1HH9A

Anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
214
structure length
214
Chain Sequence
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)
publication title Evolutionary Transition Pathways for Changing Peptide Ligand Specificity and Structure
pubmed doi rcsb
total genus 48
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hh9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hh9A01
1OD7A 2IFFH 4ODUB 4WHTB 4O5LH 2ZCKH 2VLRB 5AD0B 4MVBC 3M17A 3FO0H 1IEAB 3H7BB 5IW6A 4JO3H 4BQ6A 2OX5A 1BQSA 3QWRD 2FWOA 4KI5C 1MCBA 3CDCA 1KC5L 1WBXA 1ZT1A 1QRNB 2PYED 4HAGA 1MUJA 3BP7A 2OJZH 4P9HC 5E0QA 3SCMD 3DUUA 5LG1A 1XGYL 4RMTA 1LILA 4P4KB 4ZODA 3FB5B 4KPHH 2G2RB 2ICEA 2X9YA 2X9WA 3F7VA 2WSKA 3B9DA 1I4FB 1IAMA 3P77B 1LD9B 4NKDA 3G5ZA 5K9OB 5E8PA 3GEWB 1Q9OA 2ZCLH 4ZOBA 5EU5B 1JYNA 1HZHL 5DMJB 1TITA 5FYKL 5D2NA 5FCUH 5K9KB 1OLLA 1YJDH 1B6UA 2Y06H 5ALBL 4KGJA 5E5RB 1OSZB 1R3KA 3HR6A 4UT7L 1X44A 1MWAA 3L5IA 3DNKA 3QDME 3U0TA 1MHHA 2C3GA 1W72A 2OCFD 1WZLA 2FATH 1HH9B 2FX7H 3WN5C 4FXKA 2VUOA 3O6KL 5CSZA 1QTYT 3DSFL 1PYWB 2HT2D 4MMZC 2DDQH 5C3TA 1T0NB 5EUKB 3LEYH 1AO7B 3UC0L 3ARFC 4GT7A 4GXVL 4OKDA 1PW3A 1G0XA 3E6FA 5ADOH 4S1DD 1WZKA 3JV6B 1RURL 3HA0A 3QRGH 4KKBD 1NGYB 4PRPA 1J11A 3RUGA 2ADFH 3D39B 3BZEB 3S35H 3MOBH 4OT1L 2WIMA 4WUUE 2DQTL 5IQ7H 5IHLB 4CVZA 2IANA 4ZXBA 5T5NG 1ED3A 1R0AL 4MLSA 4LLQB 1AGEA 1UFUA 1DEDA 4XZUB 2WBJC 5J0BA 3ARZA 1OQXA 1BBJB 1A1NA 2HH0H 2VDKH 1DQQB 4ZPTB 1DQJB 5F3BB 5EOCL 1NC4D 5IJKA 1LHZA 3CFBA 5AUMB 3ROLB 4L1HA 5CJBA 3S4SA 4Y4KB 3VRLF 3K1DA 4ZSOE 2H6PB 3VXRA 3BGFC 4LLWA 3ROOA 3KLAB 3F7QA 4NNPL 3OAYK 1ZHLA 1NFDA 3KNBA 5DFWH 2FR4B 3PL6B 3QIBA 4L4JA 1MCFA 5FGBC 5GGQH 2CDEA 3GIVA 5B8CB 3P9MB 1LE9B 2PW2B 4K94C 2BSRB 3VFNA 3RY6A 4AENA 1T7YA 2P8LB 5J7CC 3GB7B 3MREB 2HT2C 4Y5XA 3CGTA 1L0XA 4FN0A 5MEPB 1MCRA 4Y19A 4X7DC 3ZL4H 4C56D 5HHOA 4OLYL 1R5VB 2A6JA 1MRFL 3C5ZA 1TZGH 4F8TA 5CEZD 4KKBC 1SVCP 5TF0A 5I66A 2XY1A 4A6YB 1H3XA 5K93A 4PV8B 1FNSL 3VFOA 5I1IH 3HPLB 4WI7A 4C58B 3DYPA 1JP5A 3MLSH 5HHNA 1WCQA 5L8LB 4YR6A 2F53E 2JIXB 3PWLB 1GGIL 5TDPB 5C0RH 1JUFB 4FZEL 1NGZB 2VDML 1MFBL 3K2UL 4LLMA 3TV3L 5BXFA 3V6FB 4LVHC 1QBAA 3H9SE 5ESAB 4DZ8B 3MROA 3B3IA 4LSDA 3CPLA 4PD4K 4JFPB 5D6DC 4QRRE 2X40A 3DRQA 4JHAH 3IKCB 3LPWA 3HFML 1DJSA 1JPFA 4I4WB 3TBYA 1WWAX 2NY4D 3RPIB 5E94B 2FX9H 1BIIB 1P5UA 4BH7A 2LTQB 2WLYA 2LU4A 4YH6A 1GCFA 4G6KH 4YAQB 5DJZA 2VDLH 3CC5A 3RI5K 4MAYA 2AP2A 1HHKA 3FZUD 3AS1A 3QULB 4HCRA 4NQDE 4B0MM 3C6LB 4KH2A 3MBXL 3EKCA 2YC1A 2BRRH 4LGRB 3REWB 1T20B 2FHFA 3W5MA 1I9EA 4AG4L 2CMRL 1FORH 4P2QB 3OTTA 3O3AB 3VFRA 5JR1L 2QADB 4QRUB 1E4KA 5D7LE 4DCQB 4EN3B 2VDRH 1URLA 4M61A 3LD8B 4ELMF 1JHKH 2V5SA 2PXYD 4P57A 1I7TA 1KB5B 1AKJB 3WJJC 5C0CA 3FOMB 3OXRB 4ZAKD 1RHFA 4DZBA 5E8DL 5E2UH 4JFDD 4JM4H 1GVIA 4O4YL 3PNWA 5EORL 4HG4J 4EVNA 2ZP0T 3Q6GL 2O5XL 4XGZB 1ZHNB 3P11H 2VISA 4BZ1L 1E6JH 2UUDH 1QFWH 3HI6L 3PUCA 3WDHA 3MLTB 1FPTH 1OLZA 2NY4C 3KJ4C 4YUEL 3P73A 1BZQK 3BFOA 3MACL 4WW1A 3JTTA 1HINL 3BKYH 4XH2B 4RIRA 4ALAH 4JGMA 4CJ1A 4M1GH 4MXWH 1IT9H 3MXWH 3IF1A 1KJ2B 2R1WB 2GJZA 5C09E 1C1EH 1T7XA 5IKCA 3G5XB 4JRYB 5FUCC 1S9YB 5J06A 2C5DC 4P5TD 5B4MD 2R0KL 3C87A 4X6DF 4TUJA 3UTQB 1ODAA 1FQ9C 5JW4M 4TOYL 3FRPA 4GRMB 1T6WA 5J12B 4UINL 1FFNB 3LPGA 4LPVA 4LRNL 2CPCA 4NT6A 3D1MC 4PJBA 1HCFX 1MQ8A 1KJMB 4JRXB 1N0XL 4XRCB 4XMLL 1BFOA 1OF2A 5F9OL 5GRYA 3R4DA 2GKIA 4Y4FA 2PXYC 1CYGA 3RNQA 4ELKA 4OFYA 3WIHA 1UQSA 1EO8H 3MNWA 1KTDB 4MDJB 4ZAKC 1Y6MR 3VMOA 1J12A 2ICWB 3BH8B 1Q0XL 4LMQE 3BVNA 3HZYA 1UWGH 4O58L 4YQXL 4MDIB 4PS4H 2WBKA 5EBWA 4U1JB 1HEZB 3ULSA 2HJLA 5L8KB 3UTSE 2V5TA 5KSAD 3FQXA 4WFFE 3V4UH 5BV7H 3PWJA 4YFEA 1CFVH 4DTGL 3RL2B 3VW3H 2D7TH 2A83B 4WEBL 4PJ9D 2PYEA 4KZEH 2PR4L 3UTTB 3N1GC 3SCMA 1UT9A 4LPUA 2D7QA 4LLAA 2NX5B 3R1GL 4I5BA 1NQBA 3TIDA 4J23A 2D2OA 5DJXA 1YY8A 3SDAD 1CXKA 4P5TC 5B4MC 2R9HC 5E9DE 4HWUA 5CJQH 4HUXA 4JG0L 2CKBA 1RMFL 1YEJL 3MNVA 3OR7B 2Q7NA 2R2BA 1RSFA 4K3DL 3O45A 1ZS8B 4LASL 3VU2A 1T5WB 5TE4H 5E6ZA 3FHQA 5BS0D 2APFA 5IJVB 3T77B 3RTQB 1MFAL 2H1PH 3CU1A 1BVLA 3F5WA 1ZGLA 4NHCH 1MI5D 4AEFA 5E08L 5H37H 3IKKA 4HQQL 3SGDH 4LEXL 3BSZL 2ED8A 4PJGE 2HN7A 2D03H 3DVIA 8FABB 3RWGA 3X3FH 4NRZB 1SBSL 1ETZA 2OI9C 3DPBA 5KOVC 1ITBB 5KSAC 3O4OC 4KTDH 1B0RB 1K85A 5DWUL 1MSPA 3EYFB 1ORQA 4ZUWB 1CICB 4PJ9C 1FBIL 5GSVA 1FE8L 3MYZA 4GH7B 4D8PA 1TDQA 4Y1AA 2IQAA 3MLYL 3SOBL 3RY5A 1CDBA 3V6ZB 1CIDA 2FLBT 5F97E 5E24E 4I13B 4ODSL 2F74A 2F19L 1QBLH 2HLAA 4UV7L 3HG1E 5D6DA 2OZ4A 4LF3A 3SDAC 2VO5A 3GSOA 3LQMA 2Q8AH 4OZIA 3HC0B 2HKHH 4GRLC 3H6JA 4MWFB 2WIIA 1G9MH 3SDCA 1A4KA 5EWIH 5JORA 4L3ED 3ZHLA 3X13A 1WF5A 5F9DC 3K8LA 3VD4A 4JQVA 1U3HD 3QQ4A 5IF0A 3L6FB 1PQZB 9CGTA 5DRZB 1HE7A 3V5KB 2WUCL 2F54D 4FOMA 4HC1H 3KR3H 3EW3B 1DE4B 4OGYH 5GPRA 3RWEB 3RWCA 4IIQA 5BW7A 3B2VL 3FAXA 1MAJA 3SDXA 1UWXH 1WUNT 3MLVH 4DGYH 5DT1L 3TNNA 4PRDB 2FO4B 4RFEA 1BM3H 5I71C 2BNQB 5EA0H 4PG2C 3H9YA 1N8ZA 4MB5A 4PJXF 1K8DA 4P49A 1IGML 4JHBA 3K8MA 4NN6B 1LO5A 5FM5O 1EAJA 2CJUH 3TT3H 4Q9BA 2EH8H 5IB5B 1Z3GL 3QUZB 5CZVH 1H3TA 