3NJLA

D116a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis, at ph7.5
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPAPQIINRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njlA00
2VMJA 3N55A 6PCYA 2OCCB 4KO7A 1A4CA 1NIEA 4L0PB 3CVDA 1AZNA 4G7SB 4G7RB 4E9XA 5AKRA 1TU2A 1WA2X 2UXTA 1F56A 3ZDWA 4YSTA 3WNIA 4AKOA 2FQGA 4PCYA 1SDDA 1SF3A 1M57B 1KYAA 4NB7A 5EHFA 3NSDA 2FT6A 3HEIB 1PMYA 2VW7A 3EH4B 1WS8A 4DPAX 3T6ZA 1ID2A 2H3XC 3PXLA 2PPFA 1JZJA 2I7SA 2XV2A 4NAJA 4F7KA 2XU9A 1ASOA 1AACA 1BXVA 3ZX1A 2UXFA 4GP5B 2XLLA 4G72B 4DP2X 1DZ0A 2J5WA 4BXVA 1AS8A 1OOWA 4YVNA 1N68A 4N8UA 1NICA 3QJQB 4YSPA 3FT0A 2ZONA 3OMNB 4YL4A 3FQYA 2QDWA 2AZUA 1OF0A 3CDZA 1PNDA 1X9UA 1UATA 3DIVA 3OD3A 4E9QA 2B08A 3UABA 1IUZA 3PAUA 3BQVA 2R7EB 5I26A 1NWPA 5PAZA 4QKTA 4A2HA 2TSAA 5I28A 4N4YB 1J9TA 2PPAA 1MZZA 2X88A 3ZBMA 1QLEB 5B1JC 1OE2A 2QDVA 2BZ7A 5B7EA 1OCRB 3CVCA 4P5RA 2YARA 3KW8A 3UAAA 1L9OA 1TEGA 2XXGA 4CSZA 1XMEB 2XWZA 4E9WA 3S3DB 4KO6A 1T5KA 2MTAA 4YSDA 3ABLB 3C75A 5ANHA 1AR1B 1XB8A 1M56B 2OV0A 3WKQA 4BWUA 1GW0A 1R1CA 2UXVA 1XB3A 2GC7C 3FPXA 2WSDA 3ABKB 2LLNA 5I6LA 1IBYA 3SBQA 1E30A 2XV0A 2ZWNA 1GY2A 3PLYA 3FQ1A 2PPCA 3UGEA 1XB6A 1MG3C 3ASOB 3IN0A 2YAHA 1BAWA 3GXUB 5PCYA 3ZIYA 2JXMA 3NJMA 2EIKB 3NSCA 4QLWA 1NIAA 3QQXA 1RZPA 1QHQA 4DP7X 1SF5A 5I5IA 3IEAA 4JKNA 4E9VA 2CJ3A 3T6WA 1B3IA 2J56A 1SNRA 2Q9OA 2PP9A 4DP6X 1PY0A 1PZCA 1NIBA 2BW4A 2FQDA 3NJIA 4KNTA 3TA4D 3TBCA 3WNJA 4G7QB 4F2EA 2GSMB 3PAZA 3X1FA 2GBAA 1J9QA 2IDSA 3AG4B 4JHVA 1GS6X 3NYKA 3S8GB 1ET5A 2AANA 3EF4A 4BDVB 1JZEA 1ZV2A 1GR7A 1KGYE 4PAZA 1BXUA 3IE9A 4UAHA 4AKQA 1DYZA 2CUAA 3AW5A 3CDZB 1L9TA 4YSQA 1JXFA 4Q8BA 2FWLB 1GS8A 2YAOA 3OMIB 3UACA 3GDCA 4DP4X 1A65A 1WA1X 3S3CB 1PZBA 2PPDA 4AX3A 2UXGA 5D4HA 1E67A 3H4FA 4TXVB 1J5CA 4F2FA 3KW7A 1JVOA 2B3IA 3NP3A 4AZUA 1ET8A 1OCCB 2PLTA 4KOBA 1AZCA 1GYCA 3UAEA 1NDTA 4DPBX 1PNCA 1MZYA 2DYSB 3AG1B 4DP5X 1EZLA 2QT6A 1ILUA 2I7OA 2XX1A 5AZUA 4FAAB 1V54B 3JT2A 4BDVA 3PPSA 1FWXA 3S8FB 5I5JA 2PCYA 2IDQA 5TK4A 2GHZA 2Q5BA 2QPEB 4YSOA 3EH3B 2CAKA 2XXFA 1YLBB 5B1JA 1KBWA 2YAEA 4RH4A 4CSPA 5I6MA 2HX9A 1ASQA 3NJGA 1M9WA 3TU6A 2IDTA 2JKWA 2HXAA 3T9WA 2AFNA 1NPNA 1RCYA 5F7AA 3RYMA 2RACA 3FYEB 2BWDA 3FS9A 3HB3B 1A8ZA 1ILSA 3QPKA 3T6XA 1A4AA 4DPCX 1KDJA 2ZXWB 3FU7A 3NJLA 1WS7A 1AZUA 2VN3A 3V9EA 1OCZB 2FJSA 5A7EA 1JZIA 4M4RB 4DP8X 4E9TA 1E5YA 2XV3A 1FFTB 8PAZA 3FSAA 2BP8B 1CYXA 1J9RA 1ET7A 1HAUA 2J57A 1PLCA 1PLBA 1NPJA 4HCGA 6PAZA 4YSCA 1TKWA 4YSRA 1E65A 4BK5C 3IN2A 4UF7C 4HCFA 1ZIAA 2CCWA 4HIPA 3WKPA 5I6NA 5E9NA 3FSVA 1OV8A 4A66A 4BXSV 4MFHA 3SBPA 5I6KA 1JXGA 1V10A 2QPDB 2JFCA 3NJJA 4KNUA 1A3ZA 3AG3B 5B1AB 3NJHA 2VW6A 4WKXA 1SJMA 2A3TA 4YVUA 1ZDQA 4HHGA 1AS7A 3NT0A 3X1NA 5B1KA 5B3SB 1JZHA 3NP4A 2P80D 3EH5B 4DP1X 1KV7A 1ZDSA 2PCFA 1KBVA 5D4JA 2IWKA 1JOIA 1PLAA 3BVDB 3CG8A 4BWTA 2GB2A 2DYRB 2BP8A 2CALA 4A2GA 4HCIA 4X4KA 4G71B 3S3BB 3X1EA 3EHBB 1PZAA 2YXVA 1BYPA 1AS6A 3ASNB 2YXWA 1GSKA 2WO3B 4GYBA 3MX0B 4K9JA 4BWWA 2GC4C 1JERA 4GP8B 1J5DA 3X2QB 2YAFA 3FYIB 4A2EA 1RKRA 5I6OA 4E9SA 2DV6A 3FSWA 3QJTB 1ZIBA 1AAJA 2BHFA 1MG2C 2IH9A 3NJKA 3QJUB 7PAZA 1JZGA 3OM3B 4ENZA 3PAVA 3AG2B 2EINB 3SBRA 2BWIA 2IAAC 3H56A 2GI0A 3FU9A 2IDUA 1NWOA 3OQRA 1EHKB 2IDFA 2FT8A 4DP0X 2FQFA 5IY5B 1JVLA 4FA7B 3MBWB 1CURA 2HX7A 1PF3A 1TEFA 4YSSA 2UX6A 3GYRA 1N70A 1W6WA 3FPYA 4NERA 1CC3A 1KCBA 1BQRA 2Y1AA 1JXDA 3FU7B 4M3HA 3T71A 1GY1A 2HRGA 1OE3A 3NJFA 2YAQA 2HLEB 3FU8A 3X1GA 2I85A 3U25A 2EIMB 2HX8A 1ZPUA 2CBPA 2P80A 2YAPA 1NIFA 3WI9A 1GS7A 1BEXA 5B1BB 2BP0A 4KOCA 4AI7A 2BZCA 2FQEA 3CVBA 1NINA 4GXFA 3NJNA 4P5SA 5LDUA 1BQ5A 2UX7A 2VM3A 3JTBA 2DWTA 1IBZA 1NIDA 2X87A 4UANA 1VLXA 4Q89A 1AZRA 1J9SA 7PCYA 1AZBA 2E86A 1BYOA 1NZRA 5FC9A 1ASPA 1QNIA 4HAKA 4W9ZA 3TASA 1HFUA 1L9RA 3AY2A 1AG6A 1WAEA 3WIAA 2MRYA 4EF3A 1AANA 4A2DA 3ERXA 3IBOA 4A67A 4HZ1A 1I53A 3D12B 3T6VA 1A4BA 4KO9A 2PPEA 3FQ2A 2VSKB 1L9PA 1L9QA 1IC0A 2BO0A 9PCYA 2N0MA 2W88A 4E9RA 1RZQA 2VW4A 4KNSA 3QJSB 2YAMA 3PCYA 2VM4A 1CYWA 1OCOB 4WTQA 4JHUA 2IWFA 2W8CA 4GY4A 2BW5A 3X1BA 2YQBA 4G70B 1CUOA 3NSYA 1AIZA 4W1TA 1NTDA 2HZHA 3L45A 3WG7B 2Y69B 2XUWA 3OMAB 4A2FA 1BXAA 2FT7A 2IH8A 3ABGA 3DKHA 4A68A 1X9RA 1WA0X 5I5MA 2AVFA 1KCWA 1SFHA 1OE1A 4KO5A 1IKOP 1ETJA 3FSZA 1W6LA 2XYBA 2XVBA 3V9CA 4AKPA 2WO2B 4DP9X 5B7FA 2PP8A 5TK2A 2PP7A 3NSFA 2R7EA 2J55A 3QJRB 5AFAA 5B7MA 1W8EA 2H47C 1MDAA 2EILB 2OJ1A 2TSBA 1ADWA 1SHWA 4HHWA 3UADA 2EIJB 3QJVB 2HRHA 1PCSA 3TBBA 2GIMA 2XX0A 3DTUB 3ABMB 4ZK8A 4E9YA 1BQKA 1URIA 2AZAA 4YSUA 5D4IA 2DWSA 1V55B 1SFDA 3G5WA 1SDDB 1KDIA 3CZUB 1HAWA 1L9SA 1PAZA 3AZUA 2H5UA 2BP0B 1AQ8A 1AOZA 4YSAA 3N2JA 2FTAA 1SHXA 2DY2A 2NRDA 1E5ZA 4HALA 5I6PA 3H4HA 4GP4B 2IWEA 3SQRA 1FA4A 2VSMB 2FNWA 5F7BA 1AG0A 4YSEA 2ZOOA 1JZFA
chains in the Genus database with same CATH superfamily
