3L9YA

Crystal structures of holo and cu-deficient cu/znsod from the silkworm bombyx mori and the implications in amyotrophic lateral sclerosis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
PAKAVCVLRGDVSGTVFFDQQDEKSPVVVSGEVQGLTKGKHGFHVHEFGDNTNGCTSAGAHFNPEKQDHGGPSSAVRHVGDLGNIEAIEDAGVTKVSIQDSQISLHGPNSIIGRTLVVHADPDDLGLGGNELSKTTGNAGGRIACGVIGLAKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in amyotrophic lateral sclerosis
doi rcsb
source organism Bombyx mori
total genus 41
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3l9yA00
3KM1A 1Q0EA 1YSOA 3L9EA 2V0AA 3KH3A 1AZVA 1SRDA 3GZQA 2E47A 1L3NA 1SXCA 1PZSA 2WKOF 1HL4A 1HL5A 1SXZA 1UXLA 4OJAA 1XSOA 1JCVA 1XTMA 3RE0A 1JK9A 4A7TA 1CBJA 3K91A 1IBBA 2C9VA 2NNXA 1DO5A 1OEZW 2Z7ZA 4A7GF 1OALA 1SOSA 1SDAB 1YAIA 4A7UA 4L05A 1IBDA 1DSWA 1OAJA 5CU9A 2GBTA 1TO4A 4A7GA 3GTVA 4N3TA 2VR7A 2GBUA 1IBHA 4N3UA 1PU0A 2AQRA 3F7KA 4A7QA 2AQQA 4BCYA 1SDYA 3HOGA 3ECWA 2K4WA 3HW7A 1OZUA 2GBVA 3GZPA 3PU7A 4A7VA 2AF2A 5KBMA 1KMGA 1MFMA 2AQTA 1B4TA 1EQWA 2VR6A 3CQPA 4B3EA 2WZ6A 1BZOA 5KBKA 1SXNA 1Z9PA 1RK7A 1E9PB 2Q2LA 2ZKWA 1COBA 2JCWA 1TO5A 1CB4A 3S0PA 3ECUA 1SXAA 2WWOA 3KBFA 3L9YA 2Z7YA 2Z7UA 4FF9A 4U4IA 3SODB 3MNDA 1N18A 1E9QB 1N19A 3CE1A 2AQNA 3CQQA 3ECVA 3H2PA 2LU5A 4MCMA 3QQDB 1SXBA 2SODB 1BA9A 2WZ0A 1OZTG 1EJ8A 1FUNA 1P1VA 1S4IA 1E9PA 2XJKA 3MKGA 2E46A 2VR8A 2AQSA 2JLPA 1B4LA 1Z9NA 2WZ5A 2XJLA 2AEOA 2WWNA 3GTTA 1QUPA 2WYZA 1E9QA 1U3NA 1F1AA 4OH2A 2C9UA 3HFFA 4A7SA 4MCNA 3QQDA 2ZKXA 1E9OB 2ZOWA 1F1GA 2ZKYA 1IB5A 1PTZA 1UXMA 5KBLA 1ESOA 3KH4A 2Z7WA 4BCZA 3F7LA 3KBEA 1IBFA 2C9SA 1XTLA 3LTVA 2WKOA 2R27A 3GZOA 1F1DA 3KM2A 3T5WA 4BD4A 1SPDA 1YAZA 3H2QA 1JK9B 2WYTA 1SXSA 2APSA 3GQFA 1F18A 1E9OA 2AQPA
chains in the Genus database with same CATH superfamily
3S4SA 5CKAA 2DKMA 4RMWA 4PS7A 5LGJA 4KTEH 1J18A 3GZQA 5TJWK 2DQGH 5ANMB 1SXCA 1V3MA 1DJIA 4PHXA 4GP5B 2NX5A 4RIRA 3JTSA 3TWCH 4B9PA 4LOEA 3BWUC 1V7NL 4I4WB 4Y5YC 1IV8A 4DGUA 2PPCA 1CXHA 3L3KA 2ESVE 4U1LA 4IMKA 1Q1JH 1X5LA 3R06A 3BP4A 4UIKL 2ARJQ 2YGQA 3IRZA 4PJ6A 2OMVA 2YAMA 2DH3A 5CGYC 3T1FA 4FHKA 4IMLB 5HHME 1MFEH 1JMZA 3V5DA 1JGIA 2WGNB 4LFHD 3ZUNC 3GGWA 5DZAA 2BDNH 1GXEA 2F53B 2FSEA 3CFJA 4Z76B 5KSUA 5JOPE 3L2MA 5KYXA 1XBRA 3G6JB 5DS2A 1ZV2A 2J7LA 5DUPH 3QFJE 3TV3H 1CO1A 5HJ3A 2IANA 2WM0A 4S0SD 5J56B 2XRAH 5E2WL 5E8EB 1ZT1A 2FJUB 3VB9A 3UXFA 3MO1A 4A7VA 3DUUA 2ADFL 1HKLL 4WUKH 5EZOH 3S97C 5LLIC 1KMGA 4DF9A 4NQCB 4J8RB 1JGUL 2XTJD 4DGVH 3QZBA 5I73C 2ICWI 3FS9A 2C34A 3CXHJ 1TMCB 4Z3HA 4E9LA 1XCTB 5ESQB 4N0UE 1T20A 2NUTB 5KVDL 3WTYA 1BAGA 4JJOA 1ID5I 4HWZB 1NAKL 3U0TA 1F4AA 3N40F 2EVIA 4Y0GA 5E6RB 4BELD 5DRZA 5DJCA 5EIVA 2OYKA 2XLLA 5LN4A 3FTYA 4FZ8H 4F2MA 1M7IB 1N3NB 5EBGA 3CH8A 4K3EL 3QIWB 5DC2A 2YSSA 3X12B 1VFAB 5AWNH 1ZLVH 3B83A 4KZEH 2V2WB 2O61B 2YN3A 3B2UD 3C08H 3C6SB 2QPEB 1MCSA 5JOFA 3HC4H 3QFDA 3ZHLA 2VN7A 4DTGH 2O5XL 5AZEL 3MLPA 2ZOWA 4P0DA 2VM3A 2F9BT 2WC7A 3WNOA 2XKSA 3BUDA 1BZ9B 1P6AB 5E8NB 1HOCB 4RDQF 5LNGA 2EICA 4AXWB 3SPIA 3TVMA 2G75A 2BMKB 1BFVL 2AJVH 2BIPA 4YK4B 3VA6A 3MNVA 3OZ9L 5EF3A 2NXYB 1ZWIB 5DD6B 5AZUA 1ETZB 3ESMA 4A2MA 3QZOA 2IMMA 3MPCA 1HZHH 5F3FA 2JJUA 3CBRA 4YR6A 4AJWA 1DQQA 