4LFHD

Crystal structure of 9c2 tcr
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
202
structure length
202
Chain Sequence
QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGDPGGLNTDKLIFGKGTRVTVEPRSQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 9C2 TCR delta chain
publication title CD1d-lipid antigen recognition by the gamma delta TCR.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lfhD02
3V5KA 3S3PA 1HHHB 5CLTA 4D9RD 4JKPH 5FYLL 2NY4B 3MLSL 4YZFF 1A4KB 1IGTB 2HH0L 3GMNB 4XC3H 5F44A 1RUML 1CE6B 5J1TC 1NCTA 1IEBA 3D3VB 5EH1A 5D8JH 4DQOL 3J7HA 4CVZB 1P1ZB 4Q0XH 3OAUH 4LSVH 4X9FA 5KW9H 5FDYA 2OJEB 1I85A 1WFOA 3VA6A 3QULA 2HT4D 5MEOB 4NJAH 1BOGB 4D3CH 4DN3H 1U95A 4LRNL 4OM1H 2VUYA 3QPXL 5FUZH 3L7EB 3CVHA 3E2HB 4IRZH 4D0BB 4YH6A 4KI1A 5DJCA 4FFZH 1AKJB 1UWGL 4LLYA 4QOKD 2VDLH 5EZJA 3SDXA 1EZVX 3C5JB 5FKAA 2GSIA 1UVQB 3PGCB 3BH9B 4AG4H 1N8ZB 2QLVB 4K7PY 3HHRB 4OIIL 3O45B 3KPLA 4PJDE 1TNNA 1MFAL 3VI3E 4P2OA 3WUWB 2P48B 5T3XH 4KRPC 1LE5B 4X5XA 4QWWC 3SE3C 2ZCHL 1F6AB 3NAAL 1ZHLA 5I66A 2BVPA 1G7PB 2NXYD 3DBXB 4MLSA 3IKKA 1BLNB 3P77B 3O6FA 3DXAE 4XMKH 4U1GB 3FB6A 3LEXA 1C1EL 3V8CA 2B5IB 3OPZL 3UTZB 5ACZB 5I1DB 3TZVA 2IMNA 5KTEL 3FFCB 5C0CB 1K4DB 3I6GB 4YXLH 1JNNL 3PGFH 1GJIA 3QNXB 1MAML 1KCRL 5I76A 2A38A 2R2HB 2G2RA 5EU3B 4ZUTA 3GHEL 3L3GB 4YHMH 5E6IA 1QLRA 5HHOE 4MNQE 4JANB 1GPOH 2NY5C 3JWDH 1A6UH 2EH8H 2XIDA 4JRYE 1NKRA 4AIZB 1CG9A 1DANT 3VD7A 5KVDH 5MEQA 4HIXH 4LPCA 3G6DL 5F9JA 4TYUA 4XT1C 1IAKB 3P3YA 1X4XA 2G60L 5LWYH 3O3BA 5E8OA 2VXUH 4I1NB 1KCSH 2UY7A 4IOFD 4FFYH 1KN4L 1PEWA 4U1IA 1RJZB 3GI8L 3QG6A 3I84A 3KPMA 1RZKH 3QEQE 4Z78B 3O0RH 2F8VA 2GFBA 3VFRB 4D9LH 2F53B 4NQDA 2ICCA 2PETA 3QFJE 1DBBH 4XC3L 1J0HA 2E9IA 3MGOB 2Y4SA 2C3XA 2X44D 5I9QC 3G5XB 3MV7E 5D8JL 5HHNA 1AY1H 4Q0XL 3OAUL 4LSVL 1BQLH 4Z7QE 3KYMA 1HHIA 1HXYA 2ZUYA 5EBLA 5CJXC 4EOWL 3T0DA 1BIIB 4NJAL 3G04A 3S4SB 4D3CL 4DN3L 1WF5A 3G6JB 3H42H 2DQHH 3V6FA 4OM1L 5EIVA 3VFMB 2HLAB 2VNCA 3O2WL 4IRZL 5GS0C 4E42B 3C6LD 3DSNA 4FFZL 1ZT4A 3PGDB 4Z7UA 2ICWJ 2P5ED 4XNXH 3U7YH 4X0KB 3BUYB 3EFFA 4S1QH 4PJ7B 3WIHH 5BV7H 2O61B 5IMKB 1WJ3A 3C87A 2DWEB 4AG4L 1JZ2A 1ZS8B 1YQ2A 4ZAKA 4HUMB 2H3NB 3NABL 3UZVB 4Z95H 1CL7I 4J8RA 1CF8H 5FYKD 3SY0A 5CJ8A 3VD3A 1S78D 4PR5B 2VDNH 3NGBB 3EAKA 3T65B 2QSVA 5F3BB 1DJSA 3NPZB 4EI5D 4KJYA 4OCXH 4XHQA 4P5TC 4EN3B 4FG6D 1FFQA 1UQSB 1ED3A 3BW9A 4X6CE 3PGFL 4UQ2A 3QIWC 4K8RH 4PRIE 4PRAB 4X6FA 3HR5A 1FQ9C 4KROD 4GG6A 1FRGH 1JPST 3O3DA 4A6YB 5F89A 3QIBD 1JGUH 2YPVL 5D1QB 3VGAB 1V3MA 2J7LA 2VSDA 4JFFE 4QO1A 4NN7B 1IKNC 4RAHA 1QLEH 2B4CC 3N1GC 3QPQD 4O2FA 2RBLA 2XTJD 2N7BA 1K8IA 4L1HA 4I77H 1BF8A 2AK4E 2DM2A 3BPCB 5KVDL 4QHLB 3MBEB 4L9LC 1A4JB 3F7PC 1H0DB 3GB7B 3LAFA 5LWYL 5EC2A 2D0GA 1JGEA 2NY5H 1J8HE 2VXUL 2C1OA 5CJQH 1KCSL 3K0WA 1N2RA 4FFYL 3RUGB 3V52H 2ADIA 2F58H 2NZ9D 5DEGB 2XYCA 3I6LE 4D9LL 2EE9A 1FN4B 5JA9A 3OR7A 3OKKB 5D2LF 4OBSA 5CD5C 1DBBL 2BNQD 3V4VH 5I1GH 2MSPA 1X5XA 1UXWA 1VKXB 4PJ8A 4FP8H 4GBXD 1BQLL 1KTLA 2YPKA 2Q8AH 3QUZB 3FTGA 4E9LA 1MCLA 1I7UA 5K9OB 5L0QB 3IGAB 3CIQA 3FRPA 4U4BA 5TH2B 1E4WL 3H42L 2DQHL 4FQQA 4OCLC 5F7NC 1A9EA 1G7LA 4JQXC 2CD0A 5AG9A 1WSST 4XVSL 1FVCB 3TBWB 2HJLB 2A73B 4L4VA 5FKPB 3WXWL 1K4CB 3LS4H 5HYIA 4XNXL 3IB4A 5HYJE 5DK3A 3NCYS 4LSRL 1EFXB 3D3VD 1HHJB 3AAZA 2W59A 3WIHL 5BV7L 3F7YA 1NLBL 2V7HA 4XRCA 3ZKSD 3BSZH 5FFLA 3UYRH 5ADPH 5GS0H 3H7BA 1EJOH 1CXIA 3RDTB 1N7MH 3C6SB 3CSYA 3RKDD 2B8OT 2P46B 4X9HA 4XP5L 1Q8MA 4IRJB 3QXTA 4NCDA 1MCFA 3FOMB 3MRNA 4OCXL 5FDWB 1OW0A 2NY0C 4ZQKA 3ZE2F 3MFFB 1FNFA 1N59B 1S7XB 4R4BB 2APTA 1AFVL 1YYMH 5C07B 4R96A 1W72A 5C6WH 5T1LA 1FRGL 5JW4R 5C0DB 4ZUSA 1JGUL 1T83A 4KJPD 1U8PA 4HS3A 4QRQB 5EIQA 2YD8A 2NQCA 4P49A 1L7TH 5C0FB 1QLEL 4FFWC 1NC2A 2DQFA 2PKDA 1DTUA 4F33A 1EXUB 4PJHA 3EHBD 5I71C 3I3EA 3B8SA 1F4AA 5C0CD 1G7IA 3O2DA 3KDMB 2B4CH 2NY2B 3WFHA 3GJFA 4QRPB 1ZHKB 1DQMH 2NY5L 4P9HH 5CD3B 1I1AC 2IALA 1NAKH 3H9YA 1MHHB 2ZCKL 3BQUA 3PHQA 2ZSVB 5CJQL 5AZEH 3FN0H 5F1OB 3VXRA 4WO4A 3V52L 5I0ZA 2F58L 2VITA 4NN6C 2QQQA 4E0RA 1MVFA 3T4YA 4NZJA 3ARFC 3REVA 1TNMA 4R2GC 5EBWB 4LGPB 1OPGH 3V4VL 4U1HB 5I1GL 3RA7H 3JXAA 1BEYL 3AS1A 3RHWF 3VXSE 4I3RH 2PXYC 2VLJE 4HKZA 3TBSA 4YPGA 2NX5D 3TH2T 4QRRD 2JIXB 2Q8AL 5CMAB 4MXWH 4LU5H 4Y5YB 2D4DA 2MMXA 1BQSA 2J8UB 5C0IA 2E6PA 1AD9B 3QCUH 4LLDA 1FPTH 3BKJH 5FHBH 3T0EC 5I18H 1J7VR 1CL7H 1T7WA 1QSEB 1YDPB 4G7VH 3NTCL 3VGEA 1Y6KR 3C8DA 4XZUA 3ULVE 3DARA 4URTB 2YPLE 2F53D 3OAZK 4KQ3L 4OAWA 3PWUA 4RGOH 5E94A 4NM8H 5J0BA 3TN0C 3DRQB 1AHWA 2AXGB 1PGRB 2ATKA 2W0FB 5IUSA 2A83A 5I1LA 5JHDB 3CH8A 1LVEA 5F3HA 3FT4A 3HA0A 3ZTNL 2DQDH 1MWAB 3BSZL 4G9DB 5LJYH 3V5HA 1MEXH 3UYRL 5ADPL 5GS0L 1EJOL 4GKZA 2ESVB 4OLVH 4Q2ZB 3UPRB 3ZLQC 2BHYA 3W9DA 4EDWH 2M8XA 3FO1B 3BD3A 1N5YH 1IC7H 1HWGB 3MO1B 2ZUTA 4APQA 4M93B 1WIUA 1M05A 2E7MA 4KVCH 5KVMC 3OAYK 4KHXH 2H32A 4WW2F 2Q86B 4GRWF 1MPAH 2MOVA 1SEBB 2IMMA 2WBJB 4IRSA 1DUYA 1GZPB 2CIKB 1YYML 1ZAGA 3D25A 1CTOA 1U8OA 2GYSA 3VGHA 1HILB 1MCCA 4XCYB 1PG7X 1FV1A 5EC1B 5IVZA 1M1SA 3FRUA 3FO0H 1E28B 1L7TL 4M1CC 