4PJGE 2CNYA 4PTTB 2OCCB 1YEFL 4JZJB 1KIPB 4MA7H 1NUGA 3RL1B 3VXTB 1NIEA 4TLUA 3UG5A 3KGSA 4D9RE 1FSKC 1RZIB 1BQLL 4HMDA 4AYEC 1DQIA 1KIQB 4N0UE 4W9LC 5DK3A 1TU2A 3KYAA 3KEHA 1BVLB 3IPFA 3I6LE 3QIWB 4A39A 4P07A 3PWPE 3S98A 3VWJD 5FYLE 5J7CC 3G9VA 2PYEB 1WS8A 1Q94B 4JO2H 5A6MA 3GSWA 3PXLA 5LCVH 2RJMA 4PRHD 1XTLA 3CX5J 1OGTB 3AXHA 3VG0L 4GI8A 5K9JH 4TUKL 1AACA 1IBBA 1FO0B 4WK4B 4XP4L 3O2WL 3O4OB 1UOKA 3GMMA 5CBEA 1N5AA 3H3BC 1ZA3B 3JUYA 2EYTB 3HB3D 3N06B 2EUXA 4G6JL 1BJ1J 1UGNA 1IJ9A 2DLIA 3HI1B 3VQLA 4PVBA 4AMXA 1E8ZA 3EH1A 2ITEA 4YGVA 3FTGA 3U2JA 3QUHA 3BWUC 1ZMYA 1OF0A 2WWKO 1QFUL 2OR7A 4IU2B 4XI5D 5DMKA 1BSIA 3BKYL 5C0NC 4J3UA 4RGNB 1IUZA 3QXVA 5CUSH 3VCLB 3A6OA 4KI5F 4S1DD 3MJ7A 3B2DC 1NGZA 3S88L 3FT2B 4E41E 4Y4FB 1E9QB 1NEPA 3DXAD 3NABL 4MNGB 5EEVA 5JIIA 2LTQC 4D7PA 2ZXCA 1CFQA 3QRGL 4Y5VB 5FK9B 3RL2B 3WE1A 4UMGA 4BQ9A 4PJ7F 5BUPA 3MDJA 3ZBMA 2FJUB 3ZDZF 1H3XA 1KTDA 3CVCA 1M71A 2V3DA 1YECH 4Z1PA 3CVIL 2CDGB 2JKNA 2XXGA 4PRBB 3MJWA 1DN0B 4ZUWB 3Q01A 2F53B 3MV9B 2RCSH 2GAZA 3GUFA 3AUVA 3DMMC 3QFDA 3TEZA 1WUZA 1O9WA 5BVPH 2D31A 3BWSA 3ATEA 4YSDA 2M83A 5AB0A 2HLFD 4UQCA 4QXGL 4WW2B 1D5BA 3FB8B 3Q2LA 5KBNC 3GXTA 1AY1H 2FE0A 3BOVA 2EDDA 3V52L 4HMCA 1FIGL 3D0LB 2GJZB 1OB0A 3P2TA 4BFJA 4JO4L 4UYQA 3R06B 3ZN6A 1YN7B 4OFIA 1F97A 1UEYA 2VDPH 4CUCA 2DM7A 2P42B 1LD9B 4ELMB 4NZRL 4NKIL 4Z7OF 1JNHB 2IANB 4UTAA 1RQ5A 5JYMA 1JV5B 1S4IA 2XXMB 3ISYA 4LSSL 4NQSA 2PWDA 3HJEA 1B6UA 3EYOA 4YLBA 3CFBA 1U58B 1U8PA 1XD1A 3O3DB 3D06A 3EYSH 1FPTH 3IEAA 4FFZL 4JPQA 2EKSB 5EU6E 4ZW5A 5C70A 2BERA 2EUZA 3OKMB 4KKBD 1X9QA 2FWOA 2F8IA 4Q97A 2CM5A 5ABZA 5F0MB 2ISDA 4AXWA 3WNMA 2OSXA 4OZHF 3CN2A 4JGUA 4KXAA 4NQCD 3ZIMA 1OD9A 1ZVSA 4AYDC 2VIRB 1NCCL 2GSMB 3X1FA 3QHZL 2UWEB 1QR1B 4RAVB 43C9A 3UTPD 4OB5L 2AKRA 3O8XD 2CLZB 5HHPA 3HHRB 3AGWA 2C7UA 4JQIL 3V0VB 3RWGB 1ORSB 2WCPA 2CLRB 4ADJA 3TBSB 3K46A 4P2AA 3ZL1A 5KBMA 1WCBB 4AKQA 1XR8B 1CDJA 4PJ6A 5DJZA 3IK2A 1EAJA 1SY6L 1M2VA 3VM5A 3CK0L 1PEZA 3KBPA 4FMVA 4KY2A 3D6GA 5DS8B 4UOW0 3QS2A 4OT1H 1E67A 2Q3AA 5EUOF 3HNVL 1QSEA 2YD2A 3II3A 4Z9KB 4W9JC 4K5LA 2WP3T 4PRPD 4CNIA 1CFVL 3CGTA 1OD7A 1GC1C 1TTFA 4NQDA 1RUQL 3RVXD 4MBOA 5SX5K 5GRZA 2UZXB 2XWCA 3S6CA 4ES8A 2RR3A 5GGRA 1U8LB 1U8HB 3PPEA 1GYCA 1SYSA 1NKOA 3N1QC 2CHXA 3CFUA 4KY1H 3Q2WA 2R0WL 1PIGA 2YBRA 2HG5B 4NNYB 5BCAA 4LCCB 5EOCH 3GRWA 4N90D 3IMRA 5KJRL 5CZKA 1RLWA 3EHBC 4WAFA 3D4YA 4DEPB 4UB0H 5I16B 2GY5A 5L0QC 4JHWL 1I3RA 2XXFA 3HPJA 4FDWA 4RMTA 1MCWM 5SV3A 4FQCL 1YEDA 4A38A 3L5XH 3ILQD 4F7MB 3RYMA 1D7DA 3JXAA 3KLDA 5ESVB 1MHPL 1U2CA 2BWDA 2HG0A 4KK5D 4P2YA 4ZNCD 2X3BA 4DSYA 1LEIB 3T77B 5A2FA 3SOBH 1FG2A 4M61A 4PWHA 4PP1C 3R19A 3ILDA 3RFZA 1GAFH 3FU7A 2H2PC 3F85A 3LH8A 3TO4A 1QFWI 2G60L 4NPKA 5DUBA 3ZE0B 1ZVNA 4RLDA 3TCLA 4Q58C 3OXRB 4NN6B 1KCSH 2CR0A 3AQXA 5B1CA 3DETC 3BH9A 4JL1A 5DR5L 4CW1B 4H8VA 1LK3L 4P46A 3FAXA 4D8PB 3T3PF 2NSMA 3UOAB 3K74B 3VFTB 2WGNB 4OCRH 4MMZB 3H6AA 1N10A 1NCAH 5I18L 3IS1X 4MA3A 4G6KH 4OF7A 3L5JA 4LVHB 4BK5C 3IAPA 4M1CC 1DE4B 2DQIL 2MNJB 3ILEA 4HCFA 4WEUD 5HJBA 4WVRA 4L9LC 3AT9A 3GSUA 1JS4A 1W8OA 4HIPA 2WANA 1OV8A 2XZZA 4Z7UE 4KU1A 2Q3XA 5ID1B 4OZHA 4JFED 4ODBD 1NBZB 5ICYA 3NZHL 2CJSA 1WHPA 1T22A 1BAGA 3EJSA 5A3IC 3E2HB 1SJMA 4LHUD 4ATTA 2PTUA 3NK4A 4NKQB 1A6PA 2GITA 3QISA 4PJ9B 1E5AA 1DUZB 1NGQL 2IBZY 3CNKA 2VO5A 1T1XA 1U8MB 2Z35B 1WGOA 1DHKA 1CE6A 5B39G 2WAQA 5CEYA 2OYMA 3RGVB 5E00B 2YEQA 3WLWD 1FO0H 1ZANL 5AZEL 4HWEH 3BH8B 4TNVF 2WKGA 3FUHA 4L4TB 5T1MB 1HOEA 3GHBH 1TJHH 1QASA 1QNZH 3MRLB 3LNFA 5IROA 3U0PA 3LKSB 1M6OA 1T2XA 5KAQG 1E2WA 5TDNA 3S4SG 4BWWA 3N0AA 5D7SH 5DUPH 4HLZG 1T1YB 2V9UA 3PQYE 2RTTA 5EBLA 4EMZA 4P4KB 4LDEB 1JZGA 4Z95H 1RZKL 3PAVA 5HY9A 3TO2A 1RZ8B 2AI0H 2EE9A 2R1XB 4XB8A 4W9CC 1B3JA 1VFBB 2AJVL 4LIQE 4MHHI 5EO0B 4ZAKD 4GRLC 4GG6F 2GI0A 1G87A 2GUOB 4P5TD 2QFPA 5GHWL 4O51A 4PJDB 4YHYC 2JKLA 4XX5A 4BQ8A 1XAUA 1I8IA 2ERJC 4F33B 3IJHA 1A4JB 4M1GH 2P28B 1DTUA 3VXUA 5FO9B 1P4BH 1EJ8A 3VFNB 1VGEL 3RRQA 4DVRH 1OAQH 1JGVH 2NYKA 3ARYA 1IC5H 3FO0L 4UV4H 3DROA 4DN3H 4HJJH 1YDPA 3EJZC 1YMME 1GHFH 4JZOA 5D55A 4LPWA 3IXAB 5EV7A 4FI7A 4B9JA 5IHHA 2NNXA 1URLA 5IQMA 4NQED 2CM6A 5IGXL 1TQBB 4UTBL 4HOZA 1OGAA 1J10A 3FQXA 5GRUH 2HP4A 2GJPA 1BFTA 1ZVYA 4KOCA 4Z3TA 2VITA 2Y3NA 4MAZA 4Y4HB 3HBQA 1NDGA 4JPIA 4S0TD 3HFFA 2J4WL 3LKPB 4J8QA 1P0SE 1IB5A 3CZNA 3V4VB 1EAOA 1YJDL 4P23D 2Q10A 1N18A 3HOGA 3WTWA 3NUKA 1JPSH 1UXLA 2J8UE 1IGJA 4H0HB 3VU1A 2R8SL 3CN1A 3PGCA 4PJBA 2OX5A 5DF0A 1MRFH 1DQLL 4B3EA 4NHUA 1W80A 2BH0A 4EN3D 3K71A 3UIZA 1MN4A 2H0PA 3AC0A 3IE4A 5EZOH 3O45B 3ETSA 3GTNA 4FF9A 3MRNB 4A67A 1I53A 4RFOL 5IV2B 1VKXB 5FHAL 4N2OA 4XO4A 1TNMA 1IKNC 3OV6A 2X9WA 5AVZB 4ZFZA 1DEEA 2HFGL 4XODA 4HC1A 3SE4C 1T1WA 1DQJB 5AW8B 4TLSA 3GHEH 4O4YH 4KDWA 2BJML 4QOKB 1E2VA 3WJLC 3BAKA 3HZ3A 5C09D 2XQYA 4BQ6A 3V4UL 1OCOB 3WN5A 1YPZB 4M7LH 5F6IB 4RZCB 3D69B 2Q7YB 1AGEA 1ZAGA 1HK6A 4LLMA 2RAMA 4X8XA 2Z34A 3SKMB 3L45A 4X7SL 2J43A 2VDKB 3MPCA 1VEOA 4MJIB 4FCHA 4K7FA 1C12B 1OW0C 5DURD 3LDBC 5D93C 3SJVE 3UCQA 3BQUB 3ABGA 1UOLA 3VFUB 4JM2C 1CFNA 5FCUL 1MHCB 3AFLA 1DDHB 2XQBL 1U33A 5HHXL 3RVUD 3UXFA 3QO1A 4L29B 5AB2A 1YEJL 4KPHL 4PRHE 2DQMA 3V9CA 2WZ5A 3SQOL 4AKPA 2JVUA 2XZCH 3QEGL 3AABA 2HRLA 3N42B 3I9GL 3ZKQD 4QRPB 5KVGE 2B20A 1UHVA 25C8L 