3NJLA

D116a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis, at ph7.5
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPAPQIINRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njlA00
3T6XA 1IC0A 2BHFA 2BZ7A 3CVDA 5I6PA 4UANA 4KNUA 2H3XC 2GB2A 1A4BA 4GY4A 3EHBB 1W8EA 1NIFA 1L9QA 4HCFA 3X1NA 1ASOA 1BXVA 3WKQA 3MBWB 3RYMA 3EH4B 1KBVA 1AR1B 3OMNB 2IH9A 1CYWA 3FU8A 3T6ZA 5I6KA 3NJFA 2YAMA 4DP2X 1HFUA 1EHKB 1IBZA 3AG4B 3DIVA 4RH4A 5PAZA 4AKQA 2XVBA 1UATA 2UX7A 1YLBB 3WI9A 1BQ5A 1OCOB 5AFAA 2DWSA 3V9EA 3OQRA 4YVNA 5F7BA 4AKOA 4AX3A 2HX8A 3UGEA 1GS7A 4DP9X 1NWOA 2VM4A 1NZRA 1A3ZA 1IUZA 3IN2A 1SFDA 2GSMB 3CVBA 2FQDA 4DP8X 4BXSV 1ET5A 4PCYA 4HCGA 2B3IA 2W8CA 3NJNA 2EILB 3C75A 4A2HA 2I7SA 3S3CB 1BYOA 5B1KA 2YAPA 5I5IA 1OE3A 1V55B 4YSDA 1CC3A 4Q89A 4E9YA 1WS8A 2FT8A 3DTUB 1RKRA 3TA4D 2DY2A 3HB3B 2BO0A 1ID2A 2FQEA 1KDIA 3ABLB 2VW7A 3PAVA 7PAZA 1V54B 1GY2A 2TSAA 2HLEB 3FYIB 3PLYA 3DKHA 4HHGA 4WKXA 4YSUA 1KCBA 2J5WA 2IWKA 4DPCX 4M4RB 3WNIA 3QJSB 2FT7A 4JHUA 2BW4A 4UAHA 1AZUA 1ZDSA 3QPKA 1L9RA 5B1BB 4A2DA 4EF3A 4DP0X 3UACA 3WKPA 2CUAA 4KOCA 4GYBA 3EH3B 4YSOA 2YXVA 4WTQA 2GHZA 4W9ZA 1L9TA 1NDTA 2HX7A 1B3IA 1M9WA 2LLNA 2RACA 3KW8A 1ASQA 3NJMA 1SFHA 2PP9A 4A68A 3AW5A 5D4HA 1J5CA 2XYBA 1BEXA 3FPYA 2JFCA 2NRDA 1JVLA 1RCYA 3FSAA 1IKOP 5LDUA 2AZUA 1JXFA 2PCYA 5B3SB 3T71A 1PMYA 3NSCA 3OM3B 1L9OA 3NJJA 4YL4A 4E9XA 3PAUA 1DYZA 1J5DA 1SDDA 3CG8A 1EZLA 5TK2A 4CSPA 1OCCB 2PPCA 1QLEB 4KO9A 3FSZA 4YSAA 1SDDB 3H4HA 1W6LA 1TEFA 1XB6A 1TU2A 2B08A 3CZUB 4G7RB 1PLAA 1ZV2A 1OOWA 2QPEB 5AZUA 5FC9A 1BXUA 3JT2A 2GC4C 3FQ1A 2IWEA 1GW0A 2UX6A 3UAEA 1PAZA 2XLLA 3SQRA 1PLCA 3ZX1A 4E9QA 8PAZA 1F56A 1WA0X 4YVUA 1N68A 4KO5A 2EIMB 2BZCA 1JOIA 5I6LA 1BQRA 3QJRB 3KW7A 1AG0A 1X9UA 3HEIB 4FA7B 2GI0A 1JXDA 2PPFA 2IDUA 2J56A 1GSKA 4BWTA 1OCRB 1MDAA 2DYRB 2XV0A 4E9WA 2FTAA 2FQGA 2PLTA 2HZHA 3H56A 3PPSA 2IDQA 4K9JA 2X87A 2QDVA 3SBQA 2YXWA 2R7EA 3UAAA 3NSDA 4NERA 1JVOA 3UADA 4E9RA 1L9PA 1BQKA 2R7EB 3GDCA 5I6NA 2TSBA 1RZQA 5I28A 4KNSA 4E9TA 2DWTA 1NIAA 2Y1AA 2FWLB 1ASPA 3TBCA 6PCYA 2BWIA 3TU6A 5I6MA 1BYPA 2CJ3A 3SBPA 4GP5B 2UXFA 1WAEA 2WO3B 2HXAA 1T5KA 3FS9A 3FU7A 1A4CA 1E30A 1AOZA 1L9SA 1NTDA 4HCIA 1AACA 3FU7B 2W88A 5B1JC 4FAAB 1PF3A 1ET7A 4GP4B 3L45A 5D4JA 1NICA 1NWPA 3H4FA 2FJSA 4QLWA 4Q8BA 1SHXA 2XUWA 1J9TA 4P5RA 2ZWNA 1PY0A 2CCWA 1JXGA 1GR7A 5B7MA 1JZGA 1JZIA 3IEAA 6PAZA 2EINB 1AG6A 2H5UA 4A67A 4A66A 1NIBA 4BK5C 2I7OA 1BAWA 1KDJA 1JZFA 3GXUB 4L0PB 3OD3A 4HAKA 5PCYA 2EIJB 1V10A 5ANHA 4G71B 2FNWA 3X1FA 2Q9OA 5D4IA 2ZXWB 1A8ZA 4YSQA 4G72B 2H47C 3NSFA 2VSKB 1XMEB 5EHFA 1MG3C 4DP6X 3AG2B 2JKWA 2EIKB 3N2JA 4GXFA 1DZ0A 3NT0A 2VM3A 1ZIAA 2I85A 4DP4X 4HIPA 2IDFA 1ILUA 2A3TA 3QJUB 2VW6A 2YARA 2VN3A 3BQVA 3G5WA 3FT0A 3NJLA 4KNTA 1CYXA 1PLBA 5TK4A 4HALA 5E9NA 2WSDA 4AI7A 3JTBA 1KGYE 1ZPUA 2OV0A 2XX0A 3ZDWA 4E9SA 1J9QA 4P5SA 1JZJA 1FWXA 1KBWA 5B1AB 4F7KA 5AKRA 4F2FA 2PP7A 3FSWA 4HHWA 4BDVA 1SF3A 2N0MA 2P80A 1PZCA 1GYCA 3U25A 1AS6A 1BXAA 4BWUA 3N55A 4BDVB 2XXGA 3NYKA 2CBPA 3UABA 4A2EA 3FYEB 1URIA 1X9RA 3NJKA 4BXVA 1JZEA 1E65A 3WIAA 3T9WA 2XV3A 2ZONA 4ZK8A 1TKWA 3FU9A 2UXTA 1JZHA 2CALA 1OF0A 4TXVB 4N4YB 1AS8A 5I5MA 3AG1B 1WA1X 3ABGA 1TEGA 4PAZA 2PPEA 3ABKB 2XU9A 2VMJA 2JXMA 1AANA 2OJ1A 4M3HA 4A2GA 5I26A 1FFTB 2MTAA 3CDZA 3NP4A 2AANA 3IBOA 4YSRA 4YSCA 4BWWA 3QJTB 1SHWA 3CDZB 3X1GA 1OE2A 1QNIA 2FQFA 2BP0A 2HRGA 3FQ2A 4G70B 1A4AA 1OV8A 1SJMA 2P80D 1KYAA 1N70A 1NPNA 2XWZA 2BP0B 4NB7A 3FPXA 1KV7A 1R1CA 5B7EA 1A65A 1ZIBA 4DPAX 4YSTA 2AVFA 1NPJA 3PCYA 1GS8A 2YAOA 1J9SA 3TBBA 3S3BB 1GS6X 4DP7X 1ETJA 1E5YA 1W6WA 2VSMB 1AZRA 3FQYA 3NSYA 1VLXA 5I6OA 3AY2A 3ZIYA 1CUOA 2PCFA 2PPAA 2GBAA 2YQBA 1XB8A 5F7AA 3WG7B 1ADWA 2GIMA 2CAKA 2IDTA 2YAEA 4DPBX 1XB3A 4AZUA 1AZBA 2J57A 4G7SB 4KO7A 4DP1X 3EH5B 3QJVB 4CSZA 1WS7A 1KCWA 1AIZA 3OMIB 2XV2A 1MG2C 2PP8A 1JERA 1FA4A 5B7FA 2HX9A 4X4KA 1I53A 1IBYA 1AS7A 2IAAC 3V9CA 1E67A 3X2QB 5I5JA 3PAZA 3SBRA 1NINA 2MRYA 5IY5B 2PPDA 2ZOOA 3ABMB 3ASOB 3NP3A 2IWFA 4YSPA 2YAFA 2BW5A 3EF4A 1PNCA 3IN0A 4GP8B 1MZZA 1GY1A 1SNRA 2AZAA 3S3DB 1ILSA 4F2EA 3NJHA 3QQXA 2VW4A 1OE1A 1J9RA 2YAQA 1PZAA 3ERXA 3T6VA 3NJIA 2UXGA 2Y69B 1E5ZA 2QPDB 3AZUA 1PNDA 1AZCA 4N8UA 1RZPA 3NJGA 3ZBMA 1NIDA 1M57B 4A2FA 2WO2B 1AQ8A 2XX1A 1NIEA 2HRHA 4ENZA 9PCYA 4W1TA 3OMAB 4YSEA 4KO6A 2Q5BA 4JKNA 3CVCA 3GYRA 1AAJA 2BP8A 4HZ1A 3X1BA 1OCZB 2YAHA 2DYSB 4UF7C 3TASA 1CURA 1ET8A 1WA2X 3S8FB 1PZBA 2BP8B 3D12B 4G7QB 4AKPA 3AG3B 2FT6A 3QJQB 3BVDB 2BWDA 4MFHA 1MZYA 3ASNB 2QDWA 7PCYA 2UXVA 1PCSA 4KOBA 3T6WA 2J55A 5B1JA 4YSSA 4JHVA 2GC7C 3PXLA 1HAUA 2OCCB 2XXFA 1AZNA 3MX0B 1ZDQA 1QHQA 1HAWA 2DV6A 1SF5A 2X88A 3X1EA 4DP5X 4E9VA 3S8GB 2E86A 2IDSA 3FSVA 2QT6A 3IE9A 4NAJA 4QKTA 1M56B 3WNJA 5A7EA 2IH8A 2AFNA
chains in the Genus database with same CATH superfamily
