3L9YA

Crystal structures of holo and cu-deficient cu/znsod from the silkworm bombyx mori and the implications in amyotrophic lateral sclerosis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
PAKAVCVLRGDVSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFGDNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDAGVTKVSIQDSQISLHGPNSIIGRTLVVHADPDDLGLGGNELSKTTGNAGGRIACGVIGLAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in amyotrophic lateral sclerosis
doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3l9yA00
3GQFA 3MNDA 3S0PA 2VR8A 1DO5A 1EQWA 1IBDA 2AF2A 4MCMA 5KBMA 1HL4A 4OJAA 2AQQA 3F7LA 3PU7A 1Q0EA 2V0AA 1OEZW 1ESOA 1JK9B 4A7TA 2APSA 1F1DA 1PU0A 3SODB 4N3TA 1F18A 1SPDA 1E9PA 1N18A 2ZKYA 3F7KA 1E9OA 3KH4A 2NNXA 2WWOA 2E47A 1CBJA 2Q2LA 2WYZA 5KBLA 1XSOA 3GTTA 3CQQA 2GBUA 1HL5A 1DSWA 3QQDB 1SXNA 1IB5A 2LU5A 2XJLA 3KBFA 1U3NA 4A7QA 3HW7A 3RE0A 1E9QA 2R27A 1SDYA 1SXAA 1SDAB 2C9UA 3T5WA 4A7UA 4FF9A 2ZKWA 3HOGA 2WZ5A 1FUNA 2WKOF 2AQTA 3L9EA 4OH2A 1CB4A 3LTVA 2AQSA 4A7GA 3H2PA 1COBA 2XJKA 1SOSA 3HFFA 1P1VA 1YAIA 1L3NA 2JLPA 2AEOA 1MFMA 1S4IA 3ECWA 3L9YA 1BA9A 2WZ6A 1QUPA 1F1GA 1SXSA 1N19A 4BD4A 1XTLA 3KM2A 1TO4A 1XTMA 2AQRA 3CE1A 1OZUA 1YAZA 1UXLA 1RK7A 2GBTA 2JCWA 1E9PB 2Z7WA 1OALA 1OZTG 1PTZA 3QQDA 2SODB 1BZOA 1IBFA 1Z9PA 3ECVA 1KMGA 1SXZA 4L05A 2C9VA 1B4LA 1JCVA 2K4WA 2E46A 1YSOA 1JK9A 1EJ8A 3GZOA 4U4IA 5KBKA 2GBVA 1OAJA 2ZOWA 2VR6A 3KM1A 4B3EA 2C9SA 4MCNA 4N3UA 1UXMA 1SXCA 2Z7ZA 3KBEA 4BCZA 1IBBA 3ECUA 1E9QB 1F1AA 2WZ0A 1IBHA 3H2QA 4BCYA 1B4TA 1SRDA 2Z7UA 3K91A 1AZVA 3GZQA 2ZKXA 2VR7A 3KH3A 1SXBA 1TO5A 3GZPA 4A7SA 4A7VA 2WYTA 3MKGA 1Z9NA 2WKOA 3GTVA 2AQPA 5CU9A 1E9OB 1PZSA 2WWNA 2Z7YA 4A7GF 2AQNA 3CQPA
chains in the Genus database with same CATH superfamily
2AJYL 4OB5H 3EYVB 2B7DT 4PBDA 4U49A 4KTEH 2BVYA 4WCYL 3BUYA 4ALAL 2HFFA 1PCXA 1UZ8B 4OGYL 5T3XL 4KX8A 1F02I 3W56A 2WXHA 1NLDL 32C2A 2WLHA 1SBSL 2NCMA 3DX6A 4Y4FA 2AV7B 3R19A 2ENYA 3NDZE 3X3FH 4DWHA 4RRPA 4HPOL 3S2CA 3QPQD 4X4KA 2GITB 1GZPB 4HKBA 4L3EA 6CGTA 3KPRB 1BVOA 1ZV2A 1KTDB 3BHBA 3KGSA 4M3HA 4YPJA 3UABA 3AY2A 5B39B 2H0FA 3F7VA 5DQJA 4DQOH 4G80B 4OFQA 4TSBH 4WTZG 2C4XA 5EOQL 3D85A 5GJSL 5KYXA 5C0CB 4DQAA 4OM0L 4N2MA 3AGVA 3DBSA 3MCLL 4FTVA 2QDVA 3I2CL 1TVBA 4K0OA 5E0QA 2JKJA 3ELAT 1I3RA 4WF7A 1N64H 5KAQF 1UD8A 2Z93A 3ZLQC 2PP8A 3B9KA 3ULVF 5L2KD 4ZI8A 5K69A 1E2WA 2XJLA 2ZCLL 1D2OA 3T6VA 5BV7H 5DD6B 1UA6H 2PXYA 3O6ML 5FA3A 3O2DH 5FAAA 2C3HA 3T1FA 3UYRH 1OGTA 1T3FB 2FYYB 1UASA 1L3WA 1AG6A 2C7FA 4Z7VF 4L4VA 3MLVL 3WD5H 1LO2H 1EO5A 1T5WA 2QSVA 5KSVA 1TQVA 4JDVB 4R6UA 3HPLA 1K5WA 1TZGL 4NN6B 3S8GB 5HYSG 3QIUC 3TEXA 4ONHB 2DBJA 3HC2A 5ESAA 2DWEA 4GRLB 2XQYK 4E9RA 4IEFA 3MLPA 1WAAA 1ZRUA 1E3ZA 5F89A 3HG1D 2VISB 1MEXL 3Q6FB 1EIBA 2AJSH 3CFTA 3N42F 5J06A 5EUOF 1HC1A 1ICTA 3AFLA 4MNHA 2DQFA 3QUYB 4IRSB 4X6CA 2PP9A 3KAAA 4OM1L 3HG3A 5FO8A 1JF5A 4Q6YA 1N6QL 1R3HB 4ZAKA 2A74C 4I3GA 4OF6A 1UB6B 2ZKHH 2ALWA 4GSDH 4LOVA 4YHZH 2BVPB 2XVLA 4NP4H 4PJCE 3UTPD 4YIQB 1JHKL 4LBEA 4LVOB 4PUBL 4UTAH 4I9XA 5B3JF 4OZIF 4N2AA 4RWHA 1WISA 4NXSA 1OSPL 1MIEL 2A6JA 4OLVL 4Y5VB 3RDJA 1AR1B 4XB7A 1BBJA 1JHTA 4ICWA 2X7LB 3RDTD 2OI9B 2WIIB 5HHMB 3KPMB 4IOIA 5DZAA 1FSKB 3CVBA 5AVVB 3UC2A 2DWTA 2X6BA 5GRUL 4BDVA 5HVHB 2PYFB 1TXKA 4IBYA 4XP5L 4Q9QH 2JKSA 5CCKH 4YHNB 4M7KL 4TUUA 2ZG1A 3FU8A 5A6MA 5L9DH 3QORB 1ERNA 3DRQB 4CC4A 5IT2L 1Z32X 1DQKA 4TM9A 4J6RH 4PGEB 1WBYB 1EHAA 5F8RC 1ZANL 1KGJA 1XGRA 5CP7A 3VSTA 3EYOB 3LB6D 5F72S 4PEEA 3PAZA 1CGUA 5DWUL 2HLAB 3KE0A 1OARH 4WQOA 4FNSA 5D55A 4LSQL 1ZD6A 5IW6B 2H2SC 2ZNWA 3LY6A 3GZKA 3A6CL 4XCEB 2DQ6A 2VC2L 3S3BB 2V7NA 3RWDA 3X12A 3PP3K 2VERN 2VDNH 1I85C 4N86A 3PREA 1XCWA 3QEQB 1E50A 5E95B 2C9PA 4X80L 2Y7QA 4HOXA 3EFFB 3DVFA 1AO7D 3QZWG 3OLIA 4XP9H 4IKLA 4LRIC 3ZVVA 1QEWB 5H37H 3QULB 4U1NA 1CB4A 4O02H 1OSZA 2OX5B 3F6JA 4HBCH 4CJ1A 4PJIE 1YY9C 5KS9B 1OCRB 4EKXA 1BDYA 1RHHA 1P5UB 3PV6B 5IM7A 3OR6B 2EYTB 1ZGLM 4KRPC 1TQCC 2CXGA 2DQEH 4FNLL 2WLIB 2EICA 3TCLB 3CFKB 1CD0A 4LSVH 3THMH 3ARDB 4FG6D 1T83A 3QDAA 4NC0B 3DA0A 4N0UB 5C6WH 3JSSA 5LNDA 1IGTA 2DB8A 3DOHA 3MBEC 2P49B 2WB7A 4LCUB 4LXFA 4KDTC 4DT2A 5F21B 3LQAL 1MWAL 2X53A 5HGAA 5L8KB 3EH5B 2VN7A 4XNYH 2P7TA 1PYWB 5E6UB 3U9UB 4PSPA 4HMCA 3QIBC 3FHQA 3BGFC 3UTQA 3REVB 5E5UB 5I6KA 2GBVA 5D4JA 1CE1H 5AWNH 4NZUL 2QZQA 5C07D 4AQAA 3HNTL 1O6SA 4NO2B 4DKDC 1WAPA 4HDIA 1HI6B 2R69L 3DSNA 5ILTL 1TF4A 3ZKQD 1LEGA 1OB0A 2BH0A 2OCJA 1BYPA 3FT3A 3RNKA 1I1AC 3ZDZF 3OGCA 4F37K 1A7NH 1PW3A 4EIZC 1FNEA 1WPCA 5CUSH 3MV8E 5JW4N 2AQPA 3H8NA 4PJGA 1DEEB 3WNMA 4HIHA 2Y5EA 4HIPA 3PIQA 4S1QL 4YK4B 3O0LA 2Z92B 3BPLC 4U3XA 3VWKA 3UZVA 1P6AB 1FG2B 3CCHB 1BMWA 2F1AA 5CSGA 1JD7A 5D1ZA 4AVIA 4YZWA 2WUBL 4TXVB 2VXTH 2ORBH 2WVTA 4OJAA 3SPVA 2WP3T 3VWJA 2R1WB 4UTBH 2RH0A 4HCRH 1W6LA 3WNNA 2WNKA 2F7OA 4Y4KC 1EH9A 2WBWB 4HK3N 4XMUA 5K39B 1XGUA 4F9PA 3GMOA 2K3HA 4JMNA 3D52A 4KV5E 1SBBA 3SDCD 3N40F 3BMVA 4FXTA 4LQ1A 4K71C 4IBWA 5DJ6A 4X5XA 2YMXL 4ZT1A 1A6TA 1WZAA 3WNIA 3SZ6A 1GS6X 4R2GB 1KIQA 3LIZH 4H20L 4QRPA 3NOIA 2Q2LA 5G4OA 4C4UA 3BDBA 