1MJ7H 1WAPA 4K2UH 4GG6A 2TSBA 4JJOA 2J25A 4FXGC 1T6VN 3WEBA 2PF6A 4KJQD 2ODIA 4CC0A 1SN2A 3TA3C 3AAZB 3BGFB 1SYVA 2ARJA 2KHAA 1MAML 3QHFL 4JFHD 1S8DB 3T6QC 2Q76A 1RJZA 1RUKH 2W80C 4KTGA 1MFEH 3TNNA 4D3CL 5FFLA 1SJXA 1GGIH 1BBJB 3NCCB 4FXKA 3MLYH 4QHPA 5I71C 2W81C 3MA7A 5F89B 3AZUA 5J57B 2FL5B 5I0DA 3D3VB 5CP7A 3R7QA 3GSNB 2NRDA 3QNXA 1F6AB 1YY9D 2E9BA 3DXAE 1SOQA 1HQRA 1GIGL 3H4HA 4EZKA 2OL3L 1G9NL 1MJ8H 2AEQL 1RAMA 1XO8A 4E5XA 1FA4A 3H9SA 1AG0A 3HZYA 1JGUH 1FFPB 3FUMA 4H2AA 4ZPVA 4X7EC 3BUBA 4KXBA 4J3OC 3HN5A 5LXVA 4YDZA 2C1OB 3C6LD 3REWB 2BNUB 3QYNA 3I2CL 2VMCA 2DQDL 2OLDA 4HYTB 1NAKL 1EANA 4TNWF 3IDXH 1GOHA 4W4OC 5CM1A 5DYOA 5E1AB 2XY2A 3PF2A 3UEZA 4JRYB 3NA9H 1M57B 1JGEB 1JPST 3E38A 3LQZB 2W0FA 4DK5A 3EH4B 4UUJA 5GZOC 5IUCA 1FDLH 4WU5B 3TH3T 2PETA 2VL4A 1AZZC 3KM1A 4OV5B 5HDBB 3ZZ1A 2Q8BH 2XV2A 2Y5QA 5AOLA 3L2NA 3TOPA 1Z0MA 4KTDH 4W6YB 1RLBA 4PJCE 2IFFL 3I3BA 5LWYL 3QXUA 4UDTB 1AXSA 4XO8A 1S5HA 2UXFA 5E5RB 1UXSB 2J6EH 4UU9A 3MHZA 2YD0A 1XSIA 1AS8A 2WYTA 1DP0A 4JFDA 3VXPB 1OAZH 4RGOH 2JWYA 3NCYS 2HAZA 1U3ZA 1KSRA 2L7EA 3RB7A 4XRCB 1MRDH 3CSGA 4NC2B 4M7LT 1PZ2A 4FQ1H 4IBVA 1BWMA 1HXYB 4IRZA 4TSCH 4FNQA 1M1XB 1SVBA 4UNIA 2I9TA 1Y18A 3LKOB 3GPEA 5D6DC 1MCCA 3PAUA 2GBVA 5F7EH 2K9UA 1P7QB 4ZMLA 1G7QB 2R7EB 2OAAA 2P46B 4C55A 2DQHL 1R5VA 3UTPE 4IBTA 4BFEA 2DI7A 1J7VR 4ZPTA 3VI4E 1T0NB 5KYUA 1KACB 5D7JB 1Y0LB 1AHWB 2YPLB 3EO9H 2OZ4A 3U6XA 5BNXD 3KPQA 1GW6A 2QSCL 2PNDA 1OP3H 1A3LL 2JXMB 1QLEB 2W65A 3H7BA 4LSPL 4UQEA 4EAEA 2OI9C 3KBEA 3QQ4A 3QUZB 1F5WA 3GKWL 1IGCL 5EO9B 4JPWH 4D94A 4FMFA 1VADB 3BJLA 3QEQD 4KZ0A 5D1XA 3CHOA 1LO5A 3VFOA 4HWBA 5CJXC 5IVOA 1D5IH 3G04B 4NLAA 5AG9A 1P1ZA 4XNAA 3V79C 5FYJL 3HE6A 4D0CB 1CDIA 1Z9MA 5JHMA 3VU2A 4PCSA 5I15L 2WSDA 2YOAA 3MNMA 4HF5L 4ODVL 4P5MB 3SD5A 4FA8A 4NQDD 5I8OH 3S37X 5BXFB 4PUBH 2OCJA 3VWJC 2R4SH 1WZAA 2P3YA 3FQ1A 4KI5D 2PPCA 2DW5A 3SIKA 1BAWA 4I0PA 1C08B 2AJXL 4ZTOH 2H8PB 3MJ8A 4F9PA 2XN9B 4XCEA 4KGLA 3A24A 2D9QB 4OCSL 1CJYA 1Z5HA 4LARL 4URTB 4BA8A 4ZFOA 1NMAL 3HB3C 4Z77A 1SNRA 1PGRB 1G5AA 2JIXA 1U3JA 3UZVA 4G82A 1YZZA 5FUOL 1NGPL 4I4WB 4P3CL 3W37A 1QW8A 1RERA 2CG9X 2WBJD 4EBQH 4XI5C 1S78D 2F74B 3MGOA 3QEHB 4AVIA 1TJGL 2BFVH 2IO5A 2M26A 2OJZH 3FQRA 3FQNA 3S2AA 2HPTA 3AB0C 5AB1A 4BDVB 2VSCA 1CFTA 4S1DC 4FQXA 3TO4D 4JB9H 2YGNA 1J8KA 3CDZB 1IL1B 4ZFGH 5AYUL 5IB2A 3AT8A 2NNCA 2DQTL 1A22B 1A1MA 4NRXB 32C2A 1GVIA 4ANWA 1KFAL 5L7XH 4BCXA 1J5CA 3L3GA 4ALAL 3SKOA 2RGSA 5H2BB 2ZCKH 3KNBA 4QJ3B 4AZ8B 2D7TL 2VDKH 3K2IA 1QFWH 2N1KA 1XFPA 2VE6A 1G6RL 4O02A 4JFOB 5L2KB 2W9DH 1BF5A 2YPVH 4R96B 4L18A 2AAVA 5BO0D 5D7IB 3UJTH 4Y16A 2CZNA 1I1RA 3AUWB 2DI8A 4N8CH 4FP8L 5E5LA 3RY6C 4NFDA 1FRGL 5FO7A 2I7OA 3DIDA 4NZTH 5CSGA 2QKIB 2UZPA 2HN7B 1Z5LB 5F7DB 1IKFH 2VCOA 5TK4A 4LLQA 2A9BA 3KMDA 2FLBT 2P8LB 1IIKA 4W4NA 3TT1H 2KI6A 2YBGA 3W11D 2J21A 4M5SA 2IGTA 1CD8A 4RFEA 2Z7WA 1G7IA 4PVNA 4UILL 4L37A 5HYJD 4K4KA 4KAQL 2P24B 1HHHB 2EJ1A 5I1AB 5IROD 4YBQD 4MB1A 3M17A 2VR5A 2Y7SA 2ZXWB 3CCHB 5HGHB 4KRMB 5IW1A 4YQXH 1AZUA 5F7YC 1JZDC 3C6EA 1A7NL 4OZGE 4UAOC 1BZDA 3P9LA 3GSNH 3HI6L 2V3FA 2YD1A 3QUML 3VW3H 1E8YA 3GMOA 4MMXB 4BHUI 2LW3A 1SVCP 2H32B 3KEDA 1X7SA 4MAUL 4PBWD 1FI8C 3MLVL 4FGMA 1CQYA 1AGCA 3QQNA 4WWID 3O8XC 3UGXA 3X11A 4HIHA 4GAGH 4MYPA 4JDTL 4C4KO 4HJEA 3DSFL 2HFEA 3EJJX 4CMHC 4X9HA 5IQLA 1TQCB 3WFBH 5F0LB 5DVOA 2VUOA 4OUOA 2IAMA 1NFAA 1CI3M 1QO3B 2B1HL 3U9UA 2HUEA 4S2SA 1WJ3A 2DMBA 4HIJA 2ITCB 4NQEE 3SBPA 2XG5B 3DSNA 4EXPX 2N59A 4JHAH 4XX1G 4O9HL 5FOBA 4JRXA 3P1VA 3W82A 2OTUB 5KYNA 4BUHA 2X6AA 1IC7L 4QRQA 4FZ8H 2EIDA 2WINA 1I4FB 4QJ4B 3RVXC 4MQTB 4M5ZL 5KVEE 3NFNA 4JVUA 4XNXL 1LE9A 3WXWH 3CVHL 5JW4Q 4K3EL 2P9RA 2DD8H 5F3BA 1I1AA 4XO9A 4HCIA 4X4KA 1QLRA 2BIHA 1T4WA 2Y1ZA 1PZAA 4MBRA 1GPOH 2G4EA 2IGLA 3LMJL 4KJYB 3D2UA 4MDIA 4TRPL 5H35B 3TBVB 4OLXH 3CMGA 5DHVB 3T0XA 3MUHL 2WO3B 5ANMA 4WRLA 5FW8A 1BVKB 2ALAA 3BUYA 1PD6A 2P8MB 4MAYA 3IGAA 1KYDA 3X13A 4FOMA 1DLFL 1H9VA 4HWZB 3PFUA 1Q9WB 3E6FB 3ILQC 4X99B 3DYOA 1KWGA 3KLHD 2EINB 4LGRB 4PWGA 3RIKA 4KK5C 1ID5I 3FU9A 2MNWA 1B0GA 5IEKA 3BRFA 4JJ5B 5DD3L 2IDFA 1REIA 4L3ED 4DUXA 3FU6A 4UOQA 2GUYA 4GNKB 5F0JB 2R0LL 3TIEB 5T1KA 4DW2L 2HX7A 4EDXA 3V4PA 1AXIB 1XIWA 5A6LA 1DO5A 1IEAB 2YUVA 1QLEH 3NCFB 4OLZH 3X12A 3PJSA 2HRGA 5IVXB 2DIJA 3VWKD 4AVHA 3UPAA 4CA4A 4PGJA 5BQ7A 8FABA 4LFHD 4NRYA 1FNLA 4TPRH 3G5YA 4N68A 4P2RD 3BWAB 4N28A 3KYKH 1DVUA 2DBLL 3DLQR 2GJJA 2FQEA 4KMTH 4GH7B 4YJZL 2ZKYA 1Z66A 5B4MD 1A4KB 5GS0H 2VM3A 1ZK9A 3BEWA 2O93L 3MZTA 1UTDA 2EDQA 1VLXA 3H9HA 4JFHE 3QGVA 4LNRA 4YC2C 3SPGA 3ZHDA 4XO3A 1FBIL 3BN3B 4PV8B 1QNIA 3ELQA 1I7RA 1RUPL 3IAGC 1T0MB 3E7JA 1V3KA 3BPOC 2AGJH 2A1WH 3O0RL 1P5UB 3DRTB 3WLWC 1GA2A 1EAPB 2F1EA 2F8VA 1T5XA 2NDGA 5JIHA 4FKEA 4MYWB 3T2NH 4HZ1A 1U8KA 1G7PB 4EXKA 1K4CA 2C26A 5D8JH 4PYGA 3PDDA 1TPXC 4GQRA 3Q0HA 2BO0A 2ZE0A 2E75C 3BSZH 2AXHA 2J72A 1QRNA 3QJSB 3FOMA 2APVA 1GTFA 2K0RA 2JKXA 4YHNB 4OLVL 4YDVB 3ZPDA 2MEJB 4U1MB 4PSRA 4Y1AE 2DBJA 4F7PA 4NAMA 4TV3A 4JKWA 4ZAKC 5DO8A 4J6RL 3NACH 2X4PB 1CPUA 5I5RA 