3L9YA

Crystal structures of holo and cu-deficient cu/znsod from the silkworm bombyx mori and the implications in amyotrophic lateral sclerosis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
PAKAVCVLRGDVSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFGDNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDAGVTKVSIQDSQISLHGPNSIIGRTLVVHADPDDLGLGGNELSKTTGNAGGRIACGVIGLAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in amyotrophic lateral sclerosis
doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3l9yA00
1PTZA 1SDYA 1CBJA 4U4IA 1SXZA 1E9QB 4FF9A 3S0PA 4MCMA 1OZUA 3PU7A 1Z9PA 3KBEA 4A7VA 1F1DA 1XSOA 3HW7A 1KMGA 2WZ6A 1E9OB 1RK7A 2GBTA 3KBFA 3F7LA 2AEOA 1SPDA 3CQQA 3QQDA 2WYTA 2AF2A 1E9PB 1UXLA 1HL4A 1XTLA 2Q2LA 2AQPA 2K4WA 1DO5A 4A7GF 1B4LA 3SODB 3CQPA 4A7SA 3CE1A 1N18A 1QUPA 2ZKWA 1IBDA 1CB4A 1OEZW 5KBKA 2NNXA 1XTMA 1OAJA 1E9QA 1UXMA 2WWOA 2XJKA 2ZKYA 3ECWA 1AZVA 1IBHA 3K91A 3GZOA 1E9OA 2ZKXA 2E47A 2WWNA 3GTVA 1L3NA 1IBFA 1ESOA 1F18A 3GTTA 4L05A 1YAIA 3KH3A 1TO4A 1PZSA 3L9EA 4OH2A 5KBMA 1JK9B 2AQRA 1SRDA 4N3TA 2AQNA 3ECVA 2XJLA 1MFMA 1E9PA 2E46A 3T5WA 2AQQA 4BCZA 1OZTG 3LTVA 4OJAA 2VR6A 1SXAA 1DSWA 1OALA 4B3EA 2C9UA 4N3UA 2LU5A 2JCWA 2GBUA 4BCYA 2Z7YA 1S4IA 3RE0A 1EQWA 3MNDA 3GQFA 2Z7UA 2C9SA 1YAZA 2AQTA 1F1AA 3ECUA 4A7GA 1SOSA 2Z7ZA 3H2PA 1P1VA 1N19A 2APSA 1JCVA 2WKOF 1SXSA 4A7QA 2ZOWA 4MCNA 1U3NA 1JK9A 1COBA 3HOGA 1B4TA 1SDAB 2WZ0A 2SODB 4A7UA 2GBVA 3F7KA 1EJ8A 4BD4A 1PU0A 2C9VA 1HL5A 2WZ5A 3H2QA 2Z7WA 4A7TA 1YSOA 1Z9NA 5CU9A 5KBLA 2VR8A 1TO5A 1BA9A 1F1GA 1SXNA 3QQDB 1IB5A 1IBBA 3L9YA 3GZPA 3KH4A 3HFFA 1Q0EA 1SXCA 2WKOA 2WYZA 2VR7A 3KM1A 1FUNA 3GZQA 1BZOA 2AQSA 3MKGA 2V0AA 1SXBA 2JLPA 3KM2A 2R27A
chains in the Genus database with same CATH superfamily
4YEEA 5FO2A 3WUWG 2VXUL 3JTBA 3IDYB 1U93B 1FF5A 3KYNA 5CSZA 2YD2A 3DTXA 3EDFA 5CEZE 2UWEB 4B9PA 3KLKA 4MAYC 3TLRA 3I6KB 4IKIA 2IAMA 2X0VA 3H4HA 3QJZA 3UBFA 3SGEI 3WGVB 1PD6A 4J5VA 2CLRB 5LG6A 1Q0XH 3NIDF 3IDXH 4PP1D 4D8PB 3FONA 4XBEH 1LO4L 3FTGB 4FDWA 2ADFL 1U8MB 4HGWB 5I1KL 1OSZA 4WQOA 5I5MA 3S3JA 3VA6A 3GSUA 3GB7A 4LQFH 3DMMB 5HDBF 5C0BE 4AZ8A 3IFNL 2V2TB 2XBTA 3MTRA 4C4KO 4NJAH 3IDJB 2PXYA 4EN2A 3CFNA 4YHPA 5DC2A 3SCMA 2HX8A 3CFBA 3SQOH 4LIQE 2KC0A 4N25A 2VDOH 3GSWB 1I9JH 2VWEC 1B4JL 4LPYA 2J8UB 4QRPD 3ULAB 1BVLA 3Q43A 3P9LA 2J57A 1OAXL 5F6IB 3DUSA 3MN8A 4O51A 1AR1D 5MEOA 2ZCHH 4OVUA 1E28B 4FMKA 3S36X 1FJ1B 1E42A 2QFRA 4PI2A 1A5FH 3X17A 5F89B 2H7WA 4LCWD 3C8HA 1MY5A 1ZE3C 2G2RB 3KVPA 4PRPB 4Z7OE 4W70A 3E2HB 1UM6H 1DQJB 2PPEA 3NK3A 3U4BH 2CKBL 4PRNB 1KY6A 5A16A 3FOLA 4YIQA 4LBAA 4WEMB 5G5DA 4MA3B 1HOEA 1L9OA 3PUUA 1UUSA 4WJG3 4KV5E 5AALA 2XZAH 4XOBA 3TIDB 4R8WH 1N7ML 5C6WH 3EYSL 4HKXA 4JDTL 2O72A 4LKXB 5KVFL 3G5VA 4A7GA 1RUAH 1J5CA 3DX8B 1VEMA 3KPSB 4Z7OF 5B22A 1DQQA 4KJWD 1GAFH 3AJ7A 4GG8A 4D0DA 4EQ3A 3SDCA 1YN7B 2ZCZA 4GBXD 1K4DA 2PW1B 1OWWA 4HUWB 1XGTA 4KV5F 4P4RA 3WV0A 1X5HA 2XWBA 4Q56A 5BVPH 1LEGB 4X2UA 1OP9A 5I71C 3LSOB 3VTTA 4OGYH 3CDGB 4GSRA 4PV8B 4XCYB 3V6OE 1LO3H 2F7OA 2Y24A 3DVNA 1HILB 5DRZB 3S3PA 4BDVA 4R26H 1QSZA 5TE6L 4FHJA 4HH8A 3VXMA 5I1AA 3T0ED 5CGYD 3P3RA 1NDGB 4MRCA 2OMYB 4YDLC 1J88A 2HPTA 1NMCC 4K8RC 4QLRA 2W8CA 1OZUA 1PY9A 2CXGA 2VC2H 2I24N 1F4XL 3CHOA 2MCAA 3CFEA 3V4VA 5I0WA 1Z6JT 3K5SA 3SBQA 2DQCL 4FTVE 2Q6WA 2KLSA 4HKJA 4CVXA 3DIDA 2W07B 4LVHC 2CJSA 4MD5A 4PJGA 2HVBA 3I2CL 4RFNB 2MCPL 3D18B 4M03A 4PY7A 2V9UA 5J06A 3HAEG 1LILA 3PHQA 3DSNB 4JFFA 5IVXA 2CUHA 3N91A 4XVOA 1I75A 1WWWX 2XQBH 3RQ3A 1G6RA 4OIIL 2BIQA 5C0GB 3RJOA 1KDIA 2CPUA 2PWEA 5IMKB 5J1SC 3NSDA 1BD2E 5LXVA 1RUKH 2GAZB 4X6EB 1F2XK 2P5ED 3EFOA 4JHZA 2K45A 4OCRH 1VFAB 4XMXA 4NYLA 3KDPB 1QBLL 4P5TC 5HHOD 1WS7A 1UXWB 3MV9D 1OSPH 2VZVA 3TF4A 3HI1B 2EVFA 4QWWC 1AZBA 4OCWL 1BOGA 2P52A 4AQAB 3PHOB 2Q2EB 2BHFA 3IXTA 2AZUA 4IS6B 4IBZA 3MJ8B 4BHUI 2Y5EA 5JHBA 1JV5A 3OMAB 1VFBA 3KYMB 1D5BB 1HHIB 2P9RA 2R59A 3CN0A 5BZDB 2YAFA 2AQ2A 1D7BA 3VGFA 4C58B 5HDQL 4NN7B 3GF8A 1MZYA 1CK0H 2DD8H 2WZPA 1WFNA 5CF3A 3CDCA 1YECH 2EH8H 3LHPH 1F4WL 1YDPA 3X3GH 2B4CH 2W80C 4JJ5B 1ECZA 1YY9C 2XETA 2ID5A 3TA3C 4ACTA 2Y7MA 4C57C 1A6TB 3UZQA 3QUYC 4LEEA 3MUGA 3LZFH 4Z0XA 4H5SB 3U46A 1I1FB 1PZDA 1EAJA 1N70A 3HBQA 1HWHB 4NO2B 1RZKL 3PWLB 3RB7A 2YMOA 2GTWA 4Y4KC 3IKCB 5KVEH 3GI9L 5IW6A 1TQVA 4N2GA 3T1FA 4JFPB 3OAZK 3P0GB 1NDMA 4PJ9A 2P5WD 5HHMB 4R0LC 5B39G 1CN4A 2FEEL 1F41A 3P11L 1LO0H 3O6FA 2PP7A 4EI0A 5E9DB 4QKXB 1OGAD 2IH9A 2LTQC 3KDMB 4P8QA 4B0MB 3BYYA 3FH8A 1KYAA 5CGTA 1XGQA 1T21A 4MTMA 2V5YA 3FJTA 4LVOC 2EIZB 4MZIA 4R3SB 4R7NA 4MNQD 4CU6A 2X4UA 2C3HA 3FYIB 4NJ9L 3NRPA 3WNMA 5CSZB 2VXTH 2AI0H 3CN1A 1MPAL 3WEOA 3NJXA 3DO4A 5I1CL 1MFEL 1F1DA 4G1MA 5AB0A 3DPBB 1VERA 1ZHNA 4OLVH 4D9LL 3ULUL 2WZ6A 3PQYD 5I73B 1MAKA 1I4FB 1I7UB 3R1GL 3DPDA 3KPMB 4NT6B 1AXSA 5CN1A 1RHHA 5G4MA 3TBCA 5B7MA 4EUPH 5DVOA 5JPNA 4H8WH 2GKIA 2IBZY 2XWEA 2X41A 4MMXB 1AVAA 1MFCL 4X5RA 3B3BA 3QR2A 2IH1B 3H1ZA 5F1SA 1QBMH 5JMRA 3HRZC 2VXSH 4KTYA 3U30B 4DKAA 3IDGA 4UNVA 2VXQL 1U3YA 3MRCB 4PV1C 2IADB 3W0WE 4X8XA 4K5OA 4TL4A 1BZ7A 1JWSB 4WUKH 