5GGTH 4PV8A 4HYTB 3PJSA 2ZSWB 1EAOA 5B38A 1OGTB 4BZ1L 3QWNA 4RGOL 3FU9A 2XUWA 3BN9C 2XG5B 2ZNWA 3P2TA 1MIMH 2FK9A 4EI5D 2YRLA 4ONOA 4P4RB 1C5DA 3SBRA 4I9XA 4OSUH 4FEIA 1FH5L 4S1QH 4M1GL 2W07A 1IM3B 2YUXA 4GW1B 5GGVY 4C58B 4YDJB 4YL4A 1EHAA 4EDXA 4GQRA 4M7JH 4IKNA 1OP3H 3UTQA 1H5BB 4FDWA 4HPOL 4MX7A 2XY2A 3ETBF 3EYFA 1KTLB 2HN7A 3HMXA 5T3XE 4P3WA 1KXTA 1DLFH 3IDJA 4WTZG 3N0PB 1GKEA 1R1CA 3FK3A 1WZAA 3BIAX 4YE4L 1UFGA 4H8QA 4YQXH 5AVVB 1WH0A 4GXUM 1NGZB 4J2QA 4I13B 1L7TH 3HPLB 3WENA 2OR8A 5HYSB 3B2VL 3PWPB 3N50A 4JFOA 3VXUE 5C2BH 5MEND 4KJQC 4P05A 2AQTA 1JNNL 4G43A 4J3SA 4N5EC 1N8OE 3L13A 3UJJL 2HKFH 4OFYD 5CP3A 3ZMEA 1Q0XL 5IF0B 4KJPC 4G9FE 5F1KC 2GIYA 2CIIA 1JHKH 3GEWB 1JPSL 3LVTA 3LX9A 4LLMA 4TLTA 4UUJA 5C0IB 2E4TA 4PJHA 3BJLA 1SJHB 1DSFL 3T4AA 5A43C 1UENA 3MACH 1G7MA 3QJSB 3C9NA 1ZOXA 1E30A 3AM8A 4ZNCD 5CCGE 3RU8L 3B8SA 1X5AA 3BCFA 3T0WA 3P9WB 3X1NA 1SYVA 2WP3T 4LSQH 3W9EB 4I18B 2Y25A 4NZRL 2WZ5A 3DSNB 3KPRB 3MJ8A 5BO1H 2ZYIA 5E2UL 3INUL 5SX5H 3AZUA 3WV0A 5KZCB 3APNA 4QXVA 4HEPA 4Y1TA 3MRLA 2O5NA 4GG8B 4UAOB 1KC5H 4RBPK 4JDTH 3QIUD 1EJFA 3Q5TA 2ICCA 3IU3A 2W38A 4AITA 3VNYA 3SJVA 3F7VB 5F3HB 3T0BA 4J6IA 3PYCA 4XBGB 5I18L 2J57A 2P28B 4IS6B 5I28A 4KVCL 5F7FA 2OX5A 3ISYA 3TIDB 3DUSA 4MMXC 4OLVL 1MKFA 3FFCA 5D7SL 4JFXB 2WD0A 4GSQA 5KUMA 5KAQG 1A4KA 2CA4A 4ODTH 4Z7VF 5ENWB 3BRGC 3EJTA 5F1NA 1NCDL 4XN1A 3GXTA 1T0NA 3MRHB 2GSIB 1YNTB 3I2CH 2Y9RT 3NAAH 3US9A 2ZG3A 5GRJL 4JM2C 4PJXE 4ELKB 5F7KC 4PJ5E 2DM3A 2EC9T 2PETA 2YC1A 4QOKA 4Q2ZB 2DN7A 3ARBC 3AG2B 3MREB 3QI9B 4DO6A 1JN6B 1G43A 3NCEB 4GO9A 4NKIH 3WFCH 1YHPA 5I2IA 3G6DH 1J8HA 1LK3L 1R5IB 1S3KL 3HZMA 4AC4A 4JO4L 5LDUA 1JERA 1SEBA 2Y7QA 4JPKL 3P3RA 5C0NC 5LBSL 3L4WA 3J7HA 3D06A 4ZX3A 4LDEB 2OAAA 1G7IA 1MEXL 2E7CA 3NESA 3JQOB 1KN4H 5G5DB 5IHBA 3PGCA 5EZLB 6FABH 1JYXA 3PGDB 4M5ZH 4NN5C 1KEML 1U8PA 2P26A 3VFSB 2WBXA 1NJ9B 4IGBB 3LD8C 3ZTNL 5HHXH 4FNRA 1XIWA 4GS7B 4J28A 3GSRB 3LXUX 4WAFA 3B56A 1W16A 1WZMA 4TS6A 2WCPA 1YEKL 1IGJB 4X7TA 5EU5A 2IH1A 2CGRL 3HI5H 4Y16B 2AK4B 5CCKH 2G4GA 5DZPA 1LK2A 3U6XS 3P73B 2WOYA 3NABL 2QLYA 1ZSDB 1FBIL 1SM3H 3DURA 1JRHI 5D1QC 4HLEA 3ESUF 1JXDA 4JFEE 3KBPA 1NGXA 3MV9E 3X3FL 4DZBB 3R8BB 2H3XC 2NOYA 3MGTA 4PJDF 2HYMA 5CSZB 4MQSB 1T1WA 4YSSA 4FFZL 4WI7A 4XT1C 2FYYB 2AQSA 3HS0A 3E6FB 4XP4H 5JW3L 3H7BA 5E03A 3BUBA 1U8IA 4HGKC 2L7QA 2E9WA 4IU2A 5DMKA 1FNSH 3U1SH 1J5IA 1H0DB 1FFPA 2OZ4A 3EBGA 3W2DL 3M1CA 1AMYA 5IHZA 1QASA 4OGAD 4OZFA 5F96L 2VLMD 4MMYA 1RFDL 1ND0B 3UBFA 5FECA 4I5BA 2Z31B 5F21B 2IOMA 1JV2B 5C0CB 4RZCA 4WW2B 3ZQ9A 4F8OA 3OR6B 4QLRA 4JFSA 3LS5L 3PHOB 3IWUA 5JIHA 2FLRT 3HPJA 2UYLB 2EIEA 3GB7B 1OHZA 3HI1B 3SDXF 4YBHA 3VWJC 1OOAA 3QHFL 1JK8B 3KR3L 2DV6A 3RLSA 4NI3A 3VRLF 5IESL 2OA9A 1YAZA 5I1IL 5FUZH 5KSAB 1J88A 1T2QL 4XCCH 5HGGS 4IDJL 3MR9B 4UT7H 2P24A 3UTSA 4DOHE 1ZEAH 1DL7H 4MJJA 4DP1X 1KN2H 1NBVL 1R5WB 4JK0D 4JFTA 2A6IA 1A9EA 3FO2A 2VR4A 2PTVA 3IPFA 4JKNA 5E0FA 4DW2L 4NN6C 4M6OL 4D9QD 1FVCA 5ITBH 4ZUTA 1P84J 4LQFH 3V0DA 1HTYA 3BZFA 5T5FL 3S2AA 5K9QI 4J6RL 2KDYA 3EFOB 5HYQB 3CZFA 2W9LA 2HJFA 3L3OB 4P46B 2EE0A 4PJAA 5GRWA 4BKSC 2AJZA 5KVGL 3FN9A 2YIHA 4K7PY 4X4YB 1IGTB 4UOJA 2D7NA 1GYWA 1HOEA 3X3GL 2R0LH 1MNUL 