1CFBA 4U6VL 5HVFB 2ATPA 5FF6B 5HY9A 2CLZA 4HAFA 4F7PB 1D5MA 1P84K 3ZT5A 1S3KL 5CGTA 4NZRH 1RVFH 3BIBX 1WBZB 4NQEB 3FJTA 5AWNH 3B5GA 1CFVH 2V5YA 3WIIH 2GTZA 1ZHBA 1T20B 5KSAB 3GIZH 5ISZA 4WU5A 2MPAH 5EO9A 2B4CL 1E4XH 1QBAA 1Y18A 4R3SB 3MJ6A 4JRXA 3KPSE 4H5SB 5D1QD 1NAKL 2Y25A 1VACB 1XT5A 4KTDH 4P4KC 3S5LG 5AZEL 5TF1H 3RWIA 1A3LH 3FN0L 5H94B 1OB1A 4L8BB 4Y2OA 2XPGB 4ZXBA 4KI5E 1OGAE 4O2CA 4HFWB 1U3HA 3UPAA 3GSUA 5F1IB 3T4AB 2K1MA 5BVPH 2PYED 3FT2B 3AU1B 4LK4A 1HQ4A 5JNYB 1XF3B 2QQKH 3MBED 3RWEB 5HHMB 3OKNA 3L5WA 1A7PH 4WFGD 5AZ2L 4KK5C 4M61A 4MXWL 5I1CL 4KRMB 1KN2H 1Q9OB 1N64H 3BN9D 5FHBL 1FPTL 1S5HA 2DWDB 3BKJL 1IC4H 4HBCH 5B4MC 1BHGA 5I18L 2WM0A 1SEQH 3IDJB 4G7VL 1RUAH 3IDGA 2DBLL 2VXQH 3CMGA 3O3EB 2MQ0A 1IGIH 5C9JA 3HAEH 4RGOL 1TZIB 5J11C 3MLPA 1RIUH 1JNLH 4WFFE 4ERSH 3G5ZA 1JYNA 2DYPB 3QUZD 3BEWA 4AQOA 1MEXL 5I8EA 4LBEA 4P3WA 2P8MB 5E5MA 4I0PB 4FMFA 3NA4A 4EDWL 2EDDA 4ZOAA 3DUSB 5T3ZH 3HE7A 5JXED 1X5HA 3D18A 4JCMA 2BOCB 1IC7L 3HFMH 4LNRB 1PX3A 3N1PC 5C1MB 3K80A 3VFGH 3QJFA 4PRDB 4KVCL 4KHXL 3PJSB 4PJGB 4MCZB 1EFXD 4N68A 5KOMC 4ONGL 4JG0H 2APBA 4MNGB 4HK3N 4OQTA 4NRXB 2PO6A 4HS6A 4S1DD 5TE6H 3ARPA 3EJZD 1X3DA 4CJ1A 3TM6A 1Q9KB 3FO0L 4Z7VA 1QSFB 3CLEH 5EZLB 3UO1H 2CLRA 3QH3A 3QQ4B 3P73A 4OSUH 1HH9A 3QFDA 3IFOB 4NZRL 1RVFL 4JZOA 3DGCR 5DJ8A 5KZCD 5AWNL 4UIKH 3IDYB 1CFVL 2WIMA 3WIIL 1EH9A 2E6QA 5GGRA 4RQQB 4YBLB 3GIZL 1JPFB 4HIHB 5D7IA 3KAAA 3UCRA 3LS5H 5C07D 5ICZA 1F6FB 4HC1L 1FFNA 3HKFA 3HRZA 1E4XL 3H2WA 5LGHH 2RHEA 1AGCA 2GCYB 4H25B 4KTDL 1XEDA 3RZCD 1LP9B 4WJ5A 4R7DB 5TF1L 5J57B 3SQBA 1CCZA 1EO5A 1MI5E 1CICA 2APFA 5HPMA 2OJZL 3VRJA 3RX7A 5MP6H 3MUZ1 5BVPL 2Z4QB 5MHSE 3SKJH 2BC4B 4R4FL 3MROA 3FFCE 5JIPA 1DLHA 1OTSD 4FRWA 5L2KB 2YN5A 3TP4A 1P9MA 2NY2D 1KN2L 2G75B 2VDRH 1N64L 4HBCL 1IC4L 1ZA3B 1JGLL 1SEQL 3JV0A 4Y4HA 2W1NA 1RUAL 2VXQL 3FFDB 4HWBA 4Y4FA 2JJTC 5F7UA 2IAND 1IGIL 1RK0B 3SDXF 2ZOLB 1RIUL 1KB5H 2P8PB 4B41A 4K7FA 1IEAA 3BZDA 3LQAC 1T3FB 4M4PA 3I75B 5IB2A 1YN6B 3VXPB 2NTSP 3RZWA 2CO6B 4XHJC 1KTDA 2Y36H 3GKWH 4PJXB 5LCVL 1S78C 1CQKA 4GAYA 3OJDB 3HNTL 1RURH 1QSED 3I6KA 4UIMB 5T3ZL 4TOYH 2EIDA 1OM3H 4EI5C 3SKUD 3Q6FB 4CVXA 3D39D 3HFML 5B39G 4Z7OE 3VFGL 2X4PA 3GSXB 3VDCA 3WO4C 1Z2KA 1IRAY 1T21B 5DJ0A 4ZFOL 1SY6A 4OBRA 1S7UA 3U0WL 3C2SA 3L5IA 4JG0L 4ZNCD 1U93B 3VCLA 3A6BH 4Z77B 5A3ID 3FMGL 4HT1H 4PGEB 1D9KB 5EUOE 4LLUA 4EBQL 5JPNA 1ES0B 5TE6L 2ESVD 1J86A 8FABB 1AQDB 1JGDA 3GSWA 4ODXB 4KI5C 4Q9CA 5HI3D 5BVJA 1WAAE 2BVQA 4YO0A 1CVRA 3CLEL 1P4IH 3UO1L 4FQXC 1RMFH 3PUCA 4XH2B 5C08E 4OSUL 5D70H 4YEFA 2VJXA 1I1YB 4AT6B 3VW3H 3QQ9D 2P45B 5EWIH 4OF3A 4UIKL 1OT2A 2WBJD 1D5ZA 3T2PA 1H3WM 2HFFA 3SDCA 1DUZB 2GITB 4BSVB 4OLXH 3UPCA 3WFZA 1J11A 1CXFA 3MRRB 5LGHL 1U8QA 3QISA 3QUYB 5E4EB 4OZGB 1IGJB 1S9VB 4QKXB 2PNDA 3QO1A 1XF4B 1T04A 2VL5B 4QGTA 5CS7A 4NO2A 3LY6A 1AGBB 5JHLH 3OGCA 4Y19B 3SKJL 1LDPH 3KPOB 5KSAD 4FQHA 4XX1G 4Y5VC 3UTTE 1GZQA 4NQCA 2QBWA 1F3DJ 2VDRL 4TVPE 1YQVL 5EULV 4WRLA 3VXNA 4LPUA 3I3DA 4LQFH 2OL3B 4JG1L 2AK1H 4WU7A 4MJIB 2NY4C 4M6AA 4UOW1 1Y0LA 4X99A 1JV5B 4Z7UF 4XAKE 4ZSOA 1VEPA 1S7WA 5C8JA 3ILQC 4P2QB 1KB5L 1RD6A 1QQDA 2FBOJ 3TNMB 2IC2A 4OD2B 4I18B 1AR1C 3HCVA 4GRLD 1TTUA 1QR1B 3RKDC 5TE4L 4XI5D 3GKWL 1OY3B 1BX2B 4ZYKA 3AY4A 2VIRB 4Q58C 5IVNA 2IPUG 3OKOA 5I73B 1YEFH 4TOYL 1OM3L 3RUGE 1VGEH 5DMGD 4KUCD 3QCVH 3ZE1F 3BGFB 1JHTB 1KIPA 5BCAA 5CLWA 1A6PA 5FYKH 3K2UH 5IG7B 5IJKC 5DVNA 2C3VA 4I48A 4W68A 2DYPD 3CLFL 4TSAH 1CGWA 4GG6F 3MRDB 4KJPC 3U0PA 4O02H 1T1XA 2A6KB 1C8PA 1ORSA 4Y4KA 3M17B 3O3AA 5T5NG 3SKMB 4MS8D 5I8OL 4IMLA 1NBZB 3H9HB 3SGDH 4L1DA 4I3SL 5GS1B 4U1GC 3FT3B 2FR4A 4G8IB 2QL1A 1TZHA 1PFCA 2YKLH 3VW3L 5EFIB 5EWIL 3REWB 2CO7B 3BI9X 3W0WA 3WUZA 2X89D 1J0ZA 2VZ1A 4UAOB 5J3HD 1KELH 2VERN 1SJXA 4GKNA 5E95B 4CDGC 4LVNB 4OLXL 1RZGA 4I5BA 3KLHD 2H9GB 4IBLT 1CFTB 5E4IA 3H0TA 1FORL 3HC0B 3AREA 4MJ6B 3DX9A 3WEXB 4NYLA 4PGBB 3TYFB 5D71H 2UUDH 5C09A 1WWBX 2D3VA 1OQOA 1F4YH 2ZKHH 4OGAD 5JHLL 1G6RB 2DIAA 4RCAA 1LDPL 2IH1A 5EU5B 1GGCH 1NUFA 2DAVA 3MV9B 1LE9A 1FNGB 3LKOB 4MCYA 5I16B 2GTWB 3CH1B 4YFLI 5C07E 4TN9A 3ARDB 5SV3A 2X41A 1G7MA 3KG5A 3MRKA 1QFWH 2FCBA 4JHBA 4WHTA 2JJSC 2VXTH 4LQFL 3U4EA 2HVJB 3WE6B 1RK1B 2IWGA 2C3WA 2OCFD 3ZE0E 1EAJA 1NCNA 4GLRI 3B43A 4OT1L 3CC5A 5D2NA 4RNRA 5IB3A 1EGJH 2Z0BA 1ADQH 2HLFD 2X4UB 3WL9A 5DJ2B 3CZFA 2EDYA 1X5JA 4WUUD 4KAQH 4LSSH 1E6JH 4Z76A 4PJIA 3LH2H 1TVBA 4QYOB 5IW6B 3AS2A 3GMRA 3FB5B 1T6VN 2D31B 1I7RB 1AO7E 4QRPE 1GSMA 5K9QI 2OXHA 2D7TH 3SOBH 4XVJH 4B50A 1NGXB 1HIML 1SJHA 1M7IA 3OHXA 1YEFL 1J88A 3RWJA 4J4PC 4XPBH 4PP2A 5D7LE 2ZCLH 3LQAL 1I8KA 4LKCB 4XBGA 2FIKB 4H0HB 2XFXA 5LAXB 1I9EA 5KG9A 4LCCA 3KHOA 4QHNA 1JF1B 2PYFB 4HQQH 5FYKL 3K2UL 1EK3A 1RZFL 1RZ7H 1PW3A 2QR0A 1HYSC 4X6DA 5FGSA 3LN9A 4DKFH 4AEIH 1CXKA 2X1OA 5H37H 3ARXA 4O02L 1UH3A 3GKZA 4UT9L 1K9TA 4BFGA 3NGBC 2X4SB 4WIQA 4PBXA 3TBYB 4LGSB 1S7QB 4YEEA 4X7SH 5IESH 1LEKB 1TETH 3BESR 4QHKI 3BVNB 4EN3C 3MPCA 3BZ4A 1D6EB 1NJ9A 3EYSL 4Y1AE 2YKLL 3TO2B 1YEIH 4PJHF 2XWJA 2VLKA 3BPNB 5HVGB 1A6WH 1U8NB 5GISH 2AXJA 1KELL 