3L9YA

Crystal structures of holo and cu-deficient cu/znsod from the silkworm bombyx mori and the implications in amyotrophic lateral sclerosis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
PAKAVCVLRGDVSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFGDNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDAGVTKVSIQDSQISLHGPNSIIGRTLVVHADPDDLGLGGNELSKTTGNAGGRIACGVIGLAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in amyotrophic lateral sclerosis
doi rcsb
source organism Bombyx mori
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3l9yA00
1L3NA 1UXLA 3F7LA 1COBA 2R27A 1E9PB 1EJ8A 4A7VA 1B4TA 3GQFA 3CE1A 4BCYA 2WKOA 2APSA 2SODB 4MCNA 2JLPA 2WKOF 1PZSA 2GBUA 4MCMA 2ZKWA 4OJAA 1SDYA 1FUNA 1DO5A 2VR7A 3KM2A 1UXMA 1SOSA 5CU9A 2ZKXA 2GBVA 2Q2LA 5KBKA 3KH4A 3F7KA 3KH3A 1S4IA 3H2QA 2AQNA 1IBBA 2ZKYA 1Z9PA 3L9EA 2VR6A 1PU0A 4OH2A 3PU7A 2NNXA 3RE0A 1OEZW 2WZ5A 1Q0EA 1SXNA 2C9VA 1OALA 1F1AA 1E9PA 3GTVA 2LU5A 3KBFA 4N3TA 1TO5A 3HW7A 1N19A 4BCZA 1CB4A 2AQPA 2Z7WA 3K91A 4BD4A 4A7GF 1BZOA 1Z9NA 2WWOA 2VR8A 2K4WA 2Z7ZA 4A7GA 1BA9A 3HOGA 3MKGA 1DSWA 2AQRA 1XTLA 1OZTG 1E9QA 1OZUA 2AEOA 1JK9B 2C9SA 1IBHA 4A7TA 2WZ6A 3SODB 4A7UA 4A7QA 1CBJA 1AZVA 1P1VA 2V0AA 2WZ0A 1SXAA 4B3EA 1E9OA 1EQWA 1IBFA 2C9UA 3KBEA 1KMGA 1JCVA 2WYZA 3S0PA 1N18A 1SXSA 3L9YA 2WYTA 2E47A 1OAJA 2WWNA 3QQDA 1F1GA 1SPDA 2AQSA 4U4IA 2GBTA 2XJLA 2JCWA 4L05A 3ECUA 3H2PA 5KBMA 1XTMA 3ECWA 2Z7YA 2AQQA 3CQQA 3GZPA 4N3UA 1F18A 3HFFA 2XJKA 3MNDA 1RK7A 1TO4A 3T5WA 4A7SA 1U3NA 1MFMA 1SXZA 3GZOA 1IBDA 2AQTA 3GZQA 1ESOA 3CQPA 2E46A 1SDAB 1SRDA 1YAIA 3ECVA 4FF9A 5KBLA 3KM1A 1SXBA 1PTZA 1QUPA 1SXCA 2AF2A 3LTVA 1JK9A 1E9QB 1HL4A 1IB5A 3GTTA 3QQDB 1YAZA 2Z7UA 1B4LA 1YSOA 2ZOWA 1E9OB 1F1DA 1HL5A 1XSOA
chains in the Genus database with same CATH superfamily
1M05A 3IKCA 3N1PC 4X9IA 2DQDL 2GY7B 3VXMA 2VDNL 2EKSB 4KQ3H 2ARJB 3LS4L 4G6AD 1ACYH 3HRPA 1VAHA 4KMLB 4F7MB 1DQQB 2QQNH 4PR5A 3O11A 2YA0A 1E4XI 4KK5D 1WIUA 4CVWA 1A2YA 1GKOA 4E9VA 1WZAA 4LOFA 4HBCH 4MA7L 4E9TA 5EEWA 4E42A 1J1XL 4ZI8A 5SWZD 3QRBA 4G8EB 4KZ0A 4FMKA 4DQAA 1E50A 2Q8AH 5F0LB 2R9HD 3QG7H 2KI6A 1NBYA 2W92A 4LHUG 5AL8A 2QSCH 1IX2A 3TO4A 3W0WD 1NMCC 4K7PY 4IOIB 3CFJA 1PLBA 1JZEA 3REVA 2MQCA 2YN5A 4PJIB 1A14L 2OYLA 1AS8A 5J1AA 2KZBA 4AYEC 5E4OA 1DCEA 2EIKB 3GHEH 5GIRB 4WU5A 2QGDA 4XGZA 1XH0A 2VQ1B 4HYTB 2JB5L 1DJSA 2J8HA 3X11B 3JWDC 5I76B 3TZVC 3HHMA 4WENB 4JFQB 4J3TA 5C08A 3Q2CA 1PY9A 4G80A 4WO0A 3W81A 4Q9RL 3ULSA 3B9KB 3D05A 5ALCL 1SN5A 3BX7C 3OC8A 2QFRA 5A7BA 1IKOP 3UPCA 1LXMA 4FQLH 3NZSA 1W72L 3NZUA 4YHZL 3D9AL 5TE7H 1UVQA 2ZOKB 1XGUA 1RIUL 1MJUL 4HAGA 1R3KB 1SJXA 2C9PA 4KROC 1A3LH 3GZKA 3PQYE 4KXDA 1QRKA 3KYOA 4JKKA 1ZEAL 4K94C 1A3LL 3K2IA 3QZPA 3D8MA 4EN3D 1DUZA 1EVUA 4OZFA 4XNUL 4GRLD 1MCPL 3DXAE 3MC0A 5KZCB 1O0VA 4Y9CA 5AVQB 2DQEH 2ATKA 2FGZA 1BMWA 1C7SA 3BRFA 4QOKB 5JUEL 1G7JB 4FADA 4OGYH 2DI8A 4IYKA 4APXA 3MX0B 1CI3M 3CVBA 4K3EL 1EO7A 3JWOC 4M6OH 3STZA 4FFTA 5JXAL 2OL3L 4R90L 2A77L 5AZ2L 4BRVA 4DUWA 4P2RB 3VO0A 2OMBA 4ODHH 1U2YA 3I50H 4PS3A 3ZJAA 4JPKL 4DERA 3I50L 1T21B 3GBNH 3V7MA 1ZTMA 1UKSA 4XPGL 3ELAT 4V1DA 3VXPB 1SQ2N 2Z35A 2O5YL 4FI6A 3GLEA 2DMGA 1FNFA 1FZKB 4XP5L 4DEUA 3HRZA 3RDTC 2CE6A 1YEKL 1HHHB 5IVZA 4W9CC 2PP9A 4ETYA 1ORQA 2YIHA 2Z1PA 3HC0A 2XQBH 3O8XB 3TO2B 1VFUA 2AXJA 3NPSC 3P4LA 1S4IA 4B5ZA 3ZKMC 4TUUA 1AE6L 4JN2B 3CBJB 2WYIA 1KELL 1GYVA 2VRKA 3B37A 2MCPL 1AGFA 4MNHA 2VM3A 5F7NC 4HF5H 2JKNA 2YKLL 3ISYA 3CXDH 4LEOB 2IAMD 5ICXA 4L8CB 1T04B 4OV6F 4RDQF 5GRJH 3KCPA 3I6KA 1BPLB 1BYNA 1EVTC 5HTSA 3RUGE 4LF3A 3I75B 1OWRM 1WCQA 3L08A 4PJ5A 1OZTG 1RUQH 5IBLD 2XPZA 3ZZQA 2FGWL 4R9HA 3U83A 4WV1B 4N28A 4PJAE 4UQ9A 4I48B 3I3BA 5AAPA 4J3OF 1I3RB 3K7UA 3OKOA 2R7EA 1HT6A 4OT1H 1I1FA 5HYQA 3ATEA 4X98A 1WTLA 3FO9A 4K3GA 2R56H 4MMZA 3HR6A 4NUMA 2XFXB 1YYMH 4PJDF 5DS2A 4K94L 5LWYH 2PN5A 1VFOA 2G2RB 2WAQA 1JIBA 5L2KD 4G6MH 3IGLA 1BECA 1ZT7B 1CG9A 4NNPH 3U0PB 1NFDE 2XJKA 4LMQI 2VAAA 1ASQA 4IS6B 4JM4L 3QJXA 1IQWL 1PZAA 2HLAA 3GKWH 5IW3A 3UX9B 1REIA 2H2SD 3J7HA 4GIOA 5GGQL 5GISL 4JFEA 2GIYA 3GMMA 3MRGB 4W6YB 2KERA 3BXNA 3CX5K 1RVFH 4YL9A 1A4JA 4EZLA 3TO4C 2XWJA 2J4WL 2VDQH 1OAKL 1GL4B 1EV2E 2BMKB 4OV5B 4UINH 2J73A 5IB2A 4NOFA 2G9HA 1CFTA 1GPOH 1WUNT 5HDQH 4MXQD 1GGCL 2Y24A 2BY2A 4DKFL 5C2BL 5EEYA 2AJXH 2X4OA 4UT7L 1RFDH 2YGQA 4Y2DB 2WC7A 1LO4H 2M8XA 1ZXQA 4BDVB 2XWXA 3QEHA 3L9BA 1UWXK 1Q1PA 3C9NB 3IDJB 2XRAL 4POUB 5KBDA 1NC2B 3U30B 4PI0A 3MUJA 4O58H 3ULVF 1IEBA 3HZVB 3L16A 3NIGE 3JVGC 4XVJL 2NW3B 5B8CB 1QP1A 3BFQG 2PYED 4RISH 2JQAA 3EO9L 1MDAA 1QLFA 3WJJC 4PJCF 1T5XA 2GBVA 4YDMA 2IH1B 1IAMA 1WG3A 2ZP0T 3VD0A 2OCJA 1MXGA 2G5UA 4OCNC 1JPGA 1KSRA 4PB0H 3SPVA 1XBDA 4LRIC 4E41D 1U8NB 4HCRH 3P4MA 3FQTA 3F7VB 1ZK5A 2XZQL 3VXRA 1FQ9C 1UUNA 3RDTB 4ELMB 4ZSOE 2ESVD 4HFUL 3Q05A 2YLHA 3GLDA 3GF8A 2X10A 1OF0A 5FYJL 3QJOA 1DSWA 2WWMD 4XX1G 1BJ1H 1BVKA 4PGEB 4BQCA 5BVJA 1EDHA 1FL5A 4NBYB 5FFOA 4PV8B 3JBG7 3JUZA 3EFOB 3OSKA 4LRNL 4PBXA 1AZVA 3WJLA 5ID1B 4ZPVB 1IL1A 2C34A 4ODBD 2B2XH 2NUTA 3A0OA 4Z0BL 5ISZE 1L9OA 1IGIH 2K0RA 3KYMB 2XWTB 