5ADPL 4G80B 1VFUA 2EABA 4Y5XA 4WFHD 2ZONA 4AQEA 3Q48A 5B7FA 3DX9A 2Q10A 2PWFA 1E0OB 1EEYA 1I7UA 2O72A 3FBKA 1LEKB 3RGHA 1DTUA 4L3CB 4DP4X 1M53A 1MCJA 4ONFL 3L45A 3WAKA 3QC6X 4NPJA 3NJXA 3DRTA 4JFHE 3ISWA 1Q9KA 4L23A 1KPRA 1NCCL 4A6YB 2YS4A 2BVEA 4QHKI 3PQYE 4NGHH 4BM7A 2X09A 3AXLA 2DPKA 1KFAL 1F6LL 3VI3A 1LEGA 1M6UA 4R96B 4IKLA 2H2SD 3GI9H 3MNDA 5CGMA 5J9PA 4OM1H 2VIRB 2VLKA 4KKZA 3U25A 1G7QB 2BNQE 5DGRA 1R3KB 1ZLSH 1TZHB 1RZJH 1P1VA 1JZHA 4K9EC 4H25B 5TE7H 2XJLA 1EO8L 1KIUB 1F56A 4C55A 2HVJA 3I02B 1P5VA 3QAZB 2CD0A 1TLMA 3LKRA 2YK1H 4OZGA 2WWMC 4QO1B 3NG5A 9CGTA 3CG8A 2XV2A 3UTTB 4HPHA 1Q9OA 3CVHB 2BWDA 4QJ3B 1KCVL 1JMXA 4G9DA 5I8CA 4XCFL 4N8CL 4ZI8A 5K9KA 3V4VA 1DQIA 2AJUH 2EIMB 3DNKA 4NUGH 4GBXB 2MRYA 4G83A 4GRWE 3TM6A 4HWUA 2LABA 3N04A 4X5WA 4ZXBA 2IIJA 1D7CA 3LPPA 1I1AB 4NO2B 2BJMH 1M71A 3KWTA 4PWFA 3FTVA 4HKZA 4O2CA 2F18A 2OP4L 4R8WL 5AVTB 1G0DA 3WCYA 3VYOA 3CFDA 3FSVA 1XB8A 3K6NA 4TL5A 1B9ZA 4HIQA 5I0DA 2IBZY 3BWAB 3BWZA 3D08A 3T65A 3BP6A 1G9MH 3I50H 3KVQA 3HB3D 1G1KA 3D0LB 4FYSA 4L1BA 4XH2A 1OE1A 3D07A 1DBKH 3BAEH 3R7RA 3O9WA 5E1IA 3QFJA 5K33A 3MJGX 4BWUA 1K3IA 4HKJA 4AT6A 1FSKB 1MFUA 3CXDL 1P84K 5CEXB 4HJ0D 3SBPA 2I9LB 1KTBA 4TSAH 3ZL4H 2XQYA 3OR7A 3SCMB 3PY9A 2WYHA 4GAYA 5DQDH 5BJTB 2XXGA 4CKQA 1Y1DA 1IGFH 1HSBB 3U4BH 1TZOA 5EU3B 4XAKD 3ZE1F 2E0PA 2WXGA 1A3LL 1SOSA 3PWUB 5GS0D 1D5XA 2VJ8A 3BAIA 4N0UA 1JZ4A 3U30C 4MDIA 4XPAH 2Z34A 3QULA 4ZDHB 1BQLL 1MRFH 4IBUA 2WQ8A 4OQ1A 3DHMA 2IAMA 4HZLA 2VYRE 4PS4H 5IB3B 5C08B 1ILUA 3WIFA 1M1XA 4POYA 4M03A 4QXGL 4RFOL 1TU2A 3ABZA 3ECWA 4DKEL 1NLDL 1QFHA 1YEHH 3BSZA 2ZUTA 4WWKC 2VH5L 4N5UA 4NKDA 2ENPA 4HAGA 4NFDA 1LNUB 4CC0A 4ZK8A 4KZDL 4AKOA 3TJEH 1J1XL 3MLWL 2FR4B 4JZOA 2VMDA 5D1XB 5EEZA 1I3RB 3L7FB 4XP6H 4YZFF 3L1EA 5C0DB 4BK8A 1P4IH 3D39E 1T0MA 2QLVB 3IDMB 5SWZB 5IB1B 3MFFA 1ET5A 2YKLH 3GXUB 3CMOL 1SLVA 3AFLA 1SDDA 1UA6L 3WY2A 1NEZA 5ISZE 4M6AA 1Z5HA 1DUYB 5CJBA 1QO3B 4MWFA 4LHUG 1MPAH 3FU7B 1B4LA 1FJ1B 1ES0B 3H3PH 1P4UA 1OF2B 4HSQA 4XP5L 1MZYA 2P44B 2Y5TB 3ILQC 1RIUL 4PJ9B 4KPHH 4E0RA 4H0GA 5F2FA 2J8UE 4JCWA 4QYAA 1F00I 1G7LA 8CGTA 4IMKC 1CE1L 4P4KD 5ID1A 1DVZA 1EDYA 3NUKA 1IVTA 1T4KA 3O3EB 1E9OB 1Q72H 4U3SA 5IQNA 1AO7B 3BYYA 1TVBB 1DN0B 3A6BL 3D2UD 1GPOL 5J1TC 1JD9A 3OKNB 1AQ8A 4I9WE 1GZQB 3E8VA 3GI8L 3EYQD 5IK3B 5DK0B 1ULVA 3MLTA 4MJHA 1EPFA 1SPDA 1OPGH 1WEJH 2OMTA 2OXGB 2NNAA 3CPUA 1MG2C 4HX1B 3U6XA 3UTTE 2Y06H 4I0PA 1UXWB 5C0RL 1J7VR 5C8JA 3QNZA 3QO0A 5ELIA 1LQSR 1JJUA 1NIEA 3ULVE 2OK0H 1QTPA 3T04D 4BH7B 1JXJA 5EUOB 1KTDB 4NO3B 5LQBH 4PCSA 5F7BA 2BINA 4QAWA 1SOXA 4TULL 5FYLD 5A2FA 1BEYL 2Y6SC 4X5QA 3D4GA 4H5SB 1FFOB 1W72L 2DD8H 4UQCA 4OD2B 3H9SB 3VXUA 4BZ2L 2YBRB 2ZXCA 1R17A 2Y2TA 3VFTA 3V7MA 1T7ZA 3UG4A 4G6AC 4G9FA 2AJSH 4X9YA 1MFAH 4G6KL 3Q8AA 4DFHA 3BRDA 3MLRH 2GPZA 4PRIB 1YY8A 3O11A 1U3HD 4J8RA 2AQQA 3PL6B 2FBRA 3UTZA 2VMEA 2K4WA 3V5HB 1BBDL 1OZUA 5LCVA 1KUMA 3WIAA 1WICA 2OKMA 1PAMA 3G5YA 1J9SA 3BPCB 2R1XB 1MHHB 1JZ2A 3JYCA 3MYZA 3SBQA 5BVPL 3NZ8B 1E67A 1KYAA 1ZVSA 1GOFA 2VMFA 2CGRH 5IJBC 2D8KA 2CDEB 1CXLA 4ZJ9A 3MU3A 4WU5A 1RVFL 5DLMH 2WQAA 5I8EB 3IBEA 4ZFGL 3BIKA 2JKTM 5CGYD 2CPCA 3WL9A 3NYKA 3LN9A 2YQ3A 2E6PA 3QQDB 4M6NL 1KG0B 