3NJLA

D116a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis, at ph7.5
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
b'QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPAPQIINRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njlA00
5F7AA 1E30A 3IE9A 4QLWA 5I6LA 2BW5A 1GR7A 3JT2A 2VSMB 1NIDA 2AFNA 1AZCA 3NP3A 3FU7B 2AVFA 4HHWA 4YSCA 3AG2B 4ZK8A 1SDDA 4DP7X 1SFDA 1E65A 1AIZA 1L9OA 1JZJA 3IN0A 1WS7A 1J9TA 5I6MA 2YAQA 3QQXA 1NWOA 4JKNA 4KNUA 2HX8A 4E9RA 2VM4A 1TKWA 2JKWA 2OCCB 1OE1A 3MBWB 4GP5B 4BK5C 2VM3A 2A3TA 6PCYA 4GYBA 4HIPA 1V10A 5ANHA 1WAEA 1NZRA 3SBRA 4DPCX 1CYXA 1ET7A 2VMJA 2DWSA 1CC3A 2CUAA 2QPDB 2JXMA 3NT0A 3X1GA 2WSDA 5B1JC 1BQ5A 1BXAA 3PXLA 1AZUA 4UF7C 2TSBA 3QJQB 1XB3A 3ASOB 1A3ZA 3AW5A 3T6WA 3NSFA 6PAZA 1NWPA 4A2GA 1MZZA 3ABMB 3FQ2A 1JOIA 4A66A 4BXSV 2UXTA 2XWZA 2IDQA 1CYWA 2IDSA 2BZ7A 4DP5X 1ZDQA 4AZUA 3CVDA 2CAKA 3FQYA 3N2JA 1AG6A 4HCFA 2X88A 2DY2A 4YSUA 1L9SA 2J55A 3PAVA 3ZIYA 4AKQA 1E67A 1X9UA 2XU9A 1OE3A 1BQKA 3AG4B 2QDWA 2FQDA 1IC0A 3X1EA 2PP7A 1N68A 2IWEA 2BP0A 1KDIA 1QNIA 4BXVA 3PAZA 1BQRA 1CURA 3FSVA 2XX1A 1SDDB 2PCYA 2R7EB 3U25A 3WNJA 3NSDA 3L45A 3NJJA 1NIEA 2FT7A 1IUZA 2FTAA 1EZLA 3EF4A 2OJ1A 2ZOOA 4CSPA 1CUOA 4K9JA 4DP9X 4E9WA 1J5CA 1GS8A 5A7EA 2J57A 3S3CB 4HCIA 2J56A 4UANA 1OF0A 1GY2A 2IAAC 1SF3A 4KO6A 4KNTA 2EIMB 1A8ZA 1JZEA 1FA4A 1TEFA 4BWWA 1ZDSA 2HZHA 1I53A 2HLEB 3ZDWA 4DP2X 1SHWA 2IDTA 2XXFA 2Y69B 1ETJA 5I5MA 3WI9A 5IY5B 2DYRB 4YSTA 2DYSB 3IBOA 2I85A 1JZIA 1SNRA 3NJHA 3T9WA 1E5YA 1URIA 1V54B 1WA0X 4UAHA 4G70B 3QJSB 5B7EA 1JERA 2OV0A 3NJIA 3AG3B 4KOCA 2AZUA 5PAZA 5I26A 1NICA 1JXFA 2IWFA 3SBQA 4G7QB 4PCYA 3IEAA 7PCYA 3T71A 4YSQA 2PPCA 2FQGA 3AZUA 1AS7A 2PPEA 4A2HA 1FWXA 1EHKB 2GC4C 4AI7A 1BXUA 4YSEA 3UAEA 3V9EA 3GYRA 4KOBA 1AZRA 1F56A 4FA7B 5TK4A 1MZYA 5I6PA 1OE2A 1J9RA 3FPYA 3UGEA 2XVBA 5I28A 4YSPA 1MDAA 1DYZA 7PAZA 1SHXA 1ID2A 4HZ1A 3IN2A 1OCOB 1W6WA 4PAZA 1ASPA 1SFHA 2Q9OA 2VN3A 2XV2A 3BVDB 4P5SA 1PMYA 2P80A 1M9WA 2YXVA 4E9TA 1BAWA 1WA2X 2PP8A 3AG1B 3S8FB 2WO2B 1VLXA 4A2FA 4BDVB 3KW8A 3GDCA 2HX7A 3JTBA 4F2EA 3OMIB 4P5RA 3T6ZA 3WKQA 1GY1A 1V55B 1NIBA 2UXVA 3T6XA 2HXAA 4DP1X 2WO3B 9PCYA 3PAUA 4A67A 1AS8A 1IBYA 3TBCA 3X2QB 2YAEA 2XLLA 3BQVA 4G7SB 1R1CA 3DTUB 2BHFA 2HX9A 2GC7C 3S3DB 4G7RB 3CDZA 1YLBB 1GS7A 3CG8A 1AAJA 2HRGA 3AY2A 1ADWA 3MX0B 2GHZA 3FYEB 1JVLA 1A65A 1HAUA 2AANA 1KGYE 3TASA 3ABLB 2CCWA 3ASNB 3UAAA 2YQBA 2FT6A 1L9PA 1JVOA 2XX0A 1TU2A 2VW4A 1KBWA 3DKHA 2BP8B 3QJTB 3X1FA 1BEXA 3C75A 2FWLB 3TBBA 1PAZA 3OQRA 4AKOA 4E9YA 3TA4D 5B3SB 5I6OA 1PF3A 4A2DA 4HHGA 5EHFA 4E9QA 2IWKA 1OCZB 1AR1B 2FT8A 2XYBA 3FU7A 2CBPA 3EH5B 4Q8BA 5I6KA 3UABA 1KDJA 2QDVA 2JFCA 3FSZA 2DV6A 1AG0A 4N4YB 4N8UA 2FQEA 2XV0A 5TK2A 1T5KA 1IKOP 3QJUB 1KCBA 2MTAA 2YAOA 2EIKB 2ZONA 2I7OA 4HALA 1SF5A 3QJRB 3ERXA 3NSYA 5F7BA 3ZBMA 3EH3B 5AZUA 1BYPA 3DIVA 1B3IA 2PLTA 3NYKA 1PNDA 1OCCB 2CALA 1AZBA 3QPKA 3FT0A 2IDUA 1QLEB 5B1AB 2XXGA 2GB2A 2DWTA 3SQRA 3PLYA 3KW7A 1GYCA 4KO7A 1ET8A 3EH4B 4YVNA 1NPJA 4W9ZA 2VSKB 5D4HA 2XUWA 5B1BB 3NSCA 4YSRA 2PCFA 2IH9A 1L9TA 3ABGA 4DP8X 2BWDA 4G72B 1GSKA 1JZGA 4HCGA 4M4RB 3H4FA 2PPFA 2YAFA 1J5DA 1ILUA 3FSAA 3NJLA 2YAMA 2EILB 2N0MA 2BZCA 5D4JA 1M56B 4E9XA 3RYMA 4A68A 3PPSA 4DP4X 4DPAX 2YXWA 1WA1X 2H5UA 2BP0B 1XMEB 3X1NA 3V9CA 3WG7B 3S3BB 1ZIAA 1XB8A 2H47C 5I6NA 4F7KA 1L9RA 1JZFA 2PPAA 3ZX1A 3CVBA 3OMAB 3FS9A 2W88A 1ILSA 1ZIBA 2R7EA 3NJMA 4GY4A 2H3XC 1PZAA 4JHUA 2YAHA 4RH4A 4DP6X 5AFAA 1MG2C 2YARA 2FQFA 3GXUB 1BYOA 1W8EA 1WS8A 4ENZA 5AKRA 4WTQA 2Y1AA 2W8CA 1GS6X 1MG3C 1KCWA 1ASOA 2EIJB 2PP9A 1NIFA 1OOWA 3T6VA 4YSAA 1TEGA 3OM3B 4X4KA 3WIAA 4KO5A 5I5IA 3WNIA 5E9NA 1SJMA 1FFTB 2J5WA 4G71B 4YSOA 3FPXA 2UXGA 4EF3A 2EINB 1AANA 2ZWNA 2ZXWB 1A4AA 1OCRB 1L9QA 1KYAA 1NIAA 1ET5A 3UADA 3S8GB 3CVCA 2GSMB 1A4BA 1AACA 2B3IA 2BWIA 5D4IA 4DPBX 4HAKA 2YAPA 1AS6A 4QKTA 3TU6A 4YSSA 3FQ1A 1RKRA 4BWUA 1AQ8A 1RZQA 5LDUA 1DZ0A 5I5JA 4E9VA 2VW7A 4YSDA 2GBAA 1HAWA 3FU9A 4GP8B 4GP4B 1RZPA 1NINA 3OD3A 1PLAA 2RACA 2UXFA 4AX3A 5FC9A 1IBZA 2IH8A 2LLNA 3NJFA 4L0PB 1JZHA 2P80D 2XV3A 3EHBB 4F2FA 3UACA 3X1BA 2Q5BA 8PAZA 4YVUA 4DP0X 4E9SA 4AKPA 4Q89A 4WKXA 3QJVB 2I7SA 3H4HA 1JXDA 1W6LA 4FAAB 3FU8A 1RCYA 2X87A 2UX7A 2GI0A 1XB6A 3OMNB 2TSAA 1KBVA 1PCSA 3G5WA 2FJSA 5PCYA 3PCYA 4KO9A 1ASQA 3HEIB 2MRYA 3FYIB 4BDVA 1N70A 1PLCA 1ZPUA 1PZCA 1AZNA 4CSZA 1JXGA 1NDTA 4W1TA 4TXVB 3NJGA 2BW4A 4NB7A 4JHVA 2UX6A 4NAJA 2CJ3A 3FSWA 3N55A 1GW0A 3SBPA 3CDZB 3H56A 4A2EA 2QPEB 1QHQA 2BO0A 3D12B 5B1JA 1BXVA 2FNWA 2PPDA 3HB3B 4M3HA 4YL4A 1A4CA 1HFUA 2B08A 1UATA 3ABKB 4NERA 2AZAA 1OV8A 4BWTA 3NP4A 1M57B 2VW6A 4MFHA 1E5ZA 3WKPA 3NJNA 1NTDA 2IDFA 1X9RA 4KNSA 1PZBA 4GXFA 2E86A 1ZV2A 1PNCA 1PY0A 5B1KA 5B7FA 1KV7A 2HRHA 1J9SA 1J9QA 2BP8A 2QT6A 1PLBA 2GIMA 2NRDA 1AOZA 1NPNA 5B7MA 3CZUB 3NJKA
chains in the Genus database with same CATH superfamily