5JHDE 4ZODA 3DGGB 5GZOC 4GRMB 1K85A 1F4HA 3LQZB 4Z18A 1EX0A 1G9MC 3VFOA 5K9JL 5D1QC 2DMBA 1UJTA 3K7UA 3STZB 5BJTA 4NN7C 1XIWD 5BZDA 2OBGA 3F12A 3IDUA 4HG4K 2DQIL 1FL3B 1PDKA 2MNUA 3R1GH 4PD4K 2DQJH 4POZD 5D71L 1EHLH 3CFIC 2ZKHL 4PRPA 1F4YL 3MBEC 2H1PH 1F3JB 5TFSH 4FQ1L 4HDIB 1GGCL 3PWPE 1C7TA 2FJFB 1FL6B 3ORJA 1Z0MA 4JFEE 3PP3K 3V0VB 3LQMA 3DMMA 1QFWL 1CYGA 3B4NA 1T89C 1YN7B 5C0JB 1FLRH 7CGTA 4HEPG 3BGAA 3WBDA 2Y7QA 2R0LH 4PJ5B 2AEPH 2GEEA 1ADQL 3OX8A 3QT2A 3S96A 1B4RA 4Y19D 5GGTH 3RVWD 1FC1A 4NQEE 3L3HA 3UBXG 3WN5C 5IKCA 1WVZA 4LSSL 3QUZC 1E6JL 3LH2L 4K2UL 1YEEL 4QLRA 5L0QC 1D5XB 3JWOH 5T1MA 3PL6D 5IW1B 4BM7A 3QUXB 4TSCH 5JXEC 1WBXB 3SOBL 5I74C 3KS0H 1K2DB 3KXFD 4Y2DA 4XPBL 4MJID 1CK0L 1MFNA 5HDQH 2IG2L 1QLFA 3MUGA 3ROLA 2ID5A 1CD8A 4ZS6D 1TITA 2Z35A 3VXOA 1ACYL 1TIUA 3SKOB 1I8MB 1T6WA 5INCB 4UZGA 4HQQL 3VFSA 1K8DA 3WYRA 1RZ7L 5FEBA 1WBYA 4F37K 5HHME 1VADA 5L88H 3RDTC 2CKBL 3HZKB 4DKFL 4E5XA 3DROA 4AEIL 4J12A 2KPNA 4V2BA 3MMEB 2CPCA 1KCLA 4IRJC 5F1KC 3U48A 4M7JH 3HZMA 5HSFA 4MQSB 1ZLSL 2YBRA 4X7SL 1TETL 3OKMB 4BFIB 3S88H 3S5LB 4CMMA 3EYFB 5J56B 4KK6C 4PRNA 1YEIL 3G6AA 4PV8A 5L7XH 3D5OF 5GGUA 4XCCL 4YGVB 5AAWA 1A1MB 2AJZB 4LHJB 1FG2A 5J6GB 4U2YA 4F8QA 4Z6AT 1HOCB 1W8OA 4HSQA 5CSZB 3FO2B 4WEMB 1H15A 5DZLA 4DOHE 3MTRA 4TUOB 3EYQC 4OLUH 4GG8A 1JZ7A 5HI4C 4GLRH 3TIEA 2DQJL 2MHAB 4KK9C 5D5MF 4A6YH 1G9MH 1EHLL 5JORA 2H1PL 1H3TA 2ADJB 5TFSL 4JDZA 1IGMH 3UYOD 4OZIB 3VXQB 2NY2C 3VXUE 5B38B 2EDRA 2RFXB 4GW1A 3BKCL 5E9DB 2FH8A 2FH6A 15C8L 2YK1H 1A6ZB 2FEDC 2UZIL 3LN5A 2A6DA 2CH8A 1U58B 5HYSG 4X7TB 5IBLC 5DRWB 1QSFE 3E6FB 4LSDA 2R0LL 1NC2D 4JPVL 2AEPL 2R0ZH 4UT7H 3NFNB 4QHMA 5GGVH 3OJMB 1UGNA 1ERNA 1A21A 2NXZD 4M8QB 4PY7B 3ZKNC 4Y5YC 4LCUA 1GGTA 2WUBH 3O3UN 2BOBA 3ZDXF 1CD1B 3ARDD 2FHFA 3IAQA 4YDKL 3U82B 1R5VB 3RWGB 1J0JA 3MYJA 2AJVH 4TSCL 4DZ8B 2DI8A 3OKYA 5HDOA 4QT5B 1HI6B 3DX6A 5C0NC 1KULA 3O4LE 1LP9E 3GEWB 3HMWH 4PGCB 4UU9A 1TPXB 2CDEA 2P5WE 5BRZB 5HDQL 4JLRA 3T77A 1AC6A 4JO2H 2AXFB 1FNEA 2CDGA 3RTQB 2W0LA 3QXUA 3QG7L 1MHEB 2XT1B 1YEGH 4RAVA 3SE4A 1UFUA 3STLB 4BKLA 1FE8L 1QFHA 4IIQA 5HHXH 5L2KE 3OKDA 5L88L 4WFEE 5DHVH 2BDNL 5F93C 2WWKO 5DSCB 4G6FB 1X4ZA 3B9EA 4M48H 4M7JL 4YHIB 4Z7VF 2FYYA 1BBDL 3OMZA 4N9GA 3T0WA 5JO5B 3U0TB 4M93C 4X4ME 2IADA 3CSPA 2L0DA 2PW2A 4P59L 3S88L 5HYQA 4BZ2L 5I1KH 1WUNT 2JJVA 3HMXH 4WEUD 4XP6H 2WBJC 4AEHH 5KAQG 4NBXB 4F9LC 4X8XA 5L7XL 2ZPKH 1ZWIB 5DWUH 3M1BB 5D7IF 5IMMB 5E8NA 4P23B 1Z9OA 4JGJA 4YX2L 4AM0A 2ERJB 1B0GA 3EW3B 2YWYA 1EO7A 4PJXE 3CD4A 4JR9H 5EU6B 3STBA 5SWQA 3X14A 1U0QA 2DS4A 4OGXL 3WSQH 4OLUL 9CGTA 4UTAH 1HHGA 3LKQA 5DJ6B 4M6OL 4NDMB 4TVPL 4A6YL 1G9ML 2X9XA 1J05B 3D85A 4NKDB 3VXMB 5KSAC 1P4LA 3RVVD 1OAQL 4MVBD 2C1PB 3P4NA 2ADGB 3WNMA 5B21A 1UJ3B 2CK0H 3C2AH 3O9WC 5DRXA 4TNVK 3C5ZB 3SHSA 2EYRB 3DVFA 5ILTL 2YK1L 3RL1B 4GRWH 4XP1L 1BPVA 1F4XH 1FNAA 1GAFH 3GJEB 3RP1A 4DKDC 1MCRA 2R0ZL 1AD0A 2AEIT 4ZUUA 3LPWA 5IQ7H 1J8KA 5B39B 2QJDA 3O41A 3KPPB 2HG5A 3K46A 5DXWA 1WC7A 2EO9A 1FFRA 3BD4A 1UEYA 1TTFA 1E4KC 3B2UD 2AJVL 4O4YH 2DMKA 3VDBA 4RZCA 1YYLH 3HMWL 5ESVA 2FO1A 2CRIA 5TDPA 1ORQA 3ARGA 1CDJA 4HJJH 4R0LA 1H5BC 1NCAL 3DHMA 3ALWA 3VFUA 3S3JA 3CPLB 3LV3B 4FXGB 5BOZG 5EIIA 2X70B 5J12B 4JGUA 2FJHA 1TQCB 3UEZA 1OGTA 2APWA 3PABA 4WWKA 1SHMA 3TGXA 3QI9A 5INDB 4I0PC 2XZQL 3RY4A 5EO1B 3QUXD 4K7PX 4M48L 2IJ0C 1BOYA 3GZKA 4X98A 3GMMB 3PP4H 5FO7B 1MWAH 3D9AH 4IHOB 5IHUL 2OSLA 1Q94B 3PWLB 3TBTA 5I1KL 1AGEB 3HMXL 1NGQH 2GK0A 4MA8L 4XP6L 4AEHL 4P2QE 4JVUA 2XN9E 5SWZB 3WS6A 2ZPKL 3MA9L 3HB3D 4PTUA 3KVQA 1LK3H 1DDHA 5EB9A 1DEDA 1MJ8L 4PJAF 3EYVB 3KPRA 3KLHC 4JY6B 5LVEA 4JR9L 1YPZA 1Z9SA 4NQVB 3RJQB 5C0EB 3S3SA 3ZO0A 2HT3D 3K8MA 2CDFA 4HCRH 3SDYH 2VN7A 3IAPA 4WNQB 3WSQL 2OR7A 3KYKH 5HJ3A 4UTAL 1OAZH 3Q1SH 2QEJA 4KY1H 4N90E 3IDYC 3T1FA 4YBLC 1B2WH 3BP6B 3NIGE 4ETQA 3W11D 1OL0A 1PAMA 3NZ8B 4PJEA 1GC1H 2CK0L 1IE5A 3C2AL 4UI2A 3IDMA 5IOPB 2HTLC 4JO3H 2FRGP 1P7KB 2DBJA 1BFOA 2VLRE 2HRPH 2NY7H 3ZT6A 2ICWB 2WK2A 5C0BA 2ED8A 3T8XA 1F4XL 1ZXQA 4N0YH 4Q9RH 5IT2H 4ZPTB 3JBG7 4C83B 5HDLA 2M26A 3HNSH 5IQ7L 4Z0BL 4PB0H 1OD9A 1JUFB 3S35X 3K4AA 4F7MA 1UKTA 3U1SL 1PJ9A 4JFHD 1XGPA 5E9DD 4U1KB 3EOAB 3VWKD 1FNSH 5JW5A 3Q6GH 2AJ3B 1BD2E 5FOBB 4L3EA 3MRMA 1YYLL 3LSOB 5C3LD 2CIIB 2XY2A 4JKMA 1CICD 4G80A 2YXFA 2VDML 3OV6A 4HJJL 2C4XA 3DNKA 3GBMH 4WHYH 4NHUA 2BJMH 1GYAA 4LQ1A 1NCWH 3KYNB 1QRND 5JW4Q 5IK3B 3QQ3B 3NH7H 4HZLA 5CZKA 4XP4L 1S9KC 3MV9E 4HPYL 4ELMF 3QWRD 4IOSD 4MB5A 1FIGH 2BVEA 5EORH 5BS0B 4OV6F 3MZGB 3GMQB 4L4TB 1AE6H 4GFTB 2Q6WA 4BQ6A 1F13A 3RVXD 3EYUH 4C56B 1LEIB 3PP4L 1MWAL 3D9AL 1MJJB 1DQJB 4WI3A 2H41A 3O4OB 1V7NH 2R56H 2ZSWA 2D0HA 1IILE 3JV6A 5SWSE 4AENB 4OF8A 3PV7A 5MENA 1S7RB 1D9KC 3T2NH 1DQDH 4LLQB 1I8IB 1LK3L 2I26N 3CFEA 5H8DA 2VZOA 3BO8A 1MFEL 3IJYB 1FNHA 2E7LC 3VG9C 5GRJH 4G6FD 1P7QB 1RFDH 4GXUM 4POYA 4NRZB 1DE4A 4MNHA 2VC2H 2W65A 4PFEA 1R5WB 4HCRL 5D7KD 3SDYL 3FQXA 3T3MF 1LD9B 1FGVH 5LBSL 2BK8A 3EO0A 3KYKL 2CUIA 3L3KA 1A1NB 3OXSB 1OAZL 3Q1SL 5DGRA 5A2FA 3MOAL 1MRCH 4WUKH 4Y16B 1G7JB 4LSUH 1LEGB 3H9SA 