1NDGB 3X3FH 4ZPTA 4NHCH 4S1RH 1CFNA 1XGTA 1RK1A 4M56A 5EOCL 1A02N 3HZVB 1YYLL 2WWNA 2RFXB 3RNKA 3QUXA 2HFGH 2WYZA 2ENYA 4P06A 4F24A 3UZVA 5D96C 1CYGA 3MRQB 3B2XA 4FG4A 4N1HB 2Q7YB 2QADC 1T1YA 3Q2VA 2X38A 3RWDB 4PJXA 1FPTH 4PJ5A 1R5VB 1FHNA 4M7ZB 1XTLA 5KTEH 3UC2A 5DSCA 3KPOA 2OMBA 1AQMA 3IJYA 1ADQA 2ENJA 2BVPA 1E4XI 2NR6A 3KLSA 2V7NA 3OXSB 2NNCA 5GHWH 5E5MB 3VQ1C 1HHHB 5C0FA 2A5UA 4MBOA 1PLCA 2AANA 2NNXA 1S6NA 2VZSA 2Z8WC 3SDAB 1JL8A 2YZ8A 3CVBA 4NQED 2BZ7A 2R4RH 3U9UB 1DQDH 2Z4QB 3PABB 4JEGB 3BH4A 2ITFA 4OLYL 4ZMQA 5HJGA 1NDMB 1P5UB 3GMMA 4MA8L 3DX3A 1SN5A 1CD0A 4FQQA 4M6OH 2OMXA 1KCRL 4FD0A 2DJMA 4KX8A 4B27A 3OMAB 3DRQB 4M7KH 5DVPA 4JPWH 3CXFA 2DRUA 4HH9B 2G9HA 2AZUA 2IDTA 4E9RA 5H4ZA 1USQA 1AKJB 2VUKA 5GGUA 5C07D 2MKLC 3T4AC 3WDIA 1WT5C 3ZKXB 3UTPE 4B96A 3AM8C 4PY7A 3STLB 3OSKA 3ARWA 3HC0B 4L8SC 4YAQB 1TTAA 3ML8A 3X3GH 5BMFL 2GSGA 2OM5A 2PWEA 4GKSA 5E2TL 4ILDA 3FT4A 1CJYA 2DTMH 1MCIA 1MFDH 2FO4B 5AOMA 2OYPA 1K8DB 4JFEA 4OGXH 2G5BA 4Y5VC 2H32B 1U6AL 3MV9A 4PRPD 5EBLB 1PFCA 3PXJA 1K2DA 4PJBF 1MCOL 2H8PA 3GZPA 1I85C 4NXKA 2MPAH 1JWUB 2ZE0A 5CHNA 1N6UA 1E9PB 4PFEA 3TNNB 3QQ4B 2IALA 4PVMA 1TO5A 4OTXL 2AFNA 1S8DB 2AZAA 3FQUB 3A23A 2O5ZL 3BN9D 3KPSB 3DX1A 4EZKA 1RU9L 3OV6A 3O6KL 4M1DH 4TKWA 2A4EA 2NNRA 3JT0A 3L4TA 1USZA 2YMOA 5D2NB 3ECVA 5FM5O 2UY7A 4MVBC 4WHCA 4AC2A 1BA9A 1YNKL 2DM2A 3KJ4C 5HGBA 1BYNA 1UFUA 2VQ1B 4W6YB 4ZS6C 1NC4D 5L2KD 5DVMA 2BW4A 2JLPA 3BWUF 4K5NA 3W81A 4A39A 2YOAA 1F3DJ 3PJNA 5I0YA 5AAWC 3EBIA 3Q01A 4TVPD 1RJYA 3DV6B 1D3CA 3BAKA 5B7EA 4G11A 3V8CA 1J5OL 3ATEA 5IFJA 1N8ZB 3GMPB 4Y9FA 1NFDB 1UH3A 2PCXA 5F9WB 1GJWA 4B41A 1S7WB 4KJQD 1UWGL 2AK1H 3RDTA 1MCQA 5HDBF 5MI0C 2PXYA 1MRDH 4N5ED 4AL8L 1TTRA 3K4DA 3IMBA 5I24A 4F27A 2XN1A 4JRLA 2QPDB 4KJPD 3ZTEA 2Y36L 2ZX8A 1WFJA 1KGCD 3F7QA 5E08L 3GEFA 2PABA 3CZNA 3MTXA 1KBPA 3BI9X 3U1QA 1SXSA 2FX7L 1TQCC 5AFAA 1UKTA 4OZ4B 1SF3A 1XIWC 3LIZH 3LRLA 9PCYA 5GZNC 1N6QH 2VDRL 4HJEA 3ASNB 3EXJA 1KYDA 4G5ZL 2VDKL 3L9BA 1XCQB 4H1LA 5E9DE 3TJPA 3AS2A 4WFED 3BZDA 3MLZH 4YHIA 1SMDA 3RUGB 4LAQH 5L0QB 2WY3B 4YHPB 3CFEA 1A7OH 1CFVL 3RZCA 4B9FA 4FULA 4NUMA 3BPLC 5BW7A 2WVVB 3C5XA 2O93L 4A67A 2EYSA 1KDIA 4ICXA 3TBTA 3RL2B 4KUCD 3PQYA 4MNGE 3O4LE 2WLHA 3IETA 1D5MA 1KZQA 2ATPA 2EH8H 1NIAA 3OKKA 4N26A 2WZPD 1EMTL 3PGDA 1F6AB 2D7OA 2KERA 3ARDA 3HS0C 3KDMA 2X9YA 4QHMA 3ABLB 2YXWA 1NJ9A 1A3LH 4QRSB 4TQPA 3UYRL 3BO8A 3LRGA 4DGWC 3RWIB 2XWBA 5D7IE 2WXIA 3VGFA 1FFTB 1YCSA 4LVHB 4G71B 4HJJL 2DW5A 3SQBA 3HG5A 2BNQA 4WFGD 1B0GA 3R0MA 5EZJB 2GKIA 4OQTL 4PP2B 3W0WE 4BK5C 1LO4L 3IJ7A 4R4BB 5IB4A 3TJHD 1HI6B 4XPGH 3ETSA 4X8CA 3EDFA 4JM2D 2WUBH 1WA0X 5DJ8A 1AS6A 4GSDH 4WRLA 2VXSL 2BX5A 3Q6FB 3LEYL 2H5UA 4RISH 3ARBD 1IL1A 3ZDYF 4KZDH 3A22A 3GDBA 2P7TA 3MLWH 3ECUA 3L2NA 3TX4A 2F1EA 2P43B 2PR9A 3F83A 4FLQA 3F01A 4R7LA 3RX8A 3SQOL 2RGSA 3FFDB 1QA9A 4MA1C 4TTDD 5C0ND 4I48B 3EH2A 4U6TA 3N85L 5MHSE 2NXZB 2Z92B 4PJEE 2B14A 4S10A 1GYAA 1UA6H 2HTKC 4ODWA 3QFGA 3MGOA 2GFBB 3IVKA 2B1OA 3RZWA 1X7SA 5KJ7E 3VRIA 3MOAH 1EH9A 4FC3E 5CP7B 4JRXE 3V0IA 4ZOCA 3ZU8A 3KMDA 4BH8B 4JKWA 4CN6A 1GAFL 1X5XA 3DROA 4C4KO 4ZQTA 2PUQT 2G0LA 1KLUB 3BD3A 5BRZE 2W1NA 5BZXA 4UWQB 4M4RB 3MRKA 1JDDA 5AW1B 