3NJLA

D116a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis, at ph7.5
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
119
Chain Sequence
QGLAQFIKVNVTLENGEPVFIYTDANGQVCQGDITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPAPQIINRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
molecule keywords Peptidase
total genus 22
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njlA00
3RYMA 3QJRB 2H3XC 1J5CA 2VMJA 1BXUA 2EIJB 2YAEA 5B1BB 1AZUA 3ZX1A 1PLCA 1XMEB 2BWIA 2CBPA 3CDZA 3FQ1A 4FA7B 1XB6A 2EIMB 2ZONA 3X2QB 1OOWA 2IDFA 4DPAX 3CVBA 2UXGA 1W6WA 3X1GA 5TK4A 9PCYA 5LDUA 4EF3A 2IDSA 1MG2C 1BXVA 1ILSA 3CVDA 1SHXA 1NINA 1SFDA 2YAMA 1WA1X 2B08A 1KDIA 2GBAA 1X9UA 3IEAA 4P5RA 4E9SA 5PAZA 1F56A 4YSSA 1A4BA 1WS7A 1KBVA 2IWEA 5I5JA 3DTUB 2XXFA 1JVLA 1ZPUA 1ADWA 1V54B 3UAEA 3TU6A 4E9QA 1FWXA 2X87A 1URIA 2FTAA 2OJ1A 3AG2B 5I6PA 5I5MA 2CCWA 2IH9A 2XV3A 4GP4B 4KNUA 4YSRA 3PAUA 4N8UA 1RZPA 3PAZA 4DP9X 3KW8A 3T6XA 4BK5C 2J56A 2FQGA 2CUAA 2YAQA 1ET7A 1E65A 4HHWA 3ZDWA 4GY4A 4QKTA 3FSZA 1PMYA 2AVFA 2X88A 3NJLA 3IBOA 1AANA 1NIDA 1GY2A 1BYOA 2H5UA 2WO2B 3NT0A 5A7EA 1L9SA 5I28A 3H56A 1KGYE 1L9RA 3NJNA 1NTDA 1WA0X 2IDQA 3ZIYA 1JVOA 1OE1A 1JZIA 1A8ZA 2XXGA 3DKHA 4F2EA 5AFAA 4Q8BA 1TKWA 1CC3A 1DYZA 3PAVA 4HZ1A 3TBCA 4NAJA 4BDVB 4YSCA 3WKPA 4YSAA 1SFHA 2FQEA 1BYPA 2CAKA 1GR7A 1L9TA 2MRYA 1CUOA 1OCRB 1B3IA 2Y1AA 1V10A 1EZLA 1NICA 4CSZA 1N68A 2I7OA 3FU8A 1ZDQA 3NSDA 3QJQB 4JKNA 3SBRA 2XWZA 3X1FA 1PLAA 4AKQA 4E9RA 1MZYA 4KO5A 5EHFA 2I85A 4Q89A 1N70A 1M57B 3AG1B 2IWFA 2H47C 1AR1B 4BXVA 4NB7A 1VLXA 1E30A 2BP0A 2PCFA 1AOZA 4DP7X 2YAFA 1ZV2A 1J5DA 1SF5A 2PP9A 1RZQA 4A2HA 4YSEA 4BWUA 2XYBA 2IWKA 2XX0A 1QLEB 3FSVA 2BO0A 2GC7C 2XV0A 5AKRA 3T6ZA 2XLLA 5I5IA 2W8CA 4HIPA 1AG0A 1NPNA 1JZGA 1R1CA 2GI0A 3G5WA 4KO7A 1J9QA 2XV2A 1AQ8A 3WI9A 1CYXA 2IH8A 3NJGA 5ANHA 2GC4C 2Y69B 2WO3B 3JTBA 3T71A 3NP4A 3NSCA 1WS8A 4KOCA 2OCCB 3FS9A 3N2JA 1A4CA 3NJKA 5D4JA 4DPBX 2OV0A 1JERA 3KW7A 1ASPA 1IBYA 1JXGA 4E9TA 2YAOA 4HCIA 1AG6A 1OF0A 2J57A 1OE2A 3N55A 1KCWA 5I6OA 1ILUA 5I26A 2RACA 1NPJA 2BP0B 4F2FA 1L9PA 1IBZA 2HRHA 1OCOB 4ENZA 5IY5B 4RH4A 1AZRA 4GP8B 3NJHA 1W8EA 1ETJA 2EIKB 2HLEB 4YVNA 1UATA 3UABA 2HZHA 4DPCX 4YSPA 2VM4A 4YSQA 3BVDB 2FQDA 1TU2A 2PP8A 3V9CA 3PPSA 2VW7A 2PLTA 3HEIB 1NWPA 3H4FA 2VN3A 2YXVA 2MTAA 4PCYA 2HX8A 1OCCB 3C75A 2YAHA 1AIZA 4HCGA 1NIAA 2ZXWB 3FPYA 3S3BB 2CJ3A 2PPFA 1ASQA 4PAZA 3SQRA 1KDJA 3NJJA 4YSUA 3FSWA 2DY2A 2QDWA 3SBPA 2QT6A 2AFNA 2FT7A 3CG8A 3QJUB 4BXSV 1SNRA 3X1EA 2EILB 1JZJA 4DP8X 1OV8A 1A4AA 4X4KA 2PPCA 3IE9A 4L0PB 1PLBA 4HHGA 2A3TA 1ZIAA 3UGEA 2PPAA 4GP5B 4JHVA 7PAZA 3S3CB 2FT8A 1J9TA 2W88A 2QDVA 2PP7A 4KO9A 1HAWA 3ABLB 1SJMA 4UAHA 3NJMA 2P80D 3FSAA 4QLWA 1ET8A 3UAAA 1BAWA 2AZAA 2TSBA 4DP0X 5B3SB 3T9WA 2FWLB 1FA4A 1AZCA 4HCFA 2HXAA 3NSFA 1PF3A 2WSDA 1BXAA 3ERXA 4G7QB 2AANA 2JFCA 4N4YB 1SF3A 4WTQA 2BZ7A 2IAAC 1JOIA 1AAJA 2FJSA 2IDTA 3ABKB 1DZ0A 3OM3B 4BWTA 2XUWA 5I6NA 3QJVB 4KNTA 2XU9A 5F7AA 2DYSB 8PAZA 2BHFA 3OMNB 1CURA 2DYRB 1JZFA 3NP3A 4CSPA 1GYCA 1XB8A 3OMAB 2R7EA 1L9QA 5B1AB 1KCBA 1QNIA 1RCYA 2IDUA 3ABGA 1ET5A 1A3ZA 3IN0A 4HALA 5FC9A 1E5ZA 3T6VA 4ZK8A 3HB3B 4AKPA 3EH5B 3PLYA 4YSTA 4A2DA 2VM3A 3FU7B 1MDAA 4E9YA 3V9EA 1KYAA 4DP6X 1SDDB 4G7RB 1SDDA 2GIMA 4M4RB 3L45A 1MG3C 1ZIBA 1NZRA 2PPDA 4G72B 4FAAB 4K9JA 3UADA 1WAEA 2VSMB 3CZUB 4YL4A 3OD3A 5E9NA 1ASOA 5I6MA 3FU9A 2VW6A 4W1TA 1AS7A 2FNWA 1OE3A 2BW4A 2LLNA 4AX3A 4AZUA 4W9ZA 1I53A 2NRDA 4AI7A 2BZCA 2Q9OA 5F7BA 1PZBA 1XB3A 3GXUB 4E9VA 1GW0A 4YSDA 1AZBA 3OMIB 4DP2X 3ASOB 5I6LA 3GYRA 3FQ2A 7PCYA 4KNSA 3ABMB 1WA2X 1GS6X 4A2GA 1NWOA 4M3HA 2E86A 3TA4D 3UACA 1NIFA 1E5YA 2HX9A 1T5KA 2DWTA 1V55B 3FT0A 1X9RA 3FPXA 4HAKA 2I7SA 1JXDA 1SHWA 2GB2A 3T6WA 5AZUA 3WNIA 3CDZB 1ID2A 2VSKB 1BQ5A 2BP8B 4DP5X 3QPKA 2P80A 3FYEB 1PNCA 2J5WA 2DV6A 3ZBMA 1GS8A 3AG3B 4JHUA 1FFTB 4AKOA 1PCSA 1OCZB 3WNJA 5B7FA 2TSAA 5B7MA 1KV7A 3D12B 1M9WA 1JXFA 1E67A 3H4HA 5PCYA 2HX7A 4UF7C 4UANA 1ZDSA 3BQVA 2CALA 3EH3B 2J55A 6PAZA 2YARA 4A68A 3EF4A 1KBWA 1BEXA 3QQXA 4YVUA 1BQKA 3S8GB 1GS7A 1M56B 4BWWA 2JKWA 1TEFA 2GHZA 2UX7A 3EHBB 2AZUA 3MBWB 3AW5A 5B1JC 1W6LA 3X1BA 2FT6A 3AZUA 1L9OA 1HFUA 3FQYA 1RKRA 3AG4B 2DWSA 3NJIA 2B3IA 3DIVA 2QPDB 4A2FA 3NYKA 3TASA 1YLBB 2FQFA 5I6KA 4A67A 1AS6A 2XVBA 3X1NA 4G7SB 4P5SA 2UXVA 5D4IA 1PZCA 2QPEB 1TEGA 3PCYA 3WG7B 5TK2A 4DP1X 1JZHA 1PAZA 2UXFA 2BWDA 1MZZA 2XX1A 4YSOA 1IC0A 3WKQA 4F7KA 2YXWA 2PCYA 2GSMB 1BQRA 4WKXA 2ZWNA 2BP8A 3ASNB 2JXMA 4G71B 6PCYA 2YAPA 2R7EB 2N0MA 1IKOP 1QHQA 3MX0B 3FYIB 4KO6A 4BDVA 2PPEA 5B1JA 3FU7A 4G70B 4DP4X 3OQRA 3NSYA 4NERA 2Q5BA 1NDTA 3SBQA 1GY1A 3U25A 4E9XA 2VW4A 5D4HA 3QJTB 4GXFA 1PY0A 3GDCA 4E9WA 3AY2A 1EHKB 3JT2A 4A2EA 3S3DB 3EH4B 1GSKA 2UXTA 1HAUA 3WIAA 2EINB 1J9RA 3IN2A 1A65A 3QJSB 4KOBA 2HRGA 4MFHA 1PZAA 1IUZA 1CYWA 3NJFA 1J9SA 1NIBA 1AACA 5B1KA 1PNDA 4TXVB 5B7EA 1AS8A 1NIEA 3TBBA 2UX6A 4A66A 2BW5A 2YQBA 3S8FB 1JZEA 3PXLA 3CVCA 2ZOOA 1AZNA 4GYBA
chains in the Genus database with same CATH superfamily
