1HH9A

Anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)
publication title Evolutionary Transition Pathways for Changing Peptide Ligand Specificity and Structure
pubmed doi rcsb
molecule tags Immune system/peptide
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hh9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hh9A01
1DJSA 4W68A 3PQYE 4MJ5B 1P4IL 3KWWA 4P2OD 2A74A 5IBUG 3WLWD 1GZQB 1F58L 3FQRB 4KQ4H 4NRYA 3T4YB 1FFQA 2K7PA 3BZFB 4NQDE 5BRZA 1FZMA 3PG2A 2O5YH 1OOAA 5ETUA 1UC6A 4RMSA 1VKXB 2VLKB 4DQOH 1M7IA 1MF2H 4JHWH 5HY9A 1T7ZA 3UDWC 3HZVB 4KAQH 3S34L 1BZ7A 2VLJA 1IEBA 3ARED 4XB8A 1U8MA 4OGZA 4ZTPL 1I9RL 5FYLL 1Q9WB 1J12A 4OQTH 2WWKO 5DVLA 4EI5C 4YGVA 3L9RA 2GFBA 1JP5A 2BVPB 1T20A 4H26A 2Q20A 4KRPD 4U6HA 3UYRL 3DX7B 3OF6A 4OLYL 5FA3B 4DKEL 4LOUD 5F3BA 5I19L 2F15A 2PR4L 1SY6H 2YZ1A 1OWRM 1S9YB 1AR1D 2ENYA 5CJQL 2WINB 2Z8VC 2BXYA 5EOCJ 3MCG1 4F33A 4PYGA 1RUPH 3HC4L 4KK8D 1IGJB 2CIIB 2CK2A 1GGCH 5DTFB 3KVQA 3FFDA 1VACA 3KYMA 3QCUH 5EU6D 3S35H 5L2KA 2ORBH 5CEYA 2V2XA 5DJAA 4QGTA 3HC0B 2H32A 3QIUA 2I07B 3QNZB 3UJIL 2UYLB 2HFEB 4XBEL 5DWUL 1HYSC 3UZQA 1CLCA 1D6EB 5FYLE 3F7YB 3T0AA 3LKRA 2LAAA 1X5YA 3DTXB 3PF2A 2VN7A 1Z5LB 2XZZA 2CRIA 5J6HA 3SY0A 1ZEAH 2ARWA 4OKDA 4EI5D 4KROC 3WEXA 4N1EA 1BWWA 5F7YC 2A6IA 4G3YH 3QXAB 1AC0A 2YD8A 1YEHH 5EOCH 3MLWL 5BJTB 1MFBH 2R1WB 3BZ4B 3U4BL 1BF8A 3FO1A 3BH9B 2NNAA 4GRWB 1J7VR 4P4KA 1QVOB 5D96C 4DK3A 1XGRB 1FZJB 1YNTA 3MCLL 4HF5H 4LSVH 3QXUA 5BW7C 4J12A 4N1CA 4NNYB 1RK1A 2DWDB 5I8EB 2AI0H 5JHDB 2H1PH 4MJ6A 4P5MB 2EXWD 3MA7B 2BSSB 1VPOL 4UDTB 1I7TB 3TT3L 5F9JA 3U9PH 3KYNB 1H8SA 2VXQH 3PHQB 3MODH 1FFRA 3LKOB 4K7PY 4GSDH 4L4JA 5H37G 3UYPA 1MNUL 1ORSA 3RVXC 5CKAA 1G1YA 3RWIA 1HYSD 4I4WB 1AGBB 4NJAH 5HHMB 4X4YB 1NGZA 3CXDL 3VXUB 5FO7A 3BIKA 2PTVA 5IT2H 5IWLC 4NT6A 1QRNB 5FECA 4QRTB 2QV2A 2Q8AH 3QPXH 4KROD 4ZUUB 3M1BA 3FO2A 1PD6A 2DL2A 3RIFK 4IRZL 3S36H 3X3GL 1A3RL 1A6ZA 4XWOD 5E6ZA 3RPIA 3PWVA 4G9DA 4TUKL 2GSGB 4KZEL 1OM3H 2E6PA 5JDSB 2XKNB 4PLOB 2X1XR 3MLVL 2XZQH 4F7MA 5J13B 1MJUH 4L4VA 3MRGB 1CGUA 4HDIB 3D3VE 4KMLB 5CINH 2IC2A 4QXUH 1TJIH 4XAWL 2J5LC 1NANI 4KPHH 1MI5D 3DI3B 4P2RB 4LIQL 1A7QH 1SJVA 2EDJA 2CDEB 3NH7H 2VWEE 4R8WH 1U8NB 3C2AH 1F3RB 4TVPH 1JZ2A 3L7FA 5BXFB 2HT2C 4GMSH 1U91B 1LO4L 1W2KT 2IAMB 4XX1E 2LVCA 3NFNB 5GGUB 1Y6KR 4K7PH 5DF0A 5A43C 2E27H 3BWAB 4JRXE 1NDGB 2MMXA 2W59A 5D6CB 2AEQL 1QNZH 5ESVA 4D3CH 2PUQT 4GJTB 3QDJB 2Y07H 3WNPA 3LS5L 3MRRA 1S7UB 4KH2A 2YS4A 8FABB 1R5VA 3BZEA 2ATPA 4R4FL 1T21B 3VJ6A 4H8WH 4KI5E 4NNXA 2AJ3A 3N85L 1FC2D 1QA9B 3O3DA 1IGCL 3MJ9L 5CSGA 3NCMA 4WFHD 5CWSA 1BGXL 5IVZA 1Q9OA 1J0ZA 5DFTA 3VXRD 1XH3A 3QH3B 3LKNB 1FNSH 4URTB 2Q8BL 2XA8L 2CLZA 3E2HB 1YEKH 4LIQE 2ZZUT 4DCQA 5ESQB 1F02I 3MXVL 3QUZB 3MMEA 4XMKL 3S37H 1B4JL 4EOWH 1HN1A 4LRNH 1GHFL 2H6PB 3P77A 3ROOB 4D0BA 5SWSB 3MQIA 5IHUL 1RZKH 1KN4H 1KELL 4L4TD 1JFQH 3P30L 4J1UA 2NXZC 1XIWA 4Y4FB 1WLHA 2WM0A 5EUOA 1NL0H 2HT2D 1ACYL 2BNRE 5MENA 3H9HB 4MNHB 2Z93B 3DUHA 3NCYS 4V1DD 4GRLB 3TF7C 4JFQA 3G5XA 4ZAKB 5D93C 4MQSB 4QRRE 5ITBL 1OP5K 3RVWC 3EFDH 1EZVX 3MNZB 5ERWB 2XZAL 3RGHA 1CD9B 3D85A 1AGDA 3ARDD 1KJ3L 5J56B 1CG9B 3LZFL 1IE5A 2OJEA 4BYHA 4Q9RH 1UKTA 1W72B 3B9KB 4ZNEE 3R0MA 2D0HA 4LHUA 1UENA 3NGBB 5GHWL 1DQQB 3K0WA 1LE5B 2NZIA 1OTTC 1B6UA 3MJ7B 4MDIB 4D9QE 3CFDB 1D5IH 3K2UL 3VWJC 2VRAA 3WBDA 4YO0A 3UPAA 1UQSB 4HHAA 4J3UA 1FH5L 1CT8B 1FGVH 2J4WH 2XRAH 2R23B 3WJLA 5IVXA 3OKEA 5KOMC 2GW5A 5FK9A 5I71C 3CDYA 1F4XH 4IIQB 5DVMA 4N9OB 2CRMA 3V4UH 1CTNA 2P5WA 2YR3A 3LKSB 4HFUL 1QG3A 1Q38A 2F8XC 3ULUL 2WUBL 4YJZL 2NXZD 2BVUA 5D9SB 4GRWF 1CR9H 3EGSA 1RULH 3OKNB 3RU8L 1T89A 4YFLF 4QRQB 1VCAA 2NXYB 4ZFZB 4XPHH 1T0NA 2X89D 1UA6L 3RVWD 3BGFB 3RGVA 5E5RB 1XFPA 2HKFH 4PGEB 1J8KA 1J11A 1INQB 5A2KH 4ERSH 4WRLA 3KPLA 3L1OL 4OGXL 2QSTA 3MREA 4JFEB 3CMGA 2DQTH 1PKOA 1MWAL 3OQ3B 1TVHB 5ICXB 3QUML 1FHGA 3KPSB 4TTDC 2GTZA 2VZUA 4HS6B 5SWZA 1OTTD 1EDQA 2I24N 3O81A 3VWJD 1A1NA 3L5HA 4S2SB 5FM8A 2YD3A 3IJYB 4GS7B 4NRXA 4NQCA 1IC7L 3MV7A 1FL6B 1VFMA 5KANG 3QDMB 1JYNA 1V7NH 5C7XL 3IXAB 3AAZA 2VLLA 3NZHH 5C0AB 3TBSA 1PY4A 1FVCA 1Z3GL 4H8WC 1DBMH 3U30B 4LHQB 4PY7A 3GSQB 3N1QC 2P43B 5A2JH 4ZFGL 3DYOA 3JTTB 3MRKB 4L8CA 3VFVB 2F58L 5EU6E 2YMXH 2DWEA 2I60H 5DJ6A 4OCLC 5JPMA 3IFOB 2ZCKL 2UY7A 3ARBC 1ZT1B 2DMKA 2J6EA 1DBBH 2XA3A 3GSRA 4K07A 5FEBA 3EYSH 5C07D 3CVIL 3H42H 3VFRB 4HXAL 5D71H 4PGDA 2ZUSA 1JNJA 1RZKC 4FQHB 1AY1H 1YN6B 4AZ8A 4FP8H 4K9EC 2PYEB 3OXSA 4U1MA 4TVPD 1HHIB 2BJMH 4POYA 4XXCA 4MD4A 4MAYC 3X3FL 4TTDD 3MV9E 5CHNB 3NZ8A 4JG1H 3MNWB 5DMJB 1MAML 2DLFL 4U0RC 3QHFL 2R2EB 4JVWA 1QLRA 4MNGE 5BS0B 3OJDB 1RURL 4QRPA 5FHAL 2YKLH 3A6OA 3TNNB 4AH2B 5JHLH 1EEYB 5MEQA 4NM8L 5A40E 4MCZA 4N8CH 4ENED 1IGYB 5DGRA 2D7TL 1X7QB 4AIZB 1R6VA 1EVTC 1EFXA 4LLYB 1CLYH 3MJGX 1MFAL 4UT9L 3MRMB 3OAUH 1MHPH 3MLXL 1LO5B 4EDWH 2EO9A 2H45A 1QSFB 1GJIA 4JFXB 4RFOH 3ARBD 3MRBB 3V95A 1WK0A 3LHPL 3I6LD 1FYHB 5B22A 1KJ2L 3MX0A 4AG4L 2WP3T 1WT5A 3RY6C 1KTRL 3K4DA 4GQ9H 1DE4B 5JW4Q 1IAIM 2H32H 4OI9A 2OI9C 3OPZL 3BP7B 3LRGA 4MAYD 