2NY5C 4AJ0A 3MLSH 1NGWB 4IU3A 4YXHL 3E2HB 3UJIH 4FQJL 5TPWH 4AGLA 3OJDA 1U8OB 1IAIL 2XFXB 5D71H 1AYRA 4LOUC 1JXGA 3WUZA 5D1QD 1JF6A 2NY6B 2G3ZA 4BFEA 4N0FB 1T21A 3QORB 5JW4R 1UJTA 4JMXA 1MAMH 1X5KA 2DQHL 5G55A 1IGCH 3UADA 3HZYA 1BLNB 1YEDB 1CQKA 3CFUA 4KTGA 3EFDL 3NCYP 1GKOA 1MJUH 2O5YL 5F9AC 3ZPDA 4Z1PA 1Q94B 2WNGA 3MVSA 3SD2A 5IHWA 1CLOH 2E27H 2VAJA 3E1F1 3QDME 2ZUVA 4PI0A 5DURD 1QSFB 1ZSHA 3HHSB 2I5YL 4HK0B 5JUEL 1JZ3A 1FG2A 5EF2A 5C92A 1A14H 1CZ8L 4L3EE 1R3IH 2LAAA 3QEGH 2PP9A 3N41F 4Y4FB 2IG2H 4WI8A 1BD2B 3IMVA 1BQKA 2J8HA 3FULA 2G3MA 1YAIA 3KPLA 4NLAA 3M7FB 2Y6TE 4Q6YA 3D39A 1VZGA 3MCYA 4X6CE 1CGUA 1OK8A 1FN4B 4Z3IA 2R23B 4PHZA 4G82A 3GTVA 3TYGL 2EACA 1OB1A 4NUJB 4BE5A 2B0SH 4OCLC 4PJIF 3C6LB 4NWTL 5LAXB 2BY2A 2CKBL 1ZA3B 4UTBL 1L9PA 4LDCA 1JGLH 5ISZA 1PSKH 2VISB 3VH8A 5B8CB 2IPKB 1KNOB 3V5KA 4Y1AD 1P4LB 3BKJL 5DJ6A 5DD1L 2O26U 3KXFE 4G7YH 4TNFA 4AGNA 3QEQE 4Z9KB 5AVUB 1YEIH 4R26L 2J8UA 4X7SH 1SXAA 1TYJA 1XXDC 2OJEB 4XNXH 5FA4A 4P99A 3L08A 3H9HA 2HT4C 3VGEA 2KMWA 4KH9A 1DCLA 2FB4H 5DJ0B 2FJFA 4OZHF 5LWYL 4ALAL 5MERA 1JUFA 5FXCH 1EA9C 4RWYL 5JW5B 3HLKA 3C09B 1AFVH 4ONHB 4Z7WE 1D6VH 3D48R 5I19L 3MCKB 4E9TA 1XH3B 4LKXB 2XKUA 4ZUUB 4AVKA 4L2YA 1LE9B 5IW1A 1WZKA 1Z9NA 4WTZA 2FO8A 4NS0A 3O9WC 3KGUA 3TIEA 1AS8A 1NKGA 3ETBJ 3KE0A 3SKJL 5GS0L 4OJFL 3ALXA 2EEDA 3FQ2A 1ZVYA 5EDSA 3NH7L 2VDQL 1LLAA 3KNBA 4CBZA 1NWPA 1U3NA 4W9CC 1CR9L 1YEWA 5HYJD 3RNQA 4B97A 4IW4C 3TFBA 1IKNA 1IUZA 4N0YL 3WJJA 1U93B 3T77A 4LF3A 1X5ZA 2OZNA 3F8UB 5IOKA 3OLEA 1IGMH 3ABMB 3HBQA 4G42B 4LKCB 4N90E 3VW3L 1DBJH 1AANA 3IS1X 1BMZA 4HV8A 3V95A 5BZDB 2FEEL 4KJWC 1RUKL 4A66A 4JKKA 2IAMC 1V54B 1OAZH 3QB7C 3LZQA 2X7LB 4JG1H 3MOBL 2MQ3A 3O41A 1UACL 3W9DA 1O0VA 3HJ0A 2OR9H 2PTUA 4WDIB 3MV7B 2IDSA 5JHDB 4R7NB 3TPKA 1B90A 1XBDA 5HHPA 3GXIA 3FPXA 4I3SL 4NKQB 3MDJA 3LMJL 2B8OT 3JWNG 2YRPA 1QWHA 3NZHH 4MA8H 4BGDA 1AZBA 3GIZL 4KY2A 3ELAT 4H88L 2F54B 2WWMD 1IU1A 4OCXH 4X98A 2NY4C 3N1QC 4XWGH 4DK5A 2R8SL 5CU5A 4WW1A 5H2BB 3BT2L 5F7UA 5IB5A 3TCLA 2YAQA 5LGKA 2ZUWA 1Z3GH 4XZUB 1YA5A 3E1ZA 4S0TD 1F8TH 3NSJA 3WKPA 1HQRB 1FNLA 2RA1A 3B2PA 4H2AA 4MA7H 3AT8A 4BFBD 5DLLA 3EYVA 1YPZE 3BVNB 3LSOB 5ALBL 5DXWA 2FECI 4LARL 3CFTA 3E38A 5DTFA 4NM4L 4YHLH 1PLAA 2GABA 4F7MA 4WGWB 5C2UB 1UM4L 4IBWA 2UZYB 3BP5A 2JI1A 4APQA 3GUTA 1P7QA 3HG4A 1TVHA 1HHIA 3B9KA 2C7UA 3ZTDC 1AQKH 3WNPA 3FQWA 1Y0LB 2IAAC 3NJLA 2NZIA 4X2UA 3RWFB 1NGQH 4LLVA 2A9DA 5EDXA 4WO4A 5D1ZB 4YIQA 5J12B 1MFBH 3DXAB 4ZS7H 1QSZA 3B3IB 5JR1L 4NP9A 4Y4KB 4HEME 1LWHA 5FYLL 3F3HA 5B3JF 1EHLH 1DO6A 1KPUA 3AACA 4PRAB 3QHTC 3GSNA 5F1IA 3QCTH 5FO2A 4L4VB 4N2HA 4FYQA 5F70A 1T83A 3QPQC 1HXYA 3TO2B 1JF1A 1NSNL 3LXBA 4XOBA 4KO6A 3BD5A 3OB0K 3KL5A 4MRCA 4UILL 2W60B 3VDAA 1Z9LA 1FL6B 3IAGC 1J1PH 1CK0L 3L1OH 3EGSB 3TA3D 1BAWA 4I7ZC 3KPMB 1ZPUA 1VAHA 3CN2A 5IW3A 3NJNA 1HS6A 1IAKB 4LNRB 3W38A 4PUBL 4WWKD 3VGAB 3CLWA 5EOCJ 3WTUA 1TQSA 1PZ3A 2J3SA 4F15B 3FF7A 2J1XA 3B5GA 3KYOB 2CJ3A 1TJIL 2LU4A 3I9GH 5ICXA 3BQUA 2R27A 5DGQA 2HRPH 4JRYD 2MHAA 3N1FC 3LPFA 1EDHA 2K6YA 3A67H 5C09B 3GJFA 5L8LB 4DN3L 1AXTL 1J5CA 2J88L 5E6IA 4UNTA 1RZ7L 1CT8B 4X6FB 4XNAA 5AG8A 1DQVA 2E59A 3GHBL 5AVWB 2N7BA 3LNIA 3UAFA 1RKRA 2YGNA 5JTWA 