4WAFA 3GBML 3FCBA 3WY3A 4JANA 1M71A 1XD1A 4MNGA 2ZG3A 1S9VB 4JFZH 1N8ZA 1A02N 1JGVL 2JELL 2OS7A 3CN3A 5EOCJ 3ULUF 3ZW3A 4KK5C 2MPAH 1NCCL 5IB3A 2A5UA 2CBPA 2MOGA 2GJPA 2VERN 1A6UL 5E2UL 2DQ6A 5KSUA 2EIMB 4U6XB 4X7SL 1I82A 5SWZB 1CBVH 3UC0L 2F7IA 1XCXA 2IOMA 2WCGA 1V05A 1D6EA 4U1KB 4AMWA 2YUXA 3KVPA 5IJCC 3QORA 1QMUA 3ZT7A 3K3QA 5EU4A 5ICZA 4N2DA 4JJHA 1WYJA 2QKIA 4OGYL 1MCFA 3VD0A 3OKDB 2AXFB 1WHOA 2JKLA 2IQ9L 5DJ6A 1RPKA 4CA4A 3BH9A 2NSMA 1ZPUA 1UVQA 2BIMA 3U2IA 2V5TA 4NZJA 5CM1A 4H88L 3VXMD 4A39A 3DX9B 1A9EA 4QXVA 3TWCH 2EZ0C 2R1WA 2XZAH 4RFOH 4MB3A 1KNOB 5ITFA 5AUMA 1KJVB 4MA8H 3PAUA 4JDEB 3PAZA 2Z92B 4DP9X 2MQ0A 4BK5C 2FQGA 3B2MA 2ESVA 4OF6A 4DEWA 3B1TA 4DGWC 3FFCE 3KPPB 2KZBA 3BLKA 2CO3A 4YJZL 1G7QA 3EYVA 5AL0A 4APXB 4QY8B 1UFGA 2HFEB 1FCGA 4OY9A 5AB1A 1WZAA 4ZDHA 2NY4C 1C5BH 4WWID 4TQ8A 4Q14A 2Z8WC 5F9JB 2VB5A 3UMTA 5J4MA 4X2UA 1ETA1 1TTFA 3D05A 1AKPA 1EEQA 5E8NB 5I0WA 1OE1A 2QVTA 4M1DL 1FG2B 4HAFA 3LZLA 1LQBC 5DXWA 1P69B 3KPRE 1IGJA 5E7FA 3PDOB 5CU9A 2BLFA 1VFBA 4PIBA 3ULUC 3P4OA 1U8HB 2Q20A 1BF5A 3WKPA 1HWHB 4Z7QF 4DO5A 3HMXL 3MKKA 2YD8A 3VUAA 3EJSA 4N0CC 4Z7QB 3NJVA 3SDDB 3RWDA 4QRPA 1FORL 1L9TA 4EQ2A 3VWKC 1KIQB 2Y22A 3AUVA 1QI3A 3EJYC 2JJSA 3IMSA 2ZNWA 4HK0A 4JRYD 1G9NC 3NFNB 4JW3A 1ZDQA 1YMME 4XNXL 4S1DC 2CHDA 2AK4D 3PQYB 4AKQA 5IVXE 1BG9A 3S2AA 3US1A 2I85A 1Q9LB 1NGXB 2K3HA 1C5CL 1EEZA 3K6OA 2IPUK 2OX5B 4XCYB 4GG6E 3BSZL 3NA9L 4XPFL 4GINA 1CDJA 3EJQA 3QC5X 1UYWL 4KTGA 3G5YB 1KJ2L 3WXVH 5I16A 2D9QB 1IRAY 1ZLDA 2A9DA 1L5GA 2Y9RT 1KT2B 2WD0A 3ORJA 2WZPA 1A7PL 4NO0B 5E6IC 4BCXA 1KELH 4UQCA 5K1VA 4HMEA 1NGQH 2BO0A 1T3FA 1I3RA 3D08A 5AKRA 1KGUA 3HNSH 5CGBA 1EX0A 3ARBD 3QIBD 4HW6A 4KUCF 3I6KA 3H9HA 2OMTB 5E5MA 2DD8H 4XO3A 1O9VA 2VDPL 3VH8B 4NO0D 4NQXB 5LN4A 2NT0A 1RUAL 2OV0A 1JXGA 3BE1H 4MQXC 2YAOA 1U0QA 1E3XA 3DV4A 3QCUL 3RWJA 2IV9A 1EEUA 1KIUB 2DEWX 3OSKA 4MHHI 1X5MA 4MNHB 1H15A 4UQAA 3SY0B 4W93A 1NBYB 5EB9A 5C6TH 3W3BA 1CDCA 1G9EA 4DUXA 4GP8B 1W8EA 4FQQB 2OSLA 2F1BA 3VFOA 4KJPC 3MV8D 2MCG1 4B9YA 2OKMA 3QZBA 5LWYL 4RDQF 3WFZA 5JXEA 1P7KA 2ZYHA 4G6KL 4GRMA 4ODVL 2CHZA 3FRPB 2NY1C 2YGNA 4TVSa 2VH5L 4BM7A 2BERA 3P77A 3C60D 3NEXA 7CGTA 5E2VL 2H26B 2AJUL 3BVXA 3HN8A 5EUOF 2GT9B 1RK0A 3TO4B 1Q94B 5F6IB 3CXHJ 5JDJA 3STBA 5F3BB 1ZWIA 4OGYH 2YQ2A 1OT2A 3FB6A 1RP8A 2K78A 4FMFA 2NTFB 3I9AA 2VDMH 2PYEB 3GSXB 2HTLD 3WTXA 5HHOB 2X6VA 4G6AC 4Y5VB 1H3UA 4ZTEA 3UO8B 3UH8A 4V33A 4BXSV 2GJ6D 4XNYL 3MRHA 4CMHC 3V52H 4N68A 5I1GH 2M26A 4PJ8A 4ODHH 4MJJA 5F9DC 1NMCC 2AK4E 2OL3H 2R69A 4DJMA 3ZRCC 2DQHL 3QR1A 2A9CA 4KO9A 3LMJL 3IAQA 4XCNA 1A1NA 2DOCA 3VGDA 3HI5H 4JY6A 1NGQL 5FV1L 3CU1A 1UCTA 1H5BC 5GZOC 2FLRT 3EHBD 5D72H 5IUCA 3WO3B 5I1CL 5ALBH 4PRBA 5CEZH 1HHIB 2UUDK 5CJXA 4GLRH 4JFSA 1JHTA 3QW9A 2IEPA 1XIWD 4GEIA 3ZZQA 3ZDYE 5DCCA 4IBZA 4U2YA 3II2A 5D8JL 4HIHA 2ZSWA 1WFOA 1PZSA 4TF4A 5AQ0A 4P49A 2WM0A 3M07A 3NZ8A 4NAMA 4LKXB 1RMFH 3DVFA 4PPTA 5CKAA 4P04A 5KVEE 5KW9H 3BWAA 5JIQA 5F0PB 4CN4A 2XETA 4ZG1A 2DYRB 3UJJH 4KROC 1CBJA 2YA2A 3CFKA 4U7MA 4TTDC 2ZUQC 4J6IA 1MCLA 1MDTA 5I19L 1VFUA 3CU7A 5MEOB 5SWZD 3WE6A 2G5RA 2ZJSH 3G6DH 3LAFA 3QQDA 2ETWA 2JCCA 4AIEA 4JPWH 1P4IH 1XGRB 5FUOH 1X6NA 4HALA 5GS1A 4MWFB 4D9LL 3GIVA 4YO0A 1I8KA 4LCUA 1G9MC 5I30H 5F7DA 2BJMH 2EKJA 4AEIH 3QQ4A 4TTDD 4HPOL 1VFAB 4GRLA 1MH5A 4MDRA 1BZDA 3CZKA 1DQJB 4PGCA 2VDRH 4R0LC 5CO1A 1MRFH 2HFEA 4OVUA 5I1EL 4FQPA 3V8OA 4B7LA 3QDHA 2APVA 3VI4E 4PJ5D 3D3VA 3Q3GA 1G84A 4W9ZA 5TF1L 5F89A 3CZSA 4MAYD 4AI7A 3NCYS 1SXAA 1FV1B 1VEMA 4OJEH 4YBHA 3HNVH 3UDWC 3SDAC 2RIKA 4IU3A 1XQ4A 5D96C 1FFRA 1KIUA 4HUNB 2D0FA 3LIUA 1TIUA 3KPMA 1W9XA 2QHRL 5IW1B 5A2AA 5C2BH 4AVKA 5JYLA 3D39E 4F15B 2VOTA 4LE8A 1CFTB 1GS6X 3FT3A 5D1XA 1CBVL 1UA3A 5D5ME 1J0IA 2B3RA 4FG6D 3MGOA 4BFKA 3V2AR 4E5XA 3O6LL 1LNUB 4HEPG 2UYLA 4M7LL 2CGRH 2MNWA 1AXTL 2WLIA 1SN2A 3P4MB 4A38A 4G1MB 1EEZB 2VERA 3ZHLA 2X9ZA 2B4CL 2Z35A 2ORBH 5CLXA 5KBNC 4LNRA 4JX0A 1FI8C 4V2BA 4Q2ZB 5BVPL 4UNTA 3G5YA 4PU2A 4FXKB 4B50A 4QRTB 5CFHA 3W5MA 3VXQA 2E6JA 4NQSA 1KLFB 2H2SD 2P80A 3VFWB 3UZQB 5ESVA 3ZBMA 2G3MA 4IK6A 1V5JA 5DR5H 2IBBA 1FFTB 5LUMA 1PCSA 1WAAE 1QBAA 4XVTL 1YEDB 1RUQL 3EF7A 5BMFH 1FZOA 2O61B 3MUJA 4TVPE 2ZX8A 3PU7A 1E67A 1BP3B 2MEJB 4LHUA 4MZRA 4ZMTA 1ZHNB 5D1QA 5HDQH 3PIQB 2X70A 4LQ1A 2VDLL 4BZ1A 2JSFA 2YARA 4Y89A 5LAPA 4A7VA 5CILL 5DMKB 2D7TL 2Q6WA 1DBBH 5T33H 2DIBA 2PWFA 4U1NA 3EBIA 4RCAA 1GJIA 4AQAA 4F5CE 3KPSE 1J5OL 1HL4A 2WZ0A 4RMWA 5DJYA 4CSSA 3T09A 2IGLA 2FT6A 1F11B 3FTZA 1WD9A 4OV5A 3L7EB 5MP6L 5IG7B 2B3IA 1JGVH 3SKMA 2ZYIA 4ALAH 1XH3B 4LCIH 1UKTA 3F7QA 1CXKA 4OF7A 4AYGA 1S46A 3CFBA 4MSWB 2JQZA 3DJRA 4LCYB 1G1KA 1S5IL 5EEYA 1NJ9A 5M7QA 1OTTD 4UNVA 2C26A 1U3ZA 1JRHH 5AG9A 5EUOA 3HE7A 4X7TA 3HRPA 4DP1X 1DVQA 4L4TE 4LU5H 4M3JA 1Y6KR 2NNRA 1ZA3A 2R0LH 3RAJH 1BQRA 3IPBA 1CE1L 3MACL 2Q86B 4F7EA 3GSUA 4TLUA 4UM9D 2W9LA 4PWGA 1JPFA 3P9LA 2NSXA 1DQVA 6PCYA 5C09D 1ONQB 3AU0A 3D52A 2X2JA 3AROA 4NUGH 4I0PB 2N0MA 4PP2A 3MRDA 3O0RH 1NBVL 2YN3A 2R2HA 3L4YA 3MX0B 4WJ5A 3RDJA 1L7TH 1N6VA 3ECVA 3F58L 3MUZ1 3S4SB 2PW2B 4JQXA 3A4AA 4F1ZA 4Q52A 1IV8A 4FFYH 1U8CB 3RVWC 