4YE4L 4S1RH 5F9AC 5C07D 1VADB 3PG2A 4OFPA 2MQ0A 5I76B 5HDLA 3S8WA 1S7TA 4BQ8A 3JZ7A 1JGDB 1UKQA 5F89A 5MENB 1QLEH 3WIFA 3QUMA 2VNCA 1TJIH 2EC9T 4XBPA 3WKMH 3IDJB 4YHLH 1HHJB 2P24B 4IOFD 3BE1L 4HX1A 1BQHG 4FFZL 3GRWH 4Q9RL 1HDMB 2GSGB 3CFJB 3QXDB 3QI9B 4JFYA 5D96B 3MGAA 3P9LB 5BZDA 1Q0YH 2RQ8A 3KXFD 5FK9A 2YRPA 4KK8D 4OF0A 4LU5L 5L9DL 4H20H 1U3HC 2V5MA 2XV6B 4HEPG 3UMTA 5CLWA 5I19H 5J56B 2W0KA 1T1ZA 4D9RD 2O5ZL 2IPUK 3HE6B 3KPSE 1TQCB 5FUOL 2EXYC 3TYGL 5A3IC 4YFLI 1P84K 2QSCH 2H26A 5IFAH 2FO1A 3GSWB 1RZGB 4DK6A 4ZFOB 2DIAA 2PXYA 2NTSP 3WO4B 4OD1H 4FQLL 1XR9B 3CFDB 4I3SL 4OB5L 1I7RA 3U4BL 1OCWH 1J8HD 2XZCH 3TBTA 5J4MA 4U7SA 2EDTA 1HSAB 2FIRT 4AM0A 5TH2A 2C3XA 5HHMB 3STZB 4TVSa 2EE3A 4G8EB 3DIFB 3SDDD 4BZ2L 3PDOA 5JOEA 2VQ1A 4Z7UE 3R0NA 4FQIH 1N26A 2YKLH 3MV8B 5GGVL 4PGEA 4PRBB 3JV4A 3NCEB 1QA9B 5ALCL 1QFOA 4A2MA 1MLBB 4QHUA 4YX2H 4OLZH 1J10A 5EOTA 3QZWG 3UX9B 5C0FA 1FFRA 1EGJA 2Q86A 4F7EB 5DMIL 4M5ZH 2EIEA 3IS1X 5D93B 4ZNEA 4WFGE 2FHBA 4RNRA 3FRUA 2ZUTA 1W0VB 3BIKB 2XA3A 3LKPB 1BFVL 2RBLA 3NABH 1CGSL 2DICA 1MREL 5HHPB 4NQSB 5L6YL 5DJ6B 1BZ9A 1UB6B 5SV3A 3WLWD 1ZHKB 3ZYJA 4YPGB 4PJAA 1GGCL 4LCCC 4XBGB 3EYVB 1HI6B 1HXYB 2GTWB 1DDHB 4DN4L 3ZDZF 3TVMC 2A38A 2BJMH 1XIWD 3QIUD 1Y18B 2EDBA 3EGSA 4R90L 4ZUVB 1KJ3H 4K3JL 4UAOC 5HD8D 5D7SH 5GZNC 4PJFB 3K7UA 5DUML 5FDYA 4G5ZH 3JVGC 5F7KC 1VFAA 3MCLH 5EBMA 2HTKD 2WANA 1UCTA 3PQYE 5CJOL 5KSAA 1JHTB 5B39B 2E6PA 3I6KB 2W65A 4J8RA 2YEZB 1A1MA 4GMSL 2LFGA 4YDVB 1XH3A 3VMNA 2XI9A 4W70A 4MD4B 2YN5A 1LO2L 1S5HA 3D2UD 2DKUA 4Y5VB 5DO2C 5L0QB 5C0JA 3IXTA 5JHDE 3LZFH 4R3SA 4LCYB 5FYJH 2VXQL 3CFKB 1BD2D 5EOQL 2ZUSA 3SDAA 5I1KH 4XHJD 1G7MB 2F53D 1IQWH 2NY3B 2VYRE 1OAXL 2BSSA 3VGFA 1QSEB 4JM2D 4CAGA 4IRJD 4LLYB 4M1CC 5IR1A 3DYMA 2I25N 3SGKA 1BIHA 3VGDA 5CBEB 3JUZA 4MNGE 1D6EB 3W5NA 3HKFA 3HRZB 5HYIA 5FYJU 1XIWC 1FV1B 5IB4A 3QIUC 4XNXL 4E5XA 5HD8C 4WI5A 5TQ2H 4K9EL 5H2BB 2UWEB 5JHLH 2HTKC 1RD6A 1IBGL 3HZKA 3DO7A 5DHVH 3ZHKA 3MFFA 1VGKA 3MRJB 4PG2A 4U7KA 2LABA 4XCYA 4JZJC 1ACYH 4OIIL 3DX9B 5F96L 3HPJA 3VFMA 1Z5LA 2Y07H 3TA3D 5D7LD 3C08L 5IP4A 2JK5A 3VRIA 3VFTB 1TJGH 1Q8MA 4LAQH 1IGJB 3MBEB 4WFHE 4KUZH 1K5NA 2VLKB 3OAYH 4FABL 1VENA 4LOUC 3PXJA 2ITDA 1EFXB 4K23H 3OL2A 4FP8L 3FTGA 3UXFA 2NXZD 1BQUA 5F88B 3SJVB 1R3LA 5I1CL 5DRXA 1A6UL 1XF1A 3WEXA 1JRHL 2RHEA 4JM2C 2ORBL 5F7DB 4IRJC 4L3EA 5SV4A 4LLVB 5IVZA 3W81A 2BVUA 5KN5A 3WFCH 5A40E 1AQDB 5SWZB 3VG0L 5IB3B 2F54A 3TV3H 1C5BH 2BNUB 4R8WH 1F11B 1YUHB 2BFVH 4QXGL 3I6LE 5CIPA 3HNTH 2WBWB 3ULUE 5C09D 2YPVH 3OAUL 3KYOB 3QG6B 2LVEA 3FQTA 3MRNB 3MR9B 4KDTC 2CK2A 3SDYL 3E3QC 3BPNB 4R7NA 3LDBC 3N85L 4UV4L 1E6OH 3S7GA 4WWKD 1PJ9A 4YHPB 3TA3C 5JOFA 1D5XB 4XAKE 4LSPH 3DVGB 2AABH 2YSSA 3VFWB 4GUPA 1T2JA 5C07A 2GAZA 3RDTC 1RUML 2BOBA 2YD6A 5DD5H 3D85B 4PJEF 2PTVA 5DSCA 3R8QA 3WL9B 5FKAB 4LCWE 3ZSSA 4BH8A 3AC0A 3FN0L 3IDNB 4OGZA 1GGTA 2ZSVB 5DD1H 2VLJE 5FUCE 1AR1D 3S37X 3UTSD 4FRWA 5F3HB 2JJSC 3KJ6L 2XTJC 4NKIH 3CMOL 1D7FA 3MJ6A 3UZEA 4D0BB 5IMMB 4LPXA 5E2TH 3HI5L 3LKRA 4GS7C 1T5XA 3GIZL 4JO4H 4R97B 1OY3B 3GBNH 4G42A 4KKLD 1QQDB 3GSUA 4MD0A 4X6BA 1L7TH 1W8OA 1VB9A 5EO0A 2LQRA 4MS8D 2VAJA 2I07A 2AEPH 3BYTA 5KSUB 4I0PD 4HIXL 3ZSTA 4KK5C 2AKRB 3I84A 3P4OA 4I18B 4G43B 3S34L 4KRPB 3U30B 4J1UA 1EV2E 5ID1A 4KUCD 1WCBA 3QNYB 4MA7L 4NO5A 5CHNA 5CZXC 1T03L 2IADA 2ZPKH 4Y5YB 1R6VA 4WDIA 2MCPL 5IHBA 1UVQB 4WWKC 1FIGH 1A6WH 4N90E 2DQDL 3TO2B 1IFHL 4O2EA 5E8OA 4YHNA 4XNMB 3IJYB 4QGTA 1ZK9A 2VABB 3QDMA 1HWGB 1OB1B 3FQUA 3GO1H 4R0LB 1HKLH 1ZA6B 1KEGL 3ZKXC 1F4WH 1X6NA 1UH3A 2HVJA 2VC2L 3MV9B 5A2FA 4JFFB 4M1DL 4G9FD 3RZCB 3SDDA 5D8JL 5HGAA 1OTTD 4JKKA 5T1MA 1SYVB 3WS6A 1FCGA 3QEUA 5J6HB 4Q2ZB 1XGPB 4FQXB 5KW9H 2CIIB 3VH8G 3T4AB 2K7PA 3R06A 3PIQB 4ETQB 4UUJA 4XCEB 4XPBH 5SX4H 1T83A 3HZVB 4FQHB 1LQSR 4XP5H 2EE2A 2WW8A 4E41B 5F6IB 4P2CG 1I8KA 3AS0A 43CAA 1CGYA 2GY5A 5F7LB 5E99H 4WUUA 4HDIB 3QHZL 4M7KL 5D5MF 2A6DB 4KKLC 1UC6A 3TCXA 5TPWL 1U2CA 4F15C 4PV9B 4EUPB 2OP4L 3VXNB 4GBXD 4I0PC 3L3JB 3OV6A 2KPNA 4PJ7F 5ILTH 3B2UD 3OKYA 4WVRA 3L5XL 4H8WH 3BOVA 3DMMB 1EEYB 3QUYB 1CD1A 1J0HA 3D0VA 4G6FB 4QOKB 3I9GL 1XIWA 4ZSOA 4ZFGH 1U93A 4L9LA 5DHXB 3A6BL 5ISZE 2DQEL 4LEOA 4HXBL 5C92A 1I9JL 5HHVL 1MCQA 1JPTL 1P4LA 4BSVA 1BQHA 4PBXA 2R29L 5GHWL 4PGCB 1KB9J 3O2DH 3MFGB 4YHMH 5GS1B 4KKCC 1OTTC 3DRTB 2B1HH 2B0SL 3CH1A 4F7TA 5ITBH 4POZD 3GNMH 2VZUA 3EOTH 2X4OA 1L9NA 5IB2A 3G9VA 5I30L 1FAIL 2PO6D 4XAWL 4EIZC 1I8IA 1TJHL 1X5AA 1BD2A 4OM1L 1BFTA 3UDWC 3LEXB 3ZE1F 4KAQL 3RGVC 1KJVB 4KWUA 2F53A 2ATKB 5DF0A 2FL5A 2X2YA 3X12A 5HJ3A 5LCVL 3UTZB 1FZMB 1OAUL 2LE9A 4GBXC 1PZ5A 3T2QA 1CLOL 3H9SA 2APTA 1PG7L 3V7AG 5KSVA 1IKFH 1LO0H 2J8UE 4DOHB 4OLEA 4KTYA 1IM9D 4RAUA 4QRRA 3B2UC 3IDMA 2BSTB 1KCVH 4HUWB 1T7VA 3AB0C 4DVRL 2DI9A 3BIBX 5FECA 1CF8L 2C3VA 5IW6B 2J4WH 5CUSL 1P7QD 3MRRA 1RV6X 4GKZA 1DVFC 1QFWI 4U1HA 5F8RC 1AGCA 2FWOB 3TWCL 4KJQC 3MV7E 1WBXB 3CZFA 4UB0H 1ZT1B 4FQCL 1CWVA 3LSOA 4G9DA 1KEML 1YYML 3SEPA 1MUJB 4NQDA 3BP7B 3DUUB 5TDNA 7FABH 3HC4L 1U3JA 3GM0A 1ZVHA 2DMCA 2XQBL 2VAAA 4JPIA 4JO1L 4J3XA 5F1SA 