4AYDC 1TPXC 3OKOA 3QARA 2HVBA 5IMKB 3I85A 1HDMB 1O6SA 3ILQD 4JZJB 3IEAA 1A6TB 4N24A 5AYUL 4CMMA 3W3BA 3X11B 3BMVA 3OMZA 3QIWC 4MS6A 3VXTA 4AQ8A 2X42A 5FFLA 1OAYH 1EEUA 4BKLB 2WXKA 3MBEA 3T1WA 5AB1A 5FYKU 3W39B 5I76A 1VCBC 5F7LB 3TYFB 5KOMC 1MZZA 4OGQC 4FL4C 4FG2A 4MJ6A 5I82A 1T22B 2FIRT 5DHVB 2A0LC 2E7DA 1BJ8A 3BEWB 1NFIB 1GGUA 3QUXC 1UHVA 5CWSA 3S9DB 1PY0A 2IAND 1WCBA 3N55A 1YECL 2OMWB 4JDZB 4PVNA 2EO7A 1HN1A 1MJ7H 3JWOH 4Z3EA 2XQBH 4TPRH 2X70A 2BNUA 3FT3A 5DHYB 5FYKH 3S96A 4PJFF 5HHQB 2NXYC 3QUKB 4B6ZA 1RK7A 2GK0A 4NKMB 4NC1C 4I0KA 4GAFB 1FQ9C 2JV6A 2Y6SD 5JQ6L 5F0PB 3M45A 5FDYA 4BJLA 5JIPA 4FQ1L 2NQCA 2OXHB 1ZJAA 4N6RA 4CVZA 2TAAA 3P4MA 1JFQH 3IXTA 4F8TA 3ARFA 5ABDE 1EXHA 5I66B 1XGPA 3VXRE 5LXVA 1YVLA 4CC4C 3HE7A 4FEMA 3U7YH 2J2ZA 1BGXL 5FCUL 3FTSA 5JPNB 1JYNA 5F7WC 3MYJB 4BSJA 4XPHL 2YKKA 3LKOB 2EDFA 4G6AD 4ZO6A 4W9JC 3V0VA 4Z7UE 5D6CA 3RA7H 4U1GC 3PNRB 4GAAA 3WXVL 1Y6MR 4X8GA 4IDLA 5DK2B 3VRJB 4L0ZA 2D3LA 4ETQA 1XR8B 4UQBA 4ZAKB 3V4VH 2ZOKB 4K2UL 2PR4H 3JUZA 5E9DA 1PZDA 1KJ3L 3BVUA 1BZ7B 4D9RD 4L29A 5J7CC 3J07A 5I8OL 1DYZA 4LGPB 1BF8A 4U1MB 4K5MA 4UOW0 1NZRA 2HH0H 4UB0L 5D5MB 1H8SA 5DI8A 3HZ3A 4OLXL 1I7RA 1JTTA 2CCVA 3OX8B 5AKTA 1QPXA 3VMOA 2XFGB 4HJTA 5DYOA 5EOQH 4MNGA 3O4LA 1IIKA 5I1HL 2VERA 1KJ2B 2ZIDA 4ZTEA 1F13A 2YPLB 1ECZA 3IDIB 4ZO8A 1AZVA 3K2IA 3PHSA 2W91A 4HIXL 4JAMB 5CEYB 1G9NH 3WIIH 1XF2A 4LPYA 2DQTH 3NMEA 4N28A 5EO0A 1KBWA 1QR1B 2DWDA 4K94H 3WN5A 4I3RL 5D7IA 1JV5B 5JHMA 4XNUH 1NAMA 1PLGL 3M17A 1D9KA 3CC5A 5KBNC 1ACXA 2AQ1A 5FUCE 1EBPA 3AQXA 3K91A 3P30H 3L3IB 3TGXA 4MNQB 5C6WH 3W0WA 2HWZL 4TVPL 2Q0ZX 3JYBA 1MQ8A 3SKMA 1B0WA 2QADD 5I1GH 1MWAH 1TJHH 4JHZA 5JXEA 3L6FB 3WGUB 1I1YB 4JFZH 2JMRA 4UAOC 5IJVA 3EH4B 3K5SA 1Z5LB 2VDLH 1S9XB 3X13B 5TQ0H 2Q2EB 2CMRH 2IWFA 3SDDA 2VXQH 2BSDA 4MBRA 1C5CL 1DEEA 3QA3B 4Q9RL 4R6UA 5I6NA 3MBWB 3SN6N 5KANG 3BSZH 5ACMA 2IH3A 4PJEA 1Q9WB 4OCMC 3GMLB 3T2QA 1AC6A 4HFWB 4Q7DA 2R56H 2RACA 4WWNA 1UB5A 3IN0A 2GAZB 4ANKA 5IBLC 1A9BA 5E51A 4JRXA 4MQ7B 1EZSA 2WCSA 2JCWA 3PG2A 3RPBA 4QMEA 4WV1B 2YAPA 2WXFA 4WI9A 5E1GA 1EGJH 2BP0A 3OXRA 1KXVA 3INOA 5BRZA 4RFEB 5C0BD 1MHPL 3O0RL 4IOSA 1ZHLA 3DBXA 3QI9C 1NKOA 4KWUA 4ALAH 4TUKL 5JZ7C 2PO6B 4MS8C 4NRYA 5A3IC 1XAKA 2XV0A 3I6GB 5DQ9A 2BY3A 1WFMA 3BYTA 3KPQA 4DN4H 1KYFA 3N44F 1OARH 4PGDB 2C1PA 4YHZH 3QDJE 1X6NA 1D5ZA 4XP1H 5HSFA 4XO5A 5D7HA 5BW7C 1VADB 4HH8A 2J6WA 4PW3A 1I9EA 3SJVD 5KSBB 5CF3A 3KEHA 3PDOA 4FQXA 5GSRB 1Z2KA 5D70H 3QDMA 1FIGH 2EC9U 3ARDC 3U6RB 3FQRA 3GBML 2ITDA 3Q5YA 5I1KH 4WJG3 2MTPA 3GZOA 4X8JB 3FFCD 1ASPA 4FQHB 4GS7C 2VABA 4L3EA 2ISDA 2P45B 5I71B 4U7SA 5J1AA 5IVXE 1XCQA 1RP8A 2APSA 1CTMA 4YSQA 1ACYL 3HA0A 4FTVE 4WFFE 1FGNH 4MVBD 1TTGA 3L3GB 4LHUA 1LE5B 3GSWA 3TBVA 4JLRB 2WN2A 3ZTJG 3EOBA 4ZS6D 3CLFL 5DMJB 1L3NA 1YN6B 4X6CA 1PZSA 4MASA 5KN5B 4N2IA 5IQ7H 4J2XA 4QOKD 3WFDL 3D0AA 4HS6A 3HUJE 4LBEA 3RE0A 3UL4A 1HVXA 4IQHA 3SGEI 5GGRB 43C9A 3P4NA 3VE0A 3VFUA 1H6TA 1J8HD 1BQHB 3NSYA 2WQWA 4FXGA 2VDOH 4ZW6A 4EVNB 5JW4Q 1P0SE 3T08A 3UMTA 2YA2A 3HS8A 4UOW1 4X5XB 5EORL 2Q5BA 1QRNE 4JL1A 1SYSA 3BUQA 3ZE2F 3KXFA 4ZX6A 4G1MB 4Q6IB 2Z93A 4JB9H 5FFOA 1PL3A 5KVEE 3QEQA 4MJ5A 4ZUSA 4UU9B 4NT6A 4DPBX 1SEQH 5ALBH 