4N1HB 3WNIA 1U6AL 2PPDA 1L9MA 2WXHA 5C0JB 4R2GB 1XB8A 4OJYA 1WEJH 1IAOA 4U1HA 3BRGC 2OTPA 1YPZF 4QHKJ 1QVOB 2EQDA 4ZMZA 5JYMA 1U0QA 2EINB 4MA8L 1MCWM 1L7IL 2NY1B 3MCKA 4HUVB 1T20A 4BFKA 5HVGB 4PJ8B 4KMTH 5KANG 2FECI 2BSTB 3S8GB 4KJWC 1QTYT 3W2DL 3ZL1A 4KMTL 5IROA 5EBLB 3QIWB 2WIIB 2EIBA 4XMTA 4AIXA 1UB6A 1YQVL 9CGTA 1KCLA 3RTQB 5JHAA 2XTJB 2ZCZA 5AOKA 2L7JA 3RTQC 1S5IL 1DDTA 4ABQA 3U1SL 1ILSA 1GC1C 4MJ4A 3RI5F 2C9RA 2UY7A 1UC6A 4TTDC 3OMAB 3SB3A 3SDAD 2BIHA 1O75A 2X2YA 1ND0B 3IYLW 3WE1A 1BP3B 4JZOA 4M5TA 1J1OH 1I3GH 2GKIA 3OGCB 2A4CA 5GGTL 4XODA 2NNCA 4C4KO 3PGCA 1B4TA 2WQUA 4APQA 4WI9A 2XHNA 2APSA 2AERT 3ZZLA 3RJOA 3NJMA 1BEYL 1NMAL 4LCYB 3FUIA 2FH8A 2OSXA 2WIMA 4H8QA 3R7RA 2D4FA 2PCYA 2QPUA 5DFAA 1NWOA 5D96C 1HKLH 5DWPA 3TP4A 4XCCL 4E9RA 4R2GC 1EO8L 4O02A 1T7YA 3QEGH 3JWOL 1KDJA 1NM4A 3INOA 3KDMA 4V33A 4AYFB 4BKLA 4DO4A 4FS0A 1U8NA 3UYRH 35C8L 3UL4A 5CLTA 4DCQB 1ACZA 3RE0A 3PWVB 2BIIA 2NNAB 3VGDA 4WJ5A 2B39A 3Q6FB 3GBML 1BMGA 1KPVA 2XIDA 4N3TA 2A9CA 1QO3A 2J6WA 3F12A 2EDJA 4HCRA 5EZPA 3WHE1 2W95A 1MHEA 4V2BA 4YSPA 1RPQA 4X8XA 2EXWD 3P2DA 3WIFB 2DQMA 2JJWA 3SGJA 32C2A 4BE6A 1EFQA 1XGRB 2E86A 5JOFB 3BCFA 2DS4A 3E3QE 4QWWD 3RB5A 4Z7UF 4UU9B 4TQHA 5LAXA 1G94A 2AMGA 5B38B 1ITBB 5IHZA 4ZO7A 3DV6B 4B9ZA 1F3DH 2C9UA 5DHEA 3V0JA 4HMEA 4AUJA 5BS0D 1I85C 4XXDB 4AW7A 1E4XL 4NUGH 1OT1A 4YC2C 4Z7AA 5J11C 1XCQA 2F7IA 3F01A 1TVDA 4FABH 4AYBA 3MU3A 1NCWH 3M7OA 4L1TA 3KEHA 1CJYA 1P4LB 4JY6B 3B43A 4X7SL 4Q6YA 2GJRA 1J8RA 5F7EL 4TNWF 3VD4A 4IRJA 5LO7A 3J8F7 1WT5C 2B0SL 4DPBX 5B7MA 4M6ML 1FVDA 1AMXA 1KYFA 5E23A 3ZHNA 1Q9WA 5MEOB 1PNCA 1SM3H 2BVYA 5LBSH 4KOCA 4M6MH 4QXVA 3L4YA 1LHZA 5IT2L 1T0MA 4WK0B 4WSJA 4R7LA 4MJ6B 4W9DC 2YMXH 3MLWH 4QHMB 2YSSA 1J87A 2OP4L 4EN2A 4UQBA 6PAZA 1YEDA 3IFNL 4QR7A 4QRTB 4YFDB 1WHOA 2DICA 1FNGA 1IGCH 3CFIC 3IU3A 1G7IA 1WV7T 4JFXA 4P2RD 2E6QA 4ZMAT 3GSXA 4TNWK 3T3MB 4LASL 4PUBH 3FUKA 4GRWH 4L8BA 1AMYA 5EN3A 2ETWA 1MDTA 5E2UL 4XPGH 4JRYE 3RILA 4U1NB 1DFXA 5EBGA 3OBAA 4X6FA 4WV1A 3H42L 2HRHA 4AJYV 3PJLA 5E2UH 4Y5VB 3QUHA 4JB9L 1EMTH 2MRYA 3KGUA 2QQKH 4Y9GA 1NGQL 1I1YB 2WJ7A 3PWNB 4PGJA 4OCWH 4WTQA 5IESH 1WFMA 4KRLB 4P59L 1CLZL 1UXSA 4M48L 1WGOA 3CVIH 2NZIA 3QWQB 1RJYA 1E0OB 1R5IB 1DBJL 4LEOA 2K6ZA 4PMFA 4Q8BA 4XBPA 4XNMA 4MNHB 1R46A 5DHXB 2ALAA 5GS2D 4AKOA 4C4BA 4JO2H 3SQBA 2MCPH 3UDWC 1DBAL 5DQDL 3P02A 3LSOB 2BNRB 3MREA 1A0QL 3AS0A 4NYLB 2WZPD 1TJGH 2K78A 5JW3H 4HS8H 5E1AA 3WFBL 3CXFA 3L2NA 3ZDXE 4EDXA 2NPLX 3QIBD 5F3BA 5JOPE 1A6TA 4RZCB 1IIIA 5DRWA 1ORQB 2NXZB 4O4YH 4X9GA 3OXRA 3RZCB 2G2NA 4P57A 1GOGA 1CGSL 2BP8A 4V1DB 4Y5YC 3GMRB 1QFOA 5DD1L 3ALWA 3AUWB 2XZCH 1ZGLA 5HHNA 4K8RL 2D7OA 4FXKB 1EH9A 4G8IA 3L1OL 2Y5TA 2QTVA 3LHAA 4K8RH 1EAJA 3FQRB 2IIJA 4X99A 4Y1AB 4E0RB 4IJ3B 3K2UH 5EOQH 1ZD6A 3KPLB 3VFPA 4N5UA 4AI7A 4DZ8A 1GZQB 1OCOB 2H3NA 1L9RA 1T66C 3FUJA 3IDGA 2X05A 1O5DT 2XXFA 1I1AD 2UZXB 3DHUA 3MX0A 2VUYA 2ZG3A 3RTLA 2Y6SC 3BLBA 4CVZA 3PP3K 3EYSL 1QBML 4LPXA 5HYFA 1CICD 4N0FA 3N0PB 3QORC 4NQUA 43C9B 1GS8A 3B6SA 4JKNA 3V5KA 2BJMH 3VXUB 1WE5A 4HJGB 5LVEA 3MCYA 1KIQA 2BNUB 5AW0B 4DQOL 4X6EB 2XN9B 2AI0H 4LNVA 4G9FE 5ERWB 3V4VH 5FYLL 2D3JA 2EIMB 4B3VA 5EO9A 1CE1L 4K23H 1EWHA 4WFHD 5ITFA 2XXMB 3QULB 2WXGA 5I1EH 4ADGA 2XG5B 2DW5A 3GWJA 4PJEB 5F7FA 1ZLSH 4GAGL 3QARA 4LOEA 3FT1A 3BKML 3FAXA 4PY7B 5HYIA 2VLKA 1W72H 1D9KB 1W8OA 2B59A 1KBPA 1B0GB 2BVQB 3G9AB 3MGOB 4IU2B 4M7JL 3G04A 1I3VA 3QC5X 3QHZL 4HUWA 4ZUTA 3WUWB 3CGTA 3RIFF 5DDHB 5AW9B 5IM7A 2J1XA 3OKLA 1BEXA 2A1WH 5KJRL 4PRIB 5B21A 5FGBA 2DL2A 3D50A 4KKBD 1KEGH 4LCCC 3RX8A 4CC4A 1KJ3L 1TMQA 3F85A 3KWWA 4TNVF 2DQTH 3CX5J 5CEXA 2HKFH 4UT6L 4W4OA 4E9XA 1S7UB 2PR4H 3CN0A 4O2FB 3M7FB 1QUNB 2R0WH 2XKSA 3KVDD 2QLVB 3QIWC 4RQQA 1NBYB 4D9QD 2Y36L 3L3OA 4JRXB 3ZE1F 1CBVL 1XSKA 3OMIB 1QLRB 2X40A 3QUMH 1F3JA 4XPFH 3VDCA 1LP9B 2ZKMX 2MQGA 1CFBA 5I16A 1A2YB 2JWYA 1J8HB 3DXAB 3LQAL 4AX3A 4Y19D 5FCSH 3GSWA 1DQQA 1ZE3H 3LV3B 2P9RA 3NJKA 3ESNA 3SKJL 2BOBA 2X89A 3MRJB 4OLXH 3SSGA 4A7TA 2F68X 2V9TA 4ZMXA 4PRPD 4UM8A 3VB9A 3PDOB 1U92B 4WGWB 1WJ3A 2YK1H 1S9XB 3FT2A 1FE8L 4RMQA 3LVEA 3BWZA 4YHIA 1LO5A 1OARL 4YX2L 4LHUD 4H8WC 2JCWA 3ULVL 4JVPA 4YQXL 3BWAB 1NBVH 3NSFA 1OVZA 4O51A 5IOPA 4OZHA 1MCFA 1JGEB 3FT4A 4RETB 4WI0B 2N59A 4JFDA 1X5LA 4O2CB 3TNNB 3Q3GA 5D5ME 4HFWA 4OCSL 3EDDA 4FEIA 1J12A 3WFCL 4JY5L 3I9AA 1T80A 4XNBA 5LXGH 4I9WE 3MACL 1OTUD 1WQVT 1ZVSB 3L6FA 2GJ6A 4JDTH 1MFCL 2HX7A 4UNVA 5MEND 3C5XA 3CUPB 1AIFB 4YSDA 3OXSB 4ZNCD 3WNMA 1DBAH 3RGVA 2LU3A 1QUPA 2EEFA 1NGZB 5JQIB 1A6AB 3O6KL 3ZT7A 2XKNA 2E59A 1ETB1 2ZG2A 2NY0B 5BZXA 2HT3D 3IN0A 5DO8A 4WUUA 4F2MB 1LTXA 1RZJH 1BZEA 5LGJA 2VL4A 5C8JB 5DRXA 5FA3A 4LP5A 2ZTBA 4D7BA 4UTAH 1M53A 2IQAA 3BAKA 1QFWL 3VUAA 1G9NH 5C7ZA 2PYFB 4JZNB 4AGNA 4TRPH 4FXLA 2JIXA 4LP4A 2W60A 1RK1A 1MRDH 3U6RA 1CS6A 5IR1A 1KTBA 2VZUA 2R29A 2Z31D 4MRCA 3VXQB 1IC4H 4LCCA 4MCMA 1TVHA 2N7SA 3UACA 1AVAA 1MREH 1XZWA 5E99L 4R4FH 1IM9A 2Y06L 2VQUA 2EIZA 4KJYA 2V2WA 1QQDB 2XV6B 1HKLL 3BRDA 1PGRB 2JV6A 4R4FL 5ANMA 4PJ9B 4ZXBA 1UZ6F 2RQ8A 4OI9A 2XVLA 3W0WB 4NO2A 5F7LB 1S7RA 1Z9PA 