3D2UD 4WY7L 4JJ5B 4NHCL 1I8MB 1CBVH 4DTGH 2FGWH 5JA9A 1C1EL 1D9KA 4HLZH 1K4DA 1T22A 2YPKB 2O5YL 3UTZA 1TPXC 5SX5K 3Q6GH 1LEGB 1DLFL 4DQOL 1CFQB 1IM3B 1EEUA 4DUVA 4O9HL 2QR0B 4ZUVA 3S97C 4JHWL 3TO4A 1UFUA 4KKCC 4BH8A 4X9GA 5T3XH 3H9ZA 5D1XB 1HXYA 1YQVH 4LLWB 5CFHA 3DUUB 3V6FB 5D5ME 4HIJA 3RIAF 3GSUB 4RGMC 3DO7A 4Z8FH 5E56A 3LN4A 4LVNB 3VFOB 5ICYB 5BVPL 3QEQA 4JFDA 2XZCH 5I66B 1AGCA 4M3KB 1FL3B 4RFNC 1HH9B 3IETA 4HWUA 2R69H 4Q6IA 2V5RA 1MCLA 4JY6A 5E8NA 4RA3A 4G8EB 2VQTA 1BFVL 1FVDB 3NACH 4PRHA 4F8QA 4ZG1A 4I8DA 3VXPB 2AK4A 5DC9B 2YRZA 2NY5C 2XI9A 1RUPL 4JDZA 4N5EC 1VADA 4H25B 1CXKA 2F54E 5HVGB 3O9WB 1NCDH 2HN7A 4RGOH 3GNMH 3S7GA 3QCUL 2ORBL 3E3QC 4YDJA 1RV6X 1EPFA 3WO3B 2P47B 1JK8B 4MZ3A 5LCVL 3GJFB 3H3PH 4OGAC 4NN6C 2DI8A 4KKCD 4WFHE 1C12A 2HRPL 4X0KB 3RY4A 3VXRE 3QXTA 3ZDZE 3CX2A 3DMMA 4WV1A 3LH2H 2MNUA 3SCMB 4NO5A 5HPMA 3TESA 1U92B 2D4FA 1U8HA 1D6VL 2GCYA 1MREH 1YA5A 4G3YL 4FZEH 4R7NA 4F7PA 3GBNH 3WLBB 4F15B 5GGRY 3TBYA 3I02A 4YHYC 2DTSA 3EYUL 4YR6B 4L4TE 1LE9B 2BRQA 4LNRB 5F89A 4PJCF 1N5YH 1NAKH 1XZ0B 3EFFA 43CAA 4LF3A 1MHHA 5EFIA 2XACC 1BQLH 4X98A 4LKCA 4HF5L 4LSVL 4OZ4A 2XFXA 1OQOA 1K2DA 1CGSL 5J3HC 2VXVH 2QLVB 4N5ED 2VQUA 1KYOK 2AI0L 3U46A 2JB5H 2H1PL 3C6SB 4M48H 1TZHA 3RBGA 2XTLA 1K85A 1HQRB 5IR1B 3ZE2E 5CEXB 3U9PL 5KVMC 2MPAH 4AEHH 3QO1B 3GB7B 4PY8I 3UJJL 4GSDL 2EC9U 2VDPL 2VISA 4NJAL 2HA1A 3QIUC 4OGAD 5BRZD 5DO2C 3PIQA 3P9LA 4BKLB 3QO0B 1YEJH 4JCMA 4F7TB 1QACA 4QCIA 5IT2L 1FYTE 1LNUB 5DUPL 3PGFH 4RNRB 4HIHA 2Q8AL 4D8PB 2VLJD 4PBVC 2V5TA 4F2MB 2QJDA 3PDOB 3BPNB 1FVEA 3GHBH 3RFZC 5DJYB 3BESR 3DSNA 3EJZC 4N8VA 5AAWA 1JPSH 3LRHA 4P59H 5F7KC 5HGHA 4I0CC 3VXOA 3FQTA 3HS0B 1OM3L 1D5MB 2XQBL 1TZIB 1IAKA 3OF6D 2XICA 1UWXH 4NCC1 4HUWB 5FGCE 1S8DB 5SWQB 4MXWL 5J3HD 2DKMA 4P4KC 1MJUL 1A7BA 4M7KH 1IVLA 3OKKA 3WIIL 1BP3B 4BK5A 3QG7H 1PG7H 4HKZA 4QXUL 4WW1A 1ETZB 3K2MC 4GG6B 4HMEA 3MOBL 5JW4R 4YBQC 1T0PB 4KPHL 3CU7A 4U1LB 1IZKA 5I1DA 3BD3A 3BPCA 1WISA 1A7QL 2B5IC 3QFJA 5L2KD 5K33A 3NH7L 1Q9LB 5IV2B 2BXZA 4R8WL 3C2AL 3QIUD 3MLRL 1T7WA 2XY1A 1PLGL 2QSCL 4MB3A 5DO2D 2Z4QB 4TVPL 1DBKL 4OM0H 2DBLL 2R0LL 4GMSL 4XPBH 2J8UA 3ZE1F 1XGPA 4JVPA 3IYLW 2HVJB 3WUWA 1JGEA 1FZKB 3GIZH 1J1XH 2V7NA 5F7HA 5F9AC 5GGTH 4D3CL 1MLCB 4HV8A 1IBGH 1HSBA 2Y07L 2YEZB 1BVKA 3GKWH 4N1HB 3GSXB 1BOGA 3EJZD 4JG0H 2CXKA 4HJJH 5J12B 2FJHA 1ZLVH 1RVFH 3VG9C 1BZ9A 2IBZX 5T3XD 4CU7A 2FX9L 4PLJC 4CADB 4O51B 5HHPA 4XNUL 2D7QA 3KPTA 4HEME 4P4KD 4OD3H 2X4PB 4OF7A 3QULB 5DXWA 1KPVB 1F11B 5DFWH 2WZPD 4P0DA 4LSQH 5C07E 4QXWA 3HPJB 4HT1H 5C0DA 2X42A 1YEKL 5SX4H 3WJJA 4Z7OE 4XT1C 5AD0B 1BREA 2ADFL 4YBQD 1AKJB 2E7BA 4YWGL 1IKFH 3U7YH 3FHAA 3S37L 4U1NA 4LRNL 1U3ZA 1I9EA 1IGTA 1RSFA 2Y72A 4TVPE 5GGSA 5E7BA 5I8OH 5L7XL 1A4JA 1KN4L 1RZKL 1JPGB 5BOZG 1NGWA 5IB3A 1BVLB 3D69A 4ONHA 5EU4A 4D9RD 4ACPA 5ID1B 3T0EA 2EZ0D 4NDMA 1HQ4B 2EO1A 3FT3A 4BUHA 4Z76A 5IUSA 3EFDL 1WC7A 1V05A 3VXSE 2ADIB 1IC4L 3SO5A 3RPKA 5JR1H 1I3RB 4JO2H 4ZFFB 4X4MA 3P0YH 4HK0A 3C6LA 4HS3A 4FABH 3N0PB 1N8ZA 3P4OB 4AEEA 2IQAA 4YDLB 5IEHA 3NN8A 5BZWB 1RHHB 5IVOA 2FO1A 1PX3A 1JPTH 1PQZB 2EDQA 5M95B 3IRPX 3CH1A 2ZOKB 5F7EL 3I6LE 1FGVL 2XRAL 2OSLB 4L4VD 2FX8H 1ZVHA 1F4XL 1R3LB 3ARUA 4AY0A 4TNWF 2B7DT 3L5XL 3T8XB 1N3NB 2MCPH 2J6EH 4LEOA 1YNKL 4JFOA 1IT9L 1J0IA 1SVCP 1CGVA 1X6NA 3WXVH 2W91A 4BSVB 3RKDC 2DS4A 4ZDHA 2X70B 4OI8A 2FL5B 2APFA 1V3JA 1RULL 2FRGP 1XIWC 3IU3B 4K23L 5CIPA 5A16B 5DYOB 1PYWB 4P2QA 3WKMH 3MRHB 4LVOC 4XPHL 5B4MC 2OS7A 3HN3A 3MOAL 4YXKH 5IESH 5ISZB 3HMWH 2C4FT 1YEDB 4GG8B 4KDVA 4FFYH 4XNQA 2V7HA 1IAII 3TVMA 1XR8A 3SDXE 1IARB 1DUZA 2FYYB 2DQTL 2Y5EA 4U7MA 3VGAC 3V0WH 3HNVL 3SDDA 1OY3B 2R4SL 2EECA 1J0YA 3P73A 1QQDB 5HHOA 4ZO6A 4CAGA 4LARL 4MA1C 4MCYB 3DX9A 4JQIL 3EDFA 3RX7A 1NDMB 3OR6B 2R2BB 5IGXL 1T04B 2XTJB 3KPQB 4OV6F 4I18A 4EBQH 5IJKA 1LDPL 5TF1H 1V7NL 3FTGB 4YHZH 1JN6B 2NX5A 3JV4A 4GBXA 3MO1A 3UAJD 5DJ2B 3GJEB 3DSFH 5DSCB 2HLAA 4M6NH 3WJLC 1DBML 5D1ZA 2ZSVB 4L3EB 5LWYL 3EYOB 3STZA 4JEGB 5LXGH 2G5BB 35C8L 1JWSA 5AYQA 2P46B 3NCFB 3RKDD 2FBJL 3IDUA 3TBTB 3X14B 1U3HB 2APXA 2N7AA 1XIWD 5EZLA 1DBBL 5EBGA 3H42L 5MEND 5B4MD 4XVTH 5EPMB 5I30L 4H88L 5LGHH 2AJYH 4W6WB 2HMIC 1K8IA 1T89C 1ZGLM 1UZ8B 5EBWB 4GG6F 3RGVC 2OTUA 2VDOL 3D85D 7FABL 4EI6A 3DECA 3OXRB 1OTUC 2YWYA 3AUVA 1FO0B 2PCPA 2FATH 2YHGA 4X6DE 4JG1L 1EEZB 1NBVH 4QHNB 5FGRA 4LHUD 1W0WB 4NKOA 2VITA 4OV5A 4DOHE 5CUSH 3V5HB 2Y06L 3VU2A 3P4NA 1AHWA 1QOKA 2O5ZH 3OAZH 5C09A 4JM4H 4TSCL 1MHCB 3BKYL 1YJDL 5KJRH 5I1HH 2HAZA 1PFCA 2AQ3A 2YKLL 3OKDB 4IRJB 5JQ6L 1TVBA 3GDBA 3QEGH 4MX7A 3U0PA 5ANMB 2AKRA 3C2SA 3MYJA 3ARRA 3CFKA 1FN4B 4GQPH 3DETC 5DUBA 3R06B 4YHIB 3REVA 1D7FA 3TYFB 3EHBD 3VRJB 1CLYL 3VD4A 1AQDB 3OAUL 3Q5OA 2P5WD 2GITB 1XF3B 2LQRA 5D7SL 3CSBA 1FL5B 5BRZE 4JJHA 3UJTH 4ZQKA 2E7LA 3EJJX 2HMID 5LGJB 2NW3B 1FSKB 2FJFB 4D9LH 3GO1H 5DQJA 1MIMH 3HPLA 5FA4B 3SDCA 3CLEH 1EHAA 3UTTB 3QI9A 5F9DC 3QNXA 3IDXH 4KVNL 3RGVD 4EN3A 5D2LE 5L88H 2VLJE 1ZHKB 5AEAA 1WITA 3KPNB 1OF2B 1OTUD 3O45B 4F37F 3HAEB 4DTGL 4PRBB 1DZBA 1B0RA 5EC2A 4EUPA 2PKDA 