1MLCB 1DLHA 5EO9A 3WHE0 5CN3A 4GEIA 2Z31C 3GHPA 4JPVH 1QEWB 3H55A 4WKZA 1Z32X 3T2OA 4WW2C 3L5WB 3TEWA 3ARUA 5SWQB 1NMCB 1UM4H 1EEQA 3S36L 1FGVH 3QP3A 3O2WL 4MAUH 1AY1H 1XIWD 3MRDB 4XPFL 4WY7H 4Z7WA 5GZND 3WUWG 5T5NG 3UG5A 2C5DC 3RG1C 1ZDSA 4F7PB 5LJYH 2CR0A 2BRQA 2DH2A 2B08A 2Z9TA 1EWHA 1F11A 1FNGB 3L3DA 1W72B 2E6JA 2XA8L 3RY4A 4QRUB 2Z7UA 2ERJB 2QT6A 4PRBA 3IAQA 1ZKAA 2A3TA 4MMZA 5ETUB 4BSVA 2OTUA 2HJLB 3CDCA 3RJOA 1KENL 4PTUB 4HUUA 2RD0A 4LSPL 5BQ7B 2RJMA 3JWNE 2R29L 5K69A 2J44A 3IFOA 4FGMA 4L8CB 4CBPA 1MRCH 3P02A 4IBQA 5DC9B 4Z6AT 5D7EA 4QY8B 1CFSA 1TQBC 3CH1B 1I9IH 1QOKA 1LDPL 4N2OA 1IFHL 4JN1H 1SN0A 1ZANH 2B4CC 3Q8CA 1MJ8H 4YHKH 4XMPL 2PP7A 2DZEA 4EUPH 1SJMA 4XN2A 1V05A 3B8YA 4CNIA 5FIEA 1JPTH 2CO6B 2HG0A 3KPNA 3IFPB 3PWNB 4QRPB 1ADQH 3TP4A 4HK3J 2Y07L 3K6OA 2VC2H 4LLDB 4XMUA 3VSUA 1JP5A 4E2OA 3O3DA 2BHFA 3HC3L 3UTSD 1A1OB 5EU7C 2YA0A 2EP6A 1AXTH 3GQFA 5I1CL 5ICYA 2AGJL 3CZLA 4EI5B 1INQA 3EZJB 1YPZA 5J4MA 4KZ0A 4PGEB 3Q2WA 2HTKD 3BUTA 5ID0B 5CLYA 3TA4D 2XX1A 1XSOA 1E65A 1A5FL 2EZ0C 1KJMA 2NDFA 1CDHA 3REWB 3WO4B 1LYQA 1HHKA 1VACB 4Z0XB 4L18A 5E6YA 4N2EA 4KNSA 4GRMA 1SY6H 3JV6B 4F92B 2CJTA 4LSVL 2DQFA 2XZZA 3GNMH 4XB7A 4BEIA 5IG7A 2NW2A 2JTYA 1KGYE 3MRPA 5MENB 4HBCH 4YVNA 3JBG7 1ITCA 1OP5H 2APFA 1TQWA 3QAZC 2DF3A 4W9EC 5D7JA 3C6LA 4JFFE 4HEMA 3FH8A 4HXAH 4D2NA 4ORZC 2AS5M 3CFIC 4LVNB 1K8IA 4LOUD 1A1MB 3IRCA 2ZWZA 3NFPB 4IOIA 1BQUA 1AG6A 1PZBA 3QXAB 1UZ8B 4BCYA 3HOGA 1ZLVK 5TDPB 4XB3A 2COQA 2HKHH 4LVEA 4UV4L 3WJJC 1L6ZA 3PLYA 5DWUH 1I1AC 5F7DB 2BSCA 1RP9A 1WS7A 3LB6C 4KKRA 4PJ8A 2WZ6A 4R3SA 4M3HA 1BFTA 2JK5B 5DDHA 5JORB 4RESB 2CM5A 4GW5B 3BDYH 2XC8A 4U7MA 4K9EL 4OAWA 2W8CA 4FE9A 4P5MA 4X4KA 3SDXB 3L9YA 3VI4E 1INDL 1GYUA 5GGSB 3A21A 3MUUA 2WNWA 2ZNXA 1MLBA 4PGBB 2W88A 3QIUB 5IIEA 4NM8L 3GMNA 4QCIA 3WHE1 5FYJD 4UTAH 3ZW3A 1EX0A 2GCYA 1A6AB 5AOJA 3HNTH 2BY0A 4P9ML 3T0VA 1F0LA 1HNYA 3ES6B 1IIIA 2WXJA 3H56A 1YEGL 4R4FL 4YHNA 4U6VH 3MSPA 1SOQA 4HLZG 2YN5A 2ARWA 3GHEH 1TENA 3FTWA 3WFHB 5EWIL 3FO9A 5TDNA 5C9JB 4MCNA 3U7AA 2HG5A 1YNLH 4WNQB 5C0GB 3D85D 1X5GA 2A6DB 2A77H 2X4PA 3RGBA 5LUMA 3KS0J 3S88L 1FDLL 5IHHA 2MOGA 2F68X 4HC1H 3VFOB 4YSAA 2ESVD 4U6YB 2VN6A 1VGEH 2I9TA 3A6OA 3RWGB 2HT4D 5MEOA 2UX6A 4HW6A 3QNYB 4ZMOA 7CGTA 2VLLB 3GF8A 5IFAL 2C1OB 1A21A 1QHOA 2VR5A 4JHWL 5FWQA 1JGVH 1UT9A 2Y3NA 3QXDB 1U8JB 4P2QE 4Z7NB 1I8MB 1E5ZA 3IDXH 1A7QH 4N9GB 1GZHC 4WO4C 2YPKB 1I8KB 3O9WD 2YHGA 3VFMB 2XG4B 2JH2A 3WFBH 3QFJD 1R3JB 2WQSA 5DMIH 3FB7B 1OK0A 3IJSB 1T6WA 1VFBA 1BVLB 1QFUH 4P57A 3NIDE 2CBTA 4Y2OB 1KCSL 4KI5E 4ELMB 1T83C 3DLQR 4DEPB 1GGCH 3GSUA 4PJ9C 1QBAA 1W80A 2J73A 1NANH 1PG7W 1CMOA 3Q2NA 3CDFA 5I17B 2OQJB 3ZMNA 5GGQH 2W0FB 4KJWD 4JBSA 4PSPA 4LMQE 1CXKA 2IAMD 4PJAF 3VXRA 3LKSA 3SOBL 1JYVA 4HPYH 3ZR5A 1EXUB 1D5IL 4G7VH 5ICUA 5I6XB 2X87A 1D7FA 1SBSH 2VDKB 4E42B 3ZDXF 1MFMA 3BIBX 2VZUA 3P9LB 4NZDA 5DRWA 1RUMH 5HYFA 5IMOB 2OTWB 4GPVA 1ZTXE 4Z7UA 5BZWA 1COBA 3F6IA 5D9SB 1Q8MA 3BQUC 1CFMA 2HKAA 1PEZA 2I25N 5E9NA 1G7HA 1MIEL 2NY4D 5E6IC 2E86A 4JFQA 5AB0A 3LQZA 5DRXA 4S2SB 4L1LA 3UO1H 5HGAA 2CHXA 3EOAB 4Y19E 4P2RD 2J71A 4HWEL 3C5ZA 2X4SB 2ZWKA 5F6HI 1MHCA 4HDIA 2ADGB 1DVQA 4KKPA 4PG2C 1CWVA 4QNPE 4KU1A 