1Q9KA 4BHUI 3EO1B 2I9LA 2LV4A 4ATWA 3OLIA 5FO8B 3BGMA 3GTTA 4M5SA 5IREA 3K71A 3LXCA 1PD0A 1AZCA 5HGBA 1UD3A 3OHXC 4GRWH 4FFZL 2ZWLT 2ZXGA 4DP7X 2AI0H 3KL0A 2FLRT 4L3CB 2ESVA 4ZFOL 1U42A 3GI9L 2F1EA 3ISYA 3IJ7A 1U58B 2HPTA 3P11L 4PJ8D 1IBHA 1HKLH 4NWUL 4KKZA 3BN9D 4JHAH 3Q6FA 3GEFA 3WMQA 3SDCB 5H2BA 5D96B 5TH2B 3ZZ1A 3SPVA 5ERWA 3ARBC 4FTVA 1NAMA 3MCG1 3N9GL 4OQTH 4N5EC 5FYLD 1VGEH 5F88B 4G5AA 4KQ4L 5HI4D 2H2SC 4QIRA 3VXQA 3UPAA 1NBVH 2H3NA 2BZDA 4N1CA 2F19L 2N1TE 4R90H 5C3TA 4X4YA 1BQ5A 4UM9B 4FLQA 1AZUA 4L23A 2F74A 1X7SA 4UF7C 4BK4A 5AYTA 3QUYC 5F7DA 3LEXB 1B0GA 3AABA 4JG9A 2WUCL 5BUGA 5J06A 1RL1A 2APFA 2DQDL 3BUDA 2LOEA 1AQ8A 2VDLB 2X9ZA 3N1PC 2N0KA 5E4EB 2TAAA 1I1AB 2Y7QA 2XWZA 4Z95H 1DUYB 5T5NF 5EU7C 1MNUH 2BNQA 1JWMA 4L29A 4DP5X 4AZUA 2ADIB 1XR9A 1HNFA 1ZT4A 4Z76A 4PG9A 3SGDI 5AG8A 5IKCA 3D0LA 4NO2B 4J3WA 3WD5L 1IARB 5C7XH 5IB2B 3VI4E 3VFRB 3VB9A 1WICA 4X4ME 3I3DA 4R3SB 3ZIYA 4HWBL 4ZFZA 4HKBA 3VXNB 4XI5C 2VZOA 4LF3A 2E8YA 5MEPA 1FYHB 3V6FB 1QYGH 2XBZA 4JFDE 1UWGH 1PDKA 3ZGHA 2CJSA 5EO9A 4ZTPL 4P2QB 3UTTD 4XO4A 5HSFA 2BFVH 4OTXH 1AQKH 5DURD 1X5FA 3ESVF 3RVTD 3OJVC 4KI1A 3UMNA 3MROA 3SBWC 4HFUL 4D8PB 5I24A 4I88A 5C86A 4ODWA 1BOYA 1UHVA 3I6KB 4FQLL 1N10A 3KPSB 3L1GA 3I9AA 3MRDA 1W9XA 2BFGA 4J4PC 3GSNL 3O0LA 1KCKA 3H42L 2V2WB 1YEJH 3HN8A 4RNRA 4KTDH 2L3BA 2J8UF 3C2AH 4OCYH 5DQDH 4EUPG 1J8SA 3FQUB 3PNWA 2YHGA 2DRUA 1IM9D 1BFVH 5I19H 5D6DA 2VN7A 1U91B 3K1KC 3HE7A 2Y5QA 5DD0H 4DGYL 4U49A 2P47B 1I9RH 1RU9H 3IBOA 3KDMB 1IQDA 5B1CA 3ATBA 1DSFH 5DTFA 4B9ZA 4EZLA 4GRWF 1MJUL 4NC0B 1DBKH 4NJ9L 2BIQA 3HC3H 5BZWB 4WI8A 4O9HL 2P3YA 2QQKL 1IL1B 3CPLB 4JKPL 2AZUA 5GGVH 3S9DB 3HZMA 5E9AA 3SBQA 2J1KA 1DBJH 4GW5B 4N26A 4OVUA 3V0VB 4JN1H 2X4RB 4K5LA 5EEYA 5CU9A 1KCRH 4KZDH 4HIJA 5GZNA 1UH2A 4JDTH 1FP5A 2EICA 1KTLA 1RZIA 4KFMA 4M1DH 5I16A 4M8QB 3HG4A 1SYVB 2W1NA 5TGBA 3V9EA 3S4SA 1J9CT 1C7TA 4Q9QL 1S7RB 5LN4A 4PGJA 2CK0L 3UJJH 1TEYA 4NNPL 2V17H 5DSCB 5TE4H 4KK9D 1R46A 4CNIA 2YR3A 5TE7L 4BQ9A 1ZHKA 1TJXA 5HHPB 1U3JA 3GS4A 5F9JA 3GWJA 3W0WA 1OEZW 2D9QB 3X3FH 3LQAL 4G42B 4X6FB 3ME0A 5ECGA 1R3JA 4IYKA 3MKGA 5A2FA 2VR5A 5IV2B 2X10A 1PZ3A 1RHFA 2FIKA 2JF1A 2OQJA 3LKPA 1DVZA 3IJHA 2C3HA 4BJLA 3OKMB 4ERSH 1QRNB 3IJYA 4PV8A 5FA4A 2QFPA 4HBQA 5C0IB 1KLGB 4BZ1L 1KTDB 3BQUA 1X3DA 1KGJA 3PPEA 4JRYB 1SJEA 4OIIL 3RAJH 3BQVA 4PJHB 2FB4H 5FDWB 2BHFA 1WAPA 3GT6A 5HYSB 4F15C 1GS7A 5BO0D 3WN5C 1Q1PA 5D7KE 4QXGH 4EQ2A 2IH3A 2ZCHL 2P5WE 1JVLA 4RMQA 3KAAA 4CL7A 3PAYA 3DNKA 4JQVA 3PQYE 3CZSA 3RGVD 4FQQB 4TQPA 4JE4B 4QHNB 4XO5A 1EVTC 2QGCA 2VM9A 2OW6A 1T0MB 2WVVB 3PJNA 2PCXA 1CCZA 2NY3B 1QSFA 2CKNA 3D05A 5DHYB 4JFDD 3BIBX 2AEQH 3L4YA 4LU5L 3CLFH 3T77A 3TNMA 3B1UA 5ITFA 3D39D 4N8PA 2RGSA 2AXHA 4Z77B 4ZSOE 5K9JH 1D3CA 2VDOB 3EYVA 1YPZA 3MREA 1OAJA 1OCZB 1ZA3B 2HLAA 4HISA 1U8KA 1WZKA 3DYOA 3QW9A 3QEHB 5C9JB 2DKSA 5T8IA 2WAHA 2CLRA 2QVIA 3TO4C 1MRFL 5DZPA 5GGSA 4N1EA 2YD9A 3QNXB 4IIZA 2MTAA 3CGTA 1E4JA 1M7XA 3MV01 4IEFA 2FD6L 2ZONA 1ZS8A 4KDWA 3T0EB 1UM5L 1A7QL 1NC4B 2A9NH 2CLZA 3NSYA 1T04A 4HC1L 1EJ6A 4HFWA 1BVKB 4OF8A 3VE0B 4PJEA 2NQCA 4EOWH 2AW2A 4RA0C 1BMWA 3L4XA 3QXTA 2ZAIA 4OZ4B 3DIDA 4K07A 5F3BA 3DDGA 2RFXB 1AQDA 1V7NH 3EYUL 4GG8A 2EP6A 3QISA 4BA8A 3VFSB 2XFXA 5DLMH 5M95B 3QRLA 2NX5A 5DJXA 3G04A 1CDGA 4MMZA 5FGSA 3EH4B 1CXLA 3JTTB 4JPQA 3ZDXB 5JXEC 1HHHA 1KC5L 2WWNA 1Q9LA 4I0PA 2KH2B 5CZXC 1DQQB 1QSEB 2QJDA 5CJ8A 3FTUA 1JZGA 3QFJB 2PTVA 1UKSA 1G7HA 3MFGB 1OCWH 5E2UH 4AYID 3ZO0A 2V2XA 1ADQH 4RGMB 4ZTEA 5CJOL 1NUNB 1ED3A 4FL4C 4LNVA 1TNMA 3MBED 5L2KB 1KFAH 5D4JA 3B2PA 2FL5A 3CSGA 1UJ3A 1FCGA 2ZG3A 1FSKB 3S34L 2F7PA 4A68A 3SPCA 4KGLA 1NGXB 3LDBB 3Q9PA 3HG1B 4WNQA 4ZG1A 1I9JH 3MLWH 4JQIH 5E95B 4Z3GA 3KPMB 2MQGA 3FCTA 5EZOH 3BE1H 4LLDB 5AVQB 4IJTA 5LCVA 4NWTH 5I1CL 1BP3B 2DLEA 2ZOTA 4E41A 2PWDA 3CVBA 5IQ9B 1G7LA 4OY9A 3RIFK 4AYBA 3A6BH 3IDXH 3IFPB 3OQ3B 1ZIBA 2NY6D 3IS1X 3V6ZB 1ZOXA 3HI6H 2R0KL 4X4ZA 1K5NA 2PO6B 4LASL 1DVFD 4RFEA 5F72S 2WZ6A 1JFQL 4AL8H 3DXAB 3O4LE 2YARA 4BZ2L 3IPBA 1ZTXL 1U8IB 4PRIB 2ZPKL 2NXYC 3S37X 4I3SL 3NK4A 4IU3B 3FUNA 5F6HI 3V5DB 2ZKYA 3WDHA 5KOMC 1QWUA 1NCGA 3MCLH 4LGPB 3UBHA 1HCFX 4X98A 3LCYA 1A6AA 4HUVB 2CDGB 5EIIA 5K69A 1CK0L 1X5XA 3WU1A 2O93L 3FPXA 2JV6A 2P8MB 4U2ZA 1V3JA 2K9FB 3VXME 5KVGL 2ZF8A 3A4AA 2IPUK 3CH1B 3VXUD 5JXAL 3SCMB 1FZOB 5GGRA 5D72H 5JOFA 3BLPX 4XCFH 5T1MB 3N43F 3D3VD 1UWXK 2H1LM 2NT0A 1G7IA 3QNYB 3GXNA 2DQCL 1FNLA 1RUAH 5DRNB 4DK5A 2GITA 2Z93A 4JDZA 4QKTA 5AEAA 3FQ1A 1K8DB 4ELMA 2AK4A 1OAYH 1MUJB 3AS1A 3HUJF 2ZSVA 4XN4A 1FAIH 3Q2WA 1ZVSB 3QARA 1OM3H 4DSYA 1KB5B 1OAXH 3JWOL 2X4OA 4PJAB 5DD1L 3P2BA 4DIXA 1HZHL 5L6YL 4QD2E 4XP6H 2CXKA 1T3FB 5C0GB 4MB4A 2C9RA 1XGZA 2IADA 1EVUA 1J8HD 3CHRA 1E4WH 2V9UA 4Y2DB 3IAPA 5J12C 3U7AA 2OMUA 1JV5A 2OI9C 3RWHB 3C5ZA 2I7SA 1KWGA 3WIHL 2ZKMX 5CP7A 1VB9A 1IAOB 4LSVH 4GG6B 2Y6SC 1EH9A 4HKZA 4WI7A 3OMNB 3E6FA 3KPSE 3T0VA 4EJ1C 4WHYH 4RIRB 2HLFD 4EZKA 3RHWK 1BQHG 2H0EA 2IC2A 2W95A 3GSQB 1AIFA 2HKFL 3SKOA 3F00A 2A6KA 2QGDA 3GHBL 3KLSA 1I8KB 4LARH 3LIZH 1IFRA 1QUNA 1ZPUA 3APCA 2XG5A 5DDHA 3K6SA 3VI4F 2EKSB 1DUZA 1UB5A 3DTXB 3O41A 1GHFL 5TPWH 2G3NA 1AHKA 2C4FT 2N01B 2R8SL 43C9B 4YC2B 4NAJA 4P4KB 3NTCH 2I9TB 1KCSH 5GS1A 4PQXA 5IVOA 4ANXA 