4XXCC 3FOMB 1KPRA 2A73A 3GSNA 1I85C 1M6OA 1S9VA 1L7TH 5SWZD 5I17B 1ZHLB 1WUNT 5FUCC 3FFCA 4KMTH 1UT9A 3UPRB 1R3KA 1T3FB 4NQCD 3MV7D 4U31A 4LASH 2JIXA 5GRVK 1NFKA 1U58B 5E00B 1YQVL 1QLFA 5GGVL 4HJGB 1EFQA 3BXNA 2P1YA 3T65A 3B8SA 4AMKH 1UADC 3DETD 2QADB 4R2GB 3M07A 5F70A 2EDKA 2R56H 1Z9MA 2XZCL 2XWBB 5MP6H 5L2KE 3PJSB 4MXQC 5KVDH 4K3EH 3S5LG 4L1DA 2NLJA 4OZHB 2OMBA 5C0BB 5FGSA 5GIRB 2AXJA 1F00I 4HW6A 4HUUB 1B0WA 1WT5C 4AL8L 5DK2A 2PTTB 1LO3L 3LEXB 1NCDL 4CU6A 5IHZA 2R2HB 5FM5O 3QG6B 2V5YA 3QWQB 1WZKA 4KKLC 3IDNA 3PWUB 3IFPB 4LPCA 3R8BB 2YXMA 4XP9L 5IG7B 4KU1A 1KLUA 2G60L 3BJLA 4HH8A 1D9KC 3BQUA 3H3PL 3SPVB 1OAYH 4OCWL 4P49A 5ITFA 4GW5A 4U6TA 1EJOH 2BHZA 2BCKB 5J6GB 4P57A 3TO4C 2B1HH 4C83B 2E5EA 2ZG2A 2MQCA 4QRPD 4WI5A 3HR5B 4CN4A 2ZKHH 5ENWA 2NY6C 4XP4H 4E41B 4LL9A 5CD3A 3GMOA 4HKBB 2IFGA 5TGBA 1J8HA 1EFXD 1P6AB 1ZMYA 1EMTH 1Z6JT 4JB9H 5GGSY 3VFPB 4MXQD 4Z7NE 4FRWA 4KHXL 1CICB 1C5CH 2JCCB 3BEWB 3NIFE 4F58H 1FRGH 4X7CC 4RMRA 4Q6IC 1S5HB 4TPRH 4KGLA 2FZ3A 4RSVA 4D9RE 3D0VB 2VXVL 4MGXA 1TNMA 4PJGA 7CGTA 3V8OA 2JB5L 1A47A 4YK4C 1OSZA 4M48L 2HVKB 4ZFOA 2V2TB 4PJFB 3WNKA 5GGQH 4TUOB 4KKLD 2FH8A 4NUGH 3L3HB 4NO0A 4ZOAA 1J5OL 3LEVH 1JI1A 1LMKA 3S8WA 2R0KH 3VH8A 4NO3A 1CU4L 1D9KD 4WCYH 4DEPC 3BDXA 4K3JH 1KFAL 3QXDB 4UQ3A 5FV1L 2EYSB 4PJBA 3ZKMC 1A3LH 1H0DA 1HI6B 4E5XB 1EAPA 3TO4D 3V7MA 3PGFL 4Z7VA 4K2UH 4N90D 2ARJB 1BX2B 1WZ1H 4KMQA 5E4EC 3CFBB 3F6IA 2UWEB 3B2VH 3I2CH 2NY6D 4JO1L 4TSBH 4L4VE 2EDYA 3MROB 4OCYH 3NAAH 3DMMC 3GM0A 4WV1C 1CFNA 4GRMB 5EBLB 3V4PL 4XH2A 2WBKA 4DJMA 4I5BA 4Q0XL 1JWMB 1JPSL 2D4DA 2SEBB 4P59L 1CE6A 1T1YB 4M6ML 2AEIT 3QEQD 4JFDD 5J1SC 1FFOB 1YEEH 2HJLB 2OJZL 4J6RH 4Z5RB 4FZ8L 1RU9L 2CGRH 1GPOH 1LP9E 3NA4A 1MRFL 3NIDF 3VXMB 2GJJA 5GJTL 4L8SB 3VGDA 4PRHD 3GZKA 2Q7NA 3ISWA 1S7TA 1SJEA 3RVTC 3QG7L 3FQXA 1OAXH 1UGNA 3RZCB 4ZXBA 2MOVA 4HMDA 1AE6H 1FFPA 5EO9A 1E27A 5BV7B 4LFHD 1Y18B 1ZT4B 3QPQD 4P48A 4I2XA 3CGTA 4J23A 3MBXL 3KXFB 3ZKMD 4XRCA 4XPBL 1X44A 4Y4HA 1WCBA 5FAAA 3K3QA 4CMMB 5GS3A 1SBBA 1I8IB 3BH8B 5D1QA 3O4LB 1J1XL 4U1JA 4X7DC 2CXGA 3C09B 3PQYB 4JR9H 5GGTL 3DMMD 1IBGL 5CBEA 4UAOC 5DHYA 3W39B 4CW1A 5TPWH 1L6XA 3L3OA 1T0MA 4HJJL 4NQDB 5I1KH 1RVFL 5CJXA 5IBLC 2OR9L 1QFWL 3Q3GA 5DR5L 3H7BB 3A6CH 4XPGH 3LIZL 5FV2A 3K8LA 2AW2A 1RZJH 1DR9A 1YPZB 1MJJA 3PWPA 4OZIF 5HHXL 5EUOE 3JUYA 3ZDXE 4LSQL 5MENE 4LAJH 3RVTD 4RA0C 5DMKA 1MCOH 3L3KA 5JIIA 3U7YL 4M7LL 1TJGL 1BD2A 1M7DA 5B21A 3C8KA 5FO9B 4CRPA 5HSFA 3LMJH 3G6AA 4XXDB 2E8ZA 2DYPA 3S96B 2FD6H 4JVUA 1T66C 2P8MA 1G9NH 2YN3A 5DS8B 1TVDA 1C5DB 3FQWB 4M93C 2PN5A 1E4WH 1BIHA 3NPSC 2X4RB 3QQ9C 1FV1A 2VDRH 2CDGB 3BP5A 1BIIA 1FGNL 2P8LA 4MQ7A 1DVFB 5E24E 1S9XA 1XAUA 3N9GH 3D18A 5J1AB 4KY1H 3SDAC 1NAMA 2ED7A 5TDNB 5IVXE 2IWGA 4JO2L 4QHLB 1FNEA 3P0YL 2B20A 2WIIB 4P23B 3STBA 1JF1A 4FABL 5IBLD 3RKPA 3PV6A 2J7LA 4MA8L 5TF0A 2EDDA 5IMKA 4A6YA 2ZCHH 3PL6A 2P5WE 1OPGH 4M03A 2D0GA 3TFKC 5F1NA 2VL5B 4HZAA 1I4FB 2BVQA 5E2WH 4JZNA 3Q5YA 5ADPH 4QY8B 2G5RA 2MHAB 2NW2B 4CVUA 4XCCL 5AZEL 1L6ZA 4Y4KB 1IZJA 2LABA 4LLVA 4JLRA 3I6KB 3WJJC 3DIFA 2MCPL 2J6EL 4NHUA 3WXVL 1T66D 3RIFF 3EDDA 5LKNA 4WWKB 3SJVA 3QFJD 4JREB 2NY3C 3CDGA 4WW2F 3LB6C 2APTA 2JCCF 1HHJA 1JNHA 3QQ9D 4X9IA 3RUGF 4LCCB 3EYVB 5T1MB 1HILA 1EUTA 1R5WB 3LDBC 1VFBB 2BOCB 5EZJB 2H26B 4NQCE 3MV7E 4FFYL 3T0EC 5LQBH 1MCQA 4HC1L 4C54A 4Y5XB 1PKQB 4TUJB 3TN0B 4H0IA 4PJFF 3NFSL 4PJDB 3ZYJA 2FIKA 5C0GA 1FNGA 5IB4A 2RGSA 4G8IB 1WCQA 2IFFH 2C3WA 2EE9A 1XGTA 3ZKXB 2FSEA 1M71A 4DZBA 3C6LC 1N6VA 2JELH 3TFKD 1WWCA 3HLAB 4ONGL 2AEWA 4JPIA 5HDBF 1YEGH 4BZ2H 2JTDA 4PRPB 3EO9H 1XCTB 4PR5A 4NZUH 3T3ME 2PF6A 2FHCA 3W0WE 2W0KA 3QWOB 4R7DA 4OLXH 4P5TC 2BC4B 4LSTH 1TCRB 3DSFL 1KIUA 1U93B 4M5ZH 3KLAB 4M6NL 3SGEI 3WS6A 3B2UC 4ZS7H 3EOTH 5IBUB 5ILTL 1I1AA 1KLGB 5FO8B 4PB9L 3GGWA 2CRYA 1GRWA 9CGTA 2NY3D 2AJVH 2Y9RT 3O6FB 4XWGH 2Z0BA 2Q7YB 3LB6D 2R1XA 2RIKA 3F58H 1RQ5A 4M43L 5ESAB 5INCA 2D7NA 3FO9B 3B5GA 3GMQA 3KPMB 3C5SB 2ZOLA 1EO8H 3D3VB 3EOAA 4XVTL 1HDMA 1HHKA 5I1LA 3O0RL 1RIHH 2AJYL 4G5ZH 5KSAB 5D6DA 5LGHL 4P4RB 3JZ7A 3T0ED 4EUPH 1NCAH 3F12B 1KXTB 1UXSA 1IL1A 5T3ZL 1G9NC 2CKNA 3GSNH 1T1WB 5B3JF 3BMWA 4XNZC 4N9GB 5KVFH 3TVMC 4PJAF 4HKJA 3HE6B 4KHTH 3AS3A 1FAIH 3J7HA 3SDDC 3C6LD 4FQJH 3MLUL 4ODXB 3U36A 3CFEB 4JGJA 3GSVA 4V2BA 5HD8C 1YUHB 2F5BH 5CUSL 5IMMB 1AD0A 3MGOA 3O2WH 5KJRL 4GAYB 4I18C 4QF1A 2P5EA 1EVUA 5IJKC 2C3VA 3QEGL 3QCTH 3PWJB 1NCWL 5DJ8B 2F19H 4GBXC 4DN4L 2G9HA 1KJVA 3B2UD 3WIHA 3O3EB 4X6BB 3S88H 4MSWA 1HK6A 1A6PA 3TIDA 1ZLSH 4RCAA 3LN5A 4LMQE 5J0BA 3B43A 1ZT7A 3T1WA 3T2QA 5CKGA 2UZIH 3UTOA 4LCUA 3ILPB 2R1YA 5EZOL 3UJTL 2H8PB 4AM0B 4QTHA 4NNPL 4P2QD 3MUGA 4PRIA 4D9LL 3GO1L 5D7LA 1RZ8A 4PGBB 3K74B 1T1XB 3IDXL 2JKXA 3QQ4B 4OLVH 4N90E 3WHXA 5L88L 1G7JB 5GGVY 4GKZB 4R90L 3TVMD 2DJUA 2W0PA 1U8LA 1AXSB 3LQAH 4FQXA 3EW3B 2FECL 4YFDB 5TFSH 4M00A 4AENA 3SDDD 3ZZ1A 5I0DA 5EIIA 5HHOD 5HD8D 3CC5A 4LLMB 3BVNA 1MCEA 2ZUQB 4NQSA 4PJ5A 2A6KA 3QEQE 4JFDE 5AG8A 5E08H 3QJHA 3C5ZC 5D2NA 4ONOA 3IXTB 2JJSC 4U1GC 3REWA 2ZG1A 3QYCA 1L9MA 1AHWC 4WI7A 