HB 3TWCL 3QNZB 1KT2A 5IHUH 3V5DB 4AH2A 4HWZA 2VWEC 1OAQL 1JWUB 4ODVH 4OZIE 2R0ZH 2X7LA 3BPLC 4G80A 4ZO7A 2VR4A 3OTTA 3RVWC 4K8RC 4ZUWA 1UM4L 2H3NA 5IWLC 5E2WH 2PXYA 5FGCB 2LU3A 4KROC 4OV5B 4LHUD 2YSSA 2NY6D 4HX1B 1YN6A 4IOFC 3ZKXB 1QO3A 1G0XA 4LLQB 1FORL 4CN1A 1HSAA 4YO0B 3ULUD 1IGJB 4I3RH 5L2JA 4HPYL 5I1AB 5DFTA 3EYVA 3F58H 4CU8A 4TNVF 5DFVD 1D9KB 3LKPB 8CGTA 2HG5A 5F9WC 4ZPTA 1RK0B 5T3XD 1MY5A 3QRFM 1WZ1H 4EDXB 1H3TA 2IAMA 1KBGH 3AREB 2W0PA 1WIUA 1UB6A 3FRUA 5ABDE 4MQTB 1CVRA 2Y6SC 2F74B 1ZLWH 1Q9KB 2P5WA 3TCLB 3SDAB 1FC2D 3LKOB 5IKCA 2NCMA 1IC5H 4PJXF 3HR5A 5CP7A 3C2AH 3VFTA 3O4LD 1WBYA 4AEHL 4N8VG 1OTUC 2W9DL 3EAKA 1SMAA 3JTSA 1CK0L 2BRRL 1KCVH 3O3EB 1FZKB 2X4SA 1RY7B 4RISH 3EJZC 4HULB 1KEGH 3P4LA 1QSEB 4NQEB 1FBIH 4Y8AA 4F7MA 3CFEB 4YHNB 2ORBL 1FVEA 1QRNE 5DJ2B 1BIIA 1OGAA 4PRNB 4KI5D 4Q58C 1B90A 4JQIH 4RFNB 1JWSA 3HC3L 4EVNA 2ZUQB 2HVKB 3B5GA 2P5EB 2VITB 1KNOA 1RIVH 5DRXB 5T1LB 2DF3A 4NWTH 5DJ8A 2OTUA 4LASL 3EJYC 5DQ9B 1UT9A 1Y0LA 1HI6A 1MIMH 4PRDA 2FBJL 1XCQA 1QBMH 5D71H 1KPUB 1SJEA 1AXSA 4R96B 3HNTH 4XP9L 4C56B 5DUPL 2DMCA 1K5NB 5HGBA 5IVZB 2H32H 2IADA 2VZ3A 4P9HL 1QLEH 2IEPA 1NL0L 3P4NA 5HYSG 3ARFC 3MMEB 5EWIL 2H2PD 1T2JA 4HIHA 1YEIH 3Q6FA 4U1SA 1KJMA 4IDLA 1TZHB 1VFAB 5SWZB 5KS9B 1QKZH 3Q0HA 4M93C 4ZUUA 1HYSD 4HIIB 1CFNB 2P5WE 1U3JA 4MQSB 1CLZH 2Y9RT 1LGVA 2IPKB 2P44B 3WV0A 5FO7B 1M71B 5I15H 5LAXB 5T5FL 1L9NA 5IW1B 1FRGH 1OLZA 4KZEH 2B2XH 5IIEB 1OT2A 1S7XB 1YDPB 3L3GA 5J12B 5IWLA 5I8CA 3QDGA 3WIIL 1AO7B 2DJ4A 4WEBH 2PW2A 3S36X 4PD4J 4FQJH 3PQYD 4RIRB 3T08A 1DQMH 3HZKA 3PNWB 4CADA 5EO0A 1NQBA 5I75B 5FYJH 4Y5XC 3G5VA 2VQ1A 3V5KB 2HTKD 1ZLUH 5EZJA 1OGAE 1DBKL 4X6EA 2OJZH 5DZLA 2NY1B 1LMKA 2DKUA 1KSRA 1UZ8A 4S1RH 3VFNB 1DUYB 2BJMH 3KJ6L 3PWPA 4HH9B 3MV11 4YAQA 3ME0A 4FXGB 1YNTA 3H9SA 2P8LB 4PP2A 4OZ4A 3PG2A 3M8OH 3C5JB 5FF6B 2DBJA 4N0UA 1Y6NR 3T2OA 4PRAB 1BBDH 4O5LH 5EU3A 4JQXC 4GQ9L 4KTYA 1CU4L 1NCWH 1F3DH 5DK0A 1RFDH 4LPTA 5DHVA 4X98B 2D03L 3VFRB 1DVFD 2D7OA 1IL1A 4KAQL 3O2VH 5HHVL 2OJEB 1RIHL 3MRDB 1OTTD 4ELMF 3I6KB 1PLGL 1JZ7A 1JWMA 5EFIB 5SWSD 3HA0A 4X80H 3V8CA 1FFQA 4WGVB 4NO3A 4UDUA 4GG8B 4NQCB 1G7IB 2EIDA 4JO4L 4NYLA 5JW4M 1XIWD 4RMQA 1MFBH 4ZOAA 5BV7B 4HIEA 2F53B 3ROLB 4P99A 4S1DD 4UT6L 1WQVT 3K46A 3L7EA 4YX2L 3LSOA 1KFAL 1LD9A 2FNBA 2ILLA 3NZ8A 4E9LA 2VXVL 2COQA 4G8GD 1OPGH 4U0RC 3T0WA 2JTDA 4BSWA 4YPJA 1T89A 5I1LA 1MCJA 5GGRA 1C5BH 2XRAL 1S9YA 5T1MB 2QQNH 3T2PA 2HMID 3AFLA 3AS3A 3OQ3B 3BUYB 2VYRE 2EDLA 3KYOB 2V7NA 5AYUH 4JM2C 4RAHA 4Z7VB 2HVJB 3MR9B 4LVHC 1MRDL 3PWPE 1G1CA 1GGBL 3EOAB 3EFDH 3EFFA 4MB5A 1T20B 1X7QB 1YMMD 3H9SE 2AEPL 5KSBB 1ZT1A 2ZCHH 5LGHL 4KK8C 2EYTA 3IGAB 3KR3H 3BPNC 4N0UE 1Q72H 2OR7A 3IDYB 4DGVH 3BQUB 4IRSB 3X14A 4P4KD 5LBSH 2OI9C 3HAEH 1PBYA 1ZT7B 2EKSA 3ARDB 4LSVH 4E41A 4X5XB 5SV3A 2XFXB 3GHBH 4TUOB 1BAFL 4O2FA 2YR3A 3SPVB 3HRZA 5GRUH 4X6CB 4G6JH 1TJHL 1LO2L 3A6BL 1DDHA 4LSRL 3UPCA 4DAGH 3T4YA 4P2RA 4NOBA 4CVXA 1I8MB 4Y5XA 3OXRA 2V9RA 3MRNB 3RDTD 3BESR 3TPUB 3K4ZA 3MA7B 1FNAA 1JBJA 4NJAL 5EO1B 2A9MH 3H3KA 5GS0C 3ECBB 1AY1L 5EOCJ 3JTTA 2BXYA 5DC0A 1N7ML 4XBEH 5F9AC 4P46B 1QZ1A 3M45A 4IOIB 4HCRA 2J1KA 1U92B 2GK2A 1U8NA 3GSXB 3DXAA 4G6KH 3UJTL 2AVGA 1HOCA 4OCRH 3GBMH 2BY3A 4Z7UF 4Q9QH 1NMCB 4PJ7A 3WFEL 2VXUH 4KK9D 2W0FA 2BSSB 1JN6A 3QHZH 1LO4L 2VSCA 5DQJA 3VWJC 5D1ZA 5FECB 2GJJA 4G8FA 1D7FA 3MFFA 4R7DA 4R90L 4XWGL 5DI8B 3K2UL 3D6GA 3GMMA 3SBWA 4KRPB 3I50H 4QYOB 4U1KA 4L4VA 3D1MC 5MEQA 3L5XL 5EIQA 2DICA 5FB8A 3QEHB 2OK0L 1UEMA 5F8RC 1YY8B 4FQHA 1NUGA 4D9LL 1T6WA 1AP2A 3VRIA 3BKJL 1MFNA 1IKNC 4GBXD 5FYKH 3VXRD 5CJXA 5ALBH 3MLTA 3DTXA 2DI8A 5IB1A 4MA3A 4M3KB 4UQ3A 5D7LA 1C16A 1XGTB 4HFWB 4UQ2B 4K3GA 3ARTA 4JKPL 3D2UB 4TTDC 4TVPD 2D9QB 1WBXB 5C0DB 2X4OB 3GDBA 1JGVL 4BSVB 2PO6B 4C4KT 4UU9B 3GNML 3VXSA 4GW5A 4HIJB 1FN4A 2GCYA 3R06B 4H26A 4GMSH 5F7NC 1MQKH 4AIOA 3P30H 1NGQH 4AY0A 2DQHL 1UQSB 4LSQL 2JB5L 1CCZA 4S10A 4CW1A 4QY8A 4P2RE 5E99H 3ZKMD 4NO0B 4Q97A 1ZANL 4JY4A 2G60H 2JCCB 4OAWA 3TN0D 1TENA 2IGFL 1JPFB 3HZYA 4JM2A 5EU5B 3IFLH 3BJ91 3ISWA 4XMPL 2MCPL 5ADPL 4DTGH 2Y7QA 1FNLA 4FG6C 3FN3A 1IMHC 1SJXA 1PKQB 4HS3A 1U8JB 1I9JH 4MXVE 5GS2D 4M62L 3DXAE 4FFZH 4R26L 5DEZA 4IMKA 2XY1A 3HB3C 2BVQB 4YXKL 5TQ2L 4LCCB 4OD3L 1P84J 1D9KC 4PJ7E 1QFWI 4ZFOB 2MQCA 1MAMH 2Y06H 4APQD 3KLAB 3RPIA 1A1NA 1KELL 4HT1H 3AREC 4B7LA 1U58B 3VXOB 3CFJA 3C08L 4D9RD 1XGYL 4YGVB 3TC9A 1OP9A 1I8KA 1MFDL 2NLJA 5ESAB 4LHUB 1F13A 2OMNA 3HE6B 4XB8A 4OCWH 1X5LA 2NY6B 5F96H 4QO1A 4XHJD 3U0PB 4C59B 3SDAC 3ZHKA 5HPOA 4ZO8A 5K9KB 1UA6L 4AIZA 3DMMA 2EEAA 4M48H 5E5MB 1X6NA 4OCSL 1W8NA 1XZ0A 4JG1L 4LSTH 5D7LE 3HC0B 3INUH 4LEOB 1Q1JL 4LPVA 3QR2A 1EEZA 1DZBA 3VXSE 2JJSC 2RR3A 1T4KB 3L9RB 4N9OB 4Q9CA 2WM0A 5DJDB 3F7YA 4EBQH 4JFYA 4YDKL 2AGJL 5HVGB 2I5YL 4GKNB 2WQRA 4RFNC 3EYQC 3VD4A 1VKXA 1HHHB 5F6HI 1FVCA 2Z0BA 