3L9YA

Crystal structures of holo and cu-deficient cu/znsod from the silkworm bombyx mori and the implications in amyotrophic lateral sclerosis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
b'PAKAVCVLRGDVSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFGDNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDAGVTKVSIQDSQISLHGPNSIIGRTLVVHADPDDLGLGGNELSKTTGNAGGRIACGVIGLAKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in amyotrophic lateral sclerosis
doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3l9yA00
1XTMA 3MNDA 3L9EA 1ESOA 2WZ0A 3GZPA 4BCZA 1PU0A 2LU5A 3CQPA 1IBHA 1N19A 2E46A 2Z7UA 3KH3A 2GBTA 1F18A 1HL5A 2GBVA 1SOSA 1UXLA 5CU9A 1B4TA 4U4IA 3HOGA 1S4IA 1DO5A 1YAIA 1IBFA 2AQPA 2AQRA 2C9VA 1OZTG 3KM2A 3SODB 2WKOF 1JK9B 2ZKWA 2GBUA 1CBJA 1OEZW 2WKOA 2Z7YA 1MFMA 1RK7A 4OJAA 1PZSA 3GZOA 4N3UA 2V0AA 3KBFA 2R27A 3KBEA 1SXZA 1SDYA 1SXCA 4A7UA 4A7SA 1OALA 3H2PA 1XTLA 3CE1A 4BD4A 2AQTA 2NNXA 2Q2LA 3ECVA 1E9OA 3CQQA 1JK9A 1E9PB 2K4WA 1SPDA 3KM1A 3L9YA 2XJLA 2C9SA 1TO5A 1N18A 2WWNA 1F1GA 3H2QA 1COBA 1SDAB 3T5WA 5KBMA 2WZ5A 4OH2A 2ZKXA 3GTVA 3PU7A 2XJKA 4A7QA 1UXMA 1U3NA 1B4LA 2APSA 2SODB 1JCVA 1Z9PA 1IBDA 3HW7A 2Z7ZA 1KMGA 1E9QB 3S0PA 1F1AA 2WZ6A 1E9PA 1Z9NA 3F7KA 4BCYA 2ZKYA 1BA9A 3ECUA 3GZQA 3QQDB 1OAJA 2AQSA 2VR8A 1IBBA 1Q0EA 3ECWA 4A7TA 3K91A 3GQFA 4A7VA 1E9QA 1SXNA 2WYZA 2E47A 3F7LA 1EJ8A 1FUNA 3RE0A 1BZOA 2AF2A 2AEOA 1L3NA 1P1VA 3GTTA 3HFFA 2AQQA 4L05A 1SRDA 2VR6A 3KH4A 3QQDA 5KBLA 1DSWA 1OZUA 1SXSA 1CB4A 4A7GF 4B3EA 3MKGA 2ZOWA 1F1DA 4N3TA 4MCMA 2WWOA 4A7GA 2VR7A 2JLPA 2WYTA 5KBKA 1IB5A 1XSOA 1QUPA 4MCNA 1HL4A 1PTZA 1E9OB 1SXAA 4FF9A 2C9UA 1YSOA 1AZVA 1EQWA 1YAZA 1SXBA 3LTVA 2JCWA 1TO4A 2Z7WA 2AQNA
chains in the Genus database with same CATH superfamily
3GK8H 3HG0A 1D5MA 2GEEA 1MJ7H 4L1BA 4R26L 1U8CB 1UM6H 3K2UL 4H26B 4Y4HC 4BEIA 4LMQI 2IG2L 4Q6YA 2Y2YA 5F6IB 2BSED 3QR1A 4DTGL 2AK4A 2YAMA 5KSAD 3REVA 3GBDA 1PW3A 1AO7D 1E4JA 1P7HL 3K8MA 4JR9L 3LEVH 2ALWA 4FLOA 2ZP8A 3V4VL 3WMQA 2X7LB 4G80B 3P9MA 5IFAL 3PXHA 3DX4A 1WFUA 4ZX3A 2JE8A 3TL5A 4F27A 1G7JB 3C5SA 2VLJB 4BSWB 4ELKB 1TPXB 3ASNB 2V7NA 4NN7C 2YQ2A 4APQC 1S7QB 1AJ7L 5E2TH 4Z9KB 1D5IL 2J8UB 3N2JA 4NENA 4Z77A 2V7HA 2XFXA 5C0EA 2FJFB 4NT6A 1BP3B 3N40P 5B3JF 2HUHA 1AE6L 2NR6C 2YHGA 4DZ8B 1A4BA 1JK9A 3GMLA 4YLQT 4PGZA 3K5SA 4KV5E 2WLYA 1H6TA 3ARRA 5I8KL 1BZDA 3MLPA 2AXFB 4GIOA 2FB4L 1IARB 3MUJA 3QC6X 4LLUA 2FGZA 3FZUD 4UINH 1HZLA 4MA8L 5FB8A 5ISZE 5E99L 3L1EA 4LCVA 1MFDH 5MI0B 5DHDA 3CDYA 1KJ2L 3B5GA 1X7QB 4DK3A 1VEOA 4ODXA 5T33H 5TE4L 2VDQB 3KS0J 3E9UA 3ARXA 3V6OE 3ML9A 4JFYA 4NWUH 3VI3B 4JPQA 2JLLA 3MRIA 2E76C 4O51A 3GSVA 2UZYB 5D7JA 3QXVA 2FT6A 2BMKB 3FTYA 3PP3K 3G6AA 1F4WL 3FQRA 3O6FD 1EXUA 2R56L 5IQ9A 1E5CA 4ZTPL 2OW7A 1YECL 2ZZUT 3FPXA 3I9IA 4HW6A 3HC0A 3W82A 5EOTB 1DANT 2ZUVA 1ZLSL 3FQUA 2QTEA 2AXGB 3MQIA 4MB3A 5DD6A 5L2KA 4MJJA 2XXGA 3B2PA 5FFGA 3H3PL 1QEWB 3NIFF 1TR7A 4R0LB 4WHYG 4Z7NE 3K4DA 2DWEB 4PWHA 5E0FA 4YX2H 1DQVA 3AM8C 4I87A 1XGQA 4HWEH 1KIRA 4QRRA 4TNWK 3I3EA 1QW8A 2AV1B 5GGRY 1CFNB 3C60C 2YBGA 3GO1L 2WYTA 4WFFE 3WN5A 5CF3A 5KBKA 1ETZB 2WXOA 2UWEA 4PREA 3MV7D 5JPMA 4YWGL 2A0LC 5CEZD 3GXUB 4WY7H 4OCSH 2BOCA 1ROCA 2H45A 4R4FH 1KB5B 1NBCA 4WEBL 1AY1L 4UBDC 1HOCB 2XPYA 3MLRL 2V5TA 4IOFD 5FW6A 3LRLA 5AOMA 5HDQL 3HIZA 3QA3B 4N2KA 1AC6A 3S3CB 3KPNB 3BISA 4XCEB 5E1IA 3V4VA 4JFXA 3I02B 4RIRA 3GZPA 3VM5A 3RZCB 1BZQK 5IHBA 3SDAD 5F7EL 4L3EE 1DBJL 1NAMA 5LGJB 2IBZX 3MCKA 5E2UH 3T4AB 2WXJA 2Q2EB 4I85A 1ZVHA 5GGTL 3FRUB 3P4MB 3SCMC 2MNUA 1F13A 3ARBA 2GJ6D 2EKSB 1CT8B 4WI7A 4MAYC 2UYLB 1PZBA 1DVUA 4LEOA 4XMWA 1MWAB 1OW0A 1DCLA 4PJ9D 5DHVB 4U0RB 2CJSA 3DUHA 1JZ6A 4AQ1A 1S9XB 3BWAA 4LKXA 2ZT9C 4V1DA 3DXAB 3V9FA 4HH9B 1YG9A 3UO8B 3A6BL 3DO7B 1W72L 3LRSA 4YFLF 2ZPKH 1SDYA 4G6AC 4HZ1A 5C0IB 1JNLH 3MLYL 3VFNA 3OKOB 1PSKH 4U6VH 1TTAA 4PJ7A 2NXYC 5DVMA 3ESPA 3EJCA 5LKNA 5IHLB 5GGUA 1XSKA 1GGBH 2M83A 3LPPA 4TL5A 5ID0B 5E08L 1RIVH 4XB3A 4WWID 3NJLA 3MRFB 1VLXA 3K71B 1ZGLA 1F4YH 5JHLH 5C3IA 5I5RA 4YS4A 4OKVB 1DBKH 1BZEA 4WFHD 4N8UA 4NM4L 2YXFA 3D06A 5IBUG 2HJLA 4F7TB 1R3LB 3ZIYA 3S35L 4WEUD 4J1UB 3L3JB 4OCXL 2DV6A 3DROA 4NHCL 4RMVA 2KUTA 2JFCA 1KENH 1R19A 3RVXC 3KCPA 3PGDA 2JKTM 2JB5L 2EDHA 4J3WA 3O3UN 1ONQB 1P6WA 4P5MA 5DR5L 1AZRA 2AI0H 4NFDA 1TVHB 2X89A 4YDKH 4NO2B 4QXUL 2WLJA 5DUJA 2Y06L 1CUOA 2CO7A 5BO1H 2XIIA 3VWJB 1DLFH 4AH2B 3NAAH 2FEDC 5T3ZL 4KHXL 5T5NF 2AJZA 1AG6A 4GFTB 4LL1A 1BDYA 4OVUA 3QEQA 5DI8A 4YXHH 1Q1PA 4FCHA 5D7SL 3GXIA 1J86A 2IQ9L 2H4EA 4XNZC 2BW5A 5F9OH 2NZ9D 2WZPD 3WDJA 2C5DC 4Z7OB 3VMNA 1UASA 1QBMH 5AVUB 1FH5L 1X5YA 3KNBB 3WKNA 1IM9D 2OYLA 3BSHA 3SDCC 2M8XA 1C5CH 2Z92B 3CDGA 2DQDL 4XPBL 3MCG1 4X7SL 1AXTH 5DLML 1RJZA 3WIAA 4UDUB 1FV1A 3DARA 4YDJB 1GJIA 4H40A 4K7PY 2WBKA 1OP9A 5E9NA 1OAQL 4NXKA 2C9AA 5DD5L 5DQDH 4ETQA 2VO8A 3I74A 3L3HA 3BPLC 1BQHA 1RMFL 3EBIA 1I1AC 1OB1A 4OFKA 5T3XD 1W72A 1E6OH 4FC3E 5FLUA 3W37A 3S37H 4HV8A 5DS8A 2WAQA 4FZEH 4WO4D 5TTRA 2DQUH 3OXSB 4OZGA 2Y07L 4ES9A 4M1DH 3D2UD 1JF1B 4GMTH 4DZBA 2VLKA 3HC4L 1RUAL 3S36X 1ACXA 