4P5MB 4WFED 2VUOA 3QNZA 4FHJA 2AC0A 1XGYH 3KPRE 4N68A 5I8KL 5DJ2B 1N64H 4PJFF 4TUJB 5FWQA 3DX8A 4AJWA 1FLTX 2IAMA 4HWZB 4JM2C 1BX2B 1A4CA 3U36B 5HGAB 1SYSA 2YSTA 1G1KA 2V7NB 4CDGC 4S11A 2VW6A 1MCCA 4DAGH 2FEDD 1S3KH 4MFHA 3P40A 1MKFA 5HYJA 1TDQA 1T66C 5IWLC 1MAMH 4UM8A 3V4UL 2Q86B 4X8JB 2HRHA 1BOGB 1YDPA 4NIKB 4IBWA 2G5BA 1XSKA 3RL2B 3MO1A 5CCGE 4RQQA 1NEPA 4KK5D 5F9WB 2W0FB 4YSCA 4Z7OB 3MNVA 3VGGA 1SDDA 3SDCD 2A0LC 3GHPA 3IN0A 3FQNA 1Z1WA 4N2CA 1USQA 2J5LB 4KJWD 2VDKH 4I1NB 1UEMA 2EH8L 2N7SA 3QCTH 4Y9GA 3X17A 3H85A 5AWNH 4X6CF 1MNNA 3P4NA 2VM4A 2V5RA 2QMJA 2NY7L 1QRNE 1T5WA 1Q1JH 4GYBA 3GXFA 3O45B 1KIUB 1RXLA 2J88H 4QO1B 5FS5A 1YQ2A 1CQYA 1U8OA 4LPUA 3OKEA 4MX7A 5GGTH 4JRYE 5BV7B 3SDXB 1QTPA 5K9OA 1U92B 3VXTB 3BPOB 5CFAA 4QXUL 1XF3B 3HBQA 5FHAH 1WSST 3GMMA 3ZE2F 1OP4A 5DUPH 3S7GA 1JNLH 3FT2A 1M7UA 1N18A 3MRLB 3U4EA 2HUEA 5JR1H 2AEPH 4AYMC 4PLKD 1I3GH 3ZMNA 5IESL 1LM8V 3WIFA 2ZCKH 1LO4H 2ZKHH 5DYOB 2VKXA 2EABA 4FQIL 3GD1C 5J9PB 5F8RC 4HJEA 2JJTA 2WMPB 1I8MA 4GW4A 2NY5H 2B0SH 4TQEH 3MYZA 1QSVA 5HPMB 3F7VA 3IDJA 2DY2A 4RAHA 3ZGIA 1JZ7A 15C8H 4P2QD 2K3TA 3IFOA 3NIFF 2C9VA 3GKWH 1E67A 5DGQA 2NDGA 1ERNA 1JHLL 1D6EA 4U3HA 4FJYA 4FFYH 2XWRA 1XF4B 3G5YA 3KPSD 3HJEA 2BOBA 4UOW1 1O0VA 4OF0A 4PWHA 5GJTH 5CEYB 4WHCA 4MSWB 3OPZH 3FB6A 3LS4L 3QIWA 4E9LA 2OJ1A 3QJHA 1P7BA 4RAUA 5DJ6A 4FQHA 1A6VH 4Y1SA 2WQUA 2XY1A 3GM8A 1A2YB 3IJEB 5A7EA 3T0EE 4FFZA 4L3EB 3P69A 4F7CA 1KTJA 4IIQC 3RRQA 4D0BA 4OBRA 2WANA 2ZYSA 5J1AB 2O5XL 4ZFOA 2OSLB 2IOOA 2MIZA 1WWWX 1C9SA 2G2RB 2WXMA 1LJMA 3ZDWA 3RX9A 3FAXA 4WI5A 3II1A 5I1HH 1KG0B 2I24N 3U79A 3RWDA 1KJVA 3CXHJ 4MA3A 1BG1A 3KH4A 2IBZX 3MRHB 2YJQA 5BMFL 4NUQA 5T1KA 4LO9A 2NZ9C 3DI3B 4JLRB 2WQVA 1WFMA 1RUPH 2WBWB 4XVSH 4MCZA 4QTIH 3ZDXE 2AV1A 1GKEA 5BVPL 2OV0A 1QSEE 1ITBB 3T5WA 5EC2B 4WW2F 3S97C 4JPIA 4YXLH 2IPTL 3QFJE 1MXDA 5C09E 3RWGA 1HZKA 1O75A 3KGUA 1HWHB 1TJHH 1REIA 4NQDA 1D9KB 3LRGA 4PP2A 3RJOA 4XTRD 4EDWL 4RDQF 3DX4A 3GMLA 3BLBA 3UAJA 1FZJA 1LO5B 4A2HA 4XO3A 2XQYG 3MRFA 1NOFA 4AI7A 3IFLH 5BRZB 4GAGL 3VFMA 4RETB 1X5LA 3TPKA 3FUKA 4OQ1A 1VFAA 2BWQA 4K73A 5B4MC 4MD5B 4C83B 1BQSA 3JQOB 4RMBA 3L08A 1ES0A 2YUVA 4XOCA 3TIDA 2DYPB 4EXKA 3N42F 4PJIB 1U3HA 3WFBL 1N0LA 2ROYA 5LBGA 2EKJA 2QADB 2FX8L 3T08A 1FN4A 2VJ0A 2QEJA 4AVKA 4JFFA 2A74A 3V4PH 1AE6H 2UWEF 2APSA 5KN5A 1JTOA 3AG1B 3H9SA 5CN2A 3WJMA 3KR3H 1HHJA 3DXAE 1VLXA 4JRYD 5EZIH 3HI1A 4UT9L 3ZL4H 1J10A 4FQXA 3WKQA 2P7TB 4K8RH 5KG9B 3T6XA 1JTPA 2YPVA 5A2LH 3SGKA 3WGUB 2WO3B 4W9LC 3NZUA 3I02A 2P8LA 4JCWA 3TBCA 2KC0A 2IGFL 4JFOA 3JXAA 1DEDA 3NK3A 4UTAL 1RIHL 4ZOEA 2DI8A 3ZU8A 1THCA 3GSNA 2HVJA 4ES9A 5JOPD 2OYKA 4XCNB 4DN4L 1NGWA 2CD0A 1G7JB 4OJFL 3VNZA 1TZAA 4MNQA 5ICXA 1AAJA 4BBWA 2KMWA 3JV6A 1KXTA 1N4XL 3LVTA 4XZ4A 5DHVA 1JVKA 5DU7A 5LAXB 2DTSA 1GL4B 3O3BB 3KVQA 1RULH 1A14L 5KSAA 1AGEA 3HS0B 3L13A 5AVXB 3ZHLA 4I77L 4NPYA 5J13B 1FF5A 4OLWH 1P69B 2Z31A 3BP7A 2EDEA 3AU0A 4UUJA 1JVOA 1GAFH 2PTTA 2D3VA 5E8EB 5E6IC 3KNBA 4XNUH 4WCYL 5ID0A 2EDRA 3SEPA 4X8GA 3EBIA 4XNMB 1OSEA 3MYJB 1T5XA 1QQDA 1YEDB 2FR4B 1FYTB 1SOKA 1OTUD 1P53A 5L4JA 1CN4A 1FORH 1E27B 3MJGX 4WTZA 4BHUA 1CLCA 2GY5A 4WDIB 4JCLA 1TTGA 4LRIA 4P07A 4XPTL 1O7DE 3PFUA 4V2BA 3LNIA 3RWIB 2ZX9A 3II2A 1MCRA 3MODH 3DRQB 1S4IA 2EDNA 3P4MB 4EDXB 3UEZA 5FKPB 2GVYA 3MGOB 1LXMA 4WVRA 4UOZA 3J27A 4P8QA 4HEMA 2UVFA 3LRSB 2W60A 2ADFL 4IQHA 3HBPA 3FT3B 3O3EB 4JRXB 3OKLB 1KYDA 1JPGB 3TO2A 5F7BA 2O72A 2EUXA 2F7QA 1YEIH 1FGVL 4AH2B 2J72A 3PXJA 1UCBL 1EZVY 2W0PA 2ZUUA 2I32A 3CJJA 1SLXA 2BP5M 3C6SA 3ZL1A 3CUPB 3UAFA 3RBGA 3TA3C 1W91A 2V9TA 2Y5EA 5TE6H 3KJ6L 4FCAA 2YZ8A 2IV8A 4RMUA 3KG5A 1ORSB 3EYQC 1MCPH 2R1XA 1MCBA 4BZ1A 2EC9T 2YD1A 2DKUA 3Q8AA 3UBXG 4TSBL 1JE6A 4MQXC 5L2KD 1P7QA 2H41A 4HPHA 4P46D 4MYPA 3EW3B 5KVFH 3BZEB 1KLUB 5BQ7B 5A6IA 5GS0H 5L7XL 5GS2D 2X4SA 3WELA 1BW8A 5SX5H 3UTSA 4YDLC 5C0BD 3HG1D 4E36A 4PRBB 2NY0D 4OFPA 3HPLB 4B9YA 5C0DB 1BQLL 3MOAL 1HN1A 4LVHC 1KLFB 3ILQD 5IG7B 5I8CA 3T3PF 4I1PA 4ODXB 5D2NA 5JHLA 1Z3RA 3BOVA 1KACB 2H5UA 3IT8D 3QIWC 5DK2A 3ZDYB 3D0VB 5JIKA 3X1NA 3NA4A 4FNPA 3HE6D 5IHUL 4Y1AA 1P6FA 3BFWA 2H47C 2PO6D 3QORB 1YYLL 5I6NA 5LXVA 1VEMA 2PPAA 2Q6WB 5BS0B 4KKRA 2Q87A 2AABH 5JHDD 1HT6A 4P23B 4BKTC 3ROLB 4F8QA 4PRID 3DBXA 4MD0A 4XP9H 4I18A 4DP6X 4J7RA 3ULAB 2OX5B 4M5YH 5HHVH 4ENZA 5HI3D 4EAEA 4WO0A 4PGBA 2G3XA 4GSQA 1LO3H 4KKBD 4P9HH 5D7IB 5I1DA 2G2NA 1E4XH 3VJ6A 1N7MH 1NGPH 3KLQA 3KXFA 1NIFA 4GQZA 4DERA 4ZMXA 1NCAL 1RJYA 1XZWA 1BAFH 3RWFB 3MAWA 1U2YA 2UXGA 2OMVB 3QDAA 4HZLA 1HHIB 2ITCA 3KPPA 4HC1A 2MMXA 1LTXA 2QR0B 1FV1B 4HOZA 3UG4A 3ECWA 1E2ZA 4KKLD 4KI5F 3MRPB 3UAJC 3BGAA 1SXSA 2P8PB 2PW2B 3IDIA 4A55A 4ODTL 4FHBD 3FOLA 1JPTL 2DWEB 4KZCA 1T6VN 1KPUA 1UCTA 1CXIA 5C1MB 2Y1VA 1NCDH 4U7MA 1KB9K 4QT5A 5CMAA 1AGBA 5CJQH 3RVWD 1J8RA 3JV4B 5GGQH 4Z3JA 1SEBB 5D6CA 2F1BA 4KXBA 1L4IA 1HX0A 4JAMA 4Y2DD 2WTRA 4N0FA 2APVA 1XXDC 3B43A 1HEJC 2ZWSA 1J0ZA 5FC9A 5JQIB 1J88A 4HOXA 3FCSA 4MBRA 3UROR 2GPZA 3POHA 2GJPA 1N5AB 1PG7H 4HUNB 4PPTA 5IK3B 3LKOA 1CGUA 2DL9A 3IYLW 4Q89A 4AKPA 