3FT4B 1DEDA 2ZOKA 2QKIB 2DL2A 2ZUQC 2HKFL 1PSKL 1N64H 3GMQB 4LGSB 4YIQB 4KC3B 4DVBA 3O4LB 3VWJA 5F1IA 4G7VL 5K9QG 2BVEA 2CKBA 3O8XA 4XRCA 3GUTA 4FXKB 3FKUS 1JPGB 4XVSL 3D3VD 3EYUH 1LEGB 5INDB 4KKBC 4MQXD 5DVMA 4MQ7B 1AHWA 3AU1A 4N1EA 5JUEL 4IM8A 4X8JB 2EIZA 5ANMB 5ENWA 1HKFA 3AXLA 4S2SB 3TNMB 2OBGA 4BM7A 1FJ1A 1Q0XH 4LCIL 1J5OH 1Z3GH 4ZFFB 2Q7YB 3LQMA 3OKYA 5HHNB 4DN3L 1ONQA 1K4CA 3FB6A 5D93B 1KCUH 4ACPA 4U1JA 3JWDL 1WTLA 4X9BA 5H8DA 4G6ML 5DJ6B 4RFEB 3CSBA 2AJVL 1SM3L 5EZIH 3QWQB 2X4NB 1OT1A 4FXLA 4XP5H 3QNZA 1IBGL 3KYKL 3QIWD 4Y1AD 3CVIL 3WIFB 3FO0H 4KTEL 1HXYB 4RMTA 1SEQL 5J12C 4OV5A 1YEFL 4HPOH 4HK3N 3FN0L 2ZSVB 2MQ3A 2VDQH 4NM8H 1MCNA 4LLQA 1F97A 3JVGC 5FUZL 5I75C 3WXVL 4FABH 3MXWH 2VLKA 4YR6B 5HDBF 2QSTA 3LH2L 3P0GB 4KZDH 4GSDH 2NY1C 3DETC 3UO1H 3SKNA 1CBVL 1D9KA 3ZT7A 4GAJL 1RK1B 2D31A 3WLWD 4JREB 4TUJB 1RUQH 1EHLL 1FO0B 5I1DB 5ADOH 5D1XD 3TT1L 3BWAA 5CAYB 3F12A 2F74A 3U7AA 2BNQB 1Q9KA 2V2XB 3PL6D 3SDAA 1ZGLP 3PQYB 3HRPA 1FGVH 4HGWA 1Q9OB 1QLRA 5HDQH 4NHCL 5KG9B 4A2LA 5BV7H 3BVNB 1ZA6B 3AMLA 3FONB 2ADIA 1I9RH 2OL3B 3B5HA 3Q1SL 3PIQA 2XA8H 5F8QC 1QSEA 2EIEA 1YYLL 4YDIH 4YHNA 1ZLWK 2JJSA 4M02A 4PRNA 4DKDC 5GRWA 3VMPA 1QHPA 5EBMB 3WDIA 3BZEB 2NY2D 4WU5B 5JR1L 3JWOL 3DX8B 2PKDA 1J8HD 5BV7C 2FO4B 4LP4A 1OM3H 3BDXA 2FD6H 2YRZA 3RAJH 2BC4B 2P5EA 5I30L 4FMKA 1CDBA 4TRPH 1KLFA 3GGWB 35C8H 1DVFB 3EYFA 2CDEA 2E6QA 5FGCE 1EEUA 3L1OH 4L8CA 3IDUA 5CGYD 4ZS7L 2V5TA 1BF2A 2V2WA 2DQFB 2AXGB 4ONHA 2QADC 3MRLB 2CJUL 4RNRB 1CFQA 5SWSB 4LKXA 1LE9A 1KPUA 3QCVL 5GHWL 3S88L 2ITDB 2VLKE 1A7OL 5T33H 3BP7B 4NKQB 5E08H 1L6ZA 1KJVB 3DJ9A 3FB7B 1WWBX 5EULV 1IM3A 3WUWB 4KKCC 3SGEH 4X4ZA 4D3CL 1GIGL 3KPQB 3MMEA 2R15A 4U7MA 3GJFB 3OKOA 4GKOA 3VGBA 2OZ4A 4K7PH 1DQTA 1TZHA 4G8GB 1CVSC 5KS9A 3IDYC 3V4UH 3A0OA 4M6MH 1PJ9A 3PHQA 1U3HA 2PETA 4PGEB 5HYJB 2GUOB 3K4DA 3BQUC 3IFNH 4IRSC 4R0LB 5B38A 3T1FA 5FO7A 3ARDC 4LLUA 4LOUD 3X3FH 4HK3J 5IW1A 1YMHB 1FL3B 2DM4A 5IIEA 5F93C 1YDPA 3TH4T 1OB1A 4H20L 3OV6A 1U8PB 2BMKA 1AO7A 4XAWH 5L9DH 3ES6B 5IROC 1FLTX 1QSEE 1RQ5A 1HSBA 3CSYB 1RJYA 3UJJL 1YMMB 3V5KA 1YEEH 4EXPX 2AK1L 3G6DH 5E8PB 2VRAA 3F7VA 1YUHA 1AI1L 3U46B 4FZEL 5AZ2H 3FQWB 4DVRL 4MD4A 1DUYA 4P46C 1ADQL 1BZQK 3UZVB 1E4WL 4M6NL 3FN9A 4P4KB 4OLYL 1U6AH 2P5EE 4OLZH 4TSBH 2DMBA 3FCTA 2O5YL 3WJLA 1FZMB 1NMCC 5BOZG 4ZSOB 3TJHD 1GGCH 1DBJL 5I16B 5HYIA 5C0AA 1ZLUK 1LE5A 1G9NL 3FO1A 2XZZA 2BXZA 5HJ3B 3UYRH 3WO4B 2LFGA 3RDTB 4KRPC 1ZA3B 1ZEAL 1NBZB 4F7PB 3VRLF 3LEYL 2GJZB 4WNQA 4BSJA 1CR9H 4Z7OE 3W5MA 1HH6B 2P45B 2XXMB 3MYZA 5EFIA 3MLUL 5EC1B 1TETH 1TVBA 3HE7B 1G6RH 2W9LA 3OWEA 1DTUA 4PLKC 4U6VL 4GG8A 4NQCA 1G7IA 1G84A 4GRWB 2RB8A 1A9BB 2PO6C 2XT1B 2VJXA 4J6RL 4PJDA 4S0TD 4QHNB 4MMZC 1KC5H 5I1EH 5C0CD 1ZHLB 3OZ9L 2Q86B 5TGBA 3V52L 1DCLA 1AGEA 1F2QA 3KYAA 3RZWA 4QXGH 1AO7E 3OX8B 4KTDH 5T1MA 1KENL 4ZG1A 1HCVA 1KCLA 1N8ZA 4GBXB 3GSUA 4MMXC 3BUYA 4WHDA 3U7WL 4OGXL 4HSQA 1F58H 2YUXA 4G9DB 1MHHA 4YWGL 2HVJA 3ULVD 4XGZA 5DJAB 1GJIA 3D85A 4HGKC 2C9AA 3F6IA 3V0WH 3DX7B 2FL5B 2PN5A 1IT9H 4ZO6A 5CWSB 5C3TA 1DE4B 2FIKB 5KSBA 1RJLA 3HZVB 4LCCC 2J88H 2VABB 1U0QA 1Y6KR 3ULUH 3E1F1 1MWAB 4GAGL 5BMFH 1UFUA 5C0AE 2VDPH 2CRIA 3T8XB 3ZE0E 3BQUA 3MRMB 4IRSA 4XP6L 4H5SB 2YD8A 3ARDA 3BH8A 4X5XA 2XFXA 3TBWB 2J7LA 4HF5L 3TN0B 3JWNC 3X17A 3S3JA 2NY6C 3SPVA 5FYLD 4EI6B 3ULUC 1FDLL 5I1HH 2N56A 1MRCL 2HLFD 2AQ2A 2A77H 3MRNA 4RGND 3TPUA 3MA7A 1JRHH 2Y1VA 5EO1A 5DFVC 4Z8FL 2VXQL 4L9DA 3EDJA 1VESA 1NLDH 3ECBA 3MCLL 4OKVB 4APQB 3RX8A 3WNNA 4B53A 4PJDE 2IJ0C 4IOIA 1HH9A 3IJHA 5EU7C 4HMCA 3WE6B 4KVCL 5I18H 1E4JA 4P2OA 2NY5H 4ELKB 1HILA 5CILL 4JDTL 1FAIL 2BSSA 3MLYL 1ULVA 1GOGA 4YXHL 1BEYL 5D7IA 4KRNA 4F58H 1YQVL 5DI8A 3IRPX 2AI0L 3FQRB 4JVUA 2CPCA 1U8QB 4K3EL 5FHAH 2ESVD 4QYOA 4K7PY 4XPFH 2JK5A 2X2YA 2H6PB 3TV3H 2NY5C 2VE6A 3RL1A 5FKAB 1VHPA 4FTVD 5IJKC 4KI5C 3BPCB 1IVLA 4NGHL 1I1FB 1XGTA 4HFWA 4UQ2A 3P9MB 2KDGA 1EFQA 4OBSA 5CJOL 1UZ6F 4BSVA 1RZ8B 5HHPB 3QRGH 1KCRL 3FT3B 4NKMB 4HIJA 3EGSB 5D93C 4QRRD 3LN5A 4L3ED 4Z7WF 4M7JL 3D3VB 3QDJD 1T0MA 3P0YL 15C8L 1UQSA 1FIGH 3QUMA 2PNDA 5E94B 4UTBH 2DQJL 3MPCA 4F7CA 5C09A 3QDAA 1H3PH 1MOEA 3GSNA 1X5YA 1DQDL 4WW1B 5I0ZA 2LTQB 5IB2B 5DTFA 3IFPB 3O4OB 4NM4L 4Y7MA 12E8H 4YGAB 3T3PE 4XP1L 2LQRA 3QNYB 4KRMB 1FO0H 2XI9A 3BEVB 5EU5A 1BGXL 1AXIB 2H2PC 4RQQB 4R97B 5IMKB 2GITB 2P49B 3N85H 3QQ3B 4OZFB 3RQ3A 5E8OB 3IS0X 1JP5A 1T03L 2UYLB 3NFSL 1U8JA 4PJIF 2P4AB 3CH8A 3NIFF 5ESQB 1CXKA 1HYSC 1Z9SA 3BKYH 5ACZB 4BH7A 3NABL 6FABL 2EE3A 4MJID 5KTEL 1UC6A 4JREC 1H3GA 1U36A 3NOIA 3KLAA 5GJTL 1P69B 3QIWB 4PRIB 1CFSB 4Y1AB 5D7IE 4WW2B 4LSPL 1UH4A 3AGVA 5I0DA 4GW4A 1CN4A 5T1DH 1EHXA 2IPUK 5E00B 4J8RB 1MCQA 2K3TA 1U2CA 4LHUA 4GXUM 1A3LH 2MPAL 4QRQA 3RJDA 5JNYB 1PX4A 4JFDD 3ZMRA 1FNFA 1P7QD 1VB9A 3EO1B 4AEFA 4MD0A 4ETQA 1HK6A 3CDGB 2HTKC 1I1YB 5E5MA 3UTPE 1BWMA 