1JUFA 4HBCH 5CGYD 1X5XA 3BVVA 3HPLB 3T2QA 4BD4A 5GGSA 3ULUD 1CI3M 1M3JA 2CDEA 2LLGA 3A4FA 5FGRA 5CZVL 2FO4B 5IVXB 5KBPA 2XJLA 3UPRB 4JGJA 4K3HA 4QHLB 4DEUA 3MRRB 3TS8A 4K8RC 1QVOB 1MIEH 2ZUSA 1KTDA 2H32H 3GSOB 4R2GC 2EACA 4XN8A 4Y4FC 2YD7A 3US9A 2NQDA 1O7DC 3GNMH 3SKOB 3SPHA 4PRPE 1T1ZB 4XNUL 3NH7L 3RY5A 4KKBD 2I25N 9PCYA 1A9EA 1RK1B 4XMZA 1NCUA 3MV8A 4AOFA 2BFVL 4M4PA 2JI1A 4Z7UA 2IAMD 4KGLA 5B39A 2EVGA 2B1HL 5F7FA 4J3XA 1DQML 2IBGA 5E9AA 3D87B 1MIML 2VM4A 3RKPA 3X3GL 1K6QL 3DV4A 3FB6A 3AWFA 3VGAB 4LL9A 3BAJA 2CR3A 4FQXA 2CJUL 2J44A 4S1QL 4UB0L 5ADOL 2NY6D 4LHJB 2NLJA 1AFVH 3GHBL 1QA9A 1ZSHA 4XZ4A 5G55A 4X6CB 5C9KA 1MFBL 1MW1A 4OB5L 2J3SA 5FUZL 4R7XA 2XCMC 3NZ8B 1MQKH 4BZ2A 5BOPA 3EZJB 1EV2E 1FVDB 5EZPA 3HCVB 1Z0NA 4Y88A 4KPHH 1EAOA 3BEWA 2B16A 4S1DD 5I1JH 4B96A 3DX8B 2LT9A 4WWPA 2VXUH 3PWUB 3U6RA 5EIVA 2OP4H 5E2VH 1WISA 1SBBA 4CW1A 1VACA 4FABL 4NWTL 4MA7H 3QIUA 1BFVL 5DD0L 3LXBA 3HNTL 3ISWA 5IB3A 1FL6B 5BOJA 4CU7A 1U3HC 4NZDA 3RNQA 3FUFA 2JQMA 4PGEA 1AGCB 5FPIA 4M48L 3TO2B 5KYUA 1V8HA 4E42B 2CHDA 3N1FC 3QHZL 1FGVH 3SY0A 2F5AL 4LARH 1BG1A 2KYIA 5FYKH 1T03H 4GSQA 2DKUA 4LKCB 2HRPH 4DGWC 3HZ3A 4LIQH 1I85C 2XBDA 1UXWA 3IGFA 4MS8D 3MLZL 4PB9L 1S5HB 4PJXA 4N2EA 3MRKA 1GJWA 2DQEH 2QGCA 2IANB 1Y07A 3WBDA 1R5WB 3LNGA 3U0TB 2R8SH 5JIQA 1WE5A 3L7FA 3QI9A 1TZOA 5TQ0H 3WEXB 1N0XH 3QDJD 4ZYKA 2YPKA 4PLJD 5F93C 3OX8B 5TFSH 4OJAA 3D0VB 3L5JA 3LYRA 4KU1A 3MFGB 1TNNA 1U42A 3ZSTA 2DLFH 2ZCHH 2I9TB 1BEYH 2X42A 1YLBB 1RP9A 5ENWB 4M7ZB 5D1XE 3HI5L 2VRKA 4DKFH 1GZHA 3D85D 5CWSA 3E2HC 2LLNA 3JUYA 1RURL 4RBPH 4IRSB 2K4WA 1LO0L 1VFBB 3RDTB 3QIBA 4QDGA 1C8QA 1G1KA 3W39B 2EIMB 2EYRB 4AYID 3II3A 3SJVD 4QYOA 2HZHA 4YHZH 3TEUA 4Z7VA 2W1NA 5IQNA 3NQIA 4G42A 1XB6A 5L7XL 5JHMA 3NEOA 1IO4C 2HJKA 5DHYA 1RLBA 4Y2DA 2APSA 3FU6A 1GS7A 3BT2H 1F4HA 2WZ6A 1EMTH 3E1F1 3SKMB 4DK5A 1FBIH 3D12B 3D3VE 3AS0A 2AK1H 3D0AA 3AAZB 1N70A 3K74B 1RY7B 4NUGH 3TJHC 1P5UC 2P46B 3WFEL 4HKXB 4JDTH 4OZFG 1MCSA 4XBEH 3BMWA 4EI5A 3I6GA 1KEGL 1AQKH 2H5UA 3QCTL 4PVBA 3QQNA 2BNQB 2ZYHA 1JGEA 4QO1B 3H4FA 1YJDL 2ZUWA 3JWOL 4PRID 4X8JA 4HHWA 4ICWA 4Y1AA 1INQA 2AF2A 5F72S 3HUJE 4H0IA 1C08A 1M2VA 3ECQA 2GTZB 2BCKA 1YEFL 3VWKC 4H7VA 5G4NA 3CFIC 2FJGA 5A2JH 4NQSA 1T5XA 3ZGIA 4U6XB 1ZA6B 4KRPD 1XQ4A 1PKQE 3UYPA 1EPFA 4F7EA 1K8DB 1NLBL 4LSPH 4MVBD 1T04B 3UG5A 4YXKH 5DMJB 1EIBA 1WDAA 4J3OF 5JOFA 1IGYB 4HUUA 3KLLA 5C0CA 1QUNA 5LCVH 1NM9A 4OZIB 3FB5B 4ZFQA 3GHEL 2MKWA 4RCAA 3WI9A 3VYPA 2VJXA 3Q6GL 5C0AE 4CADB 1AGBA 1SJHB 3WIIH 2JCCB 1DQDL 5A16B 2CO6B 5EC1A 2E7CA 2XG5B 3CWGA 4G6KH 4KZCA 4MNGA 1WEJL 4P06A 1DCEA 4ZW7A 1MCLA 1RLWA 4MJIA 2W0KA 3IJ9A 5F9WC 4I0CC 2R0KH 5I1KH 1F45A 3QPXH 5J7CC 3F12B 3OKDA 1T20B 1Z9OA 3ARGB 1E2WA 2JJSC 3HA0A 4AQEA 2E7LC 1G84A 3RX7A 1DSFH 4PW9A 4IBZA 3JT2A 1GOFA 3VQ1C 3NVQA 1UWEH 3O3AA 1C16B 1YMMD 1ZEAL 2Q7NA 2A74C 5HI4C 4QYAA 5KZCD 3ZKSD 3NFSH 1NINA 4HPYH 2D7MA 2HKFL 4FZ8H 3T0EC 1QQDB 2R29H 3P3TA 2NYKA 4YDIH 1CBVH 1G7IA 4CN1A 3B1UA 1G6RH 1BBJB 5ECJE 1TTRA 2M1KA 2MQCA 4N26A 3VD2A 1ZHNB 2R1WB 1J8SA 2GT9A 1NCBL 2VC2L 4OJFL 4KWUA 4NUPA 2BLFA 3X13B 4QHNA 4JZJC 2DOCA 3KJ4C 3HHMA 1IKFL 4KC3B 4LNVA 1XH1A 4GQPH 1WBXA 5FDYA 1EJOH 2ZAHA 4WU5B 4QRPB 5CIPB 3RWFB 5C0DA 1BXXA 3EOBA 1JHLL 2OL3L 35C8H 5TGBB 4N0YH 3NCBB 3SDDB 3MJ9H 1MFAL 3SY6A 5I1LA 3QJRB 3LKRA 1HYSD 2BVTA 3WLWD 3D39D 4TOYL 1FUNA 3KDPB 3NEEA 1SHXA 2NCMA 3KPSD 1P4IH 3H3KA 1VFUA 4X9FA 3CHXA 3VMPA 5ALCH 5C08A 3CNKA 4UIKH 5HJ3A 3OKMA 1MFVA 3MKKA 4OGYL 4LHUG 4U1GC 2KPNA 1TJMA 1UFUA 3DETD 5IB4A 2O61B 4F7PB 4I48B 3OR7B 3DHPA 3QUYB 4G3YH 3QZOA 2HAZA 3BAIA 1P4LB 1KDJA 1BBDL 3FF8A 5JHAA 2CE6A 4YHML 3HJEA 4FF9A 4NFCA 1E5AA 3VD5A 1N6QH 4ONHA 3MBEC 3MOBL 3MUY1 3IETA 4JM4H 4RA3A 4XMLL 5DJAB 3SQBA 3V0WH 3T3MB 2XXCB 4O02H 3U0WH 4DVRH 4ZMPA 1INDL 2CNYA 3P69A 5IR1B 4E0RB 1BAGA 3OLGA 2ILLA 4X8GA 3VGHA 1AQHA 4HUVA 1SYSA 4H2CA 4AG4L 4AYMC 1A14L 1HSAA 2XTSA 1QFOA 1NBVL 1NLDL 4ZAKB 5BMFH 2ZIDA 3ZGHA 3MRHB 4ZFOL 3TYGH 5DHEA 3T77A 3TYFB 1BYOA 2YN5A 2Z35A 1GIGL 3S35X 5L2KE 5BZXA 2XC8A 4OD1H 5FA4B 3MBWA 3OM3B 2R2CA 3G5YB 5I66B 4NGHL 2X4RA 3ROLA 5SX5H 4U1LA 2EYTB 2HFFA 2ODIA 1WD9A 1DL7L 3L6FA 43CAB 2UWEE 1O6VA 2DBLL 2BSSB 1JF5A 2XPGB 3H2QA 4RAUA 4YAQA 1EO7A 1M57B 5EWIL 1GKOA 4G7YH 5I23A 3GTVA 4YDZA 1OAKH 1FIGL 5IW1A 3C6SB 5A2FA 3DVGA 2IWEA 5LGKA 1JXGA 1S7SB 4E9TA 4H0HB 4X6BA 1KIUB 1E9PA 1WUZA 1Z0MA 3VB9A 1XGPB 3P0YL 3VXOB 3OG4B 4OD3L 3VFMA 3HE6D 3TT1H 2PW2B 3G6JA 4PJEA 2RQ8A 2J2ZA 3LIZL 3PXLA 5J6SA 4ZW6A 1KYAA 1R3IH 4QNPE 3L45A 5DJDB 1Q9LB 5DO2C 4HD9A 2UZXB 4OIIL 4R96A 3BPCB 3GMQA 4PJHF 1XO8A 4HLJA 3KL5A 4OQTL 3AADB 3BGAA 3HRZA 1L7IL 2HN7B 1MHPL 4UIMB 5HHVL 5L4MA 4V1DE 4G8GD 2WO2B 5D2LF 4WNQA 3GSNA 3MROB 4PJGF 1SMOA 2APWA 4BUGA 1SLUA 1IT9L 3U7WH 5H94A 1A6ZA 1KGUA 4KY2A 1NC2D 4QKTA 8FABA 4OI7A 3JTTA 5C0GA 3FT4A 2OW6A 2X1WL 3OZLA 2X4OB 4H20H 4UQ3B 5E8DL 5IQ7L 3EYSL 4QXVA 4EAEA 4WTXA 5I6OA 3PJNA 4QRTA 1MZZA 3SE6A 3EHBB 4K23H 3ELQA 1Z9MA 5BUAA 4HJEA 4IGBD 3GIVA 1I7RA 3ZTEA 2QMJA 2A77L 2C9PA 2EDDA 2ZCKL 5I1IH 2C3WA 5I18L 1A02N 1JHTB 3A4EA 2O26U 3NTCH 5HGAA 4J6IA 