5AZEL 2Y6SC 3F7VA 5BJTA 1UZ6F 3GGWA 4LRNL 1JMZA 3WIIL 1E9OA 3WKQA 3GJFH 1G7HA 3X13B 2OMWB 4WI9A 3BCFA 3WNIA 1HNYA 2EKSB 2XN9A 3MZTA 1IFHL 5IB2B 1FNLA 1QMUA 4LCWB 1MI5D 3M88A 2EZ0D 4OJYA 2F74B 2Z1PA 4IRZL 4UF7C 1U8CA 5CJ8A 4YDIL 1WV7T 3ZZLA 2FLMA 3P73A 4NDMB 3GK8H 1RJYB 5FO7B 3VXPB 5J1TC 1JPGB 3QP3A 1R3LA 2YD5A 4P3DB 5CSBA 3MCKA 1K85A 5E8DH 5D4HA 2BW5A 1ZHKA 2WXHA 1RFDH 4I9WD 4GLRI 4YAQB 5D70H 5LDUA 5ADOH 3DX6B 3HHRB 3CNKA 5EDXA 3DBXA 4R5TA 1T6VN 4PV9A 4X98B 1MKFA 3MOBH 3ARWA 4R6UA 4JPVL 5JDSA 5FCSH 4PGBB 1JGUL 2FCBA 5BZWA 2EIEA 1VACA 3D8MA 1ED3A 1U21A 1U3NA 3L3DB 5GRXG 1DN0A 2VZ3A 1H5BC 2ZWLT 1NCDL 2CO6B 3BEWB 4GBXB 2Y22A 5B3SB 4DGIL 3B3IB 4V33A 3LEVH 2IXQA 5EU3A 3AFLA 1SHWA 1Z9LA 2HLFC 1LNUA 4JQVA 4KTDL 2ZONA 1BLNA 4DEPB 4BFNA 1QSFB 1TZAA 3DNKA 1MWAA 1ZTXL 1T5XB 1N8OE 3FW6A 5D96C 5E2VL 3RY6C 3QZBA 4AG4L 1TU2B 4N0YH 4KNUA 3MJ7A 2C7FA 3SKNA 1IIKA 4BK4A 2OJZL 3CZUB 1ZHLB 4ZUUA 2E9GA 2YMTA 2Z92B 3P4MA 2F1AA 1RUML 1Z9PA 3WU1A 3QIBC 4XNUL 2NYZA 1FYHB 2CUAA 3BPNC 4ZO7A 1DEEA 3C8KB 5DQDH 1QFWH 1L0YA 5EEWA 2P26A 4MDJA 2PR9A 3ARUA 1MUJA 1FVEA 3A0OA 2H2SD 1MCEA 4WO4D 3DX1A 5DFWH 1X7SA 1OOWA 1XGYL 1G87A 3BKJL 5LUMA 3ZKNC 4G80B 4JKPH 1N0XH 4JO3H 5EZIH 4PGEA 4QRBA 1ZE3H 4M3HA 4A7GF 2Q8AL 3ABMB 1UZ8A 3QG7H 4HJIA 1H6EA 1QSED 4MX7A 2ZF9A 1H6FA 4TS6A 1X7QB 4HFWB 4AQ1C 1TTCA 2DKSA 3EFOB 4KK8D 4L2LA 1M2VA 4ZODA 1J05B 5F1IA 4D9RE 3OBAA 4LEOA 1JIBA 4N87A 1GPOL 4J3BA 4IBYA 5D71L 1BOGB 2X89A 4KKCC 12E8H 1CFSB 5EIIA 3D85D 5TK4A 3UTTA 3MRLA 1C7TA 1QEWB 4YPGA 5HD8D 3ARFD 2FGZA 4DGVL 3DV4B 1FL3B 4M7KL 4QXGH 4P4KD 4YHMH 5EG6C 3T2NL 3MRJA 3UAFA 3EF4A 1JD9A 4PJGE 3NN8A 4HS8L 1BECA 1XR8B 4JE4B 4EBQL 5AUMA 1MXDA 3STBA 4EDWL 4M5YL 2CK2A 1N8ZB 1GS8A 4PYGA 4JFFE 4JN2A 4KH9A 4Z3IA 5I19L 2H3KA 3MCYA 4YE4L 4ODHH 4GI8A 2XN0A 2Z91B 4Y4HC 3WI9A 5D7IB 1I31A 3H9SA 3TU6A 3KLQA 5B8CB 2AK1L 2UY7A 1VCBC 5F44A 3CXHK 5CZRA 4XI5C 5TE4H 1HU8A 1IM9A 1Z9MA 4P2OC 5IQMA 3IFPA 4PJGF 3BAEH 3B37A 3D30A 5D7KD 4E9WA 3FB8A 3VI4B 4PJBB 1SY6A 4HH9B 2GTWB 3OR6A 4K8RH 4LO9A 3V0IA 1M7XA 4Z8FL 1GZPA 2YGOA 1U8QB 2XV6B 3BIAX 4KJYB 2PR4L 1D9KD 4ZX5A 5DTFA 5T3ZE 2P5WB 3KLLA 4M5ZH 1A7RL 5LDSA 1JGDB 3CBJB 4XC3H 5JR1L 3AGWA 4XBGA 4L5FE 5F9JA 1BYPA 2B7DT 3VX0A 2GFBA 5GZOA 2C3WA 4YDJA 4RFOL 3V4UH 2XV2A 4JFEA 3VVVA 3L5WB 2NTFB 4DSYA 5JIIA 3SPVA 1MJ8L 4XAKE 3AG4B 4HDIA 5D1XD 3B6SB 5IFAH 3RU8H 1BGXL 4MNQB 1UD4A 4PGDB 5F7AA 1LK2A 5GRUL 3S36H 3T0DA 4ZS7L 3ZUCA 2EDJA 2VIRA 4S1RL 3NJIA 4HMEA 3CVHL 3PQYB 1H6TA 1TEGA 5DA4A 2R7EB 1DN2A 2FR4A 3P2DA 1X9LA 5GGVH 3FU7B 2DICA 4X0KB 3AABA 2BWDA 2PP8A 1HT6A 3O8XA 3TO2B 5FB8B 4PEEA 3UGXA 2ITDA 3AQYA 3SE8L 5EA0L 5TF1H 1KIQA 2YWZA 4MVBC 5ESAA 3WKML 2F54D 4NZRH 3CDZA 3X12B 5JO5A 2J12B 1GC1C 1AZNA 1OT4A 3FL7A 3MGTB 2CDEA 4KHTH 1J10A 1GYWA 1LGVA 3LNFA 4XXCC 4M43H 4F7EB 1E7VA 3BXNA 3SDAA 5KYWA 3H6AA 1NFIA 3FKUS 4XMPL 3BT2L 2ZX5A 4WNJA 4WWKA 3EIFA 1JUFB 3S5LG 3D2UA 1OKEA 3WCYA 3NGBC 1JHTA 4GXVH 2W9DH 4NNPH 1DQLL 3REVB 4GXUN 4NQEE 5J9PA 4A39A 3HTLX 4YHYC 4PJFB 2XKNB 4L3ED 3SJVE 1LL1A 1D6VH 1INEL 3CFKA 3G08B 4RNRA 2Z31B 4ZPTA 1DSWA 1AP2A 2NDFA 1UACH 3A24A 4IM8A 4QMEA 3TZVC 2ITEA 1HKFA 3GXMA 2R8SL 4JM0A 4X80H 5E4EB 2L4OA 5D7JC 4PJDA 3ZQWA 2AJVH 2O4EA 2R0LL 2XWJB 5B1CA 3ZT6A 2X4QB 2XTSA 1QRNA 5IJBC 4BRJA 5AW6B 5G55A 5KVGL 5INCA 2JJSA 2YPVL 1ZT4B 3BRFA 3LKNB 1JXFA 3QNZB 2BSBA 1IC5L 4NZTL 5J6GB 3UTSD 3IGKA 1TMCB 1ASPA 1CU4H 1LMIA 2BWQA 4FFZA 4XVUC 3LKRA 4MJJA 1CJYA 4FQCL 3Q2CA 4K94C 4P2RB 5GGVY 4OGXH 5HYQA 1CXLA 5I9QC 4A7UA 5KS9B 2YRLA 2NDGA 2D7OA 1OQXA 3H7BB 2Y07H 1IGIH 2CRMA 2CUIA 2XN9E 1X5YA 4F2ME 2X70A 3QJOA 3K6NA 3ZO0A 4IOIA 3QG6B 3KVDD 4G8FB 4JZNA 2YXWA 5C8JA 2WKOA 3L7EA 5IJDC 2VISA 5CJXC 3UBGA 3WFBH 2CGYA 2YBRB 1BXUA 4K23L 2JK5A 5CD5D 5DMGC 1QFHA 4X7CC 5FK9A 4NN6B 1EAOA 1SHXA 1YPZA 3CTTA 3SKOB 3O2WH 1Y18B 1GGCL 4LCVA 1WA0X 4TQHA 1FE8H 1PVHA 1ZPUA 4HT1L 4DPBX 8FABB 1SMDA 4LCCA 1PFOA 4LBEB 5FGRA 3BP4A 4PLNC 5TF0A 3BQVA 3MXWL 5T8IA 2VDLH 2YJQA 4WO4B 4ZFOB 4AXWB 1PZ2A 3K6IA 1NEZB 3E6FA 4FI8A 4PGEB 1JGEA 1HNFA 2D7QA 2Y5TB 1AAJA 2FYYB 3BVWA 5ILTL 2ERJC 2Y7QB 2YEVB 4JCLA 5IWLC 4GW4B 2HFFA 3QWQB 1JRHL 3GTNA 1LO5B 1QSEB 3QDAA 5DD3H 3GXPA 3LKSB 3MJ9H 1IGYB 3AB0C 4M1DL 3FU3A 4X5PA 2F1EA 5BXFB 3HZYA 1QHOA 3GC3A 2FJGA 4LEOB 2Y06L 3FQUA 4BEIA 2XFXB 3WEXB 3V6FA 5EC1B 1R0AH 2ADFH 3NCJL 5I1KH 2WLKA 5MEPB 3V0WL 2FO4B 3VXQA 3VGHA 3APCA 3D85B 1E4KA 5EZOL 1HCYA 4N5ED 4M6ML 2VDRL 3CLFH 1HXYB 4FFWC 2KYIA 2OMUB 5C6PB 1EHLH 2H3NB 4JCWA 3L5HA 4YX2H 3HZMA 1OP5K 2G2PA 2BMKA 2KERA 1YYML 2XXFA 4M5TA 2VDKL 2EDBA 4CADB 4GRMA 3AITA 3CZJA 3SBWC 5JNYA 3MO1A 3WTTA 1RIUL 4PBVC 5DFVD 2R69A 2RTTA 4C56E 1C8QA 4HC1A 5FGCE 2ZIDA 1AXIB 4CL7A 5EUKB 1IQWH 4D94A 1WBXB 2X1WL 3BH4A 4KVNL 3OR6B 4OTXL 3SKJL 1MLBA 3IRPX 4HCIA 2ZX6A 2ENYA 4OKVA 1KN2L 4DOHB 4EN3B 2HUHA 2GCYA 3FB5A 3R06A 5F97E 4YXLL 3K2UH 1JNNH 1LO2H 5KVFH 3CXHJ 5EUOB 3L7FB 4KDWA 4NB7A 1UADC 3HC3H 2PCFA 4TVPH 4MXVE 3M17A 5GS2D 1A3QA 1DVFA 4N2CA 2HJLB 3Q3GA 1QQDB 1DJXA 2WXIA 3GSRA 4HJJL 3UACA 3MRMA 1SEBB 1NFDB 4L5FH 1AJ7L 2ATAA 3KBHE 3NTCL 3FRPA 4M29A 1GY2A 