4EIBA 1XO8A 1MCQA 4BJLA 1U8PB 2QGEA 2NPLX 4RFOL 1RZGA 5FAAA 4LOUD 4PN6A 1QW9A 4Y1AB 2EDWA 3O3DA 3H42H 2B0SH 3VXNA 1A9EB 1VENA 2IANE 2VDQH 1FG9C 4JQIA 4QJ3B 5GZNC 3EGSB 4OUOA 4JKKA 4KX8A 3D0VA 4U4IA 1IGFH 3ZRFC 5ID0B 4FFWC 2P5WA 2VR6A 4HWBA 3FQXB 4I3RL 5F1OB 4QRUA 3PE9A 4NKMB 4WU5A 3EJPA 5IBTL 3VD9A 4ABWA 3HRZB 2CLZA 4G6FB 1A6WH 4LP4A 4P5MA 4FDWA 4HFWA 1D5XB 2OW6A 4ZFQA 3B2DC 3RGVC 5EO1B 4AQZA 5F88A 5AZ2H 1W2KT 4JANB 2VLJE 4WW1A 1A7OH 1KYFA 3P69A 3NCBB 3HMXH 1E4KA 4NQDA 4GKZA 3WBDA 4YDVA 1IFHH 3D4GA 4NDMA 1MJUL 1X5KA 1IQDB 3KYNB 3QUKA 3QUZC 1HCFX 4Z7OB 4AEHH 2IG2L 2EUXA 3KPSA 4JQXC 4NRYA 4KI1A 2FJUB 2DDQL 3FO2B 4R7NB 5AKSA 3HJEA 5I6XB 3RIKA 4CVWA 1LO2L 3ELAT 2FUTA 1DQTA 5KS9F 1VPOL 3SDYH 3BPOB 5T3ZE 5ESVB 5IEHA 1KPRA 2XQBL 2E7HA 3CN2A 1QSFD 1KJ2H 3WXVL 4WSKA 4YSSA 5LGJA 2P8LB 4PJ9B 3L1OH 4MAUL 4PS8A 3N9GH 3MR9A 4YHPA 3PHOB 4PJBA 5D7IE 4C56B 1CVSC 3IAPA 4ZXBC 1WEJH 3QS2A 3QUXD 3MUGB 1DQIA 5I8EA 2QQKL 2VAAB 3LKPB 1QBML 3P02A 2WNXA 4HLZG 1PGRB 1U8NA 2EIBA 5JIIA 5EOQH 3VSQA 1SZNA 5C09E 3BD5A 1MW1A 3VXUB 3QUMH 4YSRA 1OP3K 1FH2A 3PHQA 3U9PL 4XCEB 4HS3B 2GUOA 2Z92A 5ETUA 3MLSL 4GI9A 4RGMC 3QDGD 4PRHE 2IV8A 4XN8A 5AYQA 2BFVH 2R4SH 4TQHA 3TZVD 4GY4A 3R1GH 5CWSB 4Z3HA 3ZE1B 1FHGA 1JMXA 1F4YH 3HG1D 4XVJH 2X44D 3O45A 5EU6A 3SDDC 5CCGE 5J12C 2CIKB 3KVDD 3BP6A 5A6LA 3WIFA 1R5WA 5F96L 1DE4A 1YY8A 1X5IA 3LKNB 3MLZH 1M1XB 5DGRA 1BLIA 4NZ8A 3I75A 1AHWB 3OSVA 3WNPA 4C83B 4Z78A 4G9FE 4GOSA 2BNQA 2X6UA 1QW8A 2K6ZA 1J1XH 1HHIA 4HBCL 4IOSA 4X7DC 5AL8A 5LNGA 5ILTH 4Z8FL 1P6WA 1D9KB 2DW5A 3KWXA 1RFDH 4QKXB 3FU0A 3QHZL 3Q48A 3RWHA 2DMHA 5CZVH 2K9UA 1A7QH 2E9WA 3ML8A 4O00A 2Y1AA 1EFXA 3QDJE 4I87A 4O02H 3V4PA 5JHDD 3L4CA 3S37X 3L7FA 4U6TA 5HI3D 3PPEA 5JLZA 4JB9L 5GS0L 2N1KA 1XXFC 3X1FA 3ULAB 3ATAA 2R29A 4KO5A 5DJ8B 1RUPL 2H1XA 1U95A 2VXQA 4Q89A 4XRCA 1ZJAA 2HN7A 3BVUA 5CN3A 2H47C 1IL1B 4ZO8A 1I8IA 5EA0L 2FECI 2MMXA 5F7WC 3QI9B 3BWUF 4MDIA 1QPPA 5DHYB 1SMAA 1KENL 1Q0XH 4P9HH 1RZKH 5IVZB 2X12A 4WWKD 4M8RA 1QSZA 4L2YA 4HFWB 3R8BB 1AGCA 1HIMH 5CJQH 3ZYZA 4QNPF 2GI0A 3CQPA 3IDJA 5D7IA 1Z5LA 3OMZA 1T5XB 2R1XB 3BXNB 3HOGA 2VLJB 1HXKA 4FS0A 2LAAA 2X9YA 3U46B 3O4OB 2QADD 4MLSA 3OG6B 4PJDA 4FHJA 4FYSA 4MRBA 1G0DA 1ACYL 4J28A 3UBFA 4L4JA 2XN0A 3EFFA 3GI9H 1IFGA 2HVBA 5EBMA 3GUTB 2ODIA 4JLRA 3MXWH 3QDGE 4PRHD 1CFVH 2ZOUA 2DWEA 1IZKA 1SJXA 4AG4L 2XI9A 3AU1B 4BH8A 4A6YL 3B6SA 4QHUA 1EUTA 3V79C 5IOKA 3QFDB 3N85L 2B4CH 3TBSB 2WKLA 2XHNA 4EN3B 3LNDA 1U8CA 3FT3B 3M46A 4R96B 3HC3L 3BVDB 3AY4C 4PY8I 2R2EB 3CHPA 2JB6A 5BV7L 2WQXA 2VW7A 1U8NB 4WRLA 5E0QA 3IGLA 3MGTB 5EU3B 4AGOA 3V0GA 1IAIH 3C75A 4L3EE 1ZVSB 4OLXL 5T3XE 2BXYA 2D3JA 4WK2B 4NYLB 3ZTCC 4PH8A 1WWAX 4HCRH 3UG4A 3EO1B 3GSWB 1J0JA 3FTWA 3A6CH 3LPPA 3QIWD 1LEKA 5CLYA 3B2VL 4JO3H 3SBPA 3LS4L 4G83A 3OXSA 5JHDE 2CRIA 3TOPA 4G6MH 1A4AA 4X4KA 3FUJA 3I6LE 1M9SA 3OJDA 4L0PB 3QQ4B 1NMCB 3TZVA 2NZ9C 1I8MA 4ZQKA 3VJ6B 1MCIA 1OTUD 2ATKB 3ZE0F 3KPQA 4EE2A 4Y2DD 5BJTA 5IW6B 1CDYA 4R9HA 3MXVL 4RBPK 4PJXF 2FH6A 1WIPA 2XKNB 4NQDB 2AZAA 1ED3B 4DP0X 1AO7E 2FRGP 2RGSA 3BGFC 1IGCL 4XX1E 1SBSL 5C0ND 3LH2H 2FWLB 2HXAA 2NTSP 3INOA 2HRPL 3IU4H 2ZNXA 4TUUA 2VJXA 5AVWB 3BVNB 4N4YB 3CH1B 4LFHD 4KFMA 1YDPA 2FDBP 1IARB 3L7FB 2IDTA 3CLEH 3NAAH 1UKSA 2WQ8A 2Y7SA 1R3IH 4OLWH 1N3NA 5BVPH 5IBLD 5IHHA 1PEWA 5JZ7D 4Z5RA 3BKCH 3L3GA 3D48R 1IGYB 5DS1A 4AW7A 3Q1SL 4AYEC 3LHPL 3Q2WA 3PWVA 4J27A 2YZ8A 5CD3A 5IV2A 4PCTA 3TO2B 3P9LB 3K6SB 1BZOA 4XBMA 2OMBA 1CLOL 3EFDL 4NZUH 4JY4B 4QOKA 4HUVA 1D5BA 5TE7H 3GLZA 1W72A 3T0EC 3V4UH 4NQVB 1YEFH 3NCCB 5IP4A 4PP1C 2FYVA 5FUZL 1RJZA 5G2NA 3QUYA 1OTSC 3FHQA 3UBXA 3BP4B 1HOEA 4I4WA 1MLBB 5CS7A 1WFMA 5DK0A 2ZAGA 4HIJA 4P07A 4YGAB 1NZRA 4F57H 1M71B 1GC1L 4EIGB 5HVHC 5CBEA 3ARQA 4PJBE 5BZZA 4DAGH 1WE5A 4XVJL 4CBPA 4W1TA 4ALAL 3FB8A 2R4RH 1I9JH 4G8EA 4NSKB 1JTTA 3KS0J 5FO8A 1I53A 2NRDA 1KB5B 3Q6GH 3MA7A 3NVQA 3WDHA 5E6IA 1XB3A 2FNBA 3ZRSA 1SYSB 3GI8H 4MZ3A 1C7SA 4WFEE 4Z0XA 3K72B 1D5IH 7PCYA 4P06A 4WHYH 4TUOB 3HBGA 4LESA 5DMIL 1XGQB 1GYVA 2V7NA 4NQUA 3L7EA 5TPWL 5BZDB 1JNHB 2IG2H 3UX9B 4EMZA 1UOKA 4AMXA 3BAWA 4JR9L 5BZWA 5F97E 4BRVA 1NIFA 6FABH 1MSPA 4IJ3B 2Y23A 1EVUA 3SQOH 5K59F 1ZVSA 3AY4A 5HYSA 2D3NA 3DX9A 2ZX9A 4HG4K 2EDOA 5KTEL 4FQJL 2ZWYA 2BSSB 1WHPA 4MJID 4Q2ZA 4M29A 5ALCL 2BPBA 5I71B 5EC1A 1KT2A 4WTZA 2DV6A 2P8PA 3GIZL 3LKRA 4XAWH 4KKBD 3O9WA 4JDTL 2BNUA 1OCZB 3MJ7B 1X3DA 3TM6A 3VCLB 4S0TD 2PTUA 1TJIH 1T3FB 1PG7L 3GLAA 4KI5D 2ZKYA 4O02A 3V4PH 4KK6C 5J1AB 3G9VA 3H1ZA 4X4YA 3CVHB 1GJUA 2J20A 5HVHB 3AC0A 2ICWA 1HSBB 4P5TB 5DJAB 3BQVA 4FZ8H 1CD1A 2FATH 4PSRA 1QASA 1XCQA 5L7XL 3IPEA 4U0QB 3TVMD 5AW3B 1BVOA 2H0PA 2JV6A 2VITB 1F4XL 3F7VA 3T4YA 1HZHL 3KDMA 2BIOA 2XY2A 4H8PA 4LNVA 3RWCB 3AREC 3VQMA 3S6CA 1PD6A 2VR4A 1ITCA 4QRSA 5AVZB 4HS3A 3PDGA 4F8QA 3ULUH 2WUCH 1UXMA 1E8XA 4ZMPA 1MREL 3NJIA 4LPUA 3OVUB 3OHXA 3BSHA 3KE0A 3BJ91 3OR7B 2ZWSA 1U8OB 3ZE1E 4LRIC 4X6EA 4KKNA 4ODUB 2JTYA 5DYOA 5I6KA 1IGCH 4AM0A 4V1DB 5JDSB 1MLCB 1EZSA 5LGHL 2WJ7A 4PRHB 3HC4L 3AAZA 5LXVA 4DEUA 3DO7B 4QDGA 5DI8B 1UD8A 3GSVA 1PL3A 3GQFA 4A7UA 