4CA4A 4JO1H 4LCWE 4E2OA 3GRWL 3TO4C 1VZGA 1MI5E 2V17L 1G7QA 2NY1B 3RVTC 4ODUA 2QADD 4Y7MA 3WS6C 4Y16C 5AAWA 4L8SB 1JRHL 1SQ2N 32C2A 3MV9B 5AVSB 4QKXB 1YYML 1CVSC 2G9KA 3U48A 4ZFOA 4TN9A 4UTBH 1LE9A 4IBWA 5LBGA 3U1QA 5TE7H 5F0JB 3T1FB 5ACZA 1T83C 1II4E 1RZKH 2BIPA 3DI2B 2GSIB 3DJ9A 4JGNA 4HU2A 5C6PB 2IPTH 3STLA 1NM4A 3OZKA 3H7BB 5C86A 2EYSA 3V4PL 4ZS7L 2Z91A 3AS3A 1HWHB 3KBEA 5DRZB 1MREH 3J27A 3OZ9L 5FM5O 1IC5H 3K0YA 4LSRL 5AUMA 4YHIB 2OR9H 1P1ZA 5DJXA 1G9MH 5HHQA 1T0MA 1ERNA 3SIKA 4G6MH 4P4KC 5C07B 3V5KA 3TFBA 4WFGE 1CO1A 1HHHB 3QDMB 5AB0A 3BQUC 4L18A 5JUEL 3BIKB 2UXFA 2P1YA 3QUXD 4M3HA 4ADIA 1IGIH 4WHDA 1PAMA 1IFGA 2AERT 4W81A 5JXEA 4HU8A 1PDKB 5HGHB 1JZ8A 2XWJA 1KCSH 2WQSA 4HJUA 3LIZA 2YO3A 1VDGA 5IUCA 2BPBA 1AAJA 3BAYA 3LHPL 1PYWA 5FF6B 4KH9A 2VDLL 4ZQKB 2C9QA 1NFDB 1OCWH 1YEDB 3U2JA 4JRXB 3G5VA 1WZ1L 3WY2A 4P2RD 2Y25A 1OM9A 2ZG2A 5IMLB 4JKNA 3B3BA 5EG6C 3T04D 1I7TA 4FFZL 4WWKD 5F6IC 3NIFE 1AHWB 1ORQA 1IBBA 1G9NL 4UQDA 4WFED 4X4MA 4EN3A 5KEZA 3BLKA 4FQQA 3OAZK 4KAQL 4R4ND 2VUYA 1IEAA 4QF1A 2MCPH 3F00A 2ID5A 4XNDA 3TN0C 1JN6A 5EOQL 2VLKE 1G4RA 1LEIB 5GIRB 1DJGA 3CHSA 4YBQC 4LVNC 2NY5H 2DM7A 3FO0H 2BY1A 3QQ9D 1F3JB 1IGFL 5GZNC 2B15A 2H2PD 1IILE 3NRFA 1F2XK 4LBEB 4RFOL 5I1CH 3GRWA 3O8XB 1MCIA 2OSLA 1MFEL 4P23D 1EANA 1YN6B 2K78A 1N5YL 2E7MA 2YUWA 5IMKB 1NKRA 1F41A 3L3DA 4CVXA 3PQYD 4FYSA 3G5WA 3IK2A 4UT6L 3FULA 4I3SH 4WF7A 2JELL 1MEXH 4HDIA 3NIGE 4XCYB 1DVFB 3MV8E 1A6WH 4NRYB 4HC1L 4L9LC 1GPOL 4LEXL 4O58H 3BD4A 4ELMB 3GSXA 4Z7QF 1JIBA 4NPKA 2KZKA 2NRDA 2HLFC 2VN6A 4B60A 2CDGA 4JFQA 4LLQB 1OCZB 2J1WA 3I84A 4NAQA 5SX4H 2XN9A 3TEYA 4WK2B 1ZS8A 3O41A 3CFDB 2PTTB 4GW1B 5I28A 5A7BA 1W0WB 3Q0HA 1HZHH 3AG1B 4P07A 5IKCB 4MXVF 1FYHB 1Q0XL 2NQ3A 1QFWL 2RMNA 2X0WA 3STZA 4NKIH 4WLCA 4EF3A 2QHLA 1D5XB 2IFGA 1QSED 3MFFA 4IMLB 4LLYA 4P2QB 4YK4C 5ILTL 5CCKH 5I73B 4Z7IA 1LHZA 3BLBA 1RZJH 1C1EH 5K59E 4Y9GA 4M1CC 4CDGC 1CI5A 1XF4A 4FQLH 1A6AA 4PG9B 2HH0L 1H5BB 1ZVSB 1X5AA 4Q6IC 1FHGA 1P4BL 5JDJA 2X9XA 2NZ1A 4HIXL 4WK4B 1K3ZA 5EU4A 4G43A 4FFZA 2FJHA 2OULB 3KLAB 5TE6H 4YR6A 3COOA 4TQIA 4TKWA 1LE5A 3WY3A 1SMAA 5B1CA 4M61B 1K2DB 4X2UA 5JQIB 1Y18B 3D5OF 4Z7AA 3US0A 2PN5A 3Q48A 1BGXH 1PX4A 4B53A 2WZAA 4J3OH 3VRIB 3BXNB 3QDHA 2XZCH 1FSKB 3OXRA 3OB0K 1V7MH 1KWGA 3KBPA 4JPWL 1GC1C 3IE9A 1YY9C 5D4JA 3RPBA 1E3ZA 3VFRB 3US1A 1K72A 3CMOH 5C2BH 2BNRD 4JRYA 1LO5A 1R47A 3D52A 1DVYA 5EBLB 5JW3H 4QTIL 1ZWIA 4XWGH 3Q13A 5JNYB 3OLEA 1F6AB 4JFDB 3B9KD 1ZTXH 2I5YL 3L4VA 2CU9A 1NCJA 4PGBB 4AYEC 3MREA 2HVKB 1Q0YH 1KLGA 5KN5B 3FCSB 4UT6A 3IMTA 4XPAH 4Y4KC 2GFBA 4D0BA 4Y5XB 1QUPA 2D31B 1D7CA 1DEEB 3TCXA 1S5IH 2CK0H 5GSRA 1BV8A 4F80A 3JYCA 4XNMA 3IPFA 5D1ZA 5E00A 4RQQA 2RBLA 1ANUA 4PTTA 5LBSH 4MMZC 4FD0A 1E4KA 4L4TB 3ZYIA 1H8NA 4PGCB 3WFHA 4BSVB 1SMDA 4M3KB 5IGXL 2YD0A 5K39B 4PV8A 4UNTA 4XPTH 2BSTB 3WFBH 1RZIA 1QR4A 4U1MA 3VFGH 4JO3L 5IP4A 3KXFA 5CU9A 3UJIH 3BIAX 4XNXL 3J2PA 3PHQB 5HYIA 1JMXA 4JREB 4K7PH 4WO0A 1R24A 1UOKA 4JQVC 4GUOA 4LVEA 1UWGL 3ZN6A 1AHKA 3HNVL 1UQSB 3I9AA 5DMGD 4BGLA 1EK3A 4ZTOL 5HHME 4KFZC 1EJ6A 3FN9A 3WEBA 1I9RH 4IU3A 4ZX6A 1KJMB 3M17B 3KYNB 1G6RB 3DOSB 3QDGB 2J6WA 5KANI 2PCXA 2LTQC 2D8KA 4GP8B 3R7RA 3UTPE 4ODWA 3FKUS 4X6EA 1I3VA 3FCUB 1OAUL 1U8IB 2HVJA 4RMUA 2V3EA 4EVNA 1WFMA 3HB3D 1BQSA 2O5NA 5GS0C 4YSEA 2XWXA 2Z31A 3IWUA 4WI6A 4P3DB 3QUGA 2D2OA 4MNQA 3RGBA 1I31A 4D0DB 1HILB 3VRJB 1TQBC 1BQUA 4AM0B 4Q9QL 5MEQB 2CR6A 4M6OH 2R59A 3GMPB 1A3QA 3SPVB 3RIAK 2DQIH 2CRMA 2WKGA 4P2OD 4EIBA 2WBWB 4A6YH 4RRPA 4CKVX 3K2IA 3DYOA 2H3NA 3TONA 2XN1A 5FWQA 4BDVB 1L0YA 3AROA 3E8VA 4MWFA 4WUUA 1TTCA 1QR1B 1ZGLM 3NCXA 5IVOA 4PV9B 4G9FD 5ECGA 3NCFB 3OGCB 2GKIA 4MNGE 4G72B 3NGBB 1QLRA 2D0FA 2WIIB 4MAUL 4MJIE 4OCMC 5GS2H 2OJEA 1T1WB 5T8IA 3OSVA 1RXLA 4LLWB 1ODUA 4D9RD 3CFEB 1HL9A 1IQWH 2D3NA 3L3OA 1AQDA 4F58H 1UFGA 3KH4A 3QIWA 3C8KA 5C6WH 1BAFL 3CZKA 5SWQA 3FSVA 4NQVB 1ZSDA 4HX1A 3ARTA 3FQYA 4YGVA 2ESVB 4JY5H 4KKPA 4QRBA 3CFBA 4UQIM 1GS8A 4XVTH 1LK2A 1L7TH 1DZBA 1YEKH 2OZ4L 5ELIA 3V6OC 4JFED 4PJAA 5I1DA 1VGKB 3ULSB 4IK6A 3FN0H 2B59A 1XGUB 2XNAA 3V0EA 2K6YA 1WFOA 1KC5L 1VFMA 1KXVA 5B1JC 2JCWA 2C3VA 4PJBE 2Y6TE 1HHGB 2NY2D 2VDOL 3FPYA 4IOIB 4O02B 1MY5A 4YZFE 3NIDB 2NY7H 3UZEC 1XIWC 3EYFB 2P45B 2XZAH 5I0XA 3FB8B 4DWHA 3GJEB 1F6FB 1L9TA 3AQZA 1OHQA 3CQPA 4DJMA 2L0DA 1KYOK 4HAKA 1IQDB 2XVKA 2GBVA 5HYJA 3LEYL 3RL1B 2AEQH 4PJFA 2YGVA 1X5KA 3TT3H 3VXSB 8CGTA 3DSNA 1W8NA 3FJTA 5FOBA 3S34H 3JVGC 2X3CA 4S2SA 3VGAC 4AQOA 3VXMB 1WHPA 4JQIL 2E6QA 3QNXA 4DN4L 1YPZE 2WXRA 4QAMB 4F7MB 4C56E 5CEYB 4DUWA 3S3PA 5I0YA 2X6UA 1OQOA 1AIFB 2NQCA 2X1PA 3C87A 4B95C 5JIMA 3CVHH 1FA4A 3CSBA 4HK3J 4LK4A 4YBLB 1V7NL 4GXUM 1DBAH 4NP4L 4WI9A 3I6KA 5HDBE 5C08E 1X5MA 4FFYH 5FM4A 3N1QC 4GRLD 4MQXC 1TJIL 3U30C 1NBQA 4HT1L 4FJZA 4KROB 2D2CC 1LEGB 2PMZA 1CF8L 3FMGL 3RUGB 1BEXA 3O4LA 2CRZA 2ITCB 1SN5A 4GQ9H 3EXJA 4DCQA 2QKIB 2XQYA 2EAEA 3OBAA 3WJMB 5IESL 4Y89A 4NLAA 1S7UA 4IIQB 5DJ8B 1YEIL 4QXGH 5DZ9A 4GUCA 2XACC 4LSUH 2A38A 3RX8A 2X4PB 4KK9C 1IC7H 4J3UA 1UA6H 3DMMD 5GRUH 2CPCA 4JCMA 1BJMA 4F15B 3GB7A 3FHAA 2Q76B 