5F72S 3LOWA 1TETL 3T4AA 3CFDB 4W93A 2F19L 3ZL2A 1LK2B 3DXAD 3L3JA 5D1XB 3MAWA 1QI3A 3Q13A 3H9SE 4I4WB 2BNRA 3GLEA 3K1KC 3EUDA 3KLDA 4BV1A 4MXVF 4NNYA 2X2IA 4WUUA 2AK4D 4PJIB 2O30A 3FN9A 2COVD 1BAWA 4H0LC 2OTPA 5C0NC 2LHAA 3IVKB 3O8XB 4LPXA 3I50H 1AHWC 2D3NA 4PRBA 1XZWA 1FO0A 2FBJH 3S35X 1KBPA 4DUWA 1HHGB 5JIPA 2LV4A 4E41A 3KLSA 3QIUC 1F4XH 1S46A 3UJIH 2G30A 3QDGE 1IUZA 2DQCH 3SDAB 3FC8A 1NFKA 2YN3A 1NSNH 2OKMA 4U1IA 5I8KL 4JO2H 3DSFH 4H1LA 4W4OC 6FABL 3I2CH 4YXKH 1JPFB 2MCPH 4DKDC 1UYWL 4K2UL 2VQTA 1M7DA 3P0VH 4D0BA 1ZLVK 4F57H 3LNGA 1IBHA 3AS3A 3FUFA 3QIWC 5I66B 1NANH 4OIIH 5SWZB 3IJ8A 4IQHA 5FEBA 4J1UB 4ONGL 3QQ3B 2OP4L 2P7TA 3ISRA 1DJHA 3ARBD 3K6OA 4L3EB 1ORQA 2WLMA 3ZKSD 5E8OA 3BAJA 4GKZA 4DFHA 4U3CA 4RNRB 3BSHA 3DJRA 2Y36H 4YPJA 5KSVB 4U1LA 3BP7B 1K9TA 5J56B 3FSVA 1SXAA 2KLRA 3FOMA 1E4HA 5ICZA 1U4FA 3Q6FA 3WJJC 3UO1L 5IMOA 2QSVA 3FUNA 4GW5B 2BK8A 4GIPD 5DMIL 3GMNA 4XPBL 2ITCA 1CDCA 2EDTA 3O9WC 1BVZA 1RJCA 2EVGA 1OK8A 1NDTA 4QOKE 4CA4A 3EYOB 2EIKB 3ZE1E 5KYYB 1V7MH 2NUPB 5E1IA 1PG7X 3H9ZA 3LXCA 3HR5B 1FC2D 2EDHA 3DRTA 3UTSB 5IGXH 5L88L 3KPRE 1DSFL 4BZ2H 3OZKA 4EXPX 1QR1B 1HH9A 3QUZA 4HIIA 4UQDA 5JMOC 1FYTA 3MLZL 4ODTL 1G9MH 4ZOCA 3NEXA 3FT3B 3KYKL 3JVFC 3MA7A 4XVTH 4DKEL 1JYNA 3ZE1F 3DX2A 3LXUX 5GQBA 3WG7B 1BXXA 2OMTA 2NY1D 4B7LA 4RWYL 1YQVH 1TQSA 2W5PA 5JA8B 1JNHB 3ZRFC 4L3CA 5KZCD 3ZTDC 4Z77B 2X3BA 4KK5C 4XWOC 5IP4A 1CD8A 3V6BR 1GC1H 4AI7A 2A6IB 2V9QA 5FK9B 3UJTL 3E80A 2YZ8A 5E2UL 2D73A 2A7BA 3MBWA 3V95A 4FC3E 4JPIB 5HP5A 4JG1L 4B9ZA 2RALA 1IAII 4LCCB 4P2YA 4ZO8A 1D5ZA 1PCSA 3MKKA 3N0PB 3R19A 5M94B 2YGNA 2QPSA 4M1CC 1SUJA 2IC2A 1A14H 1ES0B 2CKNA 2NSXA 1WK0A 4PJDF 4Z0BH 4NJ9H 4RDQG 4UTAL 2UVEA 3QO1A 4WY7H 4FULA 1MPAH 2L04A 3KPPB 4J3XA 1UOWA 3N06B 2UVFA 3O6ML 1MFEH 1YZZA 1X7TA 4OQ1A 1J18A 4ZFFB 1SOQA 2R4RL 3R1GH 5E94B 1A1OB 4GI6A 2J43A 3IAQA 4DZBA 4HX1B 2HLEB 1A1NB 4W9EC 1IVLA 2JKSA 2AJZB 5C2BL 3AWGA 3A4AA 4K7FA 2XNAA 3CSBA 1YPZE 2OL3A 2RB8A 3O3DB 2PTUA 4PTTB 4TNEA 2X0WA 5HHXL 1UJ3C 2DWXA 1PF3A 1IGML 3TJPA 1ZS8A 4BSWB 1C5DB 5HYJA 4K94H 1JZIA 2F5AH 1T22B 5CEZL 1WCBA 4KDTC 4QNPE 3BKYL 4ZXBA 2BW4A 3U1SH 4LRIC 4NGHH 1HKLL 1KDJA 2OMBA 4I0PA 3ZBMA 3UAJD 3UTPE 3X3FL 3O4LD 4NQCA 1EGJA 1TZOA 1YPZF 2VDMB 5F7KC 4RIRB 4OZGA 4B3VA 3J2PA 4A37A 1FZMB 2X1QA 2BSRA 4GO6B 3FNKA 4UQ9A 1U9KA 1W6WA 3GD1C 3AY4A 3GS7A 3WE6B 5KJRL 4UT9L 3H54A 3V0VB 1FL6A 3SO5A 1HHKA 1IC0A 1A6WL 4HJSA 4HA1A 3ERXA 2RACA 2A6DA 4YXHL 4QNPF 3W5NA 1LQSR 1S7QB 1TEFA 3I9GL 1KJ2L 1RKRA 3GLZA 4AKPA 4Y5YC 3KS0J 4AUUA 3BAIA 4PJAB 5DWUL 2YA1A 4TLSA 3SY0A 3ILQC 4Z7QE 3OGCB 2OZNA 1AGEB 5DJXA 1YMHA 3GSOA 1BQ5A 4IU3A 3QS3A 2XWXA 1U8OB 2BC4B 5DUJA 5AOMA 5IW1B 1J5IA 1UCBH 4JZJC 4BFJA 4FKEA 2OW7A 1ZLUK 5SX5H 5L2KA 4DGIH 4CSTA 3TA4D 3DXAB 3MLXH 3LY6A 4LLUA 4FFYL 4Z7QF 5AZUA 4KTDH 4NNYB 1TIUA 4FABL 4LNVA 1L9PA 3LD8C 2AK4B 2R29L 3JXAA 3ME0A 2DM2A 5I18H 3C8DA 3K72B 2E9IA 5I1LA 3LS4L 3ZX1A 3PGDA 4Y2DB 3U0TB 4AIOA 1NGYB 2J1XA 3GRGA 4EZJA 1R5WB 5TGBB 1MVUB 1N12A 1DL7L 1RD6A 3GKWH 2Z8SA 2ZE0A 3MV8E 4G43A 1A1MB 4FXKA 3GMQB 1JI1A 4M4PA 4AYDC 4WTWA 1IGFL 1OE1A 4NWTL 1P7QD 2H9GB 1BBJB 1A3RL 3E3QE 2RFXB 4U3XA 2CLVB 4ENZA 4NP9A 1GCYA 1DBJH 4ZNCD 2EE9A 1BJ8A 3W9DA 1DDTA 4AV5A 1BM3H 1HDMA 4FYTA 1X5AA 3MX0B 1Z5LA 3AVEA 4XP9L 1D2OA 4WUUE 5ETUB 2Q86B 4M6NH 1QKZL 3ARBB 3FFCD 4UM8B 5BRZD 7PAZA 3RVVD 4OF7A 3BWAA 1ZT7A 3X2QB 1JF1B 1PQZB 3UGEA 5GSVB 4KHXH 3ZTCC 2ADGA 1AHMA 1VPOL 5C9JB 2P44B 2IWEA 3L54A 2F9BT 5KJ7E 4AIZB 3RURA 4FQHB 4Z9KB 2B1HL 3SPCA 3IAPA 4LDLB 3O2DA 4M7KH 1AY1L 2CA3A 1RZQA 4HS8H 3PLYA 4L48A 5EU4A 1U36A 5CHNA 3U9PL 2NNCA 1AZCA 3ZR5A 5DR5L 3CZSA 3QUZB 5KW9H 1R17A 2AGJL 4KOBA 4MWFB 3HNTH 4FG6C 3G6JA 5BO0D 2FT7A 4G5ZH 2BSED 2X6VA 1ZDQA 5J3HD 2K9FB 1K5NA 3L4TA 1XDTT 2DJ4A 2F8XC 2OSYA 2W59A 4XVJH 4Y89A 4OCSL 3ZGIA 4Y19A 3QUMB 1XIWB 4ZUWA 2GJ6E 1W9XA 4U6VL 2NY1B 3MROA 4LLVA 1JWUB 4RX4A 2XV3A 4WTQA 4LMQI 1PG7W 4Z8FH 1EANA 1VADA 3BE1H 3MKGA 3AREC 5L8KB 1AOZA 5F9DC 3DV6B 1PIGA 4F15B 3QZOA 4DP5X 1Z5HA 3FU8A 4WV1B 2JKIS 5JYMA 3QHZL 4MNGE 1CDIA 4U33A 3OMIB 1YC7A 2ZQKA 1E9QB 4FJYA 1NGPL 4BQ8A 4BCXA 3L1OL 4PUBL 3DUUA 1EK3A 3S4SB 5SWSE 1Q9OB 4RFOH 4RAHA 2EE3A 4F7CA 3SEPA 3EJZD 3LDBB 4YDVA 4DN3L 4XP4L 4ZG1A 4K3JH 1MJ8H 2FH6A 1EJFA 2X28A 2FNWA 2DB8A 3VYNA 3UAAA 4NRZA 1JZEA 3VQ1C 4Q58C 1QPPA 3G04B 1MRDH 3QQ9C 5BV7L 1HEZA 4MAZA 3WNLA 4Y16C 5IFJB 3GMPB 3MBEC 4L4TD 4QXTB 4EI5D 1LD9B 4DZBB 2CLZA 2NY2D 1AS8A 1BZ8A 1JHKH 1JHLL 3INUH 4N0FA 4TSCL 5F7YC 2DKUA 4NENA 5F1NA 1KGXA 4LCUA 3SE8H 4PJXB 3N44B 2EYTB 1MN4A 3L8QA 5ERWA 5HYSG 3JWOC 4P46A 4PVLA 3RVUD 4CC4C 1IAMA 3U48A 2V7NA 3EDDA 3U0PA 2EUVA 1CFBA 4FQLL 2HAZA 4I18B 3ZKQD 4QYAA 3WIFA 2WO3B 4U1KA 3CSGA 4I48B 2O61B 2AKRB 2XQYA 1NBVL 4FFTA 3UMTA 1U91A 3N1GC 1E8ZA 3CIQA 1MJUH 1MIML 4PP2B 3QYMA 5A1AA 5AAWC 3CCHA 2MNJB 4LCYA 1PY0A 2GBAA 4BA8A 3HB3C 4ZTPH 4E9YA 1LE5A 3H53A 3ZTEA 5FYLD 2ZPKH 3BVVA 1SVCP 4MD0A 1S5HA 3GI8H 1J12A 1HSAA 2BVEA 2JFCA 1MRCH 3D3VD 5JQ6L 3HS0A 4RMRA 5CEXA 4NAJA 2RA1A 2VJ8A 3D0VA 3BAKA 2A6DB 2ED7A 1URIA 2GSMB 3PABB 1QO3B 3E7JA 2JIXA 2ATKB 4YHKL 4LP5A 