4FQJL 4ADGA 1NJ9B 1YN6A 2XV6B 1UXSA 3QHZH 3EDDA 4PMFA 5GRVL 3II3A 1ZE3H 3E9UA 4KDVA 4FQXC 1DBBL 3LZPA 3NA9L 3RBSA 1DQLH 1T2QH 4X42A 2FJFA 1XAUA 3UFIA 2VLRB 4L0YA 3DUUA 1OZTG 1RSFA 2EDQA 4L3EE 1X5IA 1VFOA 2CDEB 2MRYA 3AT0A 1C08A 2GTZB 4OM1H 3KLAA 4P4KD 2RHEA 4UZGA 3FSOA 5FFLA 2HT2C 4MMYB 4Y8AA 3F5WA 4OU3A 2XWJB 2F54E 4W1TA 3APMA 4JFXA 3VGBA 2RA1A 3DBSA 4IRZH 3EJTA 3K8MA 4Z3IA 2VDPB 1T6BX 3MACH 2FO4B 2IANE 1KELH 1BZ9A 4MLIA 4RGNC 1LQBC 3W9EA 4OZFA 4A2EA 1ND0B 3MRCB 3QHFH 4D7BA 1KXVA 3QQ9C 1N8ZB 3T0BA 5IJDC 1RIVL 5CEXB 5IW6B 4A39A 3MLZL 3N41B 2PNDA 2V2TB 2RCSH 4HJ0D 2GT9B 1XCWA 2X41A 2MWCA 1OSPL 2ICES 3H8NA 4G59C 2BJMH 5JW5B 1J7VR 2JQMA 1IZJA 1T83A 2BNUB 4JFHE 2F8XC 3VW3H 2VDQH 3VXRB 4GKOA 4AGLA 2JB5L 1XDTT 1R0AH 5EOCL 4FP8H 2BP8A 2V5SA 3C9NB 2GIMA 5HHQA 4OCMC 2JNZA 2DH2A 4NN6C 2NTFA 4QLWA 3V5HB 1E2WA 1G9HA 4K23H 2A38A 2OP4L 3ZHNA 1WEJL 3O2VH 3QUXB 4JDEB 3WHE0 1S7WA 4Y5VC 5FGBC 3QE5A 5B8CB 2B9AA 5T1JA 3HKFA 3WTYA 1HK6A 2X2UA 3RU8L 1IEAB 4ORGB 3HPJA 4PJIE 5GISL 1GGTA 1J05B 1AIZA 1L9OA 2GSGA 1A64A 2WQAA 5AD0B 1JK8B 3ARGA 3ZT7A 1NAKL 1BMGA 3PWJA 4PWFA 1S3RA 4JKNA 4QTHA 1ZSDB 4MHHI 4HK0A 4E9RA 1EZSA 2CBMA 1A9EA 1Z9SB 3BI9X 4HD5A 4XMKH 5AW6B 3X14B 4ODVL 1TKWA 2OCCB 3UO1H 4BK5C 4OM0L 4DHLA 2VM3A 2WBJA 1WGOA 3AWEA 4XWOD 2AXFA 5E8OA 4DF9A 1MLCB 1O6SA 3AC0A 3EJUA 1LMKA 1I8LA 5F1NA 4FFVD 4FXTA 1UUNA 2OL3L 1YNKL 4R97C 3N0AA 4AZ8B 1CVSC 5AYQA 1N19A 2UZXB 3VRIA 2WLZA 4LHUB 4WFGD 4EN3D 1N6QL 1U3YA 1D5IH 1VKXB 4K5NA 1LE5A 1J0HA 4FNLH 4NKDB 4Y4HD 3US9A 1HEZB 1Z9PA 5DHDA 1AH1A 3ASOB 4GXVL 3MUJA 4JG0L 2A83B 1QFWI 4H26A 4PJXA 3JTSB 2EYTA 4X50A 4DGVH 4ODSL 3MMEA 1NOLA 1YNTB 4OSUL 3CZNA 3PU7A 1JYWA 3FRUA 5J4MA 1F4WH 1A1NA 1QLRB 2IDQA 4NT6A 4Y16A 2D4DA 3Q9QA 4HXBL 1AMXA 2ISDA 3TWYA 4MJIB 4IBUA 5JORA 4H2CA 1DTUA 3FQYA 1E28A 1IX2A 1T0NB 2D7NA 2CO6A 2AGJH 5CILH 4F27A 1L3WA 1Y0LB 4U6VH 5CEZH 3OKNA 5IBTH 3CFCH 4KXDA 2Q8AH 3RX8A 2AI0L 3QBTB 1DVXA 2TRHA 4RFOH 3RTQD 5DI8B 5EWIL 4LLQB 4G9DB 1U8CB 4WKZA 4LOUD 4TOYH 3MJ8B 5ANME 3OXRB 5EPMA 4ZUWA 4JHAL 5HGBB 3RY4A 2OAAA 2C3GA 4L3ED 2ZXDA 2DZEA 2YSSB 1GCYA 1H8OA 5MENA 5E00A 3T2NL 4HKXA 4MDRA 3BAKA 4XMXA 4OLUH 4OQTL 4WJKB 2J44A 1CS6A 3WFDL 4QRRE 1I7TA 4DP9X 5D93B 4WWOA 1J5CA 3LEYH 3Q6FB 2ZSWA 1N0XH 1YEWA 4KO6A 3V0WH 1IAIH 1UD6A 5LNDA 2F08A 5H2BB 2EIMB 4AUUA 4CU7A 3CDCA 4L4VB 1A1OA 3UBGA 4KTEH 2EDJA 4WUUD 3ZHFA 2ZOUA 1FBIH 5I5MA 3FT1A 4O02L 4UV7L 3TVMB 3WFEH 2HJLB 4YSTA 4B27A 3LHPL 3T6QC 3P77B 3K80A 1SDAB 1J0JA 5TQ0H 5I0WA 5IUCA 3F65A 3L1EA 1AI1H 4I3RH 1W15A 3N1FC 3MRIA 2ADJA 3K8KA 1URIA 3MVSA 3NCYP 5DT1L 5SWZD 3KPNB 5T3XE 5C6TL 4CILA 4PEEA 1D9KD 3QA3A 3NZSA 2BVOB 3UJIH 1B0GB 2K7PA 5PAZA 3UP6A 4KZEH 4FLRA 1JYNA 2XWTB 1XMWA 1F02I 5BRZD 4XX1G 2BVPB 3T71A 3HTLX 4YSQA 2JTDA 4XPGL 2WZPD 2J4WL 5I0ZA 2BNQB 4FMFA 4HCRL 4FI8A 1XR9B 1ZT4B 5D4QA 1O9ZA 1TCRA 2N59A 3FH7A 3U9UB 2XWBA 4N2GA 1MVUA 1A47A 1CFTA 4J3OD 4NEHB 3FPYA 3TURA 4QRPA 2XVBA 4PS4L 1MDAA 4CMMA 3H53A 1AQKL 2CDFA 2EE3A 4YR6A 1ZHNB 1FNGA 4ZFZB 4G5ZL 1MWOA 3CQFA 1CL7H 1HNYA 2X70B 4N2LA 5DWUH 4YAQB 3W9DA 1Q94B 4GLRI 5BS0E 1RLWA 4P5KA 1PDKB 2WXNA 2YUWA 5EO9B 4GQRA 3TP4A 3NMEA 4MASA 2HWZL 3P2TA 4YHOH 3L4CA 4OCYL 4WFHE 5HGHA 2Z8WC 3IDMA 3S8FB 1XGUB 1PD6A 3WTWA 4FNQA 3ESNA 4WLCA 3CSYB 4N6RB 2WLKA 5DFTA 4Z7QF 1PKOA 4OH2A 3T6ZA 1AP2A 1ZK9A 4LVOB 3IXTB 1CE1H 3IK2A 1I9RL 1X5HA 3O2DH 2Y36H 1KXVC 1XCTB 2NSQA 4XB8A 2TRYA 1HSAB 4Y19A 1NC2B 4GBXA 3PNWB 1IKFH 1DO5A 2XVGA 1R5WA 3L9BA 1VACA 1R1CA 1A4JA 4TPRH 1PG7X 2DWDA 4G9FA 3NGBB 1U8MA 5IEHB 5K33A 1WD9A 2VDRL 3BVNA 2ED7A 4N25A 5AOZA 3ELAT 3FMGH 2P24B 2BSSB 3PL6C 5MERA 1ACYH 4JB9L 2B1AH 5E1IA 2OA9A 1RK0A 5E9DA 4A7GF 5DUBA 4NC1E 5EV7A 1QBLH 1QTSA 1S8DA 1FUNA 3NZ8A 3D2TA 1L6ZA 2YC1B 4RFNC 2AANA 3SPHA 2C1OB 3TASA 3I74A 5EUOE 2Y07H 1MCSA 3HZMB 4X5WB 1TU2A 1FYTD 2X1QA 1L0XA 1B4LA 5CLZA 4AG4L 2BVEA 3SPIA 1W80A 1R3KA 5L8JB 3LD8B 4OZIF 1G7PA 2ZCLL 4U1HA 3I75B 2B59A 4BCYA 4ZW5A 5D1XA 5I16B 5J8OA 1AHWA 3JWOC 4I3GA 4IGBA 4K7PL 4DGWC 4P57A 2NOYA 1J86A 2FLMA 2IWKA 2FWOA 1QO3B 3BDBA 4H1LG 2EDMA 3DX6A 3C6LB 4OLEA 4NLHA 2VLLB 3FO1A 3DUSA 3HC2A 2QDVA 4XNYH 3PP4L 4YDMA 5JYMA 3NABL 4JRXD 2FQEA 4X2UA 1KCUH 1WCBB 5TK2A 4Z78B 5CN1A 4L0ZA 3UXFA 2VLRE 3C5XA 1H3PH 3ME0B 2HN7B 3U9PL 2YAOA 1H0DB 1RURH 2YBRA 5DEJA 4Z9KB 1KN2H 2OZ4A 1V05A 4NP4H 4Q52A 2OQJB 3UZEC 4LSRH 2Z7ZA 1B3IA 2PLTA 5IW1A 4ZS6D 5FYJH 5I17A 5J6GB 3AREC 5ALCH 2PWHA 1BZEA 1WC7B 1LK3L 3QPKA 2MPAL 1T1XB 1VAHA 5T3XD 3SOBH 2IV9A 2X6AA 5I73B 3VU1A 4HETA 1UGKA 3PHQB 4KO7A 1ET8A 2BS71 1PVHA 4YVNA 1FJ1B 1TVDA 3OL2A 1NGZA 43CAA 3GIVA 3VI3A 2EIZB 3HRZA 5IF0A 2HYMA 2JI3A 4HK3J 4FD0A 4ACPA 3SOTA 1L9TA 1MPAH 2CGYA 2DLHA 2IH1A 2BERA 4MMXC 5KSVB 3PDOA 4P05A 3M8OH 2BSCA 4UTAA 2ZWYA 1JI1A 2PPFA 1K4CB 4IK6A 3V6OA 4PLJC 5CLTA 4HT1L 3CLFL 2BSEA 3L16A 5HVWA 4E0RB 4LCWA 5F7MC 2OK0L 2EILB 4PS3A 5JIHA 1OK8A 5F7FA 1ZLVH 1R3LA 2YD5A 3TYGL 1M53A 4E9XA 1WIUA 1JRHH 4IRSB 4WI0A 1DN2A 1U36A 1INQA 1G6RH 3CN0A 4Y89A 2C26A 4L1TA 3NH7H 5DLLA 3LZLA 1JXKA 3GSWA 3HNVH 5SV3A 3N91A 4K7PY 3WNPA 5LXGL 3WFCL 