4C83A 1BZ7A 3QEQD 4OFYA 3W9DB 3O11B 1BZ9A 1SJHB 3HC0A 4JY5L 1UYWH 2BY2A 3WD5L 4PGJA 2EDHA 4OLEA 3L9RA 4M1GL 4LLWA 3BP5B 5DJDA 4KQ4L 3OGOE 5D1XB 1OAXL 4DN4H 1WGOA 2V7HA 4OTXH 3PDDA 1A6UH 4GKNA 4JM4L 4JO3L 3MRFB 2ADFH 3U48A 3PL6B 2X9YA 3MXVH 4ZNCD 2ZP0T 4YIQA 3O4LA 5C09E 2LU4A 5ESVB 2G2RA 1CGTA 1J88A 3FFCA 4J3UA 1DVFC 1RJZB 5FO8B 3VI4F 3K1DA 2VL4A 4K8RL 3GJFH 2CIIA 1LEGA 1OTTC 4XXDA 4MQ7A 4NRYA 2QQLH 2X42A 1OP5H 4WEUD 5GPRA 2AV7A 4X9FA 5IJKA 2NYYD 3NIDF 4BFIB 3JV4B 4KMQA 3I6GA 2NY2B 1XIWC 3U9PH 1EVUA 5FM5M 3O41B 5DD0L 1J8HB 5IHLB 1L7TL 1N4XH 3VGDA 1FZOA 5MEND 3RWIB 1IZKA 5IFHH 2WP3T 1OTSD 5A1AA 5B3JF 3NPSC 4NZTL 3HMXA 3D69B 4Z6AT 5CUSH 1CL7I 4PJAB 3HUJB 3MBED 1VDGA 2XKNB 3C9NB 5DWUH 2HMIC 4R0LC 4PLNC 2O61A 2IFFL 1M7XA 5K93A 5CEYB 3I75A 4XI5D 2VLLB 1KYOK 4O58H 2BFVH 3OAUH 1U91B 4F15B 1WZ1L 4NZUH 3NZHH 1KBGL 1UWEH 4M7ZB 4IHOB 2G9HB 2NXZD 4RAVA 3REWA 5T3XE 4IRJB 5FM5O 1UVQB 4KGJA 4KY1H 2BSTA 4YR6A 5DSCB 2O5XH 2XV6B 5MHSD 5C0RH 4WI9A 4J3TA 3C6SB 3IDNB 1MLBA 1RK1A 1WC7B 4P4KC 3UPRB 1KCVL 4PYHA 3ZO0A 3GMOA 2J3SA 3O4LE 3EYSH 3WUZA 3MV8D 5I1DA 4U6YB 3FFCE 4ZODA 5ALCH 1R3LA 4IIQA 1NKRA 4MA7H 1F2XK 1BM3L 5K9QI 4LL9A 4MB4A 4BH8B 2XICA 3BZ4A 3PQYA 4FMFA 2BOBB 4JB9H 4MNQD 3SE9H 3QZWG 4KKNA 3WO4C 1C5DB 3RDTC 4Y2DA 5KG9A 1ORQB 5CZXD 1OQXA 4XVUD 1AJ7H 4KI5E 4LVEA 1RIVL 2OL3A 3G5YB 1CT8B 3BZFA 3JV5A 4NWTL 1F02I 3NCMA 4U6HB 5HPMA 1TCRB 4NQTA 4CJ1A 4WFFE 3IYLW 2X9WA 1MIML 3BZEA 4MX7A 4KK9C 2ZJSH 3EZ8A 3M17B 4WU5A 5D71L 5KOMC 3U30B 3HNTL 4TYUA 1R24B 4UINH 1NEUA 4TVPH 3FMGH 5ICZA 1FNEB 4NBXB 2VL5B 3ZDZF 4UBDC 2KUTA 5FA4B 5IBTL 5GGSY 5B39G 4ONGL 2DBLH 4PJGA 4P3DB 1YEIL 1OSZA 2F54D 4EXKA 1UG9A 5C70A 3KHOA 4GBXC 1MWAH 5J06A 4KUZH 4RWHA 2ITDA 3MRGB 3UMTA 4NZDA 3UDWC 5JLZB 1I7ZB 2HFEB 4U2ZA 1B4JL 3VFVB 2GSGB 3U0WH 1JL8A 3S9DB 1CLZL 5CD3A 1KJVA 4R4BA 5TF1L 1PY9A 1XIWA 4CVZB 5JMRA 2AQ3A 3WUWA 1P53A 4HK0B 4KZEL 5GRVL 4LGRB 1CXHA 1E27B 2KL6A 4WY7H 4HCRL 3O6FD 2VZUA 2FJGB 4WEBL 4FHBD 5C0CB 3CC5B 3O3DB 2IQAB 3VW3H 3TH2T 1RJCA 4NRZA 4FQJL 5B4MD 1DQML 1A7PL 4WCYL 1N5YH 5FYJL 3QDHA 1E0OB 1U8MB 5GS2H 3K81A 1HINH 3EDDA 3PQYE 1FP5A 3HG1A 3ZKMC 4UILH 3C5ZA 4N8PA 4PGBB 1FL3A 1Q9LB 3TN0C 4JHWH 4OGZA 4Y8DC 5JPMB 1RIUL 3RVVD 2QTEA 1LQSR 1MF2L 4UIKH 3ES6A 3W0WA 3BIAX 3M8OL 1XR8B 5C7XH 2O5ZH 2X89A 1D5ZB 5K59F 3CSYA 2HRPH 1YMMA 5J57B 4O5LL 4OM0H 3ZYJA 5E8PA 3SE4A 3EDEA 3LPWA 1NCWL 4APQC 1E4XH 3FQWA 4LHQB 3CCHA 4LK4A 2VDOH 3TYGH 2W65A 4OQ1A 4F57H 5IMMA 3CDFA 5E1AB 5HY9A 4XHJC 3VFPB 3E3QC 5I1GH 2BP3A 1T0PB 4WJ5B 3EOTH 1NUFA 2FYYB 2BHUA 2UZIH 3LMJH 4PJGE 4X83A 5I73B 4X80L 3TCXA 1MCLA 1ZS8B 3WIHH 3HCVB 1F3DJ 1FLRH 3IFOB 5HJ3A 4NQXA 3Q3GA 4QRPD 4H25A 4JHBA 3WCYA 1ZA3A 1ODAA 1A7RL 1MFBL 2BVYA 1KG0B 4F7PA 3ARRA 1MHEB 3AC0A 1UXSA 1CXLA 3MRRA 2WLZA 3LKQA 5F3BA 3S3SA 2K7PA 4V2CB 1GGYA 1SY6H 2Z8WC 2WBKA 4IJ3B 4OFIA 4JANB 1RUML 4QTHB 3RWDA 4G8EB 5LJYH 4L5FH 2QQNL 5AAWA 4OFKA 1ORSB 5KANI 5IR1A 1FGNH 1A9BA 1NCDH 3QQNA 4QHKJ 5A2LH 3LS5H 4ZAKD 1PEZA 2DQEH 3HG1E 3KXFB 5AWNH 2Q6WB 1X5KA 2GKIA 5CGTA 4OZFH 3DVNB 1ZHLA 2Q86A 3MJ7B 4MQXC 4GRMB 2H8PB 3W0WE 1NC2D 4MJ5A 4P0DA 3UTZB 2ZCHL 1AIFA 2NW3B 4GBXA 2LTQC 3L3HA 4FTVB 3VXRA 2EDOA 1NBVL 3U4EB 4YHPA 3O4OC 3UDWA 1RUPH 1BJ1H 4G9DA 2DJSA 4O00A 4KJPD 2WW8A 4X6BB 3OGCB 2IQ9L 4LSVL 4R97C 2C3XA 5GS0L 3GHBL 2R0LH 3ARSA 3U36B 1J12A 3TZVA 4DUXA 1LK2B 3PGFH 2KH2B 4DAGL 3B9EA 3QDJB 2YC1A 4ODTH 3VXTB 1HWGB 3FB8B 2KPNA 4O4YH 5EUKB 4NUGH 2EIBA 2FH6A 4LLDA 3QIWC 3QUZD 5AD0A 1YN7B 4J3XA 3T8XA 4WW2C 3MRMA 5H35A 3OB8A 1H15B 2A9ML 5LQBH 2J2ZA 3OKKA 4JPIB 3SJVD 1AQKL 3MUGA 4IMLB 4OIAA 2R8SL 4XBEL 1RUAH 3KPOB 1RZIB 4QRUA 3V6FA 1R3JB 1ZK9A 2CMRH 4ESKA 4Z7WE 4UAOB 1I3GH 3GBML 4PJ9A 4F3FB 5KSUA 4Q9QL 1F45A 3QULA 4QRSB 4MNGA 2WSKA 4MCYB 3ESVF 5E9DD 2B1HH 4MJIB 3ARZA 5ISZD 3EKCA 2JKXA 4GRWE 3WLWC 1OAKH 1FH5H 1MIEH 2GY7B 3N1MC 1I9IH 5CZKA 5D1QA 3SDCD 3O3BB 4MD5B 3HNSL 1MH5B 5CIPB 5D1XC 4P2QB 3RWGB 1J7VR 4ELKA 4GLRI 5DJXB 2EDTA 4WFHD 3PL6C 3FQNB 4JFDB 1U8KB 5FYKL 1P7QB 1LP9A 1TVHA 5ALBL 3MGTB 2E3VA 1SEBB 1TNNA 5I8OH 5JHLH 4WI8A 5D2NB 2Y36H 1NMBH 2EDJA 3VXRE 3QEQB 3QXUA 2FH8A 1LVEA 4GMSL 5E95B 5AZEL 2H6PA 3GKWL 3BDYL 5L8LB 3AY4C 1I7UA 3FHAA 5IK3B 3P30L 1NGQL 2N7AA 4YLQT 5DHXB 3T2QA 4KMTH 5JXAH 5E24E 1LO5B 5HYQB 4EN3B 1F4XH 5AEAA 4Z7VF 2NY2C 1CLCA 1FNGA 4K7FB 3ALXA 4MA8H 4Y88A 2HJFA 4HWBH 5E99L 4DCQA 1IM9D 2G60L 4BQ6A 2FGWH 2RBLA 1FAKT 3FT3A 2PR4H 1U8OA 4G9FD 1EBPA 2CK2A 4K55A 4JEGB 3O3UN 1IGIH 5CGYC 3D3VA 1VADB 4ZFZB 2BZDA 4J4PD 1QFWM 1FVDA 4QLRA 1ES0B 4MLSA 1GZPB 3G04B 5B22A 1I9JL 4Y5YB 4FFZL 2DI9A 4LP5A 2YA1A 5E94A 1ZVYA 2ENYA 2VXTH 5CBEB 3ZLQC 4FQXD 4ZUSA 4AT6B 1YEJH 3C6LD 1BLNB 1DQJA 4LCUA 2YRPA 4WW1A 5LXGL 1ZTXL 1NFIB 4YC2B 1MAML 3ET9F 4X6CF 1U8LA 3QNYA 4F15C 4MNGE 4M4RA 3O6KH 5D7KD 4PJ5D 2FLRT 4M7ZC 4QRTB 3GIZH 3C8KB 4RWYH 4IRJC 2GITA 