3TH4T 3TTSA 3HS9A 2WBJC 3CC1A 3IGAB 4OUUA 4DAGL 1G9EA 4D3CH 2IBGA 3QFDB 3BWUF 3DIVA 2BNUA 3KDPB 2H6OA 4YXLH 2E27L 2CZNA 4YFLI 3TLRA 3AT0A 4CSTA 4BGDA 2PUQT 3VXUE 3WIHH 2K4AA 4N8CH 2XQBH 3E6HA 3F3HA 4WW1A 1UJ3A 4G8FB 1FVCB 1S5HB 2K9FB 3MRCA 1N0LB 2YPLB 4DP6X 4M4RA 4LVHC 1MAML 1QTSA 4NUQA 2VLJB 3GMLA 3NJXA 4LPCA 4DTGL 2HA1A 2YO3A 2JLPA 3BRGC 1KIUA 4PRPE 5IW3A 1EZVY 4JDEB 2FT6A 4GAFB 3Q3GB 4LPWA 5DZNA 1E3FA 2J8HA 1NANI 5DGRA 3VD0A 1JVKA 2BDNL 2VQ4A 3IDJA 3QT2A 2ZONA 1J9CT 2E7BA 4OVVA 4WO4A 5F7HA 2CIKA 4AGMA 4Z7VB 4Q14A 4YBHA 4PJ9D 2EE3A 3BWSA 3H9SD 4HXAH 4OCRL 4PJEE 2HT4D 1CFNB 3PDOB 3IKCA 2B3RA 2PCXA 3W5MA 2JI2A 5IOPB 3G9VA 3CZLA 3GMPB 2WQUA 3L9RB 1LK2A 5GS1A 2BIQA 2VO8A 4XO4A 2ADGB 2QZ5A 2WQWA 1RIHH 1UEMA 5EU6B 5IFJB 3E3QC 3M17B 3N85H 3O3AB 3PWNB 4G72B 4ONGL 4X9IA 5FK9A 4AIEA 4LP4A 2MWCA 3DPBB 3II2A 4JFOA 5T3ZD 3N42B 1B4TA 4DERA 3UTSD 1VFAB 4P06A 2YAPA 5EUOB 3ZDYB 5AG9A 1YEDB 3D05A 5TDOB 3SDDD 3F5WB 1UUSA 3N3EA 5AL0A 5D7KD 1E42A 4DN4H 5JR1L 3QDME 4V1DB 3OKKB 4XVTH 3EDKA 4P9HL 5E94A 2OMNA 1QMUA 5AVRB 5E00B 3WLWD 4PTTB 1U3HA 1ZWIB 4G6FD 3VQ1C 2YXVA 3FH8A 1FNAA 1TZAA 3A4EA 1NCCH 4OZIB 4Z5RA 3VSQA 4X7DC 1CLYH 3OXSA 1I8LA 4XVUD 1NBYA 1V7NH 2X89A 1HXYA 5E6IA 2E7LC 3QFJE 4P4KA 1LXMA 2YOAA 1XGQB 3M1BA 1DFXA 1P7QA 1JK9B 2PETA 4WK4B 4CRPA 5CCGE 3MYZA 4AKOA 3H2WA 3NTCH 4P46C 1PAZA 2WBXA 3NFSL 3SDAD 4HCGA 1UFGA 1CFQB 2ZQKA 5CD5D 3X1GA 4I18C 5KVMC 3H7LA 3KH4A 1OGAB 2HFTA 3HC4L 4JK0D 2EDJA 4LMQI 4E68A 4UYPA 5HJ3A 1TNMA 1CDIA 2VKWA 2YRBA 2BFVH 3H3PL 4Z3IA 4UBDD 1J11A 4AY0A 4XNZC 3AM8C 3GEFA 3TT3L 3X11A 4CW1B 1KJ2H 1O75A 4S10A 1ASPA 1JV2A 2VMEA 2WWMC 3L4VA 4Y1AD 4IGBC 4PWIA 5T3ZL 1A21A 4Z0XB 1KFAH 2P9RA 5KVGL 4HJTA 2IFFH 1TETH 2VO5A 1XCTA 2D03H 2FH6A 4LQFL 2NTSP 1ROWA 1IM9A 2W0FB 3TJHC 1NCAH 4N2FA 1RZIB 4XPBH 4QHKI 1YNTA 2WLKA 3AXLB 4MAYD 3SDXB 4D7BA 3WMSA 1OD7A 4DFIA 3MRHA 3BQUC 3VI4A 4B53A 1LQBC 1ACYL 1LD9B 3LKQA 4UB0H 5EA0L 3M1CA 4GG6E 5I5RA 2FGWL 1IGIH 1SHWA 1Z9PA 1ED3B 5LDUA 2VLKA 2JCCE 1KXVC 5L2KB 4M6AA 3GHPA 4WSKA 3A4AA 1JCVA 4P5MA 5DMIH 1TU2A 1WCBA 3BCFA 1R75A 3U79A 3H9HA 2D0HA 5CJOL 1XCXA 1BG1A 3ME0B 3FT9A 1RJZB 2CGRL 3K4AA 3NIGE 3OKEA 2VMFA 1MFCH 3HC3H 3ZO9A 5EEUA 4KPHH 1HKFA 4WHDA 3UAFA 3T9WA 4NUPA 1KIPA 5C09A 2O72A 3RL2B 3KPPA 4F7KA 4CNIA 3GHBH 2NOYA 4QRUB 1NGXB 3MCYA 1VFOA 4KKBC 2GIXA 2Y1YA 3HG1B 4YC2B 1AXTH 4EI0A 4P3CL 4OV5A 1L0XA 4RX4D 3HUJA 3UTTE 1II4E 5DUML 2VC2B 5CLXA 2VW7A 4JZNB 1ORSA 1W8EA 2FWOA 3ZDZB 3U0TA 4CGTA 3OF6A 4TUOA 5JPMB 4GKNA 5E2UH 3IXTB 2BCKB 3PU7A 3GFUA 2NX5A 5KOVC 5I1AB 1QUNB 4PI0A 4NCDA 4YSRA 4ZQKB 1F1DA 3US1A 2B1HL 5BXFB 3ELQA 5JDSA 2Q86B 4XPGL 5B4MC 1BQHB 2CLVB 2R1XB 5B1BB 4JJ5B 4HXBL 4DGIH 3DMMA 2JK5A 12E8H 1MFBH 1EHXA 5F70A 1U8NA 4MJID 5FYLH 1QFPA 5J11B 2A3TA 1JFHA 5C0AD 4RH4A 1J8HE 2ZCHL 4LF3B 5EUKB 4P9ML 3UBXA 5AKRA 5K9JH 1P6WA 5B7MA 1SFHA 3GHEL 4P99A 1GZHC 3I50H 4WDIB 1IBGH 5EBMB 1KULA 1AIFB 3WFDL 1VFUA 1V55B 2R2EB 3L3OB 2J12B 3M8OH 3SYCA 1MWAB 4M6NH 1HKLH 5DZPA 3HVDA 2XICA 8FABB 5F1IB 4Y4HA 4MD4B 2XPZA 3TT1L 5DJXB 3U4BH 2H5UA 1MHHB 1KN2H 1UD2A 1EEYA 5F7KC 5D2NA 3ZKMC 1J5OL 4EI6A 3U4KA 5CD3B 5A2BA 5L4FA 3AWEA 2XA8H 1R24B 1EAOA 2V17H 4EXKA 5AZEH 4BD4A 2Z4TA 1MJUL 5C08A 3ROOA 1KCSH 2WV3A 4CMMB 2UYLA 5B8CA 3HNVH 3C87A 3BUDA 1R5IB 2L7UA 1HZKA 3FSOA 2J2ZA 1S7TA 4L3EE 2E59A 4FJYA 4PLJD 4MD0A 1AO7B 3K0YA 3P77A 3HMWL 4Z7UF 3ATAA 1YDPB 5JHLH 4UV7L 1B9ZA 4GBXD 1U8HA 3CK0L 4PREB 4JN2A 5DHVB 4AK2A 1SNRA 2VWEC 3SDYL 1YZZA 4FTVE 4R4ND 4I9WE 1D5IL 3LXUX 5CJBA 4A2EA 4L8SC 3BT2L 2LTQC 3TA3C 1GHFL 3PLYA 1ZKAA 1UWEH 4RZCB 4E2OA 4JFQB 3FO2A 4HKXB 2NSQA 2EO9A 4NRXB 1K4CB 5MENA 5DRNB 1HH6B 3UP6A 5B38B 1G6RL 1C08B 3ILPA 2OYLA 3IGKA 4ZFGH 2OMYA 3JVGC 4X9YA 4G6JL 3R06B 5ABAA 4LCCB 5E2VL 2ZE0A 3O8XA 2YN3A 4L4VE 5IWLA 2DJSA 3OTTA 3LEXA 5FECA 2EE0A 3OQ3B 1EAQA 1EMTH 1LP9A 5DA0B 3LXCA 2KZKA 5IB4B 5GZOD 5C07B 2PYED 2K1MA 3VG0L 1KLUA 3K7UA 2V0AA 3FB6A 2ADFH 3ZBMA 3LJ3A 1WAAE 3JV4B 1H9DA 4NQTA 5AVSB 1SPDA 1C7TA 3CFBA 4AL8H 1PEZA 4RNRA 1JAEA 2Q3XA 2EEDA 2E47A 4H44C 4KUZH 2DJ4A 2QHRH 3VXTA 4KJQC 4FA8A 5D2LA 2HT3C 3U0WH 5FM8A 3WO4B 5IQ9B 4MB5A 5FLUA 4QWWC 5JYMA 1AQ8A 3VXQB 2LU5A 3O6FB 1T1ZB 4KI1A 2FECL 1FNHA 5G5DA 2I7SA 2W9EL 1F6AB 2XKNB 2VQ1B 5FLVA 1X5YA 2BINA 3LS4H 3PWVB 5BRZA 3BUTA 1YPZA 3HB3D 4G7YL 4KQ3L 4MVBC 4KWUA 1E67A 3ZQXA 4EIGB 4XC3L 4LPVA 1K8IA 4NDMB 4WLCA 4L3AA 2PW1A 3C5ZC 4JB9L 4JFSA 4LDLB 5C0BB 1G6VK 4HT1H 2H6PB 3SDCB 3PF2A 4W9KC 3FB8A 4GFXA 2A6IA 3PHQB 4QNPF 5D7SL 3C6EA 4NKOB 2W9DH 3FU9A 2EXTA 4NN6C 5F96H 4AIZB 1QFWL 1DLFL 2VLLA 3WMPA 4XZ4A 5I73C 2WC7A 4PJAF 1PMYA 1BEYH 4L8CB 1BV8A 1Z3GH 1Y18A 1JFQH 3MODH 4JR9L 4ACTA 1BPVA 1LO3L 5EIVA 4D9QE 5TE4L 2BVEA 1YNLL 2AKRA 1EK3A 4FXGB 5EU5B 3T3MF 4N8PA 4NO3A 1CLOL 2Z31D 4QRBA 5FO7A 5ADPH 1F0LA 2X4PB 4OLWL 1VADB 4H8VA 2J5LB 1HOCA 1JUFA 1A25A 4M61A 4HLJA 2VR5A 3QZNA 4PN6A 5DR5H 4PYHA 2WK2A 1H3VA 4K15A 2J21A 3TN0D 1YNKH 2IPUK 3AVEA 3H54A 1KYFA 3GTVA 4FTDA 5DMKB 2FIKB 1ZEAL 3GSXB 4K3DH 4Y5VC 3V0HA 3UG3A 3I84A 3ETSA 1IBYA 3FOLA 4LCYA 5E8DH 4NJAH 4NNXB 1A6VL 3RGVA 3LEYL 1J9QA 2Q7YA 