4Z3EA 1XSKA 5FYKU 1HOCB 1JK8A 3H7LA 2Z8VC 3BGMB 3DK2A 3US9A 3WN5A 4DK6A 5A6MA 3QORD 5CXPA 3KPQB 3S35H 1S8DA 3IJHA 4JRWA 4WU5B 2BP8A 3ARGC 2B15A 2IDTA 3C6SA 1FN4A 1E30A 2CJUH 2YPVH 1KXTA 2DLGA 4KTEL 2NY4B 3ASWA 2M26A 1FGVH 5I1EH 3GIVA 1IC5H 1RURL 2AV7B 4FNTA 4HU8A 5AW1B 2EDYA 5B3JE 4RAVA 4CBPA 2UZPA 4FL4B 4N8UA 5C3TA 4BSVB 2WAQA 3CSFA 4LGRB 1XX9C 1BZOA 2R1WB 2WBJC 1F6FB 1J7VR 3SIKA 1MFDL 4JFOB 1GZHA 1ZA6A 4NO0D 1SXBA 2ALWA 4FLQA 4PJCA 4JHVA 5HGBA 1KXHA 4U4IA 4PIRF 4HWBA 4AWJC 1J86A 2WWKO 5HXMA 4Q52A 3VFTA 4L0PB 5BRQA 3GLDA 1H6UA 3BDYH 3P0YH 1B0GA 1T04B 3CMOH 4GW1A 5IB1A 2CGRH 1I8LC 4R7DB 1ZGLP 2WVVA 3GSQA 3PAUA 3BEVB 4QKTA 1T7WA 3WUWA 2OX5A 1VESA 3D25A 3NG5A 3D4YA 3U6XA 5TTRA 5CD3A 2V5TA 2Q0ZX 1H3PL 4N2HA 4Z5RA 2XA8L 4HT1H 3VYPA 1E6JH 1IL1B 4XPHL 1PG7H 4ZUVB 2JJTA 1LEKA 1CURA 5JTWA 3AXLB 4NPJA 5H94A 4IMKC 5A2AA 4F80A 4M6OL 3HNSH 3UZEA 1OTUD 3HBGA 3IDYC 4BK5A 4ZOEA 2G0LA 3EYFB 1HDMB 2VYRE 1GJIA 1UWYA 4QHLA 3RPIA 2X2YA 3BZ5A 4JB9L 4KMQA 1BEXA 3ETTA 3K7UA 4FNQA 4C83B 3HCVA 1QPKA 1L3NA 2VLJE 3ZYOA 3FFCB 2BHUA 2CGZA 4M1DH 2QTVA 4YVUA 4POZD 3AS0A 3DHMA 4F92B 5I1IH 1MCWW 3CHPA 3CQFA 4TKWA 3VW3L 2VZUA 1E2ZA 1OAZH 3WBDA 2R23B 4OGAC 1NBQA 1KIRB 1Q90A 1JV2B 1MFUA 2G9KA 3TBWB 1QFWI 4A6YB 4HFUH 4X9BA 5I0VA 2ICWI 4ZMWA 2VJXA 4Y5XA 4IGBD 2BNQE 5LLIC 4XP6L 3ZHFA 4AIEA 1CTMA 2IVFC 4XOAA 1WZMA 2CM6A 5F6IC 2DJSA 4NWUH 1O6TA 2C4FU 4I77L 1R47A 4NLAA 5L4IA 3JVGA 5CBAA 3K6SA 1MCIA 3F7YA 4UQIM 4WDIA 1U6AL 4WWOA 4PWGA 3ET9F 2OLDA 1B9KA 4U05A 3E2HC 1M05A 4L8SC 5FC9A 3I75B 4NCC1 4TRPH 1I85A 5EOQH 5FM5M 1X5ZA 3TP4A 1XCWA 5HSFA 1GJWA 1YEFL 3GRWH 3VXOB 3UG4A 3FTYA 3OKKB 4YSUA 5AZ2H 2YLKA 3HE7B 4K3EH 3BVTA 3V4VL 4RISH 5BVJB 3NCXA 3BN9D 2F08A 1KN2H 1NKOA 4QRPA 3ASOB 4GQ9L 3UDWA 2MQGA 5CJ5A 1SLUA 1WUZA 3AC0A 2N0MA 2NXZD 4PWJA 1IKNC 5F1KC 1DDHB 1XV8A 4F8NA 1G6RL 2UWEE 1DYZA 1L9SA 3WS6A 1HYSD 1GGIL 1L9RA 1Q4NX 3PU7A 4HIJB 3CX5K 2YAEA 1YEHH 3D09A 4PRHA 4XB3A 3UP1A 3ZSSA 2KS0A 5TE7H 1MAJA 4CVWA 1TETH 3N1PC 3HG1D 5CSGA 1TFPA 3G6JE 4OUUB 1K2DB 1KCLA 1MHHA 3MRRA 5IROC 5JOPD 5DEFB 5E7BA 3UL4A 1I8AA 5GSRA 2WZAA 2UWEF 3D39D 5JZ7C 1JMXA 1RV6X 4Z7VA 1J8RA 4L4TB 1PGRB 3PCYA 1OTTD 3B5HA 2EICA 4KY1H 4GMTL 3G6JF 5AAMC 3CFUA 5C09A 4Z7NB 5DJCA 2NZ9C 1J5OH 5AG9A 2IV9A 1Y7VA 5FM8A 4DEWA 4JHAL 1S7TB 5D8JL 3NABL 4RFNC 4I87A 4LLMA 4WFGE 3F62A 3GMOA 4PRPE 2OJEB 3JV4A 1G84A 4D2NA 4LCYB 4KQ3H 5AW4B 1K8IA 3VFOB 5GGRB 4YHNB 3PREA 2QGEA 1R4XA 3T0EA 3D6GA 2WQVA 5C0JA 5HGHA 3F12A 3L3OB 3BPCB 3D3VB 4PJEB 1A6ZA 1MLCA 4V11A 2NY6C 1FZJB 2BZCA 4GSQA 2X4OA 2EO7A 3VXSB 3GEFA 3ARYA 3RIAK 2VAAB 3VH8B 1NBZA 4FZ8L 7FABH 3KPSE 2W92A 3LQZB 4APQC 3LXBA 1WZ1L 1GMEA 5G4OA 1W8EA 5LGJB 3BWUF 1KACB 4NM8L 5IM7B 3CWGA 5I5JA 3DDFA 4I2XA 1E4WH 2WLLB 2IAAC 4ZTOL 1ZANH 2ZG2A 1QTPA 3C2AL 3Q5TA 5DMIH 4NQDB 4NHCL 1OP3K 5DZVA 5IQ7L 1YC8A 1JK9A 5HHPB 4P5MB 1SVBA 5L7XH 5I6OA 3RA7L 1RZFL 2P28B 4ISVA 4NN7C 3LKOA 3MPCA 1RSYA 1YSOA 2XTJB 1K4CA 2K6ZA 3DHUA 1RZ8A 5LVEA 4KRPD 3CVDA 1DSFH 4TVUA 2FZ3B 3G5YB 4HKZA 2ZOTA 5HHOA 1EA9C 1HQ4B 2EXYD 3MV9A 2VR7A 5EEUA 1FNEA 4RSVA 5DO8A 2MPAL 2E75C 4PJCB 4YNYA 3RZCB 4NNXB 4LQ1A 3WD5L 1A7PL 1NKGA 4DKEH 2MMXA 3CPLA 1Q1PA 1YNLH 2FD6H 5CZXC 1VGKB 3N85L 3QNXA 1HHJA 2YKKA 3N42B 5FYKD 3TVMD 4NSKA 4QRFA 1S9WB 2W60B 2WY3B 3TJHD 3OZ9L 1N64H 5IB1B 5I8EB 3JWOH 3RILA 5D1QD 1CDHA 4HJ1A 3T8VA 4OD2B 4PREB 3F64A 4W81A 2ADJB 4AC2A 3IRZA 4JDVA 1BWWA 3IU3B 5GGQL 1EXHA 3TN0D 5HJGA 5T1MB 2NCMA 3IJEA 2A9DA 1T1ZB 3RTQD 1IKOP 3M8OL 2JB5L 5HYEA 4WNQA 3IF1A 1QNZH 2K78A 2R1YA 1YQ2A 5TQ0L 3FZUC 2HKHH 5DJ6B 3N9GL 2WXLA 2ADIA 3OXSB 1YEJL 2ZX8A 3K5RA 3SDDD 3WEMA 2WM0A 2QR0A 3RWDA 1FCCA 1D5RA 4OCXH 3UBXA 5EDSA 1RUQL 2QQNL 4MXQC 5FW6A 1NKRA 2GTZA 3W57A 3FAWA 4DUVA 3PNWB 4IRJD 4HSCX 1OGAA 1R6VA 3KXFD 3NA9H 4YBLB 5CZKA 4BJLA 3KPNB 3P4OB 1CL7I 1HVXA 2PXYC 4NRYA 4DKTA 4YHOL 3U30C 3SCMC 2OXGB 4KRLB 1QBAA 1WC7B 5DQ9A 4Z3HA 5D5MB 2NX5D 4JFDD 3KWUA 1S4IA 1FG9C 1HL9A 3P30H 4LFHD 2Z35B 3BIBX 2EEDA 1RP9A 2EADA 4GXUM 2G9HA 4KO9A 4HUVB 1CICB 1EBPA 5JQIB 5K5YA 4XN2A 5E8PB 5FR3A 4UM9D 1J8SA 1YEDB 3UTOA 3ZE0B 3KMDA 1K72A 1MWAL 3F6LA 1KULA 2OMZB 2AJUL 3BGAA 4UBDC 3G5XB 4HK0A 3QZMA 3BO8A 3WAJA 4CJ1A 4QTHA 5IREA 3BYTA 3ULSB 3FU5A 2XRAL 4G6JH 3GXFA 2YSSB 4KI5D 2DQIL 1WBZA 3HE6D 1KC5L 5E9DE 5EEXA 3CMGA 1WSST 2J5WA 2HRPH 4N5UA 2CR3A 3QZLA 4GKNB 3WSQL 5MP6L 1KJ2H 3FCSA 4FEMA 4KK9C 4F3FB 4F27A 1P4LA 5GISL 2IALB 2AV1A 2YARA 4MYWB 3MLPA 2X4SA 2I7OA 5DWUH 1ORSB 3Q44A 3E6HB 3CH1A 2ZCLH 3LH2L 4J8RA 3DIFB 3WEAA 2Q20A 4OT1L 1QWUA 1CGSH 1MF2L 1V7NL 2R27A 2OJ1A 3Q8AA 1I7RB 4GBXC 1Y1DA 2DIAA 2OI9B 3QCTH 1MI5A 3OKDA 1T1XB 4JN1H 3HPJA 5F1OB 4A7VA 3B7YA 5EO0B 3VJ6A 4WI5A 1G9NC 2YPKA 1WFIA 3QJHA 1H3TA 2ICWJ 1KTKE 3MRRB 5E2WH 3HG1B 4DEPC 3ZE2E 2G3NA 1JYVA 1AQKL 1KTBA 1F13A 1CGYA 4U0QB 3IN2A 4FABH 4HPYL 4N2FA 5LGYA 4BFGA 2FIKA 1IBYA 3D39B 4JO5A 1XF2A 1U8JA 1XSIA 2JB6A 4AMKL 4DGUA 3QJFA 5E5RB 4EAEA 3CX5J 1FZOA 4JL2A 5EU5A 1XSJA 4G7SB 3D05A 3EJUA 3CBRA 1XVSA 4OFKA 2R1XB 3QXWA 1OPGL 2DLHA 3HAEB 4QRPE 2GK2A 2VW4A 3LIUA 3RY4A 3ZE2F 1CB4A 5DJAA 5F9OL 4ELMB 5D4IA 