2D7OA 5HD8C 1F6LL 2I25N 5F89A 1YPZB 2HLAB 1CFNB 3FFCB 1L0PA 2YRBA 3FK3A 2EZ0C 2A77H 3FB5A 1QEWA 3PV7A 3IMVA 3NJMA 2B2XH 1IAMA 2VLJE 2XNAB 4C8XA 1B0WA 2AKRA 2AQ3A 3U0TB 4K9EL 1OGAD 4FYTA 1CICB 4AUYA 3QXUA 1WBXA 4G43B 5HPOA 1WS8A 2VMCA 4UV4L 3G5ZA 3WE6A 4RZCA 1A1MA 1EEYB 2VL5A 1YQVL 3ULUC 2K7QA 2W8CA 1JS4A 1T04B 1S5HA 4LSPH 1EERB 4ZXBC 1ASOA 4WV1A 3VFUA 1UC6A 1HXMA 4N90E 2D7TH 1CQKA 1DJYA 4K7FA 1RI8A 2V3FA 5E5UB 4GG8B 2DW5A 4WWKB 3NVQA 1NQBA 4HIEA 4P2OA 3QG6A 3VTAA 2O5YL 5DJXB 5SWSA 3G04B 2R2BB 3IS0X 3FN0H 2VABA 1AD9B 4BSVA 3D69A 2DMGA 4ZAKA 2X1OA 3V7AE 3TBYB 5DHMC 1CGYA 1I4FB 1Q9LB 4R96A 5TDOA 4JG1H 3QG7L 1AS6A 1OP5K 5CLXA 4YXKH 5C0ND 4GOSA 4MJIE 2NDFA 3IVKB 4LSTH 4MAYC 1I9JL 3ULSA 3CLWA 3RI5F 3WKNA 2QQLL 4PI0A 1HL8A 5HYJE 2FNBA 1X5GA 2QKIA 1XF5B 2EO9A 5LBSH 5ENWA 2XYCA 3A6BL 2QQQA 4JKWA 4UDTB 3UG3A 4JZJB 3CTTA 2R2HB 3G6DL 2CA4A 4PTTB 4WNQB 4DP0X 3BVXA 3I50H 4YQXL 3ORJA 3HLAB 2VLRD 2OM5A 2GI7A 5G4OA 4Z5RA 5T3ZH 4I87A 3V4PB 3MLXH 4NQCD 4XH2B 4L8DB 5DJZA 4YHYC 1IGTA 2PWGA 3TT1H 2NLJA 4EI5C 2ESVE 1ZT7B 4YNYB 1ZHLA 3ARUA 4QRTB 1KBVA 3CMGA 3O9WC 4AJYV 4DVBA 1QRKA 3QWNA 5PCYA 3VWJC 1MW3A 1CB4A 3PABB 3FU3A 4KO9A 5G4MA 3FRPB 3I3EA 3MA9L 3KHQA 3DHJA 4OZHA 3QWQB 5DHEA 2VMEA 1MCOH 4L4VE 1J48A 4W4OA 1B88A 4FTVE 4NPKA 1BJMA 2XZAH 3Q3GA 3GMQB 4UZSA 3SQOH 1EFQA 3LRKA 1MCHA 3FSWA 3I6GB 1F3JA 1HC1A 3P3TA 3B2MA 3B7RL 4Z7AA 3LRHA 3MV11 2J2ZB 3B2UC 2WNGA 2UZIH 4KVCH 1QHQA 4NENB 1TPXC 4XBPA 2H6PA 5FOBB 5SX4H 4GMTH 3G9VA 2AXGA 3FB8B 4GRLB 4KV5E 1WZAA 3VXRD 4YL4A 3KVDD 1LYQA 1ZT1A 3N50A 2B08A 4RCAA 5F9OL 4FG6C 2CR0A 4P49A 3DTDA 2HAZA 4KMTH 3FT4A 3GJFH 3L7FB 3PHOB 2C4XA 3WDIA 1COBA 2W9DH 2F2HA 4OD3H 2BXZA 1VZGA 2LTQC 2XPGB 2BNQE 3QUXD 1MFBH 2GITB 2Z93B 3D33A 5FLVA 2OR8A 4QR7A 4GO6B 5E99L 4AQ1B 2AK4B 3H55A 1EMTL 5ESQB 5F7AA 3IE9A 5FK9A 2J6EL 5EU5A 4AW7A 4WW1A 1IGCH 1HE7A 4EPSA 5KVMC 2H8PA 3FU7B 2AVFA 4PS8A 3E3QC 3BWAB 3C08H 5LG6A 2P44B 2ZX5A 2BY3A 3UTQB 1HYRC 1H9VA 3NRFA 3QULB 3N44B 3VU2A 4TUOA 2BRRL 5CP7B 2WW8A 2X2HA 4LARL 4ELDA 2WTPA 5IB5B 4PSRA 4NI6A 3T3MF 3E6FB 1IM3D 3WXVH 1M4KA 3ARFA 3ZZLA 3QQ4A 3QO0B 3ZUCA 5JW4R 2A3TA 4UIMB 4N90D 4BFRA 2MOQA 1X9LA 1V10A 4LMQI 4LBEA 3SKOB 2PCPB 4MA8L 4P2RD 4IKNA 4DVRH 4PG2A 4F8OA 4R83A 4LPYA 3BWUC 4GKSA 1PBYA 5D8JL 5KSBB 5AW0B 4KQ0A 1JHKH 1L6XA 1QUNB 3L5WB 3K6SB 5ISZB 5BJTB 1PKQB 3CMOL 3LIUA 1JK9A 2JWYA 3KWWB 3MCKB 3TH2T 4CC1A 3QUMB 2GAZA 2WSDA 1ZV9A 2XKUA 2XA8L 4XNAA 5DO2C 3QZWB 4PJBF 7FABH 2JLLA 3VFGL 1Q72L 4DAGL 4JM0A 3CIQA 4C56A 3TN0D 4XCEA 2FCBA 3BZ4A 2C1PA 5GXBB 1JWSB 2OLDA 1L9NA 1LE9B 1HOCB 1TJIL 5LJYH 3OTTA 1HDMA 4KK8C 4Z7VA 1H8SA 1BA9A 2ALAA 4DKTA 2E9WA 2NUTA 2R2EA 1AFVH 4G6JH 2J12B 3RPBA 4KRPB 2EEXA 1PQZB 5D7JD 1TTCA 4AGMA 3OAYH 1YDPB 2DEYX 3V0GA 4ZX3A 1X9UA 1WO2A 4JX0A 4MA1C 1CT8A 1CFSB 1OW0C 2G4EA 2IALA 2BLFA 2OULB 1E5UI 4NZDA 4PGEB 1BEYL 2OR9H 3QCTL 1QHOA 3QJXA 4BXVA 4CGUB 2FDBP 3MNVB 4GINA 1SDDB 4H7VA 5E0FA 4NN5C 3FUMA 3W0WE 5AAMC 1JGUL 3FQNB 5HJ3A 2L7QA 5CINH 1INEL 1HTYA 5CD3A 1E6OL 5EUOF 5HYFA 1JZ5A 1A9VA 5HJGA 3SKMB 3B9KA 3Q1SL 5DFVC 1WWAX 4YHIB 4G3YL 4GUOA 5CHNA 5ITBH 3P4NB 4WU7B 1EJ8A 1M2VB 3SDAA 4HW6A 4B95C 1TEFA 1KZYA 3E8VA 5T1LB 1RK1A 1DANT 2B3RA 2XXFA 1OHZA 2X4PB 5SX5K 1FZMA 4MX7B 3OKEB 1T1WB 1UQSA 1JPSH 2OMXA 4UQBA 5K9OB 2EVFA 5DVOA 1V8HA 2UY6B 3D51A 2EDKA 2ZKHL 4OIBA 3NJHA 2DQUL 1PLGH 4QJ3B 2DQJH 3LOWA 1XCQA 4ABQA 3GMMB 4NUJB 3WL9A 3U30B 4UT6L 2PW1B 3CFJB 4EBQH 2BMKB 2DBLH 2OTUB 3RWJB 3X13A 4IHOB 4UB0H 3IDYB 3BHBA 2WNKA 5L0QB 4HGKC 3WIFB 1R4XA 1H15A 2FJGB 4Z7WB 2CLVB 3V8OA 4U1IA 1JYXA 4ZMYA 1K2DB 2GC4C 4YFLI 1I8MB 4JR9L 4F7EB 1G9ML 2MSPA 4GW4B 4L9LA 4OCNC 1IBDA 2MCG1 1AZRA 4FA7B 5IJCC 2PUQT 1QSFE 3VFVB 4WWPA 1J9RA 2AHIA 4U6HA 5CCHE 4XCCL 3VFTB 4V2CB 3IN2A 4OR1A 1YPZE 3UDWA 1WZLA 1A6VL 3FFCE 3OGOE 2XV2A 4NZRL 5TDNA 1YO4A 3O3AB 4ZBJA 2BOBB 1DCEA 4W4OC 1T22B 3WS6A 3VRJA 4UNVA 3FB6B 1FFNA 4AIOA 3SN6N 2E0PA 2WLIB 2WO2B 4UAOB 4RAUB 4LB8A 4B96A 5T5NG 1NC2D 4TLKA 3GDCA 1NAMH 3Q8EA 1KJ2A 3F8UB 1CU4H 3QZOA 4NNXA 1SMAA 3QWRD 2QSCH 2WVUA 2XDHA 1M05B 5I1JL 4PJEE 1OGSA 4A67A 5AQ0A 3BT2L 5JIMA 1EXUB 2VDLL 2XLLA 4LDEB 1BVOA 3CFUA 2MQCA 3CC5A 3D87B 3U7WH 2NQ3A 1HILA 1UFUA 1GMEA 4YBLC 4XPAH 4XP4H 3S3DB 1JGEA 4JJ5A 5JPNB 3CDZA 1E50A 1KPRB 2NZ1A 4JY4A 4L4JA 3PWVB 4HXAL 1F97A 2C3VB 3SB3A 3NOIA 3T4AC 3GLZA 5DO8A 3BZFA 3VXPA 5IMOB 1XR8A 3ARYA 3K5RA 4M4RA 5ADPH 1C8PA 4MCZB 4OFKA 5D7LA 3QPXL 2BK8A 3D85A 4JFYB 5ACZA 3B56A 2BC4A 4LIQE 1QHPA 1VZHA 3JZYA 4HIQA 5D9SA 1JNNH 2J3SA 4YHKH 2X9WA 2VZUA 5A2KH 5J7CC 2XG4A 3QIUB 5FUCC 5I2IB 4NQDB 2FWLB 2ZXEB 3MNZB 3GMLB 3L3HA 1MFAH 4QRQA 1FZJB 3MJ7A 1ETB1 2HB0A 3C6LD 4JPSA 4DUVA 1IGFH 1FRGL 1W2KT 4QHMB 1OHQA 3VFMB 1EUUA 4YLCA 5CR1A 5I8OL 1VFAB 2W65B 1TFPA 5F8QC 3PE9A 4PGCA 4HCRA 2JFCA 3ARFC 3TV8A 3FSZA 5CGTA 3CN2A 2XV0A 3B4NA 3TIDB 4DFIA 1GIGH 2A6DA 3QJUB 4HUCA 4LEOA 2R4SH 3W39A 5F7UA 4JFFB 3NAAH 2X6UA 1DN0A 1R17A 3PP3H 5I1IH 3QJRB 5KN5B 1FGNH 1NKOA 3H9SB 5MHSD 3SJVB 2WGNB 4AIZA 1HHJB 2K1MA 3BMVA 1NM4A 1BYPA 4PJ8A 2EYRB 3W56A 1EX0A 2WP3O 4LOEA 