1GJUA 5ICYA 1A6UL 5AVRB 1VZHA 2Q8BH 4G8EA 2ATAA 2P43B 1JVKA 2WVVB 3T3PE 3BZEA 4H8VA 2GJ6A 1OF2B 2H1XA 2G4GA 3VXRB 2PYEA 4HHAA 4KK8D 1M53A 2QVTA 3ZKQD 4PM1A 3EGDA 4NOFA 4GKOA 1BQHG 3NJVA 1EGJH 5IOPB 1SVCP 2DQFB 5DQ9A 4DSYA 4ONOA 4PYHA 5DMKA 4MZRA 3B9DA 2YA2A 3QAZC 4XNBA 2EQDA 3HMWL 4OTXH 2FD6H 3AGWA 4GLRH 2OZ4A 3VFPB 3VXNA 1VGEL 1YYLL 1JRHI 1U8KA 4I3RL 4I77L 4X7DC 4YHKL 4DVBA 1JPSL 4XMTA 1D5RA 4A39A 2BVPA 1DTUA 4QJ3B 1LP9B 1IL1A 2Z93A 4NC1C 4A7GA 4P2YA 1TQCC 3V6BR 2ZX6A 2ZG1A 1G0YR 4H1LA 1B0RB 2IC2A 1WCBB 4HFUL 3RWJB 4OLVH 1ZT7B 2RGSA 3RTQB 4WSJA 1JPEA 4DKEL 3RDTC 1SEBA 5E7BA 1BZ7A 3QGVA 4AKOA 1ZTXE 4DQOH 1OE2A 4PJIE 4XNYL 3BC9A 1NL0L 4NO0A 3T0AA 3B34A 4QCIA 3AW5A 3QORD 1CE1L 5KYXB 3KVPA 1UJ3A 2YQ3A 4YHYB 4P3CL 1NUDA 1CTOA 1LVEA 2PR4H 4TLSA 3K1DA 4M7KH 2KH2B 1BZ9B 2Z7UA 3N40F 4XOBA 3UZVA 5CD5D 2HTKC 2A6JB 2MOQA 3LPOA 5FKAA 5KYYB 5B39G 3SBWA 1BM3H 1AQ8A 4F1ZA 4L8BB 1G1CA 2NX5B 3OKNA 3V5HA 2QVKA 3SODB 3MLTB 1X5GA 4XP5H 3VFOA 4TVPH 3VE0B 4G1MB 5ESQB 1J1OL 1P7BA 2DEXX 3C75A 2ZCLL 2VXQA 3DHUA 2DQCL 4AGPA 3UTSA 4Z78B 4DIXA 1IC4L 4XAWL 5GRJL 1WAPA 5IMOA 2AXJA 4KKLD 5AVVB 1TTFA 5BO0D 1GL4B 4LASH 3CSYB 3JTBA 5AALA 1IM3D 5LXVA 2ICCA 4R7NA 4JPKL 3UDWA 3B7RL 2BIQA 2J71A 3ZJAA 5DK2A 1EO8H 2ZUQB 1RFDL 1IM9A 3S5LA 3KPTA 3R1GH 2OK0H 3DJRA 2VDKL 3S96A 3SKJH 1L6ZA 3LN5B 4O2CB 4ORZC 3D25B 2HLAB 1GCFA 4J2XA 1UWFA 3KYOB 1UJTA 2J6EH 4LOUD 3WNLA 4TMPA 3TIDB 4PJ7F 4U3CA 1FNFA 4W9KC 3TC9A 1TSRA 1DQTA 3AREC 4HJGB 1XF3B 3IU3B 3BUDA 1BW8A 2X09A 3MBXL 2GJRA 2DD8H 3PL6D 4L1DA 5FO2A 5FHAL 3X1FA 3G3LA 4X5PA 5A3IC 5AFAA 1NIBA 1SM3L 3IFLL 4RMRA 2VQ1A 1EZLA 4GKLA 1KPRB 4GBXC 3GMNA 4KI5F 3FUMA 2YK1H 3NK3A 2FLRT 2ZP0T 3U6XS 3HHSA 3HVNA 4FEIA 2VXVH 1R5VA 4OZHF 3O6LL 4NPYB 4ZDHA 1H15B 1FLRL 2C7UB 3LKOB 1HXKA 1U8NA 5K9QI 2W5PA 4HCFA 5J6HA 5FLVA 3EZ8A 1NPJA 1MHCA 4MCMA 4QGTA 2VR3A 1IEHA 3TZVC 3K5RA 4IKNA 1X5FA 4JO2H 1TXKA 2FUTA 1SFDA 3TVMD 3ROOA 4YNYA 2DKSA 2AJUH 3VYNA 1JDAA 4KO9A 2FHBA 2K4AA 2X6VA 2NNFA 9CGTA 1HAWA 3U6XA 4B9FA 2IDTA 3I6LD 1XR8A 4X9BA 5GRXG 3BUPA 2HFEA 4F8TA 2CALA 1F11A 4M7JL 3ZKND 1MRDH 3WKMH 4YPGA 1Q9KA 2CSPA 3NZHH 1E3XA 2G3MA 2XKSA 4Y19B 3G6DL 2MSPA 2Y1YA 3BUIA 3O9WA 3FOLA 4MX7A 3EOTH 4NQTA 4WI8A 3J07A 4AK2A 4BFIB 4DGVH 5BPPA 5HTSA 4I88A 1VENA 3VH8B 5KTEH 4S11A 3EDDA 3QRGL 1S9KC 1DSYA 1JGDB 3KPQB 4X4ME 4MTMA 2N1TE 2O5ZH 3QZPA 1TLKA 4XO4A 4GAJH 2NY4C 3DTDA 4UAOC 4G7VL 5I9QC 5CJOH 2R83A 3FTWA 3RPIB 4YHNB 3RDJA 3GZOA 2YC1A 4GQRA 3H8NA 5AAPA 4Q52A 5ANMB 2AEPH 4ZW3A 5C1MB 2H47C 3WSQL 2YPLB 2UVFA 3B8SA 3H9SA 1XF1A 1YC7A 4IBUA 4QY8B 5C0BB 3IU4L 1QWUA 4G59C 1CZ8L 3ZDYF 1FP5A 3WIHH 1EJFA 1UC6A 2F54E 4HEMA 3L13A 3F58L 5D6DC 2WLHA 3TP4A 3PV6B 2ZOLA 2JIXB 5H4ZA 1R46A 3TA3C 4P5KA 2AXWA 1HC1A 2XHNA 3UAEA 1HXMB 2DH3A 5A6MA 4PJHE 5HGDB 4JFFB 1MY7A 4L29A 2EDBA 2BP0A 4HH8A 4TNWF 5CP7B 1N10A 3DVIA 1WBZA 1WIOA 2QHRL 4IBSA 1HWWA 4S0TD 1BD2E 5D1XC 1RI8A 5AL8A 1OT4A 2OTWB 3CFCL 4RFNB 5MEOB 5LWYH 2IVFC 3DPBA 2SEBA 4L5FE 1YZZA 2NY0B 2GB2A 2N7SA 3ATBA 3ARFD 5AB1A 2XN9E 5F7YC 4BH8A 4E9SA 2NDFA 3TBYB 1NEZB 1PKOA 1DZ0A 2WNKA 3EAKA 5D6CB 3BVUA 3NACL 2YMOA 4Z7UF 3UROR 4LSQL 3T6VA 5CEZH 1ZHBA 3OJ2C 1DSWA 4X0KB 1BXAA 5FYLE 3I2CL 3FU8A 2WLLB 4PLKC 3MLSH 4JZNA 4BH7A 3KLKA 5JPNB 1DJYA 5EMYA 4HF5L 3ZQXA 1E4WL 4XP6H 3N0AA 2X53A 1A7RH 3C6LD 2K70A 2CGYA 2NXZB 3CIAA 4LRIC 1FL5A 3IDNB 4I5BA 1S9VA 2O4EA 4X6FA 1KLFB 1XCTA 4M43L 3P2DA 3GUTB 5LNDA 5CR8A 1XGTA 1S7XA 4JAMB 1RUML 2CG9X 2DM4A 2G9HB 1AG0A 4FXGB 5EORH 3VXTA 1XF2A 7TAAA 4I2XA 4Y5VA 1PZUB 4TQEL 2EEBA 4QJ5B 3QFJA 3FUHA 2PYFB 5DSCB 5BV7L 4X4YA 5ES4B 2VJ8A 5EF2A 1CF1A 4UZGA 1FE8L 1OSZB 4WU7A 3VU2A 2ARJA 3F7VB 3N9GH 5LO7A 4H8HA 1PG7L 1FHNA 3SE9L 3GI9H 3QNYA 4I8DA 1E5ZA 4OCNC 2ZF8A 4JBSA 4PD4K 2FO1A 3D51A 5H37A 1QI3A 1V3MA 2IDFA 4S1RH 3OKLB 3ZT5A 5C7ZA 5CN3A 1WT5A 3N1PC 1FNEB 4LRNH 2OMZB 1RV6X 4BFGA 3QYCA 2WQRA 5E0QA 1LMIA 2EILB 1NZRA 1SOKA 4I9XA 5MEPA 2PXYA 2BP3A 4LMQE 4ZPTA 2WLZA 4PJXF 3I50H 2YD8A 4L4VE 3E9TA 1A7NL 2Y36L 1IRAY 1RVFL 3BHBB 5C9JA 1UM4L 1HKFA 2O6FA 3PWNA 4IRJD 3VTAA 5SWSD 3PREA 1ZVNA 4NO3B 4EQ3A 8PAZA 1Z5YD 2ZF9A 2WZ5A 1D9KC 4QRFA 2CCVA 4KI1A 2A73A 4B9PA 2IDSA 5I1EH 4LU5L 1TTGA 4UTCA 2ICEC 2BX5A 1CDIA 4NN5C 3K4ZA 3GBNL 2VDML 1GMEA 3H85A 1LWRA 2X4NB 4PP2B 3DOHA 1N8OE 5I75B 4ECNA 3LNEA 1J0YA 2FWLB 4KJYB 5H8DA 1URZA 3QDAA 4QD2E 2OXHB 3CFKB 2RAMA 4Z7VF 3KXFE 2QZ5A 1MNUH 4PRNA 4EXPX 4L8SC 2Z4QB 4JM2A 3NZSA 4PRHD 3TV3H 3W81A 2WBJA 4A7TA 1YA5A 5IHUH 5BZDB 3H4HA 5CEXB 2UXTA 1EVUA 3IFNL 4KX9A 4AQAB 5KW9L 1JGLL 1Z9SB 4NNXB 5FGBA 3RZWA 4QWWD 1XZ0A 3UMTA 5IEHA 3X1NA 2FE0A 2F68X 4Q2ZA 4ZXBC 3NA9L 5I82A 5B38B 1KYUA 1M05A 1K4DA 2ADJA 1CD1B 2BRRH 3HR5B 4HQQH 4IOSD 1UB6B 2R2EB 5EOCL 2FZ3B 2P8MA 4DP2X 5INDB 4AYSA 1B0GB 4CBPA 1OT1A 4OM0H 3CTTA 1KLUB 3MUUA 3UH8A 1ZA3A 2G75B 5KG9A 4IBVA 4FOMA 4JG0H 1KYDA 1QHPA 4MZ3A 4HS6B 4XCFH 1EQWA 2DI8A 1RPQA 5J13B 1T3FB 2IH3A 3M88A 4XT1C 4CVZB 1OSPH 1WTLA 3DURA 3LQZB 3RZCD 2EDWA 1DN0A 3H56A 5EO0A 3W9EA 3N44F 3NPSB 4BFBD 3MUGA 3BAEL 2AQ1A 4PP1C 1NAKH 1I4FB 4JGUA 5DDHA 3EOAB 5EULV 4LQFH 1QWNA 1FORH 1F18A 