2F8XC 4P99A 4P5TC 2VR8A 1A3QA 1WLHA 1RZGB 3MCG1 4WK0B 3KDPB 4QRRA 3WD5H 2ICWI 1D7FA 1WA0X 1MEXL 1FORH 4YX2L 1XR9A 2KLTA 1IKOP 4NKDB 4UCFA 5EEWA 4QYOB 4WGWB 3IFLH 4X6EB 5AKVA 1G7HB 1N8OE 4B60A 3VG0H 4TUKH 3UTTA 2BX5A 4XP4H 3FFOA 4UTCA 3RNQB 3UYPA 4PJEF 1OM3H 2NTFB 4GFTB 2HKHL 1TJIL 2Q2EB 3CUPB 4J5VA 4G6JH 3DTUB 3ABMB 4PWEA 3LZOA 4H25A 3V0HA 4GSDH 2CJUL 3JTTB 1RJCA 3MRQB 3U7AA 3MBEB 3IDJA 2E6JA 1QFUH 4ZO9A 4YHOH 3I6GB 4JFDD 3FBQA 1NCIA 3NFSH 2IALB 3BKYH 5J13B 3GF8A 2VDML 3GSQB 1EK3A 4HPOH 4P23C 1Q0XH 1AO7B 2VXQL 1UVQA 1WWAX 3RZCB 2VZTA 3K3QA 1IAIL 3HJ0A 4DIXA 3HMXH 4WW1A 3K4ZA 1YUHA 4KK9D 4EN3C 3F12B 3M46A 1DVFB 3SQRA 1W72A 1EZUA 5TGBB 2J88H 2B9BA 1CGWA 2VSMB 2X9YA 4K9EC 1KXVC 3CZGA 4PCYA 5CJ8A 2FD6H 5DC9B 6PCYA 5IB4A 4MD5B 3HG2A 2P5EA 5ACZA 4KBPA 4UM8A 1QR4A 3QEQE 3MNZB 2ZUUA 2CHZA 2NY2D 2YKLH 2ATKA 2FX9H 2UXTA 3EAKA 2H32H 4J28A 2Y22A 1DQKA 3EJTA 4G3YH 4FJ6A 4PJHF 3L3DB 3MU3A 5DRWB 3U9PL 2VZUA 4E42B 5KVMC 3GT6A 3QPQD 4U05A 3D2TA 1D5ZA 2FT6A 3QCTL 5CGBA 2Z91A 1L6PA 3PL6B 3QULA 1MF2H 1X5LA 5D1XD 4LRNL 4PGBA 1U8JB 3V52H 1JZJA 1A7RL 1FIGH 1UYWL 1RY7B 4ERSL 3OSVA 4KI5E 3UP6A 3WS6A 5KBDA 1VDGA 5A2JH 3RVUC 3LQAH 2H0FA 5SWQB 2GK0A 1Z9NA 2NW2A 4MS6A 1AR2A 5DUML 4DERA 5BUAA 5BZDA 1KEGH 3K4DA 4YXHL 3QDJE 4NKIH 4MMYB 1Q0EA 2XVKA 4NP9A 5GRWA 4OFQA 1AD9A 4YVNA 2YRLA 5F9AC 3F7YA 4N8UA 1NICA 4PJ7E 1LILA 4XE0A 4I0PD 2AZUA 4XNUH 3U0WH 1F3DJ 4LEXL 1A66A 3B6SA 1UJ3C 4KJQC 1QG3A 3A6BL 1UATA 3WIIL 3MRBB 3K0YA 2O5YH 5KJ4A 3FUNA 1JPTL 3BQVA 1UXWB 3JV5A 3DX1A 5CZXD 4BZ2H 1BZOA 3BZEB 5MENA 3ARFB 4KVNL 5DHVH 2BSTA 4D9QD 4XOBA 3ESVF 3UDWA 1UENA 4A2HA 4AYSA 2JIXD 5I73B 2Y5EA 1QI4A 5DZJA 1EEZB 4AEHL 3VQ1C 5DLMH 5C0JA 3BVNA 2DLHA 1ZVHA 1R24B 3LZFL 3HAEA 3P4NA 5EF1A 3RTLA 1YG9A 5J9PB 1J9TA 1MZZA 2MMXA 5C08A 3KPSB 1YY9C 4HS8H 1O6TA 2A6JA 3QDMA 4X4YB 2EXSA 1OCRB 1E4XL 2YARA 3GIVA 1P5VB 1SY6H 1XCTA 1B90A 4OLUH 4FQXD 2K8QA 1IAOA 1E6JH 4Z7OE 4U1SA 1WRFA 4NT6A 3CDYA 1FSKB 1WD9A 4YDKH 4TVPH 2LU4A 2LAGB 1CG9A 1CFVH 3ABLB 3HZVA 4MCZB 4OM1H 4UIMB 3C6LC 4UT6H 1HIMH 4XH2B 4MX7B 5AOKA 4JCMA 3L9EA 4MWFB 2GC7C 4HKJA 2YMTA 4WUKL 2FR4A 2YD3A 4ZUTB 4YWGL 3POHA 2A9NH 4PS7A 3P3YA 3QDAA 5J5EA 3L2MA 4AENA 2BXYA 3UGEA 2W0LA 2EE0A 4KWUA 1IARB 3N85L 4OJDH 4Y16D 1X5HA 3KL3A 2ICWB 3B8YA 2Y07L 2ZOUA 4LNVA 3P2BA 2OZNA 5EPMA 2DQFA 1WWCA 4JHWH 4B0MB 3GB7B 3O2DA 2B4CH 2WN2A 4GMTH 2VUKA 4RRPG 2W92A 1XX9C 3D39A 3GRGA 2FWSA 2Z31B 5T3XH 3T6WA 1B3IA 2VQ4A 4DF9A 5HYJE 2L3BA 2AEPL 2WPGA 4QRAA 1YYMH 2XYCA 4GPVA 4LCWB 5CWSA 5HGAA 4DP6X 1A5FH 7FABL 4WJ5B 1NIBA 3ROLA 5EUOE 3STZA 4F5CA 3ME0B 4KNTA 3EDKA 1KPUB 3WNJA 4YPGA 4P2OB 3VD4A 4GINA 3PAZA 5DEJA 2IDSA 3W2DL 4H4NA 2UY6A 1E4HA 4UM9B 2QFRA 1OF2A 3S8GB 4ZXBA 4Y2LA 1KGXA 1XGRB 4RZKA 4WV1A 5MEQB 2C4XA 4PAZA 1FL5A 1J0JA 1JHLH 2LTQB 4ICWA 2PR4H 1I7ZA 3JVGC 1CXLA 3OB0K 3EGXB 2YAOA 1DJSA 5I18H 4LL4A 3H2PA 3VFVB 2AERT 3SD2A 3P0VH 1KXQA 3LXAA 4CGTA 3AT0A 1WZ1L 4H0IA 3VD1A 2IPTL 3H4FA 3OAUL 1UZ6F 3F8UB 1UASA 5FM8A 1CDBA 2X4SB 3DMMB 1MJJA 4OBRA 3V5KA 3E6HB 3L7EB 4XN7A 1Q1PA 2IAMD 4XGZA 1XGTB 3EFDH 1J8RA 4PRIE 3MRGB 5ENWA 2G3XA 4GQPH 5D70L 1UM6L 3PAYA 4LVEA 3N0PB 3NZHH 3ARBD 5DRNB 5F1NA 3VXRA 3TEXA 3EXJA 4AYFA 4HPYL 4AYID 1CD1B 1NDTA 4G9FB 3RUGF 3K81A 4GKZA 3RWFA 5MP6L 4H8WH 4NWUL 2X4TB 5ITBL 1E90A 1XH3B 3BPNC 4LBAA 1E7VA 4I2XE 5JPMA 1A25A 2NUPA 4O58L 2AHIA 4YE4H 1FWXA 1UWGL 3S8FB 2XDHA 4ZQKB 5AZEH 1N3NA 2NY6B 3I6KA 4PIBA 3RU8H 1ZT4A 2OMZA 3T3PE 4OKDA 4KI5C 5I1DA 3ESNA 5I6MA 5FIEA 4BELD 3MRHA 2Q3ZA 2QELA 4A6YA 1T89C 3QG6A 1I1AD 3DBXA 3O6LH 4F1ZA 6FABH 2HXAA 2HRPL 5IFAH 1CIDA 4KDTC 3QUKB 4X8JA 4Y4KA 4ZMQA 1FLTX 3KR3L 3MOQA 3QIBA 4OZIF 1FE8L 4OIIL 4ONHA 1RUAL 3LZPA 4Z7QB 5ALCL 3DX7A 4F1SA 3UX9B 3N40P 4Q74A 5E8NB 4LSDA 3C2SA 4DP8X 5MEPB 2PCFB 4H20L 4HBCH 3ML8A 5LJYH 5I8CB 4L3EE 3EGDA 2WBJC 3O6ML 1S78C 1NBYA 2Y1YA 4QXTB 3VRJA 4N2MA 3HIZA 1SBSL 3OJMB 5SWZB 1CK0H 5ITFA 2DMHA 3CXHK 3I02B 3RFZC 2Z93A 3TO4C 3MACL 4ZT1A 5KAQF 2WXMA 5TE7H 1IIIA 1ACCA 3MRIA 2MPAH 5T1KD 4N8VB 5EZLA 2XC8A 1XIWD 3OLDA 4HFWA 5G55A 4A66A 4PJGB 4BKLB 4CDGC 1DQDL 1N6QL 4M8VA 4ZW8A 3IETA 4CBZA 2ZWZA 4P2RE 1Q9KA 2WAHA 5IWLC 4UTBH 2VW6A 5D2LF 4N9GB 1HHIB 4N0UB 4BK4A 4P5KA 5AVXB 2H3KA 2BSSB 4Y89A 2V6HA 3F6IA 3L4CA 5D4JA 3B7SA 2X7LB 3C5SA 3BDYL 3PWPB 2D0HA 3L6FB 4NBXB 5I1IL 3P30L 3L1OL 5CJQL 3X1EA 3EHBB 1AKJD 1YJDH 2HVJB 3DVIA 1CT8B 4GOSA 3X3GH 3QO0B 4M1DH 4M6AA 4N25A 2NMSA 3ASNB 4IOSA 4JRFA 5GGSA 3GJEA 1GZQB 4X0NA 5EU5B 2R8SH 3K72A 3QJHB 4NQVB 4OF0A 4FQQB 1AVAA 4WZ9A 1HH6B 2A77L 4GW4A 4TNVK 4X7TA 2V4LA 2Q1EA 3NIDF 4JQVC 2X4OA 2LOEA 2C9RA 5AVSB 3FYIB 4DVBB 3DO7B 1LLAA 3OZLA 1QPPA 1EEQA 3H3KA 4MCYB 2DV6A 5D71L 3W11C 5HYSB 5FHAH 2ZG2A 3QJTB 3CPUA 4OCWH 2KDYA 4PY8J 2HFGH 3L3OC 5AYQA 3W9EA 2LR4A 3US0A 3DIFB 2X4RA 1H15A 5IROC 3RUGA 4YBQC 2F5BH 1NWOA 2X5PA 2X4UB 4ONGL 2FATL 1XBRA 5JPNA 4C57C 1BFSA 3LIZL 3MNVA 2W95A 1JVLA 4FHJA 1QRND 4X5XA 2XTSA 4V2CB 5EZJB 4V2BA 1G1OA 5KSUB 1XGQA 4E41B 4XMZA 4JY4B 1GZPB 3L9YA 2BOBA 5CSZB 4MXWL 2ADFL 4JFQB 4ETYA 1HTYA 1KEML 4NDMA 2P4AB 