1ADQL 4QRRD 2ZSVA 1ZA3B 4Z18A 1CICA 5T3XH 2QKIC 4QPEA 1B9ZA 3QPQD 1IC7H 3RPIA 3SPGA 1FAIL 4YHKL 4GUPB 1SEBA 4XN9A 4IKKA 4MYPA 2AGJH 1DCLA 5CSGA 1ZLUH 4GMSL 5B1JA 2Q8AL 3C2SA 3UFIA 3OLIA 2AJYL 4P0DA 3VU2A 4HCRL 3RY4A 1U92A 3BC9A 3ECQA 4LLMA 1ZLVH 2VMFA 4NC1E 1I8AA 4UT9H 4PJEF 3T2QA 3WEOA 2ZCZA 2FVNA 4LEOB 3D0LB 4S11A 2E75C 1X44A 3LXBA 3KGTA 3VXNB 5CBEB 4P2QA 3M1BA 4DCQB 3PP4L 1YEEL 3CX2A 1SRDA 3Q0HA 5F1NA 1IUZA 4UCFA 5DD1H 3FN0H 2VDPH 1EJ6A 4PREB 4K71C 1NL0H 4TXVB 1NEUA 1P5UC 2YWZA 4EKJA 1A6TA 4IRSA 1K3IA 2EICA 2BW5A 1JZEA 4BKSC 4YPGA 3QULA 2VDRB 1N6UA 4QI3A 1FYTA 1YEDA 2ED8A 4GYBA 3DX8A 2O61A 4WI2A 1G9NH 2XVGA 3QE5A 3QFJD 1KXTB 4PGEA 5FFLA 1D9KD 5I23A 3QJHB 2F54B 2NYYD 3VXPA 1U42A 1WC7A 2OJEB 1AZUA 3HN3A 1QTYT 3DUSA 5HGAA 1NAMA 4Y4FA 3NBNA 1AO7A 2A9NL 3FCTB 4ZO9A 4DEPC 4XMZA 1MJ8L 5TK4A 3BUIA 3KEHA 4ZBJA 1AHKA 1F11A 4DQOL 2MKLC 1F4WH 2WPGA 1HOCB 1IB5A 3HG1B 1GPOH 3VB9A 5IJVB 1E4HA 1XF4B 5DHVA 3WTUA 5FYJL 3H0TB 3WFCL 1SHSA 2ZTBA 4XVUC 4ONOA 2W07A 3SJVD 2AJXL 1V54B 1NGWB 1EAJA 5IVXB 4X5QA 3B2VH 1DVYA 2FL5A 3MRKB 3VXUD 3VWJA 5J12B 3GBMH 1TETL 1TYJA 3EOAA 5J3HD 1UD6A 4WU7B 1IKNA 3N41B 5I2IA 2EEBA 1S78C 2B8OT 5E1AB 5E6ID 3S3SA 5FIEA 3T6QC 3RL1A 5I1HH 3DTXA 5EIIB 1J48A 1DFBH 1WP6A 1SYSA 2ZZUT 3GZKA 5EF1A 2WGNB 2CIIB 2B20A 4FNLH 3T6XA 4M6OL 5IROD 3TT3H 3QXVA 4Q9RH 1LO4L 4PLKC 5C0RL 3Q6GL 3E6FB 3X13A 4X6DA 1G7MB 3HBQA 4QKTA 4PJXE 5D7EA 3N6YA 4OCXH 2D7NA 1U8KB 4HKJB 4KX7A 4R4BB 2I60H 5E5MB 3O6ML 3JQOB 2F5BL 5C71A 2EADA 2C3VA 2FO4B 2KDYA 4JGUA 1RMFL 2QPUA 2JKRM 4TVPH 1A8ZA 4HLJA 1BBDH 5ES4B 1HKFA 4N2IA 3OB0K 4GG6F 2VAJA 2D2OA 3FFCB 4A7QA 4Y5VC 3K71A 3TBCA 2XN2A 1RU9L 2VMCA 5B3JE 1A7BA 3KWUA 3T0WA 5DZJA 4NBZB 4LPXA 3H9ZA 3GNML 1C5CH 3OXRB 3CVHL 2QVKA 3DIDA 3QUML 2NW3B 3BVTA 4M7ZB 4BA0A 1NICA 3VH8G 2MCPH 4OZGF 3FUDA 3II3A 3NSDA 4GIAA 4Z0BL 4RNRA 1N3NB 2RFXA 3V4VA 1P2CB 1MZYA 2XWCA 2CG9X 1XCQB 2QTEA 2VZVA 2IWFA 2V4LA 3CVIH 4KI5F 3S3PA 4DK3A 5E08L 3QG6B 1ZT4B 2OLDA 4FXTA 2HJLA 1A2YB 4G6AD 4JY5H 2XA3A 4NB7A 4CW1B 2DTML 1EV2E 2CLRA 3ALXA 3KPSB 3Q9PA 2XWJB 4NRYB 2D0GA 4N5UA 2CUHA 2D03H 4IRSB 1X7TA 5T1KA 2DD8L 3HZYA 2B5IB 1DVZA 3SKMB 1NBCA 5DEZA 2XX0A 1OF2A 1UQSB 2GW5A 4KXAA 5IFHL 4JPQA 4PJ8B 1U6AH 2DM4A 3TBVA 3VXRB 1VACB 4K3EH 5D7JA 5JOFA 2CJUL 2VC2H 3MRJA 4ZW5A 4KROB 4AYID 3D39B 3NSJA 5GGSB 1NL0L 5CZVL 1I1FB 5D1QC 5D8JH 3NSCA 4X4XB 3N2JA 5I8OL 1Q9OB 1CGWA 3GMNA 3ME0B 2CBOA 5JW4Q 4JO2H 4JHWH 1HHGB 2EVGA 3HCVA 3L2NA 3U30C 5CR1A 2WYZA 5I74B 3VFPA 3DSFL 2OMYB 3FTXA 1U36A 2GPZA 3UJTL 4K5OA 3BAIA 2VXQL 2BMKA 5DJZA 2ZP9A 1JI1A 1K5NA 1S5IH 4LDLB 3FRPA 4LQFL 2ICES 1VZIA 4NKDB 3UXFA 2OK0H 5IMMA 2AGJL 2EKSB 3MRQB 2D7MA 2GCYA 2XWBA 4MA7H 1WD8A 1YEJL 4XXWA 2QSQA 5EEWA 3WY2A 2OSWA 2YAHA 1SMDA 1TQWA 1QLEH 2BOBB 3EADA 3KH4A 2ZXWB 2VDOL 4GQPH 1H9VA 1TJMA 4G2AA 3TS8A 5JO5A 2BRRL 2D7TH 3K6DA 3PWVB 1BFOA 1E4WH 1OAXL 2X9XA 3DGDA 1U3HA 4FD0A 5J13C 4XCCL 1H8LA 3CG8A 5E03A 2QV2A 2W0LA 1SNRA 3HFMH 5ERWB 1D5BB 3VFTB 3K6IA 3BH8B 4PGBB 1LE9B 4HIIB 2LR4A 2PO6B 3L3KA 5K9KA 4AYSA 4PJCF 3BISA 3SE8H 4LHJB 2PPAA 3ETBF 1A64A 3VX0A 1JYVA 2Y7OA 4ZUUB 4UBDC 2PP7A 5FYKE 2DH3A 1WJ3A 3AM8A 1FRGH 3D18B 1NCTA 4WDIB 1D5RA 3CHRA 3RZWA 2ERJC 4JFFB 5I1LB 5I1AA 3K1DA 2Z7YA 3BZFA 1DBAL 3M88A 4TVPD 4NUQA 1AGEB 5F7LB 4KKZA 3QISA 4HCFA 1WFJA 1I1AC 2K7QA 2NR6D 4ZAKD 3ARFA 2YSSA 1K9TA 5IB5B 5T1MA 4UU9B 4G11A 4KKPA 2HFTA 2ZT9C 5CUSH 1MEXL 5DJCB 1KBGL 1XR9B 4MBRA 4LBAA 4AGLA 3BJLA 2EDDA 4M61A 2UY7A 2IH3B 4J23A 5D7IF 1KYDA 1BBDL 4ZQKB 2E6QA 3VJ6A 1AR1D 4MXVE 4L4VB 3IT8D 1XF3B 3MRNB 3WJLC 2QSCL 4N25A 5EEZA 3GWJA 2CBQA 4OF5A 4PV8B 1ZLEA 1IT9L 1SOKA 1OAKH 5BPPA 1RZIA 4NP4H 4YGVA 2PCPB 3FTYA 1K4CA 2J12B 1T7VA 1FFPA 1DQDL 1OSZB 4GO6B 2VQ4A 1KCBA 2K0RA 4WFFD 3IRCA 3NCJH 3LPFA 3LB6D 4QRUB 5FC9A 2X3AA 5TQ0H 3PLYA 3BESR 2MCAA 1JPST 1ZGLB 1SDDB 1D5XA 1I3GH 4KUZH 1EGJL 5LB1A 4XHJD 1K8DB 3AMLA 3K6NA 1M1XA 4IRSC 3TWCL 2OMXA 4Y5YB 3J8F7 3VXME 3KMDA 5I75C 3NH7L 1P5UA 3QEGL 3QQ9D 4QXGH 4YFLI 3WIFB 4Y4HC 1RZJH 4UDTB 1NQBA 3RNKA 5E2WL 1FNGB 3ZKND 3P2TA 1AH1A 2WXRA 2FX8H 2OR7A 4PJFE 3TFKD 5FGCE 1JHLL 4PJ8C 4ONHA 4PRPE 1FL6A 4NUJA 4UQ9A 2QGBA 2R4SL 3O41B 3CD4A 1CL7L 1LK3L 3VQ1C 3K71B 5KBLA 2J6EA 4R90L 1CJYA 3IJYA 2HG0A 2X0VA 4M7LT 4H1LG 1CD9B 1SVBA 3IMWA 4HD9A 4JM2C 3OWEA 1MRCH 1W0YT 3TYGH 3MRMB 1HJBC 4HJGB 4J3TA 1WGVA 1FAKT 1H3TA 4A2GA 1WWCA 2AXFA 2LT9A 5T1JA 1Z5LB 3CK0H 3TFBA 1A6UH 1NKOA 2NLJA 4HKBA 4NZUL 5E2UH 3HN5A 4FHBD 5FGSA 5F9JA 1E6OH 1E2WA 3MOAH 2VZUA 3L6FA 3MV7E 2NT1A 4KKBC 4N6RA 3VSTA 3U46A 2WO4A 4PW3A 3G5VB 3HPJA 4JFDA 5EBLA 3FT0A 5GGQL 4HAKA 3VGEA 2HH0H 5C7XH 4CGTA 3KPRD 3IJHA 5FR3A 2XQBH 2VYRE 4FKKA 1CI3M 1PX8A 4JHAH 2P5WE 4ESKA 2Z7WA 3O8XC 3D51A 5LDSA 4KY1H 3BFOA 3BHBA 4HFUH 1CICB 1NLBL 1XSIA 4DP5X 3BVNA 3HZYB 3PQYE 4U1GC 4XP5L 4JDEA 4ORZC 2V8MA 1TQBB 3SODB 4N1HB 1QG3A 4DGVH 4FFWD 4JUTA 1AMYA 4AKOA 2VUKA 1MIEH 4FQHA 4LL9A 3OHXC 2W81C 1CFQB 3FOLA 3D12B 2W07B 1OAUH 1IEBB 1MCCA 4IOFD 3D69B 4WUUB 4XPFH 5E8DH 5J5EA 4BHUI 3MTRA 3H7BA 1TLKA 2DRUA 3RWFB 3RWIA 1I9EA 1OAXH 1V7NL 1BEXA 2X41A 2VL4A 5JXAL 