2VDLB 4K5OA 5GGSB 2OI9C 4PJ9B 2J1XA 3ZRCC 3ZE0E 5TPWH 1MCRA 1FSKC 3V4UH 2FTAA 4OJFL 5D4IA 5LCVA 4ERSH 5D1QB 5HVHC 4DK6A 4YS4A 2MRYA 3VXPA 1AANA 3CUPB 2DM3A 3QORC 1QWNA 3OMZA 5MP6H 4Z7WF 1WT5A 3T04D 5AYUL 3MOQA 2P42B 4M5ZL 4QCIB 1XZWA 3UTSB 4AYMC 3O4LD 4ZUUA 3UCQA 4K07A 1SOKA 3RFZC 2WWOA 1DVYA 1NCGA 2JWYA 3HAEB 4OIFA 3R1GL 4D8OA 4ZX6A 1E7VA 4G6FB 5JIKA 1JXDA 3DUHA 2K8QA 3MFFA 3KPSA 3CLEH 1FYTA 5BO0D 1T1WA 1WFJA 2B2XL 5I2IB 3MXVH 1WWCA 3K6SA 3MJ7A 4PCKA 3P4LA 1MXGA 2AV1B 3T2QA 1U8CA 1MG3C 1JNLL 1J1XH 4D8PA 3B5HA 4OF7A 5HXMA 4HZLA 3DOSB 5LBSL 3VRLE 4L1TA 4PJGE 4TNVK 4HWZA 3C6SB 3BGMA 5A40E 5CBAB 2VW6A 4H1LH 1KCRH 4TVPD 1P5UC 4P2RA 5E7BA 4XNMB 3SDAB 1U8IA 3OB8A 2BWDA 1MCSA 1JPFA 3DX8B 1OM9A 4W70A 5AL8A 3FUJA 1C1EH 2O6EA 3O45A 3WNPA 1ETA1 2H26B 2OMUA 1OALA 4XO8A 4PGDB 1OAZH 3BP6B 5IKCA 3ES6A 1W91A 3CGTA 4UQ2B 1J7VR 4DPRA 1QBAA 2OJEB 2X1XR 2PPAA 1TYRA 1FPTL 5DC2A 3CHXA 1TTFA 4Y1AB 1A6ZB 3D4YA 5CEZL 4N28A 4B9CA 3RX9A 5BVPH 1XCQA 5DT1L 1V10A 1N59B 2NY7L 3G5XA 4HLZG 5HYQA 4QRPE 1S9VB 1DN2A 3QUXB 3GIZL 5IBTL 1I7RA 1GRWA 2XWBB 1T4KB 1Z6JT 1GMIA 1P4IL 4MAYB 4PB9H 1SY6H 3TOPA 4GS7B 4Y8AA 5E5MA 4H8WH 2HTKD 4Z7UB 2UX6A 3W9DB 4Z77A 1KLFA 4K3EH 2MMXA 4Z7NF 3MUY1 2BWQA 1QRKA 2QQNH 3OKDA 1T6BX 5BMFL 1S7UB 5L88H 2GHZA 1IQWL 2QFRA 1W80A 3JXAA 1DQMH 3TPUA 4YK4C 3KYOA 3V8CA 4TSAL 5DEFA 2P24B 3QIUA 2HN7B 4I8DA 5SWSD 1BAWA 1L7IL 1LMIA 4J3VA 1VACB 1JGDA 4GUPA 3QZWB 4TVPL 2ZWKA 2Z8RA 1WP6A 1QLEB 5F9OH 4IBZA 3RFRA 1AP2B 2NYYD 3SO3B 2PNDA 3JTSB 4NWTL 1JNHA 1X5ZA 4PSRA 1N10A 3N1FC 1ZLSH 1BIIA 2OR8A 4WGKA 4HUNB 3QPXH 4APXA 4WI3A 3GB7A 1S9XA 4X9HA 5BO1H 3ESVF 2ZPKH 1TQWA 2ZOTA 4R2GC 2A74A 3CHSA 4ZFOL 3QJZA 1HHJB 3HI6L 4KU1A 2EIZB 5KVFL 1Y1DA 3BDXA 1JJUA 2NY4D 2OYMA 2WN3A 1EEZA 3F6LA 3ULUL 4M1CD 2VL4A 2AQSA 4GIAA 4ONOA 5CKGA 4ODWB 5EMYA 4YSUA 2XFGB 3SKJH 3ETBJ 2XX1A 4I0KA 1J1OL 1R3IL 4KUCD 1JWMA 1NCWH 4KHXL 1WO2A 3EDJA 3UMTA 1I1YA 4GQZA 4X7SL 5EZPA 3UTZA 3JWNC 2EDDA 1QLRB 4MJIB 3ZKSD 5EC1A 1S7QA 4XPTL 3BAEL 4HC1A 3DK0A 5C0AB 3WE6B 2A6KB 1QYGH 2X2JA 4HAKA 4W81A 4LBAA 5GS2H 1NDGA 5D7EA 2QELA 1OAUL 4P23D 3GKWL 2R83A 3RAJH 5J8OA 3ML8A 4M4PA 5CINL 1G6RB 3GSNA 3WUZA 4I1PA 4UI2A 1IM3A 1FNLA 1G9ML 4UNVA 5A2KH 4MSWB 1XF5A 1MCCA 2K70A 5E8NB 3QHZL 4XRCA 3VVWA 1U4EA 1EXUA 2V33A 3JV5A 3V7MA 3QWOB 4XE5B 3FCGA 1WHOA 4ODXA 1U91B 4OGZA 1NUFA 5KYWB 3MLYL 4JS7A 2ZUYA 4PJAB 4AUYA 4LP5A 1I85A 4JAMB 5FGCB 4K23H 3R8QA 4G3YL 4HIXL 4S2SA 1U95A 4ALAC 1CO1A 5FUZL 3FF7A 1HSBA 4HALA 4Q6IB 1DSFL 4HWBH 5HGHB 1P7BA 4C57C 1UXSA 4LRIA 3S37X 2HKFH 2GK0B 3G08B 3GSOA 3VXSD 3T3MB 3C8KA 3ZKND 2I32A 5K5YA 4PGJA 3RY5A 4PRNB 1IGJA 5FDWA 4RRPM 1YEHH 1SZNA 2VM9A 5HHXH 4N1CA 3VYOA 1DO5A 1JYNA 3SSGA 1KJ3H 4GKSB 1CQYA 4YHKL 4AKPA 5MI0B 3UYOD 3KYNA 3EJZC 5DEGB 3QUMB 1QI3A 5AUMA 3LHAA 1VDGA 4NKIL 3TBCA 1KC5H 3P0GB 2X4RB 4GBXB 2BP0A 1HIML 3HNSH 1K4DB 3BX7C 1S7SB 3VI4E 3QZPA 1E5CA 1SQ2N 1W8NA 3CLWA 1JPTL 2V7HB 3FUEA 1VESA 3WGVB 4AYSA 2KKQA 1UVQA 3MGOA 3PG2A 2VLKE 1NJ9A 4R7XA 2BIHA 4N6RA 1X5FA 5E8EB 3RNQB 5LGYA 2L7JA 3AJ7A 3CC5A 3U25A 3K5RA 5AB2A 4DKEH 2IOIA 1KPVA 3KYKH 1M42A 1VGEH 4XHJC 5C0GA 4Z7WB 5JXEC 3ULVH 3N55A 4A7QA 1A7PH 1KACB 3AGWA 1I1AA 4QXGL 3G5YA 4AMKH 3MRQA 1BZ7B 3RJOA 4MJ5B 2JJTC 5TFSL 4JRXA 2FLRT 2VZVA 5C09E 4FDWA 4RFOL 4LE8A 3GGWA 2PYEB 4WK0B 1AGCB 4PG2A 3ETTA 1P6FA 1N26A 4JM2D 5CGYC 5GIRA 3PGFL 1QFUL 3S3SA 1ZS8A 1Q1JL 3OAUL 4LLVA 2BIIA 2ATPA 3HUJE 2AQRA 1RZQA 2DIAA 1A8JH 1ETZB 2E86A 2VSMB 4N0FB 1PCSA 5DMYA 1MHPL 4BUQA 2NXYD 2OMXB 4RFEA 1NLDH 4PGCB 4Y1SA 4Y4KA 5AB1A 3DGGA 3P30H 3D0AA 1KB3A 2A6DB 4FCHA 4XNXL 3BAKA 3VD7A 3MNZA 2L7QA 4GFTB 3RX8A 4AGNA 5HHQA 3HI1B 1YSOA 1KBPA 1CLZH 1BLIA 2XSKA 3L08A 3QBTB 3HB3B 1OAYH 3BISA 4ELKA 2HJLA 3IAPA 1K72A 2WBJA 5AW4B 4BZYA 3CX2A 4JLRB 4L18A 3BESR 3QQ3A 2GFBA 4P59L 2ITCA 1UWXH 2OKMA 3JWDC 3VRJB 3Q6GL 3FB7B 3APFA 4N1HB 4UIMA 1UA3A 3MHZA 4Z9KB 1MCEA 3P4NA 3U7WL 1EHLH 3PV7A 5FOBA 1SEBB 4TOYL 3H3KA 3V6OC 4B6ZA 4F93B 4J3UA 1IZKA 1G5AA 2IGFH 4HKJA 4X4YA 1VSCA 3WGUB 4MZIA 3T8XA 1T5XB 4YC2C 4UIKH 3G6JA 4RWYH 5D2NE 4L0YA 4BK4A 4R7NA 4PJHF 2V8MA 2CAKA 1WA0X 3D4CA 1E4JA 2W88A 4A63A 1E6JH 2KZBA 4X4XA 3E8UH 2Z31B 1KXQE 2Q76B 3Q2CA 1AHWB 5BQDA 1QSFA 1GGBH 2VXQA 1JZJA 1NCDL 1TJHH 2BSTA 1OQXA 1CL7L 3BD4A 2DI9A 5CMAB 4YGVA 3C5XA 2J44A 2EUZA 4WGVB 2OQJA 2AITA 5GGRB 4IRZH 4AM0A 3D7PA 3DKHA 1JZHA 3TN0B 2V2TB 1FRGL 1E28B 3HG4A 2Y5TB 3AQZA 5DUBB 3UAJC 3EJYD 3N1PC 2CU9A 1M7DB 4U1GB 5I6XB 4PY8I 3CPLB 4ZX3A 3Q8EA 3X13A 4MCYB 3UDWC 1JF1A 4EEEA 4AI7A 1N68A 2ZOKB 4WV1C 4Z3GA 5A6IA 2X4OB 3IF1A 3CFMA 4NIKB 5E1GA 5D1XD 1XF4A 1JHKH 3L3OC 4JO2L 2EC9T 4U7MA 3UJIL 3LQAC 1CZ8L 3C09B 3VM7A 5MENE 3DVNB 3F58H 4HQQL 4GOSA 5CLTA 2BRRH 5F2FA 4EJ1C 2R2BB 2YRZA 3ZU8A 4X6FB 1FVDB 2BSED 1WK0A 3K2MC 3LB6C 1FH2A 3DI3B 4EI5D 3BWUC 3O4LB 4G9DA 4JFPB 3HR6A 1CUOA 1PDKB 3S35L 2AFNA 3DK2A 5KYUA 1GVIA 2E7LA 4X0KB 4LSUL 1LP9E 1BX2A 3JWDH 2UY7B 1CICA 1IBFA 4DUXA 4JM2F 5IT2H 1PLBA 2KS0A 2G3ZA 5FS5A 1XEUA 4P46A 4RMTA 4TQPA 3VGGA 4JQIL 1CK0H 5HI5C 1DUYA 3QXVA 1OAXL 4U7SA 5EZLB 2XZAH 2JB5H 2G3XA 4GKLA 4I18A 3QHFH 4L29B 