4YFEA 4G8GE 4LSPH 3S36X 1B2WL 1GZQA 1O7SA 3FQRA 2NX5D 4GBXD 3L5WB 5FM4A 3T4YA 3BZFA 2AK4E 5F9OH 2OZ4A 3RI5F 5D1ZD 3F7VB 2R56L 5DURD 1RZFH 1VKXA 4NCC2 2VLKA 3V5KB 5MP6L 2AK1H 2JK5B 3HZVA 1EUUA 4G6FD 3UTSE 2YUVA 5KVDL 3VGEA 2AV1B 1NBYB 3KNBB 2EDLA 2UUDK 4PGZA 4JAMB 4JQXA 3DRQB 2EE2A 4EDXB 1UH2A 1EBPA 2VDNH 2W0LA 2E7LC 2BVPA 4CDGC 1F6FB 15C8L 4QRUA 1KC5H 3SDCC 3DX7A 1JUFB 4P2OB 4HMCA 3FB8B 5FA3A 5JZ7C 3QI9C 5F21B 5EC1B 4EN3C 2BFVH 1S9YA 4UDUB 5DQDL 3S3PA 1YNLL 4M8QA 1WWBX 3NCEB 3RWGA 2FO4B 4XP1L 4K7PX 1ZLVK 1IGJA 3ECBB 2CIIA 3OX8B 1OAYL 2O5XH 1HIMH 5DTFA 2LTQC 5JORB 1EJOL 3LEYH 3C9NB 5IB5B 5C09D 2HJFB 1QFWM 3HC0A 4Z77B 2I07A 3QNZA 2JB6B 1NMAL 4NGHH 1NGQH 1MCPH 1PJ9A 3LSOB 2UYLA 3W9EB 2HFEA 1KUMA 3DXAB 1RPQA 4G42B 5EH1A 1D6EA 2VUOA 3F7YA 1S7RB 2JJVA 3DTXA 1Z5LA 3EZJB 4JB9L 3SHSA 1I7UB 3ALXA 5DC0A 1FRGL 3SE9L 2WANA 4WFGD 1CLZL 3N50A 5KZCD 1FPTH 4O02L 3QEUB 4BH7B 2FEEL 3UTQB 1EA9C 2X4SB 3QXAA 2X40A 4QLRA 5F7FA 5DRWB 3SDCD 5BJTA 3BZ4A 2R1WA 3WDHA 5JZ7D 3QI9D 1XF1A 1D5ZB 4EN3D 4M1GH 5GGQL 3AS2A 5EZIL 1RUAL 3P4LA 4P99A 1YC8A 1XGYL 3A6BL 1MEXH 2D7MA 1XGRA 1FZJA 2BOBB 2X1PA 3DX6B 2R0KL 2NR6C 5FOBB 2NY4B 5A2IH 1T4KB 4NNYA 5D72L 1ITBB 4K3JL 2DWDA 5E6IC 4XC1L 4X5LA 5I8EA 1A3LL 3P11L 1MWAB 4XBGB 5JHDA 3O6KH 4P5MA 1X5AA 4J4PA 2H9GB 3BQUC 3FFCD 2BSSA 4QYOB 4RMTA 4UDTA 2F5AH 3BWUC 1I7TA 1WZ1L 2P24B 3IJSB 2JIXD 3KYNA 4Y2OA 3B2VL 3I2CL 4TSBL 3PHQA 3LKOA 4OCYL 1FJ1B 3NAAL 2XWTB 1BJ1J 1WICA 1CL7I 3MV9B 4I4WA 1AGBA 4R4NC 3W9DB 4X4YA 3GBMH 5EO0B 4K3DH 3QIBB 4P9HL 1WV7T 3ETBF 1RIVH 4KJWC 1YEEL 1QRNA 4MNGB 3B3IB 4Z18A 3T0WA 3QFJE 4MLSA 4R4BB 1GPOL 4ZUUA 4ZO9A 2V5SA 4RZCB 1PAMA 3BJ91 1EJ6A 1NFIB 2IGFH 2J8UE 1J0HA 1UKSA 3IGAB 4RBPH 1JGLL 3MUHL 1A7NH 2GSGA 3DX8B 4LP5A 4OF3A 5ALBL 2XKNA 5DQ9B 3C87A 5JDSA 3ZYZA 4KK9C 4KI5F 5INDB 2NR6D 2A9ML 1C16B 4FQQA 1NEZB 2GJ6B 3JTSB 3BRGC 2A2QT 2J8HA 3MRGA 3QNYB 4EXKA 1ZWIB 4HDIA 4GW1B 2L0DA 2DQJL 4O2CB 4RMQA 4RGNE 3BQUD 5C6TL 1F3DH 3DROB 4FQIL 4Y19E 1VHPA 3DV6B 1ZV5A 2Z8SA 3W81A 5GS1A 4P2RA 2C4XA 2I9TA 3ZL4H 3VG0H 2CDEA 4A6YH 4R4ND 1U8NA 5TPWL 3QRGH 1JJUA 5GS0L 5BZDB 1MQKH 2EKJA 4MHHG 5BXFA 5I1KL 4LK4A 5IW6B 2IAMA 2IG2L 1BF2A 4FNLH 4KJWD 5TH2B 3SO3B 3NFNA 5GGUA 1HKLH 2BVTA 4QHKI 1J8HD 3BWAA 1NDGA 1V3LA 1MVUB 1RZJL 3F7PC 3QDJA 3JUZA 4JGMA 3T0BA 1KIPB 2LV4A 2CPCA 4M7JH 1G7MB 4HEPG 2Z91B 1MCOL 1J86A 5T5FL 1I8KB 3BD4A 3FQUB 2IALB 3GRWL 1T21A 3DBXB 1KJ2B 3SKMB 1QA9A 4KK9D 5A3ID 3LMJL 4IJ3C 4ZXBC 4P2YA 4WDIB 4NO0D 1F97A 3QH3A 1UWEL 3LKNA 4OIIL 3MOQA 2VNCA 3UC0L 1E4WL 4BFGA 5ESQA 4HFWB 3MV8B 4JFFB 2Q6WB 1IC5H 1II4E 1QRKA 2H6PA 3HMXH 2F54B 4Y4HC 3ROOA 5SWSA 3CFCH 3OAZK 3N9GL 2GAZB 1F4YH 1I3GL 1ZHBB 2W65B 5D1QC 5C0EB 2PNDA 4KY1L 1ZTXH 4F9PC 2QQLH 4Y4FA 4PTUA 5FKPB 1OGAB 3F7RA 2EDHA 1CIUA 4OM1H 4ODVL 3H9HA 1SQ2N 4MNHA 1A6AA 4IDJL 1KIQB 2Z93A 5KN5A 5KS9E 4GRLA 3CVHL 2QL1A 2ZCHL 1BQHA 4X9BA 2DKUA 4XP6H 4ZAKA 5CJXC 1JV5B 1A6TB 1EERB 3W5NA 2PXYB 1ZA6B 4DGYH 2DQGL 3MNZA 5ERWA 2IQ9L 2PO6B 1NLDH 3HNTH 3DVFA 2PW1B 1K8DB 1W72A 4N0UB 4P2QE 5ICZB 1VGKB 1QFOA 2XKSA 1MCWM 1MQ8A 4OGYH 5TDOB 1DQQA 1QLEH 1UB5B 4I3RL 2ZNWA 4ZXBD 2VERN 3MJ7A 4MDIA 5IB2B 3CFDA 2YSSB 4YIQB 3MA9H 4HX1B 4PJ8B 4GMTH 1CT8A 1NSNH 2R23A 4MVBC 1SJXA 5HHOE 1TTGA 2XT1B 3N1PC 1KN2H 1EGJL 4IIQA 3VD7A 5EG6C 5ALCL 2D31B 3JWNC 4Y4HD 3X17A 5HYQB 1DN0A 1ZGLB 2JJUA 3LKSA 4KQ3H 4Q9BA 1HKFA 4R97B 5D1QD 5IFHL 3ARDB 4XTRC 5D9SA 2WBJB 1HCVA 2NX5E 4OTXL 3D25B 3PWNB 3CSPA 3OKNA 1BM3L 4X7FC 3G08B 2IFFL 4QRQA 3CMOH 4ZFZA 1SEQH 3SGDI 2WIMA 2JELL 4TOYL 1FYTB 2YPLB 4PGEA 4BZ2L 3SEPA 1INQA 3DUSB 3OKYA 5EIQA 3PL6C 2XQYG 5DRXB 3CZFB 3QCVH 3WIHH 4JPKH 3PWPD 5ICXA 3PP4H 4LSTL 3MLZH 4BQ6A 5C0FB 5TE7H 3KPSA 4HZLB 5F7NC 4HS6A 5I1GH 3BZDA 3SE8H 1BD2D 3T0VA 3BFOA 3IJYA 4X83A 3IDGB 1FL6A 1QUNA 2QKIB 3QDMA 4B7IA 4BSWB 2DYPD 4YHNB 1G7QB 4MVBD 1X5FA 3O8XB 5LBSH 3F58L 2CK0H 1TFHA 4HH9B 3IXAA 5C0AA 4GW4B 4BQ9A 5LGKA 1EO8L 1LK3L 4PRNB 3ZDYE 1X5LA 1OT1A 1RIHL 1ZLUH 3GSQA 1NCAL 3JTTA 3MRKA 4IS6B 3VFVA 4XTRD 4YEFA 1BBJB 2DJSA 2RCSH 3GSNL 4BQCA 4HBQA 3TV3L 1A14H 1KB9K 3IFOA 4ZPVA 3UO1L 5KVFL 1G9MC 4KHTL 1FAIL 5CZVH 3VFRA 1C08B 5KSBB 4LVHC 3ZSTA 2Y25A 4Q9QH 1F5WA 3HFML 1RUKL 5E2UH 2E7CA 4NN5B 2UY6A 2F5BL 4FQHA 32C2B 5FYJH 3PL6D 1RIUL 1YN6A 3EO0A 1B3JA 2PYEA 3O2WL 2PETA 2BY3A 1HHIA 4KJQC 4M62H 2OZ4H 3BSZL 1H8NA 4OBRA 3EOBB 4OZFA 3QP3A 3WFBL 4HWEL 3H0TA 3KLSA 4PJXE 1MSPA 1QFWI 3D9AH 2H2SC 2F19L 3CCHB 3MNWA 3EYFB 3SKNB 1LK2B 3UBXB 4KTDL 5CEZL 5CAYB 1AD9B 5C70A 1NFDA 1ZLSL 1WZMA 3WS6C 4S0SD 5F7LB 3OJDA 1I1AC 4JFZL 3SJVD 2UZIL 3TNNA 2VR4A 4AH2A 5HHVH 4KXZH 2BNQB 5H35B 3VFGL 4P5KB 1EEYA 1WAAF 3OAYH 4KC3B 4H20H 4WHYH 1IGYA 1A6UH 4P46B 1X7QA 2Q87A 4AIZA 5IBTH 4KUCF 3FFCE 1P7HL 4LLYA 4EEEA 3MRMA 3C08H 1LO5A 5D6DC 5IB1A 1QSFA 4JFXA 2V2WB 3JWDH 5F6HJ 4Y5YB 4B53A 5DJXB 3MRBA 3BYTA 3LQAL 2CMRH 3BAEL 1U8OB 4P3DB 4LCIL 4DUXA 3PHSA 3UCRA 1DE4A 1HZHL 5E08L 1ONQB 1MY7A 5B38B 2X4NB 2GEEA 3BP7A 4KJQD 4ZPTB 1W8NA 4APQB 3S4SG 3IAGC 5DK0B 4JJ5A 1I8MA 5EA0H 2Y6SC 4L8BB 3VXSB 4L8DB 4JDVB 2HJKB 3ULVL 2H2SD 3AB0C 