3S8GB 3KPRB 43C9A 4LEBA 4WIQA 4HJJH 3UP6A 4ZFFA 3STZB 1X4YA 2J71A 1PAMA 2W65A 4LP8A 4KK8C 2VLLA 3GJFK 4G80A 4IGBC 3X1BA 3GHEH 3APFA 5IHBA 1E42A 4TNVK 3T2PA 4J3UA 1I3RB 4AYFA 3WFDL 1AIFB 1JZ7A 1GOFA 4D3CH 2VNCA 3U6RB 4P4RA 2FJGB 3T3MF 2LV4A 4EZJA 1QYGH 1NCDH 1NC2B 2N4IA 4I9WD 1U21A 5F8QC 4XH2A 1AS6A 3OKMA 2XVBA 5BRZB 2I9TB 3C5SA 1TMCB 5HXMA 1OSPL 4Z95H 3I9PA 1E27A 2JJSC 4LBEB 1BF8A 3QB7C 2DQTL 3W5NA 1DVXA 3DARA 3ZL1A 4JFED 1EUUA 1T5WA 3OPZL 4M48L 1AQKH 3VGBA 4EIUA 1FGNH 3KJ6L 4ZNEA 3MX0A 2RR3A 2NMSA 3ARRA 4M1CD 2A0LC 4JO1H 4ZSOE 4KXCA 2LLLA 2ZXAA 1CLZH 5C0AB 2C9PA 3MCG1 3O6KL 4YBQD 2X1QA 3DX2A 1SXZA 4LRNH 4NERA 3U83A 5F7NC 1ZGLP 2GITB 4PJHF 3LV3B 4YLQT 5SWSD 4P2CG 5TDOA 5D4HA 3P9MB 3HB3D 2C9UA 3QAQA 4H0GA 2VQ1B 4UWQB 3BAJA 4O51A 4ONGH 5L6YH 3ILEA 1T5XA 3L3IB 2HLFD 5FW7A 1WBZB 5D2LB 5CGTA 3R0NA 1B0WA 3TCXA 3TA3B 5ANMB 5TE4L 2C3XA 1J9RA 1E9QA 5HYQB 1A65A 1W16A 5GZOA 1BOGB 1KCUL 5AOLA 2PABA 4GW5A 4M93C 5I66A 1NIBA 1SYVB 2G30A 3WEAA 1Q0YH 5C08A 4PI2A 4Y2DA 3PQYD 1R19A 1OZTG 1YEWA 5AZ2L 5C97A 2CMRL 2Q7AA 3TFKC 5GS1B 1VDGA 3TBBA 5D1QD 2A9ML 1B2WH 3O6FC 1YO4A 2NY7L 4WU5B 3A3YB 1UZ6E 3ZUCA 1INQA 2UY7B 3OKOB 3ZE2E 4RISL 3S48A 3QCUH 1M53A 2XY1A 5F9OL 2DBJA 3GS4A 3MJ8B 2TRHA 5B1BB 1LMKA 3VGAB 4XVTH 2YGOA 1NM9A 3TT1H 2JIXD 2VCOA 5ABZA 1E8ZA 1XB6A 2X6BA 2SODB 1T1WA 3EYSL 3VRLE 4AL8L 5HVGB 2DH2A 4OV6F 4JY4A 2GYSA 2FCBA 3L2LA 3CPLA 3VRLF 1WFNA 3QORC 1ULVA 2MTPA 2Q0ZX 1L3NA 2HTKD 4OLWL 4WGKA 3CSPA 2QFPA 4J3WA 1WIOA 2E7BA 2JVUA 3EW3B 1HI6A 3FQUB 3OKDA 4PY8J 4XB7A 1HEZB 5KTEH 4ONFH 3ZDXF 1HYSC 5KSAA 5C7XL 3RZCB 1P53A 2WVVB 2Z31A 4FNUA 4OKVB 4JY5L 5GS0D 3LQAL 3RWIB 2G3NA 1RIUL 3IDGB 2CXGA 4XBEL 3FULA 1MFVA 1IAOA 1BZ9A 2F7PA 3E2HC 3LKOA 1J8KA 3DURB 1QFWI 2B1OA 5DVOA 1MHEB 3ESOA 5I6PA 1D5MA 2GFBA 3WD5L 1MCSA 2IH9A 1EXGA 4DUWA 2IIJA 2YEVB 5D7HA 3OKKA 3WKYA 1ZD6A 3PDOA 1ETZB 4MQXD 5GS0C 5HBBA 2CO4A 1HE7A 2V2WA 1JN6B 2Y2WA 5I1KH 2VZTA 4JGMA 5IESL 2B59A 5JIHA 2XN9D 2D7OA 4QF1A 4ANUA 4JFWA 2FJHA 3KWWB 2OI9B 1KJ2A 5BQDA 1ZCRA 4ZO7A 3BQUC 1BYOA 4HEME 4ELMB 1MVUB 1I7UB 2YRPA 1O7VA 1PKQE 3B2XA 1L9RA 1WA0X 3C6EA 3S5LB 4WU7A 5CLZA 4I2XE 3FB6B 5AFAA 5MENB 4PRPA 2HPTA 3ULSA 2D8KA 1MW2A 5EU6E 2QQKH 4L0YA 3C2AL 4NAJA 3D39D 3B37A 4OD1L 1ACXA 1K4DB 2KZWA 1SFHA 2PW1A 4K0OA 1QVOB 4LSDA 3T8XB 3EYFA 2DMCA 3K4AA 4X5PA 3OAYK 1EVTC 4FG4A 4K9EL 1B2YA 5AD0A 1SJHA 5K9JH 3LN4A 3UO1H 2X9WA 3PWNB 4QHMA 1G6RL 4MYWB 4JFVA 5G55A 4UINH 3QHFL 2BOCA 5JQ6L 3U48A 3UYOD 3DYMA 3LRKA 3LRSB 5GSRB 4FQCL 3S34L 3NMEA 5I74C 4P5KB 5E8OB 5L8KB 1B4LA 2DQEL 1PJWA 4ZNCD 3QIWC 4XP9H 2WYTA 4FP8L 3WELA 5J1TC 2ATPA 4CW1A 2COVD 4Y5XC 2BP0A 3DRQB 1F45A 3DDGA 2JJWA 3LDBC 4LNRB 5DEFB 4PWKA 4DOHB 3ARUA 5C9JB 4OQTL 3TTSA 1AIFA 4NZRL 3EAKA 1HN1A 5KUKA 2GVYA 3QA3B 2Z7UA 5EO0A 1S7QA 3VE0B 4DGIH 4QR7A 3X11B 5C0CB 3WI9A 4Y9GA 6TAAA 2BP3A 5DC2A 3ECUA 5F0MB 5ABAA 2XPZA 4HGKC 3LPOA 2VMDA 1ANUA 3QXDA 4G42B 1MFUA 4UAOC 1AKJD 1J1PH 5L4FA 3H55A 3CLFH 2P5EA 3FQNB 3TGXA 2V0AA 5DRNA 1S5HB 3I3DA 3G3LA 2PCFB 2EDNA 3GHBL 3QARA 3OB0H 1HE8A 5IJKC 1MI5B 4MVBC 3C6SB 3MJ9H 1GGCL 1U8HA 4LOVA 5DEGB 5C0BD 5L2JA 5F9AC 1WITA 4Y9EA 1K85A 3WIHH 4PB9H 1A6ZA 4AV4A 4YVNA 2QADB 1V27A 3C6LD 3T3MB 1S7SA 4IBSA 1I4FA 3KD4A 2OYKA 3CDGB 1KN4H 1BXXA 3LCYA 3T08A 1B4JL 4GQQA 2CGZA 4HPYL 4PGCB 4GB9A 4PV8A 4A7SA 4AXWB 2K6WA 4J39A 4F9PC 3L4VA 1R9FA 4AQOA 3K5RA 1H6FA 1F18A 1NWPA 4LSPL 4ORGB 1Z6JT 3OKKB 2WXNA 4NDMB 1NIAA 3RGHA 3S35X 4YFEA 2PPFA 5KZCD 4F33B 5FCUH 1F3RB 2NY3B 3IAGC 1G5AA 3NJJA 4ZUSA 3TESA 4ADJA 2XICA 4FQ1L 5DJYB 4CVXB 3Q8FA 3IJ8A 3OKLA 1KJ2B 4LPYA 4DP8X 5L0QC 3BWUC 1U8PA 3E1ZA 4PGDB 4R8WL 1L0YA 3V7AG 1JVKA 4FP8H 3ZZ1A 2A3TA 2RMNA 3BDBA 4UILH 4M62L 1YA5A 2W60A 3ARGA 3T0VA 4FX5A 2FGWL 4HXAL 4ZUUA 3V0VA 5ISZD 1DDTA 1HNFA 1SJMA 4ZFOA 2DQDH 4WEBL 4ONHB 1ET8A 3LRLA 1PG7X 4OBRA 4F8OA 2BVQB 3BGFB 4RGND 2BY1A 3EGSA 1FA4A 2AI0H 3ZXAC 1T1XA 2Q2EB 4JRXB 2WZ5A 2HKHH 4JLRB 2RD0A 3HHRB 1PF3A 2KLSA 2VXTH 5BW7A 3AXLB 4FNQA 2AANA 3QXTA 3QO1A 3QFJB 3RVTC 1ZK5A 5DMYA 1U4FA 4GMTL 3ROOB 2IAAC 4AYFB 4GFXA 4AM0Q 4PQXA 2DLFL 1WZ1H 3CX5K 4DHLA 1CS6A 5EIQA 2BIPA 2QADC 3PWJA 3EJTA 1U3NA 2DYSB 2ARJA 2F53E 4HU2A 4LVOB 2FSDA 4KY1L 1I1FA 4QHMB 1CQKA 1YG9A 3OMNB 4C55A 3LEXA 1MCBA 4R5TA 4XCFL 1RZIB 3WEXA 3N42B 3QUZA 3S97C 3JWDC 2BK8A 1F1AA 1VSCA 3V4PL 3BHBB 3LIZA 4PREA 3FO2A 4R7NA 2IDUA 1SLWA 4ZUTB 1UJ3B 1O9WA 3PP4H 3ATBA 1QOKA 1U8MB 4N6QA 2GG1A 3ESVF 4M6ML 4S1SH 4YSTA 3V4LA 4JFFE 2VM3A 2YPVA 3FU7B 4QRRE 1P9MC 1ZKAA 1YYMH 1DQKA 5CNHA 5E8EB 2QQLL 4O2CA 4OZGA 2WHVA 3KXFA 3IDYC 5JUEL 2ZCKH 4JK0D 4NCDA 5FCUL 2QLYA 1BLNA 5FEBA 1JXKA 1KCKA 3H2PA 5JLZB 1S7UA 3ZYJA 2KS0A 1W80A 1JZDC 2Y0SA 2WIMA 3QIUD 4LIQH 1WAEA 2F5AL 4XPTH 4X83A 1PBYA 1ASOA 3UYPB 4HU8A 2BW4A 3NEOA 4G42A 4GAAA 3HC3H 5EO9A 5DYFA 1OD7A 1QAWA 2W91A 3RFZA 5D1ZA 1FLRH 2ITEA 2Q9OA 3C60A 1JWMA 4MNHA 5ESQB 3ZU8A 2AEOA 3TPKA 3PL6D 3HNTL 5M94B 1GW0A 1N0XL 3X12A 5AYUL 1QFPA 2GJ6E 2DQCL 1THAA 1IEHA 3SKNB 12E8H 5LLIC 2H8PA 1WA2X 2I9LB 2IO5A 4I18A 2AJSH 5GRJL 5I82A 1KXHA 3MV9B 4N8VA 3HAEB 3HA0A 1OXYA 1R5WB 5DYOB 