4NI6A 5H4ZA 4LBEB 5D2NA 1HDMB 4L9LB 2XQBH 5HHXH 1YMHB 3SYOA 1KN4L 2BVPA 1YEJH 4KPHH 1QKZH 3SKNA 4QRRD 4LLDA 1I8LA 4OZIA 1E9OB 1PZDA 1RJYB 3VFMA 4BV1A 2ICCA 4WHTB 2NQDA 3IDMA 4HBQA 3MLXL 2VLKA 1OTSD 1FVCB 1ODUA 3NJNA 5DFWH 2C9SA 5F44A 1I9JH 2MQCA 4DETA 5IT2L 5B39A 1X5FA 3CSTA 4M43H 1WICA 3O4LA 4F24A 5DMIH 4UANA 2VR6A 3LJ3A 3WKNA 3FUFA 1MAMH 5K39A 4Z3GA 1HZHL 3KXFA 1DANU 4JFDE 1PEWA 1UCTA 3FFCE 4KUZL 4ZO6A 5J6GA 2R27A 3B7RL 3S4SA 5K9OA 3LZQA 2EVFA 2CA3A 3RWIA 4R8WL 5A6IA 3OPZL 2WZPA 1A6AB 3JWNG 5F96H 4OZ4A 1GGTA 4R9HA 3PWNA 5EUKB 2NCEA 1J12A 4X6BA 3ULUL 2OQJA 5KVEL 3OAYH 2YGPA 4OLYH 5EU6B 3L1FA 2R39A 4F8LA 1UZGA 2CIIB 3HW7A 4FFVD 4MD4A 4BM7A 3BMWA 3FONB 1JZ4A 3CZFA 3DUUA 4XP9H 3PCYA 3G9AB 3C8HA 5C8JB 5FECA 3HI5H 4GRLB 1WAAF 5F3FA 3OXSA 3VX1A 1EO8L 3FU0A 2PCPB 4QTHB 3KLHC 2JQMA 4YHYB 3WE6B 1JE6A 1U6AL 3VE0B 3QJOA 4DKFH 1F11B 3I2CH 5L6YH 1UA3A 1NAKH 1YNTB 4WFGD 4ZS7L 2ERJB 3KD4A 2ED8A 3AVEA 4JFTA 2YOCA 1HSBA 3ATAA 5D1XE 4LSTH 2OSLB 1LP9F 4YHZH 5AW9B 4BSWB 4U4BA 4FNUA 1YYLL 3A6CH 5GQBA 3E9UA 1KYOJ 1C5BL 2H9GB 4PGCA 3VWKC 3IU4L 3NSFA 2WP3O 5LWYH 2O61A 2DQUH 4LOFA 1MDAA 2N3JA 4PMFA 4TSBL 5ADPL 2JKIS 3MGTB 2ATPB 3DVNA 4GRMB 1TQSA 2HKFH 1NC4A 3KDMA 1URIA 4POZD 1A7PH 1KNOA 2PYFB 2ZYIA 4LP5A 4XXCC 5B4MC 3OKKB 1E27A 5DJCA 1H5BC 2DWDB 4D9QE 2WOYA 3KPTA 5C0DA 3WLBA 4IEFB 3B37A 1VCAA 3RWEA 3MO1A 2IV9A 5I6PA 3FH5A 3V4LA 5T3ZD 1VZHA 3L3IB 4OKVB 1UWXH 3O3AA 5MEND 4X4XA 1UJTA 2VLRA 4JKLA 2O6EA 3DV4A 4FXKC 3M7FB 4EKJA 4D7BA 3MRPB 1ZSDA 3GLZA 1T1ZA 1RJLB 3OLIA 5IW3A 4MNQB 5TQ0L 5ISZA 3LEXA 3DUSB 1IGCH 3B34A 2BY1A 3EG9A 4JDEA 5C08D 4G7RB 1WIUA 1B2WL 3OC8A 3D08A 2Y4SA 1JTPA 1KTRL 3G6AB 4AYMC 2WQRA 2DTSA 1G43A 1T6BX 2CK0L 3AS0A 1OSPL 3AWGA 3BHBA 3T4AC 4JFYA 4XMLL 1NH6A 3LDBB 5LGJA 4ONFH 5D93B 5I19L 4TNWK 1QPKA 2FIKB 3QSKB 4NEHB 1LE5B 1QVOA 3F01A 4JM2B 5E6YA 3QR0A 3ZQ9A 2B1AL 3E9TA 4FYRA 5CMAA 2V17H 1OSYA 4QRSA 5CZVH 2IBGA 2MCG1 1IT9H 1P6AB 5CEXB 1QSFD 4NO0B 1GC1H 1BZ9B 2OMVA 1GTNA 4J3TA 2K4WA 2AK4D 2N56A 1J5OH 3KH3A 5B3JF 1DZ0A 3DNKA 4XMXA 2R69A 4X6CB 3QORD 3LH9A 1BF8A 2XG4B 2AEWA 4FXGB 4YSPA 1HXMB 3MREA 4JM4H 4EIGB 2DQGH 3MRMA 4XPBH 4NP4L 1AZVA 4C59B 1E4XI 4Q52A 4GAAA 3MRKA 4XVJL 3FZUD 4XMPL 4ZFQA 1DLHA 3GMNB 5FYLH 3SDXF 2ZWKA 4JREC 3S5YA 2VSDA 3D25B 4QCIA 2FYVA 4MA1C 2A38A 3CDGB 5E94A 4PJFF 1GCYA 5I71B 1Q1JH 2V7NA 3B3IB 4OY9A 3HPLB 3OZ9L 5C07A 1I75A 1ZV5A 1EV2E 2LVEA 2VDOH 4N2LA 3TPUB 3WNKA 4C8XA 5IFHL 4X7FC 4YNYB 5HD8D 5E2VH 4N3UA 5DZNA 4JBSA 1A9EA 1MDTA 4XZ4A 5IMKB 1E4KA 3MNWB 1J8SA 3RFZB 3AGVA 4B6ZA 5B1JC 2YRPA 3HNTL 1EGJH 1JD7A 1Q90A 3D0VA 3NAAH 2HVKA 5AYUH 1TVHB 2YPKA 4GW5A 2VJXA 4KK9C 5C0IB 5T1DL 4F3FA 2CO2A 1D2PA 2BIPA 1XGPA 3PQYB 3OR6A 5FYKL 5ID0A 3BAYA 4TULL 2DWYA 2ZG3A 3GS7A 5KOMC 2VL5A 3MA9H 1UCBL 3STBA 3FQTA 1XF2B 3JWOC 3ZL2A 1S7WA 2VYRE 4W6XB 2IMMA 2OV0A 4NNPL 1QZ1A 2NY2C 3QPXL 3CMOH 2VUYA 5GGUA 4HQQL 3IDUA 2EDLA 4AL8L 1J5HA 2BSCA 4MD0B 3ZKXC 1RIVL 2QHRL 5I2IA 3QPQC 3MMEB 3PLYA 3VXRD 3B9AA 4ADIA 5D1XC 1QEWA 5M94B 4KKPA 1DANT 2H1LM 3GXUB 2AK1L 3P3SA 5IF0B 3VRLF 5KOVC 5GJTL 1QOKA 3GEFA 1X5IA 4P2QB 1R0AL 5C7XL 5IMLA 1YMMB 1MCOL 4PW9A 2WXIA 5DT1H 4NUMA 2R1WA 3MLWH 3B9DA 4KH2A 3DX0A 4XN1A 5E7BA 1SEBA 3IXTA 1MHEA 1JWMA 3VAEA 3LKNA 2MCMA 2WLYA 2HWZL 4I0PC 2OXHA 1NL0L 1R33A 1WTGT 2FGWH 5IJDC 4F9PC 1IQWH 1YEHH 4BRVA 2EDFA 4OTXH 5LBSA 3T8VA 5DHMC 1J9QA 3BT2L 4YR6B 5J1SC 4P57A 4UDUB 3P9MB 1UB5A 4Y4KD 5HPMB 1FZKB 3NYKA 4OR1A 3KPRD 1ET5A 1G7JA 2VDRL 3FOLB 5CZXC 3PNWB 4M6NL 5DD5L 4YAQA 5F1KC 3GRWL 3HI6H 4OCXH 4RFNC 2J8UB 1R5WA 2DDQH 3ALWA 4OIAA 3S3PA 3G5VA 4UI2A 1YEEL 4U1NA 4MAUH 2OMYB 4HAGA 1EXGA 4Y8DC 4BZ1H 1GS8A 4RSVA 2YFNA 4DP4X 4XPGH 3UJIH 2MQGA 4H0GA 2OI9B 1V3JA 3OF6A 5DRZB 2CGRL 1AQDA 3NRFA 4FNSA 3DVFA 1DEDA 5GGVH 5SX5H 1HJCA 1EHLH 5D7KD 1WTLA 1LWRA 3DUHA 3SDXA 4NPYA 2R0KL 3S9DB 3C87A 4FQXC 3NVQA 4L5FE 1AMYA 4ZI8A 3CFEA 5CAYB 4PJFA 3WTSA 1HKLH 4GO8A 3VFRB 3LS5L 5JUEL 4BINA 2A6DB 4OUUA 4OAWB 3PHOA 4QT5A 3UBXI 4X8GA 1KJMA 4DPBX 4LDOB 4PHZA 4CL7A 2CHWA 3CC5B 2EH7H 2CO1A 5AZUA 3SJVB 3FB5A 2F1AA 3WY2A 4AVKA 3HN3A 1S5IL 5DQ9A 4FXTA 1XD0A 2I60H 4J1UB 1I3UA 3ZO9A 4U1JB 5DHYB 3PWJA 2BCKB 4XBGA 1WV7T 4PRHB 3R1GH 4Y16C 1DBAL 4UWQB 5IJKC 2AFNA 3N43B 2X1QA 5ESAA 5AD0B 2DKUA 5FFGA 3VGAC 3MC0A 3HB3B 1GH7A 2G5RA 3MR9A 5GIRB 3VD5A 4A2LA 4C83A 5IB3B 2DZEA 2IG2L 2DMCA 2QGCA 5IG7B 1OGPA 3RHWF 2VAJA 2KH2B 3INOA 2CBTA 1QBLL 1N9PA 4EZJA 5JNYB 4FLHA 4HCRH 1F8TH 3EFOA 1TLMA 5LG6A 3DJSA 2ITDA 1IE5A 3FK3A 1AQKH 1KTLA 2WUBL 2IEPA 3AB0B 4MQ7A 1VGKB 2BP8B 1CYXA 3ETBJ 1EVUA 1H0DB 1QRNE 4Q6IA 2CGZA 1KGUA 1T80A 2J44A 2O4EA 2FBJL 3ILPB 2AVGA 4KKLD 1C5CH 4UIKL 5CSBA 2E7HA 3L5IA 4BE6A 3BP4B 5HDOA 3DXAB 4E0RB 5IVNA 4B41A 3ZDYE 2VB5A 5DJDB 2UZIL 3L4YA 1MXGA 1IVLA 2E6QA 3ZKMD 4RNRB 3V95A 1JXGA 4K94C 4IIZA 5EO1A 5F8QC 2G2RA 4GFXA 4YN3A 3QXDB 2WXHA 1S7RA 4WO0A 5EG6C 4A7SA 2HLAB 5C0RH 4G8FB 4OI9A 3L3HA 3AU0A 1F4XL 1M05B 5D1ZA 4OD3L 1FFNA 2IAMC 4H44C 4Q9RH 1CD0A 3D4ZA 2Q7NA 1S9XA 3OG4B 4XBPA 2IWKA 3SDCA 3ARBC 3C09C 4BWTA 1EUTA 1UH4A 2VLKD 1MCLA 3AROA 