4MCNA 4PVMA 5DWUH 2WXIA 2E8YA 1ET7A 4I4WA 3OG6B 2H45A 3BVTA 4FXLA 1O6VA 3PGDA 3MLSL 5D2LE 2DAVA 3D07A 3LOWA 1OL0A 4IRJD 1ZHLB 2BVUA 5BS0D 3VFOB 4MNGB 5JNYB 3AM8A 3L5IA 1P5VA 4EUPG 2FH8A 4PJ6A 4ZPVA 5I75B 4IGBA 1SN0A 1ZJBA 2BHYA 3BEWA 3U46B 4B3VA 3RIFK 3RTQC 4FG6C 2TRYA 1Q90A 1YPZE 4P05A 5LO7A 4J3WA 5D5MF 1JCKA 2G5BA 1NINA 1N6VA 1IC7H 4U1HB 2VR9A 1CFBA 4CVXA 1R19A 1FLRH 5C2BL 4LCCC 5C0DB 5F7BA 4XWOD 3FK3A 4ZFOB 3SQBB 5E03A 5GISH 3IU3B 1XAKA 5DD1L 2YOCA 3Q05A 1BMGA 2WUCL 2HPOA 5FKAA 3BQUA 1BFOB 4FNLH 3T77A 2KDGA 1B4JL 3S4SA 4HUCA 3T71A 2XXFA 2Y1VA 2UZXB 4MLIA 3GSUA 1G9NH 4JMXA 3JWOL 1HSAA 5JPNB 5E4EB 2Z8WC 1ND0B 4C55A 2IAND 2XV2A 1KXVA 2HKHL 4XMKL 1YN7A 4CN6A 3RUGA 4G7QB 1CBJA 4CC1A 3FSVA 2XV0A 2PPEA 2ZJSL 1QNIA 2B5IB 5J6HB 1KG0A 4R3SA 4PJ5A 3EO1B 1D7BA 1KBGL 3L17A 4X0NA 4ZFFB 3IBOA 2B4CH 3N44F 5ESQA 1P84K 2FBRA 1OTUD 2R69H 3MRFB 3O3BA 2W0PA 2Z65C 3O6FC 1OTSD 5SWSB 4B7LA 4KFZC 2AQTA 2YBRB 4G82A 5JOPD 4KH9A 4F58H 5ES4B 3GMRB 5FB8B 1Q0XL 1M2VB 3BKML 3L7FB 1FF5A 5T1LD 4HOMA 2XZZA 3ARSA 4LL9A 1FVEA 5FX3A 3IE9A 2HTLC 3MUJA 1IZJA 1Q9OA 1U41A 5DVMA 2ARJB 4HSQA 4XVSL 1YECH 1GOFA 1FFTB 3B5TA 4R7DA 4W1TA 3LCYA 3VB8A 1F58H 1MY7A 4HF5L 1OZTG 5HDBE 4NB7A 1S46A 4RCAA 4PJ7F 4F9LC 1UZGA 1KEML 4UZUA 2IEPA 3FQ4A 2J25A 1OXYA 3CLFH 3TEYA 1PSKH 3EW3B 2GJZB 4GT0A 1XR8A 1YMMD 1PAMA 1U6AH 4XP4H 1XZ0A 3N9GL 5K59F 1W0VB 4P9HC 3DO7B 2NY4B 1HHHA 4JDZA 4BQBA 1DE4B 3BO8B 3S36L 2C1PA 4U1JA 4MJ6A 2PCPB 3VFVA 1QFHA 3IDYC 2D7OA 5GSVB 2HCZX 4W9JC 1J0IA 3EGXB 1AJ7L 2JKTM 2MCMA 3T4YB 1HJCA 4PV8A 3OV6A 4KHTL 3HE6D 2HH0H 3OMNB 1GZHA 2CM6A 4NM8H 1G7HA 2J5LC 2FX9L 4JVWA 2IAMD 4ELMB 2J71A 3BXNA 4ODVL 1FYTE 4EDXB 3QJOA 5I6OA 5E8OA 1AS8A 3LPOA 3DDFA 2Y7OA 1W72L 3NH7H 4NZTH 4MDJB 4UAOB 1DVQA 1MAMH 1AD9A 5L4JA 5DD3H 2XWDA 4EBQH 1JK8B 3QJFB 1M57B 3V9FA 3IE4A 2FX7L 3LRGA 4YBQC 3MROB 2VABB 1IQDA 4OZIE 4P2RE 2MIZA 5AZUA 3TBYA 5JIMA 1P7KA 1RPKA 2HT4C 4JRYD 4UCFA 5D1QC 4A38A 1DANT 5JW4R 4PRID 1KCWA 4BXSV 3GRBA 5DQDH 3ZOAA 5BOPA 2X12A 2O26U 3JTTB 1DJHA 5ALCH 2H32A 3L1OH 2LU7A 3PJNA 5HGBB 3L4YA 4BQ9A 2LVEA 2DBLH 2EEXA 3D9AL 3QO1A 2N7AA 1CC3A 3QUZC 4M00A 3VTMA 3WJLC 2FSEA 4BZ1L 3V7AG 4F3FA 2W65A 2IPTH 1LO0H 3QH3B 5C0IB 1TR7A 4PJHB 2BMKA 1RU9L 4JANB 4UYQA 2R4SH 5J1AB 1A65A 1A9BA 5JHBA 4DCQB 3FT2B 2YD0A 4JKNA 2I07B 5C70A 5AAMC 3DRTA 3BZDA 4PRHA 1EAPA 3FQNB 5ISZD 3WLWC 4JKPL 5F0LB 4MASA 2IIJA 2G2PA 2DLGA 2ZWLT 4L8SA 1O5DT 2BY0A 1SDAB 2GJJA 4FF9A 3HOGA 1QRND 1ZVSA 4YDLB 4LEXL 4QRSB 1OD9A 5CEXA 3V5HA 4KJYB 4JE0A 3TBTA 4Z78B 5FF6A 3ARYA 5GJTL 4FMVA 3WV0A 2OMZA 3GPEA 4P9HH 4FEMA 4MA8H 4K55A 1MFMA 4MDIA 4TPRL 5JORA 5JQIB 1UJTA 2WMPA 3AWGA 4OCSL 3EYVA 1YYLL 1MCPH 4NZFA 4O51B 3KXFA 4L8DB 2CXKA 5DFTA 5CD5C 2A9ML 3UG5A 4WFFD 2E7DA 2DDQL 2NT1A 1I31A 2K6WA 2V5SA 1ZTXE 3DTUB 5M95B 1QFOA 2GITA 4B9FA 3V0VA 1EGJA 3ISYA 1I8AA 2EILB 4N2KA 5AB9A 2NY3D 4I1NB 4GAJH 3NCMA 4G80A 2XKSA 4QXUL 3GLAA 3U4EB 1E5UI 1NGPL 4OKVB 2A7BA 1MKFA 3HPJA 2UZIH 3KBEA 5IVZB 5C0CA 2VLRD 4ILDA 4S1RL 3OZ9H 2VZOA 5GRZA 1A5FL 2VDLH 1JGVH 1PD6A 4MMZB 5DLLA 1WEJL 4JM2B 1OY3B 1WJ3A 2ZXEB 2Z0BA 2VLME 3TIDA 1KCKA 3QUXC 3N2JA 1ZTXH 2UXFA 2VJXA 3AMKA 2OSYA 5FO9B 1N5YL 2WQXA 1KB9K 3D0LB 4G8GD 5DD6A 1WRFA 2AQNA 2O5XH 3IN2A 3ZDXE 1XGYL 2NXYB 4GS7C 3QAQA 5KSUB 2AJXL 4J3OD 1DQTA 2F7RA 1T3FA 5T3ZH 3C5ZA 1FWXA 4HUVB 3EOBB 3ESUF 4DHLA 3ZL4H 1X3DA 3HZYA 4N0YH 3OXRB 3TFKD 2C1OA 3RPIA 5HYIA 1U33A 1YMHB 2BP5M 4FC3E 4ONHA 3HAEH 4FQIH 1X9LA 1DN0B 1OEZW 4A68A 4FFYH 3KVQA 4RISL 2WP3O 4QTHB 4G6MH 1YRKA 4OR1A 4PWHA 2PMZA 3HG0A 1OF2B 3MUGB 5D5MB 4ZXBD 4O2EB 2RGSA 3B9AA 2CKBB 3FU7B 2PWGA 2TRHA 1UWXK 2NRDA 4QGYA 5KWYC 3QJVB 2FRGP 3Q6FA 1MHCB 1DYZA 1AKPA 5JW3L 2WYIA 3N40P 1K8DB 4LKXA 3BH8A 1XSOA 3QRGL 2N01B 1RZJL 1TJIL 3QR2A 3L4WA 4N5ED 2HWZL 2PTTA 1R3HA 1MVUA 2R0LH 5F7LB 1UB6A 3O0RH 4DK5A 4PBWD 4I5BA 2BVPA 3VX1A 4QKTA 4YIQA 2XQYG 3ZK0A 1XHHA 4CUCA 1KZYA 2OMTB 3ZPDA 1KJVB 5HHVH 1RJYA 1MUJA 1XF3A 5JQ6H 1HDMB 3V0GA 1CDHA 3FC8A 2H3NB 4OF8A 1JTPA 1J8KA 2VM3A 3N44B 2X7LA 3MRMA 1TKWA 2DKMA 2WIIA 4PR5B 4Y2DD 3KPMA 2QSCH 4NRZB 3OJVC 4KO7A 2AJUL 4L1BA 1F3JB 1TO4A 5I1LB 5ALBL 1EEUA 2PYFA 4LCWD 5C0ND 2VE6B 2VDKH 1E9PB 1KYOK 4GSRA 4OGQC 2AABH 3RB5A 1MQKL 5IVXE 3QORA 3B34A 4UILL 1MCDA 3QZMA 2X70B 3B7TA 4PGEA 3O2WL 2YD4A 1FZKA 4YDKL 3MA9H 5KBKA 1GC1L 1IAOA 1A9EB 1KCUL 5D1XB 4JZJB 4M48L 4X7TB 3VMOA 2HLEB 3RFZA 3JUYA 1B2WH 3QYNA 1E8WA 1V7ML 5SWZE 3V4VH 4AIXA 5IW6A 4X5WB 2EDQA 3WKMH 3FU5A 3OL2A 3F7QA 4XCEA 1NM4A 2OW6A 2J8UF 2KERA 3GZQA 1QWHA 3ZTNL 4U05A 2VT0A 3KYMB 1UYWL 3QEQA 1SJEB 1FP5A 5E6YA 4EI5B 2C9AA 3QIWC 3EJUA 1F11B 2J20A 5CU9A 1JN6B 4OZGA 4U6XB 5DS8A 2EH7L 4HJJH 4JX0A 4Q6IC 5EOCH 2H2PD 4AGPA 4EDWL 1QLEH 3UPCA 4MGXA 2P5WA 4JRXE 2Q1EA 1QEWA 4IKNA 3QULA 4UV4L 2OX5A 4LDEB 3C9NB 3C6LD 3LSOB 3TT1H 1ET5A 1EQWA 5KS9A 1P5UA 5T5FA 1BLNA 4WKZB 4AJWA 1A1NA 1AVAA 4HFUH 5L6YL 5CZRA 3T6WA 2EYTA 2CJSA 2ZCKH 4NQVB 2XUWA 1LO4L 3D3VD 4M8UA 3WSQL 4LHUG 1XEDA 2WLIA 2RCSH 1RLWA 2GJPA 1F5WA 2A77L 3CFKA 4FFTA 4IJTA 5ECGA 1IIKA 4WJ5B 4XZUB 1MJUH 3WJMB 3ERXA 4J3OF 4GBXC 1ADQL 3ABLB 4N0UA 