4CVXB 2CALA 5BZXA 5FB8B 3WMPA 4X5LA 4F3FA 3LKSA 4NBYB 1T89A 3D18B 3I02B 3BKMH 2DWTA 4ZNCD 3ZMRA 2CUMA 4N1HB 3TBVB 1EJOH 3NSCA 3CPUA 3B7UX 3DK0A 3HAEG 4MNQB 1KXTB 5DHVB 2HT4C 1JL8A 3QDGD 2YMTA 4M43L 4OLZL 3VFOB 1X5MA 5LQBH 3AXLA 2YQGA 3GMRA 2H0PA 3L17A 3ML9A 3NFSL 3PWUA 3PS6A 4IRSD 5B39B 1UD8A 2HTLC 2Z31B 3ZTNH 3BD4A 2DLFH 4UUJB 3L2NA 4NBXB 2FO8A 4ELME 2LABA 2C3WA 2AK4E 3RNKA 3KNBB 1YEEH 2PYEB 1J1PH 3EYFA 2RMNA 1OTSC 3BIAX 1YNLL 1T5XB 4MD4B 4V11A 2PYFB 3FFCD 2G5UA 1IB5A 1Q0YH 3L2MA 2R29H 3NESA 5F21B 3VDBA 3UPCA 3VGFA 5I15H 4H8HA 2ZUVA 2JKJA 3B9KC 2XWXA 1AGCA 1F0LA 3VFNA 2VQTA 1CICD 3SZ6A 2AK1H 3ABZA 1VFBA 2GIXA 4L8SA 3L4TA 2EADA 4KKCD 1A9BB 2X44D 4CW1A 2YPLD 1OPGL 3CDGA 4MHHG 4Y5YB 2XZQH 3L8QA 2FBRA 2HFFB 5I8EA 3ZQWA 4NM4H 1AR2A 3IMSA 2WN2A 5DA4A 5DMIH 2VN4A 5HTSA 5E6RB 5CBAA 1QACA 2F5AH 1MHPL 1ZA6B 5ISZE 4J2XA 1KXQA 1NCUA 4WWKD 4Y2LA 4QCIB 2F6AA 1IE5A 1MCLA 2GUOA 3T6VA 3AB0B 4NZTL 5SWQA 5LNGA 4KO5A 1CBVH 3FUEA 4AXWA 4JY5L 4JFUA 4EF3A 2Z34A 1IM9A 2BOCA 5F7KC 3FXIC 1EO7A 3O6FC 1UM6H 3B7YA 2XQYA 4XC3H 1T7YA 3MRRA 2FHCA 4JUTA 2A7BA 3AXHA 3B8YA 5LGKA 1BBDH 4LL1A 1AACA 5CCKL 2XSKA 5JO5B 3S35H 4DPBX 2CO1A 1P7QB 2VAJA 2WB7A 2VDOL 2EDDA 3IGAA 1PEWA 1VCBC 4JPWH 3ZYJA 4TTGA 4U2YA 4QYAA 2ATKA 1TZGL 2HG5B 2EDWA 1HAWA 3FU9A 4X7EC 1AGDA 2ZOKA 1FNSH 1H5BB 1T7WA 3QFGA 6FABL 4WO4C 4KKAC 3GUTA 1M6UA 1UXMA 1CZ8H 3C5JB 5L4FA 4X9GA 1ZGLA 4YLBA 5H35A 2AJSH 2H2PC 3SPJA 4YXHH 4K8RD 1MVFA 4LCCA 3F6JA 4CSSA 2IG2H 5TJWK 3IDGB 4YGVB 4KTGA 5I6XC 1RFDL 2E7HA 4MB1A 4V1DB 4DW2L 1FLRH 5HHVL 1C12B 2CJUL 3D09A 2GTQA 4BFOA 5I9QB 3MNWA 4WJ5A 3NCYS 1DBMH 1NGPL 3BP5A 2X0UA 5B22A 4GKNB 1KBGL 2Y4SA 3MGTA 4U1MB 2C7FA 2CBTA 1VESA 2VWEE 2HTKC 3TT3H 4OUOA 2WLLA 1TQWA 5CIPB 1VJSA 2ED8A 2UY7A 2ROXA 2YGVA 4MA7H 5HJDA 4JKKA 1SM3H 5I1DB 3KBFA 4GRLD 2DAVA 1W8NA 3FQXB 4Y5XB 2JCCA 2WOYA 4RBPH 3D12B 3MXWH 4HKJA 3L5IA 1BZOA 3K5SA 1U95A 4FERA 1LEKB 1OAUH 4X6BB 3UZQA 4GIAA 4DESA 1JGLL 1BLNA 3U46A 4TL4A 1TO4A 4JRWA 1JF1B 4ZUVB 1T4KB 3QAZC 3QYNA 3ZIMA 2BSRB 3IDIB 4Z7WE 3FOLB 4H0IA 1S6NA 1R5IB 3LMJH 1ZV2A 4JMNA 2EVGA 3LQMA 4MDIB 2ZYHA 2CA3A 2VERN 4X5QA 5MEOA 2ZUYA 3HHMA 2HUHA 4LP8A 4XXCA 4XPBH 3RGVA 1W0VB 2PTUA 3AROA 3K81A 2NNRA 1U8JA 1A7PH 3A6CL 3DURB 3JT2A 4W6YB 3U1SH 4C4KO 3CCHB 2WTRB 3ESOA 2CXGA 1F1GA 1LQSR 3WN6A 3QXWA 3LX9A 4R26L 3Q6GH 5C0FA 2CKBH 2ZOLB 5F6HJ 4BQ6A 1WH0A 4O2FB 1CLYH 5LCVH 4JFDA 5CS7A 3SPGA 1U41A 3VNYA 2C3XA 1P9MA 3D39A 3LKOB 2ATAA 1UXSB 3UBFA 1S7XB 3S5LA 3L95A 3JT0A 3CFEB 2H32B 3MRKB 4PCTA 4N2DA 5ISZD 2O5ZH 1QNZH 2A6IA 4LLWA 2NNCA 2Z7WA 3DUUB 3C60B 4F58L 1KT2A 4JM2F 5JDSA 2FWUA 4LBAA 1NZRA 1LK2A 1KELL 3KLAB 1RZGA 3DYMA 4XR8C 2ZJSH 3Q06A 3MRQA 3NCJH 4R5XA 7TAAA 5I1LB 3QJZA 1T0PB 2DWSA 2VE6A 1TZIA 5C3LD 1HOEA 2V3DA 2ARJA 5GS0D 2XXMB 5E2TL 1K85A 4NRXB 1VEOA 3FH5A 4HHAB 3DX3A 3MFFA 5HDLA 3WHXA 1S7VA 3NEOA 3MRBB 1GTNA 4R5VA 4A6YL 2XPZA 4X7TB 1NGQH 1K4DB 5D1QC 5DZAA 1KB5L 3SE6A 3G6JA 5IUSA 4GJTB 4KRPD 1B4JH 1J1XL 5HDWA 3U0WL 5IR1B 5GRUH 2C8NA 4YN3A 1S9WB 4IOSD 4N9GA 4YPGB 4HOWA 1EAQA 1A3LH 1WRFA 4MXWH 5AL8A 2VITA 1EDYA 3RG1C 3L3KA 1XIWB 1U3NA 3CVDA 3OJDB 3TTYA 4UINL 4Z7UF 1NSNH 3KH3A 4HS8H 3OX8A 2CO2A 4NQDE 5BRPA 1WYJA 1XD1A 2VN6A 3ESUF 4PJEF 5BW7A 4K3EL 5FW8A 5HHQB 4LGRB 3RI5K 4FNUA 2KZ1B 4N2BA 4Y9CA 4XB7A 1MJJB 3C2SA 4L05A 3X1EA 2ITDA 4ZPTA 1QNIA 5HYQA 1IVTA 1S7WB 4PUBL 2BSBA 2YXFA 3GC3A 4GS7C 1E3FA 2A9DA 3KL3A 4BFGA 2R7EB 2UZPA 3NSDA 1UADC 2GSGB 4ZS7L 4P3WA 2G0KA 4K9JA 4W93A 5T1LD 4JFFE 4F8LA 2J56A 3H9SE 1TQUA 2WINB 1S78C 2YXMA 3FH8A 1VGKA 4N9OB 4P0DA 1O7VA 4ZMWA 4ISVA 3SD5A 1N8OE 2HKAA 2K6ZA 5ESVB 3QRGH 5B38G 3IBEA 1DVFA 1GJWA 1LEGA 1O6SB 3PGFL 4D9QE 2EE2A 5LWYL 2DTMH 3WSQH 3SKNA 5F1NB 1ZLVK 2I85A 1A6WH 3MJWA 3VRIB 1YEFH 3FUFA 2ED6A 2QGEA 5F97E 4JGUA 3EXJA 3GRWL 1LD9A 4MNQE 4C4UA 3QXAA 2B20A 2YD6A 4CGTA 1IBFA 2M1KA 2LW3A 2NY1D 4BFJA 3O3DB 1S9XA 3WJLA 2EYTB 4TVPH 5FO9A 5F9DC 2D4FA 4HLZH 4ZO6A 1H9DA 3IEAA 5EC1A 3VXUA 3ZKNC 1P4LA 2DEWX 3CFCL 3FRUB 2CHZA 3MLVH 3D3VA 4S1SL 4Y16B 4BKSC 4LQFL 3BISA 1C7SA 3H3KA 3TEYA 4MAUH 5IVXF 4N6QA 4PJ7B 2PYEE 2APBA 4WY7L 5FYKH 1GKOA 1F3DJ 1RZ7H 1E28B 1FC2D 3L3OB 4HSQA 1QABA 1OE2A 4APXB 5EN2B 4FJ6A 4UTBL 5IHZB 7PAZA 2WXIA 4R4BB 1TJGL 4APQA 1RK7A 1OT4A 4ONHA 4ZSOA 5KJ4A 1TT6A 3OHXB 4M1CC 1M7DB 3QWOA 5L8LB 4OLUL 4WKZB 2JB6A 4BFEA 1DBAH 2DKMA 1C1EH 2JJVA 2XZCL 2VDMB 3H1ZA 4IM8A 1F5WA 4X9BA 2HFGL 2IBGA 4W6XB 1J8HA 1MHEB 3S35X 2UZYB 5G5DA 4R4NC 4J3BA 4HKXB 1WTLA 3NFNB 4HEME 1UXWA 4N8VG 5KTEH 4L37B 4WHYG 1Z9OA 3EGXA 3VG0H 1I7TB 4X83A 3HC0A 1XL6A 5D71L 1TZHA 5B3JE 4PV1C 2HXAA 5I66B 3EGDA 4M9OA 2OYLA 5MP6H 4LAQL 4XMTA 1N9PA 4A1RA 3IFNH 4HS3B 1GZPA 1I1FA 2HX9A 3GTNA 3P2DA 1YRKA 2H9GB 3CXHK 4FFWC 4IBVA 5ID1B 1ADWA 1KPVB 2D2OA 2GHZA 3BXNB 1NM9A 2L7UA 3BIKA 3CXFA 2DQ6A 3VCLA 3F58L 4HUWA 2NW2A 2PXYC 1NLDL 1SEQH 1BZ8A 1IKNA 2P43B 2YGNA 3QIUD 1KCVH 3TM6A 3BCFA 3HR5B 3ESMA 4HIHB 5I30H 1U2CA 2CCWA 3QA3B 1TSHA 1CXEA 3CX5J 5IFHL 1MW2A 4XN2A 2C9UA 4L2LA 4N2NA 2QVKA 5IM7B 2PR9A 1FH5H 4G6FB 5CLWA 3BH9B 3P0GB 4UT6A 3CXDH 4I5BA 2J6WA 