1B0GB 1Q1JL 4RFEB 2R9HC 5F9OL 2VLMD 1DCLA 1LEGA 4Q2ZB 5FCUH 2HWZH 3QT2A 1T5WB 1CFQA 3HRPA 2UZXB 3D5OF 1I1AD 2AK1L 1T83A 4UMGA 4YBLC 5DHVB 3IT8D 3TCXA 3U7WL 4LLWA 3DUUA 3V6FA 4XHJC 3GSUA 4GRWH 1FIGH 2JF1A 3EDKA 3SQOL 2R15A 2Y4SA 1RUML 5ICYA 1NCUA 4GT7A 5I66A 5DUMH 2JJWA 1FL3A 1KC5L 1HH9A 2FHFA 3TZVA 5IFJA 2ADGB 2VSDA 1WTGT 4G8EA 4HWBL 2BFVL 3FAWA 1FVDA 4GKNA 4OD1L 4G9FE 3T2NH 4JQVC 4FQXC 3R1GH 4U0RB 5KVEH 4MNQB 3VXPA 1KENH 5IKCB 3MRQB 4J3XA 4J7RA 1J8HE 3FZUC 4MJIE 4H25A 3P0VH 4PTTB 1YMHB 2A6DB 3O9WA 3QSKB 3HCVB 2Y6SD 3SDXB 2ESVB 5F96H 5C2BH 4WEUD 5L6YL 2R9HD 5E8PB 2P5ED 2QSQA 4NGHL 1NGQL 3ZE2F 1DBJL 5J06A 5BO1L 3GJFA 1AGEB 4QWWC 1G84A 5DVKA 4JM2B 4N0FB 5JIHA 4X0KA 1T03H 4ODTH 4XHJD 3SCMA 3WDJA 3FRUB 4PBXA 5CGYC 3HZYB 1U92A 5C9JB 4Q9CA 4NC1C 1FPTL 2IPTL 4PJBE 5T33L 2BVEA 3WLBA 3MCKB 4PRID 2Z92B 2Y5TA 4X7SL 5D7LD 5KTEH 4YR6A 4Z7VE 1LE9A 4M1GL 1I9JL 3G9AB 1XZ0A 5DJCB 4NQVB 3DOSA 4FQXD 3L3JB 3G5ZB 1QSEB 4XI5D 3U0WH 5I18H 1P6FA 3FZUD 1AFVH 1WFNA 4PJ5D 5IQ7L 3JWDC 1U41A 3DURA 1B9ZA 1HQRA 4YQXH 3ORJA 3RWJA 2B39A 3BW9B 5IR1A 2F5AL 5CEXA 1QO3A 3QO1A 3GB7A 5FYJD 4PB0L 2GTWB 3AM8A 4UT6H 4QWWD 2IBBA 2J88H 4X6DB 1AJ7L 3LRSB 3GBML 4GH7B 4BKLA 3QO0A 4F7TA 1M4KA 1LEIB 4K3DL 2IPUG 4DOHB 2VLKD 5KSBF 1RIVL 3H9SB 5E0QA 4RNRA 4KI1A 4O2FB 4D8PA 5CGYD 4I2XE 2XWJB 1WIPA 4CN1A 5B39A 1JMZA 5SV4A 4F2MA 2AJZB 3PDOA 5JW3H 1G7IB 4B5EA 5GQBA 1RD6A 2CDFB 5GSRB 4YXLH 1KT2B 4JY5H 3OWEA 3B6SB 1T5XB 3IB4A 2APVA 3HS0A 4GKSA 1D5MA 4IHOB 2AXGB 1TZIA 2A9NH 5K9JL 4IRSB 4Z7WE 4LCYB 1HEZB 3CXHK 4HUWA 5SWQA 1CD1B 1PVHA 1K6QH 5EBMA 3OGCB 5ETUB 3EUUA 3OKOB 5F6HI 3V7AE 3TT1H 1ETZA 4NQEB 1M7IB 4QGYA 5BW7A 4Z7OF 3F7QA 5MI0B 4U1LA 3VFTB 4YAQB 5HY9B 5D2LB 3DPBA 5E8DL 2VLJB 4J4PC 3MACL 3SGJA 3PWPE 4YFLI 3ZL4L 3VG0L 2H2PC 4A6YL 1Q9LA 5IV2A 3QRGL 3LS4L 5HGDB 2Z4QA 1ZA3B 2Q86B 3BPLB 2VDLH 4FNLL 1YYMH 2HVJA 5IMLB 1HKLL 1FZKA 2EIZB 4DVRH 4UU9B 4XAKD 4O58H 4RRPG 2VDQH 3GEWB 4NJ9H 1MLCA 1MFCH 5F3BB 3HI6H 2EH8H 2YEZA 1E6JL 2YC1B 3GSXA 3HA0A 5FYKH 3JV5A 3RX5A 4RDQG 3ZTJG 1O5DT 3BN3B 3BISA 4WO4B 3ET9F 4U1HA 4CADA 4LCWB 4O51A 4EIGB 3FFDB 5L2KB 3LOWA 2Q76A 4NUJB 1IGMH 2X4PA 4DN3H 1A9EB 1F11A 2VXTL 1IQDB 2C1OB 3HPJA 3VE0B 4LAQH 4OJFL 5AD0A 1IGIH 4ZO8A 5J13C 1QR1B 1AKJA 1BJ8A 3R4DA 3VXTB 4ZD3H 3HTLX 3LKRB 5JHDD 5KVGL 4J4PD 5J6HB 3HMXL 2CKBL 2H2PD 3GI9H 1S7QB 1JPGA 3GMMA 1ZTXL 3J8F7 1NC4B 1BVLA 2QQLL 4TQEH 5GS1C 4OM1L 5F1OB 1IMHC 5ID1A 4KKBC 2K1MA 1LQSR 1Q94A 4XP6L 1P1ZB 4OBSA 1HQ4A 2IAMC 2OL3L 1QRND 2V17H 4PRDB 4DGYL 4E0RB 1HHGB 1NLDL 1YNTB 2HFGH 2ADIA 3HNTL 1OCWL 3WFDH 4Y89A 4BUGA 3SDXF 3V6ZB 1BWMA 2GK0B 4I1NB 4ZFFA 3OMZA 1UACH 4Q6YA 1JRHH 3BP6B 3P4OA 4OGYL 5DZLA 5BZWA 1RHHA 3EKCA 3EO1B 4TN9A 1PQZA 2ZOKA 3DVGB 1P2CB 4GMTL 3HUJA 1NSNL 3RWIB 4X6CB 3FQNA 5JXAH 1KN2L 1IKNA 2AABH 2P48B 3E2HC 5FO7B 1G0XA 3UZEA 3T8XA 4X6FB 4UNVA 3QUZC 5JLZA 4FXGB 2OP4H 3T2OA 1UZ6E 3ZKSD 4P2RD 5JO5B 4BSVA 2VH5H 3TP4A 4K8RH 4WHCA 3VRLE 5FB8B 2FL5A 2WUCH 1YY8B 5I2IB 4YEEA 5D7IB 3IU3A 2VLME 4KKBD 4Y4FC 5DYOA 5A16A 1PYWA 1JNNH 3MRHA 3CMOL 3ARWA 2IAMD 4Q7DA 4OZFH 4O4YH 3RNKB 1GZPB 5ISZA 1R3IL 2ITCB 4GG8A 4GRLC 2YN5A 1W0VA 4ZAKC 2FYYA 1BBDL 4F7MB 3RVUD 1VGEL 3QDJD 4L4VB 3PV7A 4OAWB 3MLZL 1QQDA 1OB1B 2EC9T 4MCYA 2GT9B 5DDHB 3B9KC 1NDMA 5I1GL 4RQQB 2R2BA 5K93A 1OAKL 4JN2B 3SE8L 4X6DF 4GO6B 1T04A 3KPQA 3NGBC 1FG9C 2W9DL 5GRZA 1KCKA 3NFPB 1DTUA 4CU8A 1CGYA 1F8TH 1LP9B 4HUNB 2APBA 2C3HA 3FTGA 4HIXH 5F9WB 1JN6A 2CK0L 4RAUA 2P8PA 2R29H 5DJ2A 1ZLWH 3GJEA 5DSCA 2FWOB 3L7FB 2YK1L 2APWA 2R0ZH 2VDKL 2ILLA 2ZSVA 4GLRH 1N4XH 4L3EA 4Z95H 4TSAH 4IIQC 4PJIB 3F5WB 4X80L 2RCSL 4K94H 5SWSD 1ORQB 1T6WA 5DD5H 1A14L 1FLRL 2NPLX 3O3BB 3TBTA 3X14A 3G6JB 5I74B 4Y4FD 1EO7A 1JI2A 5CZVL 3UMTA 4W70A 5EPMA 4Q9QL 1U8QB 5KSVA 4GRLD 2NXYC 1UZ8A 4YE4H 4ZAKD 5EBWA 4AEFA 4LPVA 5IVZB 3BGFC 4M62L 3BPOB 5I73B 2OZ4L 3WNOA 5D2LF 3DARA 2DQUH 2ZSWB 2UZYB 5E5UB 3P40A 3OXRA 5IVNA 1FO0A 4U7KA 1EEZA 2PYFB 4QHNA 4MLIA 4PIRF 4YC2B 3U1SH 4FXKB 3BOVA 4H1LH 5D7LE 5I8KH 5CJOL 3V5HA 1CFTB 1NLBH 3V5DB 2DLHA 3PGDB 1MHCA 4B50A 1HOCB 1WFTA 5FYKD 3SKOB 2VAAB 4GS7C 4QXGH 5E2TH 5E9DE 1P5VA 4IRJA 5D70H 5CGMA 5ANMA 3KHOA 3MZGB 1UM5L 1W0YT 3TYGH 4H20L 1LVEA 3X13B 4PJ5E 1IAOA 1FN4A 3TYFA 3VRJA 5IBTL 3R06A 4YHIA 5D2NE 3G5XB 1QYGH 1A6WH 3U30C 4JKMA 1AQDA 3C08L 5CILL 4P9MH 5E8EB 3U4EA 1JZ6A 3VFNB 2GITA 5E5MA 1XF3A 3JWDL 5HJ3B 1FCCA 2I27N 5FYJE 5LAXB 1FL5A 4X9FA 4KVCH 3KPOA 2CMRL 2ERJB 5LGJA 2VO5A 4LHUB 2F8OA 2NW3A 4DGVL 2FJFA 4JZJB 2NXYD 4XC3H 4YXHH 2VLKE 5FA4A 3I75B 3UTTA 1NMBL 1VEMA 5DD1H 2V5MA 4K8RC 1ZHKA 2HKHH 1V5JA 3GJFH 2QQKH 5EA0L 1OF2A 3O45A 4XCNB 3JWOH 3HAEA 4M6OH 4PRBA 3RDTB 4M1DH 3CK0L 3K81A 4Z7QE 5EOTB 3FOMA 1IJ9A 3KPSD 5DLMH 4HPOH 1V8HA 2B1AH 2HWZL 4DKFH 3TH3T 5I17A 1ZHLA 4RBPK 2GIYA 3MR9B 4FFWC 1JNLH 4JY4B 1UKQA 4HGMA 3UPRA 1T3FA 3H9YA 3QDMD 1U58A 2B4CL 5E00A 4KK6C 3RHWF 1HHHB 3MV11 2KZWA 1YN7B 2W38A 4HJGA 5EWIH 1VB9A 2A77L 1FIGL 1VERA 5C0AD 1CZ8H 4L29B 3SBWA 1ITCA 1MFEH 1AP2B 5DUML 1X5HA 2XWBA 3O3AB 5TE4H 5GZOC 3PJSA 4DUWA 3BHBB 1MHEB 5DJ0B 2DKSA 