1V3KA 2J3SA 2MPVA 1UENA 2ENSA 4LCUA 5BS0B 3QCVL 2EACA 4DVBA 3EFOA 1KB5H 2VRAA 1UEYA 1BVZA 3CMOL 2DEWX 2WOYA 3G04B 4UT6A 3UP1A 4NFBA 3HHSA 1J8RA 3U9UA 3BW9A 2EVFA 1AMXA 1I7UB 4GP5B 3GTTA 3WFBH 3SPJA 4NPYB 4PIBA 4Y88A 1J5DA 1M56B 3A22A 4DZBA 3QXDB 5GGTA 2X41A 1RZGA 4TQ8A 3D69A 1AGDA 4BFEA 1X5IA 4HK0A 1U2HA 1USQA 4AEHL 4KXDA 1D5IH 2FD6H 2NXZD 3SBQA 4DETA 4FQHB 2J88L 1L9RA 4YH6A 2Z35B 5F9JA 3CDGB 3V0WL 1CFVH 1FFOA 2WVVB 3DYMA 4OLXH 3DTXB 2WQRA 3T6XA 3ZDWA 2G9HA 4F8LA 3PJLA 2IANB 4ZX4A 1BA9A 5EHFA 1OSEA 4AYBA 4U6YA 3T3PE 2AZAA 3E80A 2ADYA 5E2WL 4TUKL 5E2VH 3G6JE 5AD0B 5H8DA 4ISVB 3VFPA 3LEVL 3OAWA 3I74A 3NN8A 1AHKA 3SPHA 3ARED 3CN0A 3T2LA 3VG0H 1QSFE 3VO0A 5EU7E 5TK4A 3KLDA 1W72B 3TV3L 2FZ3B 2FL5B 4P2OD 4ZS6D 1R47A 1AGFB 4BM7A 2C5DC 4PW9A 3WTSA 2H0PA 4P5TD 5J3HD 2ERJB 3MI6A 1U2CA 2P48B 4YBLB 4EMZA 5L7XH 1DANU 1TZOA 4YSPA 5E23A 2LU3A 5T1LB 2X1OA 1AE6H 4N20A 4UQEA 3BDYH 3PWLB 2HB0A 5KTEL 2W60A 3QUMH 5EG6C 4H0LC 3W0WD 2LFEA 6PAZA 1DLHA 4QXWA 1GYVA 1TIUA 1TJGH 2GJ6A 2CMRL 4FQ1L 3EAKA 5ACLA 2YQ2A 3F7PC 4K7PL 5D71L 1I82A 1QSEA 1WGOA 1YA5A 4G8FA 3FCSB 5J12C 1N0LA 1YEFL 1BIHA 1FDLL 4G7YH 3ZZ1A 2YPVL 3IFOB 5J9PB 5DD5L 2C3VB 3SE8L 5IIEA 4MCMA 1YMMB 2VLJA 3IGFA 1PX3A 4OVUA 1DVZA 2BXZA 4KI5D 4YPGB 1IAIM 1OPGL 4YHLL 4ZDHA 2OULB 1MZZA 4JDEA 5F3HB 1LE5B 1SHXA 3K2KA 4F91B 4X6DF 2Z31C 1A6AB 2G4EA 3HE6B 3VD9A 5I66B 1AHWC 2FT7A 2OZ4H 1UQSB 1CGSH 1OTTD 2FLMA 1OHQA 1Z9SB 4KRLB 2IAMB 1PLGH 3L5XH 1R34A 2IH1B 1UM4H 5D9SB 4PJFF 5KANI 1UM6L 2B9BA 3M7FB 3PDOA 4YDJB 2NCEA 3VFRB 2WW8A 4NENB 5CZVL 1ZT4B 2NPLX 4YHOL 4JKLA 4UUJB 5IOPA 1HL5A 3QQDB 3IGLA 3GMPA 4OLEA 4U1GC 4CGUB 3WEXB 5J1TC 1DJIA 2DIEA 5EIIG 5I8CA 4ODSL 1DBJL 3KD4A 4M6MH 4YN3A 4AQ1B 5G4MA 5EU6A 3O3AA 3PWNA 2CJUH 5LQBL 4OT1L 3QARA 3B9DA 4B9GA 3DPBA 2WKOF 3WXVH 1H6UA 1VFAA 1HH9A 1INDL 4JRYB 5TDOA 1F4XH 4PRIB 1RK1A 4NQED 3CZJA 1KLGB 3C09C 3OKKA 4V1DA 3V52H 5EDXA 1JL8A 1UD4A 1K2DA 4XCCL 1MW2A 1FC1A 5ENWA 2YXWA 3WKPA 5IROD 2WZ6A 1F1GA 1B0GA 2EO7A 4WI8A 4F7MB 1WFTA 4TKWA 1F42A 3Q01A 3NK3A 4KNUA 5F97E 3INUL 5MEQA 3ETBF 5F6HJ 1JDDA 5B21A 4L2YA 1SLXA 1BQSA 5TJWK 1BPLB 5ISZB 1GTFA 4JG0H 1HOEA 5IVNA 2DM7A 2R56H 1V3JA 2M8XA 2NQDA 4Y9BA 1JK9A 5EPMB 4R9HA 4MD5A 4X2UA 4TTGA 3FFCA 2I9TA 4BELD 1B4RA 1LK3H 1QRNB 1NDTA 2D31B 1W15A 4PGZA 1ZT1A 2ARJQ 5GZND 3V0EA 3GI8H 3GJFB 5K1JA 4FFZA 3TWCL 3RUGE 3PP4L 3DGCR 2R4RH 4S1SL 4ZMLA 5LXGL 3GSRB 2NYKA 1M71B 3WL9A 1RZKL 1ECZA 4J4PD 5JOFA 4PJ5E 4Z7QE 1FNFA 2FBJH 5H94B 4Z7OF 1MCJA 3QDGD 1NOLA 3MBWB 5H4ZA 4OZFA 1WFMA 2BWIA 3EH3B 5LN8A 1E9OB 4GSXA 3LDBB 4JCMA 4M56A 5F7FA 2JJTA 2F1BA 2CBQA 2F68X 3D06A 3OZKA 1H8SA 2O5NA 3P3SA 4L9LB 4CW1A 3EXJA 1O7VA 4G9FB 3WE1A 3DO3A 2WZPD 5J1SC 4GXUN 2WSPA 4DSYA 2EDEA 3RWFB 2VITA 2J8UB 2I24N 2FLBT 4P3DA 1M3IA 4O4YH 2BJML 3V55A 3NUKA 4FNTA 5IB5B 4GINA 4CVZA 4N0RA 2W0FA 1O7SA 3BP4A 1RZIA 3D51A 4QR7A 3KLAB 3AXLA 4WEUD 3SDXA 2M2DA 3MA7B 5JXAH 3BRDA 4DOHB 2UWEB 2VLRB 3B2UD 3D18B 3DC0A 4NOBA 3DROB 4N2NA 1OPOA 2EH8L 3VH8B 1EEQA 1S6NA 3LKPB 4RAUB 3I3DA 4NRYB 5JPNC 3ULUC 2BNRD 1A14H 4B95C 5CP3H 4KI5F 1MFAH 5L2KA 1N67A 1WZ1H 3NIFE 3P69A 3L95B 1NBZB 3DX9B 4G8GB 1EHKB 1FE8H 5HDQH 3O6LL 4K2UL 2R7EB 3V6BR 2HTKC 2B5IC 1MFUA 3ME0A 1EVTC 4OY9A 2ICWJ 3TCXA 4XAWL 4GKOA 2XWJB 5D6CB 3FRPG 3DSFL 1HEJC 2TSBA 2AJVL 4QO1B 1OCCB 3FQUB 3RL2A 3TF7C 3BLPX 1CTOA 3DHJA 3V6OA 5KJ4A 2VNCA 2D7QA 3P9WB 4DP4X 3GIVA 4OD3H 2ROYA 4KMTL 1G9MC 4XMPH 3ENEA 3VXNB 4ABQA 4ZXBB 5I1CL 3HG1A 5EEXA 5CKAA 2ID5A 2J6EL 3MREB 3H0TB 3RWGA 3OKNB 3PABA 2GW5A 2X3BA 1EO8L 5DLML 1YG9A 3KPOB 1YY8A 4XC1H 4RMSA 1Z3RA 1X7QB 4FZEH 1TVHA 3WFCL 2L04A 4H25B 3ARZA 4PIRF 4OQTL 2XT1B 4WFHE 4G8EA 2QV2A 3WKYA 1NMCB 4TNWF 3KLQA 4OGAC 3ZQWA 1B4LA 2BCKA 1J0ZA 1QUNA 5I1AA 4JPIB 4UF7C 3HS0B 4PVNA 5F93C 3FAXA 5BXFA 2CR6A 2Q86A 1G0XA 2R1XA 2XIDA 1S3RA 4JJ5A 3UAJA 4F2MA 2FJHB 2NY4C 2CO7B 5TDPB 3UBXI 4ODHL 4M1CC 1VPOH 3OR7A 4LF3A 4NQCD 5EUKA 4ZUWA 4YSEA 5I15L 3UDWA 2PR4L 4YZFF 1AGBB 4WV1A 3ZRSA 2VWEE 5IB1B 4E9WA 2JQMA 4PRHE 4N2OA 1HQRB 1MW1A 3QXAB 4Y2DB 5I1GL 4WDIA 3BQVA 5EC2B 4PMEA 3P2BA 1CDJA 3X1FA 3L3OA 2H32H 4LCWB 4ONFL 5IFHH 1JZ8A 2RMNA 3MRPB 2F7IA 4XCFH 1HNYA 1RV6X 2HRHA 3JV6A 8FABA 5F1IA 4WU5A 5CZXD 4UNUA 4F2FA 3MLWL 5DJXA 1G7IB 3QZBA 1MHHA 2JQAA 4UAOC 4I2XA 5CD3A 2PPFA 4KK5D 3IJEB 2VZ1A 4O9HL 2AQQA 1R24A 2VXVH 1AKJD 1PS3A 2UV3A 3AITA 4U1SA 4F7EB 3MN8A 3QEHB 4TV3A 4AX3A 1RPUA 1BFTA 3KXFE 3FQTA 2JSFA 3H3BC 4WNSA 3BVNB 4HG4K 1F41A 2ZSWB 1F18A 2GEQA 1RZFH 4RQQB 2P43B 1FBIL 2HG5B 1R5IA 4FYRA 2J1ZA 2Y36L 1C16B 1E65A 4N8VG 1NSNH 1WFUA 4NZRL 5MEPB 4MMYA 3F85A 1B90A 2DMGA 2J4WH 4IBUA 3S5ZA 4X6DB 4PREA 2Z9TA 3CXHK 3C6LB 1SYVA 5DHVA 5IMOB 2VW4A 3NJFA 1OE1A 4Y16D 2VAAB 1G9HA 2FR4B 4N24A 3KL5A 4M62L 2XWTA 3ZO0A 4Q6KA 3FRUA 3BZFB 2IQ9H 2ZAIA 3D3VB 5D7LD 4RZCA 4E9YA 4UT9L 3BZ5A 4JFFA 4YDLC 1HT6A 3MSPA 1K4CA 5DRNA 5I16B 1MJ7H 1HH6A 3RTQA 1C08A 5DDHA 2W81C 4AH2B 2R9HD 5F9DC 1P1ZB 3QNYB 4NKQB 4F15C 1Q9KB 4Y19B 1H3GA 5I6PA 1N19A 1KTCA 4GXVL 2A9NH 4ODTH 4LCCA 4OCNC 2D8KA 5DXWA 2BZDA 5H37G 1F8TL 2E7MA 3VA6A 1IKFL 4XMVA 5EZIL 4UM9A 4UM8B 2G75A 