5MENB 5E8OA 2WBJD 4MHHG 2UYLA 5F7LB 1OWRM 5F96L 1XH3B 4OCWL 2HH0H 4FQIH 4OLUH 4D9RE 2VIRA 5D70L 3FRPA 4X0KB 4UIMA 1UKTA 2YD4A 1IGTA 3MBEB 3TWCH 1TXKA 3E3QE 2B8OT 2XOTA 1LP9E 3LV3B 4LOUC 2QBWA 3QIWA 4L1HA 4LSTL 4I77H 3C87A 3INUL 3TO4D 5J6HA 3RIFK 3CVHA 2ERJB 5ID0B 3V95A 3GJEB 1GGIL 1A3RL 5B3JE 5DMGD 5LGJB 5FO9B 5JNYA 4MS8D 4EBQL 2NXZB 3EO1A 3GSQB 2FX8L 4XX1E 1XT5A 2MTPA 4HWNA 2BDNH 4P9MH 3RU8H 4HPYH 4X9HA 3S4SB 5EBLA 4PR5B 5DJ0A 4PJHB 3KPPB 3O11A 3SCMD 4ISVB 2W1NA 2I60L 2I07B 1GZQA 2VISA 2OLDA 5EU4B 5JXED 3H6JA 1S7RB 5DHYB 4J3VA 3EYUL 3TBTB 3BP5A 3ELAT 3MV8B 2OZ4L 3TJHC 1N59A 4AENB 4XNQB 3U4AA 3D3VE 1WFUA 4M8QB 3U30C 3RWFB 4S1SH 2IALB 5J1SC 5CEXB 1EHAA 4ODUA 4MNQB 3GSRB 1K8DB 3ZE2F 4AEHH 4N8VA 3D0VA 1LNUB 1CK0H 5BVJA 1Q0XL 3QJHA 1J5OL 1Z3GL 3DIFB 1RJZA 4LMQI 3BKMH 2BOCB 3UJIH 1BHGA 5FO8A 1QRND 4NIKB 5HGHB 2AJXL 1MI5D 2WINB 2JLLA 2JCCF 2NW2A 4Y16D 3PV7A 3H3PH 5C0IB 1BBJB 5EZIL 1AKJD 1FCGA 2VZOA 3RTQA 3JV4A 3BRGC 4XP5L 4LFHG 4F9PC 3CXHK 1CDJA 3O41A 1SYSB 4PJFA 4OZHB 4AM0B 1BFVL 2WWKT 3BW9A 3FO0L 3I02A 1DANU 1FZJB 3GJFK 3RWIA 4OJFH 3ULVH 4LASH 4NM8L 3D69A 3I3DA 1OP5K 2ICWI 1EHNA 4MNHA 4FABL 4PJAA 2F54B 2V9TA 2FBJH 2KZWA 1A6ZB 3LEVH 5C0FA 2GYSA 5L6YH 3OKEB 2DQGH 4XP9H 2WIIB 4Y4FD 4KZDL 4GSDL 1N2RB 2Q76A 3UO1L 4OCMC 4ZUTB 1JTPA 1U91A 2IAMD 1NL0H 4L8BB 1RUQL 1K4DB 4L4JA 3ULVC 3WL9B 5HYSA 3S34L 5IVXF 4Y89A 3ULUF 1ZE3C 2XTLA 3IXTB 3QEUA 2P5WD 3GSVA 4NKDB 3WO3B 1IGML 4JFPB 1UM6L 2DQIL 4X99B 1HEZB 5ICYB 1RSFA 4OD2B 1P2CB 5BV7L 4P5MB 2CDFB 1HIML 3HZMB 4J3SA 5T3ZE 1S7TB 5CSGA 1XGUA 3F5WA 1MELA 3KDMB 3UTSD 4HC1A 5BRZE 5I73C 4YDIL 1YEGL 5KN5A 2PF6A 2KZ1B 5TDNA 5IF0B 2R1XA 4OIIL 2FB4L 2HLFC 2A2QT 1DBKH 3IAQA 3UBXG 4RGNC 3ZKND 1BQUA 2ZSWB 4JFQB 1OM3L 2DWEB 2FD6L 3VXPA 4RMUA 3STBA 4YJZL 4PJFE 4TRPL 2B5IC 1TPXB 35C8L 3UAJD 4WTWA 4U6HA 1X5JA 2ADJA 4NP4L 4IJ3C 1TCRA 3L1OL 3BIKA 4LDEB 5FYJU 1KB5A 1OL0A 5F9OH 5DFWH 1DN0B 1A4JA 2EO1A 3M17A 1IAKB 1QRKA 1CU4H 1ZV5A 5T33L 5IEKA 1R5WB 5E08L 1MCSA 1T1XB 5JQ6H 2E7LC 1WITA 1N6UA 3MRKB 4OGAD 2R1WB 1XF5B 3L3JA 4HQQH 4I0CC 4KAQH 4M7KH 1MCWM 3DURB 2F5BL 3L5HA 3MNWB 2UZXB 1A5FH 4P3DA 1PLGH 4KDTC 3WHE0 5KSVA 1KOAA 1YEKL 2CO7B 5CMAB 5GS3A 3UX9B 4PY8I 2PYFB 5D9SA 4AEIH 2EC8A 3V4UL 1V8HA 5JLZA 4M6ML 1ZWIA 2HFEA 3VFVA 2YWYA 2A73B 5DC9B 2DLIA 3IFNL 1GPOL 4I8DA 4F9PA 1OVZA 4H88H 3X3FL 2QEJA 4HK0A 5AUMA 1MJJB 4ZAKB 3LKNB 1Z9MA 1S7VB 2Z93A 4WHYH 5IEHA 5FGBC 2DB8A 1RU9H 4LU5L 2VXVH 3T2NH 4XAWL 1P9MC 5L9DL 5C0CA 2J4WH 5JQHC 1JK8B 5HHQB 2XRAH 4NRXB 4LAJH 1NC2B 3SGKC 4I18B 3RIFF 3GSWA 1CICD 3MNVB 2BY1A 5B8CB 3N1QC 3WBDA 5IW6A 1TTGA 4UOJA 3PWPD 4M5ZH 5INCB 5DJZB 1CL7H 2EDFA 5CEZE 2ZUXA 4KPHL 5CIPH 4WGWB 4OLZL 2NY4D 1NDGA 1XR8A 5DGRA 2I9LB 2AEPH 4LPCA 1FFRA 1GGCL 3DECA 3OJVC 5K33A 3VFMA 3EO9H 5LCVH 1NKOA 3ARBA 3STZA 6CGTA 3AS0A 3MCKB 3QUZB 1QA9A 3MLZH 3GBNH 3DRQA 2VO5A 5F7FA 25C8L 2Y23A 1P1ZA 3HS0B 5GRYA 4DQOL 3B9VA 5D2LB 1B0RB 1PW3A 3C60D 2YUWA 4WV1A 1CR9L 3P9LA 1KPVA 2YA0A 1UWXH 3BO8A 3KJ4B 1TJHH 3EUUA 3VFPA 4WJ5A 1MLCA 2FZ3B 3P4OB 3ARVA 2EH7L 5IB4A 5JOEA 4H0IA 4LKCB 1K2DB 5D2NC 4HEPG 1LEKB 1WCQA 32C2B 3VI3E 1ZHBB 2VZ1A 3GSNL 1T1YB 4HG4J 2HN7A 5E9DB 5F1OB 1MHEA 5ISZB 1N7MH 5K9OB 3RWEA 2CDGB 3REVB 1T66D 5I1EL 1ED3B 3BAEL 3PABB 3QDMD 1S9XB 3SDCB 1UJTA 5FK9B 3UJTH 1CLOL 3LZFL 1P4IL 4XC3H 3RVTD 5EOQH 4QXGL 3WFEH 5C0CE 3FB5A 4KTDL 3BRDA 2F8VA 2XQBH 3RGVD 1ORSA 1MAJA 2H26B 5EC2B 5SX4I 4U1GB 4G3YL 4UB0H 4R90H 3K2UH 5TQ0L 1F58L 4OCYH 2E7LA 2K7QA 4O2CB 1KPRA 2PYEB 5F6IB 3DVNA 2ESVA 2HT4D 3DWTA 3N1GC 2OK0H 5FAAA 3V0WL 2ATPB 2HJKB 3ULVE 4Y5YC 5DD1H 4KDTA 3BKJH 1NJ9A 4XCYB 3UTZA 1OGTB 5E6IA 4OLVH 3MC0A 3H2WA 3ULUL 2F9BT 4DZBB 2NYYC 1XF3A 1I85A 5JW5A 1BFTA 1WFOA 2VDPL 2IMNA 1JGVH 4NCC2 5F71A 5JPNA 4XBPB 1S9KC 3GNMH 2J6EA 1AD9A 3H3BC 1IM9B 3OGCA 1V7MH 1RZ7L 4TSCH 3VDBA 5T3XL 3U36A 4K9EL 1NSNL 2YEZB 1RZFL 3BI9X 2NXYD 1OTSC 4DGIL 2ATKB 3GZKA 2DIAA 4QRRA 5I19H 1TZIB 4U49A 5HVHB 4L3EA 2E27H 1OAYH 5FYKU 3H8NA 1P9MA 4JRXB 3MBEC 3GMNA 3QT2A 5FYLE 3FB8A 4DZ8A 1ACYL 1NCAL 2BRQA 3RNQA 2A77L 2EH8L 4WHTA 1I7TB 4FQXB 4XI5C 3TFKD 2FHCA 3C6LB 2DTSA 2JJTC 1F3JB 2IH3A 1NLDL 2IGFH 4JPIA 5F7DA 3U2SA 1J1PH 4ZPVA 4RGNE 4IMLA 5KW9H 3K8KA 5M95B 1AGFB 4U1MB 4XMPH 5GSRA 4PJ5B 4RGOL 2RFXB 2NXZC 1WIOA 1R5IA 3TBSB 4DK6A 1A4KB 3OR6A 2NY5L 2WBJB 1GOFA 3V5HB 5TQ2H 2MHAB 5GXBB 5MEPB 2GT9B 1PD6A 3PDGA 5D1ZD 1AGCB 4U7SA 4OZIB 1IQWH 4F58L 1XGPB 1BQHG 4NFCA 1B0GB 2LABA 1XF4B 1KELH 2ICWB 3C08H 5FHAL 4DOHE 2XWBB 5GQBA 4MD5A 1HDMB 4XPFL 4ZOEA 3B9AA 4HBQA 2FJHB 1FE8L 4D8PA 3K3QA 2ESVE 3CFKB 5F3HA 4DFHA 1HQRB 4YFLF 1JZ2A 4OF7A 3CGTA 4NC1C 3MGTA 1INEL 3LCYA 5CZXC 4OCSH 5D2NA 4XVUC 2E8ZA 4X4YA 4O2EB 3SCMB 3QRGL 1NH6A 5F1SA 2FATH 1Q1JH 1JZ6A 4LEXL 2BVUA 2J8OA 2RGSA 3ARUA 1IQDA 3MO1B 1KIQB 1NGWB 1CTNA 2AGJH 1EK3A 4QRRE 2WUCH 1LO5A 3DPBA 4L3EE 1QSFD 3R0MA 