4Z7NF 1FG2B 3HZKB 4OZHA 5C0BA 1G0YR 3NIFF 3PABB 5GIRA 5ADOH 3ARYA 2DI7A 2C26A 3LKPB 4MHHI 4Y1AB 4HUUA 3BE1H 4XCFH 1AGFB 1I8LA 4HIIB 4K94C 4XAKE 4ALAL 4K8RD 1KCUL 3P0VL 2PTTA 3SE3A 3MV7B 2PYED 5I15H 1E4KC 3QG6A 5F96L 2VYRE 1P4BH 4DW2H 3PWUA 2ZCLL 3IFPA 4MJ4A 3BP4B 3QAZB 3O6LH 5IG7A 2YRLA 4X6EB 1V7MH 5DMYA 4FFWD 3QHZH 1NBZB 4HWZA 3SPVA 3INUL 4GRWE 5C6WH 1GIGL 4KK6D 2BCKA 5F1IB 5JNYB 5J6GA 2XPGB 5GSVB 5J89A 1T83C 3W0WB 4C83A 1NCTA 1QBAA 4HD9A 3GSRB 3HR5A 4BJLA 2ICES 4YDIH 5D1XC 1VFOA 4E41A 3AU1B 4UOW0 1MFNA 2OLDA 5JHDE 4J3WA 4HKBA 5HBBA 3GBLA 4LVNC 5GZOD 5KTEL 4K7FA 3VFPA 1YMMB 3E8UH 5FKAB 1CICA 3RNQB 3KJ4B 1QSFD 2JCCA 3BEWA 1DQJB 3DYMA 2F74B 2Z35B 2YA1A 5SV3A 3IS1X 1LO0H 1S5HA 2DTML 1LP9F 1JZ5A 5F7WC 3TBWB 3D0VA 4OCNC 3U0WL 3ZSSA 5I18L 4JO3H 1C8PA 3IAQA 5KG9A 2NZ9C 3RWDB 3MJ8B 2HVKA 1B4RA 2V2TA 4PJFA 2XG5A 1QRNE 5HHQB 5C6PB 1S5IL 1U2HA 4TUOA 3MRLB 1MJ8H 3O9WC 4U33A 4JFHD 3AXLB 3CU1A 3PGCA 1KTKE 3QXDA 2J88L 4WWID 2EYSA 1INEH 3U2SB 3QQNA 1HI6A 4YDVB 1KCVH 4MAUL 1MUJB 3STLB 4E5XA 2MQ0A 3BDYH 3JWOC 2ARJA 1XF4B 3CFBA 2UWEA 4WUKL 5I76B 3WE6B 2IANB 4Y8AA 8CGTA 4GRMA 5EBLA 3SCMC 5JW3L 1F4AA 4YXLL 4FN0A 4F8TA 1JWMA 2E6JA 4OD2B 4JY5L 1UJ3B 2SEBA 4Z0XB 4U3CA 1T1YA 4F15C 4MMXC 1FFOA 2HJLA 3L6FB 4P2RE 3TZVD 1U0QA 1NANH 3TO2B 1JVKA 1T2QH 1I9IH 3VXMA 1KG0B 4PGCB 4L8SA 1BZQK 1K6QL 1X3DA 3G04B 3UTZB 3MRIB 5EUOF 2NZ9D 3ZDXF 4XX1G 4JO4H 3TT1L 3RZCA 3CDCA 3MC0A 3K4AA 3TGXA 3O9WD 1Y18A 1ZT4A 2W9EH 1HXYB 3QDJE 4I77H 1N26A 2HFFB 3KXFA 2CQVA 1MIEH 2IH1B 4WIQA 1A9BB 1I7RA 1N2RB 4QTIH 4WTZA 2VDLL 3BKMH 4OLWL 4EIZC 3BYYA 3A67L 3AM8C 3QEQB 1YYML 1AGCB 4CMMA 2VIRB 1MAKA 1I8IA 3BH8A 3O4LA 2CIKA 5TQ2H 4G7VH 4TRPH 4OCRH 3IF1B 4G8GB 3WO4B 1MFCL 3HI6L 1YECH 3SCMD 3W39A 3IFLH 3K1DA 3FKUS 4M5YH 1DANU 2AK4B 3EAKA 5I1EH 4GXVL 4NBZB 4PJEE 2AJXH 4JDZB 3BPNC 1OWWA 3O2DA 3VFMB 5IW3A 3H7BA 1ZLUK 1MCIA 1BVZA 3JBG7 2FHBA 2NY0B 2EH7L 4PJHE 1XMWA 3WS3B 2J2ZA 1YPZA 3UTSB 4DN3L 4OKVB 4UT7H 2CH8A 4HJ0C 3L95B 1RJZB 2IF7A 3T0DA 1VFUA 1U6AH 5KW9L 1F3JB 5FF6B 1IGIL 4LPUA 4ZD3L 1XEDA 3VRIB 5DT1H 1KB5B 5K59E 4XPTH 5FO9A 4NO2B 2I9LB 4X99B 4XXDA 1IGFL 1E28B 3GI9L 3S96A 4JZOB 1UWGH 5JUEH 3SGJC 5DS8A 3HI5L 1WFOA 1C5DA 4O5LH 3FQWA 4F7PB 2X4RA 1UM6H 4H5SA 3C60B 2W9LA 4S0TD 5F3HB 3VXNB 2CDGA 1DVFA 3VXQB 5D7JB 2WLYA 4XMPL 4ELMB 2YD1A 5J1AA 3W2DH 2HFGL 5JXEA 1NQBA 5TDNA 3E6HB 4JRWA 2XFXB 3NIGE 4UB0H 4QHLA 3NPZB 5MEOB 4P23A 4PREB 3OAYK 1N59B 4UUJA 5AAMA 4DGIH 3K80A 5J12C 3KLDA 5D4QA 3K7UA 2VL5A 3AMLA 3BEVB 1I4FA 3WFCH 5AUMA 4HJ0D 2ZNXA 1MELA 4JFPA 2DN7A 4QY8A 1CE1H 3GSOB 1YY9C 1B88A 2VXSH 2W0FB 3T3MF 2MHAA 2NW2A 5ID0B 5F6IB 1Z0NA 4Y4KA 1AI1H 5E95B 3NTCH 5T1KB 3I6KA 1G7PB 5L9DH 3ARGB 3VW3L 4HIHB 4ODBD 3NCJH 5HYJB 4WWKA 2X4OB 2ZWLT 1QFUH 1IC1A 4K8RL 2YUXA 4KZDL 3KLHC 4UNUA 5C0IB 2WUCL 3RA7H 2IPKA 3KPSE 3MRPB 3FB6B 4HBCH 3NMEA 4L9DA 4LCCA 1H15B 1JNNL 2DLGA 3EYVA 4FQLH 5T1MA 1L0QA 4WI9A 1OVZA 1R5WA 2BOCA 3RVXD 4U05A 2H26A 4O2EB 1FO0H 5HXMA 2EKSB 3QDME 1PKQA 4TUJA 3TN0A 4OLUL 5EORL 4PJDA 1A7OH 5LVEA 5C0AE 3L3GB 3OKKB 3U0TB 4G8IA 1JZ8A 3P3YA 4NZDA 25C8H 2CD0A 1REIA 4HKZB 2OYPA 1N6QL 4Z0BH 2AP2A 5EULV 4R26H 1DEDA 3HLAA 4NC2B 4OZGE 1CQYA 4JRYE 4Y88A 4YDLC 1NCNA 4PRPA 5CSZB 1SHMA 1XCTA 2CUIA 4S1SH 3DO3A 1YY9D 1H5BB 1YYLL 3QWOA 1S78C 2N4IA 1OAUH 1G7HB 2BC4A 4U2ZA 1TCRA 4OF5A 3H2WA 1KCRH 1NUDA 1U93A 3KLAA 2B2XH 3QDGB 4UV7L 1AKJD 4LEXH 1MLBB 1IKNC 4Y16B 4Z95L 4KGJA 2Z31B 1WBYB 1R5IA 3KGRA 4YHLH 4XP5H 5DD5L 1ACZA 3ZTJH 3O6FA 3BT2L 3SGKA 3KLHD 1ZAGA 3ZE0E 1P84K 4YHPB 5ESAA 3IU4L 5GGRA 3FO9A 1YC7A 3O2VH 3C5SA 4WUUB 2DQHL 2EIBA 3D3VA 5KSAA 1T2JA 2EYRA 4RGNB 5E2VH 5C71A 4P4RA 3HAEH 1NFDE 4ZOBA 3ARXA 3F12A 4K9EH 3D39A 4YNYB 4Y19B 1XR9B 1T1WA 1UEMA 4HKXA 4N9GA 3HE6A 5C0DB 5I9QB 2GY7B 1JWUB 3PWLB 4B0MM 4ODXA 1MCFA 1OARH 1QKZH 3CFEA 4FS0A 3QQ3B 2BVYA 3O11A 1YUHA 5IIEB 5IMMA 3ESUF 4NPYB 4WTXA 1NLBL 4KRMB 1QSFE 1W8OA 1CFSB 4GAYA 1S78D 2XTJC 2AJUL 3IDYB 1NEZG 4QXGL 2DJ4A 4ONHB 4LDEB 1VFAB 1E4XI 3PWJA 2X5PA 5DJ8A 2P4AB 1E6OH 4UILH 4X6BA 2DQIH 4XVSL 3LPGA 1QYGL 4JKPL 3FN0H 3KPRE 2BMKA 1WC7B 4JFHE 3EOYG 1BLNB 3PP3H 5F88B 3ILPA 1U3HC 4G8FB 2H8PA 4AM0A 3GHEL 3H7LA 4MD0B 2XIDA 4YXHL 2IQAB 1QP1A 1TQBB 4PGBA 3QQ4A 1T1XA 2CRZA 5DD1L 5ISZD 3QEHB 2X4UA 4EXPX 1G7JA 4I13B 4GKZA 3CH1B 3B4NA 2QQKL 2DB8A 1JE6A 1AXSA 4LSUL 3JWOL 2AV7B 1A0QH 1J10A 2WK2A 2NMSA 3OB0H 1NC2B 4LLMA 5AYUH 5KS9B 2B1AL 3WXWH 4M8VA 3WFHB 5HI5C 1JNLL 2ICWI 3IXTA 3MLTB 2XTJD 1A6VH 1ROWA 5HTSA 1D5XB 1KPUB 3HE7B 4ELMF 4PJCB 3L5WA 3MJ9A 3GMNB 1CZ8L 1CIDA 4IRJC 4V2CB 1DUYB 1HXMB 3O4OB 1MFEL 3V5KA 4L3ED 2Y36L 4XNQB 5TE4L 4OCSH 5TQ0H 1TZGH 1T1ZB 1NBYA 3NA9H 3KNBA 1J0KA 1F4HA 4F7EB 1X9QA 1YDPB 4NKMA 4JAMA 1TXKA 2NY5H 3DRQA 4BFBD 4EDXA 4XCFL 1SM3H 3RIAK 3D48R 1ND0B 1UCTA 1FSKC 1P4LA 2W60B 1EHLH 1JUFA 3FB8A 1AO7B 1A7RL 3HNSL 5E1AA 5EC1A 3CVHB 4CJ0A 1HH6A 4DW2L 3E0GA 3PDGA 1JHTB 4PY8J 2AJSH 4UDUA 2UV3A 4XCEB 1SYSB 5D1ZB 2KH2B 2X10A 5HI5D 3ECBA 2VC2H 1FE8H 3K8KA 3OX8A 4WI2A 2GUOB 3THMH 1DFBL 4G43A 5A2LH 3V0VB 4LVEA 4F3FB 1I85A 2AEPH 5JORA 3C9NA 