3L7EA 2ICEB 1FVEA 3QZWA 4S1SH 3F7VB 4DGVH 5I8KH 1KCSL 2E27L 5D7LA 4D9QE 5DR5H 4NKDB 3G5ZB 4WEMB 5E8PB 4HFWA 4TQEH 4PTUA 2NY6C 2PO6C 3H8NA 4JKWA 2J3SA 1UZ8A 4LCUA 5D2NB 5IM7A 2XXCB 2B5IB 4KXZI 1R3KB 3EO9H 5HYJE 1MWAB 3D87B 3QFJE 5E1HB 3U0TB 1NFIA 1KENH 2GFBA 1T0MA 2DM7A 1W72B 4XVJH 2HFTA 4IJ3C 1SM3H 2ED9A 4WCYL 3D3VD 5CSZB 4RAVA 3N1MC 4XVSH 1DBJH 5ACZB 4ORZC 5AG9A 3E6FB 2F5BL 4OCYH 1U6AH 3V4VH 1INDH 3ARGA 4POYA 4PRPB 4Y0GA 3UBXI 2YMXH 3RUGB 3NA9H 5E2JA 3OXSB 5C09A 4MHHI 4QKXB 4LIQH 2X70B 5EZLA 5DS8B 1MF2L 1IKNC 3IDGA 4NCDA 2EDOA 4PJDE 4CVZB 2IANB 4ZXBB 3DX6A 1ED3B 1JNNH 1YJDC 2HAZA 5DC9B 5MP6H 2CUHA 1AGEB 1YEEH 2ADIB 1MIMH 5GS0L 3T2NL 1CXHA 1A1NB 5ECJE 1T3FA 3ARBA 4X98A 4KU1A 4P46D 3KYNA 4HMEA 2W9DL 5L2KE 1LDSA 3CFBB 3GK8L 1RK1A 5FYKE 2BVYA 1G9NH 3BDXA 1AJ7L 5EO1A 1FC1A 3S4SB 3VXRB 4DKEH 4LLWB 2R1YA 3ROOB 2XZAL 1NFDB 3KNBB 4KZDL 4HWZA 3QIBB 1G7IA 2CDEB 4JR9L 3GIVB 4APQD 5ABDE 1DFBH 5FYJE 3VFNB 4AENB 5GS2H 4QHKJ 4S0TD 3UTSA 2BMKA 5D6CA 3TESA 3HB3D 4Y19B 4YDIL 1KOAA 2IPTH 1O7SA 3ZKSD 5HHOB 5D2LE 2A6JB 2M1KA 3C5ZB 3BKMH 3N1QC 4NUGL 5J1TC 5I66B 4K7FA 1A9EA 5LWYH 1IGFL 3VFOB 2EDLA 3QT2A 4LSSL 5HHNB 1Q1JL 3QXAA 4YR6B 3SO3B 3QWOB 3RVTD 2BP3A 4F37F 4KVCL 4M00A 2QR0A 3BN9D 4YK4B 4LLMB 5E9DA 2AV7A 5BXFB 2K3TA 1LEIB 1QBML 3QEQD 3MROB 3B3IB 3LRSA 5D70L 1JPFB 5HVHB 2MHAA 3TBYB 1NUNB 4PJGF 4OQTL 3D18B 3VXQA 1NMCC 4BH7B 15C8H 3ALPA 5D72H 1J05A 5CEXA 1CR9L 5DJZB 3BRFA 3JWOL 3TT1L 2EDNA 3CC5B 5DK2A 3ZE2E 4MAYB 4XPGL 1HHKB 4JFOA 4M03A 5I15L 2BX5A 1CN4A 4AEHH 2G5BA 5HTSA 4AT6B 3HE7D 2VRAA 1PFCA 2YC1B 5IVXF 4XCCL 5T3XL 3HB3C 4JQXC 1CTOA 4NWUL 4YBLC 4MB3A 4IMKA 4M61B 1UACL 5DD3L 1DBKL 1M7DB 2MTPA 4OLVL 2Q3AA 4A6YL 4PD4J 3RKDC 1IM3A 4P57B 4Z0XA 4GBXA 4NM8H 1KF9B 4TVPH 3KPRD 2F15A 1T21A 5C0CB 3EFFA 5BQ7A 1CLYH 3PV7A 3DX8A 3DWTA 2Y9RT 1IC4L 2BVPA 2WAHA 4JREC 2X1PA 4MNQE 2YRLA 4DZBB 2YBRA 3HG1A 4WI3A 3RVTC 4HJGA 2X4QA 3PNWB 4LSQL 2DJ4A 5E7BA 1L7IL 2E7MA 3HMWL 4YZFE 1FL3A 3MCKA 1I1AD 1U95A 2VISB 3TGXA 1H3PL 5AAWA 3PWVA 2XWBA 3BMWA 1FGNH 3P73B 4G8GE 1ADQA 1UWEH 4WW1B 3JTTB 1CK0H 5KVMC 5LAXA 4GAYB 4MA8H 1ZMYA 2HA1A 3H9ZA 1X7QA 3IF1B 3I6LD 2GJZB 3VXMD 1N5AA 5IKCB 3MMEA 4OF8A 3S98A 3VG9C 2HLFC 3OQ3B 5CGTA 1TZHA 3BP5A 3EO0A 4I2XE 4TUJB 5C0AE 4PJIE 4BELD 5HPMB 4F58L 4PRNA 4KROD 4YDJA 3NZ8A 4NT6B 3T0XA 4XBEH 1ZWIA 2F58L 3MNZA 3IETA 4XAKD 2Z8VC 2X4TA 3VI3E 1BFOB 1OF2B 1S9KC 3CFCL 1KB5L 3MLUL 4Y4FB 3TJEL 3ARTA 3RNQB 1WVZA 4QO1A 2ZUQB 4ELKB 2FCBA 1UQSB 2UV3A 3MO1A 1RJZA 3MNWB 1FNLA 2PCPB 3AM8C 1UM6L 2AJVH 1DBBH 3BVNB 3HZYB 4LCWD 1RJCA 4IM8A 5EBWB 3ULSB 2HJLB 5DYOA 4D0DA 4MJ5A 1S5IH 5CD3A 1I1AC 4U0QB 3P0YH 1JGLL 1CXEA 1P7QA 3FQXB 5J1AA 2BVTA 3MOAL 3PWJB 2GJ6E 3WFZA 3RJDA 1A14L 2AK1L 2Q6WA 2PYEB 3EJYD 1EJOL 3SCMB 3BPOC 2KH2B 4HKZA 3L7FA 5E00A 1JRHH 2DJUA 2OL3H 3VI4E 1KJ2L 3Q5YA 1U8PA 3KPSA 1E4JA 3VH8A 4I5BB 3TIDB 1PX4A 4PBVC 5J11B 2CK0H 5DJXB 4U7MA 1YY8B 4MXQD 4NC2B 4Z7WE 3S36H 3NCYP 4GLRI 1Z0NA 5HDQH 5IIEA 4KI5F 4XP1L 2VZ1A 3U0WL 4HUXB 2CKBB 3DOSA 4KI1A 4PJHF 4KHTL 3ZKQD 3MNVB 4HJJL 1TVBA 4X7FC 3O45B 4Y2OA 4N90D 2XTJE 3H9HA 5CMAA 4NKMA 4ONFH 3VDBA 3LKNB 5J8OA 5KSBE 1BVLB 3BMVA 3F5WB 5D7JD 2Z0BA 1ZGLB 2VTFA 2Y5TB 3GI8L 1OWRM 2ENSA 1PY4A 2CR3A 6FABH 1QNZH 3RGHA 1R24B 4Z7UA 4P48A 4WENB 2HN7B 1Q38A 3RWGB 1ETZB 1J0JA 2Q87A 5I17A 3HUJA 4M6AA 2B7DT 3O3DB 3AAZA 3VWJC 1ORQB 1RZIA 2FX8L 5GSVB 4CUCA 4OTXL 4D8PB 1MPAH 5CILH 4Y1AB 2IQAB 3GMMA 2NY7H 4XTRD 3S35X 2I26N 1E4XL 1BGXL 2XG5A 4JZNA 1MJ7H 1PBYA 2F74B 1NCAL 4LVHB 4KMQA 1CGXA 1XF5A 2HLAB 3ZDXF 3O9WA 5C6TL 2YZ8A 4FTVE 1QLRA 4P46A 4L3CA 2MKLC 4LF3B 4P4RB 4EDXA 3GSOB 5HHXH 4NKOA 4WI6A 3EYQC 4OZIB 4WGWB 2CRMA 3MLRL 1EUTA 2WIIB 1HQ4A 1ZKAA 3SDCB 4UIKL 4ZS7L 4IEFB 3ZTJH 5JORB 3K4DA 3ULVH 3X13B 3UJIL 5FM5M 1GGBH 5JMRA 3QQ4B 1FFQA 5TE6H 2DLIA 4FQ1H 4APQA 3SBWC 3WFDL 2VXVL 5D7JC 3PQYA 1LK3L 3RWCB 1F4YH 4IIQB 2OSLB 2HTLD 1KIUA 3SDXB 1WSST 3F65A 1EMTL 3INUH 3TNNB 3MC0A 2AK4E 1CDIA 3DXAE 4EUPH 1OTUD 4FNLL 2DQFA 4KFZC 1A3RH 4XP9L 3FMGH 5T3ZL 5JHDA 1N8ZB 1K8DB 3VXOA 5A2JH 4KMLB 2Z93A 3ZKMD 4GG6B 1GL4B 1LO5B 1VACB 1I3VA 1DQLL 3MLZL 1TFHA 2BVOA 1IJ9A 3D9AL 5TDOA 5BCAA 4OCRH 1Y6KR 4DUXA 1NDMB 3V6BR 2MPAH 1PG7W 2ERJC 1YQ2A 4M7LL 5IROA 1S7TB 4JHWL 1U8HA 5BOZG 3HLAA 1I1YA 2GHWB 4MLIA 5F89B 3KAAA 1BAFL 3QUMB 1KG0A 3Q3GA 1WBZA 1V7MH 4XBPB 3I2CL 2GI7A 4HX1B 3NA4A 4MJIE 4MNGA 4Y16D 4JFYB 1JNLL 3BWUC 3MQIA 4BQ9A 4N0UE 4M6NL 5FK9B 1JZ3A 3A67L 4AMKL 4O02L 4NP4L 4D0CA 2IGFH 1JGVL 3SKJH 3QJHB 3GKWH 4IDJH 3CK0L 2R0ZL 4Q6IC 3O6LL 1Z9MA 4JO2L 2IALA 4XWGH 1T1ZB 2EICA 3HE7A 5FIEA 2HTLC 2BNRD 3QSKB 4M6ML 1H5BC 1UXSA 4QY8A 3I3EA 5EUOF 3X17A 2V2WA 1OTUC 4QXWA 4D9QD 4CNIA 2H26B 3TNMA 3PABA 5C0ND 2UY6A 4NN5C 2PXYB 3LEVH 3ZKMC 4XMPH 1XF2A 1DANT 3KPRA 5C9KA 4P4KD 5HI3D 1Z9OA 1K4DA 4YC2C 1I7RB 2R2EB 2VH5H 4NQCE 4DKDC 3O6FC 3M07A 3QFJD 4ODTH 4AM0B 1SJEA 1BX2A 5TH2B 5KJRH 1JZ4A 2XPGB 5EC1A 1J5OH 2BRQA 3CDFA 4LIQE 5TQ0H 1RU9L 4CL7A 4QNPE 5D71H 3SE8H 3PDOB 1JK8A 3PGCA 2B8OT 4PGEB 3JV4B 2Y6SC 4QHUB 5ENWA 4Y16C 2NQCA 5EOTB 1NEZG 5IFHL 5C0FB 3O6ML 