1KIPB 4K7FA 2AP2A 4I9WE 3H9ZA 4N0FB 3SO5A 5J0BA 2VN4A 3CUPB 3ZYIA 4G7VH 3OJDB 3HPJA 3MRBB 3OBAA 4LQ1A 12E8L 4KGLA 5IVXA 3LPFA 5J3HD 3VWKD 1VACA 4KH2A 4KJQD 3N85L 1QRNB 4F33B 3CPLA 4PREB 3VG9B 3U1SH 1MI5B 2W59A 4JFZL 2PUQT 4Y16B 3BKYL 4AT6A 1VFBB 1YQ2A 1NGXB 1JCKA 3G5XA 5MERA 1KT2B 1AKJB 4AH2B 2D7NA 3ZE2E 4BUHA 4N68A 3PV6A 4HWZB 4KMLB 4DEPB 4BYHA 1U2HA 1A6WH 4G80B 1P4LA 3CXDH 1IEBA 1R3IH 1JMZA 5TJWK 3H7BA 2H3NB 2NTFA 2OL3L 4DN3H 2PXYB 4FQ2L 3ARWA 4LRIC 4QRTA 3PWUB 3C8KA 3OPZL 5A2IH 2KKQA 1YN6B 1QO3B 3CFIC 4R6UA 2C5DC 1A3LL 1HSAB 5B4MC 3DUSA 2AJVH 3DMMD 2GY5A 3MBEA 1IBGH 5L2JB 2ZPKL 1FNHA 3EYVB 3CVIH 3B3IB 4KTEH 4KXZI 1JHTA 1EVTC 3U0TA 2HG5B 2V5YA 4Y19D 2JJTA 3F7QA 5D2NE 1YEFH 1LWRA 1JNJA 3GJEA 3RVVC 5EB9A 1F6AA 2IAMB 1CGSH 3FRUB 4BK5A 3WXVH 4PRHA 5FO9A 2V5RA 3D9AL 3GSQA 2P5WB 4L9LB 5HGDA 5IKCB 1MHPH 2ADFL 1KV3A 3HR5B 5CP7B 2C4XA 3VFTB 3MXVL 1CBVH 3KPPA 4JLRA 3TPKA 2NNAA 4ISVA 3PXJA 4DGYH 3HNVH 4NNPL 3W5NA 3O8XD 4OD1L 3JTSB 1PAMA 2PTTA 4YE4H 1TPXC 1H5BA 3BH9A 3PHOA 1PYWA 4PRBA 2BVPB 3TBTA 5IVXE 5IB3A 3MV8A 5CKAA 1PKOA 4ZOBA 2R2HB 5JA8B 5L7XL 3RKPA 2QQLL 1F3RB 4F7MB 1S78D 1CGVA 3QP3A 4CU7A 4PB0L 3RWFA 4O02H 3K74B 2WK2A 5CEXA 5SX5H 5FCSH 3GSRA 1K8DA 1JWSB 1H9VA 3WFZA 1C12B 3MLRL 2BERA 2BOCA 1KNOB 2VLRD 1N4XL 3Q1SH 2VLME 3OAYK 4GXVL 1Z0MA 1YYLH 2OTUB 4KU1A 2RAMA 1NBYA 1Y0LB 1DR9A 1HI6B 4PRDB 5C0IA 3DSFH 1NAMA 1BBJA 3B83A 3QUXD 1KIRB 4LFHD 1SJEB 2IBZY 1AXSB 3LRSA 3P3YA 5CS7A 4I1NB 1YPZF 4MHHI 1SYSA 1NDMA 3LEXB 4OZHA 5JHDA 3SE8H 1VFUA 4ZAKC 3D39A 5HGBB 2RHEA 4O58L 4PRPD 3OAUL 3VFGL 3P4NB 3RRQA 3T3ME 1MCKA 5B39B 4HIHB 4JDZA 4ZS7H 3NBNA 5EZOH 3DYPA 3TEUA 1A9EA 1DUZA 3IKCA 1SJVA 4U1SB 1KJMB 4N0RA 1LDPH 1T7VA 2F54A 3PP4H 4I18C 3QH3A 4OM1H 4PRHE 4KY1L 4WW2F 3S88H 3QCVH 1MCHA 2R2EA 5B8CC 1A7OH 2O5XL 3E6HB 4FNLL 1R3KA 1D3CA 4XWOD 2NZIA 3BKCL 3N1FC 4AMKL 5I8KL 5IHZA 4KJPC 1GIGH 3EYSL 3L3GB 2DQTH 4M3JA 5I8CB 5BOPA 3O6FA 2PW2B 5CBAA 4UTAH 1QPXA 1MCRA 5KSAA 3HZKB 3MV8E 3S5LG 4NKDA 4CADB 5EO0B 2BVTA 4JRWA 1DANT 3QG6A 3G5VB 2VQ1B 4JFPA 4IDJH 3WNOA 4I48A 4BQ8A 4X99A 1HEZA 2A1WH 3DHJA 2F19L 2VQTA 3QUZC 4LVNB 4X6EB 5IBUB 3S36H 4OD2A 1P2CA 2CDFA 1AJ7L 2QQKL 1U8HB 3HZMA 1CIUA 5H94B 5CSZA 2C3VB 4V1DA 3PWPB 1WAAF 3GRWH 3MYJA 4YAQB 1KGCE 3KJ4C 1YNTB 5H37H 1S7TA 5IOPB 1KLUA 2EC9U 3KDMA 4OZ4B 3CNKA 4QWWD 1NANI 2NY4B 3UP1A 5IF0A 4N0UB 4OZGF 5E1HB 5EU3B 4C54A 4N90D 1ZVSB 2ZJSL 4OLXH 1T80A 3THML 2ZSWA 3TF7C 1AI1H 2EECA 2D0FA 4JFQA 5DK0B 4OIBA 3ZT5A 2PTVA 2BNRA 4DVRH 5DHVB 4TVPL 1ADQH 3FMGL 1E4WH 4M6NH 2Q8BH 1UADC 4OZHE 1EEYA 1G1YA 5JHDE 5FUCE 1IL1B 3SDCC 2UWEA 2WAHA 3D39E 4F37K 2V2TB 3NCFB 1HQ4B 1JWMB 1DN2A 1CDHA 4UV4H 4AJ0A 2H45A 5CCKH 1MWAL 4NO3B 1G9NH 4U1GC 4KUZL 1A6AA 2F54E 4UDUB 1RAMA 2GTZB 2J5LC 1FFOA 1R5WA 2KQNA 3U0WL 3IU4L 3S37H 4RGMB 3RWJA 4QRPA 4RRPG 5F6IC 5JDSA 5HHOA 5J1TC 2R1WA 3RIAK 3LEYH 1CF8L 3NIGF 3T0AA 3L7EB 3HUJF 3LSOB 4MZ2A 2G75B 1LD9B 5MEOA 1H3WM 5CGMA 3QDMB 2GSIB 3QO1B 3VJ6A 4BSWB 4HIXL 3O6MH 3MGOB 1BQLL 5I1LB 2CR6A 4U3XA 5GGRB 3W2DL 1QVOA 1U3HD 1S9YB 4WIQA 4U6VH 3EW3B 5LVEA 1ZGLA 3CZJA 1IKFL 2A73A 2E7HA 3RGVB 4PJBF 4J6RH 3SQOL 2XG5A 3IVKB 3UTQA 1QFHA 1YC8A 5FGRA 1MJJA 4ZAKA 1A3QA 3LKNA 4PLJD 4HV8A 5DJCA 5DVLA 5HVHC 3OZ9H 4UIKL 1NEZG 4V1DE 2ZUYA 3G6JA 3ZTJH 3L5JA 5C7XL 1WV7T 4J4PC 1JK8A 2O5ZL 1G0YR 1KTDA 2HRPL 5HHME 1KENH 1ZT1B 2XZCH 1NC2A 4OM0L 3SDYL 4I18A 4FQXC 3C6LC 4M93B 1BFOA 3BRFA 3MGAA 2EDDA 3QXAA 5DJZA 2EKSB 4NN7B 4Z7NE 2VDOL 2BNRE 4O2FB 3UBXI 3NN8A 2WBJC 3HRZB 2NXYB 2UWEE 3HMWH 4H0HB 2I9LA 1N6QL 5DUMH 5C0AD 1OARH 5EZLA 4M1DL 3T4YB 2W0LA 2UZIL 4GKZA 3RI5K 4CVXB 5F44A 1NCCH 2VB5A 3OXRB 1JYNA 2AV1A 3BGMA 1FLRL 5ITBH 5E56A 3MCKA 4YBQD 4XP6H 2MOVA 2AQ1A 1LO3H 1Q94B 2EO9A 2ITCA 5EA0H 5IHBA 3QQ4A 3SJVA 4QRPE 5EU6D 1EO8L 1IGCH 5HHOE 5MI0B 1U8NB 5A2FA 5DMGC 1SY6L 4MS8C 2EYRA 1HOCB 1JPSL 2FZ3A 1MRCH 3P4OA 4PJ7B 3BPOB 5I17A 4L5FL 2OMBA 1K2DA 2W0FB 4U31A 4PV8A 1LEKA 1JN6B 3MRQB 1FGNL 5DJYA 5DQJB 3AVEA 3SCMC 3TO2A 4OLWL 4F9LA 5CD5D 5D1ZB 4BQ9A 3O2DA 3MFFB 4R7DB 5E9DA 5ISZA 2DQEL 3GMMB 5JXEC 1M05A 3FL7A 2CDGA 3GRWA 1ED3A 1DBAH 3G6AB 1X5HA 1UWXK 5FK9A 5FB8B 4B50A 3DX6A 1HZHH 2WQ8A 4QHUA 5CILH 2QR0A 4NN5B 4ONFL 4JDTH 1FAIH 3G6JE 3OG4B 3T04D 2YN5A 4NDMA 3MLYH 4R2GD 3MLTB 5EC2A 4YXHH 1NLBH 4MA3B 5D7LB 1C16B 1MFAL 3WS3B 2AI0H 3JSSA 1YEDA 2DQCH 5F7WC 2ZUSA 4K3EH 3D85D 3KPSD 3Q5TA 4UT7L 1FN4B 5GIRA 2R0LL 4PTUB 1F4AA 1U42A 3L3KA 3VG9C 3Q5OA 1JGEA 3ZE1E 4Y16C 1OGTA 4X6DA 4ODTL 1HXMB 1GC1H 4I2XA 3MROB 1HNFA 1QSFB 4O4YL 4QY8B 4NUGL 4CW1B 4DEPC 1JNNH 3MJ6A 1A7QH 1BJ1J 2XZQH 4JY4B 1NC4A 3VH8G 1LEIA 1KCRH 5LQBL 4OAWB 2XXCB 1I1AA 4MZ3A 5DD3L 4OFDA 1RUAL 4G9FA 1XGQA 4EOWH 3VWKB 3ZDXF 1TZIA 3SJVE 2CMRL 3P0YH 3EOBA 15C8H 3L95A 1I3GL 3ZKSD 3BP6B 1GC1C 3H7LA 4PJXB 5HD8D 4YZFE 2DQJH 2EDXA 4QT5A 4JPVH 4WFED 1DQDH 2BX5A 1ZGLM 1QLFA 1F3JA 