2YPLA 3U82B 5E5UB 4J3XA 5I8EB 3BOVA 1VKXB 4XNQA 4P8QA 1KB9J 4ZK8A 35C8H 1OEZW 2QPEB 2QPSA 5IQLA 3Q2VA 1E5AA 5D1XC 1RURL 3BAYA 4ZUUA 4QD2E 2QADD 1M3IA 5AD0B 1BGXL 1K4CB 1CDYA 3FN0H 3B7UX 3AWGA 2X5PA 5F6IC 5I1KL 2VR5A 3MJ6A 3X1FA 4DT2A 1TTGA 3V8CA 4HC1H 2O61A 1I85A 1CDJA 3BH8A 1IEAB 3EGSB 3U9PH 2K6YA 3VFMB 1BZ9B 3N1MC 2RMNA 3VH8G 2FX8H 3FRPB 5F6HI 3IMTA 1ID2A 1NCAH 4JJHA 4UQ2A 2VLLA 1UD4A 2IQ9L 15C8H 1F3DJ 4PTTA 1QATA 2HVKA 2IH3B 3O0RH 3EDFA 4M1CC 3VXMD 1XGTB 4CMMB 4DVBB 3B9DA 4R0LC 2GK2A 3CZEA 5JNYA 1D7BA 3SY0B 1O9VA 3HVNA 1QQDA 1DVZA 5D70L 4DP8X 1YJDL 4ZAKC 4OQTL 3MLPA 1KGUA 4U0RB 1O7VA 2VISB 4GG8A 4K55A 2DIJA 4Q7DA 2EO9A 4HIQA 2WWMC 3GZOA 1FO0A 2F0CA 1Q94A 3K46A 5HHOD 2ORBH 4QRPB 4HUUA 2QMJA 3D51A 4LSRL 4NZ8A 3SE3C 5D9SB 4GUPA 2VLJE 3FSZA 4UT6H 1CFSB 3BISA 2IFGA 3ARBA 3W11D 1S7QA 3HG1D 1ONQA 1WD9A 3MBXL 4UUJA 1Y6NR 3C60A 1IB5A 2BS9A 5HYJB 4GMSH 2J44A 4PWFA 1YAZA 5TFSH 1TEYA 1KPRB 3ILQC 3QIBA 1IC7H 2ZUQC 1E9OB 3V7AG 5IW1A 1JK8A 3IDYC 4LEBA 3F7LA 3GJFB 4NT6A 1NAKH 3EHBC 3SQOL 3CMGA 4DKTA 4YBLC 2P47B 5TF0A 3V0WL 4A2GA 1BIIB 1F4XL 2FD6H 3EJYD 5AKTA 3IDNB 3QI9A 5GGUB 2DDQH 3MNVA 3ESPA 1XGQB 4TSAH 2OMWB 2XKUA 3UTSD 5C0RH 2IDTA 4HAFA 3EDKA 1JGEA 4WI0A 3RY6A 5KBPA 5D1ZA 4BA0A 2UUDK 3MNWA 1K8DA 1YY9D 2BS8A 4HOWA 4WI5A 2NR6D 2ZUYA 5SV4A 3NYKA 3ZHKA 2XA8L 3CDZA 3KH4A 4NCDA 4U2ZA 4F37F 1OP5K 3GSNA 5DR5H 3RUGF 5KSAA 4PJFA 1Z5HA 5DZLA 1H6UA 5IROC 1F42A 2N01B 1T2QH 3N40F 5L9DH 4TM9A 5HGBB 2KDYA 2V33A 2APBA 2VLRA 4L8SA 3MLTB 3NFSH 1QZ1A 4FTVD 5E6UB 3DTUB 5DURB 4OFIA 4LIQH 1KGIA 1M71B 3KAAA 1JI2A 4N22A 1MWAH 1DEEA 4OCRL 1S9WA 1D7FA 3ARDB 4OQ1A 4JFFB 1WLHA 4P5TB 5B1JC 5GRUH 1ZS2A 3PXJA 2HH0H 3FCSA 4NQEB 1T1ZA 4JO5A 1XIWB 2VJ0A 2H6UA 4U6TA 3Q48A 1PEWA 4X80L 4LDCA 4N0YH 4OZGF 1VLXA 1QLRA 1M57B 1TXKA 1HSBA 5CUSL 5C97A 4P05A 3WTYA 4XC3H 3ZDYB 3S0PA 4TVUA 2J8UA 4XHJC 4QJ5B 4KK8C 4MXWH 3FU0A 5AZUA 3V0VB 2RAMA 1OXYA 3ETTA 3NQKA 2PXYD 1PD1A 5I9QB 1J10A 1MREL 3BZDA 5F6HJ 2Y06H 1V7NL 1C12A 3P11L 2EE9A 3UTPD 1TT6A 1A6UH 4XCYB 5BNXD 4RMWA 1TZGH 3JV0A 4PPTA 1JGIA 1X9LA 4W9HC 3VWKC 3UTSB 4IBTA 3KYKH 5DEZA 1R0AH 3SE9H 3NCYP 2AC0A 3FJTA 5ESQA 1W0WA 5J7CC 1MHPH 1JFHA 4NUPA 3VSQA 1AZUA 3SBQA 4YSCA 4MCZA 1SBBA 3H7LA 4I5BB 2ZXEB 5ACZA 3G6JA 3INUH 1MNNA 1MHPL 3ARDA 3BVWA 2J1WA 3VX0A 3F7YB 4LVHC 4YGVB 2ZE0A 1OT4A 3GBMH 1KJ2B 5GGSB 3RY5A 2XN9A 1CXEA 1DEDA 4CNIB 3FUHA 2BNUA 2DN7A 2CGZA 3IXAB 1KBBA 4A2HA 5CD5D 1LD9A 5HGBA 4CMHC 2Y07L 4NKMA 4ZUWA 4A38A 5L2KA 4M5SA 3SBWC 4Y16B 3BT2H 3GHPA 4NFCA 1LM8V 4MBOA 4QRPD 4GUOA 2DF3A 1WBXA 3FYEB 9PCYA 4F27A 3JV4B 5E1IA 2VJXA 3QXAB 3HI1A 3Q44A 5D4JA 1EAPB 2N4IA 2D4DA 3LEXB 2FNWA 2Z64C 4JAMB 1ZK9A 2ZXBA 3AGWA 4ALAC 3DX2A 7FABL 4LLAA 5HPMB 5KSUA 5BRZB 4BFEA 5D7LB 5GS0H 2OX5B 3V0HA 4L1HA 5I1HL 1NPUA 3ROLA 2Z9TA 3D0LA 3O41A 1ZGLB 1EUTA 3FU3A 5DMYA 2R8SH 3KDPB 4K2UH 4KRPC 5TH2B 2K4WA 2GW5A 3V9CA 2FECL 3OKDA 2ZNWA 3BLKA 2LQRA 3LRGA 3VXOB 5I2IA 1U8QA 4GMSL 5F8RC 1CDIA 2CLVA 3EJRA 3FPXA 4CSZA 4LO9A 1ZHKA 3L4WA 3TA3A 2E4TA 1T1WB 1JL8A 3HCVB 4JCLA 3QJQB 3TEUA 2IPKA 4ZBJA 3SQBB 1C08A 1RSYA 4Q2ZA 3M1CA 3NA4A 2FQEA 3AS2A 4P59H 4S1SL 2WBKA 4GG8B 2C1PB 5EU6A 3FKUS 2B1HH 2HZHA 1QRNA 2WLIB 4XNXL 4YL4A 2XJLA 4WHCA 1P84J 3G3LA 4B6ZA 3V0DA 2VDOL 1PQZA 3SE6A 4ZYKA 1O7DE 4P4KC 4PJ9D 3OAZK 4D0CB 4GT0A 4NS0A 4AYSA 5KVEL 1HH6A 4A7SA 5DC2A 4ODUB 4V11A 4Y8DC 2BOCB 12E8H 4WI2A 1HESA 4HPHA 5DJ6A 3WUZA 1DLHA 3K8LA 3KPNA 1YAIA 1LO0H 2XNAB 3E80A 4IHBA 1XF1A 2BNQB 4L8BB 2NXYB 5GZOC 4NC1C 4IMKC 4XB8A 1AJ7H 3GI9H 2W65A 3A6CL 1RPKA 1TKWA 2Y23A 1F4WL 3HI6L 4PGDA 2FBOJ 3GT6A 3Q9QA 4C8XA 2Y1YA 2DIEA 2YSSB 1JZ3A 3FUFA 3I3DA 5AD0A 5JW3L 1PZCA 3CPLA 4PJDB 1SHWA 2E7DA 4LSTH 2X4TA 2KH2B 3WJMB 4AMWA 3BN3B 1M3JA 3UXFA 3APCA 5A6MA 2VABB 3CMOH 4Y4KC 2VITA 5DEGA 4WO4D 3S37L 2DI7A 2EEBA 4HH8A 4KK6C 1PZSA 3TV3H 4U2YA 3T8XA 1YNKL 1JXJA 3QA3B 4N85A 2JSFA 2OSYA 4KX8A 1A22B 1INDH 1F3RB 3EYOA 1NOLA 1QBMH 3IPFA 1RZFL 4WI8A 5D93B 4ZXBB 1Q1JH 4M9OA 3LH8A 2Y7QA 1Z0MA 2Q20A 4XT1C 3RWGA 5BRZA 1ZT1A 3F84A 1D5RA 4NRZA 4IRZA 1BFVH 3DJRA 3UTSE 3OAWA 3BZEA 2NZ9D 4WW1A 4N9GB 3TFKC 3NJFA 3BP7A 5DU7A 3LKNA 2R29L 1FYTA 2Q6WA 4U3HA 1FV1B 2GTQA 3SKNA 4NAJA 5CLWA 2J8OA 2X4SA 3FFCB 5E6SB 3BC9A 1XXDC 1E43A 2OMUA 5JW4N 1Z9NA 2BH0A 4H2AA 4YFLI 4X4ME 3K6DA 5DRXB 5FA3B 3ZMEA 1WBXB 2AZAA 4HP5A 4KJPD 2EYSB 4AYDC 2EDKA 5DGRA 3THMH 3HKFA 5T3ZE 1XZ0B 2V8LA 1WUZA 4M56A 5A16A 3LNFA 3N91A 1OLLA 1K6QH 4F91B 1LD9B 1DE4B 2J55A 5IQ7L 3UBXG 3CVDA 1CBJA 1UWEL 3L4XA 3FU7B 2B5IB 2ALWA 3DI3B 3L48A 1SOXA 3POHA 4XWOC 3VYOA 3H9SE 4UZUA 1BJ8A 3IN2A 1N5AA 4F33B 3FFCD 4U1JA 2DLHA 4XPAL 2P42B 2A9ML 3SJVA 3N9GH 4HFWB 4Q56A 4GH7B 2NY3B 3QJZA 4JLRB 4O2CA 2WWNA 4X9FA 2HTLD 2GBTA 2Y7LA 1KGCD 2IGLA 4K9EH 1SQMA 1W0WB 4Y9BA 1UD2A 2WO4A 3F04A 1OAYH 1FSKB 3HNVL 3L8QA 1F18A 2KLRA 1ZHNB 5I66B 3E8VA 1JVOA 4NLHA 2VRQA 3QO0B 4IRZL 2ZT9C 4JFZH 4R7XA 2GJJA 3S48A 4U1GC 2Z65C 5C0EB 2YARA 1AXIB 5IBLC 2ZWLT 1SMAA 4R26L 1FBIH 4X7CC 4ZFOB 2PTTB 4APQB 4K3JL 4PJGB 5BXFA 4Z7OE 1AQDB 5F71A 1MCJA 1RL1A 2GSIB 4I3GA 1FAIH 4R2GD 4S1RH 3MV7E 2EH8H 4KFZC 4YNYB 1KFGA 