4PJ5A 1NFKA 5DRXA 5F0MB 5AKSA 4IU2A 4BCXA 1CC3A 2XWEA 4PR5B 2VXTH 4OQ1A 1P7QB 5LN8A 4P46B 3CVHB 3DXAD 3EJZC 4I9WD 4ZMXA 2Y7QA 3O45A 2BJMH 2G3XA 1TQSA 3TASA 1AR1B 4HIIB 3NK4A 5KVFL 5B7FA 3TIEA 3BKYL 5A2KH 2IH9A 1SFHA 4HPOL 5JZ7C 1Y1UA 4GW5B 1TVBA 3SQOH 3AT9A 5CJXC 2PPAA 5E5UB 5F70A 3WUWB 4ZG1A 1E9OA 3L5XL 4YSRA 1WFNA 4BJLA 4YIQB 5D2LB 1EAQA 4PJGB 4L0YA 3MCLH 2ZYRA 3KYMA 3QXUA 2WWNA 4F2MB 3OKKB 1C5DA 2WQUA 3QCUH 3FQWA 4FNTA 4K3JL 5D5MA 3LV3B 1F56A 3RNKA 1TQUA 3RGVA 5L2JA 1ECZA 3AVEA 2ED9A 3CK0L 3ABZA 2JI2A 3O2WL 4NQDB 4XHJD 3WNMA 3H9ZA 5IREA 3FW6A 5CHNA 5I6XC 4RNRB 4BINA 4KHTL 2ADIB 5AW8B 3ECBB 4YEFA 4OCWL 1KJVB 4E5XA 4GRWE 3AG2B 3HZMA 4Z7WF 2Q3ZA 2WCPA 2OMYA 4NHUA 3WAJA 3FTVA 2GTWA 4P5TB 3UL4A 3WJJA 5HYJE 3DGDA 4PJFE 4F9LC 4JFPB 2F53A 3RWHB 4JK0D 6CGTA 1OE1A 3TBCA 3GQFA 1AP2A 1KY6A 3P9LA 3B2UD 5FOJA 5ALBL 3VWJD 4X0NA 1WJ3A 2BVQA 3WN5C 2AVGA 1H19A 4XZUB 3BN9D 3EO1A 4R8WL 4WTWA 1JMZA 1LD9B 3PDDA 5I17A 5D1QA 3WL9A 2PCPB 5ID1A 1G7MA 1J12A 2AQ3A 3K2UH 4B50A 3OL2A 3UTQA 4FQIL 2JB6B 1TKWB 2ZONA 1CPUA 3BJ91 1H0DA 1QO3A 1JTOA 5IJVA 4DTGH 1NUFA 1A9BA 1T5KA 4M8RA 3MV7E 3KPRA 2HX8A 3X12A 1YNTF 2W60B 2N4IA 3O4LE 4JR9H 5G4OA 3NFNB 5AVQB 3MGOA 3W57A 1HE8A 3FFCB 3GF8A 3IB4A 2HT3D 3ARQA 2NCEA 2IOIA 5HI5D 1KCLA 5IFAH 3ARBC 3LZRA 5GHWL 4PGDB 3MRLB 4PVNA 2VLLA 2KMWA 3K7UA 4GKZA 3VD3A 4PGJA 3SYPA 1WUNT 5ERWA 1OW0C 4D8OA 1QRNB 4LPVA 1AGEB 2CLRA 4L0ZA 2I9LA 3LN9A 1U58B 1AJ7H 4HFWA 1TQVA 2XBZA 4UMGA 2UXVA 4LHUB 5INCB 1D5IH 3APFA 4J8RA 2G60L 2W9LA 1QSFD 2GJ6E 2HSIA 1RIUL 2PYEE 1AE6H 5LBVA 4APQA 2ZCZA 2EH7L 4UQCA 1CVRA 4X6DF 1S8DA 4MA3A 3EFOA 2IOOA 1AYOA 5FK9A 4JG1L 5I8KH 3VM7A 1QKZL 2FB4H 3S9DB 2ZSWA 4N0FA 5E99H 3QVAA 1AKPA 4N0CD 3S3DB 1HWGB 3JV4A 3PPEA 2VO5A 2VDPL 3GGWA 1KUMA 1KJ2H 5IROD 2OM5A 4A1RA 3S8WA 3HE7B 4NBXB 5TE4H 1OK8A 4K9EC 1S9WB 4HUMB 4NQEA 2AQ2A 4LLVB 4AXWA 3TNNA 1KULA 3UJJL 2WNGA 2JQAA 2BSRA 5I8EA 4HSAC 4J12A 1F4WH 2R56H 4XN9A 3ZL4L 4ZTPH 3GKZA 1YECH 5JQ6L 1E7VA 1ZLSH 4OFYA 3Q8AA 4JVPA 4TL4A 4R83A 2APBA 3V52L 4N22A 1FNGB 3PWPB 4AC2A 5F88A 3IGUA 4YHPA 3H3PH 3V6FA 4D8PB 3MYJA 4DP6X 3JV6B 3ARYA 3Q5YA 1A3RL 2C3XA 3L4CA 2GAZB 3FDWA 1LDPL 4Y2NA 4XXCA 4AYFB 3QZWA 3HLAB 1Q9OA 1CICB 2A4CA 4U7MA 4XVUC 4YWGH 2PPFA 4FEMA 3AM8A 2KQNA 3TWYA 4Z7QB 3PWLA 1ZLUK 4LCUB 4ADGA 2NTFB 1AY1H 1TITA 3MLRH 4Z3EA 4Y9EA 5GRZA 1JXKA 5GJSL 3P02A 1G6VK 5HDQH 5JIHA 3LQAC 2CKBL 1VFAB 3L4TA 4HKZA 3M1OA 3V0IA 5CBAA 2V6HA 3MODL 5DEGA 3SD5A 4HA1A 2H2SC 5F7EH 3PNWB 3NCJL 2H1PL 4XNQA 4KKRA 5KSAB 1AO7B 2LVEA 2DLHA 5GGTH 1L9SA 5EBGA 2ADGA 1RZGB 1KXQE 3MRJB 3VW3L 4HJ0D 3OF6D 1TMCB 1FNAA 3LB6C 3TFKD 2GJJA 1F97A 3HMXA 4HGWB 4HKJA 4XWOC 2VZ3A 1FLTX 3A6BH 4MAYA 1I8LA 1W72H 5F89A 2BP5M 1YVLA 4PI0A 4A2DA 1YQ2A 1L6PA 3MLYH 3PP3H 5JORB 4R90L 5D4QA 1JPTL 2IAND 6PAZA 1ZT1A 1U8MA 1X4XA 5T3XE 4HAFA 3TBTB 4L37A 4UCFA 2B77A 5DHMC 2G5BA 4MLSA 1E5BA 5E08H 1Y6KR 3ILPA 5CLYA 4POZD 3SZKC 3FC8A 3U2SA 2Y22A 4XO8A 4HISA 4JO8A 1N6UA 1YDPA 2CJ3A 4AYDC 4E9WA 2EICA 2V0AA 3P0VL 1MVUA 1WGOA 2DIBA 2R27A 3POCA 5KJ4A 3ZHNA 2VIRA 1SXZA 3C5ZB 3FN3A 2BC4B 4ANWA 4NM4H 5K9OA 1RZPA 3ULUE 4IRSD 1T6VN 1FFQA 3S35H 4GG6A 5F44A 4GAGL 2OJ1A 2C9RA 2XPZA 2GSGA 4NHCH 2G0LA 4ZMWA 1TQTA 5M94B 2XBTA 4PJ8B 4PS4L 2PWHA 1RUPL 3GS7A 2JB5H 2PPDA 3CXFA 3RWDA 2JNZA 4EKXA 2ZG3A 1YMHA 4OSUH 3DDFA 4YUEL 5DR5H 2FR4A 4PN6A 2K8MA 3GPEA 4FNPA 4QXUH 2Y06H 2ZXCA 3LVTA 2Z7ZA 2XFGB 4N9GB 3ZSSA 4UV4L 5ABAA 5T3ZH 4KHXH 3CLEL 5E6ID 3EH2A 3R8QA 3TNMA 1R3HA 2BCMA 3IJSB 5D7SH 3D50A 2BZ7A 2DMBA 2IQ9H 2HFGL 3NQKA 4ZSOE 4OCYL 3OMNB 3ETBJ 4JDVA 3VG9C 3DRQB 4QT5B 2CKBA 5TDOB 2NW2B 1F42A 2PWFA 3L95A 4C83B 4EZLA 5E03A 5J6GA 1FH5H 5IBLD 3NABL 2EH8L 3MJ7A 3MZGB 3MUZ1 4RRPM 4UQAA 1CJYA 1KYFA 3ZR6A 4NKDA 5BXFA 4YDVB 4XPBH 3QJFB 2GIXA 2GJPA 5DJ2A 2WQ8A 4AQ8C 1J8HD 2F19L 2WSDA 3ET9F 5DLMH 2PWEA 5AVXB 4J3SA 2PABA 2YZ8A 1D5ZA 1S9YB 3SDCA 4B0MM 5DD5H 4ZFZA 1HYRC 4P99A 1RMFH 2HX7A 2PW1A 3H9SE 3L08A 1N0LA 4WKZB 4M5YL 5IB2A 1E27A 1PG7X 2R2BB 4N2BA 1I8MA 4IBLT 5JDSA 3FFDB 2YLHA 3ENEA 3BVNA 2EXWC 3BD3A 3OKEA 3T5WA 4GPVA 4G6FD 4GAYA 4KK5C 3RU8L 1GGIH 1I1AA 4QOKD 2EC9U 1XGRB 2EINB 2ZKMX 3MNWA 3HC4H 1RUAH 3BH8A 4BSJA 1KN4H 1V05A 3N91A 4WUKL 3OLDA 4U33A 4ZOBA 3O3DB 5DK0B 4IM8A 5EZLA 4FFWD 2X6CA 5CZVH 3MJGX 4RRPG 3HOGA 2J25A 4XCCL 5ESAB 5I19L 3H9YA 4OFVA 2FECL 1XCQA 1GZHC 2XSKA 3PYCA 1KBGL 5BJTB 1JI2A 3LKQB 3QDJE 5HHOD 4H4NA 2DEYX 5HI3D 4AM0Q 3EFDL 4XN2A 5A2LH 3C9NA 3OSKA 3RVVD 4L8CA 5DS2A 2AC0A 4XMVA 1OM3L 1Y0LB 2IWGA 1IGCL 2VW4A 4EDWL 2ARWA 5JW4M 1UACL 1UCBL 2YQBA 3K72A 4XNUH 4NQCA 4KKZA 2NR6D 1MDTA 3CE1A 2VABA 3FUJA 2BFVH 4Y4FA 5BZWB 5A40E 3LMJL 2EIZA 4RDQF 1DQMH 2PO6B 1CGXA 5B8CB 1MIMH 3X3GH 1K6QH 3UO1H 3KWWB 1ZAGA 3QB7C 1TO5A 3VXUD 5CJQL 4HLZG 4S1QH 3MRNA 2QVMA 4UB0H 4R5TA 5C09B 5ADOH 1BX2B 3KG5A 3QC5X 5B4MC 5IEKB 3IXAA 4MMYA 5D7LB 3GHBH 2Z34A 3W9DB 1HHJB 4PCSA 1C7SA 3IKCB 4NZTL 4MXWL 1QTYT 4NP9A 5KVEL 3B7UX 3IDMA 4X5XB 1IE5A 1LGVA 1MFBH 4G5ZL 4M62L 3RWCA 4OB5H 1KG0A 4I4WB 2R4RL 5FUZH 3WHXB 4E41B 1NMBL 1LWHA 5DU7A 4NBZB 4CMHB 3BZFB 4FNLL 3QULA 4KK6D 4I2XE 4FG4A 4OBSA 5I74B 