4OCXL 1OSPL 2RFXA 4DVBB 2Q86B 1XGQA 1P84J 4N0YH 2EC9U 3CXDH 1A02N 4OLWL 1MRCL 3FRUB 1MJ8H 4U0RB 1OTSC 1Q94A 3N1PC 4QT5A 4O9HL 3X3GH 1HNFA 1R5IA 5DJ0B 2DTML 4PJAB 3SGEH 1HHHA 3BKCL 4ERSL 1MCDA 3LRGA 1NUDA 4MZ2A 3CIQA 1ZXQA 3ABZA 3LHPL 4ZFOL 2ICWI 1HIML 5FCSH 3F7YA 3ESVF 3U7WL 2HFGL 2NLJA 4P4KC 5HI3C 4NDMB 3EGSB 4O51A 1KBGL 5CGMA 1JPST 1FVCA 4LCWA 3TBSB 2R23A 5ESVA 2OBGA 5FO8A 1VFAB 5EBMB 4BSJA 2OI9B 5DJCA 4QRPD 5FYJD 5KSAB 1ZT4A 3IRZA 1XGRA 4CVUA 1T89C 2HVKA 4ODBD 2Z31D 1TETH 1JI2A 1A1MB 1F3DH 3QNZA 4HMDA 4WHYH 1XH3B 1NCUA 1E4XI 4P2OD 4B50A 4JPWH 2OMBA 1S5HB 1WIUA 4QYOA 2Q8BH 5C0JB 3IXTB 3NACL 4R3SB 2Q3ZA 1A6TA 5JPMA 1WJ3A 4LKCA 4HAFA 4NJ9L 2ZKHL 1RUAH 2P5WE 2EDEA 4UT9L 3SDAB 3ZZ1A 4OD2A 4NYLA 1A6AA 1I9IL 1F6FB 2XRAL 2BSSB 5BMFH 3V4PL 3ZTNH 2YUZA 2ZG3A 1JF5A 4GKNA 5B38G 5IR1B 1MQKH 3FFCE 2QHLA 3GUTA 4GRWB 5FB8A 4R4FH 5CJ8A 35C8H 1MI5B 5IB4B 5IT2H 4PTTA 5ANME 3OZ9H 4E5XB 5FA4A 1BP3B 5JQHC 1IC1A 3V6OC 4PUBL 4Y2DD 4Z7VF 5D1QA 4GAGL 1LK2A 5C2BH 1OGAE 4FQ2H 3HZKB 3HS0A 4TVPE 2P48B 3DO7B 4OI8A 3MFFB 1VGKB 4PGDA 4XCYB 4Y4KC 2O5YH 4Q0XL 3UCRA 3VFMB 5I1EL 1Z5LB 1HSBA 4P2YA 1TZIA 1BEYH 1U2HA 1AGDA 3PL6C 4P9ML 1G0DA 2AAVA 3VRIB 2DLFL 4J6RH 3RU8L 3JWOC 3VGBA 5K33A 1K5NB 2J12B 1KSRA 4OCWH 2OTPA 4IRZH 5B21A 2ITDB 1EJ6A 2P43B 5ICYA 4HC1A 1NCDH 2B1AH 1R3LB 5DRXB 1CVRA 2FECL 4YXLH 3MJ9H 3PGDA 3WEXB 3ZYZA 4OIBA 1WZMA 1GZPA 4L3EB 3HMXA 5FKPA 5IVZB 2VDNL 5KN5B 3WXWH 1I1FA 4JVWA 3G04B 5ISZA 1U3HB 1CE1H 5DLML 3CU7A 5IMLA 1JTTA 1JTOA 4MNHA 3PHQA 4YJZL 1F58H 2F54B 1UGNA 4WU5A 5T5FH 1NAMH 5L7XH 3X14A 5FFLA 1CU4L 3LS4H 5CIPB 4HPOH 4Y2DC 3I85A 1FDLH 2GQHA 3FQTB 1KYOK 2M8XA 1TTGA 1HYSC 3QXUA 5BRZE 1RUPH 2XN9E 4JZOA 2YD5A 1NCWL 5C0AD 2Q1EA 4R7NB 3FCTA 2LTQC 5JOFB 3GRWA 4K7PL 3OWEA 4KV5E 2YSSB 4GUPB 3WFBH 1U41A 5GGTL 5C07B 2GAZB 1RVFH 2BOBB 2IBZX 2E8ZA 1NCNA 2O26U 4G7YL 2FJFA 5DSCB 5I1LA 2AS5M 4CJ0A 2J8UA 1NAKL 1VEPA 4Z95L 4BH8B 2R2CA 3D25A 4EN3C 4DFIA 1WITA 3GHBH 3NN8A 5HI5D 1ZLVK 3KXFB 1NANH 4AZ8A 4WGVB 4H88H 4LL9A 1P1ZA 3MV7A 1D5IH 1KPRA 2QHRH 1T5XB 3NIDE 4NM4L 2IWGA 5I18L 1AY1L 4XVUD 4G42B 3GSUB 4MD0B 1JVKA 5EO0B 5JUEH 1FH5L 4PRHE 3VWKD 2QSVA 5C0EA 3WIHH 5FA3A 2A2QT 4J3WA 1G6RA 4E9LA 4MMXC 1KV3A 5DJYA 4Z7OE 5C8JA 3GHEH 4DGIL 4J1UB 3B9KA 3AFLA 5ID1B 2ESVE 1WCBB 5CHNB 4NO5B 4OLUL 4OCSL 2IADB 3DV4A 1RUQH 4WDIB 1FZJA 4PY7B 3G6DH 5DFVC 2EKSA 5C0BE 3WCYA 3UTOA 3GSQA 4B53A 4O2EB 3QFJA 5E8OB 4YHNB 1J1OL 1MFEH 1UENA 3QDMB 3FQUB 1DLFL 3L5WA 5L2JA 2HVJB 4TTDD 5IBLD 1NSNH 4K8RH 3CVIL 3WBDA 5J12C 2BHZA 3SDDB 3RA7L 3DVFA 5HGAB 1JGUL 4RSVA 5T1MB 4JFXA 1X5IA 1S7XA 3QEUB 1PY9A 3WDIA 4X80H 4FS0A 5HI5C 3CXHJ 2W38A 1I7ZA 2DM2A 4CW1A 2Y36H 3MOQA 3RTQD 3R06B 4UUJB 2CGRH 3SE4C 4LARH 4OGAD 1MCPH 1AGFA 1I8KB 4WO4D 43CAB 3LN4A 1N6UA 4WUUB 3B8SA 4PJDA 4XVUC 2KBGA 3G6JE 4NRXA 4EDWL 4QHNA 3ULVE 4MYWB 5EU4A 3ZT7A 4EIGB 4EEEA 3VWKC 5C7XH 3AY4A 3BGMA 2YZ1A 4M9PA 4JLRA 5HYFA 3E2HB 4XXCC 3WE6A 1IEHA 4JKLA 5KANG 3KYKL 1QSFD 3QIWA 3K8KA 3W9EA 4NO2A 5DVMA 1MFCH 1DP0A 3CJJA 3FO1A 3IYLW 3NTCH 4N5EC 1OVZA 1CD1B 2RJMA 4I3RL 5K59E 1XIWB 4WV1A 3TIEA 1U93B 4L9LB 5I9QB 4Y8AA 2APBA 4J4PC 5JPNA 3O2WH 4LEOB 3OAZK 1A7RL 4M4PA 4ODXA 4EBQH 1RZJH 1EZVY 1P4LB 4BSVB 3GSNH 1BQHB 4TTDC 1RZFL 3F7RA 4QRPA 3A6CH 4PY8J 1R3IL 3IU4H 2B20A 2NY5H 2Z31A 3T0EE 2DD8H 2EO1A 2JCCE 2KL6A 2R8SL 1T1WA 3C2AL 4P2OA 2R1XA 3CH1B 4F7TB 4Q97A 2UVEA 3DX7A 2V7NA 5D2LA 2AJYH 3N9GL 1X5KA 4LSTL 2R4SL 3RTQC 4GXUM 2AEIT 3HC3L 4Q9QH 5CLTA 2R0WH 5BVPL 4U2YA 2ZCHL 5EC2A 1I8IB 2ZJSH 1BD2B 2DLTA 2FECI 4XP6H 4WO4C 1R3JA 3U36A 4TSCH 2BXYA 5DA0B 2F53B 3H7LA 1Q72L 4C4KT 5GGVY 3X12B 1H3WM 1UYWL 2FD6H 3TZVD 1PZ5B 4WY7L 5C0GA 5KSVB 3H9SB 5I1JH 1I8LC 3WIIH 3VD3A 1OPGH 4RAUB 2YXFA 4QRRB 4R6UA 4UQ3A 4XPFH 3IDMB 1CICC 5DHVA 3ZE2F 1E4WL 5FECB 3QEGL 3EOYG 5I73C 2C3VB 1JZ2A 4H1LB 1A5FL 3VCLA 1DQMH 4GKZB 1P7HL 2HWZH 1D5MA 5J9PA 3F58L 4JCMA 3PWNA 4ZDHA 1MHPL 3LSOB 3F12A 4G9DB 3U9PL 4NQDB 1PDKA 2XFXA 5TDNB 1GYAA 2PTUA 3J8F7 4N9GA 5TGBA 3VGEA 2VAAB 3CFIC 4M62H 1NEZA 3L7EB 3P30H 1FVEB 3QZWB 1S9WA 4ZTPH 2IMNA 4AL8L 3NFNA 4MJ4A 4I9WD 5D7LB 1GC1L 4NGHH 2ZUVA 4DK3A 4LRIA 3WHE1 1OAQH 4HFWB 4PTUB 4LCUB 1UZ8B 1CGVA 1GPOL 5IM7B 1MFDH 3HE6D 2VOTA 4MNQA 4Z6AT 2NXZB 1N7MH 3GBMH 4YPJA 4NZRL 1NFIB 2GFBB 5D7IE 3WNNA 1IAIL 5F72S 4RAVB 2W0PA 4NN6C 2CXGA 3K0WA 2DB8A 4PLKD 4G8GA 3QUZC 1UH4A 2WZPD 5JXAL 1GAFH 2F5AH 1WGOA 2PTTA 4KKNA 5CWSA 4TUKL 1GIGH 4YHIA 5HHMD 1F3DJ 5C09B 1JF6A 1PKQE 1DL7H 4ZFFA 5EZLB 1EBPA 3IDGB 4JM2F 3DX6B 5CINL 1ZV5A 1XMWA 1IILE 2NY2D 4P59H 4I2XA 5C0AA 4PJIA 3CNKA 3O4LE 2HKFL 3ARQA 4CADA 1XF4A 1D5ZA 1T3FB 3ARBB 4X98B 2ZOKA 4XC3L 3KYNB 3BYYA 4OV5A 1RK1B 5GS2D 1MJJA 4MAUH 5EO1B 3P4LA 4WU7A 3UJTH 3WLBA 2GSIA 5IK3A 4U05A 5DRWA 2V6HA 2R1YB 3HE6C 4YDLB 3CMGA 1TQCC 4F37K 1MWAL 1I3GH 4Y7MA 4R2GB 5GRVK 4J3UA 4HWZB 1W72L 1YEIL 1G7IB 1CBVH 4IDLA 4HMCA 25C8H 4JN2A 1LEGA 3UTSB 3WO4C 2BMKB 4GSDH 2VLRE 3SE4A 4AH2A 5D6CB 1AR2A 2GJ6A 4J3OC 2F8OA 4ZTOH 3PGFL 4OZ4A 1JWSA 2V5YA 2YK1H 4JJ5A 3ZMRA 2DQUH 4F15B 5JNYA 2NXYB 1A9EB 4GKSA 4K7FB 5JW5B 2PKDA 2KKQA 