4PRHA 1SYSB 4OLYH 5HHPA 1GC1L 4P23D 3C9NA 4JRWA 4L4JA 4YHKH 4ODSH 3QUYC 1YMMB 4J1UA 4YHZH 3BGMB 2OXGA 4OKVA 3BH8A 3EYOA 4O5LH 4NFBA 4LPYA 3QNZA 1NBYB 2ARWA 4YHYB 4N0YL 4ZO9A 2XG4A 4LSTL 3TO4A 3RVWC 5IT2L 3QIWA 1FFPB 3VXMD 1UADC 3PE9A 4XBPA 5TDOA 4G9FB 4PJIF 4PB0L 1L4IA 3UDWC 3BP7B 4H88H 2BFVH 3C09B 5I6XB 3HLAA 4G5ZH 4CKVX 1DVFA 3C5ZD 3QA3B 4TRPH 4ZUWA 1FNSL 3VXTB 4M00A 2F54A 2AJYH 3OF6A 5GGVY 2OR9H 4XVUD 4U3HA 4ZS6C 1EBAA 3LKRB 3RWHA 4XNMB 3GBML 2BJML 4L9LA 1YEDB 2R2BB 4I18C 1NCWL 4JAMB 1NMBH 1FBIH 1KF9B 4X6DF 5T33H 2PF6A 3NH7L 1FZOA 2VZTA 2N1KA 5C0AA 5EORL 2X05A 5H2BA 1NBVH 1PYWA 5HI5C 4ORGA 3UTOA 2X4OA 3PHOA 1AE6L 3LKPA 4ONHB 4BFEA 5I75B 6CGTA 4JJ5A 3EYUL 3BGFC 2YD4A 4HWUA 3DV4B 4U1NA 4PJ5E 5IR1B 4D0CA 4LHUB 5L2JA 4IS6A 2VABB 1HXMB 2O5XH 5EA0H 1N4XH 1KPVB 3LRSB 4L8CB 1IQDA 2J1KA 1U8MA 3QZWA 3BISA 5EZJB 5I1AA 4M1GH 3QDJB 3WJJC 5E1AB 3THMH 1T03H 3V6ZA 1MIML 4F3FA 2A6JB 3DXAA 4KJQD 2C7UB 5GRJL 4CAGA 4LVOB 5IFAL 1RFDL 1QFOA 5DMKA 4HIEA 5GS1C 3OR6B 4FTVE 2BY3A 2Q3ZA 3KPLB 3V5DB 4KKAD 2FZ3B 4FHBD 4P2OB 4X4ZA 4L29A 5D1XA 2FL5A 4UAOC 3ECBA 1MRCL 4CW1B 4WUKL 2BVPB 2GJ6B 4LSUL 4LVNC 4ZFFB 4O51A 4U33A 4MAYB 3MRHB 4XGZB 4RMVA 2UWEA 4YHKL 3UBXB 4ODSL 4JFOB 1XCQB 1FYTB 5FUOH 4YHZL 1FZMA 3WKNA 1JBJA 1AQKH 3MNZB 3GMLA 5LG1A 4HIJA 3RWDB 3B3IB 3CZJA 5I76B 4E41E 3BP4B 4LCYA 4PJBA 4PUBH 5DD0H 1TVHA 1E6OH 4YR6A 4K07A 1NMCB 5LGKA 2APXA 1C7SA 4H88L 1JPGB 5FYKU 5BMFH 3WFEL 3IJHB 3HG1D 2JB5L 2Q20A 4MDJB 3CX2A 4X7FC 3GSQB 4TNWK 1CXHA 4YHPA 1H3PH 5GSRB 3L3OB 3P4OA 2AJYL 3V4UL 3HPLA 5EOTA 1C5CH 2MCG1 1J1OH 3ME0A 4QRSA 1AJ7H 2R0WH 5DC4B 4WDIA 2VQTA 4PJFB 2ZG1A 2VH5L 4QHUB 1HINH 1E0OB 3MR9B 1VSCA 2AW2A 4G6KL 5DK2A 2XV6B 2Y5TA 1QVOB 1NMBL 1JPTL 4NQDB 1I1AA 5T33L 1O5DT 2AV1A 3EDDA 4OZIE 2R8SL 1QBMH 1CFNA 3NN8A 3O6LH 2P43B 2P7TA 4UUJA 3CDYA 5FM4A 3OG6B 4LOUD 1ZLWH 2Z31B 2BMKB 2B2XH 3MRCA 4L8SC 3KYMB 3L5JA 4M02A 1HHIB 4QGYA 5EBLB 3CFBA 2C3GA 3F8UB 2ZG2A 4N0UE 4HGKC 2PXYA 5FO9A 2WLZA 5JIKA 3HAEA 5DQ9A 3PWJA 2O5XL 5EA0L 5E5RB 1QFUH 3T0EA 5D4QA 5BQ7A 4MQXC 4HHAA 2YD2A 3QWQB 1DEEA 4M1GL 4N1CA 1JMXA 3THML 1T03L 5BS0D 3WV0A 3EFFB 3X13A 2EDNA 1LK2B 4YBHA 4L4TD 3SJVD 1YC7A 3FB8A 4EKXA 3HE6B 4X6CA 4C56D 5CBEA 3IXAA 5DVLA 2ZUWA 5BRZE 2NY3D 3F5WA 3MLUH 2UZYB 3SY0B 5HYSB 3RVVC 1IBGH 1EVTC 2R39A 1JN6A 5KSBA 1M7DA 4JFFA 4OCYH 1CXEA 2EDOA 5EDXA 3VMNA 4OZHA 2IAMB 4U1SA 1AI1H 1YY9C 4MDIA 2JB6B 3OBAA 5D2LE 5JOPD 1OD7A 1HDMA 5BZWA 1D7FA 2EDKA 4KUZH 5DJXB 5FUOL 3VMOA 3F58H 2FGZA 4UQ2B 3MV8B 1S7SA 2XWTB 5FGBC 2Z93A 2JCCA 3B9KD 3TVMB 4UV7H 1T0NA 5DD0L 1E6OL 1NEZG 3U6RA 2VLKD 4ZOCA 1K8IB 2HJKA 3TBVA 1YECL 3C60A 4XB8A 3SKNB 1PQZA 5DVKA 3ARTA 2YXMA 5JTWA 4CADA 4I9WD 2QV2A 2WQ8A 3J8F7 1U8HA 1YMMD 1G6RH 5EU6E 1H3PL 2EKSA 2EIEA 1ZV5A 4J6RH 4PY8I 4KHTH 4X7DC 3GGWA 1C5CL 1J1OL 4JFDE 2R0WL 3P4LA 2AJXH 5DDHB 4M7ZB 2QSTA 1ZANH 1UB6B 3GMOA 2DM3A 4U2ZA 2LFGA 4G9FD 2WP3O 3OKLA 5C0GA 3MLXL 4YFEA 1T1WB 2OL3L 5I1IH 3UTSA 1CGSL 1QBML 3QUXC 1MJ7H 1WCBB 4RAUB 4PJ8B 1UZ6F 5MI0B 4MA3A 3GBNH 5C6TH 3QJHB 4HPOH 4QRTA 1PZ5B 2B2XL 4FFVD 4XNUH 3AM8A 3M07A 2BSSB 5KS9A 4G8GB 2EO1A 4FQQB 4KKBD 5JW4N 1A9EB 4NHCL 3ARVA 3ES6A 1MVUB 2NYYC 2NR6D 1KB5A 3KWWA 1Q72H 4JM2F 1QFUL 4NZTH 3TA3B 1MCHA 5DFVD 2VAJA 3VFTA 1F11A 1QBBA 1KGCD 2NY1B 5B8CC 5BXFB 1CVSC 4QOKA 2BCKB 4XRCB 5JUEL 4YBQD 4NT6A 4J3TA 2X9YA 4JY4B 2NY6D 4DVBA 3ILPB 4YHLH 3ULSA 4RRPA 3KYOA 2RJMA 1IBGL 4OTXH 2AJUH 4HJGA 5FYLD 5HTSA 1HH6B 4LKXB 3W11C 1X5GA 3PDOA 4LF3A 1R3KB 1H3GA 3HZVB 4G8FA 4TNVF 3KNBA 3IDNB 1KCVH 3FOLB 3QXAB 2EKJA 2EIZA 1AI1L 3QDJD 1DQQA 1KV3A 3X12B 4N0FB 1M71B 2LAAA 4LDEB 1IGCL 1F58H 2MCPH 3QHZH 3EO9L 3CCHA 4KUZL 4RIRB 1ZT7B 3X3GH 3WNPA 3DURB 4LEOA 1W0VA 4PJCA 3ZDZE 1W72B 1U92A 3K4ZA 3TIDB 2K7QA 1INEH 4UV7L 1ZA6B 3PIQB 2BSTA 1FVEA 3UTPE 3GSRB 3KR3H 4JN1H 2GJ6D 3HZYA 5KSUB 5SWZE 1KJ2B 5EPMB 3HS0A 2HTKD 1IAIL 1Z3GH 2P47B 2SEBB 4KDTC 4MAYD 2H2PD 1NQBA 2OQJA 3O8XB 3KPQA 1PSKH 4RFNB 3TPKA 1FYTD 3EOTL 1G6RL 1NL0H 1G7IB 4RGNB 4H26A 1Z9MA 3NACL 4L8DA 1G6VK 2WQRA 3GJFB 4KHTL 1HHKA 4K3EH 4Z7WF 4M5ZL 2IALB 3CUPA 1ZVSA 2AJXL 4EQ3A 2BXZA 4J3SA 5JDSB 1AXSA 3NIDE 1ZANL 1T0PB 1VGKA 3I50H 4WO4B 1XGQA 5GGSB 1R3IL 1CN4A 1HQRB 4E0RB 3FQRB 4JY5H 3AXLA 2EXWC 3REVB 2DDQH 1KPRB 1S7VA 3DECA 1MJ7L 2XA8L 5ESAB 4LSPH 1AGDA 3BEVA 4HKZB 2W9EH 5F88B 3RVXC 3MLYH 3TBSB 1TPXC 1ZSDA 5C6TL 4LNVA 4HKXA 1MQ8A 3W39B 4XNUL 3GBLA 1JJUA 3RTQC 5FYJE 1HKLH 2WLYA 4Y5XB 1A7QL 2VISA 4LAJH 5DJDA 1Q72L 5F7WC 3VI4F 4NZTL 5FXCH 3PDDA 4OAWB 3V6OA 2YN3A 4GAGH 5KN5B 1XR9A 4XNYH 3C6LA 3S36H 1OARL 1YPZF 2A83B 2Z31D 5I1LB 2P5EA 3MNVA 3DSFH 5F3HB 5F7HA 3P30H 1TTGA 3ETBF 4Q74A 3PWNA 2YEZA 4GKZB 4HGMA 2P8LB 4LPWA 5I9QB 3MNWA 1T0MA 1MCWM 1TFHA 2WAHA 1IM3B 3GIVA 2A74B 5IMOA 4OTXL 1SJEA 1HYRC 3DVGB 2V2TA 1DBJH 3K1DA 4P23C 4I0KA 3G08B 1I9RH 1KCVL 1M05B 2ERJC 3P9LA 2XQYG 4Q6IA 4EI5A 3VH8A 1MLBA 3FQWA 1F58L 1H3XA 5L9DL 2MCPL 3L9RB 4MSWA 3LKNB 4XWGH 1DUYB 3X3GL 4OUOA 3HE6D 2EDHA 2X40A 5EOCH 3D0LA 1U3JA 3D25B 1INEL 2KL6A 4LARL 4AQ1B 4HD9A 5ID1A 2FBJH 5IVOA 5J13C 3DWTA 2IEPA 1UH4A 2GW5A 