5AZ2H 2ZP9A 1A02N 5E8DH 1ZJBA 5I75C 1B4RA 4NO5B 4BK5C 3WLBB 5L4JA 2PWGA 4G7YL 1UZGA 1SYSA 2NTFA 1VRSA 4CVXB 1IVTA 4TUJA 2ODIA 1YEGL 3VXRE 3ZMRA 4TQIA 3QUML 3VFTA 1TFPA 3MBED 4PJAB 1ET8A 1BBJA 3APNA 3GTNA 1N59A 1E9PB 5EIIG 3ARFC 4O2FA 4FFYL 3RDTD 4I18C 1QBLL 3OKYA 5CEXB 1QTSA 3ARGD 2DQHH 3IJHA 4H7VA 1JHLL 2E56A 4QXGL 5F97E 4L4JA 1JNLL 3ECBA 1M2VB 1NCCL 4YXKL 3WEAA 1X9QA 4NKOB 4XMWA 5L0QB 5HJ3B 5KS9F 3ULUF 1IAOB 5E4IA 5GS0D 1KCKA 2CGRH 4ILDA 1G7QB 1Q0XH 5EO0B 2GC4C 5IUSA 1BQLL 2C8NA 2Z31C 4OZHE 5KANI 4ZUVB 3JZ7A 3U4BL 4JDVA 4OZGE 1N19A 4RH4A 1ED3A 4A6YA 1OCRB 5HHOA 1BZ7A 4N2MA 4ZS6D 3QQNA 3S97C 4JGNA 3QZMA 5GRJL 3K71B 5KJ4A 2OAAA 2FGWH 4LIQL 1ETZB 3VRLF 2BVPA 1A9EA 3MBEC 4LU5L 4PLKD 1OTTD 5E8NB 2CH8A 4E9YA 2OMXA 3FB6A 2BOLA 3CFCL 3IB4A 4OZHF 5C92A 3GSOB 3II3A 4FULA 3G08B 1G7PB 4R96A 1TEFA 2ZX9A 4EUPB 1FNAA 3CFCH 4L3CB 4PI2A 2R2HA 3MJ9L 1A1OB 1W2KT 2CO4A 5T1DH 3NCXA 1NCTA 4XVSH 3HE7D 4TPRL 2RHEA 3QIBB 2YEZA 2L7QA 3US9A 1HJCA 1W6WA 3HI5L 3MRPB 4PREB 1KIPA 3RB7A 3SPCA 1TENA 1J5DA 4IKLA 3VM5A 3V6BR 1N6VA 1A9VA 3F7QA 4TRPL 1CFSA 2OJZL 1HYSD 2G30A 2P8MA 5HPOA 4NAQA 2WQ8A 1F90H 1OSZA 1KTRL 5DK3A 1V27A 2GIXA 1A6UL 4OVVA 5LDUA 3QCTH 2IALB 4FQ1H 3FQYA 2PO6B 3TIDA 5KBLA 4LLQB 1SXBA 1F8TL 5B4MC 3BUIA 1BSIA 3LTVA 4JKWA 4Y2DA 2QVKA 2PW2A 1E9QB 4Z3GA 3STBA 5HDQL 2H0JA 3TN0C 3QQDB 1DQVA 4XVUD 2NQDA 3K6OA 1BDYA 2ZAHA 4PEEA 1CLYH 3RDJA 4C57C 4I0PC 3RGBA 2M26A 3QQ3A 3GUTA 2VSCA 3BFOA 4FERA 8PAZA 4GW5B 1JZDC 3CC1A 3IETA 4U1GB 3KJ6H 1PEZA 4G8FB 5IVNA 3LSOA 5FHAL 1DLFH 4NZRH 8CGTA 4OLZH 1R34A 4PJBA 1NGXB 5GJTH 1NH6A 4M00A 5DHYB 4UT9L 1LEIB 1E4XH 1ML0A 1UM5H 1K4DB 3JSSA 4ZUUB 1QWHA 4F9LC 3PWNA 4GSQA 4WFGE 3L5HA 4RGNE 4FP8H 5DJZB 4QXWA 1YEEH 4QNPF 1IV8A 3PE9A 5B1CA 4ATWA 4MJIB 3PLYA 3BPOB 1LP9F 1WF5A 4XTRD 4CSPA 3VXSD 1KN4H 3Q2NA 1U8PB 1VIWA 1VADB 2CRYA 2MOQA 3VFVB 1AZZC 1KTCA 2PUQT 5FF6A 1DJWA 3PV6A 2VDKB 3FB5B 4HKZA 4GKZA 3HTLX 4PJ7A 2E6JA 5D1QD 3OKNB 4J3OC 3LD8C 3A67H 5K1VA 1ZLEA 2FO8A 5I5MA 2E7LC 2P5WB 2APTA 4QHMA 5HY9A 4FA6A 3QJFA 3VSTA 1D9KD 1EXUA 1V54B 1JPSL 2R15A 1MFDH 2VSMB 3V0WH 1HCVA 3BIKA 4W9EC 4NP9A 1RJZB 4NHUB 4K7PH 4WUKH 3RFZA 4XC1H 4I0PD 2A7BA 4XAKD 4FZ8L 2WXPA 4NFDA 3BP5B 2FATH 3MTRA 1TETL 2D3NA 2LT9A 4FGMA 4I13B 4RX4A 5K1JA 1RZKH 4ZO9A 3TN0D 3BP6B 2P5EB 1PFOA 4NN5B 1E30A 3ZYJA 2FHCA 3WUWG 1X7QB 4G7VH 1I82A 3BN9D 4XMUA 4ZQKB 3TO2A 1E4KC 1NGZA 3V4PH 3IGUA 4X6CA 5LLIC 4XMVA 4QKXB 4LESA 1NGQH 2Q3AA 1FZKA 2X4RB 4X0KB 3AB0C 4QYAA 3FZUD 3FCTA 3DSNA 5SWSB 3AG1B 3VG9B 3VXPA 2EXWC 1KXTB 1M7DB 3NTCH 1T21A 4H25A 3EJZC 4IBVA 3B2VH 1M9SA 2YOAA 1BBDL 1PAZA 1V05A 5MERA 4MS8C 3SPJA 1UM6H 3D39B 5FR3A 1X7TA 2BZDA 1I1CA 2FYYB 2DH2A 2WPGA 3ARBD 3APDA 4P2RA 4AQ1B 3VI3F 1TPXC 2WUBH 1CXIA 2EXTA 3NJXA 4ZS7H 4Y2OB 2CDFB 1R33A 1ZV2A 3MUZ1 1XD0A 4AEHL 4DWHA 1II4E 4OGQC 5IQOA 5CSZB 1Q9OB 1WSST 3D3VE 3TZVD 2QZ5A 1P84K 2ENQA 1G7JA 5HHQB 3Q6FA 2V7NB 1QSED 1EJ8A 4MMXB 1QBAA 1FZOB 4OKVB 1QNZH 3LIUA 5A6IA 2WKLA 1NICA 1AR1C 1MG2C 4EXKA 5GJSH 2MHAB 4OIFA 2PR9A 4OZFB 3DDGA 3TJPA 4DIXA 3RY6C 2UY6A 3NP4A 4X5LA 3KLDA 2F15A 4M93B 4YDIL 4Y4FA 4RFEB 3IGFA 4JDZB 3E9UA 4CJ0A 4ZFZA 5IB3A 3SDCB 2VR6A 2XN2A 2R29H 2ZOKA 3FSWA 3NZHL 4XCFL 4HHAA 1XL4A 4B9FA 3PJSB 4KKQA 3SYOA 4OJEH 4AE1A 1MRFH 3PGCB 4ZTOL 5K9OB 4MAUL 1YYLL 4BEIA 4J6RH 2P8PA 3GSNL 2AQPA 1A66A 3BESR 2YRPA 4JG5A 4FX5A 5KOMC 4ODWA 2IXQA 1FH2A 4UILL 4ZTEA 2UY7B 1P7QD 3C60C 3RPKA 3AG2B 4AL8L 4BSVA 5E2VH 2AKRB 4F7TB 3RIFK 1H8LA 3FSAA 1HH9A 1MF2H 3HA0A 3O3EB 3E6FB 1RVFL 4WU5B 3MGOA 1MN4A 4H2CA 1UFUA 4DN4L 5B39G 4AV0A 4A1RA 3SOBL 2LFEA 4B95C 1SDDA 1T3FA 2NW2B 3MV8B 4U6XB 3O3AB 1BWWA 1QFHA 5L8KB 1F4YH 4MNQD 3RRQA 5F2FA 5JDSA 1YO4A 1E8WA 1ZWIB 3EO9H 3PXHA 4XOCA 2IPTH 4BZ1H 4N0RA 1CTNA 3WU1A 3CHRA 3HZ3A 3MRCB 1IAIL 4WO4A 2AGJL 2R0ZL 1T4WA 2C7FA 2DMCA 4O9HL 1WAEA 1OTSC 3CFMA 1G6RA 3DX8B 5DMJB 3AS3A 4LSUH 2XVBA 3B6SB 3EGXA 2V2XA 4K3JH 2XWTA 5BRZE 5KUMA 2XQYG 2AQTA 1BVLA 2UXFA 2J57A 4JBSA 5L4MA 3QUKB 1GY1A 4PJCA 3NGBB 1U30A 4IGBD 4NQDA 3S36X 3LZNA 4LCWD 3U6XA 5AAMA 4JPVL 2YMXL 5BCAA 4YH6A 2AF2A 4UDTB 4Q74A 2H8PA 1FL5B 1N26A 4NQCE 2DTML 1FFOB 1JG9A 4QI3A 4PJ9C 4K3EH 4XH2A 1T1YB 1OGAA 5JXAH 4PB0L 4JDEA 4MKTA 1TZIA 4E0RA 5GRXG 3MFFA 2VR4A 4G9FB 3UG5A 3MLUH 2F74A 4HBQA 3LXCA 3VFNB 4EUPH 1SY6A 4KK9D 3F7PC 3P4NB 1JPGB 4HAKA 4P57B 4KAQH 4OF7A 5FM5O 5EU5A 1ZRUA 1FFOA 5SWZE 4BHUA 1CLZH 1D3CA 2H8PB 1ODAA 5AVZB 1NLDL 2UXTA 1UT9A 4FN0A 4FZEL 4UMGA 5AUMB 5F6IB 4JRFA 5T1KB 2F5AH 3O6LL 2WUCH 5B8CA 1QHPA 5A2KH 1HS6A 3GS0A 3O81A 4KY2A 4PJCB 2J3SA 1E7UA 1SBSL 2WVVB 3TCXA 5CEZD 4K5MA 4DKEL 2D2CC 3SGDH 3LZLA 2J21A 4TVSa 1KCRL 4HWEL 4HJ0D 1JBJA 4FG0A 4PCKA 5FKAB 3RWJB 2EE0A 1ADQH 3MACH 4GT7A 1PJWA 1OAQH 3JZYA 4BXSV 5DVMA 4ZMOA 3AY2A 2VLKE 3EH2A 3MRCA 4WO4B 3BQUC 1I1YA 3BH9A 3OAYH 4HCFA 1M1XA 3HNSH 1OLZA 3HBGA 3A4FA 1IGML 1MJ7H 4WO4C 4XPBH 2WLZA 4XMPL 1BQHG 2PKDA 2X2UA 2A4EA 1O6SB 3TA4D 1RKRA 5DMKB 3U6XS 4PM1A 1KIUB 1YPZA 3CMOL 3QWNA 1N6QL 5I5RA 4X5XA 5FCUH 1A4JB 3IJYA 3WDIA 2WTRB 1S7WB 3DVGA 4YDKL 2F19H 3QHTC 1QFWH 1MH5B 3BZ5A 3CJJA 1I8LA 3L2LA 3EW3B 4AQEB 1J9CT 