3ES6A 3WD5L 3IDXH 3P9WB 4LPTA 3QXAB 4Z7WA 2V9QA 2PW1A 3GI9H 2IQ9L 1C5CL 5JO5A 2NY2C 3L1OH 5DURB 2QR0B 1MCNA 4YFLF 1T66D 1AXSA 3AROA 4OZGF 2AV7B 3EFDL 5E9DB 4KGLA 4X9BA 4X6CF 5T1KA 4XNQA 5GIRA 1CD0A 5GJSH 5D93C 3Q1SL 3DECA 3LRSB 2MHAB 3BEVA 3FFCD 5JW4N 1N3NA 3HNSH 2VDQL 1U0QA 5KSBA 3FQRA 3VXQB 1D6VH 3U9UA 1J0ZA 3CZJA 4UNVA 2D3VA 4YHZL 4G9FB 2YS4A 1RUKH 1J05B 5CEXB 2Q76A 5DK2B 3NMEA 4JFOB 4JFZH 3B4NA 3HHRB 4YIQA 1YMME 4M8VA 5JXEA 1INEH 1NEUA 4NQTA 4K2UH 2G5BB 4TVPD 1AO7E 3H2WA 1LVEA 2KDGA 4D94A 1MJUH 1CLCA 4XX1E 5DRNA 5AYUL 5GJTL 4J2XA 1LP9F 1QR4A 2UZIH 4WO4A 4OCMC 3NFSH 3W0WE 5JA8B 1SBBA 2AJ3A 1I1CA 3D39E 2G9HA 1OGTA 4ZD3L 5F7YC 5KTEH 1IM3B 4Z0XB 4GBXB 4ZO9A 4GRWH 1F4HA 1T21B 1N4XH 2BK8A 3EFFB 3JUYA 5BQ7B 3DX8B 1QFUL 2BVPB 32C2A 3U7YL 2QKIA 3GMLA 2YBRB 3HG1B 3NH7L 4KK6D 4HJGB 5F7EH 2X4QB 3UEZA 2IG2L 4YHKH 2YRZA 3RQ3A 1T66C 3O2DA 1A0QH 3HI1A 5DMYA 2VR5A 2J1KA 4LVOB 1FL3B 4TSBH 3MCKB 2JTDA 3DROA 5JZ7C 2DF3A 1U95B 4MQTB 3MJGX 4BM7A 2ADJA 4UI2A 3C5JA 1EFXD 3PWVB 2XWBB 3C60D 3KPLA 4PB0L 1F4XL 3SJVD 5EH1A 2NY3C 4JPKL 1IAOA 5IBTH 1X7QB 4Z9KB 1N5AB 4HCRL 3MMEB 2AK4A 3TO4D 3DXAA 3ZTJG 1MH5A 5SWZD 1YEGH 1IGCL 1TZHB 4LFHD 3TCLA 1SEBA 3BP5B 3EO0B 4S1QL 1MCSA 5T3XE 5BRZD 4Z7QF 2L7JA 4TSAH 2Y7QA 4MQSB 1A7OH 4PRNB 4YDJB 3NZ8B 1FRGH 1RIUH 1YEKH 1ZWIB 4LBEA 3P0VL 2R4RH 1IAII 3MLXH 3MNZB 3IETB 4DQOH 5C6PB 4U6HA 5K9QI 2XKNB 1EA9C 1RFDH 3TZVA 5LGKA 5FGRA 1QVOA 1RJZB 2FGWH 3MO1B 1C12A 1BVKB 4PREB 3OG4B 1IM9B 4KK6C 3WSQH 3WS3A 5CIPH 3AXLA 5D7KE 4MJIA 3QH3A 4X6DE 5DYOB 4D0DB 4NRYA 1CD8A 5CD3B 3MBEC 1FCCA 3PHSA 1P7QB 4N0UA 1Z9LA 3DGCR 5J1AB 4CMHB 1J86A 3D85D 1YNKL 5DUPL 1H15B 2JELL 3QUKA 5E2WL 3VXTA 3LMJH 1X9QA 3MUZ1 4YXKL 4HK0A 3OJVC 2Q6WB 1X5LA 2P49B 1OQOA 5EFIA 2VQTA 4HKZB 4RGMC 3L7FB 5E00B 2OR9L 1UXWA 2MKWA 4LNVA 1U8PB 4PP1D 4JVPA 3KPSB 4HKJA 2EH7H 3VH8B 3MODL 5DD0H 3NCJL 3TO4C 1BQLL 4LNRA 4QF1A 4F7PA 3NBNA 5KVGH 1GHFH 2YA0A 4XI5D 1P5VA 1P7KA 5IIEB 1P4BH 2E7LC 1KFAH 1FGVH 1SEQH 3SGEI 5E03A 1AI1L 1YY9C 1OM3H 1I9RH 3BRGC 1MAML 1TVBB 2VUYA 4AIZA 5CAYB 4QNPF 5D1ZA 3RKPA 3H9HB 1KTRL 5CMAB 4YEEA 4NKMB 4HPYH 4RFOH 2W07A 5I1GL 5IB1A 1CI5A 4HF5L 3D3VB 4UT6L 4MJ6A 4EQ3A 3LH2H 3BPNC 2IAMA 3BPLB 3OF6D 3BJLA 4Z7UB 1CFNA 4CDHA 1YPZF 5GGRA 2BY0A 1KCRL 1IC5L 5I17B 3STLA 3HUJB 4Q6YA 3BDYH 4U3XA 5EO9A 3AAZB 3G5YA 1A7QL 2HFFA 5FUZL 3KLHD 5CSBA 4TRPH 1RZIB 2EE9A 3GMMB 1PSKL 1T80A 1TXKA 4DN3L 4Z8FH 2WUBH 2ICWJ 4JZNB 3ULVD 5TF1L 2W0FA 3O9WB 1QLRB 4GW5A 4L3CB 4P46B 4EDXB 5MEOA 3WUWA 4V1DE 4E41D 4NKOB 4XI5C 1P2CA 3PWPE 5IEKA 1ZLVH 1HQ4B 2CKBL 3RX5A 4R97C 1B2WH 1MNUL 1Q9WA 4JRXE 4Z0BL 4HLZH 1DBAL 4M93B 1QP1A 2Z92A 4UILL 3LKSA 4GW1A 3JSSA 2ADGA 4APQB 1FYTE 4I18C 3BWAA 3PQYB 4KRPC 3U30C 3DMMD 3QUYD 2C4FU 4NQXA 5C9JA 5HYEA 4JDTL 4HWBL 5KS9B 3BN3B 2DQFB 4R0LC 2C3WA 4OJFL 3IJSA 5JHDB 1UEYA 1U8IA 1H3UA 1NBVL 4UTAH 1CZ8L 3BP4A 1NLDH 4LSVH 1OAZL 3KHOA 3DO3A 2BVOB 2NX5E 4RRPG 2UUDK 4WHYG 3N50A 5EG6C 4P2RE 4FQXC 1O5DT 1U8HB 1AFVH 1I1YB 2OZ4L 2VL4A 3QEQB 1WEJH 2GYSA 2NY0B 1KG0B 3Q3GB 2CDFA 4XNUH 1UM5L 5F6IC 3OKMA 3FFCA 5I8EA 3MTRA 4XVTL 1KLUA 4MNGB 1VERA 2LU3A 4PJXE 1ULVA 4O2FA 3QHFH 5ANMA 5DJDA 1WAAF 4D0CB 3LS5L 4YHOL 1OGAA 4G3YL 1J1XL 3DMMC 2IALB 3QUYC 3HE7B 4P3CH 1Y0LA 1C8PA 4N1EA 4HK3N 3KG5A 4RA3A 4NQEE 1UXSB 3N0PB 4QY8B 2W9EL 5ACLA 4F3FA 3WMSA 3QEHA 4NPYB 3KPNA 5T3ZE 1F13A 1AHWA 2Y72A 5CEZL 2XICA 4CNIB 2A77H 2APWA 3L3HA 2WWKT 3TNMB 3PABB 4XCNB 3V5HB 4HBCL 4DW2H 1XF2B 1T2QH 3KPRB 3E1F1 3OKLA 1OARH 2VDOH 5GS1C 2H2PD 3OAZH 1IAIM 4KVNL 2GTZA 1KIQA 2YD2A 1NBZA 2J8HA 2DLHA 2BDNL 3MUHL 4IBLT 4NO0A 5GGSY 1BX2B 3S3SA 5EU6D 2DMKA 5EC1B 3QUML 3SE9H 1WC7A 1KELH 3CUPA 1JK8B 3Q6FA 3U1SL 3PGCB 5T1DH 3IRPX 3THML 3E0GA 2R56H 4U1IA 3C60A 3DUSA 5ENWB 5FHBL 3BPOB 4ETYA 1ZTXH 4XX1G 4QHLA 2FRGP 2RFXB 5DZNA 3QDGE 4OZHF 1XGQB 3PP4L 3MRLA 3V5DA 4JQIH 4PJ5D 1NCCL 1Q94B 4J7RA 4QT5B 4KV5F 5IFJB 1NGPL 2SEBA 5BRZA 2XN9A 1R5IB 3IGAB 3CVHH 3RIAK 4KROB 1RHHA 1HHHB 4PRPD 3UPCA 3REVA 2BNQE 2V17L 1WT5C 2X89D 5EZIH 4EXPX 1VFUA 4HH9A 1U91A 3QDAA 4HIIA 3F7YB 5BV7B 4HGWA 4XC1H 3F8UB 2NLJB 2H3NA 3ALXA 5JIPA 5FHAL 4O51B 4UNTA 2AVGA 1FVCB 3X11A 2QJDA 4LCWB 2R23B 5LQBL 1UCBL 5ESVB 5ACMA 5MENE 2OL3A 3JWDH 1II4E 1NGQH 5DJCB 3WNKA 4KRNA 5FM4A 4P23D 1ZT4B 2FB4H 1W2KT 3OGCA 5LXGH 1XGRB 1JN6A 2HVKB 5D2NC 4M5YH 4EI5D 1DN0A 3QNZB 1VPOL 5KVEL 4U6VH 4OD3H 3O2VH 2B5IC 4I48A 5KVFL 2ARJQ 1JNHA 1ZVYA 3V0WH 3M8OL 3ZDZE 4QYOB 4Z7OF 1BLNA 1EGJL 4JGUA 1A6TB 5MEQB 4AIXA 3MLWL 4IS6A 4LKCB 4PRHA 2WV3A 4OM0L 4LLUA 3LQAH 2HFEA 1KTKE 2WWMD 4YXHL 4OD2B 4NYLB 4W68A 1FHGA 1A6AB 4LQFH 5EZOH 2DQGL 2ESVA 3OPZL 1N64L 3LB6D 3S36X 5IHUL 5C0BA 4GKNB 1K2DA 3GUTB 1JPSH 1AC0A 5FB8B 2X41A 1YECL 3NIFF 4ODHL 1L9MA 4GJTB 2FBJL 4ODVH 2ATPA 1S7UA 4PBWD 4PTTB 3OF6A 3MRQA 5FA4B 4RMQA 5BOPA 2Y5EA 4GW4A 3WXVL 2AGJH 2IC2A 5IJKC 1LK2B 2BCKA 1W0WA 1YMMD 2ZNXA 4ODWA 3HS0B 4LKXA 5IESH 1S7WA 4GOSA 2FYYA 4PGDB 1DSFL 3C5SA 1AE6L 1LO4H 4KQ4H 5FYLH 1MIEH 2AJXH 2ILLA 1HWHB 5JQ6H 3H3PL 3PF2A 1HSBB 1TZIB 2I9TA 2H9GA 4OF7A 1AGDB 3QIBC 5KVDL 1IMHC 1FO0L 4OF5A 4JG1L 