1SYVB 1UJ3C 5FK9B 4M3KB 1Z3GL 4F15B 2IAMD 3C5ZC 2DQCL 4JM2D 3SGJC 3CMOH 3L1OH 5AD0A 1KLGB 2FIRT 1PSKL 1ZHBB 2Q76A 1ZOXA 1NL0L 4LPVA 4XPAH 3MV8D 1FFOB 1FCGA 5C3TA 4P5TB 5F1NB 4MA1B 5KSVB 4NO5A 4X6BB 4IOIB 2NTFA 4K3EL 3TVMD 2Z92A 3DX7A 2CMRH 5DEFA 1KEGH 4HV8A 2IQAB 1T4KB 3SGKC 5A1AA 4CGTA 2WUCL 5IW3A 5I8CA 3I50L 1QSZA 3S37H 4F7TA 4JZJB 3QR2A 2UUDK 2DTMH 1KSRA 1FZKB 1U3HB 3OZ9H 4JY5L 2DDQL 5IQ9B 3HUJF 3F65A 4QXGH 5HHQA 3BYTA 1HQ4B 4LSPL 3U36A 2HMID 4WHCA 2W9EL 4R6UA 2BNQA 3MLYL 3RWFA 3L5WB 4QTIH 4M61B 2XXMB 4J3OC 5CINH 3OJ2C 1UH2A 4DN4H 4NC0B 3RQ3A 4GBXA 2OTUB 5DUPH 5B3JE 4ODBD 4JZNB 1HKLL 3L7FA 4Y5VA 5J12C 1EGJA 4FQLH 3TNNB 1TQCC 1ADQA 3GHBH 2VLME 4G3YL 4I4WB 1VFAB 1LO3H 3QDME 4GAGL 4KJQC 3K3QA 2Z8VC 1CFQA 4XNYL 1HHHA 3ULUD 3S36L 1GGIH 2WWMC 4PJ9D 1DLFH 3G5ZB 1A4KA 1IGTA 3RFZC 1KG0B 3GSOA 4HXAL 1NKOA 3D3VA 4CVZA 1P1ZA 4EXPX 1P4BH 2P24B 4NRYB 4MZ3A 4G8GD 2VWEE 2OJEA 1CS6A 3VFPB 5ICYB 3HE7B 5EU7E 3FQUB 4LAQH 1HNFA 1BOGA 4PJDB 1J5OH 2DQTH 5CEZE 3L5XH 5FYJU 3QJFB 3TA3D 3L7EA 3PQYD 2R2EB 1JCKA 1J1PH 3N1QC 3S7GA 2EDBA 1WGOA 2I60H 3C5JA 5EOCL 4HS6B 1QO3B 1UVQA 1JWSB 3PGCA 3BH9A 1N8ZA 3RWCA 2GY5A 1ND0A 4PGZA 2FBJL 2D9QB 4YAQB 2G5RA 1YUHA 3O45A 3IVKB 3LPFA 3SBWA 3WUWA 3TESA 1LE5A 2QKIA 1F6AA 3R0MA 3CMOL 3L1OL 4WW2C 1BWWA 1G7PA 4YJZL 5HHOB 3DBXA 1RZIA 3SDXE 1DBAL 4MNQB 4QXTA 1G9EA 1BLNA 3P77A 3OXRB 4JRYB 1CLZH 3Q2CA 4XPAL 4LHQB 3UTZA 4JFYB 5I1DA 3AMLA 5C0CA 1K4DA 2NY0B 3I6GA 1QHPA 4MQ7B 4MLIA 4JQVC 3QNXA 4DFHA 1KEGL 5DT1L 1AGCB 3QUMA 1I9IH 2R2HA 5EU3A 4ODWB 2GT9A 3JVGA 3L3GA 1OLZA 3LDBC 4ALAL 2DTML 1NDMB 1QRKA 2UVEA 3QEHB 3RX5A 3VRJB 3OZ9L 4AEFA 3U9UB 2BP3A 3QEQB 4H20L 4KRPD 4QWWD 3O8XD 4QXGL 4JANA 4K23L 2FLBT 1BVLB 1EUTA 1YMHB 4AIZA 4NZDA 1RI8A 1A9BA 4RGND 4QTIL 3H7LA 4WI5A 3Q3GB 3MV7B 1KTRL 5CINL 4ESKA 5DUPL 4K9EH 3DI2B 3S34H 4QRRA 5I71B 1IAKA 1G9NH 1MREH 4YQXH 4FQLL 3VI3F 1FYHB 3GHBL 5GGTA 2BVYA 4G7YL 4GQ9H 1JNHB 3ET9F 1Q0YH 1F6LL 4Y4FB 1LO3L 1RJZA 4GS7B 4Z78A 5JW3H 3VFRA 2F53A 1GGIL 2W9LA 1DLFL 5EUKB 2H8PA 3INUL 3MGOA 1T7XA 4C55A 3ARFB 3G5XA 4BH7B 4OGZA 3TCLB 1NAMB 5DD1H 3O4OC 1JZ8A 1XGRA 2HT2C 1KTDB 1P4BL 4OB5L 4GAYB 4HULB 5FO8B 2UYLA 4XXDB 4TUJB 3ROOB 1BIIA 4H8WH 4LAQL 4TTGA 1J5OL 3S4SA 3G6JA 1ACZA 1DANU 1GHFH 3VFMA 2W0PA 3L5XL 2HLAA 3NFPA 4NQDE 5DJ0B 2UWEF 1DL7H 1YJDC 1S7UB 1X44A 3A67H 1J1PL 5T1DL 5IGXH 3PGDA 4LCWD 3OTTA 3VCLB 4X0KA 3BUYA 3GNML 5F7EL 4PJ7A 3DUUB 4XAWH 3QYCA 4R26L 5IMKA 1VEOA 2QADB 2DWEA 4HJ0C 4PJBF 4PRIB 1KLUB 3MRIB 3SDDB 1JGDB 1FHGA 4Y16C 4OCMC 1EMTH 2H3NA 2A6IB 4PPTA 3T3PE 1ZEAH 4KZEL 3V8OA 3T65A 1D3CA 2E8ZA 3AROA 4Z7UE 5ICXB 5F3BA 4P2RB 1EEUA 1PKQA 3G5VB 4TNWF 1XGUA 5GS0D 1D5ZB 2OK0H 2EXYD 4NFCA 4NM4H 1VEMA 1XFPA 2AK4B 2L4OA 3KLSA 2R23B 1EEQA 4HW6A 4PRAA 1U8QB 3C8KA 5IROC 1I9IL 1RULH 4KKCC 1I8LA 2HKFH 5CEYB 4AIXA 5IBUG 5D1QA 1TJGH 1UEMA 4KH2A 3C09C 3QO1B 5I6XC 4XPGH 3H9SD 4NO2B 3ZE1E 5HGDA 4O00A 1A7OL 1L0QA 1VDGA 2COQA 1D5IH 4RA3A 4FFVC 4JGMA 1P69B 4V1DD 4P5TD 2LVCA 5IIEA 1AR2A 3MBEA 4GG6E 1KIUA 5L6YL 4X9GA 5EU7C 3S34L 1A4JA 4OD1L 1RV6X 3UBXI 4NWTH 1H0DA 3GB7A 3VXNB 4OUUB 1NDGB 5D6DC 1MREL 3MYZA 3QIWD 4YQXL 4U0QB 4GQ9L 4X99B 1OSPH 4ZSOB 1Q0YL 4IDJH 3MA7A 5BW7C 5IMLA 1CD0A 3JTSB 5DEGA 5JW3L 1P2CB 3CXHK 1QQDB 3OKKA 2B1AL 5I75C 2FSEB 5HYJB 3MLRH 2ORBL 1I85C 4R4NC 1S9XB 4X6CF 2ARJA 1EO8H 1YZZA 2NW3A 2Y6SC 4XNQB 3QUZA 1BBJA 5DR5L 3OKOB 4OIBA 1MLCB 5KSBF 5K9OA 3IGAA 5TH2A 4OZHF 2C4FT 4NKMA 5JXEA 4R9HA 1BZ9A 3WFDH 2ZUXA 4JB9L 2RR3A 2VAAA 4LVOC 1FVCA 1C12B 1KC5H 2HJLA 2A73A 2DL2A 5FKPA 1K4CA 4NUJB 1P6AB 4OCWH 5DHVA 4HIIB 2FDBP 1W0YT 4OF5A 5E00B 4LPXA 1EFXA 5CD5D 3MREB 1HHJA 5CILH 4XAWL 2JCCF 5J11B 4P2OC 1T1XB 1WWAX 5C6PB 4PGJA 4MD0B 3QIUB 1KIQA 3RDTA 1YJDH 3HMXA 4P46B 4BSJA 2WMPA 2XI9A 4X6EB 4EZMA 1KCKA 5BO1L 5M7QA 1ZEAL 4IRJA 3DTXB 4KU1A 4L4VE 4M1DH 1UYWH 1G7HB 4KDVA 3CDGB 5IB4B 3FOMA 4HGWB 3TEUA 5FDWA 4LRIA 4OCRH 3DXAD 4U6XB 3NCEB 4JFZH 2OK0L 3NIFF 4O2EA 2B1HH 5FA3B 3BMWA 1INQB 1IT9H 3D6GA 4R4BA 4GOSA 3VU2A 1DQLL 3KPNB 5F9OH 5C07A 3HR6A 1NMCC 1RULL 5FV2A 3AREB 5C0DA 1YEJH 4QRQA 4XPGL 3CX5K 3L3JB 5C0FA 2XWBB 3WHXB 2HJFB 3W82A 5ACLA 5HHOD 4MNQD 4JVPA 12E8H 3P0YH 4HWEH 4JRYD 4YDIH 4DTGH 3H3BC 4PLJD 3VFNB 1CXLA 2VUOA 5AUMA 1PY4A 2XZAL 1LE9B 1EXUA 2ZUVA 3LB6D 3VXSB 2NY0D 2VLJB 3ZKXB 1GXEA 4AL8H 2E9JA 3KDMA 3A6OA 3JSSA 1ZHKA 5CD3A 5LKNA 3E6HB 1MHHA 2ZSVA 3CC5B 1OSPL 5TQ0H 3QEQD 2EDLA 2YPLB 5E2WL 3K8LA 1IGYB 1X4YA 3QFJD 3FQTB 2IANA 5EBWA 3MLRL 4FFWD 3HPJB 4U1HA 3LOWA 1OCWH 1TVBB 3MV7D 4FZEL 2ITCA 2X4RB 4UV4L 5C7XH 4NWUH 2JIXA 5CMAA 1F4WH 3MGAA 2J8UA 4RMRA 3RWJB 3VXRE 4WV1B 1A6VH 5KVEH 2AABH 1QSEA 3TT3H 5A2JH 3FZUC 5DURB 3WFDL 2CQVA 1KC5L 4QHNB 5JA8B 1TCMA 2FATH 4L3CA 5FYLH 2QR0B 1DFBL 3HE6C 2HH0H 3BXNA 4GO6B 1MY5A 3DRQA 2BERA 3ARFD 2W0FA 5CILL 4DQOH 2MQCA 5JHDA 4FNLL 3U4BH 2R69L 1MWAA 4G9DA 1ZGLM 3DPBA 1U8IB 5T1KB 2VR9A 1YJDL 2ESVA 3UPRA 4Q2ZA 2XA3A 1QNZH 3FO1A 3MUJA 3QPXH 4TSBL 4JO1L 4M1DL 1UYWL 1U2HA 4ZOEA 1NJ9B 2HAZA 3MO1A 3RGHA 4OCNC 2XWJB 2YSSB 2IBZY 1O0VA 1UWGH 1IGFH 2JJUA 3B9DA 2Q86A 3WO4B 1SEBA 