1S7WA 3ZXAC 5D2NE 5DJ0A 2D0HA 4AL8L 2VRAA 1RERA 2ZWKA 4JHAL 2UZIL 3SDDD 2Z8WC 5AOZA 4RGMC 2DTML 3EGXB 1RZKC 4G8AC 3QO1B 4HD5A 2ZJSH 3CMGA 3LN4A 1BIIB 5D7IF 1ML0A 3QH3A 4M5ZL 4JFOB 4FABH 25C8L 1QTPA 4JMNA 4MJ2A 4NWTH 1BFVH 4I0PC 5DD0H 4PRIE 2QVFB 1RJCA 4UM9A 5MP6L 1S3RA 2W59A 5JW5A 3G08A 3KLQA 3CQFA 1RJYB 1MCHA 4M48H 1HINL 3KPLB 4E9VA 3QHZH 3KJ6L 1YNKL 5CS7A 1JHKL 1MHHA 1IV8A 3C60D 4KTDL 1U91A 5DEFB 3WAKA 5KS9A 4HIHA 3U4EB 4B7LA 5KYNA 2DPKA 3QUYD 1BFOA 4GUPB 4XP9H 1D5MB 3MRBB 1UD4A 2A6IA 2WMPA 3JUZA 5SWZB 3T0BA 1M42A 3MLZH 4PB9H 1LO2L 3IFPA 4UBDD 3TWCH 1DUYA 2AK4B 3L5WA 2X40A 1U8LA 3REVB 3MXWL 2XQYG 2FH6A 4MQTB 4OUUA 4Z18A 4NI3A 4KVPA 3X1BA 4ABUA 4P2OA 3P9MB 4UT7L 4FQHA 3ABGA 3C5SB 1TZIB 2VMCA 3SCMD 2E46A 1OK0A 2V7NB 2OCCB 5CKAA 2F7QA 3HI5H 4G9FA 2FX9L 4F91B 3OJVC 1NC4A 4NENB 3N42F 1UD2A 1MPAL 1R6VA 1A8ZA 3BH9B 3QJTB 1KB9K 3B5TA 5TQ2L 1JK9B 3GMLB 3V55A 3IWVA 5KAQG 2OLDA 5IQOA 1J18A 4Z5RB 2O93L 4UOZA 5L7XH 4AVJA 4AWJC 5JIPA 2C4FT 3QXDA 5FB8B 4ZUTB 1YMME 4NM8L 3HBGA 1J1XL 2DF3A 4AT6B 5FWRA 2IAMB 1NBZA 2Z0UA 2QQLH 1KTLA 1B2YA 4JFEA 1BREA 2FHCA 5E8EB 3WFEH 4S0SD 3BVDB 1KEGH 5KSBE 3PWVA 2XJKA 1CIUA 3GSVB 3MR9A 5E70A 4RISL 5D7JB 1T89C 3B6SA 1YJDH 2Y7LA 1IBDA 1WYJA 3JWOH 3ZHKA 3FQRB 1EXUB 2E7DA 4M1GL 3RL2A 3ME0A 3U79A 1W8EA 5K9JL 2YAEA 2ZSVB 2Z8RA 5DHXB 1YEFH 5JXAH 2VLRA 3FQUB 2P47B 1OPGL 4GW4A 5DRNA 4LLDB 4C4BA 4PJCA 5GPRA 3KWUA 4AK1A 1SGKA 2EO9A 3GSWA 1WAAA 2CBOA 4OW6A 4ZMQA 1KIRB 3HRPA 1JK8A 1S2EA 4M93C 4QRRB 4DP9X 5AD0A 3D39E 4U7KA 5T1MA 4QRSB 1HCYA 1PX8A 4R6UA 1AXSB 3Q8EA 2K3TA 5JPMB 1MFCL 4ZTEA 3KPSE 1CXKA 4P59L 4QMEA 5I30L 1ED3A 3KE0A 2IPKA 4XCNA 3GHEH 1K3IA 3Q6GH 4IS6B 2GJZA 3LKPA 4R7LA 2VR9A 2P80D 3V4VB 1IAIM 4JFXB 2NUPA 1JZJA 3BLPX 4KUCD 3VQMA 3PJSA 2Q7YA 2G4EA 1WEJH 1TU2A 1SXAA 3UBXA 3MCKB 4B9JA 2VJ0A 3BZ4A 3QEHB 5D5ME 5AYUL 3S5LG 3LTVA 4HCRA 4OZ4A 2Z7WA 2P48B 4LEOB 1P6FA 4Z95L 4DOHB 4NQXA 1FFNB 1BPLB 5AKRA 1ZHKB 4IRZL 2NY1D 1PIGA 4AQ1B 4LKXB 2VE6A 4AC4A 1QRKA 2J7LA 5HGGS 1OCCB 3MV9D 1ZEAH 2OSXA 2VWEE 1T0NA 4J3OC 3D85B 2XTLA 2D7TL 3HZKA 3L16A 1SOSA 3LRSB 4JKKA 3OHXC 2JJSA 2E7LA 3VFNB 2HKFH 4Z76A 1U3JA 1MRCL 4GSRA 2ITFA 4XRCA 4HWZA 4X9GA 5DJ6A 4PJ7B 2DICA 5EBMB 4CC4C 2OXGA 3SJVB 3U46B 4ABWA 3T0DA 3CD4A 3KYAA 2M26A 1NCCL 1KJ2B 1KCVL 2XA8L 4NEHB 4XR8C 1NCBH 1B90A 2BXZA 4OJFH 3T0EA 1MCOL 3QWRD 4UT9A 4ZX4A 4FTVA 2BIIA 2N01B 5D8JL 2ADYA 5C07D 1S7TB 3LXAA 5CZXC 5GS1A 5AOLA 3UTZB 1IKFH 3B83A 2AKRA 4NRXA 5D1QE 2HJLB 3CQQA 4NI6A 3WEOA 4LESA 1SY6L 3BW9B 4L8DA 4R2GD 1OOAA 3HG3A 1T0PB 5DC2A 4OZHB 3VFTA 5C0RL 3OMIB 2OL3H 4JZJA 3SKNA 2X0VA 4BWUA 4PW4A 2PCYA 3ZL1A 3FO9A 3UIYA 3KCPB 2OMTA 3PGDB 3WXWL 5M95B 5FHBH 1QZNA 3OWEA 2Y1ZA 5IHZA 4AJYV 4JRXD 3GKWL 4P5MB 1M71B 1CLCA 4ZO6A 5L88L 4JN1L 4KDWA 4JEGB 4DO4A 1T21A 4AZ8A 1O7VA 3P30L 4XB8A 2RR3A 5LXGL 1QYGL 2EIBA 4OGYH 3DX7A 3N04A 1MLBA 4WW2F 4BV1A 4ZNEE 2AJZB 2E75C 3EGSB 2ZXAA 3QEQB 5DI8B 3RFZC 2CIKA 4JRFA 4HBQA 4DPRA 4AKQA 4M7LL 1S46A 2X70A 4U49A 1JE6A 1SJVA 2KHAA 1BBDH 1F3RB 1DJZA 2WXHA 5T5FL 4WSKA 1I1YA 1OPOA 4OIAA 4N0UA 4P5RA 1WD8A 1ECYA 3GINA 4HEPA 4JY6A 4KDTC 3UTOA 4G8GE 2C1PB 5CUSL 5MENB 3IDIA 1TTBA 4U1SA 2YKKA 2H8PB 2XY1A 4XVJL 3IT8D 4QAWA 4JY4A 1E8WA 3CDGB 3B2XA 4XMLH 1ZT4A 2IH1A 1MF2L 3MBEA 4M29A 2CM6A 4DFIA 1EXHA 1RJZB 2ZX8A 4Q14A 3O8XD 3FTGA 5E5RB 4NQEE 1HT6A 1CFSB 4N6RA 1U3HD 4MRBA 5DJYA 5FYKD 3F5WB 3L3HB 1BQHB 3Q2NA 4JO4L 3VI4A 1W72B 2DYPA 5DGQA 5KWYC 4HV8B 5DS8B 4AG4H 4ZZKA 1A14H 1OTTC 4NQQA 5FYJL 1DVFD 1NBVH 1A6TA 1NLDH 3ZDYB 3FQTB 1YEGL 2LAAA 4OZGB 1ZANH 2FQDA 1TYEB 1NQBA 1GIGH 5I75C 1NDMB 2H26A 1HL5A 2FEEL 1SLVA 1UD5A 2V9QA 1O9WA 3DTUB 4NGHH 3WENA 2GC7C 4NLHA 5GGSB 5IVZB 5C8JB 4JGMA 1DL7H 2W65A 2DBLH 2GBUA 5EU7E 4PUBL 4J7RA 5EWIH 1MKFA 1TZGL 3RIAF 1FIGH 1FYTA 3QBTB 4WI0A 1KTBA 1KTDB 3A3YB 5DJCA 1OAXL 4LSSH 4P2QD 1DFBL 4WCYL 3VSQA 1NCWL 4XH2A 3QUZA 3P0YH 5J12B 2I7OA 3CU1A 2P49B 4OD3H 1A9EB 4KJWC 3M46A 1FZMA 2IADA 2J56A 2V2XA 3TVMA 4Z7UB 4MD4A 1TZAA 5EU3A 3SYAA 2J8UF 3DV4B 4KQ4L 2MPAH 2CBPA 1N59A 1PY4A 2OMNA 2WJ7A 2JKNA 4K0OA 4N2GA 4OQTH 1BLIA 1MWOA 5IMMA 5BRZA 3GWJA 1QA9B 1L7IH 1MHPH 2QSCL 1P5VA 3TJHD 3KLHC 1NMAL 4X7FC 4MHHG 2YD9A 2AMUA 1IT9H 3GDCA 4N1CA 1OARH 2A9MH 5L0QC 5EU6D 3LD8B 5IQ7H 4WFEE 3EYSH 3K6DA 4FYQA 1Z7JA 2ED8A 3BEWB 3N55A 2XA3A 4GI9A 3OJDA 2WQXA 2MHAB 4UQ2A 4F5CE 3U6RB 2E9GA 1CDBA 3VWKD 1KCUL 2IXQA 2A77H 1BOGA 2ZCKH 3QIUB 1JYVA 3IMSA 4HJIA 1G7LA 1NPUA 3AG4B 5EUOF 5I18H 2EEDA 4JFDD 5IB3B 1TEYA 5H37G 2WGXA 4PGEB 5KSVB 1GY1A 4WV1C 3C6EA 3GRWH 3OG6B 2V17H 3SY0B 5CILL 5K9KA 1JPST 4XPFL 1E90A 4X4ZA 1JRHH 2AJVL 2Q86A 1U8JA 4NBYB 2CPUA 1YYMH 4J4PA 4NUMA 5CKGA 5BQ7A 5EO9A 3ZYZA 1DE4A 2ED7A 4GP5B 4PJXB 3TO4A 4C57C 3WNOA 3MRKB 3N50A 4H8UA 4Y16A 3PQYE 4KOBA 4L4TD 1RJLB 4NUJA 2ZUXA 3MRGA 3QI9B 3V4PH 3R06B 2Z1KA 1JZ7A 5IOKA 2ZUTA 4ZS7H 2CO4A 4ZYKB 2DWTA 2YPKB 1T83A 4D9LL 4EZMA 5DVKA 4LSRH 4EIUA 1P53A 1KYOJ 4U3SB 3L48A 2EUZA 2P24B 3ZE0E 4LLAA 1AI1L 1RULL 2WUBL 5CWSB 5JUEH 4NOBA 2TRHA 2R69A 4HHGA 5CLXA 1O5DT 1Q8MA 3GXMA 3ZPDA 4MDIB 4P4KA 1NGWA 3QIBB 3D0LA 4MQ7A 4JZOA 4J23A 4BHUI 