4L05A 5E1AA 1KT2A 4MZ3A 4K9EL 4IKJA 1P0SE 1UH2A 2H47C 3FTSA 4ZO8A 2ZP0T 4PV1C 3JV4A 2DWDA 4AEEA 5CR1A 4XP6L 4PHXA 4KJWD 2DIBA 4XBEL 2WXOA 2YSSB 3LS5L 2W07B 5BOZG 1E9QB 3BLBA 4RSVA 4TRPH 5EO0B 2BY1A 5AKSA 1NMAL 3LZRA 4QRRA 1IGMH 1FO0B 3MACH 5EH1A 3ALXA 4KQ4L 4NQXA 3Q0HA 1XMEB 2HFEA 4PH8A 5IQ9A 1C5BL 4JM2C 4OGXH 5LAXB 3UZQB 1JGLH 1UM5L 3O6FA 1T1ZA 2Z7YA 3BEVA 1WF5A 4XP1L 2XKNA 3OKLA 2VQ1A 3PWVA 4QDGA 4BK8A 3H9YA 4D9LH 1P7HL 3DVGB 3V10A 3CXFA 2XYBA 5CSZB 1F4YL 3WS3B 3AREB 1IAKB 2YEVB 4POUB 4Z7OB 2DMKA 5C0BA 4P2OB 3MLXH 2H6PA 3F7LA 2QADC 3HMXL 4FS0A 2R0ZH 2XBZA 4OCXL 1MIMH 1A22B 3H1ZA 1UH4A 4P5TB 4IMKC 3AUVA 4MAUH 4AIZA 3VFUB 4F9LA 1MHPH 2VCOA 3ZX1A 3AWFA 5HVGB 1KPRA 3MJ9H 1H3XA 4M7JL 3L4ZA 4L8CA 1D7CA 2NSMA 4AJVA 4XNXH 2B59B 3TEUA 4FEIA 3W0WB 3KJ6H 1GIGH 1TLKA 5CILH 1CIUA 3WJJC 3HE7D 2QGEA 2C3XA 1MQ8A 3ROLA 2ZX9A 2VTFA 1DQJB 2DQCH 4MRBA 4NLHA 1UCBH 2OP4H 4OLYL 2X4PA 1T7WA 4L3FA 3Q9PA 5JW5B 1VADA 1TZHA 1A47A 2V2WB 3EYFB 2D4FA 4ZYKB 2P1YA 2FEJA 1I9EA 4XVJH 1CBVL 3VXMB 2GCYB 3PUCA 3UPRB 7CGTA 2G9KA 4G5ZH 3BZEB 1GW0A 4OCYH 3V5DB 2DTMH 4OZGE 1KNOA 2ZCZA 4WTZA 5TE6L 2YD1A 1E4WL 2FIKA 4G42A 4QJ5B 2JVUA 1X4YA 4G8IB 5DO2D 1H19A 4PRAB 2IADB 2P5WE 3FU0A 5IF0B 4JY5H 5FWQA 4M1DH 5GGSA 4GMTH 4YXHH 5HGGS 5KS9E 4PMFA 3BKJH 3LKOB 3V5KB 1GZQB 5H2BB 4M5YH 5D1QA 1JXGA 4KVCL 4FYTA 5C6TL 3WTXA 1AYOA 4QIRA 3BAIA 4YHMH 3KLKA 2X38A 1ZA6B 5DS1A 1L5GB 3QG7H 3QUZA 3WJLA 4N0UE 3WIIH 2YN5A 3LZNA 1VJSA 3K6FA 4NPKA 4M1GH 4U6VH 4CMHC 3D2TA 2YA2A 4QCIA 3WU1A 1IBBA 3RP1A 2EXYD 4JZJC 1NUDA 3P02A 5HYSA 3LKNB 4LVNC 3DWTA 2WLJA 1FRGH 1I1CA 4JY4A 4NQEB 5AVUB 5HJGA 1HVXA 1IVLA 4YWGL 3BE1H 2JJUA 1NBVH 2I5YH 2L8AA 3WNLA 3DJ9A 3HZKB 3VXRA 2ZOUA 4HUKB 4AYID 1IGYB 4EI5C 2YGNA 1S9WA 4UINL 5I2IA 5A2FA 3JWOC 3OX8A 2R0KL 2AV1A 5I5JA 1UHVA 2E56A 5D7JA 3DJSA 3CHQA 4J3XA 5FHAH 3CQFA 1CZ8H 1USZA 2CKBH 1H6TA 4LP8A 3P9LA 5DJCB 3GDBA 1CN4A 5HI4D 3C6SA 1ZHBB 4M29A 2K8MA 5CBAA 3DX3A 5DJ2A 3RILA 4GSUA 5HHOA 4DVRH 4E9VA 4M3KB 2XN0A 3L3GA 3NCJL 1U3YA 5IFHL 3UC0L 4OB5L 3AS0A 4KTEL 3F12A 5I1EH 4ELKB 2X6CA 2XG4A 3X3GH 4AENA 1KBKA 2H26A 3M46A 3S97C 4PGDA 4XXDA 2QL1A 2BSSB 2C9RA 3UEQA 2WCGA 4DEUA 4R90H 1LWJA 3QDGB 3T65B 1V54B 3X3FL 2FDBP 1U8KA 2XKUA 1CFSA 2OJEA 4EQ2A 3WO3B 3SE9H 1EJ6A 4FNPA 3Q1SH 3OG4B 4M8QA 5DHEA 2GBUA 5M7QA 4DQOL 1A6ZA 4TSBL 4HLZH 3RZCD 2FAUA 4X42A 4LRNH 2HMIC 3CN4A 3CFJB 3LZQA 2I85A 4JY6B 4FQLH 2GIMA 1KPUB 3QUXA 4X6BB 5DUJA 1T4KA 1N64L 2XN9B 3CX5J 2KLTA 1EWHA 1LE9B 4HJEA 4XWOC 5IK3A 5L2JB 2D7PA 1CT8B 2GJ6E 2PO6D 3L5JA 1L3NA 4F7PA 3LYRA 4JHVA 3TGXA 3W9DA 4EZJA 1UA6L 2NQCA 3CZGA 5BV7L 3W37A 3O2DL 3ABMB 1QSEE 1FZOA 3AG2B 1SVBA 4S1DD 4KOCA 1S7UA 35C8H 3UYRL 1KOAA 1UA7A 1OP5H 2BNRB 4D0DA 4TSCH 3ARPA 5DJ0A 2P24A 3ZR5A 1QLFB 2HN7A 1PTZA 4NUGH 1BD2E 1LO2L 2QQQA 1VACA 3JWNE 3SY0B 2A73A 3T0EA 3STZA 7PAZA 1J5HA 3W81A 1CFMA 3SBRA 1AP2A 3MGAA 1SJHB 1SLVA 3KHQA 4PV9A 5HSFA 4WRLA 1TG8A 4J3SA 1OTSC 5B1JC 4KZEH 1X6LA 3FKUS 4I77H 1EFXD 5IMLB 2ERJC 1S3KH 1UG9A 4YBLC 4HSAC 3GZPA 1KDJA 3IDMB 2EIZA 3MKGA 4OF0A 3MJ8B 2MEJB 1A3QA 5EU6E 2NTFA 2V6HA 3MRIB 1RUQH 4GSDL 4YHZL 1MW3A 4GRWB 3ZDYE 3WIFB 3S0PA 4UTAL 3D8MA 2Y72A 2PF6A 3BKMH 3EF7A 4ODWA 5I9QB 4Y9GA 1MNNA 1X9QA 3AY4C 2M1KA 3ZHLA 1SEQH 2OPCA 4LLUA 1ONQB 3K74B 4UU9B 1BJ1J 1LILA 3SY6A 1T20A 1PKQB 2NY0C 1WBZB 3ARBC 3VI3A 2I26N 4MJIA 2XG5B 4A6YB 4W93A 5C0AA 3SN6N 4NQCB 5IP4A 3SJVA 4Q9QL 5CCKL 3UGEA 2BY3A 3HE6C 4DZ8A 5L9DL 2PP7A 2WO2B 1RL1A 4U4BA 5BJTB 4J6RL 4EOWH 1G6RA 2GQHA 5HVWA 1OW0C 3SKMB 2IAMC 3LQZB 3FFCE 3NRPA 4KTGA 4HIEA 3P3YA 1I9RH 2HJFA 5MHSE 4JHZA 3PCYA 2ICEB 1ZGLB 4ZUSB 1U91A 1PY4A 2WINB 3TBWB 3VNYA 1OARL 5KYWA 1T7XA 5CJQH 4IMLA 5DI8B 5L8JB 1U8LA 2BW5A 1Z5YD 4ZSOB 2PW2B 2DLFH 4TF4A 2X3AA 3VFMA 4AQ1C 5GS0D 4UMSA 5KYYA 3QIWA 3NEEA 3FCTB 4WSJA 2P44B 2JNZA 1EXGA 1AKJB 4OAWA 1P1VA 5HGHA 3FN9A 2J1YA 4FQJH 4X5QA 2GK0A 2HZHA 3CIAA 3D2UD 1R3LA 5IB3B 4HU8A 4XP9L 3VGHA 4LFHD 4FFZH 3K1DA 2HFGH 2JJVA 4PWKA 5FGSA 4O02L 5DRXA 4HBCL 4KJPC 2P52A 4GKSA 4OIAA 3OGOE 1XIWA 2YBGA 2OMWA 3RVXD 1ORQB 3DETC 4BRJA 1HU8A 4TLTA 2OTPA 4MWFB 1TOXA 3SDXE 1F13A 2DQEL 3MV8D 2X4RA 3KYAA 4GBXA 4PS4H 2XWXA 1K4DA 2CDFB 1S7SA 1A3RL 4OFYD 4PP1D 3THML 4Y16B 2UZYA 3QEUA 2V7HA 4MA7H 4PJCF 3VFGH 2QKIB 1F90H 2ZXAA 2OA9A 1RURH 5E7FA 5D7LB 3UH8A 5F0MB 1BM7A 4L3CB 5E8PA 4CU6A 1O7DE 2V5MA 4X99A 5T1DH 5J6GB 2FHFA 5I76B 1TEYA 4LASH 1A7OH 1Q72H 3BPNC 4ATWA 3IJYB 1CE1L 2JXMA 2WTOA 5AWNL 1Q1PA 2NUPA 5DRZB 3H42H 5IUCA 1MCOH 1OE2A 1ZOXA 2CA3A 3DOIA 3PS6A 2D0FA 3MGTB 4ZS7L 3U1QA 4N6QA 4YEEA 4YMPA 3DBXA 4HWUA 4A66A 3PNWA 1E43A 3QXUA 4LZKA 2NQ3A 4JPQA 3PGCA 4FHKA 1A7NL 3B7UX 1AGCA 4P48A 5EIIB 4JO1H 5HHNB 2DQHH 1RZJC 4HULB 1FIGH 3JZYA 3VE0A 3VXUD 2DJMA 2EYSB 2BS71 3NCWA 1ETZA 3Q06A 4N0FA 5D6DC 1U8OA 4P5SA 2OMXA 2RFXB 2VDRH 4MXVE 5H35A 3NJLA 4PGCA 1KTLB 4QOKA 2WXJA 2VXTL 2ORBL 2BCMA 2A6DA 4LEOB 4XB3A 4UTBL 5ACZA 1URLA 4X8CA 3GSWA 2OL3H 4HCRL 4YLQT 3ISWA 1A64A 1XXDC 3HG5A 3AXHA 4PRPD 4B7IA 1M7IB 1ZA3B 2QMKA 4F2ME 2PTUA 4IW4C 4FHJA 2YD9A 1VKXA 2NNRA 5DVKA 5I8OH 2JIXD 2CALA 5E9DA 3WG7B 5IB2B 4PJIF 4JLRA 