3PJSB 2B1HL 4NM4H 3RPIB 2VDLH 1A1NB 1FH5L 2IAMC 5FUOH 1BGXH 1AGFA 4U1MA 3CFJB 1I9IL 4OCXH 1U9KA 2RFXA 4P2OD 4KI1A 4YHIB 1I8KB 1IARB 2NLJB 3V7AE 43C9B 5DK3A 3NFSH 4AQOA 3SDXA 2A9NH 4L9LC 1Q9WA 3V5HA 2F8XC 2MHAA 3ORJA 4TULH 3DMMB 2A6IA 4YHYB 4OZIA 1JV5A 3HI1A 5GJTH 5MP6H 1XZ0B 2Y36L 1B0GA 1NMBL 1KACB 2ICWA 2XACC 4LSPH 3TBYB 4N0YH 5FKPA 3TO4A 1R6VA 4Y19B 1EEZB 1HDMA 4FQLH 2FJHA 4D0CA 4XX1G 3AROA 1X6LA 2MPAH 1E28B 3UTPD 3F7YB 4JFYB 1XFPA 2HJLB 4M43H 4GRLA 5IJVA 2XWTA 4KMTL 4NT6A 5JXAL 4D94A 1F4XL 1FVCB 4PJEA 3ZKNC 5DVOA 3RIAF 4X6DE 3SGJC 2ZOKB 4U0QB 1UXWA 2DDQH 4I2XE 3RUGA 1DFBH 1GVIA 2OTPA 2EZ0D 3PHSA 2PR4L 3O8XB 2CKBB 2R0KL 4XRCB 3GUTB 1QR1B 4XVTH 1G7MA 3WD5H 4BFEA 1X5IA 5JXEA 2ZCLH 5TDOA 4G43A 1P4BL 1B3JA 1OAXH 4G9FE 1AHWB 3AU1B 2H2SC 4JM4H 3HAEG 4JO3H 5ETUB 4NC0B 5C09D 3VD7A 5ENWB 2B1AH 2VXTL 4LLMA 1E6OL 4L4TD 1ZLSH 1YEJL 3AXLB 3FT2A 4I4WB 4LMQE 2YKLH 5AYQA 5IFJB 3OJDA 3IKKA 4MAYD 4OGAC 1JGDA 2OQJB 5DXWA 3CX5K 4OF3A 3MUHL 4RWYL 3FB6B 5SX4H 4U1JB 5I1KH 3V2AR 4F33A 4HC1L 1PZ5A 4QCIA 5KJRL 2HH0L 4MB3A 4OLUL 1MI5A 3GFUA 4GG6A 4BKLA 1SQ2N 3MNZB 3ZDYF 1TITA 3SDXE 1VFBA 1T5XA 1AKJA 4XT1C 5DD0H 2I9TA 1PZUB 2X1QA 1L7TH 3EIFA 3L7FB 4R4ND 1RZKH 4I77L 1ZMYA 2D7TH 4G7YH 5D72L 1HHJA 1SVZA 3PWUA 2AJ3A 1X9QA 4PRPB 3LQZA 2WWMD 3VA6A 4U1LB 4NZTH 2DLEA 1GYAA 3LOWA 4OZGA 2GW5A 4MLIA 4Q0XL 3RBSA 4NN6B 1OCWL 1NGPH 1BWWA 2VLKB 1G9EA 2BDNL 4P9ML 3RU8L 2IFFH 4G42B 4LVNC 4NQDD 4OFYD 4Z7QF 3CFBA 1CICC 3B3IA 3MFGB 3SKNB 4Y4FA 5DHVH 4CN4A 1RZKC 4PJEE 4MXQD 4XPTH 2D31B 1BF8A 3RUGE 3D25A 4ELMB 1FSKC 1A6TA 5E8EB 2NY4C 3BWAB 5GRXG 3F12B 2AJYL 2VLJD 2X41A 1K3ZA 4L9LA 4HGWB 1QACA 4S1SL 4UT9L 1QLRB 4HJJH 3MRHB 3FFCD 1URLA 2AEQL 3BEWB 4XNXH 1T1ZA 2DS4A 2ADIB 3BKML 3UJIL 4OFPA 5J89A 4Q74A 3C60C 2Z91A 3JUYA 2BVPA 3VGAB 3PIQB 1OSPH 2N4IA 2R2HA 3CMGA 1BM3H 3UTSA 2P24A 1BX2A 3H3PL 1YEHH 5C8JA 2IPUG 3QZWA 1QSZA 5EN2A 1MI5E 4LHJB 1MCEA 4GG6E 4RGMC 1C12A 2WUBL 1W8OA 3SGJA 3KPRA 5FHBL 5ACMA 4Z5RA 4G6AD 5HBBA 5F88A 3OKNA 4WFFD 5E2VH 1T66C 4OJFL 3ULVL 3EYFB 5F7YC 2CDEB 3GM0A 4L8CB 1T89C 2V2WB 3RVTC 4ONHB 4OZGE 4E5XB 5SX5K 3LEVL 1CFQB 4LKXB 1KIRA 1LE9B 3RGVC 5CJQL 5L6YL 1DBML 2DQGL 3QQ9D 2JJVA 1ND0A 1S5IL 3LEXA 2Y5TB 2R4SH 5BS0D 4KUCD 1IM3B 5IBTH 3FJTA 3T77B 2HT4C 4ONGH 1HYRC 2F15A 5B39A 4P2YA 5M7QA 3OKOB 1XCTA 4PLOB 3IDJA 4OSUL 5FYLL 1TCMA 4AZ8A 5D7JA 3U83A 3NMEA 5J8OA 4Z78B 1ITCA 4K3HA 1DEEB 2M8XA 3ARGA 4ODSH 5IQ9A 3PHQB 3TYFB 1B4JH 1U3HB 3KVQA 3E6HA 2YXFA 5B38B 3T1FB 5TF1H 2Y5EA 4LLUB 4NN7C 4GJTB 4M61A 3CZFB 3MOBH 1OB1B 4HCRH 2NXYC 3SY0B 4ZQKB 3NA4A 1MCCA 2BMKB 1Y18B 4PJHF 5JOPE 4WCYH 1A7PH 5ICXA 1HSBB 1RJYB 3LKSA 1QFUL 1KJ2A 3CMOH 2R0WL 4Y2DD 3UTSE 3B4NA 3WSQH 3F7VB 4S1QH 1YUHB 4GW1B 3MACH 3EHBD 4M6OH 4PGCA 3TFKC 1CICA 4KHTL 2YK1H 2R4RH 4RCAA 1U8HA 4MD4B 5H94A 1P5UA 2C3VA 4LSUH 1RIUH 1DJSA 3PE9A 5MI0C 5SWQA 3KPRE 5I1JH 5IOPA 4NKOA 1MF2H 4XPHL 3FCTB 4X9GA 3X13A 3RFZC 1A1OA 3BPOC 4DKAA 3WFDH 2EDRA 5C0AB 5F9OL 1LE5B 1ZVSA 3DV6A 4OT1L 5E4EB 5D1ZC 5TDPA 3FO1B 1P5VA 4EI5A 5H2BB 1YNLH 3SBWC 5JQ6L 3R0NA 2J6EL 2X4UA 4M7KL 4HQQL 4QXTB 4WNQB 5HGAA 3DHMA 4U6XA 1UKQA 4X7TA 3TNNA 1A5FL 2V2TA 3C60A 4YEEA 5TF0A 5JORA 5EU6B 1HQ4A 4NN5C 2UVFA 3J8F7 2AAVA 3S37X 5CJXC 4FQCL 2Q8AH 1TVBB 4GKSA 2H1PL 1J0JA 4AEIL 4CKVX 4OUUB 5BW7A 4CBPA 2GTZA 4CGTA 1QHOA 1C8PA 1K6QH 2EC9T 1A7RH 4JCLA 4PJDB 4H88L 1JF5A 4NQUA 4P4RA 2M1KA 1KB9K 4WO4A 4NO2B 2G75A 4L3AA 1RU9L 3RY6C 5BCAA 3T2NL 1YZZA 3QDMA 1IC1A 2GSIA 3AUVA 3QO1A 5TGBB 2J4WL 4UV7H 1AGEB 1B0WA 1RUMH 5D6DC 3MGOA 4JCMA 5EOCH 3IAGC 2QADB 1VERA 3HG1D 4PGZA 1N8ZB 3GSUB 3RGVA 4R2GB 3ZL4H 2E9JA 4JFXA 3C5ZD 3OMZA 4P57B 4QKXB 1O0VA 3IVKA 1EGJH 3KS0J 1MHHB 3UC0H 5EUOA 4M5ZL 1CL7L 5J3HC 4X7DC 4XGZB 2C1PB 2E9IA 3VWKC 1PY4A 1FC1A 3D85B 3W0WD 2YD3A 3KPSB 1FNSH 4KJQC 4JY6B 5C92A 2X89D 3MZGB 5FA3B 5ID1A 2BNUB 4IMKC 3WJJA 3LHPH 1RJLB 3TVMD 1UGNA 2OTWA 3SEPA 4TOYH 1OF2A 1XR9A 3EO9L 5J1AA 2LE9A 1NBVH 5LCVL 2MKWA 1T21B 5LG1A 4ERSL 1P7HL 1W72B 1TIUA 4K94H 3CIQA 3MLZL 3GBNL 3BH8B 1IRAY 2IQ9H 5GS0H 4D0BA 4WFGE 4X6FA 1BVZA 3HHRB 4K3DL 5GGRY 4DWHA 2ED8A 1S9VB 3PWNB 1AGDA 1P6AB 4JO2H 4KDWA 3HN3A 3DMMC 4YHYC 3TLRA 1G0DA 4K94C 1KN4L 2XNAB 3FO9B 4ORGA 4Z77A 1Q94A 2CKBH 3LY6A 4ODHL 1AQKH 2R8SH 1HH9B 3IJHB 4JFFD 1UKSA 3GI8H 1W0VA 4LCYA 3P77B 5IM7B 5IG7A 1M7IA 4LBEB 4P2OB 1HILB 3DI3B 4XC3L 3MLWH 4JKKA 4YQXH 4J23A 5EOQL 3QDME 1EX0A 3DARA 2XKSA 4NCDA 3SN6N 2XQBL 3NCJL 3MRQA 5D7IB 1FYTE 1R5VA 2J8UA 4J3OC 4BZ1H 3O8XC 4UB0L 4WI5A 5JOFA 2WP3O 4OCYL 1ETZA 2EEBA 2R9HD 2X1PA 3HNSH 3G6AA 1V5JA 2JK5B 2BHYA 5EUOE 1AHWC 5ACLA 2VE6B 3WKMH 3PWLA 2A38A 3RL1B 5DD1L 1S78C 2X1XR 1MVFA 1SBSL 4OLVL 3VFUA 1A14L 3WS3A 3QI9A 3MLXH 1BJ8A 5TFSH 3KYMB 4O51A 4DFIA 4XBGB 3K0WA 4Z0BH 1HHIA 1V7ML 4TSCL 4EQ3A 4PTUA 5AZEH 3TZVD 2XTJE 3CX2A 3GKWH 3LN5B 4Y4KD 3BDYH 3UTTA 5GGTA 5I19L 