1I8KB 2DLHA 4FJZA 1IC0A 1VGKB 1I85C 3I02A 5MHSD 3CVDA 5IB2A 4XOEA 4FQJH 4WU5B 4MNQA 3Q1EA 1OAZH 1AXIB 2HTLC 1F4XL 3WO4B 4MZ3A 5L4MA 4HK3J 4FABL 1NANH 4IRJC 5DSCB 4GQ9L 4NGHL 2AQTA 1NDMA 4AGNA 4UDTB 5J3HD 1CK0L 4LAQH 1X5XA 3DBXB 4PS7A 1QSFB 4NRZA 2FIKA 2ZCHL 1B90A 4JFFB 4X6BB 1IBZA 1LE9B 3B3BA 3VD2A 3GBEA 2UX7A 4EN3C 5KEZA 2B59A 5JIMA 3CC5B 3I9IA 3HS8A 1NCDH 1OCOB 5AB9A 1JN6B 5ACMA 4FQQA 2DQGL 3IMSA 3IT8D 1XF2A 3KYOB 2OX5B 3OR7A 5HGDB 4Y4FB 1DR9A 4BH8A 4JGNA 3GRBA 2HB0A 4YFDB 3CVBA 1WUNT 2IGLA 1F3DH 4QHPA 4F57H 2W8CA 3S37X 1HEHC 3ARBB 1BQUA 4OFQA 4O51A 3TA3D 5DHVB 5CBEB 3KCPB 1PVHA 3FBQA 4XPGH 3QORB 3U48A 2XKNA 3SJVE 4WU7B 4BQBA 3IM1A 4PIRF 4K94H 5B1KA 1OWWA 1AGDA 3F7KA 4NZTH 4KRPD 1G4MA 4WNQB 4U1MB 5B38B 4KKZA 3GSXA 4HIJA 3GJFA 3AT0A 3UTQB 1EAOA 1HZHL 5BW7A 1GY2A 7PAZA 5D1XB 3FC8A 3VXSB 1QRNE 3KG5A 3WELA 3ZT7A 4FHKA 2OL3H 3SDCA 2VDPH 3BPCA 3GHEL 2Z7YA 1RJZA 2Z64C 1IM9B 1KTBA 4ZMLA 3ZHLA 3GLAA 1IX2A 3P77B 4MBRA 1FF5A 4XMKL 2G5BA 4IU3B 5FUOL 1I7TA 3U0PB 2A9AA 3BRGC 3JTTA 4HSQA 5HY9A 5DF0A 5KSVB 4BHUA 4L8BB 2HX7A 4M6ML 2DLGA 5CBAA 3JWNC 3TCLB 4ZW8A 3ZKQD 5CFHA 5FYJU 3BAYA 4G83A 4L8SC 1XCTA 1QFOA 4BHUI 3LXAA 1KZQA 1RJYA 3MFFB 3MBXL 5D5MF 5JHMA 2VSDA 1SM3L 5ANMA 3IKKA 3I74A 5F70A 3QORD 1FC1A 4OGYL 5I2IA 3A21A 4N6RA 5F7HA 2WIMA 3ESPA 2EEXA 4X7SL 4Y19A 2EABA 4HGKC 1UEYA 4YX2L 5B3SB 5J6GB 2FHCA 3EO9H 2XWTA 3ARGB 3FF8A 4N2MA 4LPCA 5JZ7D 3SIKA 1T21A 3U1PA 2KHAA 4FRWA 1KB5H 1SY6H 4FTVE 4BA0A 2CMRH 4K3DL 2XWDA 5KVGE 1FLRL 5TK2A 3EDKA 4L3FA 3CFKB 3OB8A 3Q2VA 2V5TA 4FQPA 1TU2A 4N2AA 3VXSD 2P4AB 5E9DA 5FYLE 3F65A 1KB9J 1PLAA 2X9ZA 5AZEL 3VFUA 2R1YB 1IM9D 4LDOB 5LB1A 3TM6A 4PUBL 5CSZA 4H1LB 2E7HA 4NBXB 2VLKE 1U2YA 3GO1H 5IW1B 4H8WL 1QR1A 3B3IB 1MNNA 1WA0X 2DQEL 2WW8A 2H8PB 3UG5A 4BK8A 4HUCA 2ATKA 3FRPA 3QUYB 4FQ2H 1N8OE 4QRFA 4L5FE 3BKYL 2LHAA 4JO8A 5KN5B 4G11A 4URKA 5EU6D 3VDCA 4JZNA 3GLZA 4DIXA 4XTRC 3F7RA 3CLFL 4GH7B 5K5YA 1A5FH 1S7UA 4RQQA 3W39B 5HI5D 3P4NA 4X5WA 3D7PA 2BIOA 3K6IA 3EOYG 3O81A 3PPSA 4MAUH 4W6WB 3FQUA 2QDVA 2H7WA 4HWEH 5C0CB 3KPRD 3SJVB 3WLBB 1AGFB 3T65A 3D51A 3WIFB 1ZEAL 5AAWA 2C4FT 4F2MA 2JCWA 3BRDA 4HPYH 5HVWA 5ICUA 3DGCR 1P1VA 2ZXAA 4FMVA 4AMXA 5I6NA 4JPIB 2HMID 1HYSD 2B0SL 5HYJA 4NUGL 4OLVL 3MA9H 1BZ9A 2FB4L 1JDAA 1QBLH 2MJWA 4F7PA 2FYVA 4HXBL 5EBWA 4I9WE 2AXWA 5EU5B 1JZ6A 4H0LC 1KULA 2DWXA 4N0UA 2W59A 2CJ3A 1J0HA 1HWGB 3V5DB 1LEGA 3FONA 1QRNB 3CQFA 4BFFA 2UY6B 1BEYH 5AYUH 1VEOA 4J3OD 5DZOA 2VAJA 2EACA 3H0TB 3L3JA 4B50A 5IROD 3E2HC 4S11A 4EIUA 1BVLA 2L04A 5CP3A 3SSGA 2YKKA 4OJAA 4AE1A 1AACA 4Y16B 4MD5B 1LILA 2EDQA 3QQ9D 2NY2B 5FOBB 1E8ZA 1I31A 1T1ZA 2EKSB 1NICA 1P6FA 3OR6A 4FHJA 3Q8EA 3FHEA 4GG6A 1SEBA 3UP6A 2XA8L 3N9GL 2W80C 3LKOA 4J12A 1YNTF 1YSOA 4UTCA 3VXPA 3KYMB 1H19A 2AGJL 4I7ZC 4XBPA 1OB1A 4NBZB 4AUUA 4EVNB 2VDQH 2DQTH 3ISRA 1H3TA 1NGPH 4JLRB 3L2NA 3UERA 4KMTL 2VLLB 4L0PB 4XAWL 1CFVH 1BIIB 4HUUA 3SCMC 3P9MB 2MQCA 5AOMA 5GRJL 4ZFZA 3V6FA 1S5HA 4L2LA 3WKML 3IDGB 4KVCH 3U36A 4V2CB 5CP7A 4FTVB 1NLDH 4GS7C 4G59C 1B2YA 1FL5B 3PAYA 1EBPA 1NEZB 4L8DB 1XMEB 1H3XA 5BO1L 3LNEA 2E5EA 5EU3A 1NJ9A 4BGDA 4GAAA 3QZWG 4FXKA 4PJEB 4B27A 5K9JH 4Z3FA 3LZLA 5JORB 3UPRA 2ZSVA 2J21A 3EYOB 5A2FA 1Z32X 2A4EA 4L9LC 1CFQA 3FU6A 2VLKB 1K4DA 1YQVH 4X6DF 3B43A 4G6MH 1OP4A 2Q87A 5E9NA 3QXUA 2GJRA 5E8OA 2EVGA 5FM4A 2NTSP 1I4FA 2VXQL 3E3QC 5K9OB 3Q48A 4R83A 2NQCA 4TPRL 4M8VA 1MWAL 2WZPA 3T0EA 1FWXA 2BIMA 2QQQA 1ICTA 2XZCH 1EWHA 3WNMA 3STZB 2J6EH 3DX9B 1EHLH 3ZQWA 4YHIB 4TUOB 1YVLA 2PW2A 3APCA 3HS0C 4BDVB 4KY1L 1L9NA 4XP5L 3ZKNC 1CJYA 2A6JA 3LXBA 3QPQD 4PRHA 1DVYA 4N2BA 2YRZA 4Z7UA 5T1MA 4FTVD 4WFFD 1WO2A 4LKXA 2CKBL 3U4EA 3UCQA 1NC2A 1PPIA 2QFRA 2CIKB 1R46A 2EDDA 1CWVA 1J88A 1ZT1A 3N43B 2VC2H 3T4AC 3VMNA 3RFZA 3JZYA 5FYLD 2X4PA 1HSBB 5EPMB 5SWQA 2LGNA 4H20L 1U36A 4E5XA 1CTOA 5BZDA 4ZO8A 2XPGB 3HI1B 1Q9KB 3PL6A 5KYYA 3ABGA 4NQVA 5JO5A 4WW2A 1MLBA 2NSQA 3H9SD 3AQZA 1O5PA 1HEJC 1FNSL 2VLKD 1UXSB 1OSZB 1RERA 4M3KB 4XVJH 2NCEA 3Q06A 4FXLA 1K2DB 3FULA 4L3AA 4OIIL 5D7IA 3OKNB 4FG2A 3C8DA 2XWXA 4Q7DA 3GSNB 3QG6A 3OJDA 1U92A 3T0DA 4Q0XH 1FNFA 1RK0B 1INQA 2OFQA 3V4VL 3CK0L 4NKOA 4RZCB 1BAFH 2P80D 4XVTL 1I7UA 1A65A 1XXFC 1YEJH 3QH3A 1U3HB 3C6SA 5I0VA 4G6FB 3P9WB 4XMVA 3F58L 4R7XA 4PREB 2VXSH 5DWPA 3HC3H 1AP2B 1KFAH 2OR9H 1J10A 4ZMOA 1BQLH 4FFVC 3V52L 1IQWH 3FO0L 1LP9F 4TOYL 5E1QA 5EIVA 5FS5A 5FGRA 2J57A 5SWZD 4ACTA 4WHCA 5F0JB 4CSZA 4EUPG 3DRTA 5EMYA 4C59B 5IEKA 3KBHE 2EDXA 3K2UH 3KLHD 4OZIE 2XV2A 1NPUA 1KCRL 4AQ1B 1CD1B 3FUHA 4WV1C 1IBYA 4AL8H 4PLNC 3GMPB 3RZCD 3HMWL 1OKEA 3RE0A 1SVZA 4N0FA 1J5IA 1TTBA 2XQBH 3NCBB 2IG2L 4K7PL 1E28A 3UZEC 1ML0A 1X7QA 3NJVA 3C6LA 5CEYB 4HYTB 1GY1A 3CVHB 5DT1H 4C56E 3QHZL 1NDGB 1C1EH 1BSIA 2VUYA 2X9WA 1AQMA 4WUUE 3WOVA 4JFTA 1U3HD 4EDXB 3ZR6A 1UD2A 4G6FD 3RVUC 1KN4H 3WN5A 4XCYB 4AM0A 2ZWSA 3NGBB 4H25A 5FYJL 3DUSB 1MJJA 5CS7A 1J87A 2YSSB 4Q74A 1G9ML 1DVZA 4R7DA 3WKNA 1KT2A 3EYQD 4PJBF 1CLZH 2Y72A 1NKRA 4LCYA 1HL4A 4PCKA 4EI0A 4X99B 3OMAB 2RIKA 1I1RA 2ZZUT 1U8JA 1J05A 4EAEA 3MRCA 5KS9A 4GI8A 2E46A 3L1FA 3SDAC 3VYPA 2JKNA 1IAKB 1SUHA 2BP8A 4HZ1A 5TDPA 1W0VA 1TZOA 2OMNA 1OCZB 2WKLA 4ZUWB 2AV7B 4RX4D 1ORSB 1WA2X 2JELL 2ADIB 4ONHB 5AVXB 1TNNA 1PQZB 3IDJB 4U1HA 5FIEA 5J6HB 3CX5J 4FOMA 1JHTB 4OVUA 5D1QC 3KH3A 