3G6JA 4RGND 1JCKA 4WTZG 1GXEA 3RY6C 1HH6A 4Y5XC 4RISH 4XNYH 2WWMC 1A6VH 5AWNL 5ICYB 3O3EA 4F57H 5IG7A 2OTWA 3MRDA 1FFPA 3C5ZC 2J8OA 5F8QC 3LB6C 2P47B 2DQJL 5E5MA 1RAMA 1A7NH 4WRLA 1GZPB 5FKPB 4OFVA 3ISWA 1T04A 4HFUL 3B9VA 2DLGA 1I1FB 4X4YA 1NH6A 5INDA 3V52H 4YBQD 5C0CD 5ISZB 3B83A 3OJ2C 4JVUA 3IFLH 5IMLB 1QKZL 3SO3C 1KCLA 4MNHB 3BZDA 3PHQB 3VXUE 4WU5B 3P2TA 4NNYA 5CGYC 1MCOH 4YK4C 5C0IA 3X14B 4V2BA 4KKAD 2R69L 3QJFA 3CLEL 2ARJA 4UTBL 2HRPH 5EU7C 3T0EA 2X7LA 3T0DA 2JCCA 4LHJB 3ET9F 4WW2A 1OAKL 4MB4A 5DQDH 4NOFA 4KK9D 5HVHC 3RWHA 4BK5A 4IRSD 1INQB 1DTUA 2YHGA 4JZOB 3VFVA 4HT1L 4Q9CA 3PJSA 5ICZA 1KT2B 1JYXA 2CO6B 3NFPA 4AIOA 4LHUG 3UJJH 2CKNA 4MAYC 2R0LL 4RGNC 4JFEE 4U1LA 1A4JA 5I16A 1YN6A 4QWWC 2FJFB 5I1LB 2J8UB 1QSEE 3FFDA 2GEEA 3D25B 1E4KC 4NZTH 3BZFA 3RAJH 1NMBL 2AJUH 2X1OA 3NN8B 3HNVH 1KN4H 2VXTH 3IFPA 3OJMB 4UDUA 3QCVH 3JBG7 4M48L 1KYOJ 3OKKA 5E2VH 3BT2L 1P1ZB 3UAJD 2COQA 3MV7B 4KHXL 2X1WL 1KPRB 1QYGH 1F3JA 4AEIL 4Z7NE 2BNRB 5IWLC 1OT2A 4PJEE 3OB0K 5F71A 1JHLH 3BW9A 3KLSA 3K4AA 1WT5A 4ZOCA 5FA3B 1UKSA 1G6RB 4C83A 4KK9C 5DJYB 4DKFH 4L3AA 2EYTA 4IRSC 4GMTH 3B9KB 4K8RD 1QO3A 5D7IF 4U1GB 1HILA 5M7QA 1TQBB 2QL1A 3DV4B 4LVNB 4RMVA 3S37L 4ESKA 4KY1L 1F90L 1FZJB 2EKSB 3GSQB 1QUNA 4HS8L 4OV6F 2VLKE 3QFJB 2D9CA 4GG8A 2C9AA 3VXSE 5JW3H 3U2SA 4NO3A 3GMQB 5EU6A 4OSUL 3L5WB 5L2JB 1FZKA 4I0KA 4KC3B 3CLFL 4AY0A 4MA3A 1T0PB 4NSKA 1NCBL 4JFXB 3IAGC 3OKNA 1S7XB 1UM4H 2XZQL 3L3IA 3DV6A 1BJMA 5GQBA 4TULH 1I7ZB 4CW1B 5BJTA 3IFNL 2J6EL 4YNYA 4Y4FC 2ZG1A 2YPLD 2ZUQC 4ZO6A 1AGFB 3UAJC 1HN1A 4FFWD 3NZHL 3LN4B 4PJ5A 1EDQA 3QO1A 1PG7X 4PJDB 5TE7H 3G9AB 2P42B 3UYRL 1A3QA 2FJGA 4CVWA 4NRXB 4QHNB 3QPXL 5EU4B 3U48A 3QUXD 4PJ8D 1FJ1A 3O4LA 1Q9LA 3BGMB 3VA6A 8CGTA 4JLRB 2X89A 3WE6B 3I02A 4P9HH 2BZDA 3W9EB 4NO2B 4V1DD 4NZUH 1QPXA 4ZOEA 3OKOA 3FO1B 3NAAH 1FNEA 3PWPD 4K8RC 4YDKL 3SCMC 4Y1AD 2OJEB 3E8UH 4NQVA 2CRZA 1ZANL 3MYJA 4WV1B 3TIEB 4WHCA 3UO1L 5I0DA 5I8OH 1ZGLM 1RIVH 4D9LH 1B4JL 5C71A 5J11C 4F80A 1U8KA 4PR5A 5D5ME 2QQLL 4G6JH 4RBPK 1FYTD 1FAKT 4ODXB 1YNLH 4XP4H 4QRPB 1EEUA 4P23A 1CXFA 3SDCD 2X10A 4EI5A 5AD0A 1QSZA 2Z31B 5DVLA 1T1WB 1MAKA 1T7ZA 5HPOA 4PJ7E 4P2OB 2R1XB 3DX7B 3WFHA 1ROWA 5D2LB 5I74B 3U4AA 1XZ0A 3CAFA 5FV2A 1TVDA 2WINA 4NC1C 4NCC2 5LJYH 5EC2B 1XFPA 5AZ2H 1B4RA 1JL8A 4FFWC 3MXVH 2A0LD 3U36B 2V2XA 1X5HA 1JZ8A 5D9SA 1BZ7A 1Z9SA 1N5YL 4S1DC 4I77H 2E9IA 5T33L 4P2RD 2VE6A 4N8VG 5C86A 4X9HA 5MHSE 2GW5A 4JANB 2JF1A 3EYUL 1PLGL 1OP3K 4UQ3B 1L0YA 1RZJC 4WUKH 2P5ED 4L5FH 4D3CL 1NMAH 3HTLX 5DHVB 3I50H 1CL7H 4LCIH 3QXTA 3RFZC 2NY5C 4TPRH 5I1HH 2DQIL 1F2XK 3O0RL 2IFGA 4Y2DB 1D5MB 5J9PB 3MV9E 3ZE1E 2CUMA 4XCFH 3PWNB 4JFFE 4ZDHB 3JWNC 3F12B 5JTWA 1PYWA 3BKJL 1YMMA 2XFXB 5HGBA 3FONA 4J3SA 1UJ3A 1AO7A 2I5YH 4N9GB 5TGBB 4POUB 3SDCC 1X5YA 2JLLA 3GMOA 3QDJE 4X83A 3TH4T 1KTLA 1NEZB 4NQED 5GGSA 1S9WB 3ZE0F 1J1PH 3H42H 3NFNB 1MCLA 3TYFA 4RDQF 4K94H 3MJ9A 4JQVC 4E42A 3W0WA 5IOPA 3D39A 4K71B 5LGHH 3RRQA 2C1OA 1WISA 4K3EL 4IIQC 5BW7C 2OK0L 1KXTB 3W9DA 3ARPA 2A9MH 3BI9X 4XPHH 5K9JL 1M7IA 1KLGB 3IB4A 3BAEH 1NAMA 4XZUA 5HYSG 1DQQA 4GQ9L 4XPTH 5CCKL 5M94B 1A3LL 1KLFA 4OQTA 3TFKD 4FZ8H 4ELMA 1OWWA 2E6JA 4QEGA 4G8GB 2PTTB 5CWSB 5E1AA 4YHIB 5IWLA 2MJWA 4HXAH 1N6QH 1GOHA 4ZFFB 3MA9H 3WFEL 2AJZA 3S3PA 4C4KO 4QRTA 1EHLL 1D5BA 2H32H 4IRSA 1FG2A 4J3VA 2A9NL 4I2XB 4M6OL 5C0AB 4PJIB 4CBPA 2D4FA 1JWUA 1LDPH 4R26H 1OAYH 4CADB 1XF4B 5GRJL 1D5ZB 4RWHA 5J57B 2AQ1A 1C16A 2ZOKB 1J87A 4OV5B 4IOSD 1U36A 3LAFA 2CIKA 4M7JH 3FZUC 3QO0A 4ZUSA 1MJJB 1F42A 2XWTA 4CN4A 4WU7B 2GCYA 1K6QH 2A1WH 4XMKH 3WLBB 2X6MA 5IK3B 5DRWB 2YXMA 3V79C 4NJAH 2DBLH 4QTIH 1NL0H 4NWTH 4N5UA 3ULUH 4JFPA 5ADPL 4X6DA 1LEGB 1RZ7H 1XGUA 2D9QB 3EYSL 1M6OA 5AZEL 4I4WA 1WZ1L 2DQCL 1F2QA 4AH2B 4K07A 3LCYA 4Y4HD 4JY5H 3M1BA 2GJ6B 4FQJH 4NUJA 3U83A 4BFGA 3TFKC 1SYSA 4M43H 1ZHBA 4OZ4B 2DTSA 1JWSB 4JJ5B 4RGOH 4YAQA 4I8DA 4LSUL 5IMKA 1TPXB 2VXSL 1FLRL 5JNYB 1LO3H 3QULA 2RCSL 3V95A 4HV8A 3UPRA 3VWKB 4LSRL 3WHE0 4WI9A 4NZJA 1ZEAL 4KMTL 1WBYA 3DETD 4Z7WB 2PW1B 4PJCB 5JO5B 3FN3A 1IC7L 1IGIH 1AXSB 4OGXL 4QRUA 2B2XH 1UA6H 5T1KB 4L8DA 4XNQB 5HVGB 5GIRB 3BUTA 4FFYH 4QXUL 3BEVB 4U0RC 5KSBB 2VZOA 3FQRB 5FYLE 3U9UB 4JFQA 1LNUA 1ZLWK 5F1IB 5L88H 2W9LA 1VEMA 2Q76B 4L4TE 2B4CL 3DI3B 3MRPA 1V8HA 2ZZUT 4N8CL 1DQDL 4YIQB 4WIQA 4KQ3L 1YDPA 2MQ3A 4K7PY 5GISL 2GJJA 3SO5A 2EYRA 2JE8A 3MLTA 5DHYA 1IZKA 2VWEE 2YPLA 2X4RA 5E4EB 4FQQB 2AI0H 5DRNB 1X6LA 2VSDA 4WO4B 4G7VL 1P4IH 2AJ3B 5LBSH 1S3KH 1KJ2A 2G9HB 1OGTB 3C8HA 5E6YA 3QQ9D 3QUXA 5CFHA 4PJ8A 1A9BA 4PB9H 3VA2C 32C2B 3VFGH 2QKIB 2I60H 1GZQA 3DETC 1QSFB 2QQKH 3EZJB 3GSNA 3P0GB 4V1DA 3PWPA 1UB5A 4LHUA 3HI1B 4JKPH 3ZLQC 1YEFL 3CDGA 1KJMA 1TCRA 5I73B 1BBDL 1CGWA 4XRCA 3DROB 1AQKL 1X5JA 2X4NA 3ARWA 3PV6A 5IVXE 1ZLSH 3RL1A 4ZYKA 4F9PA 2O93L 1KCUL 1F8TH 5CJXA 2ADJB 3C5JB 12E8L 4L8SA 3KPLB 1FYTA 1T1YA 2ICWA 3CH8A 1YYLH 3VXUD 1HXMA 1YEHL 5E8EA 1P6AB 4U1JA 2EDXA 2FBOJ 1L4IA 2AK4B 3DXAB 1MH5B 4HLZG 3BJ91 2R2HA 4ONGL 3W11D 2XA8L 3TCLB 1KACB 1SEBB 2MOVA 3SGKC 4Y19E 1KGCE 1NCTA 4X6EA 2Y7QB 4HS6A 