3P2DA 4QTFA 1F86A 3LIZL 4WW2F 1DQIA 1J88A 5DGQA 4P4RB 4M8RA 3VRJA 4XOEA 4ZO7A 3S8FB 2QTVA 3FB7A 4AVHA 3TFKC 3GINA 4TULH 4D3CL 3L48A 1K5NA 1ET8A 4YXLL 1N5YH 2BHUA 3NIDE 1MJ8H 2ZX8A 1AD0A 1SDDA 2I60H 4MA3B 4X98A 3WIHL 3GSQB 4N8CL 4UOZA 1GC1C 1MI5E 2XQBL 5DQ9A 3UMNA 2VZSA 4YO0B 5DYFA 4CILA 3I6KA 1U42A 3AS1A 3CE1A 3I75B 1U0QA 4KKAD 3L8QA 4L4JA 1FL5B 4LNRB 4ZXBC 1UXLA 2DY2A 1MHEA 1ZT7B 3VCLA 1N6UA 4X6EA 3HE7B 4I2XE 3GK8H 2AAVA 4QHMB 3FQ2A 5I1IL 3EJSA 2H0EA 5T1KD 3QDMD 2Q76A 1AI1H 2DLHA 2OSLB 1AHWA 5IESH 3MMEA 3T8VA 4AV4A 4BSWB 5FWRA 3IWUA 1NOFA 3HS0C 1CLVA 5GGRA 43CAA 4WZ9A 5LBSA 5IY5B 2P8PA 2V2TA 1P2CB 4A1RA 1IGCH 4HXAL 5DUBA 1MH5B 4MTMA 1RZPA 1PJWA 3TYFB 4ESKA 3QFJD 3CPLA 5HGDB 1RZJH 5CJXC 4MCYA 5CCJA 3TZVD 1FFNA 2MQ3A 5TF0A 2AXFA 4UDTA 2WANA 1RIHL 1HAUA 4B5ZA 2R8SH 3N85L 4GRMB 1P4LA 3FBKA 1T1YB 1Z0MA 2XWCA 4JFFE 1B3JA 2AP2A 3N41F 5IFAH 4CVUA 3ZYZA 3DVNA 4DN4L 4ZNEA 2YQBA 4XVTL 2Y22A 5PAZA 1QBLH 4D0BB 4X6FA 5I1KH 3FRPB 4Z7IA 4ZX5A 3O4LA 4A7TA 3LRHA 4JFPA 1I8UA 1PDKA 1R1CA 2ZWNA 4J3OH 1NFKA 1NCCL 4FMKA 3MR9B 5CSBA 5TTRA 3LKRA 5AZ2H 1GJWA 2EE9A 2ZKYA 3TBSA 3QI9D 3ZT6A 1V7NL 3ARFD 3K6DA 3CBRA 3MRDB 2EYRB 5K9KB 5BV7B 1AAJA 2BO0A 2WXMA 4FRWA 3PHOB 3B2VH 5EZLA 5E6RB 1JNNH 5HI3D 4L29A 4RFNC 1EA9C 2C7UB 3NTCL 4BKSC 5IBLD 2VDMH 3BPCB 2HT2D 5AOLA 2GSGA 4L23A 4QRRE 4A2HA 1R3KB 3TEZA 4N0CD 1ZHKA 2JMRA 2ODIA 2X4UA 1ZHLA 3AAZB 3VFOA 5D96C 2F8IA 3IDNB 1UGKA 4MNGA 1LL1A 5JNYA 1FAKT 1JI1A 4XX1G 2BFVL 4AQEB 2CCVA 2CSPA 3VQ2C 2P80D 4IDJH 3SPGA 1OIOA 3IKKA 5DURB 1MCQA 3HZMB 3U46A 1KJ2L 4Z1PA 5LGJB 2A4CA 3GXDA 2V37A 3K71B 1HNGA 2CRYA 1IEBB 4FHBD 3D39A 1KFAL 5DJAB 4QRQB 2IFFL 1TETL 2D03L 2DYPD 4U3SB 5C0DA 4BZ2A 4ZFOA 3SQBA 3HS8A 5C0BE 1YUKB 5LKNA 3MRGB 4JFDA 4A39A 4N2HA 4FMFA 1NCAL 2AEQH 1YN6A 4XPBL 4AYFA 3RZCB 2WYHA 3B3IB 3KVDD 4NP9A 4H1LG 3KDMA 2UZXA 4G43A 3IVKA 4RGNE 1C12B 2NY2D 2C3WA 5JPNA 1WHPA 1I53A 1ND0A 2A2QT 1UXMA 4UB0L 1NCIA 2G2RB 3BC9A 3QEGL 3DIDA 1A6UH 4WY7H 3TU6A 4LGPB 3UTTD 1IGIL 3VDBA 1JHLH 3FYEB 1HHKA 4GJTB 3CH1B 5E4AA 4YAQB 2PO6B 5DMIL 4ZMPA 3C60C 3EO1A 1H3PH 1MJJB 1U58B 1XGPB 1ES0B 3SKNB 4QHPA 4HETA 2WTPA 1F6FB 1VZIA 3QYCA 1OP5K 3L5HA 3QNFA 4N8VB 1MF2H 3HC3L 1MFCL 3VYNA 4KPHL 2GSIB 2IJ0C 1YJDH 1MCWM 1NPJA 5FB8A 1J8HD 1M2VA 1JZ5A 3L7FA 2CR0A 2CO6B 4P2AA 5L0QC 5C7ZA 4ODBD 2EDHA 3QXTA 3AREC 3GHBL 3EGDB 5EO9B 3RHWF 3TJPA 3LKSB 4MXQD 4F8TA 1DJSA 4C8XA 1AXTL 3RL1B 3KCPB 2ARJA 4P2OC 4ZS6C 3IXAB 1JZGA 3U30C 1MSPA 2QSTA 1EFXB 5D1QE 1PG7W 4GQ9H 4P5TC 5J3HC 1JXFA 3MRJB 4NX0A 1CDBA 1A3ZA 4OKDA 1IEAA 1XF2B 2R2CA 1JV5A 1YO4A 5E2UL 1HYSD 3I9AA 3BAWA 1PNCA 4GUQA 1OK0A 1W0VA 3DO7A 5DO8A 3BO8A 4O02B 4P8QA 2UVFA 5KSAD 4DGIL 5F7NC 5GSVA 4BFGA 12E8L 1MFBL 1WDAA 3D34A 3EGXA 3ESNA 5FYLL 1MOEA 3WI9A 3VW3H 2GKIA 4XNUH 4Y4FD 2Y0SA 5H4YA 5K9JL 5I5MA 4G7VH 2RACA 5AALA 4HHAA 4XN9A 3IFPA 3VXRE 2XTJE 4AZ8B 4ELMA 4L3ED 4KI5C 1BMZA 2XETA 1IBGL 4EDXA 1NC4A 4LGSB 2OR9H 3V4PB 2RB8A 3M8OL 3PL6C 4BRVA 2O93L 4M6NL 1HKLL 3L4UA 4GG6F 4PJIB 5KG9B 4FTVD 4MDJA 3BP7A 4I9WD 4OZHE 4FG0A 4WW2B 1OTTC 2JCCF 2XN1A 3OPZH 4OCMC 4ES9A 3QJFA 1KN2L 3B8SA 1IUZA 1RZKC 1INEH 2VABA 3MROA 1EDQA 3B9KD 5HHOE 2MKWA 1FO0H 3TO2B 5A2CA 3NPSC 1HE8A 4B9ZA 2XA8L 1E4HA 5KANG 2PABA 2PXYD 2V17L 5AZEL 1F56A 4HWEH 4HJIA 4BH8B 1KCSL 4FADA 3NIGF 3EBHA 5DJZB 1M2OA 4AOFA 3CZUB 2BVQB 1QZ1A 5HGBA 3HNVL 1PNDA 3FMGH 4UQAA 4L4VD 2F74B 1FC2D 3QH3A 4PJHA 4FI8A 4JANA 3RRQA 4N8UA 4XAKE 4J5VA 1AZVA 1G7JB 2NR6C 3V9EA 3FT2A 4ZMAT 4KKPA 2EEBA 5CZVH 1AXSA 1R6VA 2EVIA 3C08H 4KK9D 3VAEA 2WYTA 3FQNA 1FGNH 5JHLL 1PFCA 5IROC 1NDMB 5I0YA 2VIRA 3CSYB 3RIAF 3BSZH 4G71B 4N1EA 4NN5B 1IC4H 3QJQB 2XYCA 4FYSA 4UQ9A 1S7RB 3UZEC 1UWEL 1RPQA 3NCXA 3FQ1A 3O3DB 2APVA 3QZLA 2YHGA 3O3EB 3KLLA 4ZAKD 4ZFGL 3QUGA 2FNWA 2QR0B 1WE5A 4JKMA 5DMJB 4CU7A 1F6LL 2ED7A 3TNMB 3A67H 2IG2H 2X88A 1R5WB 5GZNC 3BCDA 2WGNB 5EOTA 1EMTL 3BSHA 4AQOA 3N41B 3PDGA 4JO8A 2LHAA 3T0EE 1TTUA 4J4PC 4HU2A 3N43B 3IDGB 2I27N 3W82A 1EUUA 5TGBB 2ADFL 1YVLA 3QRLA 2I9LB 2D9CA 4PLKD 2WCPA 5F3BB 4LAQH 1QI4A 1M6OA 2EADA 3KWXA 4YHYB 4P5RA 3STLB 1YYCA 4FNQA 2CNZA 2R15A 4Y7MA 3FT1A 5D72H 4M02A 4K9JA 3TWCH 4AL8L 1WUNT 2D7NA 3OVUB 4KUZL 1FUNA 2QHRL 1RZKH 3T08A 1E8YA 2DPKA 3SD2A 2QPDB 3U0WL 5EWIH 4FQXD 3L5WB 2IFGA 2OTWA 1CI3M 2BOBA 3VXUB 4ABUA 4D9QD 5KAQG 3D0LA 2B15A 3R4DA 1LWHA 5KVDE 3B2DC 4H0HB 4ZFZA 2Y2YA 3L9YA 5GSRA 3U6RB 3B2UC 4LIQH 3LS4L 4F20A 2Q3AA 5KSUA 4NQDB 1FCGA 3EOBA 3OKMB 2ATKB 3OJDB 1GCYA 1NGZA 3AMLA 4PB0H 4RA0C 5F7UA 4NSKB 2XWRA 1ITBB 4KBPA 2CG9X 4PRPB 4IMKA 1WVZA 1YMHA 1XSJA 4HT1L 3VMNA 1HINH 3L1EA 1DN0A 3VI3E 3NDYE 3DX2A 3NA4A 4HIQA 2W9DL 4QTHA 2JIXB 4IBTA 5F96L 5KVDH 1NLBH 3SJVE 4CN1A 1UZ6E 5E99H 1OF2A 4O2EA 3T2OA 3FU7A 4HAGA 2ZYRA 1BEYL 1MHCA 2F9BT 2YK1H 2Q8AH 1Z3GL 3WJJA 4NNPH 1JFQL 3MODL 4E41B 3GJEA 4KY1L 5I8EB 3V9CA 1K8DA 4ABWA 4JFHE 2RALA 1G7LB 2AEIT 3U82B 4KAQL 1AY1H 3G6AA 3BZ4B 1N3NB 3EYQD 3MV7E 1CD8A 5JHDA 2GUYA 1IC0A 2A1WH 5ADPL 5IJBC 4L5FE 4H8PA 1KYDA 2WHVA 4LPXA 4UTCA 4BFBD 3AXIA 3GJFK 4PJ8D 4WNQA 1PQZB 4W9LC 4MX7B 5DR5L 1KJVA 2WSKA 1EUTA 4MA1B 5T1KB 3QDMB 