3Q2NA 1XSIA 3ATBA 5GZOD 5DS2A 1M05A 3NFNA 3ZE0F 2V0AA 1QBML 4ZQKA 1B4RA 3FUFA 2Q0ZX 2KPWA 1G0DA 4UIMB 3N42F 4DP5X 2QT6A 2ZOLB 3P4MA 1HKLL 4QKTA 2FD6L 5E8EB 2VDNB 4NSKA 4E41A 4QRQB 4S1QH 2FL5A 5C0EB 2NZ9C 2VRAA 4QTIH 1INDH 3VCLB 2NX5A 1QYGL 1OK8A 4EOWH 3GJFH 3DTDA 4WWKC 4Z3GA 5FM5M 1Z1WA 3QZMA 4UUJB 3UMNA 4NN5B 2A0LD 4MCMA 4XBEH 5B3NA 1M2VB 4K07A 4X98B 3PDDA 4QUOA 4QHUA 2UUDK 2F74A 1TQCB 5KZCB 4MA1B 2HT2D 4DP2X 1Q8MA 3AG4B 5JIQA 2HKFL 3MGTB 3RWIA 3SHSA 4YEFA 5JPMC 2DEYX 1UATA 4LIQL 2BCKA 2Q86A 4GRWH 2C8NA 3UPAA 2BH0A 3S35X 4TSAL 1BQ5A 4XC3H 4NFCA 3JVGA 3Q44A 4KMQA 1MCRA 1YNKL 5BVPL 3TO2A 3EGXB 1HSAB 3B83A 1U21A 5FHAH 1FZKB 1ECZA 3WEXB 5CSBA 4FKKA 1TYEB 3U30C 2EDTA 4BM7A 3LD8B 4PEEA 1Q94B 2V2XA 3EFOA 1MCWM 1G43A 2EDWA 3BZEA 1I1FB 3DX2A 3SE3C 4K8RH 1I8LA 3C5SB 3GSRB 2Q1EA 4PJ8A 5C0BE 3ULUF 1HH6A 5GS1C 3ISWA 2K3TA 1HQRB 5EEYA 2IALB 2IO5A 4PJCE 3ARQA 1I3GL 1P69B 3OL2A 4JN1L 4XVSH 2FGWL 1CC3A 4NUJB 5IHWA 3KPSD 2FT8A 2F61A 3HNSH 4Y2OB 5CM1A 4EI5C 3BWAB 4XZUA 5GISL 4U6YA 3QR1A 1IFHL 3OKEB 3FYIB 4JY6B 1OQOA 2BIIA 2DEXX 2L7JA 4NC1C 4BSVB 1C5CL 4LP8A 1MFAH 1A7RH 4HT1H 4JHWL 2JMRA 2NXZD 4LCWE 1PZSA 1WAAE 2AAAA 3QXDB 1CF8L 4YHOL 1JAEA 1XH3A 4KITB 2AK4B 1KIUA 2OW7A 2ZCLL 4GG8A 2FX9H 1UT9A 5BS0A 4DCQA 3PP4L 4YE4L 1T83C 3FN9A 1TTCA 4X8XA 4QRSA 1MJ8H 2AJZA 4WEBL 3ZKMD 3QHTC 1FNLA 1JXJA 1A3RL 4FFYL 5DD5H 1RUML 3OHMB 4RGNB 5JTWA 5HJ3A 4AV0A 2JFCA 1JVLA 4LSTL 4H88H 1F2XK 2CBTA 1UD5A 2XBDA 2AZUA 3O11B 4UQIM 3WJLA 3BSHA 3BP5B 3RWCA 4WO4B 1XIWC 2QLVB 3WNLA 2JB5H 2X2HA 4JKPL 4C56D 1EJ8A 4MD0A 2YPLA 4OLYH 1KEGH 1EPFA 4U1LA 3MLWL 4H44C 4WUUD 5T5FA 2C9QA 5LKNA 4UQCA 4BSJA 3FSZA 2WCPA 4DEPB 1JP5A 4EI6B 3K6SA 1NMCC 4RBPK 4MHHI 3EYFA 1MVFA 3HE6A 2QPEB 3M86A 2BOBB 1HK6A 5IOKA 1IVTA 4LKCA 4X4ME 1XGTB 5CP3H 5I17B 3P69A 3FQ1A 1CGWA 4XP1L 3F04A 3O6FD 5ICXA 1R3LB 3BAEH 5T1LB 3WEOA 1OALA 4E9QA 4OM0L 2YWYA 2GYSA 4PJDE 5JXAL 2F0CA 5H94A 5IVZA 2J5LB 1JRHI 4IIQA 1JPGA 3KW7A 1MPAL 2DTSA 5C0FB 2WIIB 5JHLA 4N8CH 3JV0A 4JG5A 4MTMA 1KPUA 2EE0A 1Y6NR 4GXUM 1MAKA 4AQAA 3VFGL 3V0GA 2YUWA 2CK2A 5GJTL 5EEZA 2KERA 2XV0A 4KC3B 3FN0H 3LNHA 3I6GA 1U42A 3L9RB 4MA3A 2FX7L 3ZSSA 4XPFH 5DMIL 1KJMB 5LBSL 2IPKA 3VFMB 2YXWA 5L9DH 1NBVH 4NZ8A 1QI5A 1A3LL 3MLYL 1MEXL 3OZLA 1DVSA 4OZGF 2NY3B 5D6DA 3FW6A 4PJCB 5EF3A 1AC6A 3DUUB 3DX1A 3DARA 4UU9A 1UD3A 3K5RA 3BDBA 5F89B 1A25A 1N7ML 4L29A 5F96H 4A38A 4ZG1A 1BBDH 3WTVA 5FM5O 3ARDA 1K9TA 1Y6KR 3D9AL 1VACA 3KVQA 4Z7OF 1A6WL 2OMUB 1CXEA 4EQ3A 3DO7A 3ZN6A 1MIEH 3CZNA 3FO9A 1EJOH 4QHLB 4LCWB 2X7LB 3BAWA 3WMPA 4JQVA 4XB3A 4DGYH 3BKCH 2J8UA 4P49A 4HCIA 5HDQH 2VJ8A 1G1OA 4UQ9A 4IDJH 1MN4A 4GSUA 1HHJB 4GB9A 4LSSH 3TYGH 4APQA 1TSHA 3D85A 1OSPL 1D6EA 3C09C 3QYCA 2B15A 2P26A 3TA3C 3K8LA 4LHUA 3SKUD 4X8CA 3CN4A 1M1XB 2WWNA 1F2QA 3HZVA 2FJSA 2X1PA 2VCOA 1BMGA 4QLWA 1IM3A 1T0PB 2JCCF 4BH7B 1X4YA 4KRPC 1NSNL 4XP6L 3WO4C 1HNFA 3HS9A 4G7YL 3OB0H 5BZWB 2DQUL 3IEAA 4LSVL 3TJPA 5HDBE 5J57B 1JNNL 3L95B 5I1DA 1NLBH 2CKNA 2FEEI 2HJKA 4N5UA 5C0BD 5CJ8A 1CFNB 1ID5I 1OW0A 3OD3A 4C54A 2EIJB 2D03H 4JN2B 1ZVHA 1OM3L 4IBVA 3OX8A 5T3XH 3E8UL 5DJDA 3DOSB 4U3XA 1KLGB 5AOJA 2OZNA 3VXUD 5F72S 1ZD6A 3F7VA 4JG0H 1LK3H 5E95B 3SQOH 2JKWA 1A7NH 1CR9H 1OTTD 1WEJL 2XWBA 3EJPA 3OKMB 1LO3L 4BCZA 4U1JB 2WVVB 2QPSA 5H2BB 4P2OD 2R0ZH 5D2NA 3A67L 4Y4FC 4XNAA 3BT2L 3LPFA 5HYQA 1P0SE 4E9LA 3ZE2B 3DSFH 3L6FA 1UWEH 1JCVA 2XTJB 1ZVSB 3ESOA 4HCRA 3ARBC 4GSDL 2XQYK 2FBOJ 1UJ3A 3ELQA 3QORC 4PJDB 2FYYA 3LQZB 3V0EA 3HPJA 1XF3B 1KELH 2YIHA 4M1DL 3IRPX 5A6LA 3VXOA 3GNML 1L0XA 4BFKA 1CE1H 4JO3H 1K5NA 4JW3A 4CMMA 3FSWA 3O6LL 3HMXA 2VDLL 5I24A 1IIKA 2VZ3A 2ZOWA 4N6QA 3V6OE 4WUKL 4ZD3L 3AJ7A 3PHQA 3QUXD 2ICEB 3IU3B 4JJ5A 1P5UB 2G2PA 4NPYB 5D2LA 4BQ9A 4O2FA 4MXWH 4TS6A 4D0DB 3FYEB 1MCJA 3O4LE 7CGTA 5C0RH 3TP4A 4WJ5B 4RISH 1WH0A 3ABZA 2XV3A 4ZNCD 4TVPE 2A7BA 1G7IB 3GK8L 4M7LL 2CALA 2R1WB 4MYWB 2FCBA 1SDAB 3TGXA 4YO0B 4NHCL 3APDA 1UA6L 1I8IA 3OF6D 3GTTA 4PJXF 1V7ML 5CLXA 4XHJC 4YBQD 1ZLUH 4IOFD 3UBGA 4M61B 4CDGC 1Z5HA 4LSPH 2IH1A 1YHPA 3AC0A 5C0AA 2NYKA 5B22A 5KYXB 2WN2A 1CMOA 3EXJA 4L37B 3WFBL 2CCVA 3MRBA 3L3HA 4ZXBD 1E7UA 3ARGC 1JV2B 3PYCA 3T0WA 5IESH 1R3JA 4LSUL 2JLPA 2Y07H 5DTFA 4A6YA 1EO5A 4RGMB 3P11L 1ADQA 2GCYA 3CPLA 1JK9A 3F6IA 2HMIC 1XZ0A 1J18A 3A6BH 1N70A 4DFIA 2XWZA 2CIIA 4XNZB 3OAYH 5GZNA 1ZIBA 5HDBB 4DPAX 5B3JF 2JJSC 2QQKL 1H0DB 4WSJA 5DRZB 5ES4B 1SN0A 1P7KB 3I2CH 4WW1B 3TFKD 4K3EL 3AU1A 1EK3A 1CICB 2R0KL 1JWSB 2DQHH 3BSGA 4R7LA 5DJXB 5E7FA 1KJVA 3FQYA 4HS8L 1SMAA 1WBZB 1C5DB 3RTQA 4AGQA 3OXSB 1GYUA 3QUYC 2Y9RT 4JS7A 1V3KA 2BMKA 2CA4A 2YAEA 1QSEE 1ZLWK 5JHBA 3QQ9C 5HHOE 4PRPE 2NT0A 1DFBL 2X2YA 3D25B 1BXXA 3MLTA 3FH7A 4KHTH 1R6VA 1AIZA 8FABB 3VI4B 3UTTE 1DUZA 4PY7A 4YBLB 5L6YL 3RJQB 2P44B 4OTXL 1UQSA 2IAAC 2WLJA 2DEWX 3RNQA 4NHUA 1DQJB 4G6KL 1V27A 4P04A 4R0LA 4Q6YA 2R56L 5J11B 1KXVA 1JUFB 1NAKH 1LEIB 1HTYA 3ASOB 4BZ2A 2BW5A 3B9VA 3LZPA 1FO0A 4GP8B 1J48A 3HCVB 3F2LA 2X44D 2D9CA 4PTTB 4KTGA 2C7UB 5MEQB 3NK4A 2AQSA 3HUJF 2M2DA 2YD3A 3QIWD 2BINA 4JG1H 3OAWA 2DDQH 