1OL0A 3EYOB 3IE4A 3CLFL 3K6FA 4OGAD 5GGUA 3VX1A 3K0WA 4APQD 4TPRL 4KKRA 3FRUA 3HG0A 3O45B 3UACA 1BZQK 2A9BA 4NUGL 5GGRY 3U1QA 2VGLM 4GBXB 4IIQA 5I73C 2OSXA 3VDAA 3WFCH 3RBGA 4NKIL 1WG3A 4KK9C 3FPXA 4ONFL 4EI5C 1M4KA 1R4XA 4LQFH 4W6YB 2ARJQ 2ZUVA 3KLQA 3SE6A 5LXGL 1PDKB 2YK1H 1JZ4A 3H8NA 3GHPA 4YHIA 4U3XA 1LO3H 1MFCL 3UGUA 3MMEB 1AJ7L 4XO5A 4LLDB 2Y3AA 2EC9U 3OKLB 2R51A 4FZ8L 4PJ7B 2HT3D 1KCVH 3FO1A 4L4VD 2GTWB 3NJXA 1Q0YL 2JKTM 4UIKL 3QO0A 3CVHA 4MZ2A 1AI1L 4H4NA 3N40P 2EUWA 2R2BB 3B43A 4MD0A 2IJ0C 4KDTA 4M93B 4QHLA 4NAQA 5AYTA 4XHQA 2HX7A 1FBIL 1ZDSA 4ANWA 1N4XL 4O51B 1HHGA 3BPCA 1IM3D 1CDGA 1KBWA 2UZPA 3QQXA 4FCHA 5AB9A 1YECH 3EJZC 4PGZA 4X4XA 2B15A 3QYMA 1R3IL 2YD5A 3D3VB 3Q3GB 1QPXA 1H8SA 3MBWB 2G3XA 4RMQA 1YEHH 4X42A 4Y4KA 5AVTB 2ZE0A 3B4NA 1HILA 1TVDA 2LTQB 4MMYA 1LXMA 4H2CA 1NGZA 2ED7A 3VTTA 1IAKB 3RI5K 3MC0A 3F6LA 2R69H 3BUDA 5TFSH 1EAPA 4QRBA 2ESVB 2RCSH 4YBLC 4OZGE 4GRWH 1ES0B 2G2PA 5FB8B 2E6PA 5GJTH 3AS1A 1O5DT 4HK3J 1FFNA 3V6OC 1NSNL 1KXVA 3C5SB 2DQCH 3T3PE 4KUCD 4Q6IB 4EOWL 5J6GB 2ZYSA 4P5TC 1IKFH 1C16A 3DO4A 5MEOA 1XFPA 2J5LB 1G7HB 4AEEA 2BHUA 3O41A 2JXMA 1MFEL 2EYTB 3ZYIA 1KGCE 4MTMA 4BA8A 1VESA 3H9SE 2AEIT 2LGNA 2VDQL 3FYIB 3QXUA 4KO6A 4HS6B 5ISZA 4NEHB 4XPGH 4EZKA 5JW3L 1MCNA 1Z5YD 2B0SL 4GXVL 4YHNB 3SPIA 2VW4A 2O26U 1BM3L 1TTAA 4NLAA 3GDCA 5FB8A 4OLXH 1MCDA 3UOAB 1PY9A 1EHKB 1GIGL 4JFYB 1WBXB 3L3HA 1F00I 1BFVH 3D2UA 3H3PL 1RHHA 1S78D 4ODTL 4PJXB 4KZCA 5C0GB 5GSRA 4B97A 5J6GA 2PXYA 4R6UA 4QO1A 2BVQA 1FFPB 3GZPA 1N6QL 4JFXB 3VFPB 2JXMB 4I1PA 3HZVB 2QFRA 3IRZA 5J7CC 1NIEA 2F8VA 1UD4A 4BZYA 2CO7A 3SBWC 3CMOL 3PJLA 4R0LA 1DANU 3FT4B 1LWJA 4LSQH 3MBED 4QUOA 4ZUVA 1NCGA 3OGOE 2Z93B 1K8DA 3GO1H 2K7PA 4M7KH 4OCSH 4NJ9H 4R83A 2X4OA 4AEHL 2HMID 3ZO9A 2BS9A 2J8UE 3VM7A 4HV8A 2VZ1A 3U0PA 2CBTA 1EK3A 3ARFD 1NMAH 1VERA 2VO5A 3L5JA 2YD0A 2PYFA 2EIJB 4JG0L 5GHWH 2H3KA 1ZS8B 4G3YH 3O3BA 2ZP8A 5ANMA 4QT5B 3CBKB 4DPRA 3RIAF 1IL1A 1DO6A 1DCEA 5EN2B 4OLVL 3VXOA 1TTCA 2ZOLB 2IDFA 2V5MA 4L8SC 4TSCL 4Y2DB 4WTWA 1AFVL 2LVEA 5BQ7B 3WMSA 4I0PC 4YE4H 5I73B 3SKOB 2DZEA 3T0DA 1BXVA 1FFOA 3MO1B 4A6YA 5DFVD 5FYLH 1SFDA 1HS6A 4XX1G 3IEAA 1KDIA 1MCOL 3MLWL 1DLHA 4GRMB 2F54E 4LVHC 2MQCA 1I8UA 4RBPH 4X4ZA 3WENA 2GSGA 4X9BA 2EJ1A 2ZG2A 5D2NA 3BP7B 4LCWE 5IQ9A 3P40A 3QIWB 4XMPH 3VFSA 4LKXA 1J7VR 4XPBL 1ADWA 5FHBH 3P73A 1NEZA 4E9QA 4NQCA 1TYRA 2WTPA 4A55A 5DF0A 5AEAA 3AG2B 1BM7A 5AVRB 1TZGL 1OTSD 3ARZA 5KVFE 1BQLL 3LSOA 1NLBH 4XWGL 5GXBB 3JWNG 1SLVA 1T4KB 4NN7B 4XNQA 5K69A 1EO5A 4XE5B 1VAHA 4LLVB 2I60L 4P2RB 4G5ZL 5E4EB 3E38A 4QAWA 1QP1A 1ET7A 4Y4HD 4YX2H 4JO2L 3S9DB 4L4TA 3U7YH 1HK6A 3TCLA 2GSGB 3DBSA 7TAAA 3MACH 4IBWA 1RHFA 3CAFA 4K94L 5GZOD 2A4EA 3DSNA 2JWYA 4NZTL 2OR9H 3V7AE 4F1SA 4Q6IA 3IPFA 5BRZD 2OCFD 5JHBA 1KLGA 2HT4C 1Q9KB 3GRBA 3BCFA 5AWNL 4F3FB 4AIOA 5IR1A 1QYGL 2OYMA 1YQVL 3EBGA 3M86A 3DVIA 5GRWA 5TDPA 3E3QC 3EOBB 5KYYB 3CN0A 3GMPB 4BDVB 3K72A 3EO0B 3MA9L 2OMZA 3MRDB 4H1LB 2BCMA 1WCBB 4WJ5B 2QQNL 5DO2D 4ZMNA 3WSQH 1FH5L 1GR7A 4ZMLA 2CU9A 4OCWL 5IMOA 2BS71 2X05A 1F4AA 3SJVB 3HG4A 1ETB1 2AJ3A 4IBYA 1EHXA 2UY6B 5DQDL 4JFHD 4H25A 2K6YA 4JKNA 1I7ZB 4XO9A 1U8IB 3ZE2B 2XWZA 3CIQA 4WUUD 3TURA 1GL4B 3BKYL 3ZE2F 4XN2A 1UZGA 1YEIH 4JO4L 5DO2C 4FTVB 1HVXA 4C56E 2F74B 1UZ6F 3MLXL 4HIEA 3C5ZA 4I0CC 4JPIB 3AS0A 4P9HL 4BQBA 4JFXA 5C07B 5SX4H 3MAWA 3SE9L 2JJVA 1FDLH 4JFOB 1T04A 4PM1A 1RUQH 4WENB 4P23A 1MIEL 4GS7C 4XP1L 1JPEA 4GEJA 3DIFA 4MMZA 1S8DB 4ACPA 4OGZA 1T0OA 2PP9A 2F54D 2JJTC 4IM8A 4DTGH 2BXZA 3MFFB 3GSRA 1YECL 4LKCA 4HIPA 1UQSA 5L7XH 2Q76A 4RGNB 1EZVY 1PD1A 5EUKB 1FZMA 1YCSA 2X38A 2Y69B 3BPNB 4UQ3B 1UURA 5DTFB 1QSEB 5D70L 4DGYL 2VXUH 3Q7JA 5CZKA 5IROC 1ASPA 1IBYA 4ZFOB 1SQ2N 3A0OA 3NZHL 3N1PC 1AG6A 3SE3C 4ZSOB 5F9WB 3G04B 4M3KB 2WQWA 5I16B 4I1RA 2FB4L 2NXZC 3S5LG 2AJZB 3KPMB 1KF9B 4FQJH 4ZX4A 3P11L 4B9CA 5AOMA 3L9YA 2NY3D 2YN5A 1JI2A 2HZHA 3OXRA 4OCLC 5IGXH 5C09A 4NHUA 3P73B 3HR5A 2E7CA 3U36A 5L4JA 1BECA 1PZ3A 1L6PA 3R1GL 3V9CA 1MFEH 1OIOA 5DFVC 2CRYA 1NAKL 5BJTB 2ZOTA 1OZUA 1BMWA 3MRIB 1HQ4B 3KXFD 3VI3E 5ICYB 3FNKA 1AIZA 4Z7UB 1SYVA 3IRPX 3Q05A 2VDRL 5LBVA 2RAMA 2VABA 5E4OA 4XVSL 4YWGL 5T1KB 2F08A 1EXUA 4JZJA 3K2UL 3H9SA 2NDFA 3QQ3A 2NY4D 1MI5D 4FQQA 3QEQE 5DMGC 4AENB 4CMHB 3J7HA 4PWJA 1O6VA 1ZHLB 3H0TA 2IBGA 2APTA 5KVFL 4ZDHB 2L3BA 4WUUE 3MGAA 4HWBL 1J8HE 3SO3C 1GZQB 3U0PB 2FYYB 3HLAA 7PAZA 3WO4B 4QY8A 2LAGB 2N7AA 3KPQB 4Q4EA 2QDVA 4B95C 4Z7NB 2FH8A 2CDFB 1S9WB 1U8QB 2G0KA 4NPKA 4QT5A 4DTGL 5BUGA 4WDIA 1CB4A 3GMPA 3T9WA 4G8GA 3T4AA 1NCDL 3MRLB 3D0AA 2X4RA 3GXIA 4LSRH 1ZTXE 5JPNC 4MWFA 2GSIB 3RTQC 4DGYH 4BUGA 4GBXC 3QUXA 1SJEB 2CNYA 3ZSSA 1XD0A 2VR5A 3MZTA 4GKOA 1Z9OA 3E6HB 3IETB 2WLJA 4IS6A 3GSNL 4W9IC 3QULB 1N2RA 3BLPX 3ISRA 3TBTB 3BN9C 3I3BA 2FO8A 4XCNB 2VE6A 1E9PA 4XR8C 4HOZA 3GK8H 4MXWL 3NP3A 4BFEA 1P4LA 1PVHA 4I9WE 5BV7B 1UB5A 2OZ4H 2NQDA 5F1NB 2BP5M 2D0HA 1QNIA 2GKIA 3RVVD 3V52L 1ET5A 3O3UN 2CO6A 5TE4H 2NUPA 3APCA 3HHSA 2JI2A 4OW6A 5E6SB 4PB0H 3Q6FB 3HG5A 4QXGL 1NC4A 1Q8MA 3IS0X 4PJFB 5DD5H 4CJ0A 2CJSA 5KVGL 3W38A 1D5ZA 1F58H 