1DBBH 2LAGB 3RY6A 2E27L 1OAYL 1T0MB 5IT2H 4AIXA 5F1NA 3QUXC 1HXMA 5D6DA 4ZTOH 3QUMB 3MROA 4F7CB 1QSFA 1UM5H 5C09B 1WT5C 1U8IA 3GSNB 3P40A 1JHLH 5DTFB 4F7TA 5FDYA 1G9MH 1J1PL 3GSOA 3K2MC 3W82A 5KW9L 2JJWA 1D5MB 4MAYB 4HKZB 2OP4H 3E6FA 3KNBB 3VWKA 2IH1A 2K1MA 1WISA 4NN6C 4PJ9D 5TE7H 3UCRA 5K9JH 3BP6A 5D5MF 4PJXA 2MFNA 2X4RA 3S3PA 4Y2OA 1F4YH 5DUBB 4BH7B 5D2LF 3LKRB 1UJ3A 2CR3A 5LXGH 2YS4A 2AXJA 5DRWA 1WBZA 1ZTXH 1IQWL 4XWOC 2AXFA 3PJSA 1EGJA 1G9MC 1I4FA 5D1QD 1JF1A 5HHXH 4Z76B 1IILE 2J8UE 5DGQA 4GW4B 1IGFH 4I0KA 1X5FA 3O0RL 4JFHE 4TN9A 1J05A 1AH1A 2CGRL 4FA8A 4YHIA 5CHNA 3X11B 43C9A 4QRQB 3P4MB 3QXTA 5D70H 4W6YB 2P8MA 5DF0A 4MD0B 4ETQB 4M1CD 2D3VA 4CNIA 4CVWA 4C83B 1BZ7B 2B39A 4X7EC 5DMIL 7FABL 5D8JH 4EZMA 4ZUVA 1EEQA 1BZ9B 1S9WA 4KK8D 3TBYA 3VGAC 5HVFB 1G7QA 2FATL 3SKUD 4Y19A 1GGIH 5L88H 1A3RH 4LLWB 2QHRL 1J87A 1E28A 1V7NH 4QWWC 2V7HB 3UTTE 2HJLA 3SDDD 2X4TA 3NAAL 2FX8H 5KZCD 5DRZA 4X5LA 2WUCL 1A7BA 1MHCB 3TIDB 2VLJB 4EEEA 5CP3A 4YFDB 1INDL 5TH2A 1VPOH 4PJCF 2I60H 5C0JA 1QSFE 1OWWA 2G2RB 4JDVA 1QR1A 3FFCB 1N5AA 1AQDB 3AM8A 4FFYH 2WMPA 2CIIB 4Z95H 4TVSa 4XXDB 2OZ4H 2VR5A 4NRYB 5ETUA 1T22B 3U1SL 4YHMH 2E8YA 3RWHB 4XVJL 5TPWH 4LRNL 2AV7B 2V9QA 4PJXE 4I4WA 3I6GB 4I0PD 4ONOA 3EO0B 1JI2A 5IFJA 4PS4H 5L2KD 4MJ6A 2ID5A 3VGFA 2E7MA 1A6WL 3CXDL 2OQJA 1R3IL 1FZOB 3QA3B 2VLRA 4NNXA 5I76A 4KV5F 3MJGX 2AJXH 3OL2A 3K4AA 4MVBD 3AS2A 3DGGB 4XMKL 2EYSB 3MNZA 1U3HC 1CFVH 2CLVB 3QUXA 2O61B 1FV1A 2VNCA 5IMLB 1EDQA 3G08A 3I75B 4QHKI 1BFVH 1WT5A 3L7FA 1FPTH 5FDWA 4X7FC 4PLJC 4R8WL 5BS0B 5KBNC 4PRPA 2VZSA 2HAZA 3T0EA 1CGSL 4U1LA 1T83C 2FSEA 4RAVB 3P9WB 4Y19E 3REWB 3WDHA 3FAWA 4F80A 1MCFA 4Q2ZB 3FQTA 4ZYKA 4NKIL 2B0SH 4QF1A 3KPLA 5C0GA 2BSTB 4HZLA 4URTB 1J0IA 4G42A 1MHPL 3OHXA 3EDKA 4JO1L 4OBRA 4E42A 2F5AL 1V3JA 5J11C 3LB6D 4DGYL 1MLBB 3HNVL 3BYTA 3EZJB 3IF1A 1HHGA 3QUKB 4YE4L 2X1OA 4ELMA 3GMOB 3S34H 5E8EA 3WJLC 3T4AA 4RBPH 1CZ8H 1R3LB 5DEGA 2QL1A 2CIKB 4IIQB 1EO5A 3BZ4B 43CAA 5C0EB 4N8CH 5E4EC 1IGMH 1KLGB 4O02L 2F58H 1UM6H 3GIVB 2DQIH 3IB4A 4J2XA 4Y2DB 4LDOB 4FG6D 3MRHA 1HCFX 4YBQC 4CAGA 5T3ZD 3MRCA 4P3CH 3BEWA 3VDCA 3D18A 3A67L 1HIMH 5BRZD 3LPGA 4YHKL 1P7KA 2FEDD 5T1KD 5FEBA 3BZFB 4HFUL 2ICCA 5HPMB 1YEGH 3QG7H 3TT3H 2VLRE 4LLYB 2H9GA 3PDOA 2X44D 2DWDA 4WWID 2GAZB 4OIIH 4U7KA 3RTQD 3DSFL 2FB4H 4MX7B 4WDIB 4HS6B 4YK4C 3UBXA 1NFDF 3G9AB 5DLML 5CD5C 3MJ9A 3GKZA 1I8LC 4OB5H 3SE8L 2GIYA 1G7HB 5ICZB 2OR8A 3W39B 2AXHA 2OS7A 3E0GA 3OJ2C 4NP4H 5HDOA 1MFEH 2XPGA 4PJGB 4PRPE 1OSZB 5EZOL 3T0EE 2DKSA 1M1SA 1EFXA 1LDPL 4BZYA 3PP4L 4E5XA 2NMSA 4NQED 4OM1L 3DO3A 4R2GC 4D0DA 4QHLB 3SKJH 2P47B 1RZJH 3MV7A 4PD4K 3O9WD 2Y5TA 3IETA 3Q2CA 4WTZG 3DO7A 5CD3B 2EE6A 4R4BB 4CUCA 1XIWB 4ZOCA 3HI5H 2Q3ZA 2F5BH 3T77A 2DQTL 3SGDH 4ELME 4XCCH 5T1LD 1EZVX 4NWUH 3J7HA 1YEKH 3NPSB 4M4PA 4JJ5A 4NRZB 4UTAL 3WEXA 4Z78A 2ENSA 4FQQA 1DEEA 1NMAH 3VMOA 3RY4A 3TYFA 3LIZL 1RZJC 4HWUA 4IDJL 3VDAA 2Y25A 3VD3A 2A1WL 1GHFH 1GPOH 3HG1B 3S36L 1UB5B 4FOMA 1JE6A 4H1LG 3O2DL 3EYOB 3C5ZB 4XPGH 3VE0B 3DV4A 2RJMA 1A6VL 3CZFA 1MCBA 3GRWL 1A2YA 4LU5H 3SY0A 4ZQKA 2O93L 1Y18A 3HPLA 3W0WB 4Z7UA 1T1WB 4P23D 3VCLA 1T83A 4LPUA 5HD8C 2JE8A 3TVMB 4BA8A 3IDXH 4OLXL 5CEZD 4GW1A 5SWZD 2R29L 4XZUA 4YBLB 4QOKD 3CCHB 2FHFA 4N90E 5GRVK 2XN9D 3BWUC 1J8KA 4I3SL 2Q8BL 1PG7H 2W65B 4KPHH 5IMMB 2ZZUT 3L3OA 4XCFH 4PG2C 1OP3H 4P2OC 3P0VH 5C0ND 5HY9B 3OF6D 4UV4L 1KIUA 5E2UH 3VXUA 3MRPB 5CCKL 1L0XA 3ARXA 4X5WA 2YZ8A 3QWRA 1EV2E 2EDWA 1T04B 4NQXB 5H2BA 3Q3GB 4H25B 2FECI 3S37L 4PIRF 4UMGA 25C8H 3MV7E 4DQOH 1L0QA 1KB9J 2DIBA 4NSKA 4U3CA 4QXTA 1CQYA 1UXSB 2QSCL 1F42A 4Z7WB 4U33A 3MRRB 3LKQB 5F3BB 4KKAD 5EU6A 5GSVA 4JFFB 3PWJA 2VDKH 1X4XA 2H32B 2LVEA 3O6ML 1QUNA 3RWDB 3QUMH 1G7JA 3B2VL 2SEBA 5IVNA 2EH7H 2QJDA 4OUUA 4KVNH 3QB7C 4RSVA 3BISA 4HMEA 3DVIA 3GSNH 5IR1B 1PEWA 2W9EH 4DKFH 3NGBB 2XQYG 3MODH 4CL7A 4HUVB 2EZ0C 1I8LA 4NO2A 4JKMA 3BAEH 4HKBB 2VAAB 1CLOH 3LZFH 1P4IH 4H8WH 2APVA 2H41A 5J4MA 3ULSA 4MJ5B 4Z7UE 3VG0H 1S5HA 1FL6A 2XZCL 1AIFB 1KCSL 3L3HB 3VXRB 3DBXA 2DLGA 4G3YH 4YHPB 4P57A 2IANA 1F4HA 5TQ0H 5LWYL 1EUUA 4MAYC 3FTGA 1JHKL 3QUYD 4J3WA 2C1PA 3RA7L 1L7IL 3KPSA 4YHOL 2BK8A 2F53D 4JY6A 4H8WC 3TZVB 4Y4KB 5FA3A 2BNUA 5CINL 3HMWL 2FR4A 1MJUL 5DUML 1OARL 5E2JA 1JTTA 4HGMA 2YC1B 1OAZH 3ARBD 3GB7B 1NCCL 1T21A 5JW4N 3VXUE 1EO7A 4LLDB 1W72A 5ITBL 5AD0B 2DYPD 5H35B 5TE6H 2K9UA 4CU6A 4UZGA 4R4NC 1E4KA 3OKKB 1JYWA 1LO3L 5C07D 1RZ7H 5EA0L 3JV0A 4U4BA 5T3XH 3MUGB 4K9EH 1NSNH 1RZFH 1A47A 4QRUB 4DGIH 2WWMC 1IGCL 1S9VA 3V6FB 2WNGA 1E6JH 2D0HA 3PWNA 5A16A 2YMXH 1RHHA 4WUUA 1G7PA 2EDEA 1MFCL 1U93B 1W2KT 1FYHB 4PJ9B 5EU6E 5KSUB 4PY7A 1MCWW 1K8IA 4HKJA 4E0RA 2ED7A 1ACYH 1NCAH 3QULB 2EH8H 2AABH 2XNAA 3FO9A 4MNGB 2FX9H 2B20A 4JZNB 4MXQC 5JO5B 3QHFH 2Z31A 4K9EC 5HTSA 3SQBA 4NJ9L 3V7AG 1TLKA 5D1QB 3L5WA 1IAOA 1DBAL 4RGOH 3KG5A 