3CBKB 1CL7L 1QKZL 1THAA 3EO1A 2W81C 4HEPG 1TCRB 3KLHC 1CFVL 1MVUB 5D2NE 4X4XB 5F7EH 3D0AA 4P9ML 4OF3A 1NCJA 3RDTD 3T8MA 2VXSL 2WM0A 5LO7A 4Y1AE 3EFFB 5F3HB 3W9DB 4V1DE 2WLMA 4LGSB 4YDJB 3OF6D 1IKOP 5INCA 3SJVD 1U58A 1DL7H 1KCBA 2ZUQB 4N28A 2BDNH 2K3HA 5HDBB 5HXMA 4IBQA 3S8WA 2VN5A 1CDCA 4FFZH 3KD4A 3SDCA 3MV7B 5I1GH 3BESR 5CP3A 1RVFL 1SLWA 4TS6A 5EFIB 4RDQG 3GJFK 2YQ3A 3GI9H 3NYKA 5FCSH 3P11H 5F88A 4YEEA 1AZBA 5F0JB 2C9PA 4NWUH 2W9LA 1L7TL 3TV3H 5KVEE 3N40P 2EACA 2VIRA 3F7YB 3GFUA 2XXGA 3N1MC 4Y19B 3NPZB 4GBXB 3SQRA 5T5FA 1R5WB 1VACB 3N9GH 3ZOAA 4KUCD 5GRJL 4KQ4H 3O8XC 3WNKA 5CEZD 4U6YB 1F42A 4YHLH 2MQ0A 1JMZA 5MERB 3MLTB 4IRJC 1RK0B 2FE0A 4R2GC 5E9DB 3WEXA 4AQ8C 3NZ8B 1S8DB 5KYUA 4X0KB 1UFGA 2PYED 1DUYA 5J1SC 2BCKB 5DJ0A 5C0JB 2IOIA 2ADIA 4W9CC 4GAAA 2YAMA 1FH2A 4FXKC 3DV6A 2DQDH 4NO2A 3N0PB 1M56B 3VFRA 5EDXA 4LDCA 4XMWA 3VXNA 3RP1A 5D1XB 4EI0A 1FO0A 3IJ8A 5DA0B 1ZMYA 4IGBB 3WG7B 2G30A 3HNTH 3V6FA 5D1ZB 3QIBC 2FWOB 1H3PL 4P2QA 2AMGA 3DX6B 3NN8B 1KBPA 3OZKA 4CADB 4D8PA 3MLSH 2W80C 3I6KA 4R0LC 2FGWL 4QY8B 3KPSA 1UD5A 5L4MA 4I8DA 4XVJL 2D3LA 2PABA 5AFAA 3EJZD 2CUIA 3HCVA 4ZTPH 4WI6A 1E4KA 2V2WA 5C07B 3KYMB 4Y88A 3SOBL 4H20L 3E6HA 2YD3A 4HFUH 5CFHA 4FQLH 1KCWA 3FQUA 4M48L 3IU3A 3UEQA 3VB8A 2DMBA 3TEUA 5E51A 5A3ID 2BHUA 3GSNH 4W9FC 5IB3B 3R7RA 3GLDA 5MHSE 2EYSB 3H42H 4N2MA 3KDMA 3OAYK 3T8VA 4KXZH 4F15B 1KB3A 2ZWNA 3NIDE 3TNNB 4NZUL 4LCUB 3PWNA 4ELKB 1BYNA 5BZWA 4DOHE 4NCC1 2C7UB 4U33A 2BXYA 1IL1A 1ETZB 3CVCA 3GIVB 4UT7L 3CPLA 4DGYH 5IF0B 2GSMB 1EA9C 4XNQB 2B3IA 4WEEA 5ESAB 1Y18B 4HAKA 3ZE0B 1EHLL 4HG4K 1AR1D 4PGDB 1OAZL 4GW5A 1NCHA 1SLVA 3PDOB 5CU5A 3V0VA 2X4RA 4D7PA 1MJUH 4HX1B 4NJ9H 2AXWA 4QMEA 3BEVB 4O9HH 4RMWA 4YSDA 4ZO9A 4K94L 3QJFB 4JKPH 2OMWB 4RX4D 2IMNA 3DV4B 4NUPA 1S7RA 3NJFA 2VRAA 4XXDB 4J6RL 5DSCA 3HC4L 2Q5BA 4MJ4A 4V1DD 1F6AA 2B9BA 5FKAB 5CSZA 2EXWC 4Y4KC 2ORBL 5B3NA 4J8RA 1LO0L 3O2WH 3K4DA 4GSDL 5F89B 2UX7A 2R0WL 4Q9QH 2CK0H 1GRWA 3TO4B 4G42A 4NNPH 4X6FA 4AV0A 3UTPD 1QEWB 2Q8BL 4EUPB 5IV2A 3PCYA 3MOQA 3APFA 2AKRB 5TE7H 4M61B 3K72A 4RDBA 5FEBA 3KEHA 4PJCB 4QGTA 5K9KB 3U9WA 3SYPA 2X28A 3OKMA 2AAAA 3GZKA 3JBG7 3P73B 4TKWA 3LQAH 1NEUA 4NB7A 5C0IA 5T3XL 1KLGA 3G5ZB 1MRDL 3WE6B 4LSSH 1CR9L 1A1MB 1C5CL 2O30A 4JRYA 3VFUB 1T7VA 4PJHA 1Z5LB 5FDWA 3FNKA 1FL5B 5CM1A 4K7FB 5HYSA 2R69L 5IQLA 3QRFM 2XHNA 3KS0J 4MBOA 3COOA 4JG1L 4BZ1H 1NMAL 5EOCJ 1KGCE 2Z91B 2D0GA 4OIIH 1B2WL 1B3JA 4O2EB 3VXOB 4PJXE 5DCCA 1N59B 4Z8FL 2Y7NA 4FQQA 3E38A 4QHNA 4R96B 2VC2L 4JFZL 1T0MA 2WVVA 3P4OA 1XEDA 1DDHB 3LPOA 3QDMB 1AOZA 3UZVB 5LBSL 2ZCHH 5DHYA 1QP1A 1G9MC 4MZRA 4AV5A 5JHLH 1Z7JA 2GJZB 3GUFA 1PX8A 1LEIB 2WIMA 3TT1L 5BOZG 5EDSA 4POYA 3MA7B 3E8UL 2J7LA 3M88A 1NFDF 3MV9D 4FG0A 5C9JA 3ETBJ 4LU5H 2VZ3A 5J6HB 3AGVA 1ZSHA 3SDDC 3C60D 4XPHL 1RMFL 1HIML 3AWFA 1NWOA 5MENE 1RD6A 1RY7B 3QZMA 4I2XB 1TJMA 1OE1A 4R7NB 1AXSB 1E90A 4YFEA 3T0EA 5EOQL 5ACLA 1CTOA 1NC4A 4HIPA 4NKIL 4QHUB 1R3IL 1BVKA 3RZWA 1DJXA 1FIGL 1MRFH 1RUML 2NXZD 2ZT9C 3ARDC 2NXYB 3CDYA 5EIQA 1OP3H 1T4WA 5IJKC 1J5IA 4OZ4A 3VWKC 3QHTC 2NY2C 3Q3GB 1CC3A 2FD6H 2RFXA 1H3WM 4PVBA 5IT2L 1A6PA 3LXAA 1UM5H 1OF2B 5IHWA 1A7QH 3VFSA 3QCUL 1M1SA 1I1AC 4HC1H 1HXKA 1RQ5A 3EDKA 4N0YL 4Y9BA 4CRPA 4YDIH 3JTTA 2H6PB 4EIBA 1XIWD 4ZUTA 3EYUH 1A5FH 4OGAD 3SYOA 1MFBL 4NRZB 3EHBD 4IJ3B 4PJDB 4LCYB 1FAKT 1MAJA 3ZYOA 5EU7E 1DJGA 1NCCL 4U1SB 2YEZB 1KC5H 4YLQT 3WNMA 5L2KA 1BZ7B 3PAVA 3VRLF 3PP3K 4AKQA 1IZKA 3TCTA 1JPST 5ABDE 4RRPA 4U1LB 1NGXA 3CHOA 4QRPE 3HG1A 2Y72A 5C0BA 5CJOH 3BRGC 5HI5C 3ISRA 3ZL2A 5DRZB 4AVIA 5IHLB 4LLDA 5J12B 4AIEA 1TQSA 1S7QB 2BNRB 2OI9B 2AJYL 4S0SD 3GMOA 1E4KC 4DWHA 5IQ9A 3S34H 1F18A 3IFPA 5I74B 1KBKA 3V6ZA 2I27N 2VAAB 2VDPL 2PO6A 1XGPA 3DSNB 3S3CB 4NOFA 4WQOA 1U4EA 5I1CH 2EXSA 4OI8A 1FA4A 1U8IA 4BWWA 4BE5A 4PW3A 4PRIA 2R0KH 5GGVY 3V5DA 1I53A 2HLEB 4RMRA 3WIIL 7FABL 3QI9C 3BDYL 4LASH 4FF9A 5AW7B 4HUVA 4E5XG 2CDGA 5CD5C 4JPVL 1JFQH 4MAZA 4Y19E 3TPUB 5JZ7C 4OZFH 1OT2A 4OGQC 1CLZL 2VZSA 5HHMB 4G9FE 1IAKB 1TENA 2ZPKH 4I3SH 3EF7A 1HYSC 3CH1A 5HY9B 2L7JA 1I82A 2KERA 1FZOA 1XV8A 5T1MA 3TFBA 3WO3B 2GIYA 4U1JB 3CFIC 1A21A 5I26A 5E9DE 2IWFA 1YJDL 1CK0H 2XN0A 3QNYA 4P5TC 1L0YA 1V3LA 4FKKA 1BD2B 3HZKA 4J1UB 1BWWA 2XN9B 5FXCH 4XBMA 5DRNA 5KVGH 2PPEA 4BRVA 5T3ZD 5JXAH 2OPCA 4A6YA 1MUJA 3NIGF 4QXTA 1MXGA 5BNXD 1ZVSA 4UNUA 1P6WA 4PJAA 5DZOA 5TK4A 1MZYA 2DQCH 5BXFB 1PS3A 1ODAA 2CO3A 5D1XE 3T09A 2WXRA 1T3FA 2R0ZL 5C0GA 4TULL 4B5EA 1XL4A 2WK2A 4KI5C 1OCOB 1G7QB 1L0QA 2IALB 1JP5A 3TBTB 4Y2DA 4G6KL 3TXAA 4XCYB 4OZGB 1IT9L 3JWOH 3RWHA 1UURA 3LNDA 5DD1H 3BN3B 5DD3H 4FKEA 4Z7UB 5L6YH 4GG6A 2XTJB 3M86A 3ARBD 3JWNE 4E9TA 5JIIA 2HT3C 3ZE1E 5EU3A 2AQTA 1GOFA 3DMMC 4N5ED 2F5BL 4NN7B 4RIRA 2DQTL 2A4ZA 3GSQA 4G7VL 2H2SD 2EUVA 4ZJ9A 2QGBA 3IRZA 1I8KA 1V55B 5A2BA 1RZJL 1YG9A 4JEGB 1OARL 4KC3B 3O6LH 2EKSA 3QCVL 2X6BA 3JZ7A 3HG0A 3TLRA 2QSVA 3QUYD 43C9A 2DQJL 1LP9F 3JVGA 3JWDH 4P4KA 3V0HA 3QPQC 2I9TA 2HKFH 4F1ZA 3OLGA 4P5MA 2R0LL 5FGRA 3GHBH 1FZMB 1UQSB 1IILE 3MX0B 2HRGA 3AY2A 1G5GA 4QEGA 5DJ2A 4TUJA 