2NCMA 4QRTA 1TTBA 2BNRE 3FTXA 3RTQD 2VAAB 4IS6A 5A2LH 3QUYB 2V9QA 3FUEA 4NQEE 3KGRA 2QQNL 4XN8A 4M6NL 3ECUA 3SDAC 4WHYH 1LGVA 5EDXA 4M7LL 3CQQA 4HX1A 4QXUL 2X0WA 1R3IH 2VUOA 4HBCL 4PIRF 4M4RB 5F7DA 3BKYH 4ZZFA 2PP7A 1A65A 3VFWA 3PJSA 4PRID 3BMWA 1KYDA 5B1KA 1KBGH 4I1NB 4BFIA 5EOTA 4BBWA 1PD0A 1S7WA 1HHJB 4QHNB 4ZO6A 5IEKB 2EDNA 1I7TA 4XCFH 2AK1H 4X5XB 2A6DB 5EPMA 4ZMPA 1RZIA 1FDLL 1N7MH 3UAJD 5E00B 2UY6B 4DFIA 3AXLB 1JK9A 1CWVA 2EKJA 2W94A 4AYMC 6CGTA 4JL1A 4WEBL 2DLIA 2ZOLB 5IQNA 2DWSA 1X4YA 2BFVL 3GHEL 3HFMH 5AW3B 5IB1B 4TNFA 3IDXL 1EJFA 3OZLA 2QR0B 1QW9A 2ZAIA 1F86A 4P5RA 3L3OC 1UACL 2DQUL 3M17A 2EVJA 1FIGL 4PJ7F 1CLCA 5HYJD 5GRYA 3RQ3A 2ZWZA 4Y4FD 1VF5C 3WIFA 2Y7MA 4AQAB 3DHJA 1N0XL 4F93B 3JT0A 2OMYA 1W91A 2QGEA 1H9DA 4JG9A 4RDBA 1K6QL 1RZKC 3TBVA 3UGEA 5SWQA 3HPLA 1XAKA 4LNRA 4QWWC 3QZNA 3V5DB 1NCDH 3N5AA 1TQUA 3UTQA 3QCUL 5FPIA 1E27B 2EYRB 4JFTA 2X87A 2DJMA 5HGGS 4BQBA 1R5WB 1SM3L 5LBSL 1X6NA 1M7DA 4YXLH 3ZRSA 2Y36H 2VLJB 1FAIL 1U3ZA 1L0QA 3DBXA 4FP8L 2OZ4H 5G2NA 2PO6C 2VQTA 3HN5A 4G8GA 4Z78B 2AABL 1DN0A 2F74B 3AT9A 4AC2A 2IV9A 4X0KA 4W9LC 4W9GC 1RK0A 4IRJC 5K39A 1E5BA 1N0LB 3BPOC 3S3CB 4PRHE 5F3HA 2QQQA 1NIFA 5TF1L 4HJJL 4Z7OB 2YAQA 5D6DA 3GJFH 4N8CL 5CWSA 3NMEA 1KWKA 4H0GA 3KVPA 2VLKD 2ICEB 1H3XA 4H13C 2IMMA 4N8CH 5I1GH 1VGEL 3D4GA 2I85A 4J6IA 1EFXA 4LCYA 2X4NB 4S2SB 4FFYA 5AL0A 4ANUA 5F96L 2AXGB 1JZ5A 1T5WA 2VERN 4NQTA 1BV8A 3LPOA 5J3HC 3HR5A 3QDGB 3AY4C 4B27A 3RKDD 4UYQA 2Y0SA 4WK2B 1ZLVH 2IBBA 3MLSL 2QQLL 3QJFB 1RZPA 3WS6C 1H5BB 3EGXB 4W9ZA 3CV5A 1F6AB 1KZQA 1G6RB 3CN4A 3DX8A 3PP4H 1OGTB 5F88B 4IU3A 3L3HB 3PGDB 3KGTA 3TOPA 2Z8RA 4I3RL 1L9PA 3IF1B 4K5NA 1MAJA 3L9RB 2R1YA 4LLDA 1HEJC 1J8HE 1X5MA 3D2UA 1UVQB 1A1MB 1WFIA 4LP8A 4OLWH 5JDSB 4YWGL 3VCLA 2H1PL 4L3ED 4XXCC 4GKSB 1SRDA 2Z31B 3RAJL 1MFCH 2UXGA 1IT9H 4YXKH 2LTQC 4HWBA 2C26A 4NQQA 4RAVA 4Q4EA 3RJQB 5JA9A 4K3DH 2JELH 2OR7A 5BVPH 1LEIA 3AGVA 5C08B 1NUDA 1TG8A 3CXHJ 3ZK0A 4J3VA 3CPUA 4Q58C 4JFHE 4PJBB 1M6OA 1TJIH 3TBCA 4LCWE 3IDYB 3MJ9H 2IXQB 4FL4C 4CU8A 4W81A 2N0MA 3S8FB 4GI8A 2HVJA 1DQLL 4TVPL 4GW1B 5ALBL 4HK0B 2A83B 4NX0A 4UTAL 3Q06A 1CD0A 1VFMA 4LBEA 4AQ8A 5K9OA 3GRWL 3MAWA 3REVB 2DMKA 1J1OL 1I3GL 4PV8A 2CLRA 1MQ8A 1MCEA 3V2AR 2A99A 4XCNA 4XRCB 1LEGA 5GGVY 3IRCA 3MNZA 5IB3B 1P4IL 2A9DA 4J3OG 4HKBA 2AEPH 3OJDB 4N8UA 2JJTC 3TN0A 3WL9B 4LLQA 4E42B 4K5PA 3KW7A 1JRHH 3UZVA 3DPBB 4K8RC 4RGMB 4Y4HA 3SPHA 5HHPA 3N2JA 4PTUB 4HOXA 4ZD3H 3DGCR 1SHMA 3SGEH 3ZE2B 4EI5D 1IKFH 3ILPB 5T5FA 2J6EH 5ES4B 4JQXA 1GC1H 3IPBA 2IANE 3NACH 1J05A 1KB5H 3L13A 4FLHA 3AITA 4XP9L 5GRVL 1Q9OA 2EUXA 4JRYB 3EDEA 2OTWB 4LVOC 3LD8B 2Z93B 5HBBA 5IBUG 3QEUA 1YN6A 4L5FH 4X7TA 1T6WA 1DBKL 3JXAA 4WI7A 2YPKA 5TK2A 4XN4A 4QUOA 3NPZB 1IARB 4ONGH 2AJZB 1SJVA 2SEBB 2DTSA 1PG7H 4KOBA 4OQTA 2YFNA 4BWWA 4HOZA 2P46B 3VFUA 4FQ2H 3N40P 4PJCE 3S37X 3TVMD 2VXQA 3BVXA 3FB6B 1DQDL 3GMOB 2MH4A 3GSUA 1ETZA 4G3YL 2HMID 2CO7A 1CLYL 4HIXH 2HFTA 3UJJL 5B3SB 3EF7A 3KLAA 3TH3T 3N42F 4BFBD 4EQ3A 2X1PA 4U7KA 4ZPTB 4ANKA 3DOSB 5HHOB 2FLMA 1LE5B 4XVJH 4F80A 1IAIH 1ZTXE 2WBWB 4ZRGA 4A68A 1T89A 5T1LB 1YECH 2GT9A 2Q3XA 4LFHD 4CU7A 3EYUL 3T2NL 1QSEE 2ZX5A 3Q8AA 5L8JB 3BP5A 5EO0A 3L4VA 4OF0A 2HLAB 4C59B 3FONA 4NI3A 4FQIL 3RNQB 2YGPA 4AC4A 5E6YA 1J88A 4X9BA 1NBQA 3EJZD 4M9PA 1R3LB 4M6OL 4WGKA 3ZL4H 4JFDE 3RJDA 1IFHL 1G84A 4MNQB 4XWGH 4JHAH 4DGUA 3VI3A 1NAMH 5EEUA 3RL1B 3FW6A 3C6LA 4HKZB 3FB5A 4DP7X 6FABH 3D25A 3L3JA 3BN9C 2PTVA 4EUPG 2YPVA 4LSQL 4MXVF 1XH3A 4TSBL 3FFCE 5JW4Q 2PCFB 1WAPA 4B7LA 4TUJB 4LASH 5GPRA 4E9SA 4J39A 3Q8BA 4RCAA 3LS5L 4QHPA 2NTFB 5TD4A 4EI6B 4G72B 1KZYA 4MJ2A 5TDPB 3V4PL 2LAGB 5D1QC 2F8VA 4HUCA 4PRPE 3ILDA 3BKJL 1JXFA 3EOAB 3KCPB 4FNLH 4LHJB 4PJ8D 3ZTCC 1HN1A 1NLBL 4EZJA 1FRGH 2MWCA 5EEVA 3S5LB 3T71A 4YSTA 4IKJA 4FNLL 4FZ8H 1GGUA 3D07A 1A9BA 4XXWA 5DHYA 5JHDB 4HUXB 1GH7A 4UQIM 2IDQA 4O02L 3EZJB 3MJWA 3ABGA 3WELA 3QG6A 1Q0XL 2EIEA 3IETB 5FUCC 5KVEH 4N2IA 1A0QH 4NXKA 3HIZA 3OPZH 5DEJA 3R7QA 4D9QE 5I28A 4AEHH 1AHMA 4AGMA 1EAOA 3OPZL 3T8VA 3CHXA 5JHMA 4JLRA 3WKPA 2E7BA 3UTTA 3ZYOA 2G60H 1ZGLP 3R06B 4HV8A 1A6ZB 1AJ7L 3HNSL 1MZZA 5DEFB 1E9QA 2PW2B 4PY8J 2DYPB 1KGYE 1RZQA 3BE1L 4QXTB 4YPJA 3WKML 3M07A 5CILH 3VI4F 3QHFH 5D72L 2OJEB 2VT0A 2R56L 3VYPA 1EFXD 1CO1A 2A3TA 2R4RL 3E0GA 4PN6A 1W6LA 3K72B 4J4PD 2D7PA 1FFQA 2NY6D 4PYHA 3QE5A 5CO1A 4WW2C 2OLDA 4KNTA 5F7HA 3DVNB 1U8CA 5CN2A 5ADPH 2OR9L 1LK3H 1D6VH 2VDNH 4JY4B 4G42A 4Z7QB 2DQGH 3SEPA 1OW0A 2FLRT 2Y2YA 4I9WD 2Q6WB 1MLBB 2WQAA 3BEWA 1ZJAA 4H0LC 1WIPA 3NZ8B 3DTXA 3DK2A 4GI9A 3DHPA 2CO1A 1LVEA 5D1XB 3WY4A 4LHUB 4L3CA 1E28B 1G6RL 5MHSE 1JS4A 4R96B 3BQUB 4D9RE 2H45A 3O9WD 3M8OH 3TWCH 4X8JB 5EHFA 3FCUB 5IBUB 2NYYC 4Z3FA 1GGCH 5DD5L 1R3KA 4UTCA 3T8XB 2NZ9C 5FM4A 3JYCA 1BAWA 2H6PB 3CG8A 3MLVH 3ZUCA 1F58H 2C1OB 1DSYA 4LRIA 2HLFC 4KDWA 2CKBH 3CX2A 3DETD 4R7NB 5FYKU 1U93A 4NKIL 1EGJH 5FUZL 1TZOA 4ZUVA 5TE6L 2FZ3A 2F08A 1AZNA 5HYSB 3QAQA 5IQ7H 1OAUH 4ZOEA 4EKJA 1EK3A 3QUXB 4Y4KD 5I1KH 3C09B 3FTGA 4PGDB 3X11A 5I76A 5T1JA 2VQ1A 2H9GB 3FL7A 2P52A 2JK5A 2YEQA 3KLQA 2ZKXA 4ERSL 1TJHL 