3S4SA 3FB7B 4WEEA 1I7TB 2EXWC 5IT2L 2XNAB 4KV5F 4JDZA 3VXMB 1HU8A 2FZ3B 1A3QA 5DZVA 3K8LA 1WUNT 1ZIBA 3N40F 1L0QA 4Q9QL 2YGQA 4IOSD 3GI8L 3QRLA 1DQQA 3MRKA 4QHNA 4YR6A 5DUJA 3ZZSA 3GFUA 4NRZB 2EEFA 1CI5A 3S5LA 2VDKB 1OHQA 5I6MA 1QZ1A 1YNLH 2KLRA 4KBPA 1UWFA 2FNWA 2LLNA 1JWSA 3N43B 3QIUA 4YX2L 4QWWC 2VH5H 2J2ZB 3UCQA 8CGTA 1EJFA 1NFIB 4FI6A 3IVKB 5B8CB 2FD6L 2VXVH 3NA4A 5DD6A 4MQSB 5IBLC 5BXFA 1KIPB 2CIIA 3F8UB 1F3DH 5IZ7A 1AOHA 1U91A 4Z95L 4Z7OF 4R84A 5C1MB 3FO0H 3EDEA 3AFLA 1A0QH 2SEBB 3I6LD 4NHUB 4C58B 4L8SA 4RWYL 3QNZA 3SE4A 5T3ZH 4XPHL 4ZW3A 4N28A 3NZHH 3RLSA 1ACZA 1KXQA 1AXIB 4N8CL 5INDB 5G5DA 2HX9A 3QXDB 5CEYA 4LGSB 2XTSA 3MYJA 1JP5A 4JG1L 4U1IB 4HGWA 25C8L 4IBLT 3DX1A 4J1UA 4JDTH 4M1CC 5B4MD 3V6BR 4D0DB 3BRGC 2DJUA 4J7RA 1SHWA 5MEPB 3HS0C 1A4KA 3F7VB 5C08E 4W6XB 4RQQA 4IRSD 1TQCC 1KXQE 3RWHB 5KEZA 3W2DH 1HDMB 1OCWH 3SDAB 1EEYB 5FGBC 3QUGA 5C8JB 1JG9A 2EZ0D 1BD2B 4LKCB 2BHYA 3BD4A 2QEJA 4QTIH 5GJSH 2JH2A 5DD1L 2V2TA 4Y4FD 3PWLA 5DJ6B 3BCDA 1P4BL 1AQDA 5CP3A 1XF1A 3IU4L 3ULUL 2JIXB 2VAAA 4AH2A 1TFPA 2O5ZL 4RZCB 4JREB 5FOJA 2AHIA 3EF4A 4YWGH 2AJSL 4HCRA 1YAZA 1U8QA 3A6OA 2ROYA 4I2XB 5KBDA 3TONA 2XWTA 1LILA 4MD4A 1SN0A 4PS3A 4G8GB 2WP3T 5ETUB 3T4AB 3VFRB 3AZUA 4NO3A 1KEMH 1UASA 2OL3A 2ZCHH 3FTSA 4TSBL 1HCYA 4Z3TA 2G0LA 5GRXG 3W9EA 3WN5C 1FP5A 3WV0A 1MY5A 1P5VB 1A6ZB 1ZY9A 2MQGA 4MNGB 3SQBA 1S7UB 3ATEA 4G7SB 3P11H 2UXVA 2IPUG 1MWAL 1ZS8A 1DJXA 4I0KA 4UZUA 1KXVC 1ZPLA 1YC7A 3GMNB 4C59B 1TEGA 3HVDA 2I25N 2H3NB 4GSUA 4WV1B 3VGHA 4FFYL 1IC0A 1CT8B 4LVHB 4ORGA 4PWFA 5D93B 3S4SG 1AMXA 4N0UA 1IBGL 1RSFA 1HHJB 3LQAH 4GUPA 4Y1TA 3NOIA 1QHQA 5E2WH 3WU1A 4HPYH 1CE6B 2R1YB 3VM5A 2WINA 5FKAA 4OZIF 3F12A 4MJ2A 5C0AA 1I8KB 3PV6B 3P54A 1T0MB 3MLUH 3PREA 5EO0B 1XDTT 5C0IB 5JXED 4NKOA 3REWA 5TDOB 3AY2A 3CFMA 3FO9A 3F6IA 1HHHB 3LKOB 5TQ2H 2M1KA 3OBAA 1HSBA 2MOVA 3QUZB 2R0WL 1GSKA 1Z66A 2WVTA 4K55A 1LM8V 4PJIB 1T4KA 3QUHA 4GSDL 4HG4J 4JGJA 3E0GA 1CYWA 2H6UA 1INEH 1KB5H 4G7VL 1M2OA 5DJ0A 3G9AB 3LKQB 4XNZC 1YAIA 4I7ZC 5FLUA 1RURH 3RWEA 5L8LB 4M7JL 1NM4A 4ADGA 3U2JA 2AABH 2FGZA 3MUUA 4ISVB 4XMLH 5HYSG 5ALCH 4Q4IA 3PXLA 3CVCA 4KI5E 1MHPL 3IETA 3HC0B 5D7IB 4NKDA 1EAOA 2WOBA 4C4KO 1IBDA 1PIGA 4GW1A 3MYJB 4BZ2H 1YEKH 1WBXA 4HGMA 3BGMB 1QRKA 5INDA 2ENYA 4WWKB 4WCYH 3WJJC 5G4OA 5KSVA 2ITFA 4N8VG 1S7XB 4PS7A 4FA7B 5EN2A 4KAQH 3X2QB 2BX5A 5H94B 1BIHA 3GBNH 4MNQB 4LDEB 4E0RA 4JKWA 2VR7A 3QCVH 5D6CB 1OT1A 5D2LE 4NBXB 4RQQB 1NGZB 2V17H 5AW6B 1YYLL 1E5AA 3Q44A 5I0DA 2E9BA 1YJDC 1TO5A 4M5YH 4XOAA 1VKXA 3ZMNA 1A6AA 1F56A 3Q8BA 4XP1H 3ZQXA 4FQXB 1U8IA 2C8NA 3V6ZB 5E00B 3L9BA 5FO9B 5IMKA 4FFZH 2VN5A 3LB6C 4LHQB 4MQ7A 5HGDA 3ZMEA 1FL3B 3K2UH 4J3OF 4Q9RL 3LNEA 3L3IA 2FTAA 5ITBL 1FHNA 1J05B 4L8BA 1E4WL 2O5XH 3IKCB 2X4QB 2C4FU 3QUMA 4X5WB 4G82A 2A4ZA 2DMKA 2XZCH 1A7RH 2DQDL 3A22A 3UTTB 5CSBA 1PZ2A 3HI6L 4LCCB 4HS8H 4OT1L 3WTSA 4OV5B 4K3JH 4N8UA 2NDGA 4RETB 1UOWA 2BVYA 5F96H 3QDMB 4HUVB 3BH4A 4RGMB 2Y1VA 2YLKA 3CHOA 1ACYH 1KFAL 3W56A 3PWPE 1QEXA 2IWGA 4YDJA 1EXHA 3NJLA 1GCYA 4JN1L 4XB3A 1F86A 2I5YH 3A24A 4N0CD 4PI0A 3WXWL 1BPLB 2EDYA 4WW2F 4MAYA 4Z7IA 4X6CB 4JNXA 1B0GA 3QXAB 4W9CC 4DF9A 5KBPA 1CFSA 3MNWB 3OL2A 4S1QL 5HGBA 3L3JB 2WQAA 4MA3B 4AG4H 5AYUH 3HG1E 1NTDA 3LSOB 1TPXC 3R06A 4M1GH 4Q0XL 3G04A 3SE4C 4TSAH 1L7IL 2FSEB 1TKWA 4FNSA 4R4FL 1EFQA 1WEJL 1XT5A 2UZXA 1KPVB 5EZJA 4ELKA 2H9GB 5DWUL 4MX7A 5EG6C 4HJ1A 4ZS7H 3N9GL 4MCYA 2NX5D 4P2QE 5BZXA 4YSAA 2HMIC 2WN2A 5DEJA 3FHEA 4G9FD 4Y7OC 4EDXB 2PW2A 4PLJC 4PRAB 2WBJC 3E6HA 3TVMB 5M95B 3Q8EA 4NP4L 4BINA 2VKWA 1QSFB 1E7VA 3QJQB 4HK0B 5AD0B 4GW4A 1HEHC 5DDHA 4KZDL 4CVUA 3L4XA 4PJIA 4XNBA 1Z2KA 4X8XA 5E8OA 4LL4A 4S1SL 2Z9TA 3ROLB 5INCB 1F6LL 1R46A 1AR1B 4X8GA 2QQQA 4PP1D 2DQJH 3PGCA 3CXFA 3SKJL 2F68X 2CUMA 2AK1H 4UIKH 2G2RB 3UAJD 1CPUA 1N19A 1WZLA 3EDKA 1DSFL 3FRPG 4X99A 5TE6L 4UTBL 3TL5A 3ZKMC 3QIBA 1BAGA 4A6YB 3W0WA 5HHPB 2WB7A 2N7SA 3KPLA 4E2OA 4G9DB 4X98A 2HG5B 2ISDA 5CILH 2PO6C 1JZGA 4QRAA 1RIHH 3GMLB 3WYRA 3OAZK 4GAYB 1PSKH 1JZ5A 3BIKB 1K72A 4JFFD 4AK2A 1GZQA 5FM4A 4PV9A 4GMTH 4YDVB 1WS8A 3AQZA 2KT6A 2LE9A 2OCCB 2Q3XA 5BUAA 1EA9C 5CD5D 3QHZH 4TPRH 3ZUNC 1JFHA 1IIIA 3WKML 4Y4FB 3DHJA 2PO6D 2WLKA 3MOBH 5H4ZA 2VLKB 1L9PA 2WN3A 2X53A 2XA8L 3GO1L 4M7KL 4Z23A 2QR0B 4M5ZH 2XFGB 3Q5OA 2MSPA 1HSAB 1I1YA 1JHTB 2EEXA 3J27A 4UQDA 3EYQC 1VFMA 1IAIL 1LO5A 1LE5B 1JPTH 1T20A 3RX5A 1HXYA 1AD0A 3Q2VA 3P9WB 4N3TA 5GISL 4PS4L 3SYQA 1DQML 1RZGB 2OW7A 3MLYL 4BSVA 3BWAB 1TU2A 4MKMA 5HI5D 5TTRA 4NP9A 5IESH 4M48H 3GJFH 1Q0EA 3FK3A 4PJXA 4XP4L 5C0GA 1T6WA 3VXUA 4PGJA 3R7RA 1E27B 3IFNL 4PG2C 3E9TA 3T04D 1TQUA 1KMGA 2ATPB 4GQZA 5IQOA 4CVXA 2ED6A 5CN2A 3GMMA 3U2SA 1J0KA 3IDIB 4LIQE 1EDYA 1WT5A 4ZUSB 1JGIA 2W0KA 3FQUA 1JYWA 4FNTA 4UMGA 3MROA 1JHLH 3G6JB 4WW2C 1O5PA 4O2CB 3QIWA 4U31A 4LLMB 1QACA 3DGGA 2M83A 1SM3L 5GGSA 5FGBA 1FIEA 1YN7B 1I31A 4N26A 2QL1A 4KNQA 3WIHL 5D7JB 5JOFB 1MFNA 3TV3H 1RK0B 4HS8L 2H32B 3ABLB 4OT1H 2DLTA 2CNZA 2P80D 3IKKA 2CDEA 4CSTA 4R3SB 3GRWH 5ENWA 3GSOA 4QD2E 4KRLB 5HJ3A 2Z7ZA 5ADPH 3VRJA 4WHCA 4RWHA 1IQDA 