4LVOC 3APCA 3KBFA 3CH1A 4Z7VB 4TRPL 5FO9A 4G42B 4YJZL 3S48A 2XWRA 3BGFB 3LHPH 4XXDA 3ZU8A 2VDLH 5DHYB 3DGCR 1QSEE 5FX3A 4Y2DB 5K1VA 2NNXA 1D7FA 1NOAA 1WZ1H 3QJOA 5LAXA 3MRMB 4MGXA 5DWUL 4D0CA 5F7HA 3F83A 1FVEA 4R3SA 4N2DA 3QJQB 2X88A 1G9NH 1TSHA 1IIIA 1JZFA 1JI1A 2XVBA 3GJFK 3JWNE 4TQ8A 3I6GB 4X9YA 5DYOA 1CLYH 2FK9A 1CK0L 4KAQH 1CLZL 1NDGA 5LB1A 4X8JB 5EOQH 4OI8A 4MKMA 4Y1AB 1INQB 2C34A 2CMRL 2IMMA 2OTUB 1M2VB 1RD6A 2CBMA 1ZLEA 2X7LA 2Y7MA 3ISRA 4G80A 3P2BA 3BKCL 4N87A 4RA0C 1G7JA 3TN0A 2VLJA 3N44B 2FJGB 3RQ3A 4NQSB 1T5XB 5E9DD 3ZDZF 5AW5B 1KXTA 2L4OA 1S7QA 4XC3L 4MZ2A 1GC1L 1W16A 4JLRA 3UYPB 1MFEH 2GHZA 3RE0A 1F6LL 2XYCA 4S1SL 1N5YH 5GZNA 5E94B 1UZ6F 3ATDA 5JOFB 4Z8FL 3NP4A 2IGTA 2B9AA 2BSDA 5C0CB 1QUNB 3FQXA 4LAQL 2VNCA 3IRZA 4NIYE 4ZD3L 4DZ8A 1PQZA 1SJMA 2JELH 2YD6A 1XVSA 3NJGA 5C3LD 4PJDF 4N3TA 5J3HC 3VGGA 2AXFA 2P8LB 4HC1H 4LEXH 1GPOH 1ADQL 2BINA 2DQJL 1R4XA 3HE7C 5D96B 4GKNB 4YO0B 1O7DE 1P7KA 2A3TA 3KGSA 1SJXA 4TLKA 5EC1B 4AENA 5C0JB 1MAML 2FQFA 4A38A 3BI9X 2NY3B 5GZOD 4L9LA 3EDJA 4E9LA 4Y2OB 1MCWM 1WICA 3D9AL 3TTYA 4MCYB 4M6MH 3VI3A 3SE4C 3OKDB 4ZQTA 1QFWH 2UZYA 5FS5A 4BUQA 3VXSD 3EYVB 2I32A 2CUIA 5ILTH 3O3AB 4E5XG 2JMRA 1PG7W 3HG1A 3OAZH 1KTRL 1GGYA 1UD3A 4H8QA 3V0GA 3SOBL 2HA1A 5EOTA 5FUOH 3LZPA 3QUXB 5EZIL 4ACTA 1AXIB 3W0WA 2AXGA 2YEQA 4K55A 2DJ4A 2HH0H 4CN4A 1QEWA 4Z7WB 5IV2A 4R0LA 1JTTA 1P4BH 2M2DA 4JNXA 4TSBL 2DWEA 4HIXH 3WTXA 4ONFL 3VCLB 5A2BA 4QUOA 3MA7A 5HGBB 5J89A 2GT9B 3BMVA 1CFNA 1IZJA 2Z31C 1OALA 3H2PA 4Q6IA 4KROD 1ETZA 1T7XA 4IBQA 1OE3A 4LDEB 2I27N 4P2RB 1UB5B 4QTFA 5GRVK 2J88L 3VFVA 1F8TH 1KB5A 1WS8A 4YSUA 1HOCA 2YRZA 3V0DA 3QEGL 3SPGA 3I3BA 2AJSL 4ZUSB 5E95B 1TCRA 2VL5A 5KSAC 3EXLA 5C0DB 1VADB 5GS0L 2CA4A 4XCEA 4JPWH 2PF6A 4GXVL 3LKRB 1YNTB 2E4TA 3UABA 5DUBB 3MCYA 3VA2C 3T4AA 4CU8A 2Q7AA 5KVDE 4QTIH 2EKSA 1CT8A 4ENED 2GIMA 1JGIA 1MWAA 5DO2D 2I5YH 3MDJA 4JFZL 3L3OC 4R97B 5DHVA 1HQ4A 2VZVA 5HJ3B 1J5CA 3BFWA 4G9FE 4HALA 4KO6A 4BIKA 1S9XA 1JF6A 4UTAA 1KSRA 2DMKA 2O6DA 4NPJA 2MFNA 4HH9A 4KNQA 2GY7B 5FCUH 2WYZA 4P23B 4G71B 4DUXA 3QUML 5C0IA 5D7HA 4N8VB 3OKOA 1ADQA 1V3JA 4Y4KA 2J55A 3FZUC 5AW1B 4M8QB 2DWDB 4HLZH 1G4MA 2P5ED 4Y7OC 1SF5A 4X6DB 4X99A 4BELD 2V3DA 3ZKXB 5IGXH 1NIEA 4AGLA 3CG8A 3IETB 5B3NA 4PY7B 3UAJD 2A6KB 2FX7L 3DJZA 3VAEA 3DBXB 4MMZA 4JO3H 1JD9A 4MA1B 4JFEE 1PF3A 4XNXH 3R19A 4OKVA 3GJFA 1BZ8A 2FBRA 2WYHA 1S7RA 2H0FA 1GSMA 1UWGH 5GRVL 3HNVH 3HS8A 3MJ6A 3O6FC 4I1NB 3AWGA 2KI6A 3E8UH 1UVQB 4LB8A 5DVPA 4OGXH 4CJ1A 1HSAB 4JQVA 3VSVA 1ZE3C 2LFGA 3IBOA 1ONQA 1A25A 1DJHA 3IGLA 1WA1X 4HCGA 4TLUA 3Q3GA 3T77B 3T8MA 1JTPA 1UKQA 2Z35B 1WG3A 5AW6B 1UXSA 3F7QA 3HI1A 4LPUA 3CHRA 2VC2B 1JWSB 1WAAE 1OAUH 1BF2A 3ROLB 1I7UA 1DBBL 2WLIB 1JG9A 4U1LB 3SDXF 2HFFB 3P3SA 3QZWG 3FB7B 3L6FB 5HYSB 2UY6A 4YAQB 4LPWA 4IOFC 1U95A 4HGKC 4Q9QH 4BFJA 4WDIB 1L0PA 2OL3B 1B0IA 5IW1B 3RYMA 2EIJB 2CQVA 3DVGB 3NCWA 1KEML 4N1EA 1T7YA 3KNBA 5HHNB 4XPHL 4MJ6A 1IE4A 1E9PB 2F8OA 5E7FA 1F02I 3SDAC 1WWBX 2QPDB 3AZUA 5DTFA 2Z92A 3G6JB 4PJEB 2DQHL 1SYVB 2J2ZB 1NJ9A 1ETA1 4MAUH 3D18A 4UDUA 3RILA 1WFIA 1YY8B 4PJ9C 4R96B 5D7IE 4PWKA 2BNRB 4KXBA 2RD0A 4QI3A 3FAXA 1ZD6A 3HRZB 4QXTB 1OLLA 3FRPB 1YRKA 2X2JA 1BAFH 3FH7A 3U9PL 4WNQB 3TBSB 3R18A 3OXSA 1A6ZB 4NQUA 5CNHA 3KCWA 2OZ4H 4EPSA 3JTTB 5C0GB 2FO8A 3ARDB 5DCCA 1OY3B 4FADA 1CFTB 3TH2T 1W8OA 4BFKA 3HPLA 3G5XB 1KC5H 3IJEB 5IROA 5AVTB 3GIVB 5IVXA 1OSEA 1QD0A 2VDOH 3QT2A 4FTVE 1CFVH 1DVTA 2VN4A 3SDYL 3VQLA 3AUVA 4H1LH 2YFOA 4B3VA 5BNXD 1QVOA 3N85L 1V3LA 1CGVA 5B1JA 1UJ3C 1RHHB 2TSBA 4GG8B 3I9PA 1WTGT 3LEYH 5F2FA 1G7QB 3UZEA 5A6LA 1XIWA 4ODUB 3LAFA 3SKOA 2L7JA 1T1ZA 1F86A 1T7VA 3UCQA 32C2B 3VVVA 1Q72L 1P69B 3F8UB 2BHUA 4JQIH 2FYVA 4ZFOB 3UJTL 1P84K 6FABL 1JD7A 2HG5B 5ESVB 3VO0A 1WWAX 4D3CL 4HYTB 4RGNE 5HBBA 2XVLA 4Y19D 1JGUL 2EYSB 1V7NH 2YRBA 1VKXB 4GSDL 4G1EA 1FCCA 4CMHC 1TJIH 3MRPA 4HT1H 5EA0L 1B4TA 3QJXA 2LE9A 1P1ZB 5DJXB 5HHQB 4FQJH 1T0MB 3FMGH 1CF8H 3AQYA 2V3FA 3ZYJA 2NZ9C 3OC5A 2AHIA 3NZ8A 3P11L 3AMLA 3UDWC 5IESH 3WFCL 3HCVA 4PWFA 4PD4J 5EOCJ 1YEIH 1Z5HA 3ZT7A 4N0UE 3KWTA 1B2WL 2XWJB 3M1BB 4L3EA 1BYNA 2X44D 3DX8A 2YPLD 4ZO9A 3T8VA 1XTLA 4FNRA 4J3TA 1A6UH 4M1CD 4JM0A 4L1HA 1NMCC 3VG0L 4WEMB 5C0BD 4Q56A 1XL6A 2OI9C 2BSBA 2VW6A 3CFJB 3G5VB 5AW2B 4QHPA 1AGCA 1QMUA 2F2HA 3DVNA 3TO2A 4BXSV 1U0QA 4Y5YC 1I7TB 2IV8A 2JIXD 3L17A 1ORQB 3JWNG 3IKKA 3VI4E 1MJ7L 3HBQA 4WO4C 1ET5A 4JFFD 4BQCA 3HMWH 3K6OA 4MNHA 5HVHC 1S5HA 1PLGL 3P0GB 5IT2L 4I3RH 4I77H 4TSAH 4QF1B 1IEAB 1KGWA 1JPSH 2Y24A 1R5WA 4PI2A 3A6OA 3V4UH 1DEDA 3EJUA 4ELDA 5IM7A 1OGAD 1WIUA 3ULUC 2NY0D 2UVEA 3WTYA 3OX8A 3CSTA 3NSDA 1TIUA 2I9TA 4HFUH 1JZ2A 3HNSL 4DKEH 1S78C 4LSDA 5ENWA 3INOA 1ND0B 4P9HC 4XNYH 2AQQA 1NL0H 2OSLB 2WQAA 2BNUB 3CLWA 4ZMAT 4MXQD 1VCAA 2P5WD 1F4XH 4NJ9H 5DJZB 5SX4I 1CE1H 1VFBA 3L3DB 3RDTA 4OGQC 4DW2L 2YA1A 5AQ0A 4KKBC 4P3CH 1UT2A 1ZIAA 1XMWA 4MMXC 4LDOB 3VNYA 3QWNA 4JFHD 4HDIB 2NXZD 3IM1A 3AY2A 3FT2B 3MUHL 1PTZA 2EE3A 3GSXB 5EZJA 3V4PB 1FPTL 3HS0C 3L2NA 1USZA 3O3EB 2NY6C 4KUZL 4DQAA 1DO6A 3I6LE 2ZUYA 1J1OH 1BLNA 2HTLD 4KO5A 3SO3B 