5D1ZD 3VFMB 3BQUD 3FTZA 2DQHH 3PV6A 4P3WA 1EO7A 1ZA3A 3I3BA 2CDFA 3CG8A 3WYRA 5I76A 2ZKHH 2N7AA 3DGCR 4NO5A 3W9EA 3TIEA 2WINB 1F4HA 4FLRA 2NCEA 4LCWE 3Q8CA 2BSSA 5EC2B 3QPXH 4GKLA 4GP5B 1HHHA 4HV8B 3Q1EA 5GJTL 5JOEA 4WW2B 1SY6L 4ZK8A 4H25B 4AKQA 1KIUB 2A5UA 5DVPA 3ZT5A 4NZUL 2HKAA 1T0NB 2HFTA 3IDUA 4JY5L 2K7PA 3WIAA 4CGUB 5HHNA 3MOAH 3RFZA 1G1OA 4OGZA 2PO6D 4M7ZB 5D2NA 4TSBL 1M9SA 3B7RL 3RWCB 2A99A 4Z3FA 5J7CC 4XNXL 5IOPA 3BKCL 2OXHA 4TV3A 1AXTL 3VXNB 4HXAH 4TVSa 1XF4B 3VFGL 3SYCA 2BDNH 2KPNA 4UUJA 1RMFL 2XV0A 5FA3A 1QSFE 3V0HA 5IJVA 2B5IB 3FO0H 1OVZA 1EXUB 4KRPB 4MB4A 4TOYL 3SB3A 3MLRH 4QF1B 2KZ1B 5DR5H 1HXMB 2HFEA 4BH7A 5B8CC 4KUZH 3EW3B 3T0EE 2MOVA 5C92A 5AYUH 5IHZB 3BD5A 3WJMB 3ZHDA 2Y2TA 2XI9A 3MLWH 3F3HA 1AFVL 5JIMA 5B39B 5C3LD 3CPLB 3RI5K 3ARFA 1P9MC 5LGHL 1YNTB 4HKBA 4O9HL 5SWQB 1KNOA 4KJQD 3L81A 3TVMB 3MU3A 1W72B 2VN7A 5HI3D 2QKIA 3MNVA 4ZMOA 3MACL 5MHSD 3F05A 4MMZA 4YFEA 5HYIA 5TH2B 3O6FC 4N8VG 5D7SH 3TCLA 3WLWD 5D1QB 4NC1C 4PJ5D 4ABVA 4XT1C 2NY5L 4KKAD 4MQXC 3KJ6L 3VXUD 1E8WA 1DQML 4RMUA 4I3RL 2BOLA 4LXFA 2I60L 3TN0B 4B9IA 4PUBH 3VA2C 2VZTA 4PJ8A 3RTQB 4WNQB 1DJIA 2NY7H 2P5EE 2QPDB 4UOW1 4TQEL 3NFPA 4DF9A 1C08B 2YOCA 3S34H 1FFNB 5HHOE 3MV9E 3W39A 1MCSA 1AI1H 4BUGA 3DOHA 4EUPG 4Z3GA 1CDYA 4QJ4B 3L95A 3SDDB 1T80A 1D9KA 4JMXA 5JPNC 1O7DC 3VCLA 5IVNA 3DURA 3QAQA 3LPWA 1TJGH 3QO0B 4FP8L 1DUZB 3K46A 1KCUL 1MW0A 4XXDA 3JT0A 2ZAGA 2DH2A 1S7SA 4AEIH 5IHUH 3BAXA 2FEEI 4IRJB 2IWKA 5CJOL 4TSCH 4JM4H 3WMQA 5DRXB 3GSVA 3KXFB 3VI3B 3ULVD 1P7KA 5F8QC 4AY0A 3S5LA 4GSDL 3WIHH 5ECGA 3REWA 1BQKA 2V17H 3VFWA 5DQ9B 1B2WL 2HH0L 4FFZL 3X14B 5KSAA 1U8NA 1N4XH 1NPUA 3CU7A 3LRSA 4N86A 2NX5B 2W0KA 4KQ0A 3C5ZA 3GM0A 4MAYD 5FECB 1Z9OA 2WMPB 2EE2A 3PWUB 5DC9B 5HPMB 3DHJA 4ZQKB 5FDYA 5LNEA 2Z7UA 1AGBB 1SF5A 4KXZH 4UM9B 4U1SA 4PJBE 5DZ9A 3F8UB 3RBSA 2CHNA 2X12A 2E5EA 1JAEA 1IAKA 2EYSB 2ZNXA 4R9HA 1Z3GH 3LN5B 5JQ6H 5EU7C 1Q94B 2X53A 2OS7A 4Q89A 2P5WE 3EYUL 2WBWB 3SPIA 1TLKA 4L2YA 5K33A 1DFXA 1JS4A 2F54A 2Z31C 3HE6B 3OXRA 3DETC 3ZZ1A 2FL5A 1L7TL 3O3EB 3LMJH 2DI9A 4KMLB 1OGAE 4TNFA 4UDTA 5EO1B 3AG2B 3K2MC 4L37A 4PJBF 5E4EC 3KYOA 4O4YL 5DRNA 4U0RB 5C08A 1KGIA 1QYGL 4Y9FA 3FU0A 1YYLL 4MNQE 1NCBL 1WIOA 3TT1L 4QPEA 4RGMB 2Z34A 3ESOA 2BO0A 2VDNH 2EXTA 4ADGA 3IEAA 4HEMA 4HUXA 3PQYE 3UFIA 4UV4H 3IJSB 1CBVH 1XGZA 3ROOB 4X0NA 1TZHB 4L4VA 3FCTB 5FUOH 5AFAA 3FU9A 1AGFA 3K4DA 3HLKA 1ZV9A 5I15L 4RESB 1V3JA 2CR0A 2XSKA 4EKJA 5FXCH 4FNUA 5KVDE 1Q9LB 4XE5B 3HIZA 2MNUA 4BSJA 2MQ3A 5DRWB 5DLLA 2Z64C 1CF1A 4ABUA 3F5WA 4ELDA 43C9A 1RU9L 3K8LA 2VRAA 4GS7B 5LAXA 4L3FA 4G6ML 2VABA 5DD0L 4Z95L 4CNIA 5HDOA 2O5NA 1BFOB 1DSYA 2HSIA 1LEIA 3ZDZB 4RSYA 2IMNA 4BFFA 1XFPA 1WEJL 1BBDH 1KFAL 4C59B 4UV7L 4F7PB 3GMLB 3BQUB 3HHSB 4L9DA 1W0VB 5I74B 5MENB 4G7VL 1H3PH 4WKZB 2Y7OA 4JJHA 1GYCA 4O2EA 4WKXA 3ZTNH 1JVLA 4XPHH 4PJFE 5JHMA 2BSSB 1CS6A 3UYPB 3ULVE 1MI5E 4RWHA 2LGNA 2R69L 1DQTA 3P4NA 4HULB 1CFQA 1T1WB 3L4UA 1HHHB 4HC1L 1VIWA 4ABQA 5KN5B 2B14A 4Y7MA 3U6RB 4JVWA 1K3ZA 1F86A 1Z9SA 3T5WA 1Z7JA 3FT0A 5B38A 2DWSA 4JG0H 4I9WE 4K8RD 3U25A 3VSVA 3MA9L 2HVJA 2IWFA 2CO7A 4KZCA 3VACA 2E9WA 4KH2A 5DZOA 2DH3A 4PJFF 3D51A 5EOTA 2PO6B 1UM5L 3ULVF 2I9LA 1AE6L 4WAFA 5DS1A 5LCVA 1NGXB 4JM2B 5FIEA 5F8RC 4ZMVA 2BOBA 1TYJA 4AEHL 3CZFB 3EGSA 4DETA 1CLOH 3EUUA 7TAAA 3TWYA 2QDVA 1GGBH 1KN4L 5E2TH 5AYTA 3WNOA 5KS9E 2X2UA 5A6LA 1A9VA 1LDPL 3JWNC 3O6KH 3RVXC 5B7FA 2N3JA 1KBKA 3QW9A 2MQCA 5FS5A 5FA3B 1E4XH 1A4JB 4UOJA 1G9NH 5CS7A 5HJ3A 3Q1SL 4PGCB 1L6PA 3FB7B 4X6DB 3N1FC 1F3JB 4IDLA 4P5TD 3P54A 4XNYL 4JX0A 4Z7UA 4AM0A 1RIVL 3P4LA 4D3CH 1U6AH 4QWWD 1BVOA 3QEQA 2YRBA 5KS9F 1HIML 3FQNB 4BFKA 1FO0L 4XPAL 2OYKA 3FMGL 1S9YA 4JO8A 2W65B 3VD0A 3SOTA 4AUJA 1IGCL 35C8H 4EN3C 4J6RL 2XDHA 1SJHB 1CFVL 1KCSL 3QNYB 2O26U 3IJYB 4NHUB 3TNMB 4XMLH 4NKIH 1F11B 1ZS2A 4YZWA 4MBOA 1XGRB 1B3IA 3FFOA 2AW2A 2H41A 4KWUA 2BM3A 4NKDA 4NRXA 4PJ5B 2OQJA 4ZMNA 3A23A 4Z7WB 5GZOC 5DHVB 3VXUB 1YY9D 3AACA 3TA3D 1KG0A 3T0AA 4QRAA 3GJFB 1QSEE 1R3IL 1QI5A 3QUYD 1A7NL 1KGUA 1MCCA 4XPFH 5D1XC 5I75B 2YD7A 4NQSA 5DJ8B 3QDJD 4B7IA 4YBQC 2GABA 2UYLA 3JTTA 2O6PA 3I85A 3RGVA 1RJLA 1ZTMA 3LEYH 3TEUA 32C2B 1RP8A 1KLFA 4QTIL 3VCLB 3G5ZB 4QIRA 1WE5A 3OAYH 3QEUA 4G8GD 3NFSH 1LWHA 3O8XC 4K7PL 1KWKA 2WYIA 4DAGH 4JO4H 3RKDC 3B5GA 2K9UA 4GAFB 2J6EA 1JZ8A 3WTXA 1QP1A 2VQ4A 5KBMA 4MJID 1FI8C 1P4IH 3BLKA 1Q9KB 1UWXK 4FNLL 4UIKL 1IC7H 5KSAB 3EJJX 1T20B 2GSIB 1PBYA 4QY8B 3SDAC 5GRJH 3MLUL 4WWKC 5J6HB 1KXQA 1F42A 4PRID 2F8IA 3N04A 2C1OB 5DS8B 3ELAT 3MYZA 2LAGB 5ISZD 3QFJD 3M6DA 4EZKA 5ECJE 1UM4L 5JA9A 1NJ9A 4U1SB 1TCMA 2B1AL 3EJRA 5D7KE 2AQTA 1FFRA 3Q8BA 2QADD 4IKJA 4NFCA 2WKGA 3AS1A 1WIUA 1YUKB 1P5UA 2ZXQA 1YVLA 5I16A 1RULL 2DQMA 2ZOLA 2D7PA 3K4AA 3MLTA 3VM7A 2VDQB 2PWGA 2W88A 4ODSH 1CIUA 3OXRB 4UQ2A 5EUOE 3WDIA 4LDOB 4NPYB 4FQXA 5BQDA 3MYJA 4R5XA 2GBVA 4UTCA 3RWHB 4LLQA 4I3SL 3V5HA 4ZNEE 4RGNC 4BQCA 1ODUA 1L5GA 3TEZA 1V54B 3MRGA 3DK0A 3FBKA 3OHMB 3OB8A 4PJ7A 4Q8BA 5C08B 4ZTOH 2JJSC 4GRLB 7PCYA 2QHRL 4IU2B 2ICWB 2Z0BA 4N6QA 4NHCH 4BZYA 2R2EA 2ZUTA 5IIEA 5D1XE 5IB3A 5IG7A 