1WIPA 3P77A 5IM7A 4PG2A 4RZCB 4LBEA 5C08D 3N06B 3BMVA 1KCKA 1BP3B 1HZHL 1L6XA 3V6ZB 4ZD3H 1WVZA 4BJLA 1NCBH 4YPGB 1LP9B 1TVHB 3IS1X 1NLBL 4WI4A 3HTLX 2C1OA 1BQHA 2YPKA 2DQCL 4JN2B 1CFBA 2DLFH 2IANE 5BZWB 1VENA 4Y4HA 3B8SA 2AW2A 1FE8H 2X6MA 3HMXH 1F11A 1I7UB 1NCNA 2HLAA 2FHBA 3KPSE 3RBGA 5E6ID 1BVLA 1S8DB 3SDDB 3BGFC 1GC1L 5KZCB 3WFHB 4O9HL 1INEH 1FNGB 5EOTA 2X70B 3F65A 4LPYA 5IGXL 3TH3T 4NQVA 1JNNL 2HJFB 1A7QL 2XZQL 4P59L 4DCQB 1IGYB 3KYMA 3FHQA 4XBGA 3OXSA 4HBCL 1U8OB 4G6AC 1D5IH 2OYPA 4LEXH 1HN1A 4YDJB 3K8MA 4Q7DA 4EOWL 4XAKD 2C4FT 3EBAA 4B7IA 2GFBA 4I9WD 1QBBA 4PBWD 1FVDB 3CH1A 3RL2A 2Y07L 5DRNB 5CZVH 3O45A 3CK0H 4WUUE 1UCBH 2WV3A 4P5TD 4WWKA 2W07A 2J12B 3QQ9C 4JPVL 4ZUSB 1DQJB 4LCUB 4L4TA 2JIXD 4XCEB 4PJCE 4POZD 1D5BA 4I0PB 3ALPA 1IFHH 1U8LB 1YNKH 4WFEE 2VDLL 5FUOL 4MAYA 1D5MA 3MV01 2GJ6D 4HKZA 2VC2H 4OCXL 3KNBA 3NH7H 2PO6D 2CKNA 5BQ7B 4HJGA 3SOBH 2A9NL 2VIRB 4JFZH 4UIMB 1H8OA 4TULL 2UY7A 3OAZH 5DUBA 3OKMB 3LKRA 1IGTB 4M03A 4PV9B 1B2WH 3G5ZA 5I9QB 4FQPA 1A0QL 4MXVF 5MP6L 3R1GL 5ILTH 4L8DA 4JFEA 4CMMA 2ZCKH 4HKXB 4Z76A 2OL3H 5J6HB 4N0YL 4FQ2H 3CVHB 1DQQA 4NO0D 3OPZH 4A6YB 4PJ7F 4IIQC 4FQLL 4MJ2A 3X11A 1I7RA 3RY5A 3P4MA 3D87B 2NTSP 4HWEL 1MREL 5C2BL 4UNTA 4M43L 1O5DT 3P73A 4NNYA 4U3HA 3E2HB 4OZFG 5EO9A 4Y2DC 2ZPKH 4FZ8H 1GCFA 3IDIB 5EBLB 5I71B 4NQDA 3EHBC 5DJ0B 3WYRA 4EDWH 2DDQL 3S7GA 5E7BA 1DFBL 1GZQB 2VISB 5IQ7L 4ZS6D 5JDJA 3LN4B 3MLSH 4XVTL 4HS8H 4QHMA 1CG9A 2VMFA 3IJSB 2YD9A 2ZCLL 4HLZH 2I26N 4U1HB 1VCAA 3D9AH 1N59B 3O3AB 4AQ1B 1MHCA 3MRIA 3TIDA 4Y5VC 2VLJA 5HDBE 3HE6D 5A3ID 2B1AL 3GK8H 3QJFA 4ODUB 1ZLSL 4KJWD 2YKLL 4NNPH 4AL8H 4XTRD 5HI3D 4JHAH 3QCUL 4OD1H 4N8VB 3D0VB 3V0VB 5BVJB 1JI1A 3MREA 4X7SL 1H3UA 1AQDA 4L4TE 3QJHB 1J10A 5E70A 1ZHNA 5BRZB 1AGBA 4LCWD 3RNKA 4JGUA 7CGTA 5L7XH 5T1KB 5I1KL 3C5SA 1T22A 4PB0H 5E8NB 3RWHA 2NW2B 1OLLA 1KJ2L 1CGYA 5KVDH 3RTQB 3K7UA 1X5ZA 4JM2F 2Y72A 3EO0A 1A6PA 1BFSA 1WJ3A 2VLMD 4JZJC 3Q5YA 4PJFB 3MLRH 1RZGB 3BW9B 2OCFD 4S1DC 3I02B 1RZKL 1BPVA 2D7TL 4M7LH 1WWAX 3HKFA 3NFPA 4G7YL 3QA3A 4JZOA 5D7SL 3NPZB 5E0QA 4GXVH 4JFEE 4M8VA 1F8TH 2MJWA 5C0BD 4JE4B 1IAII 3HR6A 3DGGA 1V3MA 2IFGA 3F8UB 2E9BA 2EYSA 1EBAA 2X09A 4MNHB 4JRYA 1NGPL 2CLVA 4JQVA 4HHAA 5C0FB 5IMLA 3C5ZC 1NFDE 2Q76B 1ZHKB 4ENED 2HKHH 4XPTL 3O9WB 5FM8A 1CD8A 4NQDE 3VFGH 5GRJH 5IVOA 3H9YA 5BS0A 2AKRA 5HYSB 4PRHD 3KPMA 1QNZH 4Q2ZA 3QEUB 3TVMC 2A6JA 3WDJA 3GSVB 1SYVB 3O6LL 3SE4C 1IZJA 1A1MA 4YBLC 4FNLH 4HJJL 2VLJE 4Q6IA 3BKCH 4AMKH 5I8KH 2HFTA 3QUKA 2FJFA 4XNXL 4CN6A 1GSMA 1FG9C 2IG2H 5GISH 3U79A 4MDIA 1OSPL 5DO2D 1QFWH 4TSAH 1XGUB 3F5WB 4IBLT 2CIKA 3H42H 2C3WA 4LPXA 3ZSTA 5KN5B 5TDNB 4P23B 5C0EA 2R1XB 3S5LA 1DLHA 3DX9B 5BZDA 1KLGA 1N3NB 3GIVA 1YEHL 3KLDA 3BP4A 2VXSH 4GRWH 2ZOLA 2F19H 3WKNA 1KGCD 2XZAH 2QQKH 4CJ0A 3UZEA 5SV4A 4QOKB 3VXPB 2XN9B 1IEAB 5E2VL 1I3VA 4RBPK 1D5XA 2ADJB 3VXQB 1WUNT 4LLYA 3BIKB 4NO5B 4HUUA 1RVFL 1KB5B 5E2TL 2GAZA 2VZTA 1CI5A 3IU3A 1WK0A 4OQTH 1A4JB 4WDIA 1L4IA 3NGBC 4HS6A 3THMH 1JRHI 1IC7L 1RI8A 2BNQD 4Y5VA 4JRYE 5JHDD 5IEKB 2ZUVA 3D39D 5GGVL 1KXVC 3MOAH 1I1CA 3AAZA 1VEMA 2R4SL 1G7HA 5F97E 4XCNA 3W39A 1VA9A 3L3JB 1JNLL 4GAFB 2R9HC 2NPLX 3VFOB 5BS0E 5KSVB 3AB0B 2V17H 5D9SB 2UVEA 5J56B 4QHLA 2P8PA 4WUKL 1BIHA 1EMTH 4ODSL 1ZWIB 3GI9L 3IU4H 2B4CH 1A64A 3L3IB 3RVXD 3TJEL 4JZJA 2L4OA 4RRPA 3QXDA 2Z8RA 1CF8H 5AUMB 3VRLE 3MOBL 5EDXA 2Z93B 5IEHB 3TZVC 4Y4KC 1VSCA 1IAMA 1Z2KA 4PUBH 5KSAD 4HIXH 2XWJB 3VU2A 1BQLH 2KBGA 3W2DH 3WS6C 1QQDA 3CMOL 3H0TA 1IKFH 1AD0B 3WSQL 4RFOH 3GSWB 1MVUB 1F90L 4S1QL 3SQOH 1UB5A 3MACL 2B4CC 4M6OL 5IW6B 3PF2A 3EYOA 3VE0A 2R4RL 2YK1L 4V1DD 4MCZA 3WFBH 3JBG7 4LSUL 1PGRB 3QUYB 4KKLD 5HHMD 5I1JL 1VGEH 3OKLB 1NEZA 1T1WA 1NDGB 2AJUH 2R39A 5IMOA 3N1PC 4GFTB 4PJ9C 1U95B 3RX5A 4P5KB 4ZDHB 4IRZL 3VFMB 3WFDL 5I1CH 3SDYH 3TVMA 2VWEE 1PG7X 1SBBA 3ARBB 3STZB 2ARJQ 1NFKA 2BNRD 1YNLL 3QDGE 5IB5B 5HYFA 4W81A 3NCEB 4LSSH 1QA9B 2DYPB 3DRQB 3OKDA 5D1QC 5HYJD 3BN3B 1P1ZB 4HUNB 5C07B 2N7BA 3CFDB 3MRJA 4WV1B 3P9LB 1KPVB 5GGTL 1N6QH 3BO8B 2VDNL 3QIUD 1EXUA 3QYCA 4M1DH 1BD2A 3ARYA 2FIRT 3MRPA 1MLCB 2Q8AL 1CDGA 4GUPA 4M1CC 5FGSA 1C7SA 5IB4B 3ARFA 2VDRH 5I74B 1T04A 2EKJA 5GGUB 1T7WA 1K6QL 4RGNB 5HHOD 2UV3A 5I8EB 3ZTNL 2DQDH 1IJ9A 2HN7B 4U6TA 4KDVA 1DLFH 4XPAH 4Z7WA 1OP3K 3RWEB 4HAFA 1EO8H 3T0VA 2B5IB 4L1DA 4JFFA 1QFPA 4UV7L 2H32A 3SDDC 1JPSH 5C08B 3MBXL 5EOCL 2MCG1 3FB5B 4Z7OF 1PQZA 4FFWD 5EORL 4OLWH 3ZL4L 1ZSDB 4DOHB 1EGJL 4HUVA 3U6RA 3UC0L 1KPRB 5KS9F 2ADGB 4HKBA 2ESVB 1FNSL 2VAAA 3QFJD 4PJIA 3VFSB 4ONFH 3LHPL 1NJ9B 5E6IB 1V3LA 2FX7L 4TOYL 4OQTA 1N6VA 1XF3B 4I0PC 5DYOA 4NOFA 1MFAH 2A0LD 5JW5B 3HE7D 3HFMH 2IWGA 1Z0NA 4K94L 4HJ0D 5JPNB 2IF7A 1REIA 1AD9B 3CVHH 4JAMA 4A6YH 4UT7H 3HI6H 1X4YA 4JQXA 1J9CT 4EIZC 4QRRB 4Y4KA 1CFTA 4L3EB 2ZG2A 4MVBC 1LK3H 4LARH 4JO2L 2WBWB 4UBDD 3GMNB 2DTMH 4PP1D 3WS6