3KYNA 3RUGA 1JTOA 5A7BA 2A99A 3GZOA 2XTJD 4PVLA 1JE6A 1GJWA 3D85A 4XI5C 1ZTXH 2P46B 2VN4A 2XQYG 5D7KE 5IF0A 4FA6A 4ZFGH 1QRNB 2OR8A 4ODUA 3BUYB 4LCWA 4NQDD 4M03A 1P5VA 3GB7A 3RZCD 4JZOA 4U1MB 4Y2LA 5F7FA 2P5ED 4I3GA 2Q2LA 4AGQA 2NXYB 4U1HB 2BHFA 2X5PA 3RNQB 2VWEE 4OQTH 1AE6L 5DD3H 3F2LA 4PJEB 3W11D 5HY9B 1QRNE 1CURA 3FH7A 5T1LD 5EZIH 2XXMB 3C09B 3LNHA 5EDSA 3IU3B 2DLEA 1OAZH 3OMAB 1U9KA 3L5XL 1H3WM 1TEYA 4UBDD 1RCYA 2CLRB 4G6ML 3E8UL 4Y7MA 4H1LA 1LO0H 2H1PH 4Y19A 4RRPM 1X5YA 4IOFC 1MVFA 4DZBB 3H3PH 3H54A 5ALBL 2F5AH 3ARDD 1RZ7L 4XPTL 4MXQD 2ZSWB 4FFVC 3UZQA 1AVAA 1IGIL 2ZG1A 1T0NA 4IGBD 4TULH 3D30A 3NIFB 4C47A 1KGCD 2VXQH 5AW0B 3L45A 1RK1B 3Q8AA 4R90H 4UYPA 4BGLA 3DI2B 4G72B 3WN6A 5IOPB 4X5XA 5DLMH 3ETTA 4LGPB 1CTOA 1S9YA 3QEUA 4HC1H 5E9NA 1UA6L 1U2CA 5I1JL 4JCLA 4ELDA 5L0QB 1I9RH 2EEAA 2DBLL 1MFMA 4YZFF 4ZX5A 4GRWF 3UYPA 4R2GB 1KN4L 1ZS2A 4EUPA 1B4JH 3FTGA 1BW8A 1FV1A 2PYEE 4O58L 1DJIA 1Q1PA 3VD5A 3GUTA 1OGAD 3LH8A 5FFOA 3GJFA 4MZIA 1UXWA 3FT2B 3GYRA 3HC4H 4S1QH 4X6DB 1SN5A 2FEDC 3ABMB 3ZDZB 3VXRE 3ET9F 1T0NB 2BNUB 4LSUL 5HYFA 2VRQA 5D2NB 1X6LA 1A9BA 4X9IA 5DJCA 1AGBB 5CEZD 4J4PD 3WKMH 1C8PA 2E86A 3TA4D 5EEUA 2J8UF 1VADB 3B8YA 1P4IL 3RTQA 4KHXH 4WNQA 1DN2A 1GZPB 4FERA 4IIZA 5GRVL 4LDOB 2W9DH 3TN0B 4NS0A 4PMFA 5JORA 3BVVA 3TF7C 1B6DA 2FEDD 1XL4A 3F62A 3T4AC 4YGVB 2D7QA 5A2JH 1H3PH 2QHLA 4JPKH 3O6FA 1E3ZA 1KN2H 5D7JD 2V5YA 4Z0BH 5I71C 3V4VL 5DZ9A 2PWEA 1DEEB 2J44A 3IFOB 4NQDE 1LEKB 1Q1JL 4TNEA 1IGML 2ZWLT 1QA9B 3QNZB 4G7VH 4QHLB 3BH8A 4PGBA 2TSAA 3MROB 3SYPA 1JPSH 3QEHB 4QCIB 1N12A 1M9WA 2L4OA 2ZKWA 4WGVB 1J8HB 4NWTH 5FO9A 3ZE0E 4NI6A 4PBWD 4BQCA 3GHEL 5KYWB 2X2IA 4JM2D 4DFIA 5GGTA 4XTRD 1J0HA 3EH3B 3EJYD 1MHPH 5JHDB 1S9KC 3C6LC 5JORB 1A6WL 4JFQA 1BAFL 4JRLA 3GSNA 2B4CC 2NY7H 2WNKA 3E3QE 4HBQA 3RDTB 4HWEH 4I48B 2DQGH 4IOIB 1BJ1H 1FIGL 4QTFA 4F7CA 2W9EH 4L5FL 3D8MA 5KYYA 3BPOC 3ESUF 3GMRA 2OR9L 4ZTPL 4XBPB 2A7BA 3MREB 1OO2A 3LEYH 3D85D 1XGYL 4IHOB 2Z8VC 4CDHA 3C5JB 4LEXL 4EI5D 4M7LH 1TR7A 3B2UC 1CU4H 3C2AH 2AMUA 4RSYA 2R0LL 2FQFA 4QTHB 1F42A 3D0LA 4YK4C 2D73A 3HC0A 1AHMA 4P5SA 5E99H 1XCTA 3QDME 1FO0L 4IK7A 4NN7C 1HL8A 4PRPD 3HVNA 1MFDH 3BFWA 4HPOH 4P9MH 1CICD 2OJZH 4Z7QE 1JZHA 2EDMA 4H8WC 2A6IB 4LOUC 5KVDL 3L3OC 2O6EA 5MI0B 4G8FA 2PCYA 4PJ5A 4FABL 4RGOH 3D9AL 3QDGB 2ADFL 4F7CB 5IROA 1PTZA 2YPLE 3QORB 2BVOB 2MPVA 3SBWA 3I6SA 5IQMA 2ZKHH 4WUKH 3PL6A 3AREB 3GEFA 4B7IA 4G70B 5C2UB 2H2PD 3NSYA 3QXWA 3SYCA 5CEZE 2FJHB 5JOPD 4ZMYA 1KTDB 4WUUA 2FJFA 3IFNH 4OF8A 3T2OA 2JLPA 4XT1C 1UOVA 1Z9LA 4V1DA 5F2FA 5GGSY 1F8TH 2DJ4A 1U8LB 4B3EA 1FL3A 5IHWA 1QUPA 3QZLA 3BKMH 2ROXA 2DLGA 4AW4A 2DKSA 3GS7A 1FL5B 2FEEI 1QEWA 3NJFA 5LKNA 4OZIE 4YHLH 1HHJA 3VYPA 4KJYB 3PJNA 3MYZA 3QC6X 4LU5L 3N1MC 2E7DA 4Y4HB 1T7XA 2YUVA 2UX6A 4A66A 3WFEL 1JRHL 5C70A 2OSLB 4J8RA 4P2RD 5IFAH 4A7TA 5L2JB 2DB8A 4HWEL 4X98B 4B5ZA 2ZOOA 5DHMC 4JHAL 3IB4A 3G08B 5F88B 3INUL 4OSUH 1D2OA 3U7AA 4DO6A 4QGYA 1J5CA 3D06A 1IM9B 1BXUA 3KM2A 3SCMB 4A63A 3QRGL 3VACA 4R7LA 1TJIL 3GS0A 2VXTL 4GS7B 3N42F 3EYQD 3WE6B 3VXSD 3DUUB 1T1WB 3Q1EA 1F3JA 1S7TB 2OXGA 2YMOA 4ODTH 3C8KA 3DOSB 5A2CA 4MD4B 4DESA 3MCKA 4R5XA 2XIBA 4PRIE 4FA8A 5E9DA 4D8PB 2LABA 4BQ6A 4D9QD 4Q6IC 1XGPA 3EHBC 1Z3GH 4ISVA 4BEIA 5FHAL 3EZJB 2Y6TE 4P5RA 1X9UA 5KS9B 4I3RH 5GS2D 5PAZA 3RJDA 1INEL 3LPGA 3MV9A 4YEFA 1TLMA 4XMTA 2AEQH 5DJAA 4OBSA 2GCYB 5I5JA 5FA3B 1ZE3C 3TC9A 4XO8A 3UAEA 1Y1UA 3FB5A 3JTSA 4WTZG 1IM9A 3SCMA 4D8OA 1TQBC 2AXJA 5F9WC 3LKPA 3HE7B 4KKAD 2DKMA 1MXGA 2CCWA 3WMQA 4NIKB 3SJVE 1WF5A 1HXMB 3LX9A 4DN4H 5D1XD 1GOGA 1JCVA 5F1KC 5B38G 4EZMA 1QKZH 4H1LH 2HT2C 4NO5B 5C3IA 1KYUA 4L8SB 5E4EC 2PR4L 2CUAA 3ATDA 4K7FA 4FQXD 3CH8A 2B59B 3PWUB 4FI7A 5CGYD 5B38B 4YDIH 4YDJB 1I9RL 1YNLL 3O4LB 2XV6B 4PUBH 4B96A 5J9PA 1L9MA 1JDAA 1S7SB 3P4NA 4YQXL 4F8TA 1R5IA 4IMLA 4JO8A 2IBZY 1DVFB 3T2LA 1G7QB 3EYVB 1T1YB 3DO7A 2ITCA 3MJ9L 2E4FA 1FNSH 4M5ZL 3O3BB 2EDLA 2IDQA 1IMHC 4X5WA 3BD3A 4JCWA 5IK3A 1DLFL 3OGCA 4FQ2H 4EBQH 4Z78B 2B5IC 5K33A 2XWJA 1YEJH 2XVLA 4FYRA 5JW5A 1R75A 2F9BT 4Z7OE 5JR1L 1UJ3A 3ARFC 4P2RE 1YUKB 3FUMA 3KHQA 4IKNA 2EDFA 4MAYC 3U4KA 3FU5A 1NC4B 1TFHA 2IVFC 5DU7A 2ADJA 3C60C 1NPUA 3CVIL 5F21B 2AV1B 1RIVH 3U1SH 1JWUB 1EFXB 3MBEA 4P9ML 2ADIB 3HI6H 1BD2E 1T2QL 1G7IA 5GGRA 3CMGA 2C9VA 3HBZA 3NEEA 3CX5J 3WIHA 3IDXH 1CG9A 1U3HD 2J8UB 4M6NL 3AM8C 1F58L 1H3XA 2W1NA 3CZGA 2Z4QA 3V0VB 4PVNA 4LHUG 4OUUA 3VXSE 4RZCA 2XXCB 1M57B 1Z9NA 4D9LH 3ROLA 1Z9SA 2OMVA 3S88L 4ETQB 5HHXL 2D4FA 1MNUL 4YXHL 2A83A 3BQUD 5KVFH 4G8GE 1QWNA 3PFUA 1LEIA 2BC4A 1AOZA 3AXLA 1U3HC 3QAZC 3RIAK 1YQVH 1RZQA 2EIZB 4BWUA 1DBAH 2WAHA 4TVPL 3ZL2A 3DX8B 1T2XA 2IANB 1L6XA 4YHZH 4EI0A 1W72L 5D9SA 1SOXA 5FYLE 4HUUA 1FZJB 3O9WD 4M43L 3L95A 5HDWA 1T7YA 2ZKXA 3NUKA 4H44C 1NMBL 4X8CA 5FUCC 3EYOA 1IM3B 4YHLL 4S1RH 4XXWC 4PJ9C 2OMXB 1IIKA 5KJRL 1J8RA 5CEXB 3KW7A 2GTQA 5EV7A 3IFLH 1KJ3L 4KI5C 4P2YA 2E9GA 4AK1A 2X4RB 2DMBA 3EO0A 4Z0XB 5DS8A 3D87B 4Z6AT 4E41D 4WSGA 3HKFA 2YK1L 2KI6A 1V3MA 4ZMXA 2X42A 1KJMA 3BN9D 5EF0A 7FABH 4DW2H 4F8PA 3F12B 2CDGA 2O6FA 4MMXA 5LQBH