5DDHA 4X4ZA 1E42A 2XFXB 3GIZH 2FJHA 1E5ZA 2Z7UA 4QRPE 5KSBF 1PKQE 1YUHB 3MRPB 3PNWB 1DQTA 3X3GH 2HFGH 3I50H 3GLDA 4IGBD 3D0VA 1X5MA 5L0QB 2ZP8A 1FV1B 4P3WA 1ZT7B 4Y16C 1IGYB 2N1TE 5JQ6H 4ORGA 4UIKH 5IHHA 4JHZA 4JFDE 1DQIA 3ILPA 4YGVA 5TDOA 1QPXA 1T20A 2N59A 4KDTA 3FB8A 2CR0A 1NGWB 1RJLA 2XKUA 3S97C 5AUMB 4WEUD 4CVUA 4FFZH 4EUPB 2K7PA 1E4JA 5J1SC 1OTSD 5I1AB 2O93L 4XBGB 3TC9A 3AG3B 4CC0A 2F1AA 4JM4H 4F15C 4K94L 5F1KC 3KYAA 4KZCA 3A6CH 2BNUA 4KOBA 4NZTL 4KPHL 4AEHH 3HHRB 3TO4B 1OAUH 2C3GA 2OCCB 4XODA 3QPQC 4F7TB 1QHQA 4PS4H 4TUKL 1SF5A 3IK2A 5IBTL 1ZLDA 1XHHA 1TZ8A 4OJCA 4NAJA 4ATTA 3LRGA 2YR3A 3QDGE 4JGUA 3BHBB 2CDGA 3DDGA 5E6YA 1CFBA 3GMOB 1RP9A 2R2BB 4UANA 3DJRA 2B9AA 3ROLB 3BIKB 3ESNA 3IJEA 5KVFE 1RUKH 3B6SB 1MCBA 1VADB 4M8QB 3ULSB 5F3HA 1KGUA 3O4LD 1JGDA 3ZL4H 4PLJC 3FJTA 2Z8SA 5L2KE 3GMNA 1E0OB 4D8PB 4TVPD 8CGTA 2APVA 4YLBA 1LMKA 1JF6A 3FU8A 3B2DC 3MI6A 5I6KA 3BPLB 1P6WA 1T2QH 3P9LA 3QUMB 4NM4H 5H35B 2OZ4A 2JQZA 4ZFFA 5J7CC 5FO7A 1M3JA 4OLUH 3SKMB 3VQ2C 1QSEB 4PJIA 4OM1H 3SGDI 4BE5A 5HHOB 4PRPB 1KYOJ 3NZHL 1ZGLM 5IMLB 5A2CA 3IXAB 3BMWA 2ZXGA 5D93C 2F68X 4MMZA 4HU2A 2XVGA 1PKOA 4RDQF 1HI6B 5DUPL 3UTTB 2NNAA 4PY8I 1ETZA 2JK5B 4BXSV 2C4FU 1ET5A 4PGJA 4NUQA 5JR1H 1CT8A 4JDVA 4OCWH 4OIBA 3CXDL 4LLMB 3WE6B 1A2YB 3T8XB 3S3CB 2VXVH 3G5YA 1DQLH 4B7IA 3KXFD 3ZQXA 1WFIA 2CDEA 5IW6A 2UZXB 4LCUB 1MREH 1BZ7A 4KUCF 5T5FH 1KNOB 4OFPA 3LIUA 2VYRE 2Z8WC 1AQDA 2G2RA 2WXMA 4I77L 1WS8A 3LH2L 3HZYA 3MAWA 4L9DA 3K6FA 4YHNA 2BO0A 3GO1L 3TA4D 3CBKB 3W9DA 5JW3L 1KDIA 3G3LA 3PAVA 4PYHA 5ECJE 1H9VA 3LAFA 3DUHA 4IBQA 4K5OA 1K5WA 2TSAA 4L4JA 4G80A 3FTSA 3MLZH 4FQHA 5H37G 1PKQB 3BISA 2OK0H 1DBBH 3WFEL 2HH0H 4YSUA 3ARFD 2VDRH 1R34A 1D9KB 4DPCX 4OCMC 3KLHC 1KIQB 1QACA 2VKXA 4QY8A 3R4DA 4OJYA 1QSED 3MROB 1A5FL 5IOPB 2C7FA 1QNZL 5HHOD 3H2QA 4PRPD 4RRPM 1CB4A 3PWLA 4NRYA 3GS4A 4JO4L 3EJUA 3EH3B 1UC6A 3CSBA 3QNXA 1RIHH 3PQYA 4YXLH 5JHLH 2QTEA 4X5RA 1MNUH 4DH2A 4CNIB 1DN2A 5HVGB 3UTTD 1HIML 1JTPA 2Z93A 4HWEL 3RGVA 4XCEA 4AE0A 3BH8A 4A68A 3P4OB 1JG9A 3N3EA 3DXAB 2WOYA 1KENH 1BEXA 3W0WA 3FQRA 4P0DA 1W8NA 1U3HC 3MJ9A 4MNGE 1MFUA 3EJJX 4HXAL 4L4VB 4Z8FH 5LDUA 2OI9B 2ZUQB 2R29A 3L08A 1UCBH 4YHZH 1A9VA 4PP1C 3NJJA 4YL4A 4XN9A 1E43A 3GSNH 2ITEA 3QDGB 5KVDE 3ZQ9A 2F19L 4XNDA 4POZD 5AYUL 1FI8C 2FBJH 1B4TA 3O41B 3CFJA 5DVLA 4UQ3B 5DMYA 4D3CL 1SDDB 4WI8A 4QRPD 2WINB 3NH7H 2DICA 4W9GC 2XCMC 3VFNB 1GPOL 3MA7B 4L1HA 2A6IA 4AQ1C 5L2KB 3LIZH 3FQWB 4FULA 2QZ5A 1TNMA 3PF2A 1ZWIA 2JI3A 2OMXB 4FG4A 1T0OA 4JFDD 4ZPVB 1D5ZB 4IKKA 4N2KA 1F56A 1J5OH 1G9NH 1OAXH 4YS4A 1AJ7H 3HAEG 4LF3A 1IU1A 3LCYA 5CD5D 5JOFB 4GMSL 5CWSA 3MCKB 3TIDA 2O72A 3UYPB 3NAAH 1CFVL 5DCCA 5E99L 3D34A 4KZEH 1JWMB 3ARRA 4N9GB 3IXTB 4R4FH 5IB4B 4Q6IB 1QMUA 4M00A 4RMRA 3SQBB 3C2AH 4N2CA 2Y1VA 1YN6A 1K8DA 4Q97A 4N85A 4Z3JA 2BY3A 4MB5A 3NGBC 2GTZA 5TQ2L 3VDBA 1EA9C 3SBQA 3QDGD 4A7UA 4AVHA 4PJ7F 3T3ME 4ZFOA 1O7DE 2PCPA 4B5ZA 4R7NA 2YQ3A 2NR6D 4PBVC 2M83A 4E9TA 2HT2C 2VN7A 5F0LB 3P3TA 1MVUB 2DD8L 5FWRA 3QAQA 4QRTA 4BFNA 5FPIA 5MENE 1KBGL 3M88A 5E6RB 1YQVL 3L9YA 4YR6A 5C3LD 3EOTH 1GL4B 2ERJC 2IPUG 2AQNA 3C08H 1DUYB 2P5PA 1GGBH 2CK0H 2D7NA 1U8NB 2IPTH 2K1MA 3AREA 4HUNB 1YYMH 1KC5H 4I2XE 4HCRH 1S7TA 2ZAGA 3SBWA 1P2CA 5LVEA 4RGOL 2NY7H 1UA7A 5T33H 4HPHA 4FAAB 4YPGB 1ET7A 1KLFB 4S1DC 1BGXH 4QTHA 3L45A 5IVOA 5I1JL 1HXMB 3L5WB 2CJUH 2DI8A 3K4AA 4NXKA 3HMXH 5FCUH 4CC4C 4PHXA 4XP9H 3J27A 1G7JB 1IT9H 4BIKA 2X1QA 3S3SA 1J9TA 1AZVA 1RZJL 4P5TD 4KJQD 4TQPA 7TAAA 1OOAA 5LXVA 3E9UA 1GC1L 3EGSA 4FZEH 1C16B 4HH9A 5JW5A 2X1OA 2Z31B 4NN5C 1F5WA 5K1VA 1DSFL 3KGRA 4QHKI 5E2UH 5CEZH 4PU2A 1OGTB 5I18L 5I1CH 4RMQA 3UL4A 2ZKMX 1ES0A 3I9GL 1TQCC 3BWUC 2ZXWB 1NCIA 3K8MA 5LCVA 4WKZA 4XMLH 4HSAC 4WWPA 1A14L 4I0PA 4ELMF 4KBPA 1T89A 4UTAL 2A6KA 1IBDA 1XV8A 4FADA 3KWWB 5E03A 3T8MA 4JCWA 4JAMA 3Q5TA 3FT4B 3T1WA 5D1ZB 5K59F 3EJQA 2CXKA 4QJ4B 5IJCC 3LD8C 3QJUB 3ZKMC 1CU4H 5MEOA 3RL1B 3QJHA 3HC0A 4BFGA 3QDJE 1BAFL 3VQ1C 1NEPA 1KGWA 1I7ZB 4X9YA 3L5IA 5DMJB 3E9TA 4A6YH 5EDSA 1ADQH 1GXEA 1JFQL 5C70A 4ZW3A 1P7QB 4I89A 4D9LH 3TT3H 2YQ2A 2NUPA 4F2FA 4HAGA 4XX1G 2WQXA 5DJAB 4BEIA 4BD4A 5EEVA 2H32B 1JHKL 2VN6A 4POYA 2J73A 3NACH 5JUEH 1EUUA 4RAVB 1P1ZB 4M7ZB 3EO1B 4P5KB 2P7TB 2LFGA 4PR5B 3GPEA 1KJ3H 1NH6A 1S9WB 1IFGA 3V4PB 4JO2H 5GQBA 3ZO9A 1PX8A 2DYPB 3JWDL 3LEYL 4GLRI 1IAII 4UZUA 3T3MB 1G7LB 4F8PA 1A7OL 3NTCH 1HHKB 1MHCB 1CGXA 4PG9A 3O6FC 1QWUA 3C60D 3IMUA 4KJYB 3MTXA 5D5ME 5E1GA 4B9PA 1OEZW 3HR5A 5MENB 4HS3B 4LCVA 5DMGD 1F4HA 2XRAH 4UQ2A 1BM3H 1PLGL 3SDXF 4YHYB 5EORH 4IKNA 4XRCB 5BOPA 2FDBP 5FA4A 1A0QH 4AT6B 2AS5M 1MHHB 4RGNC 2K9UA 3RAJH 5IHBA 3FCBA 2Y1ZA 3FOMB 5CUSL 1MIML 3VFWA 4A2GA 1TIUA 4LGSB 5L4FA 2YA0A 4DQOL 4JZOB 4IJTA 2ZWYA 5E2JA 4WO4C 4CBZA 1UOLA 3FCSA 1ZVNA 2WZ6A 2JE8A 5D6CB 3GGWB 4BZ2H 1FO0H 1UH3A 5CJBA 4F58H 3GSQB 2J7LA 4IEFB 1HE7A 1HEZA 3B2PA 4LVNC 5C0DA 1RK1B 5IW3A 4PPTA 4PJAE 3KPMA 4YOKA 4DEPC 2IXQB 2GAZA 4DVBB 4XCNB 1LMIA 1V8HA 5EOCL 5ACZA 4OR1A 4M1CD 5KBMA 4NNPH 1JK8B 3BGAA 5EN2A 3VDAA 2LU5A 2RCSH 4Y1TA 4EIBA 