4RX4A 4K94C 2DQCH 1I1RA 1CR9L 1PMYA 2E27L 2OSYA 5BRZE 4EIZC 1IC4H 4HKXA 4XAWH 5GRJH 1PLCA 2D3VA 3L1OL 4XPGL 4PU2A 4G83A 3BP5B 4NWUL 4HZLA 4GRLB 1J5IA 2BNQA 2CHNA 4L3CB 2EDEA 1DJSA 1ZRUA 3STZB 2EDLA 5L8LB 3TTSA 4M6NL 4JPKH 1XSJA 4XBGB 3CC5A 4B5EA 1EUUA 2N7AA 4LLYB 3IXTB 2N1KA 1RFDH 1WK0A 2Q6WB 3T3MF 1XF4B 2VDLB 3TBVB 2YD4A 5E1GA 3SB3A 1DQIA 1YN7B 4PTUB 1H3PH 2ZAIA 3GS4A 4HIPA 4TUUA 5EU4B 1K8DA 4G43B 1Z5LA 3B3IB 7FABL 3DI3B 2AEWA 4ONGL 5FFLA 3WE1A 4X4XA 1E4XL 2X1OA 3MBXH 4ZFGH 5ADPH 4H25B 3BVTA 1YEHL 1JCKA 5FHAH 2K6ZA 2X87A 4MS8C 1SHWA 5FYJE 3FB5A 4R4FL 1IFHH 1COBA 3IFLH 4G6JL 4M9PA 1FFTB 3AREA 3OXRB 2AV7B 4CADA 1EHNA 3ZTNL 3LXCA 4I7ZC 2HMID 5ABDE 4PWJA 2C3HA 3KDMA 4PLJC 1KV7A 3ZYOA 5GS2D 3O6LH 1FLRH 4JRYB 2QQNL 2VMFA 1KCRH 3HN8A 2B08A 2OMUB 3NFPA 1A47A 1KPVA 3F12A 1T20A 3ARGA 4Y9BA 4WJKB 4K2UL 4KZ0A 2IWKA 1KLGB 3ABMB 2P7TB 2GFBB 3ZZLA 1C16A 3E80A 5ISZD 4WTZA 1JGVL 3TZVA 1UM5L 4CKQA 5GJTL 3ZKMD 1GS6X 4J6RH 1JSYA 3K0WA 3N42B 4XNMB 1B3JA 1H6EA 1QQDA 4ODVH 5LDUA 4U6VL 3A6CL 4PTTB 3DSFL 5F1IB 4G82A 4JHWL 2V2WA 1DDHB 1ZHNA 2VUOA 3SHSA 3L2MA 2I24N 3G6DH 4BFOA 4U6HA 1C8PA 3GM0A 5D2NC 3CPLA 3WHE1 3X13A 2BDNL 2VW7A 3QRGH 12E8L 1M1XB 3ZQWA 2AJYL 1RZ8B 1K5NB 4HWBH 3HZYA 4G7VH 4QRPA 5B7MA 4OLWL 4ES8A 2PTVA 2J12B 4KUCF 4V11A 3ARZA 2Y3NA 2BVYA 3SDDA 4ZJ9A 1REIA 4NZFA 2J5LB 4GIAA 4QIRA 3WSQH 3FO2B 3ZE1F 4YSAA 4IU3B 4CC1A 2ZD0A 4U1JA 2K7QA 4P46D 2WSKA 3D1MC 5H37H 2BIMA 2K9FB 2PXYC 3ZVVA 2XN0A 3IU4H 4RDBA 2CO3A 2VLJE 1IAKA 1CZ8H 1AR1D 4KRPC 2ROXA 2OR7A 4ODWB 5E4EB 1A22B 4X6EB 5DZOA 2R9HD 4MVBC 2B4CC 2HVJB 3NAAL 3F58H 5LGHL 4LF3B 1RH8A 2J8UE 1AS7A 5DZNA 3OR7A 4XODA 5IJKC 4MNQB 3EBGA 1ZLWK 5D6DA 3PY9A 2O5YL 3N43F 2G3ZA 1A7PL 4KTGA 2EVIA 2E74C 2QHRH 4BA0A 5I8OL 4N20A 3ARWA 3HG2A 2H3NB 2YA0A 3CFCH 4DAGL 2I85A 5L4FA 4WUUB 4NQDD 1M7DA 4AUJA 3GMRA 4BFNA 1IBZA 3UBXG 1N68A 4PAZA 3DK2A 4WNJA 5DJAA 1QLRB 5C97A 2CHWA 2WBJC 1T1XA 3PWJA 2Z8VC 3NACH 4TNFA 4LSQH 2G5RA 3IFOB 1AZUA 3VI3E 4E0RA 4FKKA 3I2CH 5I71C 5FGBC 4ALAL 2PCFA 2I07A 3C8KB 5SWQB 2X10A 2V9UA 4FZEL 4UWQB 1D5BA 4HX1B 1E4WH 4YGVB 3ES6A 2GHWB 4ZAKA 3MTRA 3UC0H 3CFBB 1AGDB 3C08L 3CZJA 2C8NA 4UMSA 4M43H 2WBXA 4PJAB 5I1DB 2FVNA 3INUL 1KELL 3SBQA 3BRGC 2R7EA 2B59B 5CMAB 2XNAB 1RUMH 3RLSA 2EYTA 3ZE2F 4LRIA 5JHLA 2C3VB 2ZYSA 1HFUA 4TQEH 1QSVA 1UOLA 43CAA 1NGZB 2ADFL 4Q74A 1EUTA 5BV7H 1W0VA 4FMFA 3FFCD 1QBBA 4HUNB 1G43A 1MCCA 2IIJA 2WQVA 4DGYH 3F7YA 1RKRA 2JKJA 1LL1A 1FE8H 4ODHL 1ACCA 4GT7A 2WJ5A 3DSNB 4GEIA 3G5ZA 5FOBB 3SE9H 3O0LA 3VXOA 2H41A 2PW2A 2DRUA 1QRND 4U2YA 1HYSC 3WLWC 4R4BB 3H7LA 3QNXB 4TM9A 5KS9F 4W9JC 2WZ0A 1WFTA 4LHUD 3ULVE 3M1CA 1FFPB 4TVPD 2B0SL 1PKQA 1OO2A 1T0OA 2IDUA 4L4JA 5K9QG 1A7NH 2Y36H 2GEQA 3I6KB 2ICES 1RVFH 1AFVL 1S4IA 3DETC 4FKHA 1UM4H 2HN7A 4NS0A 4APXB 4N2MA 3I9GL 5HSFA 3QZMA 2ITDB 3DXAE 4I9WE 1MJJB 2UZPA 3MROA 3GXNA 1YO4A 1NCTA 1KFAH 4FL4B 2OAAA 2G2NA 5C0AA 1BAWA 2YGQA 4LU5H 4DCQB 4DHLA 1WGVA 1BQ5A 4MDRA 1S7UB 1CXHA 4HEPG 4KO7A 3GBNH 2VDMH 3RGVC 1D9KA 4F33A 1J7VR 1WIPA 1XV8A 2XLLA 2VXUL 3AQXA 3GB7B 2FX8L 2ICEA 2OP4L 1TNMA 1CGSL 1CU4H 2XTJB 3QUKB 4G8EB 2VWEC 4H8WH 3EYQD 4W9HC 3O4OB 4AJVA 3ZDXB 5G5DA 1SOQA 3V7AE 4R7DB 4KZEH 4UILH 2X1XR 3PFQA 4ZUVB 1U8QA 5DQ9B 1X4ZA 3IFNH 2J1KA 3PWPD 5DMKB 5KW9H 1JGLH 3CGTA 4L8SA 4CMMA 3U4AA 2HRPL 3FSWA 2JQZA 4LEBA 5EV7A 5A3ID 3NA9H 5I0VA 3VXNB 3CVCA 5EOCH 1AYRA 2GSIA 3ZHFA 4GBXD 1CICD 2BVPB 3LHAA 5D1QC 1CDJA 4ZXBA 1Q4NX 4OF8A 1N0XL 1IL1B 2Z93B 4W6XB 2IQAB 2VDOB 3TV8A 3MYZA 4H1LB 1JL8A 4PRBA 2ZCHL 4FFVD 1J8KA 1BVZA 1X9UA 3QUHA 4ZW5A 2TAAA 3NDYE 1SEBB 4PRPD 1HHHA 1BZ7B 2H32A 3L9BA 3QDMA 2ZKHL 1MFUA 5IJDC 1VJSA 4NO0B 2PTUA 3BIKA 2XWTB 4RWYL 1PNCA 3GTNA 4Z7OE 3BAEH 5ITBL 1WF5A 4JHBA 1SDDB 4S10A 4LGPB 5DO8A 3CFMA 4JFUA 2WNWA 1PDKA 4XC1L 1R5IB 4UZSA 3HE6C 3B37A 3THML 1J0HA 4FJYA 1ZLVK 1HL4A 2ODHA 5FKAB 3GRBA 5FF6A 1D6VL 1NAML 1JNNL 3UAAA 3Q1EA 1KT2B 4JRXA 2QSVA 1CGYA 1TO4A 3OKNB 3V5HB 2XKUA 3MMEA 5B1KA 3VFOB 2X4SA 5KVFH 4X4KA 5IMLA 4POYA 3JZYA 2AK1L 3CHOA 3TPUB 2KZBA 3UTSB 2KERA 4HPOH 5DRWB 1PLBA 2BOBA 2BSCA 4JL1A 1RUKH 3NSCA 1OL0A 4JFSA 3FT1A 4IRJB 3L5XH 5D72L 5SWSB 3IDJB 3A23A 5T1LA 1QFHA 1H6FA 5CJXA 2AGJL 4PRDA 1LEIA 4K3JH 5DK2B 1UZ8B 3C5ZD 2J4WL 4IGBC 4ZUUB 2AJ3A 3CK0H 5E2WL 3ARUA 3WGVB 3O2WH 5GISH 1FZOB 3S96B 1ORSB 2BS71 3E3QE 4ZFFB 4WK0B 5IVXE 4KHTH 1KZYA 4OCWH 5JLZB 1TZ8A 2UUDK 3O8XA 3ARPA 4GKSA 1YN6A 4K9EL 2W0FB 4PJ8D 1XL4A 5EUOB 3W2DH 4YXKL 1L9PA 1XX9C 1EFQA 1HHKA 1PY0A 2QADC 5CIPH 4G9DB 5DZVA 1F1GA 4PRHB 5BQDA 5CSZA 5LCVL 3TA3D 3EJSA 1M1SA 4OLEA 1K4CA 3PHOA 3AXLA 4XCYA 2VQ1B 1J9QA 5ALBH 4BQBA 3QRLA 4NRYA 1VESA 3CN4A 3HW7A 3KR3H 1ZV2A 4XXCC 5ITFB 3W56A 4F9LA 3BZDA 1JDCA 5EU7C 3AMKA 2CA3A 4LLQA 5C0FA 3DK0A 2B8OT 1EHLL 3HHSB 2ZKYA 4G6KL 2ICWA 1SBSL 2W81C 1FQ9C 4AVHA 1BA9A 5DXWA 1HEJC 4FQIH 5SV4A 4HS3A 2QELA 2PTTA 1W0WA 1U8NB 4X6CE 5GGQL 3QPXL 5IKCA 1A9VA 1MHCB 4NKMB 1ZGLP 4A7VA 1FAKT 2FWUA 2BWQA 3QUXC 1PPIA 1DSFL 3KHQA 2WO4A 4IMLA 3UC2A 3ROOB 2MWCA 1MNNA 4PLKD 4I3GA 5GHWH 2EDNA 1JVLA 3LQAL 4HOWA 1QX1A 4DFHA 4AUUA 3D3VD 3RB5A 3DA0A 2W94A 1JPGA 1ZVSA