4F7TA 2OMWB 2YXVA 3GI9H 3IU3B 4Z6AT 2RA1A 2F68X 3O4LD 2DM4A 2NQ3A 3VI3F 2CO4A 2QVFB 1KLGB 4J6IA 2ILLA 4PJCB 4N85A 1S7XB 3EIFA 3N44B 5ESQA 2YUZA 5D7LA 5A2AA 1K5WA 4PY7A 3GS4A 3QUXB 4PRNB 2UYLA 1RP9A 2W59A 5F1IA 3KWWA 1OK8A 3QT2A 3PY9A 4ODTH 2A6KA 1M42A 1QWHA 5AVYB 2WZPD 3VFPB 2VLLB 4N0RA 2V2TB 2IQAA 4G6AD 4U0RC 1WIPA 2GIYA 2VR3A 2XBTA 5HHOA 4YDIH 4YMPA 2OCFD 2Q6WA 3DGGB 4JZNA 3BZFB 4UAOB 4XAKD 2GKIA 1BIIA 1FZMB 1CQKA 1RU9H 2WHVA 2E7DA 3AACA 4I0CC 3TNMB 1F0LA 4HK0B 2DB8A 1PF3A 1RV6X 3L5WA 2WIIB 2VZ1A 2QMKA 3O8XB 3VI4B 1GYWA 3NSXA 4N2NA 1W0VB 1SJVA 2MHAA 4CMHB 5HHQB 1G0YR 3ARZA 2BHYA 4YHLH 2Y7NA 5E9DA 3X1GA 4J3OH 2HX8A 4WK2B 5JHLA 4LIQH 4HC1L 3U36B 2F1BA 3SPVB 1ZK5A 3QE5A 1WYJA 4XPAH 1XIWC 2XA3A 5JORA 1INEH 1ADQH 3GXNA 3H9ZA 1ECZA 1VRSA 4PRPB 3ZZLA 1YEGL 3IFOA 2DKMA 1U91B 3MUUA 3CFMA 4I85A 2VH5H 4WSJA 5J6SA 5E1IA 1NIDA 3QIUB 3TIDB 1JFQL 5T5FL 3NH7L 1KBBA 3UC0L 2W60A 3LX9A 2EDXA 1QX1A 4XOCA 2WBWB 3UBXB 3WUZA 3PHQA 1NC4D 4H5SB 2J3SA 4PBDA 5AQ0A 3OZKA 4B9GA 1AANA 2FX8H 1VAHA 3MCKA 3WBDA 4A2DA 3UTZA 1MLBA 5DWUH 3V10A 5B38B 3FO1A 2EYRA 5MENE 3HC0B 2VSKB 4FLSA 1WD8A 5EBMA 5A7BA 1NSNH 4G8GA 5TDPB 4WENB 2DLFH 5IMOB 1BQHB 1RZQA 5FDYA 4M48L 2EVGA 1U92A 1HQ4A 2VM4A 1K6QL 2WXRA 3L4VA 4GY4A 4ISVB 4R26L 3SY6A 5C08E 1SJHB 2L7JA 2VLRD 4Z5RB 1MCHA 3W39A 2MSPA 1MCQA 2VISA 4G80A 4AMWA 4PJEE 4N2FA 1KT2B 1NTDA 4HJ1A 1XT5A 5ISZD 3UTSE 1ZEAL 2FT7A 3UTQA 3VI3A 4K8RL 3VFWB 2DQEH 5I23A 1CE1H 2WB7A 1ZLWK 3S36L 4F57H 4N1EA 4XAWL 5AOZA 3H0TB 3CFDA 3GSVB 1M2OA 4FQIH 1KCRL 3U1SL 5BOZG 4MASA 5D5MF 5I76A 3ZSTA 1OAXL 4D9LH 1E8WA 5E4IA 5ETUB 1SXSA 1QSFE 2R2EA 2YKKA 2ADIA 3IDYC 4XPFL 3KYOA 5KYYB 2J55A 2AK4E 3B7UX 2C3WA 5DUMH 1A3RH 4YXHH 1SLVA 4GXVH 1MJUL 4JFEB 4BKSC 3U2SA 2XN0A 1A6TB 3ZE2B 4PGEA 1JYVA 4FG0A 1KJ2A 2I5YL 5I8EB 1YY8B 3S96A 4WUUD 1OTSC 5E1HB 2C9VA 5GS1A 1Q9LB 1NFIB 5M7QA 4YC2B 1NC2D 3ARUA 4Z7WF 4LLWA 2MNUA 1HAWA 1J11A 4MHHG 1JPTH 1SM3L 1HI6B 3BPOB 2EEXA 5K5YA 1P9MC 4KVNH 1CB4A 4PJHE 1LEKB 4X80L 4A1RA 4K55A 4F5CE 2V2XB 2CO6B 3SYAA 5KVGH 1HC1A 5DGQA 1T7YA 2O6DA 3S35L 2VN6A 4KK8D 3QWOA 3OJVC 5EU4A 4PR5B 2OSWA 5C0FA 3TS8A 1X5GA 3OMNB 1TPXB 3VYNA 2R4RH 2HPOA 2ZOOA 4G43B 3NRQA 5C07D 1FAIH 3ZYZA 3FSOA 1LNUB 1LEGB 4AMKH 3K6IA 4E9XA 4FFVC 3COOA 5KSVA 3T0ED 3WFDH 1JN6A 4CVWA 2OA9A 2PO6A 3DTXA 4P3WA 4ZAKB 4IRZL 3WNOA 5AL0A 4DTGL 4OCLC 4OZGB 1KB5A 4P5TB 3ARGB 2ZXGA 4PH8A 2BIOA 1JF6A 2ENYA 2BDNH 5BVJA 3VGEA 1BXXA 1J86A 2I69A 4JANA 4XZUA 3RURA 2H3XC 4PLNC 3H42L 1M7DB 4B27A 1OT1A 4YWGH 2V8MA 3STLB 1N59B 3DURB 3VXRE 3RWHA 2CDFA 4GKSA 4DZBA 2J71A 3JWOL 2JV6A 2OZ4L 1LTXA 3ZX1A 2KC0A 3L9RB 4Z3HA 2Z92A 2YEVB 3TH4T 2J5WA 3C08L 1INQA 2C9XA 4I7ZC 2X1WL 4NQEB 3OX8A 1T83C 5F0PB 3HFML 1MIEL 2JB5H 3DDFA 4ZQTA 5CBAA 2YWYA 5JQIB 1JZ6A 2L8AA 2AEPH 4HWBL 4TOYL 3RJDA 3L16A 4L1TA 5FUZH 4IOIA 3CPLA 4IGBA 5L4MA 2YQGA 1U42A 4POZC 4XVUD 3ORJA 2YN3A 1ZHLB 1OIOA 3NEXA 2VKWA 4P23B 4GKNB 2J1WA 3KPRE 3QUYA 5D5MA 3FAWA 3OGCA 1R75A 1FVEA 2AJ3B 5IHZB 5DJXA 2WUCL 2SEBB 4PG2A 3V9FA 4EN3B 3FW6A 4ZMAT 1XEDA 2JMRA 2PW2A 4A7TA 5JR1L 4F58H 1L0QA 2CBMA 2LHAA 1XMEB 2ZCHL 4ZS6D 3UDWC 1IILE 2X1PA 3FRUB 4ZFOL 2BVUA 4X98A 5D7KE 3OAUH 3PV6A 1DQQB 3V7AE 4GT0A 2IMNA 1RHFA 3F7QA 3OF6D 3ARPA 3WEOA 4K5PA 1E28B 4OFPA 4JO1H 4V1DA 1R1CA 4UQ3A 5D70H 2WBKA 4PJ5A 3FPXA 2MOGA 1P6FA 5CP3H 3G6DH 3I50H 5DVMA 5AUMB 5D6CA 5DURB 5MP6H 1SVZA 4NWUH 5JHDA 1XH0A 4L3CB 2HSIA 3A47A 4PBXA 2JELH 4M8QB 1TU2B 3FUEA 1UWGH 2B0SL 2G0LA 3RPBA 1QHPA 3T2LA 3RIFF 5LXGH 4LSRH 4O5LL 4OJYA 3KPMA 2FX7H 3JV4A 4YHKH 1LMIA 2EIZA 3F65A 1IC4L 4C56D 1KIRA 2DKSA 4TUOA 3C2AL 2H41A 2HRPH 4YHPB 3QORC 2ZOLA 1IAMA 2PP9A 4N3TA 1F4WH 4KTEH 1UJ3B 1WEJL 3RY4A 4YDLC 1FFOA 1UZ6E 4O02L 2BW4A 2LLGA 2C7FA 3KR3H 5DD6A 3VX0A 4B7IA 5L8KB 2DWXA 3FZUC 4HUNB 3GMMB 1ZS8A 2GBAA 4JKPH 1DJWA 2IXQB 4HUKB 4OQTA 3MRCB 2WXPA 1UWEH 3KPOA 1MFBH 4L23A 5ALCH 4RWYL 1ZGLM 2V5SA 3MV11 5ACLA 1PZ3A 3BPCA 3ESPA 4M56A 2OTWA 3FTGB 3O6MH 3RUGE 2M1KA 3FQ4A 4YSQA 5B22A 2EDTA 2XWJB 5DMKB 2EE3A 5HD8C 2NUTA 5CGMA 4ATWA 1GJIA 1HCFX 5JLZB 2PPDA 3MACH 3ZJAA 1NJ9B 4KQ3L 5GS3A 3ZTEA 4V33A 5CEZD 1BZQK 1NGZB 3NZUA 5DUJA 4MZ2A 3RY5A 1YQVH 3Q6FA 5CHNA 1U30A 3VO0A 3DARA 4BSVA 1EO7A 4K5NA 1D6VH 1DQDH 4PTUA 4I77H 1CFQB 3C6LB 4Y1AB 5HGBA 3OMZA 2BP5M 4JO8A 2BSED 4OGXL 2F61A 3WUWB 5HXMA 5LAXA 3IKCB 3LN9A 4HXBL 4OZIE 2YGVA 2VMEA 1R46A 2VLKE 3QFDB 4K94L 4QXUL 1EIBA 4POYA 5D1ZD 4AH2A 1THCA 2XKNA 1PAMA 1MCDA 1I82A 3SDCD 4NCDA 4QY8A 2BRRL 3O4LE 1KLFA 1CLYL 1KBWA 2WWNA 4N2IA 1D5BB 1XF3A 2B15A 4RRPA 3LRHA 1BBDH 5E8EA 3KWTA 3MBWA 2NX5E 2R0ZL 3LPGA 5MERB 3LN4B 5JPMC 5GRVK 1JZ7A 1LYQA 2NXZD 4UYPA 1U4FA 5D71H 2QADD 1IJNA 4PJIF 4DAGL 2WCSA 2Z9TA 1R3IH 5JHAA 2R51A 3EFFA 4LLYB 5D7LD 4XOAA 4AIXA 2Y7QA 4UTAL 4OD2A 3NSJA 1I8KB 4M6ML 3PWUA 3I9PA 4XAKE 3MROA 3WOVA 1E5YA 2G3NA 2G75B 3CFBB 4UT7H 1FH5H 5D2LE 1U8PB 2B59A 4ONGH 5EORH 5FKAB 3VDAA 3FUJA 3LIZH 2PN5A 2C3VA 1PFOA 1HNGA 4Y4KC 1L5GA 1J9RA 3DGDA 5HHOD 4AQAB 1UFGA 2ZUSA 3A5VA 1X7QA 3EJYD 6PAZA 5IHLB 4AXWB 3IMBA 3OHXA 3S34H 5F9JB 5AWNH 1QATA 