5FKAB 4JO1L 3LZNA 5B39B 2YQBA 5EC1A 1KACB 1MLCA 2J5LC 5HHVH 3RURA 4NM8L 2F6AA 2VM9A 3I9PA 5GGSA 5ICYA 1R75A 3V2AR 1HL5A 2OMZA 4WTWA 4DP1X 4NOBA 3QA3A 2D3LA 3C9NA 5DEFA 2D7QA 3LB6C 4DTGL 5KBDA 1L7IH 3KS0J 5C97A 5GRYA 1YMME 3PWPA 3QG7H 3NG5A 43C9A 4UWQB 4P23B 5HI3D 4X4KA 1TQBB 1ZHKB 2WVSA 3GI9L 2ZYSA 3ZMRA 1MCCA 5LWYL 5I5JA 2W60B 3H53A 3PAZA 4JFVA 4M02A 3NZ8A 5ISZB 3Q0HA 5CD3A 4X6CA 4R4NC 2G3ZA 2KLSA 3VI3A 3B2MA 3EF4A 2HRPL 4P9MH 3US9A 2ILLA 2R83A 2VLJE 4LNRB 1A9BB 5EO9A 4F2EA 3NJHA 2ZOUA 1IGML 1HXKA 1PX3A 3PWUA 1BFOA 4D7BA 1G7MA 3HKFA 1OTTC 3CFUA 4NQDE 5IHZA 1YEEH 1FJ1B 1TZGH 2DMBA 4HEME 3D06A 4N8UA 3ZZLA 5EO0B 3VXRA 4OD1H 3VD5A 3F62A 2J71A 2VIRA 1GTNA 3QEHA 4AIZB 3BSZA 5J5EA 1NBYA 4JDZB 4U49A 2VDOH 1J0ZA 2XN9B 3KM2A 4Y5VB 4L0ZA 1T0NB 4W1TA 1KB3A 4PJHA 3VXTA 2X12A 3NIGB 3VFVB 3BP6B 3F64A 3UJTH 4PD4J 4AYSA 1I8MA 4MMXA 4JFPA 3DVFA 4X9HA 2CO6B 3NCJL 4LHQB 2GUOA 2IADB 3S8FB 3KBPA 4XCCL 1VFAB 2VH5L 2FWUA 3VX0A 4TRPH 2EEBA 5TE6L 5D7JA 3QDJD 3EXLA 4PJFB 4HDIA 4PWGA 3IMRA 5LHDA 1TVBA 2DM3A 2WXHA 1X5JA 5ACLA 5E2VH 3HI5H 3UMTA 5DJ0B 5F88B 1KB9K 2IDCA 3PABA 1N4XH 2V5SA 5CGTA 2IC2A 4BZ1A 3MRIB 4HKXB 5GGUA 5BRZB 4LK4A 4XB8A 1N5YH 1U8QA 4FZ8L 2G75B 5AKTA 4PJAB 2AXHA 5G4OA 5CMAA 3C6EA 4DZ8B 3KPLA 1OHZA 3KPOB 2NY6B 1RZKL 5HGAB 1AXSB 1A7BA 1SMDA 1JGLH 2J20A 2PO6B 3EHBB 4HCFA 3MNVA 2NQ3A 4DVRL 4OCXH 1RHHB 1N64L 3FQTB 2FX9L 3WKQA 4RFEB 3MRMA 7FABH 4QF1A 4OGXH 1FNEB 1AR1B 1KXTA 2IH9A 4NP4L 5BUGA 1MJ8L 3L5HA 3CE1A 2YAMA 3B1TA 2F53A 4LEOA 3DTXB 4LEXL 1CZ8H 1HESA 2OMVA 2BVQA 2XVBA 3M1BA 3RWEB 4L0YA 2P5WA 1A1NB 5FW8A 2OPCA 2VXUL 2V2TB 3LN4B 5EU7E 4H88L 2PXYD 1J12A 1IC5L 2IAMD 3T04D 3PDGA 3QXAA 1E4KA 1R5WB 3HC4H 2LFEA 1ACYL 4PJ9A 2FJFA 4JE4B 4K5NA 4GINA 2C1OB 1J0IA 3V5KB 4CKQA 1YMMB 4FQ1H 1XIWA 3MKKA 4N86A 3VXQB 1RSYA 1P5UC 3MJ9H 1OSYA 4HJIA 4OLYL 2Q2LA 3KVPA 4ZYKB 1YY9D 4GQQA 3GSVB 1AGCB 5DJ6B 2R29H 2OYMA 2VNCA 3J7HA 4IRSB 1OGPA 5ID0B 1ECYA 3TYFA 2IAND 5E1AA 5E2TH 4X7TB 4G3YH 1ORQA 5FUZL 4J8RB 2HJLA 2VO5A 1AD9A 2NY6D 3BZ5A 1YRKA 4DW2L 1CO1A 2VLJB 3QEUB 3EHBD 1TQWA 5L88H 1A1OB 2EYRA 2G3XA 3BI9X 3FB7B 3H1ZA 2QHRH 1WZKA 1ID2A 3RGBA 1T3FB 4NQDB 5EB9A 3OPZH 1OF2A 1AR1D 3VO0A 4M3JA 2J5WA 1FN4A 5ALCH 1KIRA 1QLFA 4ORZC 4BKLA 5L7XH 2XHNA 4MQ7A 2IFFL 3WS3A 3JWOC 5JW4M 1W8OA 4A7VA 4YHKH 4J5VA 1L0PA 4F80A 4L1DA 4RGMC 4NQED 1JF5A 1NDTA 1NGQH 5HJBA 4XH2B 1I8AA 4U33A 1YMMD 5DD3H 5AWNL 3MCLH 3MLUH 3QFJB 4XNZC 2ZXEB 1XF5A 2M1KA 3QXVA 3L9BA 5E4IA 5FKPA 2Q20A 3IJSA 3FOLA 3L3DA 3P30H 3CFDB 4P07A 2BCMA 4IRSD 4MA8L 3T3PF 2EYSA 4DOHE 1LP9E 3CFQA 3KPNB 5HI4D 1CICC 5TFSL 1PSKH 5D55A 5AL0A 2ZUVA 4YZWA 1KCVH 1WK0A 5KJRH 3CMOH 1OP5H 4WGWB 2OSLB 1QFWI 2VLJD 3M1OA 5TGBA 3SOBL 1CDBA 1DYZA 3K2MC 3PJSA 4NN6B 5LO7A 3WSQH 4KO9A 1DDHA 4WTZG 3SKNB 3BUQA 3LKQB 2JB6B 4IBSA 4CSSA 3SDDB 32C2A 4IKLA 3S96A 1GHFH 4LSSL 3TYGL 2K9FB 5F7WC 2B1HL 4NXSA 4YC2B 1BX2A 3TA3A 4YBLC 2X3CA 1OTSC 1FFOB 4LQFH 3B7UX 5EIIG 2EVHA 1Y6MR 2IWEA 3TF7C 4M1GL 2XACC 4R2GB 5J11C 4GKOA 2EZ0C 4F33B 5DJZB 4CN4A 1BQRA 4MJ5A 4C57C 5JOPE 4U1SA 2R15A 3RDTB 3O3EB 4Z7NF 2H9GB 4LEBA 1U4FA 3GWJA 3RVVD 1E27A 1Y18A 1TR7A 4P9HC 1WRFA 3DX3A 2JJTC 5CHNA 1NMBH 2FECI 1GIGL 3CTTA 5DD5L 4PJBE 3I6LE 4ZUTB 5HDWA 5C08E 1GMEA 2N7BA 4GOSA 5T3XL 3L16A 3V6OC 3QI9A 3ZTDC 4WHYG 1PDKA 3O3AA 5DO8A 3VB9A 3ZY7A 1QQDB 3ARUA 3P02A 2FQGA 4MJ4A 1A9EA 3LKPB 3IDXH 4JG0L 1ODAA 1JNJA 2NNFA 4HKJA 4JFQB 3F00A 1ZANL 5L0QC 4F9PC 3FDWA 2VDKL 3UADA 2H0JA 4ZDHB 1HDMA 4XP4H 5LCVH 5G5DA 2Y7SA 2CR3A 1TZHB 4DAGL 1FP5A 3TTYA 3U7WH 2A73B 4ODXB 5KSAD 3WXWH 4HSCX 4TQEH 2ED6A 3UC2A 4HK3N 4AYMC 2FO4B 4HH8A 2R4SH 4JCLA 3T0AA 1H6FA 1BECA 3MXWL 1OGAE 2YBRA 5KSUA 3DX6A 3SPGA 5HGHA 4BKTC 2EP6A 1M4KA 1F02I 3EH1A 1F3DJ 2HXAA 4Z0BL 3KYNA 1B2WL 1XAUA 4R2GD 4F5CA 3ESVF 2Y36H 1GGIL 1XGRB 2AJUH 3EBHA 5B38A 5HVHB 3UDWA 1QSZA 4NJAH 2YOAA 5B1JC 2A2QT 3QRGH 3RDTD 1ZJAA 1PF3A 3CFCL 3HAEB 1HXYB 1PEWA 4KQ3H 3GBNH 5BMFL 4NIYE 2JKTM 4LLWB 2FWOA 5K9QI 5FO2A 4F7CA 1XGZA 4XX1E 4KV5E 3EDDA 2EUXA 2JTDA 5CN1A 3G6DH 2FIRT 2EDJA 4MD4B 5SX5K 3QPXL 3RHWF 1TETH 1E40A 1CDYA 5ICZB 3GRWA 2OQJA 4U0RB 2YJQA 2I9TA 4QXTB 4DOHB 1N2RB 3BEVB 5C07D 3RY4A 2SODB 3R1GH 5EOQH 2GK0A 3BPLC 4GRWF 5CJQL 4PTUA 5EU6A 3N6YA 4TNGA 5F9OH 2H45A 3U9PH 4BELD 5HYSG 1MFBL 5D8JH 2ZCKH 3FO1A 3K71B 2NQDA 2OMYA 3O0RH 4AQ8C 3ULUE 3BGMB 4HIPA 2AQ3A 2JSFA 2A3TA 3KPRA 1BZDA 1FIGH 1L7TL 3SY0B 4XGZA 3TEXA 4MCZB 1NFDE 4K4KA 3CFKA 3UO1L 3FB5A 2HVKB 3B2UD 1Z0NA 1QTYT 1KGYE 4UBDD 4AENB 4ZS7H 4KQ0A 1Z3GH 4LSRL 35C8L 2Y23A 4GKNB 3FO2B 5IUCA 4JMXA 3I2CL 2Z8RA 2GSGB 2OR8A 3Q9QA 3RWFA 1PEZA 1F1AA 2N0MA 4AH2B 2X89A 5J9PA 4QOKA 4WAFA 5IROA 3H7BB 1J8SA 4ETQB 3BEWB 4DGUA 1KEMH 3M17B 1GZPA 1D9KC 5LGHH 3LZQA 3CXHJ 3K46A 3K6NA 5DJCB 4HIHA 3QO1A 2AJYL 4RDQG 1G0XA 4PB0L 3AWEA 1W2KT 1FH5H 1YEKH 4PRIE 2PR4H 2ZQKA 4RA3A 5IV2A 5I8CB 1BVKB 3IGAA 3EJSA 1OAYL 1Z9PA 4XO9A 5DJYA 1WBXB 2NY4D 3DGGA 3DHMA 5ITFB 1TLMA 3RDJA 1IGJB 1OGAB 4PJGB 2C9AA 4MGXA 1WICA 1UFGA 3DC0A 1CE6A 1FPTH 2A77H 1CDJA 1FG2B 3VGEA 1G7QB 4KTDL 2W9EH 4WI7A 1HL9A 