2OXGA 3I9PA 2CGYA 2ORBL 1XF3B 4PJIA 3IJHB 3TJHC 2K9FB 1SMOA 2PXYB 3FB7A 4KWUA 4QTIL 3IFLH 2J7LA 1JDDA 3EJSA 4ANVA 2Z8WC 3TO4B 3UAJC 2VE6A 3MGAA 2PR4L 2HT4D 3GXIA 3IDIB 1D5ZA 5BS0B 2R0WL 4G71B 1LQSR 1UOKA 3ENEA 5ILTH 4JO4L 3CTTA 4G8EA 3LEYH 5I1GL 1DBML 1UXWB 4KNUA 1OP3H 1UWFA 2WINB 2FL5B 3CZKA 1VFBB 3T2LA 2PTUA 5J8OA 2ARJA 4OY9A 4M8VA 1KFAL 2B2XL 4LL9A 5E2TL 3IKCB 1V55B 3TA3C 4Y5XB 5B38G 1KN2H 5C0GB 1NINA 4PJGA 4GB9A 3DROA 1AY1H 3MRKB 5D4QA 1QPPA 2YR3A 1NIAA 1DZ0A 4KDTC 4MYPA 4OZIA 5GQBA 1T66D 2X38A 1OSYA 1BJMA 5D6CA 4DEPB 2IAND 1P7HL 3EZ8A 1DVTA 2F5AL 4YPGB 4PQXA 2VSDA 3CFUA 1T03H 4HKJA 4WDIA 3PP4L 1KCWA 2XQYK 3Q7JA 1ZT4A 3CLEH 3BEVB 5HYJE 2ZSVB 1U8KA 3HZMA 4QXGH 1PJ9A 4Q0XL 3K2KA 4OJDH 1A7OH 4EBQL 4UNIA 4XE0A 3O9WA 4KVCH 4LBAA 2EAEA 4RIRB 4PW4A 2F7QA 2OPCA 4WJG3 5C0BA 4CW1A 4WI6A 3RBSA 4F7PB 5BUPA 2HH0L 3BGFC 5GS1A 2XWEA 2VIRA 4GMTH 4JHBA 1FG9C 4K7FB 5K93A 4HJEA 3QDGD 2FH6A 4UIKH 4BELD 4WU7A 3U4EB 4WNQB 5D1QA 1N8ZA 5E5RB 2O5ZL 2X4PB 1F1DA 3CXDL 4JKMA 5I73B 3B3IB 2EADA 4RIRA 1GS6X 1X5YA 5DUML 3C6LD 2YAPA 1P2CB 3DGGB 1FV1A 1SLWA 3O9WB 4GBXB 3IJEA 2ARJQ 3D5OF 3KR3H 4J1UA 1M7IB 3K4ZA 3CU1A 4ABUA 2ESVE 3MLYH 1RLBA 3S8WA 4F58L 5J6GB 4AIZA 2G5BA 1RUQL 3L7FA 1SDYA 1KGCE 1RSFA 2PPCA 5D8JL 2Y7QB 3HRZC 2KYIA 3PRZA 3CDYA 1Z9OA 3MV7B 4AM0A 1U8LB 1ORSA 5JOPD 3T6QC 2I9TA 3KH3A 1C5CH 2NY1D 1QA9A 1CGWA 3M1BA 2GJ6D 4JR9L 2VJ8A 4BXVA 1PW3A 2HG0A 1S3KH 1JZ2A 3ARPA 1ECYA 3DURA 5BZWB 2VXVH 3GGWB 3S88L 2XACC 4Z8FH 2C9VA 1CD8A 1C7TA 2QSCL 1J0ZA 2ATPA 2JVUA 2CPCA 4OGZA 4HIHB 3AMKA 3SGEI 3NBNA 2Z7WA 3ARGB 2J12B 4KKZA 4L5FL 5EWIH 4WEEA 4GQQA 3CU7A 5LCVH 5JW4R 1LYQA 2V5MA 3HKZA 4MQ7A 2RCSL 4YEEA 1FPTL 1E2WA 2MNJB 5FYJD 1WBYB 3K5RA 4NAMA 5GRWA 5TDNA 2BSED 2FQDA 3RWEB 3OTTA 3WHXB 3BVVA 5D7EA 3QR1A 4DETA 4MA1B 1A6WH 1D5ZB 1U9KA 1N64H 1R19A 2DLTA 4UB0H 4OM0L 4YR6B 3U9PL 2WK2A 4C83B 1L5GB 1KMGA 3OAUL 4Z7WA 3VSUA 1T1ZB 1YZZA 1N64L 4L9LB 2QPFA 3G5ZA 4Z3IA 4F1ZA 2B1AL 3IMUA 3MUHL 1WAAE 3V4LA 2X4UA 1S9WB 3NJVA 1CTOA 1AGCB 4GEJA 3GJEB 1XF3A 4YSEA 4H5SA 2OXGB 3GMLA 4G3YH 5K69A 4G1MA 1E6JL 2H3KA 3GD1C 4CSSA 3K1KC 1D5BA 2DQIL 3B7YA 2FHFA 1GZHC 2ITCB 3SCMB 2AQQA 1XHHA 3OB0K 1CK0L 4N26A 3BP4B 3EJUA 3FOMA 2WYHA 5BJTB 1TCRB 3QUXA 3HCVA 4JQXC 3LKPA 4KI5E 4XNYH 3QUMA 1MJ8H 1O7DC 3H9SA 4PJFB 3X1GA 4FD0A 4Z7WE 2EVHA 2GG1A 3A4DA 4M02A 2ICWJ 5I0WA 5GSRB 5AW6B 5J1TC 4F8OA 1HCFX 4YDZA 5A3IC 4QTFA 4PRHB 3LQZA 1RAMA 4ZO8A 3MNVB 4BGDA 3TVMA 2ZJSH 4D94A 3AT8A 2OV0A 3RKDC 1TTUA 2L0DA 4Z0BH 4DPAX 3C8HA 3II2A 3LZPA 1QR4A 1NUGA 1E28A 3H42H 3CFKA 1HXKA 3QZBA 4LHQB 4PUBL 7CGTA 1IJ9A 4I18B 2YAOA 4R97B 2GSGB 4J23A 1FG2A 3EUDA 1KPRA 1KN2L 1NEZA 1JHTA 2B4CL 5DJXA 5KYWB 4G42B 4JY4A 5CBAA 4B9PA 3QZWB 4P5TC 3KM2A 2YQBA 3H6JA 5GSRA 3S2AA 1EHXA 4U4BA 1S7QB 4EKXA 3IDMA 1AANA 4EI5B 4LZKA 1JNLH 2AXWA 3H9SB 3EFFA 2IO5A 3MRQB 3S3SA 5L2KB 3WGUB 5B22A 1IZJA 4JUTA 1TCRA 5FO7A 4IMLB 4A2MA 2VISA 3ESOA 3MPCA 4X7EC 3BAIA 3KPRE 3D09A 5HVHB 3PABB 1D5BB 3MZTA 5CZVH 5I8CB 3ARDC 3CFDA 1PLAA 3GMLB 3OL2A 3PAZA 1ZS8A 4A7GA 2VDRH 3FZUC 1FNEA 1XGTA 4EDWL 1W8EA 3F62A 1BYPA 1PDKB 3F6LA 4GINA 2D0HA 4MCZB 4F7CB 3MYJB 3VW3L 1FGVH 5EZOH 1WWBX 1JRHI 3UO1H 2YQ2A 3WHXA 1X6LA 2HFGH 1N2RA 3AY4A 3R4RA 1I53A 1G4RA 2I7SA 2O5ZH 2CBQA 4GLRI 1S5IH 4AEFA 1I8UA 5AZEL 4S0SD 2NR6A 3VXSB 2F54E 3BI9X 2BSRB 4XBMA 2YRZA 3GXDA 1HZHH 4J8RB 1I4FA 3RU8L 5I8KH 2VXSH 3NCJH 5DD6B 1U8IB 5IHBA 4L3EB 4RMSA 3QH3A 5SV3A 3AB0B 4LKXA 3VFOB 5DHMC 3US1A 3QI9D 3PDDA 3ZQXA 2CLZA 2ICWB 5FGRA 4ELKA 2AEWA 4PWKA 2WZPA 2ATPB 2K7PA 2JKIS 4J3OD 3MJGX 4OCYL 5AVWB 5TDPA 2J8UB 3EG9B 5L4IA 1E3XA 1JERA 1PMYA 2XU9A 1AGEA 4YBQD 5EMYA 4JQIL 3D3VA 3WEXB 5GGSY 3WLWD 1SJEA 4PJ7E 2WOYA 1U91B 1XH3B 5HHMD 5BO0D 3QPKA 5KYXA 3T65B 2WKGA 4LMQE 2YD2A 4OGXH 4Z7UE 4I88A 4LCCB 4EIZC 3JTSB 3DOHA 3CFBB 5BZZA 2FHBA 4E5XB 2XIIA 1JFQH 3LMJL 4YE4L 1KB5L 3DGGA 4RRPG 4G6JH 4M7JH 1MXDA 4YE4H 5DK2A 1OAUL 3G5YA 3PWLA 2FX7L 4KC3B 3OKMA 4YIQA 3CE1A 1AYOA 2BSSB 2JJUA 2WBJB 3VRLE 2NOYA 3A47A 5G5DA 2R0LL 4IKNA 3KPPA 1R5VA 4BKSC 2J20A 5GJTL 5BRZD 2DQFB 5E6IA 4E41B 4B97A 4MB5A 2O4EA 3F6IA 5D1ZB 3HLAA 3WO3B 3ZQ9A 1AG6A 4P99A 2ZXAA 4H1LH 2VO5A 5E95B 2HJKB 3V7AE 2GJ6B 1A7RH 4HZLB 4YAQA 3FQUB 1AD9A 1BHGA 3PJNA 1FH5L 1IBGH 4XNUH 3JWDL 4W9JC 4ELMF 3TNNA 2G3NA 2LU5A 2UWEF 2ZG1A 4TOYL 3VFUB 5F1OB 2DQEL 1GAFH 4NSKA 3WBDA 4Z7NF 1NPNA 1U3HA 3ZSSA 1AGDB 4CJ1A 1RLWA 4XP4L 1A7PH 3OHXA 4MWFB 4TNGA 4KI1A 4U3SA 3T0ED 5MEQA 4AZ8A 1KB9K 4YHIB 4X4XB 3KPPB 3B9KD 1KJMA 1G0YR 3DETC 4I4WB 3FF7A 2DY2A 4LVNB 5I19L 5ICZB 3C60B 5HYJA 2JTDA 3PAUA 2C3HA 4HS3B 4XMLH 1IBHA 3TU6A 1UZ8B 3VNYA 4L0PB 1I8LC 5EU6D 5DK2B 3T0BA 2YGOA 2EDQA 3LKSB 2H4EA 2MJWA 1RMFH 1JN6A 2R4SH 3T77B 3R0NA 2VC2H 1FO0B 1KT2A 3VH8B 4G7RB 4JPSA 2WLJA 1VENA 1J5OH 2B16A 2GABA 4PJFF 2WINA 2Y1ZA 3NSXA 5I16B 2BHFA 1KTJA 3DX7B 2DDQL 4C55A 1URLA 3OJDA 3QDJE 3ROOB 2IMNA 5IV2A 4GQ9L 1JHKL 3SY0A 5IVXA 5JYLA 3MV8E 1CLVA 3Q0HA 3TF7C 4N3UA 1SJEB 1TJGL 3HE6D 4FTDA 4RQQB 3NIDB 2B9AA 1NWPA 3KPMA 4OB5L 1W0VA 2LVCA 5CJ5A 4PJIE 3BWSA 1NFDB 5I74B 3NRPA 1QFUH 1YDPA 2MNWA 3D4CA 3UJTH 2CO6A 