1HWWA 2XJLA 2YC1A 3ENEA 3HS8A 3DECA 3F7RA 5TDOB 5I8KL 3ECBA 3BO8A 1M4KA 43C9B 4HUXA 4XNZC 1A8JH 2AQ1A 3ATBA 2AKRB 5HHPB 2C7UB 4PG9B 4KQ4L 3NIDE 3OVUB 3B8SA 1ZDQA 2F19H 5E9DD 3C9NA 1AS7A 3TJHC 3QEQB 4IKNA 5I1JL 1SPDA 2H3NB 5E2JA 1FC1A 4NUQA 1M2VB 2FSEB 1ESOA 5DZAA 2D3JA 3SYPA 3LSOA 1KV7A 4F15C 3BD3A 3PGDA 4ZSOE 3U7YH 4QIRA 3WKMH 5HHNB 3BVDB 1VESA 2FH8A 4P9ML 4DGYL 1D9KA 4YK4C 3BPNB 5EF2A 5ECJE 4PS4H 4CNIB 1XV8A 1R3LA 3V4PL 4C47A 5DQDL 1B6DA 4U2ZA 5I30H 2P7TA 3IRPX 12E8L 2XTJE 3BEVB 1MELA 3QFJE 4KUZH 4KVPA 4XXDA 1IEBA 1JTTA 5TE4H 1SYSB 1VPOL 5LCVA 5C2BL 5H8DA 5K9QI 2VDRB 5C6WH 5T5NF 5I6OA 4E9SA 1P84K 1J05A 2VMFA 2VDNB 5FGCB 3VRIB 4PJ7B 5KTEH 3K80A 3ZDZB 3V8CA 3KZ8A 2EDWA 4GQ9H 2HJFA 3T65A 1G1YA 1KIUB 1VFAA 1FYTA 1K4DA 4FLOA 5HHMD 5LBVA 4G8GD 4KDVA 2WJ5A 1YEDB 3LS4L 1CURA 2WBJB 4NN7C 4U4IA 2CLVB 4K9EH 1FG2B 3FHAA 1IBGH 1TZOA 2C8NA 3FU7B 4FQ2L 4HJTA 3T71A 1Z9SA 3TO4B 3W9DA 4AQEA 5EIVA 5ABDE 1MFVA 1UA6L 4LCIL 5DUBB 2YRZA 3FFDA 4KKLC 2YWZA 3TCLB 5JPNC 4OGAD 4TYUA 4U1HA 5FM4A 3K5SA 1TZ8A 3HRZA 4PJIA 1VFOA 1XZ0A 1GS7A 3A3YB 1BEXA 3ZKMC 4O2FA 1G7LB 4OBSA 4Z7OB 4MA3B 4P59H 1FV1A 1KUMA 1OCWL 1DFXA 2ZKXA 1NCNA 4XTRD 3CFCL 1MFUA 1TQWA 4WUUE 3GSUB 5AYTA 1QP1A 3T2PA 2QTVA 1I8LC 3II1A 1WAAE 3GMPA 4N1CA 4E2OA 3ZYJA 4HAKA 1S3KL 3S5LB 3RX8A 4ZMVA 3TJPA 3OB8A 4O2EA 1HHGA 3SCMB 2R2HB 3II2A 4GI9A 3FXIC 2GITB 1IV8A 5E95B 3MFFA 1F45A 3AADB 1UKTA 1SN0A 2P5WA 3MJ9H 3P3UA 3T6VA 1KTCA 2BOLA 3DYMA 3GNML 5FGSA 1LP9E 4LLUA 5CEYB 3E0GA 3GSOB 1Z9PA 3L3OB 2ZSWA 3REVA 2FUQA 2VT0A 5HYJB 1LWHA 2GTZA 1XWVA 4HUUB 4XBEH 3ZSSA 5EUOB 4G70B 1F13A 1OVZA 1AXTL 4G6AC 3T0EE 5D9SA 4JPKL 4ZYKB 1TUPA 3F58L 2J8OA 3EJUA 4PV1C 1M1SA 3GMRA 5EBLB 2CK0H 3DKHA 3NZ8A 1OSPH 1R5IB 3S7GA 3UO1L 4M03A 1CICA 2P52A 3TO2B 3ULSA 4QHKI 1NCOA 1IO4C 1W6LA 4IKLA 4O51B 2X70A 2PWGA 1N8ZA 1MCEA 2W07B 2PP8A 1VFUA 4I9WD 4GBXA 4WHCA 1W72L 4NCC1 3U48A 4C4BA 1ZXKA 4JG5A 4ODUA 3O9WA 1E5UI 4MNHA 4XVTL 5E8OA 2EILB 3WEXA 4BFOA 4XPHL 1ADWA 3RTQA 1LL1A 3JYCA 1RK1A 3KCPA 5BRZD 2XX0A 2Z65C 3DROB 4PRIB 3RAJH 1QUPA 4LSQL 4G42A 3ZTJH 4NP4H 4KX7A 1RPKA 4QHUB 1AE6H 1ROWA 1F6FB 3ZE1F 5DK0A 1NEZB 4HSCX 5IW6A 3FQXB 4XC3H 4JDVA 1XAKA 1D5XB 3CN4A 4I2XB 4PLOB 5F2FA 2Z8SA 4R83A 4UQ2B 1MI5D 1SHXA 2VITB 4OD1H 3VD3A 2H1PL 3KLSA 2ZKHH 4U1LB 4JPIB 4IGBD 5DTFB 3KWUA 3T3PB 1MFAH 4RMQA 4J39A 3U2IA 4MJIE 1MREH 3FMGL 1MVFA 5KVFL 4HKZA 3QUYD 2GEQA 2F7PA 1L6XA 3KYMA 4UTAH 1IGJB 1WF5A 1H8LA 2VWEE 1AZNA 4ODWA 4NHUB 3PWLB 7TAAA 5B3JE 1WA2X 4WNQA 3K71B 3O2VH 5K1VA 4K07A 4PLKD 2Y25A 3KGUA 4ORGA 2WTRB 3CFJA 1ZGLA 5T3ZL 5JIPA 1DEEB 4PRAA 1T1WB 3RPIA 4HOWA 4GMSL 4ZX6A 4L3EB 3QQDA 1PMYA 3SDXE 1EEYA 4HS3A 2R1YA 1TZGH 4L4VA 4WWKA 1LO4L 1BGXL 3OKLB 1KCVL 4QTIL 1BXVA 4PJ5D 5CR1A 3FTYA 2AV1B 3VWKB 3MNDA 1F2XK 3MJ6A 1EMTL 4K7FB 1R0AH 1UACH 3QJQB 3VXTA 5JHDD 1CFNB 3Q8FA 4M7JH 4P2RB 3E1ZA 4C56E 3PXHA 3ARTA 4XBMA 1KIQA 3IDNB 4HA1A 2WXOA 3QO1B 1JXKA 1MNUL 2DM3A 1BVLA 3WHE1 3UABA 3QIWA 1WDAA 1F4YL 2AQSA 3ULVL 5IHUL 3A4FA 4FQJL 2GY7B 1SGKA 4OSUL 1ZLEA 4JPVL 1H5BB 2PYEA 1A6VL 3B9KB 4YUEL 5C71A 4GG6B 1CWVA 1S7VA 1TQTA 1G6RA 1ERNA 3E3QE 1WZLA 2D3NA 1OGTA 1SYVB 2ARJB 4HS6B 3WFEH 4HLEA 4RETB 1FO0A 2VDNH 2Z0BA 4HUWB 2KQNA 4TF4A 5LHDA 1BVNP 5DJ6B 1ZA3A 4JRYE 4FXKB 4KK8C 1Z3GL 1NCWH 3HI1A 3ARQA 3O2DL 3VRLE 3SGKA 5JTWA 1KGIA 2CGRH 5CEZE 2VABA 3EBAA 5CP7B 3WIFB 3L1EA 5KVDE 5KJ7E 3QNXB 1G0XA 3JZ7A 4V11A 4BCYA 1HXKA 4BGDA 1R3HB 3SE9H 1C1EH 3BWZA 2RFXA 1VSCA 2L4OA 3T0EC 3T4AB 4XMKH 3FT1A 3LHPH 3VCLA 4BWUA 4E5XB 3HZYB 1BLNB 4P0DA 5JUEH 5EEZA 1QFWM 1KELL 4ZPVB 3FT2A 5E5MB 3RKDD 4JE0A 1B4JL 4Y4FA 3WTUA 3MLUL 2D3VA 3IFPA 4MNGA 3X14B 1OTTD 1MG3C 4NJ9L 4Y5VA 3RL2A 1KCLA 4NHCH 1S5IH 1HSAB 1J1PL 1CBJA 3SDAD 1I9IL 1CLZH 1NIAA 1NLDL 5AZ2L 2NY7L 3QCUH 1O5DT 1QHQA 2CDGA 1P7HL 4PRBA 1DN0A 2F53A 1IBFA 3MV9A 2K1MA 3NQKA 1GGUA 1MXDA 5CINH 2Y06L 2J56A 3N1MC 4X5WB 1ITCA 1JK9A 3TBTA 3AREC 2ZPKL 5DD1L 1A1OB 1OAYH 2DIEA 4JCWA 1SLXA 3HR6A 4JREB 4U33A 1UD4A 5HHVL 2NY5L 3FB8A 2X9ZA 4MA1B 5D7LE 4DH2A 2J73A 2OYLA 3PDOA 1SHMA 1PPIA 1MKFA 1QBLH 1MWAA 1GGCL 4UU9B 1DZBA 3ZE0F 4F8TA 1BQSA 2I32A 3LPWA 4JFDB 5HYFA 4WTWA 4DGIH 3OB0H 3FFCB 3R06A 1MPAL 2JJUA 3LRGA 1YN7A 1E6OL 3BLKA 2CUAA 5HHOE 1EJFA 1LD9A 4AGNA 4ELMA 2YMXL 1HH9A 4FLQA 4XT1C 1JNHA 2IANA 2IOOA 5E8PB 3UACA 2QQKL 1Z3RA 4PV9A 1U58A 1QTPA 4A6YL 2EKSA 1R5VB 2D7MA 1ONQB 2PCXA 4WQOA 3F5WA 1ECYA 3KW7A 1A9BB 1OHQA 5I1GL 5KYUB 2BS71 1WFJA 3IFNL 4G8AC 3S5ZA 2G5BB 4ZS6C 2VWEC 1EZVX 3AWFA 5JO5A 1OCCB 4IJ3C 5E9DE 4S0HA 3KPQB 2VIRA 2CXKA 2JLPA 3H7BB 2W65B 2NY2B 1OP5K 3ZOAA 1UXMA 3RPKA 1HL8A 5H4YA 5IBUB 1F4XH 1HZLA 1QABA 3V0VA 3ZKXB 3UCRA 2CLRA 3FL7A 3RBSA 3MGAA 1WCBA 5D1XB 1PD0A 4KKZA 2DRUA 3VFOB 3EH3B 4X6FB 2NXYD 1P1ZB 3M8OL 1YLBB 1HU8A 3PJNA 4RH4A 5C0AD 3U0TB 1G9MH 5GSRB 4KQ0A 4MXVF 5DS8A 1D9KD 2H0EA 5JZ7C 1IGMH 5F7AA 2RACA 5E8DH 5C6TH 4N8VG 2AQ2A 3L48A 4X5LA 3BDBA 3SKUD 4JGMA 4B9FA 3VQ2C 3BP5A 3SO3C 1K3IA 1YC7A 3EDDA 4NX0A 4ODHH 1KDJA 5IESH 2C9UA 2V2WA 4I0PB 3TP4A 5TF1L 3FH7A 3Q3GB 3R7RA 2EEDA 4CN6A 1KCUL 4XCEB 