2B1HL 4HCRA 2WBJA 3D2UD 1IT9L 2EDWA 3TN0D 4F9LA 1GZPA 1JFQL 4PRID 5BJTB 3SDDD 5F9OL 4U49A 2W9DH 1MIEL 4XCYA 4LP5A 4JO4L 5EC1A 4JFFD 5DK0B 1NC4B 4WGVB 3VGBA 5FF6A 4PRPB 3KS0J 4DK6A 1U8LB 2HMIC 1OGAB 1OTUC 4AK1A 4NOBA 3ZKQD 12E8L 4CVUA 4WI2A 4YDIL 4DTGL 4FQXB 5F9DC 1WBZA 1BZ7B 4NQEA 3OPZH 5GGQH 1BREA 1PG7L 2AK4D 2DOCA 5KTEH 1T20A 5KSAA 4HX1B 4OF7A 4JREB 4M7ZC 1JNNH 3MRFB 4XCNB 3RJDA 3LKSB 4KZDL 1MAMH 4NQXB 1UZ8B 1KCRH 3WNNA 5HYFA 4XBEH 3MRJA 4R3SA 3PXHA 1J8HD 4H5SA 3BZFB 1JL8A 1VACA 2KBGA 2Y7QB 2VZSA 5H94A 4L8BA 2CR3A 3S96B 5TQ0L 2HFEB 1IKFL 4NC2B 4PJ8C 3I6LD 4M1CD 5MI0C 1OT1A 4HFWA 1Z6JT 3L3HB 5AEAA 3UJJH 4AH2B 4P5KB 1Q9WA 4PYGA 5F1IA 3T4AA 2QQLH 4ZFGL 5ISZE 4LFHG 4G6JH 1BGXH 1OCWL 3FT2A 3AU1A 5CEZL 3U30C 5JNYA 1XF3A 5T1MB 1NUNB 5IB5A 3RWEA 3UJTL 2X4NB 3TJHC 4NWUL 4GRLA 4JRXE 4HUUA 1KB9K 1F4WL 4UDTB 3OG4B 1A22B 2G60H 4JE4B 4Y2DB 4H0IA 4K3JH 2DWDA 1R3LB 1MUJB 1YNLL 1A6VL 3MUGB 1E4KA 5ESQB 3ROLB 3IDJA 5DHYB 5KVEL 3HNVH 5DMIH 2X1WL 4N9OB 3GRWH 4PV9A 5EN2A 2NY1C 4P4KD 3OWEA 2GUOB 5GRZA 3LRHA 3O3EA 2FATL 5FB8B 5HYJD 3EDFA 1WBYB 1MCQA 1A3RL 3D69B 2NPLX 2DYPA 2EZ0D 3U4BL 4YDJB 4TULH 4RGMC 1NMAH 4EOWH 3QEGL 2EH7L 2P8MA 4KK5D 4I0PA 2O93L 2YBRB 1YC8A 3DYOA 1OW0C 3DUSA 1MHCA 1QNZL 1F90H 4KI5F 5B4MD 2BOCA 2OP4L 3LPGA 1KXQE 3O2WH 3VRLF 3M8OH 2CKBB 1U9KA 4ACPA 3FONB 4PRDA 2V2WA 1IGFL 4EUPG 2HRLA 4F7EB 3CFKA 3PJSA 4PJGA 4MCZA 5DTFB 1VENA 1FG2B 2FX9H 2X89A 3KYAA 1OTTC 1T83C 1UACL 2GJJA 4MNGA 2AQ3A 4NRXA 3MLWH 2B7DT 1H15B 2W9DL 3QIUD 4MAUH 4P46D 3HI1B 3NABH 3IDXH 1JWUB 3I02B 4N8PA 2DICA 3JTTB 2DM4A 3O8XC 3QDGB 1MI5B 1QSFA 3WLWC 4RFNC 5CKAA 2D7NA 5E0QA 3QQ4A 5JORB 5KBNC 5I8KH 5DJZA 4RGNC 3SDAB 1LGVA 1HK6A 5F8RC 1NCCL 3HTLX 4MWFA 5GGQL 4DZBB 4RQQA 4GW1B 3BQUC 1JPFA 2R2CA 3GMPA 4HIHA 4U7KA 3W9EB 5E6YA 4WO4C 3LN5B 1CU4H 3MLVH 4XBEL 4Z7VE 1RJLB 1CFSB 2GCYA 2YPVH 4H25A 4PTTB 4R7DA 1CT8B 3GDBA 43C9B 2CXGA 3V79C 3UJJL 4X7EC 4Z0XB 2V7NB 1RSFA 4ISVB 4CMHB 2DTSA 2QQLL 5GRWA 4G6JL 1BGXL 5D7IE 2Z4QA 2BC4A 2YC1B 2YUVA 3VXSD 4WUUA 4DVRH 2VLJD 1CDCA 3CK0H 5ANMB 4Y5XC 1RY7B 5E24E 3ULUH 3MSPA 2G75A 2IPKA 1EEZA 4UINL 4GAFB 1NCDH 4K3JL 3SE8H 5JOEA 3HNVL 5DMIL 4A2MA 1AHWC 3GRWL 2CDGB 3ULVD 1U42A 2YPLD 5FHAH 3FFDA 5EOQH 4LGRB 1RK0A 4RFEB 4IIQB 4K3DH 2ZOLA 1X6LA 4P57A 1T3FA 4NO0B 4YK4B 4KMQA 3F7VB 1MFDL 2K7PA 4TULL 5EUOB 1NMAL 4W4OC 4X83A 4P5MA 4N9GB 4M43L 4APQC 1KXVC 3OJDA 2R29L 1E4WH 2IADB 2BNRB 1RHHB 5I1JH 1F90L 4QEGA 4UIMA 1OP5H 4X80H 5HYQB 5DURD 5JOFB 2GSGB 4XVSH 5C08B 3M8OL 3WXWH 2EXYC 4ODVL 5E8NB 3AS0A 4LSRH 2FX9L 4ODUB 3SE9H 3VE0A 1U93A 1DP0A 1NLBH 1T1YB 1NCUA 2A0LC 2PW1B 2BZDA 1AC0A 3MLWL 3X14B 2DJUA 3RGVB 5T1KD 1ES0A 2X4QA 4MAUL 3IDXL 8FABA 4XHJD 4F15C 2N4IA 1AQDA 5ADOH 5GXBB 4XP5H 1XIWA 1HHGB 3AC0A 3LKQB 4XH2A 5GRXG 2Y72A 5I8KL 3W81A 4MA1C 3QBTB 1B6UA 5CHNB 2E9BA 1KJ2H 5C9KA 3BDYH 5F21B 4B7LA 1NFIB 1DUZA 4P2YA 3UTTB 3MRQA 1A64A 1Z9LA 2GITA 4BSVA 1AFVH 4JZJC 4ZXBC 1CU4L 3MLVL 1XF2B 3KPSD 2VO5A 3MRRA 3OJVC 5FA4B 1U3HC 5DQJB 4OZGA 1NC4D 1T7YA 1IGJA 1WZMA 3C08L 3SPVA 3BWAB 5K9KA 4KI5D 1OGAD 4P2RE 4EVNB 4FQXD 1AGBA 1SBBA 2HG5B 1WC7B 1N0LA 1NFDB 4Y19A 2CLVA 2V5MA 1MQKH 3KPOA 4DVRL 3WS3B 3CK0L 1NSNH 3GK8L 3BUTA 5LGJB 3UDWA 1KXTB 3ULUL 3CFCH 5KVGL 3PL6A 1NCDL 3G6JF 4H1LB 5ESVB 1JP5A 5ABDE 3ARGB 3SE8L 2ZCKH 4KGJA 3CFJB 3KXFA 4MJIA 3VFUB 5FHAL 2ZOKB 4ELKB 5EOQL 1OGTB 4WWKB 4K3DL 3R06B 4FZ8L 4PJ7F 4YDVA 1BEYH 3K2MC 4WFFD 1RIHH 1ZLWK 4LLAA 4OD2A 4I18A 4NQCE 5IHLB 3HE7C 3WN5B 5HVHB 1TZGH 5DO2D 4C59B 4JJHA 1DN2A 3RU8L 1QR1A 2X4TA 1ETZA 1E4XI 4GKSB 4MB3A 1BX2A 1WT5C 2VIRA 2VRAA 3D0VA 4LIQE 5I1JL 4X80L 5HD8C 3NTCH 4ZSOE 5I74B 1BAFH 4LLVB 1B6DA 5ITFB 1MAKA 4MD5B 5IBUB 4YFLF 1MOEA 1JHTA 4OZFG 4X8JB 2NY4D 5FGRA 4KQ3H 4PTUB 2NNAA 1MCWW 2PO6C 1F3DH 4RDQG 4YUEL 5IG7A 3ILQD 1V5JA 3SE9L 2ZUUA 1NLDH 2PTTA 3ZTNH 4RFOH 1AR1D 3MRDA 4K3GA 2MQ3A 4XC1L 1HEZB 3WJJA 2A6KA 4PREB 1KPUA 3U7WL 3QQNA 5ADOL 3SKMA 1W72L 1NBZA 3H9HA 1QR4A 1T7ZA 4ONOA 5CBAA 4M3JA 5GS1A 4HXBH 4PLJC 1AKJD 2VZ3A 4ETQB 3LB6C 1FLTX 1JVKA 1UC6A 5EFIA 1U8JA 4PJEB 2Y07L 4FQCH 1KJ2L 3U46B 4NNXA 3BDYL 1J1XH 4PS4L 2XOTA 3WXVH 1QOKA 1BFOB 5CP7B 2I9TB 4MJ5B 5M94B 3T8XB 3BRFA 1UM5H 4ZUVA 3T0XA 1EEYB 3KGRA 2B0SH 2PUQT 2H9GA 3IF1B 5HGBB 3RUGF 4Q7DA 3HC0A 1MI5D 4MJ6A 4U6VH 1U3ZA 3RAJH 5D7SL 5DGQA 4IM8A 3WEXA 1S3KH 3TYFA 3SDAD 3W0WE 2LTQB 1WZLA 2DLEA 1T1ZA 1P9MC 3MJ9A 3S97C 1G6RA 2UV3A 5MHSD 4F7MB 1MQKL 2ICEB 3FFCD 4QNPE 1NSNL 3MV9A 2WP3T 1HSBB 4Y4HC 3LKOA 1I3VA 2GTWA 5CZXD 3BIAX 3CFCL 3ARDA 1AO7B 1FSKB 5GIRB 3MRMB 3MRLB 1H3UA 5DD5H 4Y4FC 2EYSB 5C2BL 1H9VA 3IJSB 4G80B 4BJLA 3TYGL 4GS7C 2CJUH 3WE6A 2HVJA 4MHHG 1UXSB 4U6YB 1RK1A 5D7LB 3JUYA 5C09E 4NSKA 5DRNA 2R1WB 3LN4A 1YEHH 1U3YA 2X4UA 4GXVL 1WK0A 3I85A 3NZHL 3OB0K 4R8WH 1RIHL 1BVKB 4R7NA 4U7MA 4D8PA 2R1XB 5FUCE 5AZ2H 1TZGL 3FB5A 5IEKA 3UJIH 5I1CH 2D31A 5HDBF 1PZUB 2XG5A 4GMTH 4QXWA 1PVHA 5D2NE 4UOJA 3RVUC 1BAFL 2DBLH 4LKCA 2FIKA 2BHUA 5CIPB 4Y1AB 5LAXA 1F8TH 2FHCA 4MJ2A 1JF1A 4JKLA 3PWVA 2QADC 4YPJA 3SDDC 5LQBH 2E6JA 2J12B 1T66D 4NO0D 1NLDL 5FGCE 1I1FB 1DE4B 