4Y1AB 2KS0A 4IRZA 4YNYA 5BXFB 2OI9C 2LR4A 2E47A 1KCSL 2EH8H 2ZUQC 4Y4KB 4YXHH 5JOPD 2MTAA 2H4EA 1ZSDA 1X7TA 4K5LA 2ZKYA 3QWRD 4HIXL 1URLA 2BNQE 4G1EA 1E7VA 5KVMC 3GIZL 1EDHA 1A64A 2MOQA 3I6LD 4MDJA 5C08D 2BP0A 4P4KD 2DM4A 1A4AA 4XNQA 1G1KA 5J89A 2W95A 3A4EA 4MWFB 2KT6A 1KYAA 3IJYB 4NB7A 4JUTA 1FZOB 1S3RA 3W11D 2HG5B 3FFDA 1MI5E 4KKPA 3N41B 1DJHA 1KTDB 2KYIA 5DVKA 1G7PA 3LNFA 2XZZA 5CSGA 3BSZH 3OLIA 4GSRA 4X5XB 4C4KT 4RIRA 4GG6F 5DA4A 4GIPD 1AD0B 3UZQA 3OKOA 5BZZA 1H8LA 4MMYB 5CGMA 5FOJA 5IFJA 3RWJA 5FYKU 2X4QB 4JM4L 1J8HA 2PCFB 3U6XS 1OGAD 4ZZFA 5C0JA 3BPNB 3G6AA 1TZAA 5BQ7A 4YQXH 3P3RA 1IGIH 3V6ZA 2H6UA 3QJVB 2E9JA 1WS7A 1KLUB 5GIRB 2K6WA 2AXFA 1KCWA 4M5ZH 4MZIA 1X9LA 4OZGE 5HHPA 3MV9B 1AFVL 4P5TC 1CTNA 4Y4KD 3MNWB 4FNLL 4JQXA 2DQFA 1WITA 1NFDB 1K4CB 3P4LA 4Y2DB 3KPQB 4V1DE 2O61B 4PRBA 4D7PA 1R19A 2MTPA 5ADOL 3ROOB 3TVMB 4OCRL 1BMWA 2BSSB 3DVNA 4IYKA 4BZ1H 4PWIA 4R96B 4Z7OE 4ZTPH 5IQOA 4YSPA 3PIQA 2IBBA 4ANVA 3VACA 3H9SA 4DHLA 5ITBH 2AZAA 2BS71 3L4XA 2UWEF 3IF1A 1NCWH 3QQ3B 4E36A 1H5BB 2YEVB 3MRKA 4QGYA 4PRAB 5CXPA 3NJIA 2Y69B 3AXIA 5DK0B 1OLZA 1IEAA 4JKWA 4LL9A 3N44B 5IVXB 1SBSL 2X4TA 3GZOA 2O30A 5F3BB 3FQXA 2Q7AA 5FFGA 4XI5D 3MRQA 3DO3A 5IB3B 4ZOCA 1R33A 1JGVL 4JKNA 1B6UA 4PRIB 4IHOB 1IKFL 3MXVL 1FAKT 1MRCH 2PMZA 3L3KA 3ULUD 1R3IL 5JR1L 1XCQB 1DVFD 4MJ2A 2FUTA 2YAHA 3D2UD 4K23L 2ICWJ 4RAUA 2JLLA 2JV6A 1F1GA 4XMXA 2DWEB 4X4XA 3UTZB 3COOA 3ZDXE 3NZSA 4MFHA 5I66A 4Y5YB 1C7TA 2Z31C 4PWEA 1NL0H 2UXVA 5EUOE 1H3PL 1RFDH 3IGKA 1CL7I 1EFXB 2WQAA 4QXWA 4LU5H 5LQBH 2Y7MA 2F15A 3S37H 3VM5A 2IV8A 2XXFA 2UY7A 3M7FB 5BJTB 5SWZA 1U8PB 3ULVH 3G9AB 1LDPL 1B0GB 3P0VH 1JZ2A 5GS0L 1D5RA 1DVTA 4FEIA 5LGJA 3KWXA 1JRHL 4GW5A 3D3VE 5IFAH 2EO7A 4CUCA 3EYUH 4LDLB 3C60C 4EJ1C 1WGVA 4FQXD 4L23A 2LVEA 1AHWB 4LL1A 5DMGC 1W8EA 2DZEA 4M29A 2GJZA 5D1ZC 3RZCA 2YEZA 3H9HA 3MBWB 4UQDA 4U6VL 4NZFA 4MCYB 4PG2C 4C83A 5JHLL 5BV7L 2B14A 1CYWA 3ZHKA 4N0CD 3FFCB 1MRFH 4Z7VE 2F58L 3WD5H 4Q2ZA 1N0LA 4KVPA 3FAWA 1ANUA 3IMWA 1P7BA 2P3YA 5FLUA 2E7LC 3TS8A 5ADPH 1KENL 2CSPA 2G4EA 1MXGA 2AEWA 2WKOA 4M7JH 4RVBA 3RA7L 1UOWA 3MFGB 3V0WL 3MYJA 3N1PC 2ARJB 3L4WA 3BMVA 3WHXA 4U6HB 1NOFA 4DP9X 4ZUUA 3L4TA 1SHSA 5I19H 1RZ8B 2F54A 4TM9A 1B9KA 2PN5A 2F8VA 1DQML 2V7NA 1FGNH 2YSTA 2YOCA 2BNQD 4V1DB 3IJHA 2FBJL 1DBMH 1UHVA 3W9EB 4XMUA 1YDPA 5C0IB 1KG0B 2AQPA 5ALBL 1D5BA 1OT1A 5B4MC 1OPGH 15C8L 3B1UA 4ZMXA 1NFAA 4Z7OB 3NBNA 1CN4A 2EE3A 4PP2A 5A3IC 1XVSA 3JV4B 4Q9RL 4RX4A 1IKNC 2GUYA 4IIZA 1BZ8A 4KDVA 3ZW3A 3I6KA 3L1EA 5HHQA 1BMZA 2HPTA 2WAHA 1HILB 2XWJB 1MI5D 3HB3B 1WC7B 3ZZSA 3ZL2A 3P73A 3MREB 4I3RH 3RB5A 4YHYC 5GZOA 2RHEA 3V10A 1G9NL 1OAXL 1O9WA 3FCTA 3U79A 2J72A 3RJDA 1ZTXH 3D18B 3INUH 4NO3A 1DQQB 2XBZA 2FEEL 2MFNA 3PWVB 4JHUA 5EULV 4HUXB 4ZMYA 4DP0X 3RPIA 2F9BT 5HI3C 4NKMA 3U1SL 4R4FL 2YXVA 3IETA 3ZGIA 2XNAB 3MUUA 2O6DA 2Y4SA 4OFKA 4AYFA 5GGRY 2LLNA 1JGEB 1G1CA 1UUSA 3BDYH 4S2SA 1W91A 3P54A 4WI5A 1S7WA 3WAKA 4ZFGH 5H8DA 1YJDL 4W6YB 3ZDXB 4QEGA 2ISDA 3FT2B 5FGCE 3S48A 3AS3A 4V1DD 3DIFB 3F8UB 5D4HA 4PGBA 2Z35A 3OHXB 4UM8B 5EUOB 2AJXH 4U6TA 4G8EA 3T2NH 3Q43A 5C92A 5IQ9B 5IFHH 1XSKA 3L5XL 2AV1B 3W56A 4NENB 2YPKA 5BPPA 4PWKA 4AJ0A 3NA9L 4JM0A 5LBVA 3DURA 3M6DA 3IKCA 4N87A 5KVEH 3QDMB 2IPTL 3D3VB 1ZLSH 3DA0A 4G7VH 3CUPB 3LKSA 4AMWA 1QUNA 1KC5L 4NDMA 3LH9A 2VLRE 3KPTA 3PUUA 4ZAKB 3T5WA 1BVNT 2OYKA 3H4HA 1MFCH 1A7PH 3L4VA 4OSUL 3SYPA 1LD9A 4N2HA 4ZMPA 3DVGB 3HBZA 3QNYA 1DTUA 4TULL 1UWXK 3A6OA 1S5IH 2ICCA 1IBHA 2JVUA 2Y22A 4P23C 1TQBC 1SN2A 3D87B 2WY3B 1V7NH 4Z7VB 2C1PA 4HBQA 1UXLA 1JPSH 3MOBH 4YVUA 1J1XH 2WWKT 1XCXA 3KPSA 4AMKL 5FDWA 4B9GA 4JRFA 1EXGA 1TO5A 3O45B 3GXTA 5DQ9A 2D7PA 3DMMB 3R0MA 4H0GA 3DX8A 1LEKA 1S7RA 2IDUA 3TNMB 5KTEL 2IGFH 3MUGB 1CLYH 1IGFL 3GRWH 3WFDH 3CU1A 1AHKA 4JPSA 3CSYB 3K0WA 1AYOA 1FE8H 1QZ1A 3FRUB 4AK2A 2C3HA 3KNBA 3LZFH 3NSDA 4ODUB 3WTUA 1BFVH 3CZFB 2ATPA 2DB8A 3D3VD 1BQKA 3GDCA 4NWTH 2TSBA 5E4EB 2Q8AH 4OZIA 3US1A 3VWJB 5DHEA 3T2QA 1DEEA 4Z3IA 3LQAL 2L7UA 1M7UA 1K8IB 2BWIA 3MC0A 3O3UN 2IPUK 2TRYA 4LASH 3SE4C 4X9FA 3TV8A 3HG4A 3V8OA 4IOSD 1ADQL 2WYIA 2JKXA 3FT9A 3PJNA 3D0AA 1IMHC 4LP4A 3X11A 3GMMA 2J25A 4D9LL 3Q6GL 4C56A 4M5YH 3G5VA 1U8IA 1JNHA 1FL6B 1RZ7H 4WUUA 1Q9OB 1BD2D 5IB1A 4NNXB 4NO0B 5JUEL 1IV8A 5EG6C 2Z0BA 3DMMD 4A1RA 5JHDE 1PZ2A 4HK0B 1YEFH 1KJ2B 3WYRA 2YC1A 2G5UA 4OFIA 2A6DA 2PYFA 1IZKA 4A2LA 4LPUA 5EFIA 3SO5A 4J3OH 2NY6C 4CU6A 3ZU8A 1R4XA 5FYKL 1C8PA 5FGCB 5I1IH 1O9VA 2PO6C 3EHBC 2HFFA 3EYVA 3IE4A 3MLVL 4HJGB 4TNWF 4XPTH 3DJSA 3O6FA 2DLEA 1FNGB 1OQXA 3TBVA 2Y5QA 5DS8B 2ESVE 2V3DA 4RWHA 1AR1C 3WU1A 3BE1L 1XR8A 3VWJD 4CN1A 3KPPB 2VISA 2VRKA 4JFZL 5EORL 2MPVA 5IM7A 1A8ZA 1RUQL 2UZYA 2OXHA 4YGAB 3MV8E 4NS0A 3IPEA 2VLRB 4PJEF 4UILL 4E0RB 5DEGA 3REWA 4FGMA 2V2WA 5HDLA 1M3IA 1C7SA 4ODHH 1ZIAA 5J56B 3FU0A 4G8GA 3LV3B 4IRZH 1FO0L 3ZHDA 5JW4Q 3QEGL 1LYQA 1EHNA 5IP4A 4NO0D 2VXQA 3NJXA 3TN0B 3FQNB 3U0TB 1WWCA 4IRSC 4CVXA 5IEHA 1ZA6B 4RBPH 1MWAA 5AQ0A 1WFOA 4JRXA 1JYNA 3FUKA 3G6JE 3ORJA 4HMDA 1J9QA 4CA4A 3MOAL 4KHXH 1VSCA 5AD0A 