3QR1A 1AG6A 2BIOA 4IRSD 4LVEA 1FGNL 1M7IA 4JDEA 1YCSA 4FQQB 1S7VA 3IFOA 3T08A 3QRLA 1GR7A 2F5BL 4PJIE 3L3KB 2WIIA 2WTPA 3APMA 3HC0B 1UWGH 1PTZA 3HA0A 4E9SA 1P69B 2YD4A 3OHXA 2ESVD 1R3KA 4ONHB 2NYYD 4YHIA 3H3PH 1SEQH 1U8LA 3EGDB 4PB0H 3H2WA 2OR9L 3KWTA 5E4IA 3FTXA 4UINL 3U0WL 4L8CA 4B5ZA 3BZ4B 2ICEB 5ID1B 3PL6D 1AD9B 3FHQA 1S7RB 5HGDA 1DO6A 2A6KA 2F54E 4PJIF 4XN4A 5FWQA 1VZIA 2OL3L 3ARPA 3RL2A 2MPVA 2H45A 2MSPA 1BAFH 4DQOL 3AU1A 2Q3XA 4JRLA 1RZGB 5F7UA 1OTSC 2NQDA 5T1LB 4ZYKA 1S5IL 3KPLB 3SYQA 4ZZKA 1PFCA 3OZ9H 1KLUB 4JMNA 1A4AA 4XCFL 1A6UH 3EBIA 4I1NB 4L1TA 5DQJA 4LCCC 1F2QA 5HDRA 3FSWA 3MFFA 1L3WA 3EO1A 2GSGB 4DW2H 2B9AA 3GXUB 4Y4FB 3W37A 3UYOD 1UD2A 4R90L 3GUFA 3KW7A 1EGJL 3QJUB 4TPRL 4L3EE 4HWEH 3M8OH 1M4KA 3OF6D 1ZT1A 3MRIA 5K9JH 1FZKB 1BIIA 1PD1A 4XMKH 3N2JA 4YSDA 1BYOA 1KELL 3ULVH 1CVRA 5I8CB 3FQRA 3CN3A 4N3TA 3B2DC 3N9GH 2DLFL 1YEGH 1UOKA 3NZUA 1B0RA 5CUSH 1NMCB 2IAND 2AQQA 5F88B 1ZVHA 5HDLA 2CO7B 4GMSH 5H2BB 1HCFX 4TL5A 5C07B 4V1DD 2O6CA 1NCAL 5CP7B 2X7LB 1E6OL 1TFHA 1I3GH 3QIBD 4UANA 3SGJA 1SMAA 4X99B 4F9PC 1DJGA 1HE8A 2MTPA 4A63A 1J8HD 4TVPD 2NZ1A 1B9ZA 1X5MA 4LVHB 3UTSE 4B9KC 4GUPA 2DM3A 5CGBA 1JPTH 3RIFF 3V5DA 2MHAA 4N5EC 1CE6A 2EABA 4YHOH 4DH2A 5LXGH 3ZKND 3CDYA 3AM8A 1MNUH 2AXWA 2V8LA 3HFMH 3OJ2C 5ITFA 4JCMA 4YLBA 4FLSA 1JXKA 2CHXA 3MZGB 4LSDA 3STLB 2ROYA 2A73A 4LHUG 3U1QA 4CVUA 2VNCA 1JRHI 1Y1UA 2RMNA 3UXFA 1EEQA 3JWDC 3V4LA 4BGDA 3Q06A 1C1EL 4Q0XL 1FFQA 5IQNA 1EFQA 2P8LA 25C8L 4KKCD 2IPKA 2XPGA 2XY1A 4N2OA 5IMMB 1BQHG 2R4SH 5CZVH 2WYZA 3WXVL 1MCBA 2DQIH 4K7PX 4OLWL 4BIKA 2VR9A 1UGNA 4BQ6A 5DMYA 2IPTH 3LHAA 4LU5H 3ZVVA 4QAMB 1NL0L 4MA1C 2WXFA 3EO0B 4XGZB 1F4AA 3RUGB 4JAMA 4WWID 1Q1JH 2CRZA 2YAHA 2A4CA 1CT8A 3LKPA 2GJZB 5AVSB 3K8MA 4Y4HD 2FAUA 1EO8H 4UI2A 4ZPVA 1X6NA 2B9BA 3CLEH 3O4LA 3GBNL 5F93C 4OT1H 1RZJC 2PF6A 2D31A 4TSAL 1WJ3A 3TA3B 3NUKA 5BS0D 1MF2H 4BFRA 3T4AC 3EYVB 4XI5D 1G7JA 1G7QA 3TO4A 3QUYB 4PD4K 4UT7L 4HIXL 3TBSB 4NQSB 4LPUA 1U8PB 2O93L 3QDJB 1YY8A 3LH9A 2OR7A 1ID5I 3T77A 3IU4L 3IT8D 4K07A 2FHFA 4ECNA 1CLZL 4U7MA 4P04A 3D4CA 2WXPA 4OR1A 3GJEB 4IK7A 5L9DL 4G8GB 1RZ7L 2A74A 2YMXH 4WLCA 1JZHA 1FLRL 4Y2DC 3G5WA 2ROXA 5IBUG 2A9CA 3O2DL 4GFXA 3UO8B 4AJVA 5ENWA 5F70A 2WQWA 1QUNA 3MMEB 1JYWA 4GI9A 2VLKD 2RBLA 4HJGA 5T5FH 1YEWA 4XP1L 5DD1L 4BZ1L 4F9LA 5JHLH 2DWEB 1SJEB 4MJIB 4Y2OB 3JWNH 5EWIL 1GZQA 5JW4N 1MJJB 1XEUA 1P4UA 2FO8A 4I85A 4OB5L 5D6DC 4CUCA 3S8FB 3NEOA 4PRIB 2ZYIA 4MSWB 1TTUA 4AVHA 2BINA 3GSNB 3G6DH 5ISZB 3WN6A 4KFZC 1H15B 3SE6A 1TJHL 1CDGA 4BYHA 2C9QA 2Z65C 3Q2WA 1IIIA 2QADB 4RFEB 5E8EB 2QV2A 1UCTA 1FFTB 4B9GA 3HUJB 1N6UA 2WV3A 2ZOLB 2CNZA 3UIZA 4ZT1A 2A6JB 3QUXA 1ADQH 4L29B 1AGDA 4HWZA 4N9OB 4ORGB 4L23A 5IK3A 1FNSL 3TEWA 1IILE 4BKTC 4P2AA 2YXMA 4AVIA 4R96B 3T8XB 1P7QA 5ALBL 4G6KL 4HIHA 1AXTH 3QULB 3O3UN 4DO6A 1DP0A 3ECBB 3ESPA 1JBJA 3K80A 3VWKA 4GINA 1MQKH 2UUDK 3DXAE 5DEGB 5D9SB 4IRSB 4NC2B 1AIFB 1KXQE 1S9KC 4JHWL 1DR9A 4OBRA 5HHQA 2VLRD 2C7UB 4NM4L 4M48H 4AV4A 2AK4E 3FN0L 3QUZC 4APXB 5AWNL 4UB0H 5BRZA 1G7LA 1KT2A 3T8MA 5C0DB 2WLYA 1GYUA 1BCIA 4OLZL 4U1GB 5IQ9B 3S0PA 2DWYA 2WK2A 3TZVD 3QWOA 3LN4B 3A5VA 3CC5B 3QXAA 4JKLA 2LT9A 1M1XB 4FKHA 1NC4A 1DBBH 3CV5A 4MCZB 1XIWC 4AITA 1NBYA 5F7MC 3PIQB 5IBLC 3U9UA 1ITCA 3PL6B 4AENA 5H4ZA 4KKLC 4M56A 4O9HH 2APXA 2QGDA 4BH8A 2B0SH 4Y1SA 1DQDL 2F7IA 2H32A 3OX8A 3P2TA 4E9VA 2FT6A 4JR9H 3C9NA 1P4BL 3ZMEA 4XVUD 5F71A 1H5BB 1CYWA 4J8QA 3VFSA 4UT6H 3IWUA 4XVSH 2NT0A 3WLBA 1DQMH 3A6CH 4JANA 5L8LB 4G9FD 1HL8A 1SM3L 2Z4QA 3ALWA 5T3XL 5F7BA 5DMJB 2XT1B 4HLZG 2Z93B 2VL5B 3MLSH 4UQCA 2R15A 1RK0A 3SGEH 1CLYL 5D96B 1R34A 4IEFA 4JY4A 1AH1A 3FT9A 4QJ3B 4YS4A 2XYCA 2BCKB 2CKBB 4GAGL 5IESH 2WANA 5DMGD 3BKML 3RWIA 5GGUA 1KPUA 1QI4A 4TNGA 1KYUA 1YN6B 3A6BL 4UTBH 1THAA 5E5MA 3MRHA 5D7LB 4XZUA 1Y07A 1KCUH 3QIBB 4HIEA 2W0LA 3WFEH 3BPNB 5AVZB 2R2BA 1GJUA 1W0YT 3MV7B 2AXFA 4OQTH 5BOPA 1QLRB 3MNDA 5F7DA 1M3IA 4Y5VA 1B2WH 4MQ7A 4OFPA 4YGVA 1ROWA 3VAEA 1FRGH 1RHFA 4L1DA 4ONFL 3RDJA 1G4RA 1M71B 4QRRB 3I02A 5FKPA 4ZXBC 1DBML 5FHBL 3G6AA 4N28A 4YSRA 4I0PC 2CUMA 3GM8A 3OC8A 1B4TA 1H8SA 1LYQA 2E9BA 4ZX4A 4DT2A 5J1AB 5KBNC 1TNMA 2VL4A 4U6XB 5TQ2L 4HWBL 3VYOA 4EI5A 2ZXAA 5CILL 2IFGA 3AY4C 4A7TA 1T5KA 5KBLA 3BUYA 1L0PA 2HG5B 2F61A 4K9EL 3B43A 1R3JA 2FK9A 5B1JC 3IDNA 4N8CL 4XCEA 2F0CA 2VAJA 4FFWD 4DESA 4S1SH 4AGLA 2V5MA 4H8UA 2WQXA 4AGNA 5FFOA 1BZ9A 4AE0A 4JPKH 5GPRA 1U92B 2WVSA 3UEQA 1ETJA 4JAMB 1JTPA 5C0IA 2B3RA 4C4BA 1OCWH 2LW3A 4KZ0A 4A38A 1YYLH 3IDIA 1AC0A 3MLYH 2NY4C 1IAIM 3VRLE 5DSCB 4X8CA 1J87A 3OPZL 2C1PB 4DGWC 1MFBL 4PS4H 1DZBA 5TPWL 5BS0B 5DYOA 4JVPA 5EO9A 2J88L 2F8OA 5K59E 1ZHBB 1GXEA 3FO9A 3QJRB 2RCSL 4JLRA 5KSUB 2X4NB 2ZWKA 3RWJB 1TYRA 3WOVA 2E6PA 4NUJA 4QRUB 3QORA 4OCYL 3HPLA 3VRLF 4PJXE 4TUKH 3MRPB 3SPGA 5DUPL 1DVSA 3HI6L 4PD4J 4JQXA 3V10A 5K59F 4X8JB 1NCCL 4U1HA 2IF7A 2IBBA 2VLKB 2GY7B 1BF2A 1X5JA 4M62L 3O4LE 3N44F 4PJXF 1F90L 5JQHC 4G7VH 4NX0A 4PU2A 2FATL 5D93B 4J3OC 3C5SB 4JHUA 4NO0A 2VDMH 1MCQA 3AU0A 3JWDH 2WSPA 3KNBB 2R69H 4ODXA 3CFCH 1WT5A 5EN2B 4M3JA 5C0ND 3IFLL 2JI3A 3JV0A 