4RFOL 4XWOD 1F2XK 2W65B 3WNOA 1NH6A 5A16B 5CGYC 2H6PA 4XPTH 3TBYA 3SQOL 1S7QA 3ZE0F 4U6HA 2DQUL 4HXBL 2K9UA 5C08D 4J4PD 1D6EA 1LNUB 3BD5A 4PRHB 3TO2A 2Q87A 2BSRA 4AJ0A 5E2VL 4UOW0 1G7QB 1TCRB 4FQCL 4ONGH 2NW2B 3PWPB 3DOSA 1J1XL 3WXVL 4GRMA 3VD4A 1HYSD 2ICES 4JFEB 3RGVD 3BH8B 3BKMH 3ZDYE 4FXKB 5DFTA 3TCXA 3STZA 3QNZB 1MCNA 1UM5L 4YIQA 2B0SL 4OLWH 1F00I 3TO4B 4XP9H 3RAJL 5E2UH 2R9HC 4KVNH 5FGBA 3N50A 4UNUA 1QKZH 4XCFH 4EN3D 3V2AR 4G6AC 3HLAB 2Q8BH 4N0CC 5DYOB 3VGGA 4HDIA 2FX7H 3EGSA 2OZ4H 5J6HB 3UTTD 4OFYD 2FJFA 1KJ3L 1FL6A 4ZUWB 3V0VA 2J8UF 2XXCB 4HC1H 5GZOD 4TVPD 2F54B 5IVXA 3O9WB 1B0WA 5AYUL 5DD5L 5ITBL 4PLKC 3MJ7A 2CJUL 1YN7A 5C0JA 4KDWA 2VB5A 4PRPE 1IQWL 2OJZH 4XAKD 1YEHL 1JHKL 5D5MA 4KTYA 5ENWA 2OTWB 4R8WL 1UWEL 2EZ0C 3L3IB 3AY4C 4R4FH 3VWJB 4JFQA 5EO0B 5H2BB 3P2TA 1PYWB 2X4OB 1XMWA 4D9QE 1UCTA 3UJIL 4ZPVB 3U2SB 3S98A 5IV2B 4GMTL 4JJ5B 3QUXA 2X10A 3LZFH 1WBXA 5I30H 1JGLH 1FAKT 2ITDB 1K2DA 1NAMH 4N8CL 4JFXB 1RZ8B 3WJLC 1KYOK 1F8TL 3ARQA 3MXWL 5B38G 3QZWB 5INCA 5GZND 5I1AB 1S9YB 1H5BB 5LQBL 2WBWB 3QIUC 3HZKA 4P46C 3DV6B 4N8VG 4PG2A 4P99A 4XPTL 5LCVH 5F71A 2MKLC 4OQTL 3HNTH 4DOHB 3B8YA 2XKNB 3QO0B 5D1XB 3OKMA 1JYWA 3ECBB 4BFIA 3S5LA 1RJYB 3EYFA 1CLYL 2R0KH 4HUKB 4UDUA 5E03A 3U0WH 1A1MA 3EZ8A 4PIRF 5TE7L 3VXUB 3ARBB 1QYGL 3AREC 1FZMB 5J6GA 3FMGH 3PHSA 3BKML 1I3RA 1DN0B 3AB0B 4BZYA 4EBQH 4HIJB 3RDTD 3VFVB 1HOCA 3L3DA 4ZO8A 5CSZA 3EDKA 4MD4B 4M7LL 1N6VA 4LCYB 4YHOL 4IRJD 1BECA 4OLWL 5DA0B 4XP9L 1TJIH 1TVHB 2DI7A 5E2UL 5GRVL 3U79A 4YR6B 4KVNL 4TUKL 1QKZL 4XCFL 3TWCL 4XCEB 4P3DB 1L0YA 2Q8BL 2ADJA 3ZKXC 4I2XA 4KK6D 2FX7L 1VFBA 2OZ4L 3X17A 4OZIA 1V8HA 2RFXA 4HUWB 3I2CH 5ERWA 3TH4T 1G84A 4YHPB 5A2LH 5D2NC 5E9DA 3VWKA 1A6ZA 5J9PB 3ULVC 3JV4B 1A2YB 3GSNB 1U58A 1FO0B 3O4LB 2BY2A 4WDIB 5GGSY 3SGDI 5DRWA 2H2SC 2P5WB 3QDGE 1I7TB 3E6FA 4KUCF 3ZMRA 1K5NA 5D1ZB 2WIIA 3EYQD 5HI4D 5F96H 2W07A 2AV1B 3NFNA 2J5LB 4KK9D 4LEXL 1QRNA 3N1FC 3NN8B 2EE6A 4EI6B 1S8DB 3RRQA 2P7TB 4OGYH 4UUJB 4EUPB 3QWRA 1CD1A 4WV1C 1AO7D 4QRPD 4F9PA 1KJMB 3LZFL 2I07A 1YQVH 5I30L 3MGTB 1MCJA 4U1MA 1HI6A 1NAML 2P1YA 4PGCA 2FEDD 5D7LD 4JG1H 1BFTA 1EHNA 2ZZUT 1ZHNA 1OP3H 4NCC2 4YC2B 5IBLD 5DI8B 1BQHG 4PJGF 1MHEA 1B0RB 1CDBA 5K9QG 1FG9C 2PN5A 2IGFL 4TTDD 4RWHA 1YNTB 2JIXD 5ANME 3ZKND 3FB8B 2DB8A 2EDTA 1OOAA 3K1KC 5K59F 5DSCA 1NPUA 5TE4H 3V4PL 3ZYIA 1QFWI 5JO5A 2DF3A 3FHAA 5C0ND 4ORZC 1JN6B 2Z8SA 1ZLUK 1WQVT 2FWOA 1C5DA 2OS7A 4Y1AD 5JMRA 2E7BA 2R0KL 3F7QA 4MDIB 1CLOH 2GAZA 4HS8H 2NMSA 3IAGC 3MRPB 5JHDD 5IMMA 4P23A 3CLFH 1MAJA 1UZ6E 1WV7T 1JIBA 1MJUL 3ISWA 4MXVE 1LP9F 3RPKA 1XF5A 3VG9B 2BNRE 1KJVB 5I8OH 1T0NB 4RBPH 1TJIL 4I3SH 4EJ1C 4YWGH 4HUVB 5DJ6A 4NDMA 1J05A 4NKDA 3VXMA 2BNUB 4JREC 1PQZB 2C1PA 2FD6H 3PWPD 2ADGA 3MOQA 1UJ3A 1J10A 5KANG 4JFED 3I2CL 1Z5LB 4BSWA 3C5ZA 4L5FH 5JPMA 1MH5B 4IJ3B 3T0VA 2EYRA 5T3XE 4PJAA 1CBVL 2JJWA 3RL1A 4S2SA 4R90H 3NCCB 3O81A 4ZNEA 3IXTB 1QSVA 2MJWA 2BVOB 1FORH 4YNYB 4C54A 4CRPA 3MRBA 3GJEA 3OKLB 5C0GB 3DX8A 3L95A 3P9MB 5F96L 3RVTC 3MZTA 4LIQL 5B39A 1DBKH 4NQED 4K94C 4OFPA 3SGKA 3S8WA 3KPPA 1X7QA 3ULVH 5DO2C 4OGYL 4YXKL 4PB9L 4CNIB 4Y2DC 1AIFB 4KV5F 4PJXF 2DM7A 4X4YA 3O9WD 3QHFL 1XGTA 5KS9B 4U7SA 1TJHL 1P53A 4F2MB 1UA6H 1A6TA 4OT1H 3KWWB 1LWRA 2QTEA 1GGUA 3WHE0 3CPLA 1NFDE 4FXGA 2XN9B 3LCYA 1GVIA 4JDVA 4KJWD 3VWJD 4F7CB 4JPIB 5HHMD 1P84J 4NT6B 3QB7C 2JLLA 3TV3L 3NCBB 2ZP0T 2FGWL 3QAZC 4KPHL 3AS3A 3CU1A 4HUXA 1HIMH 1MCDA 3BE1H 1MCSA 4CL7A 5E70A 3GMMA 4HJGB 1P6FA 5FO7A 4HK0B 5HGAA 2QHRL 4IHOA 1CWVA 3LQAH 3PDOB 2J88H 4LF3B 3PWLA 2IFGA 1AGEA 1FJ1B 3KNBB 4M6NH 5GJTH 4OFKA 4FQIH 1CLOL 1KNOA 4HS8L 1BJ1H 1RZFH 5IB1B 2ENSA 3UAJC 1JRHH 1A0QL 2EE2A 4MGXA 4LEOB 4ELMA 3EYVA 4PJCB 4JY6A 1AP2B 3MODH 4I0PD 1U92B 4G42B 4UT9H 1IL1A 2E7HA 4NQVA 5SX5H 4OZGF 2VLRB 1ZGLA 3BDXA 4PLOB 2XICA 4WNQA 4ZMAT 5IWLA 4CU7A 4YWGL 3SDAC 2BSTB 1FVEB 3RNQA 4S1SH 2LU4A 3EYSH 4OI7A 4JHWH 5I2IA 2E27H 3VI4E 1R24A 3BP6A 1TQBB 2FD6L 1N3NB 1Y6NR 4UNVA 5CZXC 3KPRE 3NZ8A 3VXUD 3ARBD 4LFHD 1YPZE 3HG1A 3X11B 1U36A 5K9JH 4L5FL 5E8EB 3DI3B 3AGVA 1KYOJ 2WANA 4L8DB 3QRFM 1RUKL 4U1JB 5IF0B 3QEUB 4R90L 1LILA 2OR8A 1BD2B 2ICWA 1XCTA 1F02I 5JXAL 1QSFD 2DQIH 2H45A 2YUWA 5HPOA 1VGKB 5I15L 4CMHC 1XGQB 3BFOA 1FVDB 4C83A 3UZEA 2IPUK 3VJ6B 2NZIA 4PJEE 1DBKL 4FQ1H 4WWID 1K3ZA 5J8OA 4OZFB 3V7AE 4HF5H 3ULVL 3BEVB 2FLRT 5IM7A 1ZSDB 3MLTB 1X5KA 4HH9A 4HKXB 4J2XA 5C0BE 3N9GH 3EOAA 2HTLD 5TQ2L 1CE1L 3IDIB 2AJ3A 3O4LD 5FOBA 1V7MH 1NGYB 5ALCL 2P5WD 4K94H 3SE4C 3T1WA 2AQ2A 1UA6L 5DJDB 3S35L 4IIQC 5D1ZD 4D2NA 4PY8J 4R97B 3P4MA 5J1AA 5EBMA 5E8PA 3NIGF 5SWSB 3KYNA 1T66C 4YK4C 3RL2B 4EDXB 3C6LB 4XWOC 5L2KD 4K2UH 4F57L 1YEEH 2P5EB 1RJCA 1CDIA 4PGDB 4NZUH 4WFED 5BS0A 1L6XA 2RGSA 4L3EE 1WTGT 4L4TA 3SJVA 2J8HA 4ZTOH 2GJZA 3DRTB 3BE1L 2Z8WC 1LEIA 4C56A 4HH8A 4C4KT 2QSQA 4HLJA 1YY8A 1CK0H 4L8SB 4X9BA 5BOPA 2IG2H 2V2TB 1MJJA 1DQJA 2J88L 3OSKA 3IFPA 4M6NL 1ACYH 5GJTL 1AGFB 2VYRE 4FQIL 4AENA 4M03A 3RI5F 2KZ1B 3VH8B 1S7RA 1NGWB 3RGVC 4LLQA 1I8IA 4MSWB 1JRHL 2CKBH 3IJYA 3ZSSA 1H3VA 1JWMB 1P7QA 3MODL 4QCIA 4NRZA 