1U33A 4F7KA 5AW5B 2JKLA 2YPVA 4NNPL 3WUWG 1NGXA 3KLKA 1EZVY 3O3DB 4UQBA 3B9KB 4AUYA 3U82B 2VABA 1L6PA 3K6DA 5KYWB 4BWUA 1RIUL 3PS6A 3QQ4A 5DRWB 2PF6A 3HOGA 3N55A 5B8CB 3QUHA 2CKBA 3UABA 3QP3A 3GUTA 2GG1A 3TZVB 1SJHB 3GKWH 4W4OA 5KYUB 2F8OA 2P5EB 5AB1A 3S5YA 2UV3A 3GXNA 1IL1A 2EIDA 3N43F 4Y9GA 2ENSA 2QR0B 3HR6A 2VLRD 3UBXG 3FU9A 4PGEB 3VGFA 4PV8A 4YDLC 2ZSWB 4LB8A 1OF0A 1XGQB 1DJXA 5HYSB 4KZDL 3KWUA 1KCKA 4KGJA 5DC0A 3UO8B 4N4YB 3HN8A 3MLPA 4NJ9L 1ED3B 4BSWA 2JH2A 1ND0B 1F00I 5C0BA 5F6IB 4X0KB 3ZL1A 3OG4B 4NQTA 2OTUB 2JTYA 1MHEA 5C09E 3TN0D 1ZHLB 2E6JA 2VDML 1D7FA 3OGOE 5IWLC 4S1RL 3VXUA 3H6AA 1YECH 3QJFB 1CPUA 3IAPA 4L3EA 1S9XB 4YWGH 5F0PB 3V4VA 4ZUSA 4IU2B 5JHDB 2CGZA 4L48A 2Z6FA 4ODVL 4HHAB 1T5WB 4P2OA 4NN6C 2F7PA 1PJ9A 1OV8A 4F3FA 4HX1A 4P2YA 1AGEB 4UNIA 3SDDC 5I0XA 3AVEA 4OFYD 3FUDA 1KTLA 3MRLA 5E24E 5KSAC 2AEPL 2OZ4L 1W0WA 3DPBA 3CFTA 4G1MA 4PGDA 3LKNB 4YC2C 4ZMZA 1UKSA 1J9SA 5ID1B 1DE4B 4WI3A 3AGWA 5HHNA 1WLHA 2DQCH 3CHPA 2QQNH 1GMIA 1R24B 1WT5A 5IK3A 1W6WA 3TV3L 2IMNA 3T0VA 1RAMA 1FHNA 1HINL 2BSTA 3VGAB 4R2GC 3ZIYA 4N3UA 1BJ1H 2APTA 2XJKA 1XB8A 3VG0H 3WG7B 4ETYA 4J3UA 2NY5C 3RDTC 5EU7C 3EO0A 1MOEA 3QUXA 1QWNA 3RY6C 4ZTOH 5I1KH 2FEJA 5FF6B 2WTRB 1RULL 3U4BH 4JZJB 4P2CG 2D0GA 3LNIA 1LO0H 4S1SL 1F41A 5TE7L 3BAXA 4I18B 1N5YL 3BO8A 4GO9A 4M48L 4LO9A 4AM0Q 3EJTA 3IU4H 5JHDD 2BFVL 4P2QD 4LSQL 5CIPB 3RBSA 3FH5A 4JFYB 2VMFA 3CH8A 3OF6A 3G6JB 2WXKA 3ETBJ 2ID5A 2VJXA 3QCTL 3TIEB 1YEGL 2CUIA 2QVFB 2GIYA 2YAFA 3QIBB 3QUKB 1F4XH 4OCXL 5D7LE 7FABL 4FABH 3K0YA 4OGXL 2B3RA 2OTWA 1ILSA 3GM8A 4GQ9H 4NGHH 4XWOD 5SX4I 3K72B 2VW4A 3K2KA 3SGEI 1N6VA 2ESVD 1CK0H 4I48A 3VWKA 3ETSA 4IMLB 5AW9B 2XPZA 4ZXBA 2ZCHH 3D30A 3BDXA 3GJEB 1MUJB 4FERA 4GQZA 5FFOA 5EU4B 2A74B 3BUYB 4XNXH 2R1XB 4GUQA 4JGJA 5HVHC 3MV8D 2GJ6E 4YDMA 2HA1A 5IJBC 4QO1A 3PHOA 3L4UA 4FQ1L 4AZ8B 2B9BA 1UB6A 1JWUB 3B2UC 3HZMB 4M93B 4AUJA 4L4TD 1INEL 3EG9B 2ORBL 2AF2A 3QNZA 5LXGL 4EEEA 1CURA 3ZT6A 4KUCD 1Q9WA 3I75B 4I1NB 5F7MC 3WGVB 1A4JA 1QZNA 3GC3A 5C09B 2B4CC 1DJZA 3CN1A 2A4ZA 4U0RC 3C5ZB 4ELME 3BJLA 2JJUA 3HNVL 3WY2A 2SEBB 2Q7NA 3A22A 4JQIL 3QZWA 2QHRL 1HAWA 1QUPA 2X88A 5EA0L 3S8GB 4DO4A 1KPVB 4PSRA 4OGAC 3T6XA 4J7RA 3ECBB 3STLA 1I9EA 2IH3A 2YZ1A 1TPXB 3VQLA 3L7EA 1AGBB 2CCLA 4GW4B 4DO5A 1FVDB 1XXDC 4XMKH 3BWUF 4ALAH 5FUOH 3ALWA 1NGQL 2DN7A 2PYEA 1N67A 3BVTA 2AXGA 3V0VA 4M6MH 3VMOA 4R6UA 4OZHE 2Z91B 5I75B 4D0CA 1QKZL 4P5MB 3QIWA 3VD7A 2CWRA 4NQXB 1RZIA 2R2HB 2J2ZB 3EFFB 2KMWA 4GRMB 3TNNA 2Z4QA 3LHPL 5IB5A 5DJXA 5TPWH 2OAAA 3MBXH 3S5LA 1VHPA 2I9LB 1SM3H 1ZE3C 4P4KC 4ZW6A 4OGYH 2OSYA 4NZUL 1F11A 3C5ZD 4YX2H 3MV7D 4IGBA 3MZTA 1ZLWH 4HOMA 4Q4IA 1XTMA 4UT9L 5F9DC 5GRVL 3CVIL 3D8MA 5CZXC 1O5DT 5KW9H 3ES6A 2YLKA 4OZFG 4PBDA 1FLRH 3SDXE 1S2EA 2HRLA 2YXFA 1B0RA 1G1YA 4LLDB 5D7LB 1FVEB 3D39B 5M7QA 3RL2A 1I1AD 2CA3A 3HG3A 3CH1B 5AZEH 5TH2A 1W72B 5CZRA 2DLTA 4PUBH 4JM2B 3WY3A 1SYSA 4HZLB 2DF3A 2KDGA 2ZP9A 1FQ9C 4J4PC 4YE0A 3L3IB 4OZ4A 2NYYD 4H8WH 2VITB 2EEAA 1A4KB 4GXVL 3QYNA 5EZIL 1XL4A 4PHZA 3F3HA 4JFXB 4MZRA 2W91A 3WDHA 3HE7B 1AZUA 4Y4KC 2Q7YB 43CAB 3BKYH 1IAIM 2UZIH 3TEWA 3WCYA 4RMSA 4FYQA 4Q9QL 4HWZB 3CLFH 1T4KB 1EZSA 1I1CA 1L9TA 2NY0B 3BKML 1J8KA 1CG9A 3VVVA 1UKTA 3O4LA 4FFYA 1ZRUA 3WO3B 4R5TA 1IB5A 3T77A 4KK9D 4NX0A 3D69A 3FCGA 4UT7H 1FZMA 1H3VA 2LTQC 2PW1B 5FO9A 3RRQA 3K5SA 5JXED 2XDHA 4MKMA 1FYTD 3FPYA 2WP3T 4YFLI 2XG4B 2A9NL 1ZEAH 4N9OB 1JCKA 5IG7A 2CO7A 2EDMA 4TQEL 4B0MB 3V5HA 2Y7OA 2ZXDA 5BRQA 2R4SL 3AADB 4NUGH 4OLVH 4Y5XB 1KN2H 4ICWA 4X9IA 2FB4H 4UV7L 3WTTA 5F1IA 4G43A 1JPFB 1M7IA 3CG8A 4XI5C 2APXA 4XPHL 3HFML 4GAGL 4RLDA 4KXZI 4F93B 1U3NA 3BPNC 1QLEL 3MRHB 1DLHA 1E6JL 1P4LA 3O3BA 4FKEA 2RQ8A 3E6HB 3A5VA 5FYKD 1H6UA 2VERA 4QHNA 3DGDA 3HG0A 3BUDA 2GJ6D 1FZJA 4Z78A 4UMSA 4OF7A 2A83B 3KXFA 3IFOB 1PAZA 2DQDL 3MBED 1MKFA 2FE0A 4OCSL 4ZOAA 3TVMC 4OZHB 2OL3B 2XA8H 5E1IA 2VDPB 2NY0D 1IAIL 3REVA 3GSOA 3MJ8B 1GGYA 1RURL 2AGJH 2EDFA 4HBCH 3BH4A 4NZDA 1OT4A 5E5LA 1MXDA 1U8OA 3MO1B 1H5BC 4KMTH 4LLUB 4OAWA 3D48R 3SDYL 2HTLD 3NIDE 3ARFA 4XAWH 1R5VA 1L0QA 4DN3L 4ZNEE 3TBWA 2B1OA 5LBSA 1KCLA 1F13A 4BGLA 3WKMH 1S7XA 4FQXC 4M9PA 5DRXA 3PWNA 5IKCB 2IDQA 2GT9B 3U9PL 4NO5A 5IF0B 1TZIA 3IFPB 4PJCF 1R3HB 4LRIC 2R7EA 3QEQE 4NERA 1KY7A 1L9PA 3B56A 5GJSL 2X0WA 2X6VA 2QEJA 1QVOA 2XI9A 5IR1A 4AQ8A 5FAAA 2BDNL 4CGUB 1R5IA 2QKSA 3DV6A 4JFUA 5GGVL 1FL3B 3AY4C 4J23A 3O2DA 1S9VB 3O8XB 5AW2B 4YUEL 4PRDB 1XR9B 1KB5B 1UJTA 5I9QB 3UTSE 3JV6B 4QJ3B 5J1AB 1WAAF 2D7OA 2ADGB 4WFHD 4Y5YC 5SWSA 4Z7QE 5DEZA 2AMUA 4QRRE 2D4FA 2VXQH 3BVVA 1E30A 1EGJL 4HUWA 4TPRH 4X4YA 4NNYA 3NCFB 1MWAH 4Z7WA 3UEZA 1KPRA 5CILL 1BVNP 3BUTA 4ZJ9A 5AYQA 4JEGB 4NYLA 4WK0B 2Z34A 4QRPA 1P6AB 2EDYA 3F83A 3SO3C 3OXRA 4KY1H 3MMEA 1M71A 5F7LB 2GPZA 3QZLA 3TWCL 4G8FA 1D2OA 2OW6A 4JRYE 1FCCA 1BBJA 1AHWC 2DLFH 4MAYB 5B7MA 6PAZA 1F4YL 1P4BH 3D08A 4JFDA 1BP3B 2CKBH 2WZAA 5EZLB 2BZDA 3B7YA 1YEKL 4PYGA 4XXCC 3C5JA 4AIOA 1BAWA 4LRNL 2PR4L 3VFSA 1DANT 1UACL 2ATAA 4Z76B 12E8L 2GY5A 3INOA 1WZAA 4ZSOB 1IVLA 4WTXA 5DRNA 2X4SA 1XX9C 