5DS8B 2A83A 4HK0A 1DJHA 2P8LB 1IEAA 3EGSA 5FWQA 5LN4A 3I2CL 4PJ6A 1U8IA 1AS7A 2NDGA 4Y2LA 4PRIA 5EU4A 3C2SA 2BZCA 2CHDA 1JV2A 2DQCH 5IM7B 4ZT1A 1UWGH 4QRFA 2GYSA 3BWUF 3QNYB 1K4CA 3OMNB 1UOVA 1WFUA 2CNZA 1MI5E 3T0EA 1XSIA 1P5VB 3RZWA 3SPGA 2ZUUA 4K73A 1CU4H 4KTDH 3UBXI 4P2CG 1EZVX 4WSGA 3BJLA 3BPNC 3EO1A 1F11B 1PG7X 2DQDH 3BIAX 3BYYA 4D8PB 2Z4QA 3U30C 1EX0A 4GPVA 4Z7IA 1AOHA 2ZKWA 4FC3E 5F9OH 1A7QH 1BWMA 1B0IA 1P7KB 1YVLA 1ZS8B 3DK0A 3FYIB 4YDIH 4PJ9A 4PV9B 1KLFB 3PABA 4L1LA 3UAEA 2EIZB 4WK4B 3LDBB 5AVUB 1JTTA 1RHFA 3ZN6A 1KCSH 2BO0A 3KG5A 1FO0H 2P4AB 3UIYA 3V0IA 3WTTA 3U2SB 3X17A 4OD2B 5IW6B 4TPRH 3QXTA 4PS8A 5H2BB 4DQOH 3GDBA 1S3KL 4OW6A 4JM2B 1FHGA 2VXVL 4TL5A 4KV5E 3GTVA 2PYFA 4TL4A 1A3RH 3QDGA 3HR5B 4Y5VC 3GKWL 5DC0A 5E6RB 5HDBB 1CB4A 2OR9H 2J6EL 3U36B 3VWKB 1OB1B 3L95A 4AL8H 1RD6A 3BVNA 2K70A 5LGJB 3QBTB 1KYOJ 2R2BB 2LW3A 3RIAF 4GRMA 5FOBB 5IB5B 3HN3A 5E8PA 1HSAA 3QDJD 4NKIH 3THML 3RGVC 3IJ8A 1A6WL 2CO3A 5DVNA 3QHZH 4EQ2A 1MHCA 4DAGL 1S9VA 3ULUH 1Q8MA 2YD1A 3V6OA 2ZICA 1HCYA 5JA8B 1LO4L 2O72A 4JRYD 3PS6A 2J8UF 3FO0L 4MD4A 1RZGB 1GW0A 3ARYA 1NCBL 4GAGH 1I9JL 4M7LT 5ISZB 3GBEA 4H4NA 4P0DA 3KPRD 1SPDA 4U1IB 3UTQB 1VGKB 4HJ0C 2A9MH 5DSCA 5IOPB 3QWRA 1KV3A 1C1EH 1OAXH 5E94B 5DLML 1FNSH 3I6GB 2L4OA 3AQXA 4QYOB 4Z7VB 5ECJE 5KZCD 4LDEB 5E1AB 3SCMC 4U7MA 4NO0D 3WFZA 3TBWA 3CVHA 3COOA 3N85H 4LLVA 1TF4A 4HUXA 3QR2A 1QR1A 1T6BX 5BJTA 1A9BB 3OAZH 5JHDA 5TGBB 1IE5A 1IVLA 3PQYB 2WO2B 2C4XA 3KM1A 3W9DB 1BOGB 2GFBA 4KY1H 4QHLA 4WHDA 2C4FT 3PNRB 5C0FA 2ZWNA 1PLGL 2C9AA 3WFEH 3DMMD 2X4QB 1DR9A 1PCXA 3G5ZB 4ZFOL 1PLGH 3JTTB 4XNZC 3WFEL 1TQCB 4U1NA 3QRLA 5HHXH 1WTGT 3NABH 4WKZA 1UGNA 3NFPA 3P40A 4BZ2A 4HT1H 4W4OC 3KNBB 1IMHC 2NXYD 4XPHL 1XGZA 3ARGC 3ZHLA 1FNGB 1R17A 2HX8A 2I26N 4DF9A 5B8CC 1WS7A 4FFVC 1E4WH 5DT1H 4CGTA 5ICYB 1HXMB 4NWTH 4LCIL 3B2UD 4NO0A 2ADGB 1DVFC 1P9MA 4NZJA 5M7QA 5CR8A 3LKOA 2D7TL 3BSZL 4G9DA 1HXYB 2H32H 5IY5B 1CR9L 2Z1KA 1A1NB 4HD5A 3WG7B 2WB1A 1MVFA 4NP4H 1KXHA 3HG1A 5EFIA 3LYRA 3I74A 5F1IA 1E8ZA 3G5VA 3FQWA 3WNNA 3BVDB 5ESAA 2LGNA 1U8LA 4Z7VF 2XV3A 2OA9A 1O6SA 4JY6A 4PY7A 3CZFB 2CIKB 3MRDB 4XP1H 3U0TA 5E7BA 4ANXA 1DANU 2AXFA 2CBTA 1JNJA 2BP0A 1H15B 2TRYA 4ZAKB 1M1XB 3B9EA 1LK2B 3QZLA 2VLMD 4UANA 3DV6A 2FUTA 4UM9B 3A5VA 3HMWH 1I8KB 3D85B 4NB7A 1KLUB 5LAXB 1ACYL 2FJFA 5BZDA 4X6EA 3FRUA 3K0YA 3OKKB 2OXHA 1KIQB 3BPLB 3QORA 3DYOA 1ZKAA 1N8ZB 1UZ6E 3QUZC 4KU1A 1BQHA 4PHXA 4XN7A 3IFOA 4HA1A 2PABA 2D03L 2D3VA 5CJXC 1C9SA 1G4MA 4TVPD 2VRAA 4DH2A 5CN3A 2VOTA 4WTZA 5D2LF 4H88L 5E70A 3SOTA 1P5UA 2HJLA 1IFGA 5C0CE 2LLGA 1WYJA 1MCQA 4XPFL 5BOPA 1AR2A 3MRFB 5JIPA 1YUHB 3C8KB 3WFDH 3T0DA 3W38A 1GGTA 5LKNA 4GSDL 2CMRH 1ZHLB 4J2XA 1HZKA 4PTUA 2X44D 4MX7B 4DEPC 4N5ED 4ZSOA 3ARRA 3OLGA 4X5WB 4FYTA 3TN0B 3E6HA 3RHWF 2AJSH 3BLPX 3LPWA 4AIEA 4QY8A 5I18L 3GS4A 3V55A 1R3HA 2JB6B 4XH2B 2CHWA 4IM8A 3MNZB 4N0UB 2YQGA 1KJVA 3AC0A 1OOAA 4UB0L 4L48A 3AG3B 3PUCA 4JPKH 5EZJA 3LEVL 1DUYA 25C8H 3R19A 3HG5A 1A6TB 2EC9U 2IWKA 1TLKA 2CO2A 1DQKA 3P3RA 5FLUA 3D39D 1EBAA 4DO5A 4F92B 1G7MA 1S7TA 5JDJA 4FQXC 5FHBL 2VDPH 3ZKSD 3OR6B 2XBZA 2WQRA 4M4PA 3CDGB 4XBPB 3UTPE 4CBZA 4EZMA 1L6ZA 3FULA 4X83A 1QX1A 3RTQA 1KF9B 1NCBH 2P45B 1P6AB 4N2CA 3IKKA 4EJ1C 1VFAB 1HINH 3FUDA 4OH2A 3OKEB 3ZX1A 3N04A 5MP6L 2F8XC 1D5XB 3FT9A 4GRLA 1BIHA 2PXYA 3FB7B 1CE6B 2OMZA 3PIQB 4LLYB 2BY0A 1T20B 1JYNA 2R2CA 2BC4A 2DWXA 3QUXC 4P2QA 4Z18A 1N9PA 4NO3A 3HMXL 3IJ9A 1KCBA 1A6PA 4B41A 1HH9B 5F88A 1IC7L 4GRWB 3RIKA 4N5EC 1P1ZA 2AV1B 3ULUD 3FTGB 1YC7A 3HMXH 4B9CA 5C0JA 3ETBF 1BQKA 5F93C 3VD9A 5IT2H 4IDJL 3KYMA 1OPOA 3VMNA 5IG7A 3DJTA 5C0IB 2CZNA 3PPEA 2WCGA 4FI8A 1KENH 2R4SL 5FW7A 1RUAL 3DLQR 4KZCA 3LRSB 3KBHE 3HN8A 3LNGA 5F96H 1T5WB 1Z9SA 3EFOA 2DWTA 2NSMA 4FTVB 5C08D 4JFWA 5BMFH 5MEQB 4L1SA 4ANWA 1U95B 1A4BA 3SDCA 1ECZA 5K9QI 2ICEA 5CBEA 2XN9D 3B2DC 4OFQA 1PF3A 3KPOA 5HYSG 1XF2B 4OZIE 2EJ1A 5EBWB 3MGTB 1HYSC 2JJSA 4XNXH 2XXCB 4NRYA 3X2QB 3FQTB 3T3PE 5IMOB 3GZPA 3S4SB 2EDRA 5I9QC 4FXGB 3O45B 4YWGH 1CDUA 1J1PH 1TVBA 4JM2C 3ABLB 4XXDA 4JREC 1T83A 1R5WA 4L29B 2WBJC 4XNDA 1DJYA 4OLWL 3T2QA 2O6PA 2VMCA 4KRPD 4JREB 3QFJB 4PJXB 1CZ8H 1MWAL 3EH3B 4OCRH 1JE6A 3FXIC 4LNRB 1EZLA 5SWQB 1SHSA 1AKJB 1KNOA 3MRBA 4RAUA 4GAAA 4XMKL 1UEMA 2MTAA 1F4WH 2FX9L 3HZVA 3FS9A 3IJSA 4HDIA 4H1LB 4OGAD 1MHEB 2COVD 5CJQH 1A4KA 3WMPA 4TQEH 3BUPA 5I5JA 3C60D 3NFSL 4QIRA 3QFJA 1DTUA 4KUZL 2J72A 1DQLH 2EDYA 4RNRA 3T3ME 1MCOL 1VZIA 3DWTA 7TAAA 3ZOAA 3B1UA 3BQUD 1JMZA 2VLRE 2X4OB 1EHKB 3A23A 1FFRA 5T3XD 3VQ1C 3DC0A 2KDGA 4LSVH 5E8EB 3FO2A 5SWSA 3UTTB 5LGKA 2ZOLA 3MFGB 2YPVL 1CFTB 2VM9A 5DJDB 4L8DA 1JGUH 1H6TA 4BUHA 4ZNEE 1WFNA 1KCSL 2D03H 1X5IA 3AAZA 1RZFH 1P4BL 2EH7L 3NSYA 3ZRCC 3LIZH 3VRIA 5GS1C 3H2QA 4H88H 1MHHA 1TZHA 2VN7A 5KUKA 3CN2A 2JI2A 3O4LD 1U95A 1TQSA 2AZUA 2QMKA 5JQ6H 1R75A 4DHLA 4FTVA 4PGCA 3NIFB 2A6JA 1QNIA 3GI8H 4K4KA 3HNTH 1RJZA 3LRSA 4NHUA 4RMUA 5L2JA 3WYRA 1ND0A 5MEPB 3VWJC 4CAGA 4Z7NB 1GGBL 5JLZA 3AXIA 2B9BA 4RMRA 1M1SA 4A55A 4OBSA 1WGVA 3V4VL 1YEIH 1W72A 4LSPL 3OKNA 5B3NA 3HMXA 4Z7UA 1RZ8B 3VI4B 4UOZA 4JPIB 1ZVYA 