4JQIA 1YNKL 4K3GA 5L4IA 4K3DL 3NJNA 2NLJB 1YEGL 4KO9A 1WAAF 5AW0B 5E8DL 3S98A 3TCLA 4NRZA 4IOFD 5I1LA 1LLAA 2ZXDA 4L5FH 1TCRB 5TPWL 5CFAA 2VE6A 1L7TH 1E9PA 3BH4A 3V4UL 3EGSA 4ERSL 1LHZA 3QFJB 4OQTH 3PFUA 3F7RA 1OCWL 3I3BA 3UBXG 1JZ3A 3Q8BA 2X70A 3GXNA 2XRAH 3TZVB 3MV01 3DTDA 3SYQA 5MP6L 1KJ2B 3NVQA 1A9EA 2XPGB 3LRKA 3H4FA 4X83A 4JZJA 3A6BH 2DQDH 3KR3H 2Q6WA 2ICEC 4X5WA 3L81A 5CZXC 1LVEA 2ZXQA 4PGBB 1NFIA 3SQRA 1ULVA 3VWJD 1ZVNA 5E9NA 1S7VB 3JQOB 3KYMA 5DK2A 1SJEA 4EI5A 3QAZC 2KC0A 1GSKA 3QDHA 2O61A 1JN6A 4K9EC 4U6XA 3CLEL 5DJ8A 3L7EB 2APXA 4ZW8A 3QI9B 3LNFA 3TIEA 1GYWA 2JLLA 3ARFB 1CQKA 3C9NA 3LSOA 1JYVA 1J1XL 3MLWH 4QRPD 1A1OA 1AYRA 4J27A 4G7RB 1Z0NA 4TL4A 1DJGA 2ITDB 2ICWB 2X40A 3ECVA 3KS0J 1KCRL 4HW6A 3RB7A 3BAJA 2NW3B 4ADGA 4Y1TA 2ED6A 4WJ5A 4XZUA 1WFIA 4DEPC 1M1SA 4P0DA 1C1EL 1AIZA 2CGZA 4GG6B 4YSTA 1QX1A 2IF7A 2ZUWA 3CXDH 3F7YB 1A4BA 3KWWB 3CJJA 4LEEA 3RI5F 4B0MM 4QOKE 5BS0A 3GMNB 4Y16C 4XTRD 3U4AA 3WCYA 1OAZL 3WFHB 1UADC 2JCCB 4U1MB 3P4OA 1DUZB 1RJLB 2QKIC 1GR7A 1U36A 3HZVB 2P26A 4K94H 5I0VA 4W9ZA 4U33A 1I7UA 1RERA 4PVBA 2Z1KA 4A7SA 4PG9B 2VJ8A 4Q8BA 2OSXA 3QXDA 3NIGB 1R17A 1A9VA 5BVPL 1D5ZB 2X4QB 5E9DE 5DJYB 4B9IA 2P28B 3S8WA 1G84A 1NGYB 3ZE0F 3CZFB 4WO4D 2DQMA 4JPVH 4HJ0D 4A6YH 3ZE1B 3FTYA 4FQHA 5ID0B 3IMVA 5EBWA 2RIKA 4UT9H 3BWZA 1IL1B 2Z35A 4PB9L 1FNSH 3EJRA 3CDGA 5IJKC 1SY6L 2GG1A 4H8WL 4BSVB 1F45A 2NY2B 4H26A 4K3EL 1J0KA 2ZNXA 1KN4H 2QQNL 2QLYA 3TC9A 3UTTB 5L88L 3OQRA 4BQ6A 1DQML 1D5MB 3QR1A 3UOAB 5GS2D 3G5VB 2H1LM 1PZ5B 2UUDH 2FK9A 4LSRH 5EZIH 1D3CA 1I7ZB 2CIIB 5F7DB 1VFBB 2WYZA 1XR9A 4K9EH 3IJ7A 1E5YA 3NFPB 3PWUB 5F9OL 2VR3A 4E9TA 4XMTA 1W72A 5I17B 1U3HD 1A7BA 3EADA 4QRTB 1QA9B 4QHLA 1AGFA 3O9WA 1D5BA 1NFDA 1PX4A 1XT5A 4JGJA 1V3LA 2EKSB 1H5BB 4HZAA 1J8HB 2J7LA 3S6CA 3WLBB 1FN4B 1L4IA 4O58L 2JJWA 3QPXL 3ZT5A 5T1LA 2X89D 5E6ID 3VRLF 4PWGA 1THCA 4PJGF 5BO1L 3QA3B 1QTPA 2ZPKL 2YARA 3HFML 3HJ0A 3PWLA 3BVWA 3LH2H 4X9BA 4C56A 1O6TA 4ZMXA 2WN2A 4BFIA 1C5BH 2WQAA 3HBZA 4PVLA 2XZQH 4I87A 4XMLH 3CAFA 3CIQA 2ZICA 1FL3B 2OXHA 4W68A 4BA8A 3K8LA 3IS0X 4BZ1A 2G5UA 4IOSD 3FCSA 3P73B 5FA4A 1ZSHA 1BXUA 3AB0B 4BFKA 2V2XA 5J9PA 3AY4A 4EIUA 5I82A 2VUOA 1YMMA 4ZNEE 3H6JA 4JQVC 5CEZE 3ARBA 4WI5A 4YPGA 4GQRA 1AXIB 1NCWL 3HE7C 3FXIC 3HJEA 3EOAB 3MRRA 4L9DA 3VJ6B 5KSAB 5F3HA 2HFFB 1LE5A 5DK3A 32C2B 1JNJA 4L4TE 4Y4FB 1QYGL 1E4KC 3OAYH 1UQSA 3FOMA 4NBYB 1OP3K 1Z9SA 2FO4B 2O4EA 4PYGA 3IK2A 2CRMA 1OW0A 4ZG1A 1WTLA 2IAMA 4TUJB 1E0OB 1FORH 4HKBB 4L3EB 5JDJA 2IH1A 5D9SA 4R96A 1IM9D 1F4WH 1EBPA 2O6FA 4YDJA 5DQJB 3VFRA 5KYXB 4XWGH 1QVOA 4NXKA 4Q0XH 5DO2C 3P3RA 3RPBA 3BUQA 3WEXA 4JFYA 1TVBB 4AQ1A 1HN1A 1FV1B 1I3RB 4R5TA 2SEBB 4K23L 2Z93B 2EECA 3BT0A 2YA0A 2G5RA 4F7CB 4LU5H 4H5SB 3MO1A 4MNGE 2IDQA 2PXYB 4HWBL 1KWGA 5FA3B 1T22B 4NFCA 3QDJB 5JMRA 2YAQA 5BZWA 3T1FB 1THAA 2E9IA 3BD3A 1OGTB 5LAPA 2O6DA 4W6XB 3WN6A 5ICZA 4UDUB 4F7MA 1FZMA 5ELIA 1NC2A 4L4VB 3D39E 5HHXL 2CO2A 1T5WB 1KJ3L 3HPLB 2EXYC 4DGUA 5C09D 4EXPX 2CJ3A 3LH8A 3UTOA 4JFDE 4BQ8A 4OZ4B 4OJYA 5ESAB 3S3CB 2VZUA 4PS8A 2KHAA 3GXTA 4Q58C 2XIIA 2P5PA 3DO4A 4KC3B 1KC5L 4M7ZB 4IEFB 2P3YA 5DZOA 5ISZA 3W5NA 3HNSL 1OGSA 1UT2A 3ULUE 4ZPTA 5BV7C 3QP3A 4HAFA 1X5JA 1QRNA 2D31A 4OD1H 4JG1H 1SMOA 3TVMD 2X0VA 3GJFA 3O3UN 2N4IA 3O6KH 5LHDA 2EIBA 1GY1A 4MNHB 3PWJA 3AU0A 4GKZB 1M71A 3OF6D 2DQFB 4BZ2H 3B8YA 5I1DB 4XCNB 4YWGH 1JP5A 4DKEL 5H94A 2DKUA 1LTXA 4ZAKB 1T0MA 5FW7A 5HI4C 3KYKL 2EDWA 5BZXA 5BRQA 1VGEL 3ULVL 2GY7B 1GGIH 1X5AA 2JV6A 4LBEB 1A7PL 2ZXBA 2NNCA 4U7KA 1T1XB 4G9FA 4AMKL 1XTLA 3NZHH 4QY8B 2D2CC 4NQSB 1BBJB 3GMMA 4JG5A 5CEYB 2J8UA 1JHTB 4HUUA 1BOYA 2YQ3A 1NEPA 1G5GA 5AW9B 1GCFA 1WAEA 5DFWH 1CYWA 2C9VA 2Y1AA 4BDVB 3KLAA 3PPEA 5F7WC 3MA7A 5D6DA 3UC0H 3J07A 2UWEA 2VLRA 3RZCC 1JPGA 2WLLB 2E4FA 2OTUA 4Y4HD 3LKPA 4N5UA 4XGZB 3P30L 1XGRB 4FQXB 4WWKA 1QW9A 3KBHE 1BVNP 2RQ8A 3MLZH 4WFEE 4V11A 5BVJB 1CLZL 1IT9H 3U2IA 2R7EA 3IFNH 3I6SA 3PAUA 2ISDA 2AJ3A 3BUIA 4NEHB 3QCUH 4HOWA 1OAYL 2XWJA 2V7NB 3RWDB 1RZ8B 1Y0LA 4RMBA 5D4HA 4A2GA 2YMTA 1TMCB 4KX7A 2HVBA 4NO5B 1ECYA 4DK3A 1GOGA 4QO1A 3FO0H 2VRKA 2XBTA 4Q4IA 4ELME 3UYPA 4G11A 1YNTF 1CU4H 2B0SH 1D5XA 4IHOA 4KH2A 4TNWK 1CD1A 1EHLL 4KK6D 1OWRM 3VI4F 2ZD0A 1UXWA 2J57A 4D94A 2GUOB 4U1NB 3JZ7A 2IGFL 5TQ2L 1OSZB 1DDHB 4ZXBA 2X4SB 2AVGA 3H0TA 3OKNA 1ESOA 3EOTH 3ZE0B 3I9IA 2HYMA 1RHHB 1JRHH 3KPOA 4ODUB 5SV3A 5IMMA 3M88A 5LDSA 4FE9A 1X7QA 2CGYA 3DUUA 3E6FA 4O2CB 4UIKL 5B1CA 4H25A 4RWYL 4EUPA 1ZGLP 4OSUH 5EU3B 2JJSC 5MEND 5DCCA 4JFEE 4P07A 2W9LA 1E6JL 3FQRB 3E8UL 4GMSH 5I26A 3AUWB 3QQ4A 4WHYH 3VDCA 5I23A 5CCHE 1GGBL 1TJHL 1AR2A 3HAEG 3HS0A 4J2XA 4PJ8B 2P7TB 2FSDA 4FLQA 3O8XD 4HA1A 2CO7A 4IRZL 5TDPA 4IBLT 1BXXA 1UTDA 5CJXA 4H1LB 1CLCA 1AGBA 1D7DA 3QXAA 4HDIB 3VMPA 3DSNB 4HEME 1LEGB 2O5YH 5EC2A 1ADQA 3HUJF 1F2QA 4JE4B 3F62A 2YD8A 1O9VA 4N9GA 3OGCB 1FNEB 3PYCA 1G7IA 2JKWA 3RKDD 3DURA 3QW9A 2YEZB 4FQPA 4HIHB 4BQCA 1DCEA 2VZ3A 3F58L 4CAGA 4WW2C 2FO1A 1PJ9A 2BRRL 1SXZA 3N91A 3HRZC 1NAMA 1UWYA 3GXPA 2V9QA 5TDNA 3UZVB 4KKLD 2EUWA 4WKXA 2CRZA 2W80C 3K6IA 5FDYA 4BUHA 3N5AA 3BVNA 3UIYA