5KVFH 1FL5A 1OAUH 1R5WA 4ZOBA 4MX7A 5ID1B 2VQ1A 4KXZI 1ZLSH 4L3AA 4KROB 3B6SB 25C8H 5DD6B 4KKNA 4X4XB 3B9KA 3QIBB 1A1NA 2L7JA 2BXYA 1A7RH 4ENEC 5MENE 4S1SL 3IETB 4JHWL 1G7JA 2E27L 1WZ1H 2WBKA 4PG9B 4XCCH 1LEGA 2XTJB 1L9MA 1SYSA 4RDQF 2HFTA 1VCAA 1AXTH 1D9KD 3QWOA 3DO7B 4FQPA 1YMMA 2I9LB 4NO5B 5IHBA 3BGMA 1MSPA 5GJSH 5MEPB 3JWDC 3FQNA 2Z92B 2DLGA 4DKEL 4BZ1L 4LHUG 2VR4A 3IFNH 1NGZB 4KKLC 4ZTPL 4OFVA 1FFPA 4NFDA 4PRHE 5IROA 4LLWB 4G9FA 3K74B 3BP7A 4HF5L 3C5SB 1UKSA 3AVEA 3LHPL 1A5FH 2YHGA 3QA3A 3ARGC 3VRIA 1XR8B 3BKCH 1RZKC 2X1QA 3N9GL 2DKUA 2V5TA 4KK8D 15C8H 3QUYD 4GBXB 2UZIH 4JN2B 4HLZG 3VXTA 1V7ML 1LO2H 4Q9QL 4K94L 3LKRA 1P5UA 4WWKC 4QF1B 4XNMA 32C2A 5HHVL 1U91B 4JPVH 5GZNC 4IMKC 1X5YA 1YEDA 2R2BA 3BZEA 5GSVB 4JAMA 5DZOA 2AEWA 1CFQB 5HVHC 1MFCH 1QEWB 3GSOB 4NZUL 5BW7A 3P40A 4RMTA 3F7RA 4W6WB 4PP1C 4YDKH 1CZ8H 2F54E 4KTEL 4JHAH 2JTDA 4ONHA 1VPOL 4ZTOL 4AMKL 2G5BB 2WW8A 2VE6B 1ZLVH 4WI7A 1XZ0B 4YGAB 3WS6C 1L7IL 4FTVB 4Z7NF 3DV4A 3UTQB 2XRAL 1Q9LA 5BV7C 5DVMA 5IR1A 4WVRA 4LHUA 5JLZB 3LEVL 3MCKA 3QG7H 4P2QD 3UZQA 2XN9D 2VABA 1HXMA 5D9SB 5C0AE 1RAMA 1KPVA 3LRSA 1FE8H 2F74B 4L8CA 1ONQA 3EO1A 3QDJA 5E1AA 5D93C 2Y5EA 2A6JA 1F3RB 2BDNH 2C7UA 2QQNH 2VKWA 5EU4B 5KVFL 3RWCB 1OAUL 1M6OA 5B8CB 1BBDH 1ND0B 5HI5D 4NCC1 4LCIH 3OR6A 4E41B 25C8L 1YUHB 3V5DA 2Z91A 3BX7C 3FN3A 3MOBL 2FZ3A 4P59H 4FQJH 1A7RL 2QKIB 4BZ2H 1CIDA 4N90D 4K8RC 1G0DA 4CW1A 4DK3A 3V0AC 3ZTJG 2GJ6A 1WZ1L 4LPTA 4ZFFA 1RZIB 2YOCA 4QXTB 5H35B 1HN1A 1S9WA 3S37X 4MAYA 3MRHA 4XGZA 1IM9B 1AXTL 4YE4L 1JZ5A 1RZJC 3X3FH 4YX2H 3UBXA 5IVXF 3BT2H 4JFOA 1XCQA 1FYTA 4X5WB 2Q7YA 5GJSL 1BFVH 2VLRD 3MNZA 2W91A 4OZ4B 3QUMB 1FZJB 3RWDA 1KIRB 3B3IA 1I7ZB 3QHTC 4OGXH 3WHE1 4UQ3B 3BP4A 3IFNL 2GT9B 2LTQC 2NLJB 3P0VH 3IKCA 1K3IA 1UKQA 4XVTL 5CZVH 4M6OH 5I17B 4TVPH 3WD5L 4WEBL 4P4RB 1U8KA 1OAQH 2PR4H 2UWEE 1JPGA 4MXQC 1FSKC 3BPOB 3IJHA 1A5FL 1A9BB 1QFWM 4JKWA 2A9MH 2VN4A 4MDJA 1MRDL 2FEEL 2AQ1A 3ZZ1A 1H8OA 5ILTH 3GSQA 2NX5B 4QRRB 4WI6A 4WFHE 1BD2D 1IAOA 2AV7B 4XP1H 5GSRA 3L3OA 4PJBE 1LO2L 2HN7B 1WISA 4N8VB 2D7QA 1DR9A 4UB0H 4N0UB 3IS0X 2HVKB 4PJFA 3GSVB 4QHUA 4H1LH 2IBGA 3MR9A 1A3QA 1JMZA 4TTDC 1XF1A 1QVOA 4UT6H 3TF7C 4NGHH 1KBGH 4JKPL 3V0WH 1H8NA 3MV9D 4OF6A 2H8PB 1A02N 1MFCL 2KQMA 1CZ8L 2Z31A 1XGRB 5DJYB 4JHAL 2BMKA 1W0WA 3QP3A 5KW9L 2UYLB 2G9HA 4KXZH 4NNYB 4NO3B 2FJGB 3E8UH 3GRWA 1BJMA 4POUB 1KT2B 4GW4B 3EUUA 5FUZL 1NCAH 1UB5A 1CGXA 3NFPB 2IBZX 5SWSD 3BIKB 4WI4A 2BVUA 2VDLL 5D2LB 5F9WC 1T5WA 2MKWA 1RUQH 2XZQH 1LK2A 1TLKA 2QQNL 3QNYB 4XNZC 3I3BA 3HE6A 4LCIL 1PBYA 5IHUH 4FQJL 5HYSA 5T3XL 2AXHA 4MA8H 3T0EE 5L8KB 1OF2B 4LVHC 3MA9H 4D0DB 4OZIF 1PKQB 1XGUB 1OWWA 2DJSA 3Q48A 2IAMA 4XMKL 4JM2A 2EC8A 2UVFA 2JB6A 2FHBA 1CGYA 1MJ8H 2BX5A 3X3FL 4MQXD 3BT2L 5T3ZE 2EDQA 5DJXA 4YXLL 3TO4C 3FRPG 1BFVL 5ALBH 1MCOH 3KLAB 3KJ4C 4ZO7A 3MV8A 2EC9T 3C8KB 4NC1E 4WCYH 4UBDC 2XWTA 3DVIA 3MXVH 4GW5A 3CNKA 4F58H 3TVMA 4JFDB 3P0VL 5KSBE 2AVGA 1A6AB 4YHML 1T22B 5CZVL 2JF1A 1ZT1B 1DVFC 1RZJH 4OZHE 4W81A 5HGDB 2PR4L 4U05A 1GPOL 3JWDL 1HSAA 1A6UL 2EH8L 4GUPB 4P9HC 5HXMA 5J13B 5IFJB 4RX4D 1BQHB 1DZBA 3SKNA 2OMNA 3S9DB 4HKJB 2VQUA 2A9ML 1SBSH 2PYEB 1V3KA 1YY9D 5IIEB 4G8EB 4HIXL 2FECL 2JCCE 1HWHB 3F62A 4F8TA 2W92A 2FB4H 4UB0L 1G1YA 5DDHA 5ELIA 4M6MH 2AEQH 1UB6A 3MA7B 4KJWC 2DQEH 3VWJC 5HGGS 4UT6L 5IMLB 4Z0BH 1RZKL 3KJ6H 4NGHL 3O0RL 2YMXH 1T1WA 1KBGL 3V0WL 2LABA 3VGDA 2V17H 1JZ3A 4OKDA 2ARJB 1WCBA 3U1SH 2NW3B 4PJ9A 3NIFE 4RAUA 5IHZB 7FABH 1AY1L 1Q0XH 1BJ8A 3QJHA 5CFHA 1PZ5A 1BBJB 5IEHB 5B3NA 1EUUA 2BSSA 3E8UL 1P7HL 3QXDB 2VDMH 4G8GA 5DC0A 2AAVA 4Z7WA 4PJ5D 2EICA 4NKMB 1BZ9B 1MVUA 3UTSE 2IQ9H 2VAAB 5D7JB 1OWRM 4HG4J 3FAXA 4D9RE 3TA3A 5DHVB 4EQ2A 1CQYA 4XP4H 4HPYH 3U7YL 3DVNB 4PD4J 3PQYA 4X9IA 5CIPH 4S1QL 1RUQL 4MQTB 5BXFA 5TDNA 2BCKA 5D1XC 2D03H 5D96B 5DQDH 4CU6A 5KS9E 5B22A 1JI2A 1EERB 4JY4A 3FHQA 4FTVD 4GXUN 3QUKB 3W5NA 1KIQB 3WLBB 3ILPA 1OP5K 4Z95L 1CF8L 1Z0NA 3VA2C 4QTHB 4WW1A 1EAPA 1UT9A 2VDNL 1URLA 3HI6H 1HH6A 4LKXA 1GOGA 2DLTA 1R3KA 3ARBC 2R4RH 3HZVA 3IU4H 3B2VH 3IDNA 3DIFA 3FOLA 2NYYD 3QXAA 3WIHA 3AB0C 2JK5A 4QOKE 3GO1H 3X12A 5KZCB 1MFEH 4N0FA 1M71A 4O2EB 1T5XB 4RIRA 1ZT7A 3CFDB 5ALBL 1MCOL 3DURA 4K8RL 2DRUA 4E41D 4OV5A 4WCYL 3MXVL 3TIDA 5LBSH 4F58L 2D7OA 1ZA6A 3PIQA 1QP1A 5I1HH 3RZCB 3ARUA 2AKRB 1RZJL 3MOAH 3GSRA 1S7TB 5KSUA 2DN7A 2C9AA 1KJ2A 5EPMA 2C3HA 1D5BA 4AIOA 5M95B 2SEBA 1IM9D 5AUMB 1LO5B 3O8XA 4I77L 5E2JA 4Q6YA 3SE3A 1SBSL 5A2IH 5JZ7D 4WW2B 4PJCE 2VDKH 4GRWB 1W2KT 4JFPA 1QACA 3WNLA 3TLRA 1XH3B 4NPYB 5D1ZC 2FB4L 2KDGA 2X42A 3WIFB 3GJFK 2J5LC 3VFWB 4LSTH 4DKAA 5JDSA 4M6ML 2AEQL 4K55A 1KOAA 4D94A 2WINA 2DQEL 4P9MH 3KJ6L 5GGSA 2YMXL 1HQRA 3IU3A 3FQRA 3MJ8A 5DD3H 3LDBB 2IFFH 2IANB 1KPRA 1R5IB 2V17L 3FCTB 5ESAA 3ZKMC 3MUHL 2ITCB 1F42A 7FABL 5F88A 1Q0XL 1QG3A 2J6EH 4FP8L 4G43B 3ZDZF 5FECA 1A14H 3DUHA 4YC2C 3W39A 2XNAB 5EZIH 2YA2A 3TPUA 1B3JA 4Y5XA 1OAXH 2CGRH 4PLNC 2BVTA 2FO4A 2IQ9L 3D39B 3FB7B 3SO5A 4QY8B 2D0FA 4L3CB 3LS4L 5F7YC 2EEDA 5KN5A 3BXNB 2EXWD 3HUJA 2VDQH 1A1OB 4YDLB 4LCWA 4NC1C 2X1PA 2D03L