1L7IH 3RNQB 3IE9A 1R1CA 2WBKA 1X44A 2IGFL 3FK3A 4WENB 3SDYL 3C6LD 3FCGA 4IYKA 5E08L 1IO4C 3T3MF 3RL1A 1SOKA 4UZUA 4RRPM 1R5IA 2PP9A 1ZEAL 2QGCA 4H88L 4M7LH 3QIUD 4X5XA 4X6CA 3OKOA 1UT9A 4AVJA 3OAZH 3M7OA 4GSXA 4E5XG 2FQGA 1IGJB 3KCPA 1T5WB 3P69A 2B39A 4AEHH 3QCUL 3EH2A 4NAMA 3HI5L 5E8NB 3VM5A 3MNZB 3MRNA 5GS2H 3CFIC 4PR5B 2OYLA 1B90A 3VWKB 1RZJH 1ONQA 3QIWD 2KZKA 1KN4H 3NGBB 2YGPA 3CAFA 5HTSA 5DD6B 1LDPH 2X6CA 3BH9A 3WFCL 1KLGA 1A2YB 4CJ0A 3BSZH 2VLRB 4YHYB 4P5KB 1VKXA 4LSSH 2W9EH 5E23A 1UB5A 3S37H 4PHXA 4HG4K 1KTRL 2ZOKB 4QXUH 1SYVB 2UZYB 5LB1A 4HOZA 2HMIC 1F8TH 4U1NA 3BP5A 3HS9A 2QGBA 3FQ1A 3PWPA 1OAQL 5IR1A 5AB2A 4XMVA 5AD0B 1H9VA 1I3VA 4GG6B 2Z1KA 3O9WD 5FF6B 1JE6A 1KGWA 3HE7C 4CC0A 5IEHB 3QDHA 4IGBA 1LVEA 1BG9A 2BNUB 2H1LM 2W94A 3L48A 3A4EA 3DJSA 1MJ7H 1NM4A 1SYSB 1WUNT 1CFVH 3CK0H 1QW9A 5I17B 5A2KH 1INQB 2WNXA 1CTNA 4RMQA 1TMQA 1J0HA 3JYCA 1PDKA 1OB1A 3KR3L 4TQ8A 5IEKB 4HJTA 5K9OB 2E7LA 4XNMB 3SODB 4A7SA 4ZUSB 3FBQA 3H0TB 3UTQB 1D6EA 2Q76B 4WW1B 5FHAL 1V3LA 3MNWB 1B3JA 5DJ0B 3R8BB 5JOFA 3L16A 1F6LL 4G9FB 2CD0A 3UBHA 1XGUA 4I5BA 3FFCE 4CMHC 4UQ3B 3B2XA 5BRZE 5C0AD 5CLTA 3TYFB 4NFDA 3HN8A 4Z76A 1FV1A 1GS6X 2VUYA 2QKSA 1YAIA 3QI9A 5H35B 3ZKXB 5L4MA 2NT1A 3N50A 4KK5D 4XWOD 4ESKA 5HYSB 1OARL 4QTIH 4RMWA 2L7QA 1ZSDA 4MJ6B 1IAOB 4BXSV 5JXAH 2EYRB 1RJZB 4H4NA 4IIQB 2VRKA 4W68A 1QFUH 3EOBB 5AVVB 4IMLA 5F7NC 4QYOB 3L45A 2JCCA 3C12A 4P46C 5JORA 4P9ML 4AIXA 3VE0B 3ZJAA 2NLJA 3L3IB 4FNLH 4PVNA 1AD0B 1AO7D 2CPCA 4OFVA 4FJ6A 1XF1A 1ZRUA 5H8DA 1S6NA 1LK3L 2ERJB 4RA0C 3IDMB 1BM7A 5F96L 4BGLA 5IJCC 5DJ2A 2P3YA 2A83A 2I26N 3B4NA 1WVZA 2DM4A 3V4PA 1TZIA 2WQUA 3MUHL 1U95A 1BMWA 3AB0B 5DJZA 4YO0B 2IFFH 3HS0C 3QUMH 2CO1A 4OZFA 3PWVB 1XH0A 3V9EA 3D7PA 5CR8A 4U4BA 1EEYA 1T1YA 1F4YL 2NW2A 3K6FA 4ZFZA 3ZN6A 4AMWA 2V2XA 3WN5C 1JFQL 4GLRH 3NJKA 4CW1A 3MVSA 3ATDA 1FNGA 1BQRA 1OO2A 4I3SH 5EZLA 4H0IA 5E9NA 4X7FC 3O11B 3Q6GL 4TLUA 4PRAA 2ZAHA 3TBVB 1AKPA 1HWWA 2QHRH 2APFA 2GK0B 1I7TB 3P40A 4WI7A 2WUCH 4HCGA 2ZUVA 1AC6A 4HK3N 2JKWA 3FT2B 4KXZI 2XTJC 3QRBA 2Q3ZA 1IMHC 2B59A 4A04A 1XAUA 2FX9H 4JFXA 5TDPA 4K7PY 1U58B 4L4TE 4GKSB 2H3XC 1XH3A 3EAKA 5E1QA 5KTEH 1GZHC 1ZGLA 1BV8A 3RZCC 4HGKC 1TVHB 3FFDA 4PY8J 4HZ1A 4OM0L 4QCIB 4Z7NE 5EBGA 4UINH 4Y7OC 3HJEA 4HCRA 3ILQD 4R7XA 2HT4C 4JFZL 2J5LC 4URTB 3FQWA 3E8UL 3QYCA 2DQJL 4S1QH 2BXZA 4ERSL 1FIGL 2NSMA 1CXHA 3NFNB 2ZCKH 4X7TA 1FFPB 1NAKH 5AOIA 2YC1B 2DQTH 4XH2B 4CVZB 4K55A 1I7ZA 5EU6D 1YJDL 2AJSH 3BZEA 2DI7A 1ZVSA 3I9PA 1FDLH 3B9AA 1VAHA 4OZHB 5FYLE 4FA8A 3FN3A 4ES9A 2MIZA 2H26B 4TN9A 1CE1L 3V79C 3II3A 5I24A 3D3VE 1UB6B 2HA1A 2VLMD 4BK5C 5A6IA 4U1MA 2PW2B 2F2HA 4U6TA 5KVDL 3EJYD 4HOWA 1SOXA 4RRPA 5BQ7B 1NUGA 2DDQL 1C16A 4P57B 5IVOA 1EFXD 4N4YB 4KPHH 4KKZA 2H6UA 1AHWB 1ZK5A 4O2CA 3GQFA 1KGCD 2FJHA 4KXCA 4XBPB 4P59L 5D6CB 3WJLA 1MHPL 2X4PB 4GXFA 4JY6A 5KANG 3C6LB 1SBSH 4X4MA 2DEYX 4JRXD 2D03L 4O2FB 4OLUL 4IBUA 4POZC 3CXDL 4X5XB 1P1VA 2N1TE 3OJDB 2TSAA 3QIUB 5IVZA 4YBLC 2V2WB 2APBA 2O5YL 3LV3B 2CRIA 3L4VA 1CZ8H 3HNVL 3PWJA 1C5CH 2EDLA 4ZD3L 3EGXA 3MRNB 4FTDA 5MEQA 4JPWH 2BVYA 1IEAB 2PCPA 4XWGH 3X1FA 5FKAA 1BX2B 3F84A 2ED9A 5CU9A 3FRUB 5K9KB 1JPSL 3EOAA 1E8YA 4FZEH 5I6PA 5IQLA 4LKCA 2DWDB 2R0WH 4H1LG 3V8CA 2GT9A 1CICC 4N0UA 2L8AA 3KM1A 2KQMA 3WXWH 3CX2A 4JGMA 3DOSA 4HZLB 5CN2A 3QUGA 5F7EH 1E5AA 4WU7B 5K39A 2VQUA 4X6FB 4ODWA 4UOQA 1C1EH 1XCTA 1JNLL 3CVHB 3VGBA 1LE9A 2X05A 3MXVH 4QDGA 5ANMA 1TOXA 1T7YA 4PMFA 4WVRA 3LNHA 3VQMA 1CI3M 1AQDA 3P9MA 4H0GA 3O9WB 3W5MA 5IB4A 2EIMB 4X6CE 3B9KA 4JFDA 4OV6F 4HG4J 3MCLH 3HS8A 5EIVA 4K4KA 3UDWC 5AKSA 3VRIB 4E9RA 4TULL 5GHWH 2FEJA 2D7TL 2Q2LA 4XRCB 3RX8A 3L1FA 4J3OH 2IOOA 3WEBA 4FG6D 3PV7A 4J4PA 5AVRB 3ZQXA 3GBNH 2JKNA 4LSPH 1HYSC 2OI9C 4X6CF 1NCWL 1LHZA 2PPCA 2MCG1 3B8SA 2WAHA 2L7JA 2H1XA 4LOUC 1CF8L 5C0AB 2VT0A 3MBXH 2ED6A 4KROB 1FVDB 5L6YH 2YFOA 2VR3A 5JHDD 1IU1A 2EEFA 1AYOA 4FQ1L 3ARED 5ICXA 1ZK9A 2AQNA 3NYKA 4LLYA 5D5ME 1PMYA 3WL9B 4G7RB 3A22A 4OZ4B 4Y0GA 3V55A 1A7OH 2BIPA 1S7WB 4HHAB 2FX7H 5TDOB 4ZX6A 1UA7A 1I3UA 3N3EA 4PBDA 5AVXB 3ZDYB 1QFWM 1Q72H 4OZIB 4Q9QL 2C9XA 4KXDA 3F04A 3K74B 3ZE0E 3WELA 3D5OF 1L0XA 2YPLD 2ATPA 1AO7B 4TNWF 3L6FB 3R7RA 4MCYA 3U82B 3UADA 3WGUB 4G7YL 2W38A 4HS6A 3BN3B 1TCRB 1FL5A 2A83B 2CHDA 5D5MF 5DJ2B 3TBBA 2FQDA 3OKEB 3CUPB 1HSBA 4OV5B 4HQQL 1UXSB 4GAYA 3U83A 4Y16D 3VXRD 5KYUB 3MBED 4XAWL 3OKNB 5DJZB 1G6VK 4FQ2L 4K3DL 4WW2C 3RAJL 4DGYH 4RQQA 2BP0B 4ZOBA 2SODB 4NKMB 1NLBH 5IKCA 3LZOA 3GHPA 3SBPA 1XF3A 1S9XB 1HZHH 2J25A 4E42A 1OSEA 5EBLB 4IBQA 2PYED 3QQDB 5DD5L 5D1ZA 2LFEA 3NIGB 2R0KH 2BFVL 3FTUA 1A4KA 2VZOA 3NK4A 4KC3B 5DZNA 4MDIA 3T2LA 4BWWA 3SQBA 1DHKA 4TMPA 3LRKA 2V0AA 3MODH 4RMVA 2G5BB 2DQUH 2XZCL 1GOFA 1N0LA 3BIKB 2X4RA 2C9PA 3QEHB 3HB3D 1TKWA 3A67L 1KB9K 4ZMXA 3K3QA 2LU3A 3HG1E 1DVYA 2DY2A 3QQ4A 1UVQB 4XN1A 5JOPE 4Q6IA 1UUNA 2B5IC 4IJTA 4JFYB 4JFQA 1I1YB 1TJIL 1YMMA 4KRPC 2JQAA 4LAQL 1IX2A 3BOVA 3D39E 2JTYA 1DE4A 1T0MA 3SE9L 4J12A 2UY6B 2BZDA 3ZSTA 1JGIA 3V5KA 3GXTA 2OCJA 1KTDA 4G71B 4ANUA 5AW8B 5I1DA 3ARGD 4W6YB 5EIQA 3BZDA 1ET5A 3FQWB 3ZL4L 