2H26A 2WTRA 3DVGB 2Y1VA 5JPMA 2BC4B 1MF2L 2EC9T 1I3RA 3ZE0B 2FB4H 2HXAA 1XQ4A 2ENYA 4AZUA 1WIOA 4AEIL 5ACMA 4HWZB 5D93C 5CLXA 4DKFH 5JORA 3L1EA 4PRAA 2PNDA 2FK9A 3N9GL 5DLMH 3OWRA 1HHGA 2IF7A 2F1AA 3QO1B 4IGBA 4NQDD 4FNSA 4GW4A 4Z7QF 2PWDA 3TYFB 1AGFB 5FO9A 4O58L 3FONB 1IM9D 2A74B 4MHHI 1IM3D 4R26H 5GGRY 4GXVH 4JN2A 5H94B 1UH4A 1OM3L 1MCPH 3FFOA 1F5WA 4HHGA 4IRZH 2NY2D 2LU4A 5C3TA 1JNNL 2Z6FA 1IL1B 3BDYL 4HSQA 4NQXB 2O26U 4XWOD 5DWUH 5DZNA 4ZPTA 1UB5A 4JFFE 3QJRB 3WGVB 2H5UA 2VCOA 2P5WE 1UYWH 1PZUB 4XMLL 4WEMB 3QXWA 4WCYL 2DM7A 3HE6C 4R5XA 5D7IF 1NGWB 5EZIL 3FRPG 4FKEA 2HT3C 3WEOA 5J12B 2VXTH 3MLSH 1H3PL 4PSPA 1AFVL 2AQ3A 3GIVB 3NN8A 5KVDL 3D06A 2KLTA 3GO1L 2EEAA 5EUKA 1OSZB 4AW4A 3EKCA 2BXYA 2X1OA 1DANT 1P6WA 3RVWD 1HJBC 1EMTL 3RL2A 3WAKA 5DFTA 2KQMA 5JQHC 1UXMA 2PCPB 4QAMB 4LDOB 3RL2B 5DC9B 4TUOB 1NPJA 4FNRA 1HU8A 3P9WB 1H8OA 2QHRH 2JCCF 4NHCL 2YUVA 3CFTA 4ACPA 2YD3A 2AEIT 4DKEH 5BZDB 3HI6H 1B6UA 1HTYA 1I8KA 3D85A 4P4KA 4WFFD 3GSQB 4NPYA 4UM9A 3L3DA 1IAKA 4IGBC 2ZX8A 3UC0L 4AKPA 2OK0L 3MOBH 4JG1L 4UDUA 2HB0A 1QZNA 3VFRB 5AW8B 3UC0H 1DL7H 3C87A 3ZTJG 4YDVA 1AXSB 5EO1B 3L45A 1D7DA 3HHSB 4BSWA 1MFBH 4C54A 2IGFL 4LBEB 2XWJB 5CINH 1MI5B 2AJ3A 1NL0H 4M5YL 5L88L 2GHZA 2KPWA 2YD5A 4FFZA 1NFIA 4KX7A 3MTXA 5CJ8A 4YHLH 4M5YH 2NQCA 3U7AA 1XL6A 4BSVB 3QVAA 1D6EB 4L4VE 1CGUA 2GITA 4WKXA 4Q9QL 1RJLB 5J6HB 4IGBB 3RX5A 4ISVA 2C4FU 3ECBB 3QPQC 5INDA 3B8SA 2P8PB 3MRLB 3VU1A 3V0AC 1H3GA 5EU6E 1YEJL 4GYBA 4IQHA 4L4VD 2A9BA 3P9LA 4FLQA 2KC0A 4P49A 4MMZB 4X4YA 4JHVA 3UMTA 4TYUA 2HP4A 4LRNH 4YBLB 3VFTB 2X3AA 2I9LB 5DRZB 4YGAB 3K4DA 3PGDA 3ATDA 5ETUA 4PP2A 4LEXH 3WE6B 1DVYA 1QSZA 3ZY7A 3AQZA 1B4LA 3I75A 3NIGB 2CCVA 3O11B 4S1SH 5KYYA 1H5BA 4IBUA 1NDMB 4ORGA 5T5NF 5T3XH 2GFBB 2XWZA 2Z3FA 2G5RA 1EJOH 1YJDC 2DLEA 5L2JB 4ODTL 5D2NA 1FYHB 3G7TA 4PW9A 1AQDA 1YEFH 3FC8A 1I8IA 5CSZA 2W0PA 3LXAA 4ZFOA 1WA0X 1XR8A 4DN4H 3SKMB 3U1QA 2PO6D 3TBWB 4Y2OA 3UZQA 3CFNA 2JQMA 3P3UA 1CUOA 5IESL 2Q3ZA 3GEFA 4ONGL 4E36A 1AO7E 5DVKA 5JHBA 4LQFL 3HE7C 3FT3B 5DJ0B 4U0RC 4ZG1A 2Y69B 2Z91B 2V37A 2X88A 2CA3A 2X0VA 1HHHA 2BVOA 3EOYG 3DRQA 5DVOA 3C12A 3VAEA 1A4AA 5JPNB 3LXUX 4MMYA 1F02I 2ZCHH 1WA2X 4A04A 1J0JA 2DAVA 2VDMB 3IMWA 1FL3B 3V9EA 1HILA 3H56A 2LFGA 4P23A 2G4EA 1S9VB 2WXJA 5GGTH 2Z91A 2CU9A 3IFNH 3QS3A 4CADA 3FT3A 4FG6C 1IGCL 3CZUB 4H1LA 4HDIB 3O6FD 1HSAB 3BVTA 3S96A 1C8QA 4U3XA 4BFFA 2XICA 2JJSC 3QIUD 2P5EA 1Y6MR 1S8DB 1T0OA 1BD2E 4KVPA 3RPIB 4F3FB 5CSBA 1XTLA 3IFPA 3STZB 5H37A 2XTSA 4LKCA 2E9JA 1TQVA 2E7MA 3GMQA 3EGDA 4XC1L 1I8IB 1XAUA 2GJPA 3LS5H 2F53A 1PZ5B 5FA4A 4TN9A 5D71L 3MA7B 3T3PF 4EIGB 3EYVA 4JN1H 5GGTA 4N2KA 1TETH 4LGRB 5K9QG 1FYTB 2VZVA 1RUAH 5E2TH 4NCC2 1DO6A 4UIMB 4M1GL 4D0DB 2HUEA 2FJGA 3RI5K 4Q89A 5GSVA 4OD2A 5TQ2H 2OTUA 4U49A 5EIIB 3QYCA 5F9JB 4AV5A 1A3QA 3BSZH 1U3YA 2H7WA 1J5OL 3EYSH 3PV6B 4PJ7B 5ETUB 1KBVA 4FE9A 4UZSA 4B96A 4ZX3A 5C0RL 3ABZA 4YQXH 4V2CB 1SFDA 1G9NC 4KNSA 1MY7A 5EOTB 4ZUSB 3IS0X 3WTXA 5E24E 2MPAL 5DEGB 1IAII 1IBDA 2VABA 1T0PB 1JV5B 4U7SA 4M5ZH 5DJZA 1E5CA 1ESOA 3Q8CA 4UTAA 4O5LH 3A24A 5JIMA 5JZ7D 2ZYIA 2WBJD 1K4DA 1JDAA 4QNPE 2X6VA 4Y1TA 2XBTA 3KL5A 1WH0A 1WZLA 1LP9E 4PRDA 5CMAB 3SDDB 2BWDA 1LEKA 5KTEH 1YNLH 3O3UN 4ZDHA 1Q9LA 2WMPA 2P8LA 3DI2B 1MI5A 1OTTC 3T0EE 3TL5A 1Q72L 1COBA 2CO6B 3LIZA 1WO2A 1QKZL 3E2HC 2XIBA 4I3SL 4RMTA 4HGWB 2E75C 3DXAD 2IBZY 2DQJL 3FU5A 1CMOA 1AXTL 5EU3A 3OKEA 4WFED 3KPMB 4GSXA 4FQXD 4PWHA 4XO8A 5EORL 3BDXA 1QOKA 2ED8A 4JM2D 3K6SA 1ZCRA 4JVWA 4NQCD 5DVPA 1YY9C 5C7XH 1IGJA 2R4RH 4EF3A 2VXSL 2YAFA 5EOQL 1LQBC 5JXED 3EH1A 4PVMA 3MV9B 4Q2ZB 4NZUH 1MRFL 3CHSA 3DVFA 4X42A 2Z8VC 1ET5A 1F8TH 4F2EA 3H7BB 4ODXA 3QUYD 2WVVA 3BKYL 1CL7L 4NZUL 4GJTB 3IMRA 3LKSA 1OPGL 3KBFA 1AC0A 4NN6B 1D5MA 4FJ6A 3FH5A 3C6LC 5T1KA 5FKPA 1D6VL 1D2OA 1KCUL 3TNMB 3MJ7A 3MLVL 3IU4L 5HI5D 4GKLA 5KSBB 3D34A 2MTPA 4KK5C 3ATAA 3P77B 1XH2A 1USQA 3MRPA 1BGXH 1WAAF 1MKFA 4X6BA 4XI5C 5AOZA 4YHMH 2DQHL 3VD1A 3B7TA 2I5YH 3B7SA 1IE4A 3D0LB 3NN8B 4MAYA 2R2HB 2CA4A 2FB4L 4H20H 4U1MA 4P3CL 5FYLH 1B9KA 1X5FA 1OIOA 4NZTH 5E08L 4NJ9L 3W11C 3O3BB 4YDNA 2RBLA 1S9YA 4KHXL 4ODTH 1SVCP 3FQUA 1NGWA 5F7YC 4L4TD 3T0WA 1KACB 4ZJ9A 3MMEA 1CT8B 2ZYHA 4FHBD 4ZMLA 1KJ3H 4PY8I 3ASWA 4TUKH 2V3DA 1XH1A 3UJJH 4UOW1 1MLCB 5F7BA 3KYNB 5EIVA 1FAKT 1DVFB 2D7NA 1NMCB 1CICB 5KN5A 3MOQA 3ZKXC 1TQWA 3ZTDC 2L04A 5CEZE 2RIKA 1TO4A 3UPRB 2IGTA 3GM8A 3JV6B 3TYFA 2EVGA 2N1TE 2XZCL 1H8SA 1HQ4B 3OZ9H 3Q5YA 3QORB 5A3ID 4GW4B 4FF9A 2NY5H 4CNIA 4PJXF 3K6SB 1KLUA 3QO1A 1M2VA 3X1BA 3QT2A 4LEEA 5I1CH 4N6RA 4PG2C 4JANA 1LE9B 4H1LG 1XDTT 3D30A 3GTTA 3Q2WA 1L0XA 4LLUB 4R7DA 1IGYB 1ZAGA 2AXFB 2N3JA 3KPSE 3HI5H 3VFSA 3W57A 2ILLA 3FBQA 1H3PH 2EUWA 4UM9D 1H6EA 2BSDA 1BBJB 4KQ3L 5ESQB 1MRDL 2N0KA 2PXYC 1SDDB 2NW2A 5HDBE 5KVDH 3K6NA 1RZKL 1K8IB 3GO1H 2WMPB 1Q9LB 1WDAA 2DM2A 4JZJA 1RZ8A 3VI4A 1Z5YD 1OGPA 5PAZA 2XG4B 3QDME 1N3NA 1AACA 2WXQA 1AQHA 1NKRA 4HQQL 4ICXA 4AK1A 4DUVA 3FTSA 3LQMA 1Z66A 1RHHB 4DNLA 3QG7L 3VMOA 3DX1A 3Q8FA 1JCKA 4L3EA 4Q6IC 4PLJD 1U8JB 1V3LA 1N6UA 1AI1L 4J8RA 3BKJH 2G3MA 2ZWSA 4W70A 1BW8A