1A7PH 4O2CA 1JFQL 1SY6L 5IGXL 1VFOA 4LBEB 3DBXA 4GAJL 1TVHB 3HMXH 4FXGA 3LV3B 6CGTA 2DJSA 4U6HB 3RWDA 5GRUH 1MEXH 4P2RA 3F62A 3TZVB 3QQ9C 4KTEL 2Z35A 1QVOB 4I1NB 4Z76A 1C12B 1QG3A 3C9NA 1CLZL 3OX8A 2G60H 2P5EA 1KN2L 4QLRA 4YWGL 3WS3B 1XCQA 3AXLB 4MJIB 1NLBH 3QH3B 3RWIA 5DGQA 4PJXA 2KQNA 4NRYB 2JB5L 4WFEE 4JFHD 4N0UB 4F9LA 1S9XA 1MRDL 1BOYA 3RX7A 4F2MA 1RZKH 1CTNA 2AEQH 2J88L 1UG9A 1NUFA 3QUKB 3VXTB 1ADQL 4HK0B 5EFIB 1V7NH 2AJSL 5JDJA 4OLXL 3RIFK 1UXWB 2A74A 3OGOE 4JB9H 2ZUXA 4NQEA 2W1NA 4X7SH 4C54A 3SQOL 2IEPA 3MRBB 3NPSB 4LNRB 4QF1B 4F7PB 1Y6NR 1TMCB 3ZO0A 1KXQE 1JWMA 1YQVL 2Y23A 3O8XD 2DQHL 1P7KB 1CFTB 1G1CA 5JOPE 2IFFL 4O5LL 2ZCKL 4JPVH 1BWWA 3FO0L 1X5FA 4AIZB 3QG7H 5D1ZB 4JO3L 1AXTH 1OAKH 3W2DH 2VXUH 1OOAA 3S97C 1LEKA 3KDMA 3FB8A 4K55A 4UDTA 4EOWH 3S88H 5IB1B 1JZ5A 4MJ6B 3Q0HA 4JN1H 1H8NA 3HCVA 2OJZL 3IDUA 3EAKA 2QQNH 2YA1A 2H2SD 3DLQR 5TFSH 1P9MA 3LIZH 1CFNB 5GGRB 4KPHL 2FHCA 5E56A 4HWEH 3QDMD 4KI5E 1ONQA 3STLB 1VGEH 1G6RH 2VDPH 1RULH 4PJHE 3QDGA 5EO9B 2AW2A 3GDBA 3G5YB 2HFFB 1DBMH 4G6MH 2ZCLL 4PYHA 1I8MA 3QCUH 5FCUL 1YJDL 2Y06L 4RWYH 4IOFC 5I2IA 3QCTH 2NY2B 1EO7A 3BH9B 2BY1A 5GZOD 4XPAH 1RIHH 5J89A 1DQTA 2W0FB 1FVDA 4HKXA 4KK8C 2BNQA 1G9EA 4FFVD 2FATL 4GW5B 2FX7L 5MEOB 3L3DA 3WUWB 3GM8A 5DJ8A 3MRKB 1P2CB 4LMQI 2DDQL 5IEKB 4WUUD 3LEYL 1Q9WB 3GJFH 3GJEA 5ADOL 2VR9A 5IMOA 4E0RA 1MCWM 4N8VA 1ND0B 3QRGL 2Z92B 2BVQA 3K4ZA 5DQJA 1S8DA 3LKSB 4GW1B 2ADGB 1KC5H 2BHUA 2ADFL 5MENA 2VQUA 3S35L 3BWAB 3MOBL 3OB0H 2O61B 1XGYH 5IQ7L 4Y4HA 1I7UA 2H2SC 3ZDXE 5C9JB 3FO2A 2DYPD 2JJTA 3LPFA 2HH0L 5DUBA 2VDKL 4RZCA 1HZHH 1U8IB 2PYEE 5I1AA 2F9BT 5FYKH 5ALBH 3UP1A 3MRGA 3SDDC 3BP4B 4PRAA 3T2PA 3SKNA 3WS6C 1FL5A 4UT7H 2D7NA 1QRKA 1FZOA 5GZOC 4TUOA 5C6WH 4PGBA 5GGQL 3O6KH 5BZWA 3PXHA 1T83C 4GFTB 3DSFH 4Z5RB 3KPOA 2CDFB 1WLHA 5K9QG 1U8MA 4L8CA 3FFCB 5H94A 3UC0H 4GXVH 5I8EB 3CFDA 1RPQA 3QYCA 1X5ZA 1KLUB 5FYKU 5HYSA 4O2FB 3ZL4L 1RURH 3WLWC 4C57C 5ANMB 4OFIA 5DJDB 1A7BA 1WQVT 1TZGL 4YO0B 4M8QA 1CE6A 1WV7T 3H9SD 3E2HC 3TF7C 4OT1H 4QRRD 5I1IL 1EXUA 1OGAB 2DQTH 3MLSL 1R0AH 1Y0LB 1L6ZA 2X4UA 3QDJD 4L9LC 5C0RL 5I9QC 4F3FB 1E0OB 3V8OA 3RHWK 3QEHB 4MZ3A 3KPNB 1AHWB 1V3JA 5JMOC 5EOCH 3S3JA 3L3HB 4NQDD 4JHAL 1GGYA 3UZQA 3D69A 5KAQF 2NY1B 1NBYA 3OKLB 4HKBA 3UPAA 2Y1VA 2FX9L 1KIQB 4NNPH 1NBZB 4RBPH 4ZPVA 5DZLA 4NO0B 4G6KL 3EYVA 5HGGS 3RBGA 4MX7A 5CD5D 2VDLL 3QDHA 4OZIE 1M7XA 4Y8DC 1WC7B 4MA1B 4PJFF 3TN0D 3CUPB 3Q6FB 5EUOE 1F3RB 4R4BA 5J1SC 3H3KA 5DMGD 2EDYA 2BRRL 3C60B 3DUSB 2FEEL 4XHJC 4ZUVA 4OLYH 3VXUA 1MRFH 1FORL 4RGMB 4QHLB 4ZFZA 1ZSDA 2VDRL 4TNWK 1JHKL 2EDHA 2XG4A 1FNSH 3W39A 3FQNA 4R96A 1BHGA 3TO4B 4B7LA 5JDSB 1I85A 1H8SA 1GGIH 2SEBB 5BRZB 4C56E 2QSQA 2HP4A 2XN9B 4FZEH 2VDMH 5E2UL 1MFBH 2ENYA 2ZNWA 3K2UH 4JM4L 3JV0A 3SN6N 1OP3H 3ARGD 1RHHB 5F1KC 4Y5VA 3REVB 3K46A 3SKOB 5CEZE 5D1XA 5JIIA 4HWNA 1PEZA 4GG6E 4LCYA 4HH9B 1U91B 3P11L 3HFMH 5FO9A 4HIIB 4UU9A 1E6JL 1O0VA 1QFWL 2ICES 4HGWB 4JFEA 2ARWA 1FPTL 4JCLA 1G7MA 2H3NB 4BQBA 2HJKB 3BKYL 3X11B 4ALAL 1U8QA 4M1GL 4MXWL 5HYQA 3ARBD 1YMHA 2OL3B 1IT9L 3MXWL 5ESQA 5CD5C 2CDGA 1C1EL 4DEPC 5KZCB 1XGTA 4XHQA 3OGCB 3MBXH 3QPQD 1JN6B 4Z7NF 1FNHA 1DN0B 3HRZA 2UWEF 4WWID 5DMGC 4I48B 1FV1A 4R2GD 4AG4H 5F1NB 1JNHB 2CMRH 2NXZC 5JR1H 2Y4SA 3L5HA 1BLNB 1JYVA 2HYMA 3MJ7A 4IS6B 4PJEA 5H2BA 1V05A 1MCEA 4PRHB 4LLUB 1DEEA 4WFFD 2HFEB 4FMFA 4MCZA 1EO8L 5E8DH 2XXMB 3O8XA 4O4YH 3DX9A 4J3TA 5EORH 1JMZA 3IDYB 3Q6GH 1UWGL 3ARGC 4PS4L 2O5XH 5J6GB 2NXYD 5C0BB 3CXHK 3IVKA 3JWDC 2OM5A 2OLDA 4BZ1H 4CRPA 5BVJA 5GGTA 2DI8A 2VLKA 1M4KA 3HI6H 1K2DB 3V4UL 3VXSA 5BV7L 5E8NA 1CFVL 3NCCB 3VE0A 4YUEH 1BF8A 1A1OA 3VW3L 3MACH 2D7TL 4JFDE 1HINH 5DURD 5FYLD 2ATPB 1S7UB 3KPQA 4KZEL 5E9DD 3MRQB 5C08E 1B9ZA 5JA9A 1AD0A 4GW4B 4HIHA 3ARBC 5SX5K 2BCKB 1W0WB 4ODWB 4ENED 2V2TA 4UNUA 4LKXB 1S7WB 2R0KH 2FYYB 3C5SB 2D0HA 3QPQC 3LQAC 4TOYH 4UINH 4YDLC 1H8OA 1S7VA 4LRNH 4R2GC 5CJQL 2BNUA 2I9TB 2H9GB 4L1DA 5DVNA 1N0XH 4XMLH 2HT3D 2B4CC 3T65A 5F9OH 3OHXB 3G6JB 2DM4A 3KYOA 5TE4L 1AR1C 2R39A 3MRNA 1HH6B 4Y88A 2N4IA 5F7UA 2H1PL 3MRFA 2YOCA 4NHCL 4Z7VE 1Q0XH 3O3EB 5IG7B 4O58H 3GSXA 2OTWB 3MRDB 1FFPB 4YQXH 4WHDA 5KBNC 3T4YA 4HEME 5E5MB 2D03L 2NXYC 1T04B 4MS8C 3X3FL 1NKOA 2AQ3A 4X4YB 5INDB 2P8PA 4DTGH 2VR4A 3AREA 4KTDL 4WEBH 3HG1D 5D5MA 1MVUA 1WK0A 1LWRA 2PR4H 3BEWA 4NNYB 5C0IB 5IUSA 1QD0A 2GK2A 3QJFB 2ARJB 3T0EB 2X7LB 2JCCB 3R1GH 2DYPA 4PJ7A 4WW2B 1QBLL 3BPCA 1H0DA 3UYPA 4ENEC 3RWHB 4OIAA 4TTGA 1YN7A 4K3GA 1KIRA 4KDVA 3VFVB 5ID0A 1KGCD 2NMSA 1LGVA 1HK6A 3CX5K 2Q8AL 3PJSB 4JG0H 5ICZB 2HKHL 3ALWA 1RMFH 1G9ML 1YEJH 4HH8A 3NFPB 4K3DH 5EWIL 4LASH 2DIJA 1X5XA 2HT3C 5FOBA 1ZLWH 4U1LB 1MFAH 4L8BA 1A4JB 1BECA 4X4ME 4BUGA 1YN6B 5T1LD 2FEEI 5E08H 3KR3L 1G7JB 5GXBB 3DARA 4OGYL 1U8JA 1NGWA 3FFDB 4HQQH 4Y5YA 3IDIA 4LEXH 4IMKC 3BSZH 3MLVL 4DGYL 4ISVA 3IFPB 3QR2A 1SBSH 3M45A 4UDUB 3IJYA 5BS0E 2J2ZA 3ARDA 1BM3L 5EA0L 1HHIA 1MI5E 5DWUH 3MV9A 2DOCA 3SE3A 1FBIH 4Q58C 1FE8H 4U6YA 1F3JB 1SJHA 2CJUL 3T0BA 3U4EA 3TT3L 3MLYH 3M17B 3SOBH 2EH8L 4LVOC 3QDJA 4ODSH 5CZVL 2F19H 4S1RL 3T8XA 