3CU1A 2WOYA 3AXIA 5DI8B 5CWSB 3UPRB 1DQDH 4YEFA 3CZNA 4L9LB 1VF5C 2XWDA 3L9RA 4QAWA 2VDRB 3KLAB 1P4BH 2WLHA 4S2SA 4JZJB 3QDMD 5AG8A 5EU6B 5J8OA 5DT1L 3TCXA 4OJFL 2RH0A 2WBJD 3Q8FA 2QQKL 1NIEA 1BYNA 4EUPA 1QWNA 4NOFA 2VDKB 3BRDA 5FYLH 3U2SA 5T3XH 3VWJB 4F5CE 5FOJA 3FTVA 3LD8B 2IPUG 1J1PL 4WHTB 4ODUA 4MZ3A 1HFUA 5ABZA 5IMLB 3DX0A 3GO1H 3BW9A 1NTDA 1G7IB 2P5PA 2X9ZA 3TPUA 4Y1AB 1CG9A 2R39A 3NSXA 2HRLA 1KF9B 5EPMA 1EUTA 2HN7A 5C0BA 3SYAA 2AJ3B 4GAGH 1BFVL 1FPTL 4XNAA 3BKMH 2AABL 5EBMA 1F3RB 4JRXB 5IVZB 1QA9B 4LNRA 3M07A 1YNKL 2DMKA 3QR0A 2ZUXA 1KIPB 3RJDA 3QHTC 4PIBA 2J2ZB 4N1CA 1KJMB 5LBGA 2CMRL 5CN3A 4DP0X 2QLYA 1LP9B 1RK1B 3CVIL 3NCCB 4P2QD 4YR6B 1OAYH 2XOTA 4KAQL 1ASQA 1WIPA 4LLWA 1YJDC 1CFNA 3QA3A 5FHBH 1JYXA 1XXFC 3WMPA 3DOSB 4DKFL 4X7SH 4Z3JA 5I6LA 4DO4A 5FYKE 4OGAD 2VN4A 1HYRC 3DC0A 2LFGA 3HRPA 1NQBA 5I6MA 5D1QE 1D5MA 3ILPB 1HTYA 2CIIB 1FC1A 5F7HA 2YKLH 4FE9A 3GMMA 5GGRY 3M1BA 2FO1A 1CQYA 4HD5A 3S3SA 4JDZB 3GSXB 4MAYA 2UZIH 1MREL 4G1EA 2K4WA 4HHWA 4RGMC 3Q48A 4YQXH 1YEEH 3KWWA 1O9WA 3WFZA 4X9FA 5CMAB 3RX9A 3VO0A 3CZGA 2E27L 4AW4A 1KTJA 3V6OA 5HY9B 3ZUNC 3OPZH 2VN6A 1ZLVH 3WHE1 2F53D 5JYLA 5TPWH 2Z9TA 1J9TA 2QSCH 1NIFA 1U3HB 5LWYL 2ZKYA 3PP3K 4KO6A 4AT6B 4HSAC 5GZNC 3W81A 5E03A 5LCVL 3ZHKA 3KXFE 3VI3E 4FEIA 2FGWL 5ANME 3MC0A 3FO1A 5JHDB 4GNKB 1O9VA 3TNNB 1TF4A 5BRPA 1QD0A 2B08A 3LB6C 4J28A 3FQXA 3MRBB 2NX5E 5DUPH 3U4AA 3HI6H 4JFDE 3ZRSA 1OSYA 1G5GA 2P48B 4UU9A 3V7AE 1F6AA 4LF3B 1T03H 2XG4B 3II2A 3D33A 3WY3A 3T6WA 1XGPA 2ORBH 3B7UX 3NZ8A 2GBUA 3FAXA 3O3BB 4HUUB 2ARJA 1PZCA 4FQIH 1E3ZA 4L8DA 5MI0B 5LQBL 1I9RH 5DLML 5EBWB 4JRFA 4KXBA 4B41A 1BD2A 3ARDA 3L2LA 1AYRA 2EH7L 4X5WA 4AYEC 3VXTB 3IPEA 3IGLA 2P8PB 4MA8H 2VZ1A 1VEPA 4Y16B 3VXRB 5JZ7D 1U8KB 2FIRT 2I7SA 2VN5A 2E86A 2W0FA 3MBEB 4KI5E 1GGTA 4HPOL 4M61A 4BFEA 5BO1L 1FAIL 4M1GH 2XZQL 1UD8A 2VOTA 3O3AA 3BP6B 4PJHB 4ZSOB 4HETA 3RFZC 2LQRA 2QQLL 3E1ZA 4A66A 4QRTA 5D72H 1OM3L 4CSSA 1NCGA 4G42A 5D2NC 2NZ9D 5ALCH 4POYA 3DO7B 3SOBH 1OGPA 3C60A 2VSKB 5FYJL 4JM2C 4JRYD 1T0PB 5ACZB 4KI5F 4TQIA 1JGLL 2FLBT 2GC4C 5IQOA 1JVKA 1FFOA 1CCZA 1E5UI 4C47A 4DVRL 3BZFA 5E4AA 4MD4B 3R0MA 1XB8A 3GMRA 4YL4A 1OW0A 1GCFA 5IY5B 5BMFL 4HS3A 1OM9A 4W9DC 1QVOB 5CBEB 3ETBF 1ZWIA 2XQYG 2H8PB 4XNZC 2DQEL 2G75B 4BFIB 3KBEA 5E24E 2NY6D 1A9EA 4IOFC 4OI9A 4ZDHB 1CO1A 1HINH 2QT6A 4APQD 5I2IB 2HTKC 2DOCA 3MRDA 3WY4A 3LS5L 2NW3A 1WFMA 1Z5YD 3SGDI 1ND0B 1R24A 4MNHA 1KB9J 3VG0L 2J6EL 1E9PB 3MRQB 1T3FA 3GNML 1E27B 2X3AA 4N8VB 3ZDZE 1WZAA 3ABLB 3ARGB 3NJJA 1JG9A 3HAEH 4OLEA 5HHVH 3DRQB 3VQ2C 4ELKA 5FO9B 5I8OH 4MMZC 1NC2B 4P9HC 1TZ8A 3RDTD 5HGAA 3AMKA 3D08A 1O7SA 1QG3A 4B96A 1IAIH 1A9BB 3ZDZF 5ADPH 3K71A 4P07A 3VD2A 3QDMB 5HDBB 2DBLL 1KOAA 3BH8A 3SKMA 2XY2A 3PRZA 4P5TA 1HH6B 1MIEH 4PJ8C 2X2JA 2GQHA 4CKVX 2WBJB 4CKQA 4ZMAT 2AQRA 1SRDA 2ZUQB 4OLYH 3JV6A 4WEBH 5C0CD 5KVEE 3P9WB 4PRDA 4KNQA 5CZXD 4CMMB 3HLAA 4F58H 4Z1PA 2JXMB 1CG9B 1KEGL 2FJFA 1MEXL 2Y5QA 5LG1A 2Q7YB 4QO1B 5HHMD 3S8GB 4XP5L 3RNKA 3PDDA 1YEKH 2MH4A 4S0TD 1KJ2B 1OARH 3H9YA 1ZDSA 3RJQB 5CCKH 3TT3H 4LSQH 4O5LL 4BKLB 1N6QL 5C7XH 5JW4M 1EDHA 1HEHC 3O6LH 2Q7AA 4PBXA 4L0ZA 4QHNA 5KSAC 3EJQA 2ZOWA 4ILDA 4LEXL 4M5SA 4F7TA 1AG0A 4X6DE 1EPFA 1KZYA 5FUCE 4BBWA 3FZUD 3C5ZC 3DX7A 1HNGA 2F58L 4P2QB 2LLGA 1NMBL 4Z78A 2IAMD 2JLLA 2P4AB 4KZEL 1LK3H 4Y4KA 3G9AB 3I3DA 1BFSA 1CLVA 2DLIA 3T65B 2VMJA 2Y4SA 4M7JL 1ZLUH 3S5ZA 3STZA 1H9DA 4M8RA 2DYSB 3EDEA 1M6OA 4R0LA 1OV8A 1SHSA 4U3SA 3FT4B 4MXQD 3TJEH 3RWGB 1WYJA 5C71A 4X6DF 1QAWA 4NIYE 4N2BA 2ZWYA 3ROLB 5MHSE 3MRKA 3QXDB 4GPVA 2AXGA 2PXYD 3LPOA 5FYKH 5TDNA 1W72H 3RVWC 2MKLC 4NBYB 3SCMD 3LVEA 3L3HA 4JHBA 4IHOA 4PJ5E 3VQLA 4Z7WE 1N3NB 4P3CL 3VFUA 1PLGH 1JFQH 3VXUE 1UA6L 2JELH 4WI2A 2GYSA 4PVBA 3MTXA 4AYSA 1OP4A 1SQ2N 1KENL 4GRLC 4I0CC 2IOIA 3QFJA 3C08L 1MCOH 4YDKL 3DWTA 2ITFA 3KEHA 1ACYL 4G83A 4GO9A 2D9QB 1DO5A 4UBDD 5T1KA 2Q87A 4DVBA 4Z7WF 4R83A 4TTGA 1EBAA 3N41B 5CAYB 5DWPA 1EHKB 4E0RB 4DN4H 4L8SB 1XH2A 2W95A 2F53B 4QHMB 1AGCB 4OW6A 2OMNA 3HRZA 1E3XA 1U8IA 5F3FA 4R4FL 5EN3A 1VA9A 3LEXB 4NCC2 2EUZA 3DJTA 5IF0B 3B1TA 5TD4A 1IEHA 4KK9D 1BF5A 2ICEC 1BFTA 4JKMA 2WWNA 2Y0SA 4X4XB 5IB5B 3KPTA 5F3BA 4D7PA 3EG9B 5DUBA 1S7UA 3DTUB 3OKLB 2HFGL 4FTVB 4OD3H 4CN1A 4E9TA 2DTML 1F6AB 5L2JB 3A4DA 2DQJH 1NUDA 3BGFB 3FB6A 5I6KA 3FO2A 5M7QA 1T83A 1WAEA 1F58H 1EAPA 3T4YA 1N2RA 1CFTA 2DN7A 4HBQA 15C8H 1TZGH 3IN0A 2HZHA 1YJDH 4Y4FC 3CHQA 4FLOA 5ID0B 2ESVA 5E1HB 3AQDA 2BS71 5DCCA 3BLBA 1QSFD 3WS3A 3ASNB 2ZWZA 4LOVA 1J5DA 3L5JA 1JXDA 4LSUH 4XC1L 3VXMD 2CZNA 1EAQA 3QHFL 5IBTL 2VR4A 2V33A 5EOCL 3GUTA 1GTNA 5D2LE 3L5IA 4AYFA 2PWDA 4PG9A 2CDGA 1S7XA 1W80A 2PN5A 5E99H 1HC1A 3DVGA 2VWEE 2XVKA 4DZ8B 4JO1H 1UFUA 1RUPH 3FUDA 1N9PA 4FQJL 2WUBL 1BIHA 2D03H 4OLUH 4DCQB 1HWGB 2G5UA 1PNDA 4JRYB 5CJQL 3MJ6A 4KQ4H 3DGDA 1QTSA 5KOMC 3DKHA 1P1ZB 4GT0A 2O5XL 5D2LF 3AG1B 3Q5OA 5DZAA 4EI6A 5B7EA 2P8MB 3HNVH 4ZD3H 4LHUA 2AQSA 2GITA 4HBCH 5JLZB 2QMKA 4L8BB 4G9DB 4NXSA 2IG2H 1GIGH 1MAMH 3I9AA 4UDUB 3IMRA 4R5VA 3H6JA 4HWNA 3GBEA 1KJVB 3TBTA 3ABGA 2ODIA 2RR3A 1BQHA 2IANA 2NY6B 1AACA