2FO8A 4F37F 3LKRB 1ZGLB 1YQ2A 4HC1L 4H20H 4P2RD 2WLYA 2O26U 3D6GA 1P4UA 3FTGB 3QWOB 2VSKB 4J6RH 1ZHNB 4DP6X 1FNSH 2MMXA 3DX7B 3WNPA 3QXTA 2EVJA 5CGBA 3ZE2F 4ZZKA 3DRQA 1B4LA 1RQ5A 3BH9B 4PJ5A 4BFIA 2I85A 1PG7W 4K9EC 4KJPC 4E5XG 4OIIH 1R3KB 2XETA 4FF9A 1TO4A 4PJDF 3CJJA 3FT0A 1LNUA 2NR6A 3LJ3A 4F9LC 3F84A 4KMLB 1C12B 3VXME 1MCEA 3V4VH 3D1MC 4AI7A 4YPJA 1ZPUA 3PV7A 3WJJA 3ZDWA 2IQAB 3PG2A 1UB5B 3DX4A 4XVTH 1SLWA 3MRJA 3NFSL 2VL5B 4FFWC 3NCMA 3BT0A 4MAYD 3BSZL 3QIUB 3HB3C 4F92B 1AS6A 4NRXA 2EDNA 3NIDB 4LLYA 3UP1A 4M5TA 3BIAX 4P46B 3UZVA 4OD2B 3IDIA 3UJJL 2HFEA 4B7LA 4CJ1A 3WHE0 4PD4K 1K72A 3F58H 3PE9A 3GMRB 2B5IB 2VDQB 4HJ0C 4YQXL 3QEQB 1JS4A 3AMKA 1REIA 3V52H 3CHOA 1KY6A 1U3YA 4TOYH 2Q2EB 1QLRA 3GHBH 2FVNA 2W9DL 4KK6C 4P5TA 2GI7A 4HKZA 2AKRA 4YDVA 1GCFA 5T1JA 1N3NA 3VTTA 4KI1A 2VE6A 3O9WA 1KCRH 4XTRD 4P3DB 2A9CA 3NVQA 3OLEA 1TEGA 4OLWL 4LOUD 2Q76B 4BZ1L 1ZT4A 2VLME 2EUZA 3OHXC 3HMWH 4UV4L 4Z7QB 1HQ4B 3EJCA 4QRRB 4NN7B 2IG2H 2RJMA 3PGDA 4A2MA 4XAKE 1G6RL 2OYLA 5SX4H 3BESR 1E9QB 2PTTA 5C9JA 4YSCA 3GMLB 3QHZH 1C08B 1LO2L 2QKIA 4U3SB 3HHSB 1HHGA 4LLVA 2TRHA 4R5VA 5F3FA 5HDBF 3WUWB 4ZAKC 4ADGA 1M7DA 3TPUA 3CCHB 3TEZA 5E51A 4K0OA 2K6YA 1G9MH 3QEQD 2AJ3B 1D5XA 4HF5L 2E6QA 2ICWB 5GHWH 5EUKB 4KQ4L 4PGCA 1IGTA 5JDSA 1ETJA 3OZKA 1OP9A 1VZGA 3IDMA 4QHMB 1YZZA 5CINL 5T3ZL 1U8LA 3HPLA 3UBXB 2N3JA 2LW3A 2ZNXA 5DFVD 3UTSD 2JELH 2CAKA 2H6PA 5H4YA 4MNGA 1ROCA 3L3GB 3UGUA 4DFHA 3DMMC 3VI4F 4KO7A 3S37L 4LOVA 4PMFA 4YXKL 3MJGX 1ONQA 5TE4L 2VC2B 4QRRD 1LK2B 3OMIB 2R2EB 2APSA 5E94A 3VE0B 4O02L 1QBMH 3RUGA 1P7HL 1JERA 2BVPB 3IRZA 2IGTA 2BY2A 3KLSA 4YIQB 1AI1L 1HKLH 2FD6H 1H6EA 3C60A 3SCMD 3VXMB 5DHDA 1CLOL 4OBSA 3SD2A 2QGCA 4H1LG 4ESKA 4AIEA 5D9SA 1QYGH 5E4EC 3CDYA 4ZUVB 3SPHA 4UM9B 3VWJC 4F7MB 4FXGC 4JRYD 4FCAA 2B16A 1L4IA 4G8IB 1MCHA 1T5XA 4RMVA 1AKJD 3RL1A 3DROA 1VCAA 2ITCA 2LT9A 3KDPB 2DKMA 3JWOH 3BLKA 5D1ZI 3WD5L 4YFLF 1T6BX 1PX4A 2RBLA 2JIXA 2X0VA 3NZUA 5KANG 5AAMC 2G2NA 3MGOB 4LVOB 2FZ3B 4I4WB 4GUPA 2HKFH 2J1WA 2MEJB 4L1LA 4QT5B 1CDIA 3I3BA 5D1QE 5I76B 1I3UA 4TSAH 4WDIB 5J12B 4WHDA 5I1GL 2HTKD 4GJTB 4LBAA 1YNKH 1BG9A 2E0PA 3RI5K 5BVPH 4HMEA 2Q5BA 3M7OA 3BPOC 4Y8AA 4PW3A 1QFWL 1U8HB 2W07A 3CVCA 1SQMA 1VB9A 1LDSA 4A7QA 3CLWA 4HJUA 4O2EB 2P24A 3KR3H 3TASA 2G9HB 3FB6A 4GRWE 4N8VB 2W65A 5EC2B 5I71B 2Q6WA 4ZO6A 2R51A 2E27L 1EXUA 4MLIA 2DQIL 1WCBB 3VXMD 1SJXA 3WUZA 2NNXA 1A6TA 1L3NA 3HZ3A 1I3GH 4JNXA 1EZVX 4JN1H 4F8QA 5ANME 2WC7A 4HLEA 2DV6A 4E9VA 4GAYA 4MX7B 5HHME 5LBGA 3VFPB 1TTAA 3CU7A 3IS1X 3AUWB 2BERA 3GMQA 1A8JH 1RSFA 2AFNA 2O5XH 3LVEA 4I2XA 5GISH 2CDFA 1IFHH 1NAMA 3LXUX 4TKWA 3E80A 1C5CH 4JHWH 4R97C 5JPNA 2X28A 1A4BA 2FECL 3I02B 5IB2B 2YK1L 1ZLVK 3X17A 4MNQB 2AXJA 1L9QA 3KL5A 1CF8H 3MRFA 4YHOH 4GAFB 2V5YA 4B96A 4P9HH 5C0GA 4DK6A 1A22B 2ZCLH 1U4EA 4HFUL 2FO1A 1N5AA 1NDMB 4XO8A 3TN0C 1UD4A 3WDJA 3PP4H 1MCIA 3HJEA 4UYPA 1IC1A 5TTRA 4NRZB 1KWGA 2FIKB 5ILTL 25C8L 3WI9A 2AERT 1LJMA 1A3RH 2N01B 4FFYH 3FSOA 1RUMH 2EE2A 2VLMD 1NCJA 2B59B 3B9KC 3RVXC 1T1YA 2OKMA 2XFGB 2ITDA 4LSTH 5F7BA 2WVTA 1K85A 4FQQB 3P0YL 4NLHA 2W1NA 1TXKA 4MBOA 4XAKD 1XF2B 2GSMB 3OR7B 4BH8B 1ZLSL 5E5UB 3LEVL 4G7VL 3LS4L 4ZMNA 4POUB 3TZVC 4LVHB 1BFSA 4A2HA 3NUKA 3MLWH 4OGQC 3D05A 2G9KA 2O5YL 5AVRB 4O51B 3LPGA 5IHUL 1NCHA 5I5IA 2XKNB 4Y9BA 5T1KD 4UQAA 4JANA 1DCEA 3QDJA 1AGDB 4KUZL 4C55A 1JPSL 3B7TA 1NCCL 4YL9A 4QWWC 5TQ0L 4P4RA 3SZKC 3CFBA 4M4RA 4BYHA 1EX0A 3GSXB 4LFHG 1QABA 4HIJB 4OM0H 3GJFB 1MCOH 1KCBA 2E74C 5IJVA 3ECWA 1ZDSA 1MPAH 3SDCB 1NUNB 3O2VL 4BFRA 1KXQE 3BPCB 1DVXA 1RJZB 3QWNA 5FGBC 4U6XA 3PHSA 3VFGH 3WFDL 1WIOA 1AY1L 4W9ZA 1EXHA 3M07A 1BOYA 2G5BB 1GZHC 1I7TB 1NCGA 5GJTH 1U3JA 2OSXA 4HS6A 3JTTB 5HY9B 5IQ7L 4GG6E 3LZFL 4MQXC 3OKKB 5HYIA 1BFVL 2FX7H 3QHFL 5CBAB 4ZPTA 5DMIH 5LBSH 2W5PA 4XWOC 4YFEA 5C8JA 2XYBA 4NWTL 3RVUD 4NPJA 2Q8AL 3RB7A 1ZKAA 1T1WA 1A3LH 3FAXA 1MEXH 5D5MA 1XCTB 4C47A 4QRUA 3Q5YA 4MA7L 3WNKA 4NI6A 1RJYB 1X5IA 2YUZA 4P05A 4AG4L 2R39A 3T71A 5ANMB 2EIZA 5I2IB 3VGAC 1JHLL 4N6RB 4JG9A 4Y19B 2PXYA 5ESQA 4LASL 1QFHA 2IAMA 1N7MH 3SYAA 3ASWA 2XWTB 1JV5A 1P9MC 4KKBC 1EZLA 1T21B 3R06A 3D9AH 2PPCA 1A6WH 1SGKA 3SEPA 1S3KL 2GJPA 4LP5A 3QCUL 2F5BL 1QW9A 5J0BA 5JHAA 1URZA 2EECA 3LH8A 3WS6C 3B2VL 1TU2B 5FM8A 1Q9LA 1WFTA 4KJWC 5E9DB 5D1QD 4AWJC 2IANA 4I18C 1QAWA 1OSPH 3VFUB 3JT2A 4FS0A 3BRFA 1CI5A 1YPZF 5AVQB 3BUBA 4RRPA 1OK0A 3CIQA 5CSZB 4EBQL 1UWGL 1T4WA 4GBXA 1XF4A 3LMJL 4XOAA 1QR1B 5I6LA 4AVIA 3QIBC 1RHHA 1NSNH 2YD9A 2MPAH 3ZKSD 2ATKB 3FRPB 4G7YH 2DQUH 1XGPA 3CXHK 4LSVH 4M6NL 3V8CA 1JNNH 5I15L 2HWZH 3LSOA 1TCRA 1XQ4A 2E3VA 4N24A 3T0EE 1HCYA 4YLCA 3UAJC 4WWKD 4JZNB 4ABWA 1Y7VA 2MCG1 3ZT5A 1S7UB 2FTAA 3CV5A 3E8UH 4NC2B 4RQQB 2O6FA 4K9JA 5HHMD 3P4NB 3S4SA 4X5WB 2A74C 3ZHFA 4Y4HA 4K8RD 4NQEA 1AO7D 2EEFA 3FQUB 3HRPA 1WEJH 1UCTA 2W0PA 1LO3H 4X42A 3T65B 5JIKA 1RVFL 2Z92A 2B2XL 2FSEA 3A67H 4YEEA 4M93C 4F2MB 3UCRA 2DMCA 2FWLB 2D7TH 3BT2H 4Y88A 2QELA 3MZGB 4MNHA 3RIAF 5HYJB 1BZ9B 4GNKB 3DYMA 4N1HB 4F7PB 4QYAA 2E4TA 4LCCA 5EBWB 4JFOA 1OAQH 2QSVA</