5IB5A 3MRJB 1IAMA 4OF0A 2HJFA 5DMGC 1RFDH 1K3ZA 3WFEL 5EZLB 4Z77A 2JB6A 4IRJD 5HGBB 4YDIL 3KHQA 3LSOA 3W9EA 4NYLB 3DXAA 3V79C 4G42A 4PUBL 4R9HA 2C7UB 2VDML 2QADC 1S7RA 4R2GC 3SBWC 5FUZH 3RQ3A 1I7UA 3E8UL 3GI8H 1A5FH 3QDHA 4YDKL 1DEEB 3BO8B 4S1RH 1I1YB 2BNUB 2PCPB 4X5XB 5BV7H 4JO3L 3QEUA 4BH7A 1OAZL 3UTQA 4YPJA 2FJGB 4OLZL 2J8UF 4X7EC 3UTTD 1D5ZA 1I8LC 2A83B 3SKJH 3MFGB 1U95B 4ZSOB 3SE3C 1MJ8L 1NEUA 3DX6A 5FOBA 4HIEB 4MX7B 3U0PB 2C9AA 4PV9B 1T4KA 5B8CB 3MYJB 1RZIB 4MXVE 3OSKA 3REVB 1INEL 5DUBB 3KYOA 5DZOA 1X6LA 4XBGA 2GSIB 3JSSA 4HUMB 2H9GA 4BZ1H 2DD8H 5DMGD 4QYOA 4KQ4L 4U6YB 5C0JB 2P24A 1QD0A 3IJSA 1AC6A 5DD0H 3O2DH 1FJ1A 4LDOB 1OD7A 2QEJA 2XWTA 4O00A 4PJXB 3MV9A 4FQ1H 1MF2L 4OCXH 4YHKH 2QADD 3AFLA 3OJVC 4R2GD 5EO0A 4KAQL 3DI2B 2ICEA 4HSQA 4JANB 4MNGA 1OLZA 4OQTL 3B3IA 1ZANH 5DRZB 4R4BA 1T2QL 1NKRA 1CICC 2AQ2A 3FT4B 4RZCA 5C0BD 1MI5E 1GGIH 1RK0B 2X09A 3HC3H 3DGGB 4HGWA 1I7ZB 4JO4L 3IGAA 1T80A 4NN7B 1QPXA 3ZTNH 3DX8A 1SY6L 2XXMB 5DQ9A 1PZ5B 4M7ZC 2Z9TA 2PW2B 2W9EL 5IJVB 5INDA 1C16A 2WQRA 1NEZA 1ZE3C 1TENA 2GJ6A 3JTSA 3QNYA 1Q9KB 5EO1B 1ZWIA 4GW1A 4O2CA 3UBXG 1GGCL 4QTIL 3BKML 3S35L 3HG1A 4LU5H 1MCKA 3OHXB 3LD8B 1NCCH 1IM9B 3DV6A 5TQ2L 4G7VL 4KJPC 2WP3O 4TRPL 4OCRL 4ZTPH 1I9RH 1DQTA 4UTBH 4LSRH 4YZFE 3VWKB 4U1IB 2YZ8A 5BZDA 4M5YL 4E41D 1ZLWK 3T4AA 5IW6A 5L8JB 2AJXL 3QUKB 2V9RA 5TH2A 1ZEAL 2D9QB 1A64A 1P7QB 2D7PA 1WIUA 4XMLH 5KS9F 2HT3C 1MVUA 1CICD 2ID5A 1WAAA 5I19H 1KIPA 1YEHL 1G7MA 3GMRB 5EOCL 2M26A 4MS8C 5CJQH 3MFFB 1MFBL 2Z91A 3EJYC 2WSKA 3VMOA 1I8KA 1S7WB 3FQUA 4L8SC 5B38G 2IALA 5DT1L 3DBXA 3D6GA 1KJ2A 1A21A 2XYCA 4XPTL 3SKMA 1TQCB 5CMAB 2W1NA 3IDJB 3QUXB 4M4PA 4U6VH 3RZCC 3WIFB 4WU5B 1X5IA 2VABA 4WDIA 3L3DA 1UH4A 4V1DE 1UWGL 5BV7C 5JUEL 3BN9C 4G9FB 3UJIH 3UZVB 4XBEH 1EHNA 2BHYA 1WIOA 5CD3B 4HFWA 1FFNB 5J11B 3MV8A 4JFFA 3G5YB 3I3EA 4HWNA 4KJPD 4MJIB 2Q6WA 4U6XB 2VXQL 3MODL 2F54A 4LKXB 3H3BC 1UXWB 4HPYH 4Y8DC 1ZHBA 2AAVA 2W65A 5C0EA 1R24B 3HUJE 1JGVH 4PS4H 3B5TA 3G6DH 5FKPA 1OTSC 3C09C 4UB0L 1OGAA 4AT6B 5L0QC 4WI3A 1KIQA 3QPXL 1OSZB 3MLWH 3DLQR 2HT3D 1JV5A 2CLVB 1A6TA 1YEIH 1WWAX 2IADB 2PXYA 3WFCL 3QR2A 1ZA6A 3S36L 3TBVB 2PO6A 2X1OA 3TM6A 2VLRB 4MS8D 3EJYD 3VXMD 2PW1A 3VH8B 1KCLA 1K8DA 4CVXB 4N0UA 4HK3N 5ICZA 2L4OA 4PJBB 3IS0X 1H0DB 1MCNA 1AI1L 5GRVL 5TDOA 5L9DL 5ISZE 2YBRB 1UB5A 3RZCD 1VPOH 2XZQL 1PEWA 4ETQB 1UG9A 1MRCH 1I1FB 3QA3B 2YSSA 1UEYA 3TT3H 4S1QH 5CINL 3BN9D 4PJ8A 1IAIH 3GJFK 2C3GA 1MNUH 1TJIL 3UEZA 3CAFA 3OJ2C 3KXFD 2ZUUA 3ARZA 1EIBA 3ARFB 4FQLL 3QUYB 1B90A 2D31A 4PJ7B 3DWTA 5HYQA 3ZDYF 3KS0J 1ZGLA 3AY4A 2RB8A 3VCLB 43C9B 2UUDH 1FO0L 4TNWK 5TJWK 2X4TB 3O4LD 1DVFC 2VMFA 1OTSD 2WBJA 4IRZH 3PWNA 3FJTA 5JXEC 4K7PL 2E27L 2EYTB 3G08A 1SJEB 5T5NF 4YBHA 3SDAA 3FQXB 1ULVA 4IMKA 1QNZL 4L3EE 1PG7W 4P23C 4KZEH 1FYTA 2YPLA 4FHBD 3C8DA 3MLVH 1QBLH 4S1SL 3CZFA 5DRXA 2ENSA 2GKIA 2MJWA 4I2XB 4Y2DB 3K4ZA 3TCLB 1OAUL 1WSST 3RWHB 4H8WL 5C0FA 4HZLA 2B2XL 5FHBH 1F6AB 4XAWH 4PJXF 4Y4KC 3S4SB 1TCMA 3GKZA 2EE6A 1FNSL 4PP2B 5IFAH 4OFYA 3L5JA 3IDGA 4K71B 4XP5L 4Z7WB 4YHNA 4BSWA 1G7QA 3F62A 3U9UB 3O8XA 3P9MB 4HH9A 1X5ZA 2EXYC 4WWKC 3WN5B 5HYFA 2QQNH 4EOWL 2MFNA 4GW4A 4PRNA 3Q1SH 4C57C 1B6DA 1JFQL 5E2VL 4LCCC 4K9EL 4IS6A 2GI7A 3S6CA 4AK1A 1DVFD 1BBJA 2AEQH 1NL0L 3G9VA 5IOPB 5JXED 2EE3A 4Y5XC 3TN0C 1KYOJ 2DIBA 3CUPA 5ANME 4LLAA 2JLLA 4FQPA 1X5XA 1C08A 4P23D 2YD9A 4QNPE 5KSBA 1LD9B 1OARL 1QKZL 3MUZ1 4R4FH 5IW1A 5FYLD 3N85H 3ZKXC 1FORH 1IGCH 4U3XA 1WVZA 3T04D 1BGXH 4Q9RL 5I75B 3MYZA 4PLJD 3EOBA 3U6RB 4ZUSB 4OFPA 4LQFH 3WNMA 5H37H 4MA3B 5KSUB 4Y4KD 1E6OL 3CCHA 1D5IL 3EYFA 3SKNA 1CCZA 4XPFH 4P5TA 1B4JH 3BP5B 3CH8A 1DQLH 1O7VA 3UTTE 1AD9A 3FN0L 1XF2B 2B0SH 1K9TA 1S9XB 2ED8A 1JGDB 2J4WL 5IHUH 1TTFA 2HG5A 1KELH 4OT1H 4P3WA 1P7KB 2C5DC 2EXYD 4WWKD 1O0VA 3V4UL 4OLEA 1FNEB 3O6FC 2BNQA 1LGVA 3SGKC 2NY1B 2F53A 1CXLA 4P5KA 5H35A 3W5MA 1Z9LA 3DVNA 4P46A 4PJ9B 4ZS6C 4A6YB 5DRNB 3ZKQD 3DV4B 5KSAC 4HUKB 1CR9L 2HFTA 3WD5H 1XGQB 2V2WA 2XZAH 4Y5YA 5DJXA 3TN0D 5C1MB 4ODUB 3L5IA 1U8OA 4P3DA 2HKFL 2VWEC 3HE6C 4ERSL 5AYUL 3F65A 5CP7B 4MMZC 1QFHA 3WXWL 1ONQA 2RJMA 4NHUB 2ADJA 4PLKC 2X4NA 3OZ9H 1WGOA 2K3TA 5GRUH 3T08A 3K2UH 4ZPTA 1A6VL 1BOYA 4APQA 3BRFA 2Z8RA 4PRPD 3ULVF 1FH5H 4OZHE 3IJHA 3VXSA 4L8BA 1AXTH 4L8DA 4JDVA 2HJKA 4LNVA 2EEDA 1B0GA 2VQ1A 4KV5E 4RFEA 3CLFH 3ARPA 4I0PB 5EU5A 4F37K 2JE8A 1KOAA 3RL1B 4Q2ZA 1T5WA 4KWUA 12E8H 4HFUH 3SE4A 3ULSA 3ULUH 2WUBH 4X5WB 4TULH 1ZKAA 3NZHL 5EU3A 3RL2A 5DHVA 3ZLQC 3O6FD 4GFTB 4XNXH 4A2MA 5C0GB 1VEOA 1GXEA 4ZS6D 5M94B 2DMBA 2CKBB 2NY5L 2Y7QB 2CUMA 1HE7A 1XGTB 2VXUH 2YMXL 3D3VD 5C0CA 2I60L 3ROLA 1UA6H 2C1PB 5KSAD 1RUQH 3CSYB 3MUY1 4PJBF 4XBPB 3D39D 1I1RA 4F7CA 3L1OH 2ADGA 3EYSL 4ZOCA 2DIJA 2RQ8A 5D71L 4Z7VF 4RMWA 5EOQH 2OL3B 2AJSL 4QKXB 3HE6D 1AY1L 1MCBA 4LLUB 1NMCB 3VGFA 4MNQA 1J05B 4FP8L 2ICWB 4UQ2B 3MRQA 4PLKD 2BJML 2ZUQC 2WWMC 4QOKB 3THML 4PTTA 4L9LB 2A6DA 5L8KB 2AEPL 3HCVA 3GUTB 2JCCE 4PJ7F 5DEZA 1M05B 4UINH 3SDXA 2ESVA 4ODWB 2RFXB 3C5ZA 1Z9SA 4OB5H 5INCB 2JJSA 5E8PA 4XGZB 1CS6A 3IFNH 1GCFA 5I1LB 