1LWJA 2HG5A 4RIRA 4LCCA 1KN2L 5HHME 3RHWK 4G8GE 5I1HL 4APXB 4ZFOB 1X5YA 5DJ2A 2GBUA 4RFNB 4N20A 4Z77B 1TKWA 2JIXB 3E3QC 4OJFH 4P4RB 4ZDHB 2GIXA 4YDJB 3ARDD 3NJVA 2VDLB 3BKJH 4M6OL 3GGWA 1XGUB 4F7MA 2O5XH 3ASWA 5ESVA 3FQNB 4MFHA 2X3CA 3GTVA 1MCPL 3GI8H 1V10A 5D72H 1JPGA 2IH1B 5IK3A 1CFTB 3POCA 2MQ0A 4FQXB 5C0EA 1JNJA 2DL2A 3K6OA 3NT0A 3X1NA 1EO5A 2CMRL 2W9EL 1FNAA 5C9JA 4ZTPH 4JVWA 5F88A 5LGYA 32C2B 1KBVA 4CW1A 4ZZKA 3NPZB 3TWYA 2D03L 2UUDK 3CG8A 4D8PA 5IMMB 3QVAA 1JFQH 2YHGA 2ZAIA 4U3HA 5GJSL 3VMNA 2K78A 4MMZA 4O02B 2VE6B 4Y5YA 4NZFA 1CGXA 2XZQL 5GRVL 1E3ZA 1MIML 2OFQA 2G5UA 3MX0B 5D1ZC 5JDSA 3FCTA 4Y16B 3S97C 1IM3A 2W0PA 3SDCC 2YAFA 3UPRB 4LCUA 4ABWA 5ID1A 3VGAB 1AFVL 1DBKH 3AJ7A 1ZIBA 2C9PA 2BHFA 3QJXA 2JLLA 4IDJL 3RX7A 1OO2A 2DN7A 3QCVH 2J6EA 4JJHA 2P5WD 3CSYA 2NXZC 1DUZA 1U8IB 2QADC 4KZEH 1K6QH 2YD6A 1MRCL 2Z35A 2ZCLL 3UIYA 1T4KA 5IY5B 2ZT9C 5E00A 4CU7A 1KY6A 1SEQL 3BH8A 5DJAB 3EADA 4L4TA 5E99L 5T1MA 3NRPA 3M17B 1OPOA 1QFHA 2G9KA 3MRLA 3RVWD 5IW1B 5C3TA 1GY1A 2ICES 4K3HA 1R4XA 3MXVL 1K72A 2G3ZA 2QVIA 2YAQA 2HLEB 3EJYC 4U1IB 4X6DF 4OI7A 2X1OA 3P9LB 3WFZA 3BDXA 4Q14A 2P1YA 1T1YA 3D18B 3GMOB 4I9WE 2KQMA 3RVTD 1OAXH 1CICD 1QI5A 4P4KA 2VXQA 3L95B 5JIQA 2BP0A 2WM0A 1AGCB 3CX5K 2J6WA 1S7QB 3B3BA 1VFBA 4ILDA 4P5SA 2UY7B 5BRZE 2GUOA 1J9CT 4AJWA 4N6RB 1V3MA 2IAMB 2BM3A 4GBXD 2EQDA 3U9UB 3TONA 3MZGB 4QNPF 3O9WD 2Q86B 3ARBB 1Y6KR 3C09B 4S2SB 3RTQD 3BRDA 1V7NH 3ML9A 3EOTL 2FDBP 1A4JA 4XCYB 3DSNB 2BOCA 5FO9A 2WYHA 3VFNA 5FOBB 4YIQB 2BVOA 1LDPL 3P3TA 3PABA 2G3MA 4HXAL 1MI5E 4I13B 4EO5A 1JHKH 4GSXA 5HJDA 3IMTA 1KB9K 2FZ3B 2RH0A 3HZKB 1LE9B 3D09A 4AWJC 3OPUA 2PXYA 1L9PA 3S35H 5F3BB 1BOYA 1DSFL 3P77B 3FN0L 2VW4A 5D5ME 3TWCL 4FCAA 2IH3A 3DX9B 4YHMH 4U0RB 3X17A 1AR1D 3MODH 3NCJL 5EBWB 1SLUA 1R3KA 2YQBA 3CX2A 1D7BA 2ATAA 1JBJA 4GXUN 2X53A 1JF5A 3BUYB 1RVFH 3IGAB 4IRZH 4DTGH 4IRJD 2K3TA 4DGUA 2H0JA 4Y2OA 4Z7WE 3UAJA 2LQRA 3RJOA 2XYBA 1B0GB 5EDXA 5IEKB 3K7UA 3Q44A 4NUGL 1VKXA 2EDEA 2R56H 3BVXA 4GG8A 1JWSA 4PJ5E 5TK2A 1DQJA 1IGYA 2O26U 2F54D 3JWOH 4JRWA 5T1KB 2ICEB 3WO4C 4OGAC 1XIWB 5TD4A 4WWKD 1B88A 5DFVD 3ECVA 4QOKA 4R5XA 5JHDE 1IGTB 3X12B 4QRFA 3PJSB 1BM3H 1LQSR 4RZCA 2NSXA 5J6HB 1FHGA 2Q7YA 3Q6GH 1OANA 4MB4A 2ADGA 3SKMA 2OR8A 5CNHA 3DX8A 4NRYB 3G5WA 1SDDB 4N2EA 1J0KA 5FWRA 4XTRC 5CJOH 2VR7A 1BEYL 2QV2A 4NUJB 1HEZB 1QZNA 5F71A 4H26A 5G4MA 4X6DA 1DDHA 2V37A 1AKJB 4NNXA 1WFNA 2EH8H 3TX4A 2WQ8A 5GS1C 3C60A 3H9HB 1FVDA 1LO2L 4LNRB 2HMID 1AOHA 4QRPA 2BVQA 3FTVA 5HDWA 5KSBF 4YFLF 2R69L 5D1QA 3T1WA 5JR1H 3S3SA 1IGIH 1QBML 2COQA 4L0PB 2ZCHH 5E23A 4R84A 2JKRM 4JR9H 1S8DA 3I75A 3B9VA 3K6NA 4G7VL 5K33A 1E4WL 4APQB 1K4CB 3RIAF 1YEIH 3ZLQC 5IQNA 3KG5A 2J5LC 5F89A 3U79A 3W57A 2VDLH 2ENQA 4DPAX 3TYFA 1QRNB 2DWEA 3FOMB 3GSNA 2E7MA 4JQXA 5C1MB 3NTCH 4QJ5B 3FUKA 1F6AA 4RX4A 2R2BA 3QNZA 4O00A 1P4IH 1VEMA 2R29A 4CBPA 5KW9H 1HYRC 3RE0A 4BQCA 3QQ9D 3IDYB 2ITFA 2FEEL 2JKSA 2JJWA 2XLLA 3K2MC 4M5YL 1FFPA 1PSKL 4AQ1B 4QRRB 3P40A 1Z1WA 3BIKA 2FUTA 5I17B 1AO7E 3TYGL 2C1OA 3FQYA 4NKOA 3M86A 3Q8EA 2BNUA 3DX6B 4K23H 1M7IA 2E7CA 1FFRA 2GI7A 3KM2A 3C2AH 1RZ7H 1RP8A 5IQ7L 2VQ1B 1Z9OA 1T20B 5BPPA 2DH2A 2F53D 1XDTT 2A9ML 5FGBC 3VXSE 43CAA 1JGEA 1N0XL 4K5MA 1PG7H 1IQDA 2ZF9A 3CN0A 4ZNEE 5CILH 1FNGB 2CR3A 4RMVA 5FCSH 3BX7C 3CIQA 5GPRA 4IHOB 1HHKB 5I28A 3LXUX 3WNPA 2PPAA 1HOCA 2J2ZB 2GT9A 3VXMD 3HBPA 3IDJB 2QDVA 5AOIA 2NY3D 3P11L 2WLZA 3IDGB 3AU1A 4IGBC 3SY0A 1MOEA 1N5YH 4F2ME 5JOFA 1LMKA 2QBWA 3SGDI 4IRSA 4XRCA 3ZUNC 1YNLH 2IGFL 3BP6B 3C6SB 3QUYC 4KQ3H 1BJMA 1YAIA 4U2YA 1T5KA 2IAND 4WW1B 1A14H 1HXYA 4MLSA 5AW3B 5C9KA 3LKOA 4BE5A 1M56B 4PG2C 2O5ZL 1P7QA 1GW0A 2C1PB 2UXVA 4PLKC 2NNAA 5LBSL 5FB8B 4P3DB 4FKKA 3MLRL 5HI5D 3MBXL 1PYWB 4U3SB 5GZNA 4NGHL 4ORZC 5ACZB 1KG0B 4OCNC 5G5DB 3P0YL 2VXSL 2AABH 1OPGL 1K2DB 1Y0LA 1AHWA 1KZYA 1QBBA 2ATKB 2YPLA 2ZXBA 1A64A 3B2VL 1J1OL 3F84A 4K94H 4DN4H 2JXMA 4PI0A 2Z4QB 3QI9D 1CLOL 3F00A 3JQOB 4X4MA 3QUZA 5C0AE 1DVQA 3QQXA 4X7DC 4LEOB 4DP7X 1CLYH 5I5IA 1D5ZB 3QULB 3H3PH 1VADA 2HH0H 3RIFK 4OI8A 2Q9OA 1TTAA 3L3KB 3G04A 1N4XL 5JW3L 1BCIA 1CDGA 2MTPA 2VAAA 4LSVH 2ENPA 1WZMA 4H13C 5MHSD 3V6FA 4IM8A 3F7YB 1S9WA 2OMUA 5BXFA 4U3XA 4HUVB 3ULUF 4BH8A 1JZEA 3EYUH 1ZV2A 3P2DA 4OM0L 4AOFA 4KZDH 1CF8H 4W93A 1DYZA 3B6SB 1L9TA 4HDIB 2CWRA 4GAYA 3JSSA 5BO1L 1ZTXL 4XP1H 1RUMH 3MOBL 3FCGA 1SUJA 4GAJL 5L9DL 1KJ3H 4AX3A 5MENB 2ADJA 2L7UA 4ENED 3V0WL 4URKA 5I8KH 1CLCA 5LKNA 3IVKB 3WXVH 5C6PB 4KFMA 4ZZFA 3GMLA 4FABH 3BW9A 1K5NA 3N41F 3T5WA 3Q5OA 1PDKA 5C7ZA 1HINL 3P4NB 4I4WA 1RMFL 5C08B 3QYMA 5CCHE 1T0PB 3A4AA 3QQ3A 2A6JB 2KL6A 4PJEB 3KWXA 3VXQA 5ALBL 3QEHA 5F72S 3GIVB 3HR5B 1TZHA 4PJIE 1KXHA 1MZYA 2MCPL 1XCTB 5I24A 1EZLA 4FXLA 3VNYA 3ZL4L 4BDVA 4NT6B 4DFIA 3RKDC 3CXDL 2Q2LA 5EH1A 2G2NA 1KYUA 4IOFD 5CEZL 2E9JA 2CAKA 1CG9B 1ZOXA 5E51A 3HZVB 2DEWX 1TSRA 4LPYA 1OTTC 1BLIA 4NXKA 2QVKA 3TU6A 2NQCA 3P4MB 4L5FH 1QSFB 4HKJB 2FR4B 5F8RC 4YBLC 5T8IA 3SDAC 2AK4B 4J3WA 3MXWL 2ZJSL 3QORB 3T6XA 1JNLH 5L2KA 4JFOA 1NMCB 4YDLB 5FA3B 1A7QH 1IM3D 4HT1L </