3BW9B 4UV7H 4C83B 2EYTB 5F44A 5DA4A 4KJPD 1QLEL 1MCKA 1TJIL 2OXGA 1DLHA 3WKML 4YHLL 4ZS6D 1HILB 1JE6A 3GRWL 3VFSA 3KPSD 3WJLA 1EVUA 3MRMA 1Q0YL 4GG8B 4GXUN 4HS3A 4POZC 3WO3B 1VDGA 3U2SB 4NO3B 3RX8A 5EU6B 5FEBA 4H20L 1Q9OB 2WUCH 1FZKB 3NCFB 3T3MF 3TN0A 3B2VH 4MA3B 2OTUA 4NSKB 5I19L 5DT1H 3OKNB 1YEDA 3L3IB 4L3EE 3DV6B 5IHZA 1F6LL 5A1AA 5BJTB 4X8JA 2FDBP 3CVHA 1MHHB 4FMKA 4YNYB 3LQZA 3VDCA 2QSCL 4FXKB 1IGMH 5IFAL 2F54E 2XQYK 4OD1L 3A6OA 4DFHA 4PJ5B 1ZE3C 3GZKA 3MSPA 3QO1B 1CFSA 1Z3GH 2FJGB 2CR6A 4PRIE 1C7TA 4YE4H 1OCWL 2XZCL 2NNAA 2VIRA 1G1YA 1HYRC 1Q9LB 2UVFA 3O41A 4CMHC 3OKEA 1DCLA 3I02B 3BQUA 3FQWA 4G8FA 4WFGD 2WLZA 4KJPC 3BE1H 3OKOB 1FNEB 4FFZH 2AXJA 4ZS6C 4FQIL 4NQVB 4Q9RH 2YKLL 4M3KB 1KULA 4F7MA 2C7UA 4NZDA 5DEFA 5C07E 4YX2L 4CDGC 4OLZL 3O9WD 5F7NC 4LU5H 5L9DH 1U8KB 4PR5B 4M5ZL 3GSRA 3EOAA 2F8XC 1N2RA 4QRQA 4C55A 2BSTA 4P23B 1OW0A 4HUWA 1G7QA 4OBSA 3ARFD 4EI5B 2O5ZH 3NABL 4BQCA 5FUOH 3OSKA 2Z91A 3TYGH 1ZHLB 4EI6A 3KXFE 3WFHB 1J88A 1XZ0B 4MQ7A 2WINB 4A2LA 3PQYD 4G6AD 4FQLH 3L95A 3BPLC 4Y5XB 4D9RE 2FJHA 2BJML 4I3SH 3SGDI 2V2XB 4OB5H 5EOCJ 5SWSE 5D9SB 3U4BH 1BZ7B 2WBJD 4HUUA 1KPVA 1KJ3L 4Z77A 5D7SL 2VE6B 4NFDA 5JHDD 1I75A 4G5ZL 2UY7A 3AMKA 3DTXA 2FH6A 3MCLL 4BZ2H 5ERWA 3ZDYF 2C3HA 3B9AA 5GGVH 1R3HA 4RMWA 1HOCA 5ALCH 4D2NA 1JZ6A 1J8HE 4HK3J 4IMLA 1ES0A 4W4OA 2R15A 2V7HA 4MSWA 2P45B 4ZOAA 5DMIH 3O9WC 3LZFL 4L4TA 2NY0D 3CPLB 4P46C 4XWOD 3DRQB 4C59B 5FYJL 3RUGF 1YMMB 5HGBB 3HAEH 4I0CC 3V9FA 5ACZA 3FONB 1BFVH 1CGSH 1UJ3B 5HVWA 1MREH 5I1KL 3GMOB 5L6YH 2C4XA 1X3DA 1KTLB 5GGSB 1IQWL 1GGCH 5JW4R 1AXIB 1WWCA 2ED7A 1EEQA 2XTLA 4M93C 3TYFB 4DKAA 1NPUA 4E42B 3W0WB 5IOPB 3T0WA 4AEEA 4PJGA 4APQC 3OXSA 4DN4H 4X5XA 3SGJA 2X70A 4RGNB 5DS8A 2C1OB 4G6AC 3EDKA 3T1FA 2NR6D 3W9DB 5HDBF 2VITA 4L4VE 4R90H 2VL5A 4WEUD 1M7IB 2ADIA 4FHBD 4K3JH 1NAMB 3VFRB 4ZUTA 5IBUG 5DUMH 5MERA 5TQ2L 1NFDF 5CJOH 5IVXA 2H8PA 4WFHD 1I7TB 5JHLL 1AP2A 3NVQA 1FNAA 4GMSH 1ACYL 4NIKB 3KYAA 4ELMB 4BKLA 1LO2H 2VKWA 3BN9C 4EVNB 2Y07L 5E1AB 2D4DA 1NC2D 5IROC 1TJGL 3T09A 4LAQL 2VXQH 1L6XA 2NY0C 2RIKA 2AJZB 4KUZL 2UYLA 4XWOC 5EOQH 4QRTB 1D5BB 4IRSB 1FG2B 4K23L 1JWUB 1OAXH 4RIRB 1QFWM 2YUVA 1C16B 3ULUD 1FFOA 2CIKB 3QO0B 1BD2E 4ZUSB 3WFCL 2XWTB 1B90A 5LKNA 2GCYB 4RCAA 4LHQB 3QWOA 2YN3A 3HE7C 2NR6C 5T1LA 3MUJA 1JIBA 4B41A 4ONHA 4XNXH 1AGBA 1C5BL 3KWWA 3LN9A 4PJBB 4R8WL 3QAZB 2DS4A 2BFVL 1RQ5A 2IH3A 1LEIA 2E5EA 4NQUA 1I1RA 3HNTL 4K9EH 2MNUA 4X6DB 1IGTA 2YPVL 1IBGH 5IW3A 1XGUB 4N0RA 1M6OB 1NKRA 3M1BB 2EKJA 2W92A 4LPWA 4OIIH 1E27A 1M05A 1TLKA 3D18A 4NUJB 5F96H 1SYSB 2K9UA 1ZHBB 3C08H 1E6OL 3SKMA 5IMKB 3P4NA 1V3MA 4LSPL 2VLJD 2MQCA 3DI2B 2AABL 4HV8B 3UPRB 4JDVA 4FABH 1QLFA 3E3QE 4AT6A 3C09B 5GGUA 5DD5L 1WBYB 4FP8H 1A64A 1FSKB 1T4KA 1GSMA 5I1CH 2P1YA 1A6UH 4NN7B 4CU7A 1M7DA 4L8DB 2ORBH 5DD1L 4QXTA 4H0IA 2VZVA 3ZKND 4IOIA 3ULUC 3ORJA 3R0MA 3TBWA 4H5SA 1YC7A 4NKIL 5J13B 3VG0H 5E2TL 5I8CA 3S6CA 4NKQB 4F33A 4JFQB 1LNUB 4WTWA 4JO4L 4KROC 3P3YA 5HGDA 2C4FT 1CGTA 3GBNL 4QXGH 4RFNC 5C08D 2R2BB 3MRPB 1L7TL 1HCVA 3OAUH 3ARXA 2AEPL 3FT3A 1YDPB 2L0DA 4OZGE 3ARSA 2EYRB 5DHYB 2YPLB 5BV7C 4P0DA 2X4RB 4X6CE 3SDYH 4PJHA 3N1FC 1MVFA 3WHXA 3N85H 4PYGA 4UV4H 4GAYA 4WJ5A 3H3BC 2ZPKL 1BMGA 2PYFA 3RVXD 4M7ZB 5D1QD 1VKXA 1FIGL 3HRPA 1A6WL 5KG9A 2OS7A 5DK0A 4PJBF 1RUMH 3GMRA 3QUXB 3FL7A 4PJ8B 4TN9A 1A9BB 1EUUA 3GO1L 1HKLL 2R9HD 1EEZA 1F4WL 1GZQB 5HPMA 2X42A 5F1OB 3GSNB 4V1DB 1UZ6F 3EJYC 3PWPB 3FN0H 1UB5B 4LHUB 3KGRA 4AQ1B 2Q7YA 5A2KH 4KXZH 1WIPA 3CDGB 1TCRB 4R7DA 3FB7A 2X4NB 1CDYA 4ZYKB 3PV6B 3RL1B 5KW9L 3ZKNC 1LP9E 3CFEA 3KJ6H 2GIYA 3CMOH 3K1KC 4M4RA 5IQ9A 3WN5A 4L8SB 5LVEA 4XPBL 3HI5H 2PCPA 4MXQC 4XP5L 1FYTB 1T1YB 3GIZH 1HXMB 3ARFA 5E8EB 5E99L 1A4KB 3QFDA 4X7CC 2Q20A 2Z8RA 3ZT5A 4BA8A 4R4ND 3B8YA 4HIXH 3B5TA 5ISZD 2R2HB 3WNMA 3RVUD 3BX7C 3QWRA 5IF0B 1FNGA 4BSWA 3S34H 5ILTL 4X6EB 2RGSA 4HS6B 4MA7H 1T03H 4O2CB 4UQ2A 4H8WL 4QHKI 3DBXB 2MCPH 4LDLB 1D3CA 2DQDH 4FXGB 4M9OA 4ZFGL 3RVXC 1S7RA 1IFHH 2WBJA 5I6XB 2VLLA 5D1QC 3RWDB 5JLZA 4P2RB 2YD3A 1KEGH 2J5LB 2Z35B 4RFEB 2VC2H 4Z76B 3C9NB 1KUMA 4GRLD 3VRJA 4M1DH 3OX8B 2EIBA 5D8JH 4U1NA 5SX5H 2P5EB 4YHML 3O2DL 2HJFA 1XCQB 1G9MC 2B1HL 4H26A 5EZJA 3VXPA 3RWIB 4XTRC 1J0YA 4Z7QE 4PJXB 5ITBL 3GNML 5FGBA 1S9XB 3SY0A 1SJVA 4ZO7A 4F2MB 3LKNA 3KPTA 3EOTL 1B6DA 2VZSA 2Y5TA 3AS3A 3WIFB 4G9FE 1R24A 3QHZH 4M7KH 4X8XA 3OBAA 5TPWH 2A74B 3QXVA 1J0IA 4HWBA 2OP4H 4NQEB 5BZDB 2BC4A 4R4NC 3PWUA 3UROR 1LE5A 3EJZD 3O3DA 3RVUC 1JWMB 3MV7D 1IKFL 1LO0L 3B5GA 3L5XH 1KCVL 1M71A 3I9GH 4UBDD 4OZIF 3P40A 1VESA 3A6BH 2DQEH 2J4WL 4HXBH 1I9JH 1LEKB 3KDMB 3FB8B 5HHVH 4UDTB 1S9VA 4PFEA 4P4RA 4NNXA 1NC4A 1RZKC 1JPTH 4UB0L 3B9KD 3G6AA 5F9JA 3IFOA 2R29H 5GHWH 1RJYA 2D31A 4XNZB 2PN5A 3HCVB 7FABL 5EUOA 2B0SH 2H32A 3TBTB 5HYJD 3SDXF 5JW4Q 4S1SL 1ONQB 3RWJA 4DGVL 3SKUD 5I8KL 3B43A 1NC2A 5DR5L 3QDGB 1O7VA 5I30H 1FAIH 1QEWA 4XAWH 3KVQA 3C6SA 4TQEL 1TJHH 2VQ1B 4OM1H 1I8MB 1IGYA 1EBAA 2OSLA 3VFPA 1ZAGA 5I2IB 4KAQH 4GG6F 2EXYD 4BJLA 3EO9L 3P4MA 1A6PA 4C56A 4PRID 5LCVH 2OR8A 5A3ID 4OCNC 1NDGA 1KENL 1O