5BMFH 1AGEA 4OFDA 4PJFE 4CUCA 3MV01 2F58H 3QZWB 4JM2A 1UXSB 4N0FA 5FUZL 5K9OB 5JHLL 1ERNA 5K9KA 5FFLA 4N8CL 2ZCKH 1ZVSB 3FRUA 4OUUB 3V6BR 2PTUA 4S1RL 3HZYA 5C9JA 4ISVB 3E3QE 1MHPL 2XN9B 1DP0A 5BV7L 4EDWL 5GXBB 5HYEA 3MCKA 4LRIC 2K7QA 4RFOL 3FONB 4DFIA 5IF0B 3MGOB 3B83A 1T7VA 2EDOA 3TPUB 4MWFB 3GMLB 2ED9A 2NYYC 2UWEE 3MBEB 5DJCA 3RBSA 3X3FH 4GQ9L 4NQVA 4P2OC 1N5AB 3L3JA 4U1SB 5A2FA 2WWKT 2NY2B 4Z7WF 1QSEA 4LLDB 5E99H 2WWMD 2DLFH 4XCYB 5C08B 4EVNB 3QHFH 3VFUB 4DVBB 1CBVL 4UBDC 2FGWL 3LN5B 4E42B 1R3HB 3BW9A 5ACZA 1G6VK 1RURH 3VXME 1S7SB 3Q6GL 1KIRB 3FHQA 1N64H 2VSCA 4P2CG 2GTWA 1WWWX 4FQ1L 4X6DA 4OZIB 2D7TH 3LRSA 5I8CB 2VR5A 3QJFB 1LEIA 4NRZB 5F72S 4UT9H 5T3XL 3ARQA 3RTQB 3H9SA 1G6RB 4L5FH 1SMAA 3ES6B 4Z8FL 4O2FA 1CD0A 4XB7A 5E9DB 3MLPA 5JPNB 3KXFE 1KJ2H 2AJZA 5HHNB 1G7IA 4MD5B 3BVNB 3HC3L 2CDFA 2MWCA 5GSRA 2XKUA 3ULUC 2R69L 1KT2A 3BI9X 5D2NB 3OPZH 3G5VB 3DJ9A 1EV2E 3W82A 2AXGA 2NYYD 3NACL 2P44B 4WY7H 4NHCH 4IRSA 4LCYA 1HEZA 1Y0LB 4WI6A 4YX2H 2V9TA 1IRAY 4LLQB 5C9KA 3H6JA 1C1EH 3T1FB 2QSVA 1CD1A 2EDWA 1XF5B 2OTPA 2BVOB 2NY4C 4RGOL 3OGCA 3OKOA 3GNML 1DLFH 4UBDD 4NQEA 4LU5L 4O9HH 1NCCL 3VFTA 3CSGA 1HNFA 5E6IA 4YAQA 5D2LA 1TITA 2KKQA 1YPZE 4LSSH 1CXIA 1S9WB 1GGYA 3ARSA 5T3XE 4UTBL 4LSRL 4R0LB 1F90H 5HGDA 4HS8H 4WHTB 3OG6B 1ZA3A 2Q86A 1CFVH 3DXAD 5BVPH 1AIFB 4LBEB 1I1CA 3LH2L 5IMLA 1ZK9A 4QRUB 2W07A 3VI3E 2EIZA 3RWEB 4UU9A 4XMLL 3QIBC 1MREL 2DIAA 4LGPB 4FZEL 2X9YA 3GBNL 2VUYA 5DHXB 3K46A 1EX0A 1BFVH 5T1LB 2YC1A 4M8QB 4LHUG 3ULUD 3RWGB 4WO4A 5IMOA 3TNMB 1NAKL 1N5YL 1DQMH 4WW2B 4C56B 1GOHA 3RUGB 4LCWA 1BQLL 2WV3A 2DQDH 2EXWC 4QRSB 5HYIA 5JOFB 4U6VL 1N0XH 4B7LA 4L3CB 2CUHA 4NUJA 1A9EA 1IQDA 2C1OA 1NCBH 2NY4D 3X11A 3WL9B 3VE0A 3OL2A 4X8JB 3BKJH 4JPVH 1C7SA 5LCVH 1QR1A 3VXTA 1J1OH 1QTYT 1WBZB 2VE6B 5D7KD 4Z6AT 2VN4A 1CDBA 2MPAL 4AEHL 2HRPH 1U8PB 4HPYL 3D0LB 1S7QA 3WHE0 4PS4L 1JGVL 1NC4A 1YEJL 3G6DL 1UZ6F 1D6VH 3CFJB 4K3HA 1TIUA 3PNWB 4ZUWA 5IM7A 2R8SH 3MV9D 3ZKNC 1JPST 2EDTA 3VRLF 4XWOC 3EYUH 3QIBD 1P1ZA 3MRDB 1YEIL 1UM4H 1OL0A 3SO3C 4E0RA 3HB3C 4PRDA 2Z8WC 1HHGA 3GHBL 4WTWA 1FZOB 4MB4A 3V6ZA 2GK0A 3PP3K 1CGSH 2EC8A 4BFEA 1GAFH 3BP6A 3BUYB 5DC4B 4D2NA 2GHWB 2FLBT 1CDHA 4M7KL 1MRCL 1PKQE 5FGBA 3EO1A 4S1QL 1CDYA 2BX5A 4FTVB 4PJDE 2NTFB 3JVGA 3DVGA 1P2CA 3GMPB 1IAIL 3UJJH 1PG7L 2GJ6D 2VDPH 5CJBA 2ICCA 4X6CA 2Y23A 4Z7UA 3WUZA 3OB0K 4PJAB 4KFZC 3HG1D 3MNVB 4X6FA 5DUPH 4ZYKB 4FXGA 4PRPE 1ZS8B 5HDOA 3O6MH 5JDJA 5JO5A 1FQ9C 4OM0L 4R3SB 5FB8A 3WNNA 3ZKND 1YY8A 5I2IA 5D7IA 2KZ1B 3GIZL 4CBPA 4RDQF 4F9PA 2YPVH 1GZPA 3MRFA 3RNKA 3SGEH 3HB3D 2ITCA 2XQBH 3QB7C 3GKWL 3P9WB 1QBLL 1KJMA 4JG0L 2AXFB 4FQQB 2PXYC 4MXWH 2ATKB 5C8JB 2PO6C 4OAWA 4KKNA 3LN9A 1NGXB 3WIIH 3FL7A 1OB1A 4KUCD 4M7LT 5E70A 5FHBL 5TE6H 2GT9A 5DDHA 3MOBH 4PRAB 3I84A 4RQQA 6CGTA 3D39E 4OD3L 4JN2A 2MCG1 5JTWA 2ZUWA 5IFAL 3BGMB 5GS1B 4HT1L 4JFYB 3NFPA 5TDPB 2I9TB 1LP9A 1BAFH 2G75B 4KUZH 1GGTA 4EZMA 3O41A 1RJCA 5IROA 1IKFL 3MLRH 1PLGH 2QSCH 2LU4A 2QQNL 1DBKH 4PJ8C 4LPTA 2FWOA 3Q1SL 2DBLH 2R0LH 1CVRA 3QIWB 5I8OL 5CIPH 5E8OB 3NCBB 3HI1B 3SN6N 4PJIA 2NCMA 3F5WA 3MV8D 4JFFD 4IOIB 4OFKA 2F54D 4D0CB 4NBYB 4ZOEA 3AY4C 4PBWD 1ORQA 2DLEA 2X4QB 3O3BA 4R97C 2OQJB 3G6JA 4I9WD 3H3KA 1L0YA 3ARDC 2WBJC 5MEPB 2D0FA 1OGAD 5I1AB 3FOLB 4XNMB 3MRNB 2BY1A 1U8QA 2FX9H 1A1MB 4XNUH 1FORL 2ITDB 5JR1L 4IMKC 3S5LA 2AGJH 2PXYD 4XHQA 4Z9KB 2PO6D 3ZYIA 2ZSWA 4HUVB 5IHLB 4LQFL 2ADFH 1JPTL 2PYFA 4YWGH 3VDBA 4FXKA 4PJEB 4XPFL 4Z7QF 5DHVH 1G7LB 4OQ1A 1DQLL 2B0SL 3EYQC 1CFTA 3V5DA 2VZTA 1JHLH 4Q97A 5L7XH 3D87B 2J12B 3PGDA 4PJHB 4OT1L 1HOCA 2FX8L 4Z78B 3SKOA 3KR3H 2VAAA 4N0CC 4PTUB 4PJ8D 1TNNA 3O8XC 1A6AB 3X13A 4DK6A 5KN5B 1J18A 4CMHB 2FDBP 1BQHB 1KNOB 5BQ7A 1MOEA 2E7MA 4I3SH 5E8EA 3VFNA 3WD5L 3D1MC 3MGTB 3P4MB 5HJ3A 1IC4H 3WKML 2WBJD 4FFZH 5LAXA 5SWZE 3OGOE 2ARJQ 5IEKB 1A4KB 4YXKL 5IESL 3C5JB 4UV4H 2DL9A 2IJ0C 3HMWL 5FIEA 5GGTA 4JZJA 3SDAD 3VFWB 3T3PE 3I75A 4LFHG 3V0WL 3OZ9L 5GRUL 1FYTD 2YPLD 4NN5C 4NFBA 4NWUH 4AYFA 3GSWB 5F7EH 1AXTL 4XCNA 3RDTA 1NBQA 5EOTA 3CLFL 4GAJH 4X4XB 3L5XH 4EBQL 3EYQD 1DN0B 1YNKH 5TF1L 1IT9H 3MR9A 4NSKB 12E8L 3AGVA 4YHZL 2B8OT 4JY4A 3RVVC 4TNVK 4TULL 4N0CD 3U82B 4OFYD 1Z9OA 1I3VA 3A0OA 1U9KA 4WENB 1HHHA 4XNXL 3O8XD 1YN7A 1ZHNB 3HRZB 4K23H 5LXGL 3UBXI 4L29A 2VXUL 2FBOJ 3MOAH 1AP2A 2NQCA 1RUQL 4P46C 5IQ9B 1UVQB 2FEDC 3O3AA 1G1CA 4NKDB 3RI5K 1U8IB 3FB7B 3BHBA 3GIVB 5FUCE 1MHEA 5DJ0A 3HNVH 3QFDB 4LPYA 1CQKA 1FG2A 3HZKA 2R4SH 5EOQL 4Y5YC 3CPLB 3FT2B 3KDMB 2VZ1A 3PABA 3RZWA 5CGTA 3TWCH 3DXAE 3JV6B 3LKPA 4LARH 4Y1AA 4JQIH 3U83A 1OP3H 1XGUB 1AGFA 4HIIA 4LGSB 3X12A 1H9VA 4QRPE 5IGXH 1L7IH 2G2RB 1LDPH 4UINL 2FATL 3L3IB 4J3OC 4OB5L 1NBVL 4APQC 4TVSa 3BP4A 3ULUE 3IFNL 2O5ZL 4JRXB 4X6EA 4JM4L 5BMFL 4IMLB 4ENEC 1MY5A 5I1HL 1NBZA 2COQA 5LWYH 1T7YA 4P5TD 4R96B 5DI8B 1NGPH 2FLRT 3LCYA 3EBAA 4M3JA 3RVVD 35C8H 4K3GA 4OZGB 3UX9B 4JRYB 2IMMA 2FBJH 5F1IA 5JNYA 3SE4C 2XPGA 4ZPVB 3TA3B 3I3DA 5GSVA 3FO0H 2P42B 3W0WA 2O61B 2R39A 1DSFH 2X05A 2BNQD 2F53D 3AU1A 5I30H 3MZTA 4N8VG 2W92A 4H88H 5D7KE 4P46D