4MS8C 1GHFH 2R8SH 3OKKA 4L3FA 3RFZC 1BX2A 3H9HB 2COQA 5DJAB 3WL9B 1IEBB 4G6FD 2NY3C 1MN4A 2V7NA 3M1CA 5EUKB 3ZE0E 2FT6A 3D06A 2OYMA 1NDGA 5I8KH 3V6OE 1H15B 1S9KC 4QUOA 4A63A 5I1AB 4XI5D 1HH9B 1A7RL 2Q86A 4X8JA 3GRWA 1BOGA 3AQYA 1PU0A 3STBA 4OCRL 3RL2A 2APWA 2V37A 3QEQB 4XAKE 4JHZA 2WHVA 4A2DA 5JYLA 3QS2A 4JUSA 2ERJB 4RMVA 2W0FA 2KQNA 2GEQA 1KJMB 1O6VA 4PLOB 3U1PA 1QMUA 1BQHB 3A4EA 4YDZA 3MV7D 3T0EC 3OAWA 4J4PD 4ZZKA 2NCEA 4PRNA 4RBPK 3IF1A 2P48B 5TDNB 1Y6MR 3AS2A 2G4GA 1JPFA 4IDLA 4CJ1A 4PJCE 2OJZL 4P9HC 5AW3B 3BC9A 1NEZG 4LCIL 1Z3GL 2NNXA 1DQVA 2J21A 2V8MA 3K3QA 3O45A 4QO1A 3B3BA 4KRLB 2EH8H 3ES6B 1KJ2B 4PSPA 3T0XA 5KBKA 4M7LT 2ENYA 4KITB 1UD2A 3SDXA 1X4ZA 4Q2ZB 3VXTA 1CBJA 1G84A 4MCNA 2I07B 4F57L 2NY7H 2LQRA 1LNUB 1XF3A 4JGNA 5KEZA 1NCNA 4W9ZA 5LN8A 1H8LA 5DZ9A 1ZGLP 2E9JA 3MRLA 1JNNL 3CVHA 1CTMA 4FZEL 4JY4B 5CGMA 5HDQL 2PWEA 2XC8A 3AU1A 4OF5A 4KAQH 4NYLB 3HZVB 4HWEH 1KIQB 4M4RB 4UQCA 5DYOA 4QXUH 4Y4HA 1PX3A 3P9MB 3VD7A 1Z9LA 1J5DA 1MFAL 2N56A 1OB0A 4AMKL 5J9PA 5CJXA 1EGJL 3STLB 2WMPA 3NJLA 3PY9A 3JUYA 3LDBC 4WSJA 4J3VA 3ZYIA 4XE0A 4PRHB 5C08B 5KYNA 5IESH 2K6WA 3NEEA 5HPMA 1OSYA 1XXFC 5ILTL 3U6XS 4FQPA 4KY1H 1IU1A 2ADGB 3L4WA 4FQIH 2YXWA 3C87A 4NQVB 3I2CL 5GRWA 4MJ5A 4H1LH 4JN2B 4XBEL 5F1SA 2CBOA 1XF4A 3LN5B 1TZOA 4F9PA 4N86A 4JFPB 5CEYA 3NAAL 4PJXF 1WK0A 1K8IB 5C07D 1BFOB 4QI3A 1JHLH 1DANU 4I2XE 3EOYG 5EBMB 3RWEA 3ZKXC 1I7RB 1SUJA 2Y7OA 1A2YA 1MG2C 3IJEA 1X6LA 4XVUC 3ETSA 4L3EA 3W39B 2V5TA 4MVBC 2ICEC 1OWWA 4OZHE 4ONFL 4IS6B 4KKBC 5J1AA 3LS4H 2OSLA 1MG3C 2PP9A 2G2RA 3WTTA 3WNIA 3SCMC 4ETYA 1SJMA 5L88L 3DYPA 4QHLB 4FXLA 3OAZH 1KG0A 4NQSB 4HP5A 3KGTA 4AGOA 4F3FB 3MRHA 4ANWA 5AB9A 2W38A 4WUUA 4JLRA 5DJDA 1A4AA 1BCIA 1ZVYA 2YRPA 2E4TA 1D2PA 2JELL 1ET5A 3F6IA 1I7UB 3GSUB 5EC2A 4FNTA 4L4TD 3BH8B 3W38A 5BMFH 2P9RA 1ZKAA 3E2HB 4ZZFA 3US1A 4KPHL 1RKRA 4R7DA 1RZQA 1D9KA 2BSTA 3GMRB 1P4IH 2WXFA 4M7LL 5BVPH 5IFJB 2DH3A 4JFQA 4TSAL 5HGDB 1O7DC 1KENL 5BRZA 1W72B 3ZT6A 2HCZX 2RR3A 5BRQA 3QDHA 4LDLB 2ZAGA 4ZOBA 4F2FA 3W82A 3UCRA 5LB1A 1PZSA 4MD5A 4C83A 1G9NL 2JVUA 4YVUA 5H37A 3TO4D 3VXMD 4EDWH 3S3PA 4Y2NA 3QJVB 4FAAB 2DYPA 4MJ6B 5C0EB 4GAGH 4A7VA 2VERA 3JWNH 3U82B 5KBNC 2TSAA 3OXSB 2E4FA 1YYCA 4DN3H 1VFBB 2F5AL 4L8BB 2JK5A 3D1MC 4H8VA 3D6GA 2YKKA 3JVGC 5CXPA 4JFEB 4YHNB 4M4PA 3UTTB 1MDTA 3WFBH 3IM1A 4LSUL 2FX8H 3EDFA 5KG9A 4D3CL 1U8PB 4JHVA 4OJYA 4ZMPA 5CBAB 1OGTB 4NM8L 2X9YA 3SE4C 4MCMA 4HLEA 3ULVE 3BFOA 6TAAA 1ZANL 5SWQB 5JXED 4UZUA 5JHBA 2KDYA 4BSJA 5HHME 3MJ9L 3OG4B 5AVZB 5CZXD 5GZOC 3E80A 3QZBA 3TA3B 4XCNA 3LEVL 1DR9A 3G9AB 1G7JA 1PCXA 5EEXA 5L9DH 4HYTB 5ADOH 1F1AA 4C56E 4YK4C 2AZAA 2IGFH 2QBWA 3PF2A 2J8UA 4RLDA 3HS0A 3NP4A 4UTAH 1Z5HA 1RIHH 3QDMD 4GIPD 1EAOA 1MWAB 1JDDA 3U4KA 2AQSA 3TH3T 1BD2E 4U1NB 3FTXA 3L3IA 1FNSL 3A21A 4Z7VE 1X5AA 4B9IA 4DN4H 1ECZA 4OJFH 1B6UA 1PY0A 2CM5A 1N4XH 5E8EA 3IMTA 5F9WC 4YDLB 2M26A 2WQ8A 4XNMA 4YPJA 4I77H 3FQWB 2ATKB 4LVHB 1YEDA 2FR4A 1FYTA 2HFEB 1AGDB 2E7LC 1N67A 4WDIA 2EVHA 3GUTB 1OXYA 5CLYA 5JQ6L 4WCYH 2XQBL 1FLRL 4JE0A 4OZGE 3RY6C 3WAKA 3RWIA 3DRQA 3IGFA 4FQ1L 4R7XA 2YK1L 3P4MA 4EDXA 1MREH 2XTJE 1BVLB 3MGOA 2YPKB 4XBGB 2X6MA 1RIUL 4BE6A 2AQRA 4ABVA 4XPTH 2NXYD 3LRSA 3GLEA 3Q44A 2E59A 4I4WA 3O3EA 3FT3A 4JRXA 3KWVA 3OKLA 1SM3L 3BPOC 4WJ5B 2VXUL 1JPGA 1FFQA 5A2CA 5H4ZA 3UYPB 4Y8DC 1UOKA 4M8VA 4AH2A 3KJ4C 1KYOJ 4AQAB 4P04A 3O6KL 4KUZL 5A6MA 3AQDA 2ADFH 3K2UL 4LIQL 4LPTA 3DOSB 3B9AA 5FLUA 1SY6L 3CUPA 1XEUA 2FSDA 3N06B 1XH1A 2L04A 4FZ8L 2WXLA 1AD0B 2JCCB 3QH3B 3LSOA 1ORSA 1G94A 4HKJB 3P54A 5JNYA 1UCBH 5IMMA 1U95B 2FK9A 4NKOB 1I3RB 3UZQB 3S5ZA 3ZE1F 2A9ML 4Y9EA 3D7PA 2ID5A 2NSMA 3GI8L 2CHXA 4NO0D 2E74C 5I5RA 3KJ6H 1KLUA 5BQ7A 4JFTA 4DKDC 5EF1A 2R69A 1P4UA 1TTUA 2WVTA 4PRBA 5DQJB 3HPLA 1URZA 4TSBH 3Q6GL 5C0DA 1CGWA 3QEQE 1NOAA 1CLYL 3V4VB 3NUKA 1KLFA 5IG7A 3TONA 2BNRD 1BQKA 3RGVB 2X6VA 5DK0B 1B9KA 1U8JB 4QF1B 5L7XH 3D0VA 2Y6SD 1ICTA 5GJSL 1KDIA 3Q01A 3PAZA 4BUGA 1X7TA 3BWUF 3QORA 4PV9B 1BQLH 3MOAH 4JANB 5D2LF 1WP6A 2N4IA 2WPGA 3VI3F 1IUZA 5IP4A 3D39B 3MV8B 1T03H 3TZVC 2NY4C 2OTPA 3GRGA 3ROLA 5FIEA 3FJTA 4KDTA 1WDAA 2Q0ZX 3PNRB 1DQTA 3QUZC 4HCIA 3L95B 3S5LB 5C2UB 5JW4Q 5IHUH 4AW4A 2NR6C 2OX5A 1YYLH 2XIIA 3L5JA 3FQ4A 2A6IB 2XN1A 2APXA 3ARXA 2VUKA 4G1EB 4GFXA 5L4IA 5D7IA 4RSVA 1OGAA 4H0LC 5HHMD 2P45B 5BUAA 2WUBL 4YDVB 1I8UA 5FW7A 2DYSB 1NGQL 4HUXB 4TNEA 4JM2D 4RGNB 1SNRA 1TZIB 3BP4A 3UBXB 4C54A 1B4JL 1JJUA 1WA0X 2OMVA 1V54B 2JTYA 5FDYA 1HHIA 3IMUA 3MFFB 3FN3A 1S7VB 2XN9D 5HVHC 1OLLA 1NCAH 3PYCA 4AQEB 1T66D 2E56A 1O6TA 3MRPA 5JUEL 5KVDE 1NSNL 4P2CG 4XMPH 3LKQB 4Z7NB 2DWEA 1C5BL 1UWEL 4IOFC 4F9LA 2DJMA 1U6AL 3L9YA 4J6IA 1IEHA 3JV4A 4MJJA 5C08E 1MHHB 1SEBA 2FBOJ 2WVSA 4K71B 3UX9B 3OX8B 3D07A 4ODTH 4FABL 1JPTH 5T33L 2YQ2A 2WQXA 4YSPA 4WK0B 2YFNA 2Z64C 2A0LD 2QADC 2FLBT 5AAWC 4NIYE 1YA5A 4Y5VB 3TJHC 1W6WA 4H13C 1HHGA 3K46A 3EYSL 4PH8A 5AVYB 1N5AA 3MBEB 2AQPA 5EB9A 5DMGC 2ITDB 2ZXCA 3RQ3A 1NJ9A 1XSJA 4XMLH 3LKRB 3HMXA 1N26A 5AW9B 3RZCC 3R19A 1SQMA 2YXVA 3I84A 5LGJB 2KZKA 4NNYB 3QRGL 2VL