5DZLA 4QHLB 1GVIA 4PLJC 2QSCL 1E4WL 4HCRL 1HCZA 3BAYA 3VX1A 1FYTB 1DJWA 1DVFA 5DUMH 4O2FB 4GG6B 1QHPA 2W0LA 1CF1A 2QMJA 4PJ7E 3UP1A 3LJ3A 3WUWB 4ODSH 1S7RA 1U92A 3ARPA 1NMBL 4RNRA 4M43H 3GPSA 1NC2B 4IIQB 1D7DA 3V4PH 5F0JB 3UROR 4YDIL 3KYMA 5F6IB 5I1JH 3LHAA 4IRZA 5GXBB 1RUPL 1WTGT 3OSVA 4YDMA 1I75A 4NXSA 3T09A 3AUWB 2P9RA 1L7IH 1SNRA 1DJHA 1U36A 3FTXA 3QPQD 5DEJA 4HCGA 3QWRA 1EEZB 1MREH 2JJWA 2XNAA 2VE6A 4JO1L 1CD1B 1AR1C 1IC5H 4O51A 4X4XB 4MXVE 5T3XD 4HZ1A 4LCCA 4F33B 4X8XA 3OHXA 1FFNA 2Z65C 4UQ3B 1YEEH 3S35X 3BUIA 3ARFC 5E8OA 1TNMA 4ORGB 4AQAA 1L9MA 3VXUD 3ZLQC 4D0BB 2DLEA 2UZXB 3GMRA 3HE7C 3JTTB 1GS8A 3BE1H 1KLFB 4BRVA 4UV7H 5HJBA 1ED3B 1LO3L 4NQXA 3HZKA 3ZZQA 5L9DH 1BW8A 2ZOLA 5J11C 2B20A 3TOPA 4G9FD 2H9GA 2N59A 2IPTH 2HLAB 5ESAB 5AW2B 1IC7L 1WIUA 4LDOB 3EO1A 3QUMA 1S3RA 1X5HA 4XBPB 1I9RL 4G6JL 4NAQA 4RAHA 1UEYA 2A6JA 1W6WA 4M61A 1F45A 5TTRA 4J3BA 3LH2H 2P4AB 3CSYB 1YEJL 3IDGB 5DJDA 3FUEA 2ICEB 3VQMA 3QDJA 1BPVA 4YXLH 2FAUA 3ZYOA 1MHEA 3SDAC 2Q76B 3FT2B 3UAAA 5D1ZI 4IJ3B 3E8UH 2X4TB 4L9LA 3QIWD 4OZIF 3WMSA 4R0LB 3SOTA 1JNLH 2PMZA 3OZKA 3KYNA 4HWNA 4NYLB 1SMAA 4YNYA 3HFMH 5GRUL 3VFWB 4OFVA 3A3YB 2C4FT 4DP0X 5CINH 4FKKA 1M7XA 3BGAA 2A0LD 4HG4J 3ZKXC 1CGSL 1BBJA 4HISA 3QUXD 3ULVH 4HHAB 2NUPB 5IVXA 1A7NL 5E24E 2FCBA 3HMXL 4XN8A 1BIHA 2LOEA 4FTVA 4ZSOE 3L5XH 4HS3B 1OW0A 4RGNB 3FMGL 4XNDA 2YPVH 1GIGL 1C1EH 1V8HA 3BSGA 5A2JH 4OFQA 1H3UA 5JXEC 3S48A 1JRHL 3HRZA 5ECGA 4PJ5D 4OVUA 2OJZL 2EEAA 3T4YB 3HUJA 1E5BA 1PG7H 3U9PL 4GP8B 2DBLL 3D3VB 3SO3B 3X1GA 4X6BA 3SDDC 1FYTE 1PIFA 3T3ME 2NR6D 4MA3A 4GG6E 3LRHA 4HWBL 2N1TE 1A6PA 3CLEL 5D2LE 1QRNA 5FB8B 3QWQB 2IC2A 4A2DA 3LYRA 4MB3A 4L4JA 2JKIS 2JIXB 3UDWC 2FEDC 3O6LL 2XX0A 4UINL 4X0NA 1BG9A 3BC9A 3R8QA 4DPRA 3NEOA 4R7DB 2NY7H 1KV3A 5D2NC 1U3YA 3H6AA 1ZHBA 1JK9A 1J05A 2XWXA 3F84A 3NFNB 4C4UA 4XR8C 1KXVC 5FGBA 3RVUC 2YFOA 3T9WA 2R69L 4XPTH 4ZTOL 4LCIH 5KYYA 2DMHA 4OT1L 3O0LA 1BZEA 1BAFH 1HEZA 4G1EB 2ZCHH 3M88A 4GMSH 3X13A 4NNYB 4K7PX 2CDFA 5EN3A 5T1MB 1JZFA 2H6PA 5AW4B 1R3LB 3P3UA 2AABH 3AGVA 2PCYA 3LV3A 2P5WE 1SHWA 3PWPD 4XO9A 4JFED 4ZFZB 4H20H 3MV9D 5KSVB 1PU0A 3L1GA 1A4CA 2HVKA 4CVXA 5EH1A 5K39A 4LPVA 1UD2A 3QH3A 3QO1A 4ZFFB 5K9JL 1LO2L 2ZUQB 1M6OB 1MCRA 1EQWA 4W6XB 1E27A 2ODHA 5GQBA 4FQXC 4BFGA 3WJMB 3K4AA 1XGYL 2Q3AA 4OI7A 5IEHA 4K9EH 3RVTC 3CHXA 2UZIL 1HXKA 1K85A 2J56A 2KLRA 4DKFH 3WJLA 4UM8B 4J3OG 1E28B 2NMSA 1IKFH 3CDZB 4P4KB 3ZR6A 3RTQB 2UV3A 3TBWB 1D6EB 3MRRA 3VVVA 4JO2H 2IF7A 4HUCA 3MKGA 3U7WL 2ITCA 3MLYH 2F15A 4AV4A 3D2UB 5FO8B 3C5JB 5T3ZH 4L8DA 1X5MA 2RH0A 3TZVB 3ZZ1A 2Y24A 1KWKA 2DKUA 2UWEB 2HTLC 1F4XH 2B16A 3UPRA 1WWWX 1MW1A 3LEXA 1U95B 4RH4A 5CIPH 4E9VA 3RDTD 1NINA 1OKEA 4GI6A 1YQVL 3EO9L 5BUPA 2PXYD 1A6UL 4HIHA 3VX0A 2BZDA 5IBLD 1PPIA 4Q9QH 4PLKD 4PRNA 3F12B 5FHBH 4HF5H 4HMCA 4YSPA 4IKKA 5FS5A 5LBGA 1TQUA 4D8PB 3O3UN 4RGNE 4XMLH 1NGPL 2KLTA 1T0PB 1T5XB 1NICA 2XWZA 2A1WL 5CLWA 3EAKA 1B9KA 1Q0EA 2ZUUA 5F7YC 4MGXA 3WS6A 1G6RA 3QI9D 5JZ7D 2PN5A 4MS8D 2R0WH 4WEUD 2JKWA 5A3ID 3CK0L 3EF7A 3LH8A 4JFFA 3D3VE 1AGFA 4XNQB 1BYOA 5F1SA 1UKQA 1CDCA 3KPPB 4GRLA 1HJBC 1JZ8A 3MXWH 4H8VA 4R90H 3ZZLA 5IB2A 1T1ZA 3SQRA 2WXNA 1QLEL 2WWKT 4MMZC 1KIPA 4XNZB 2OZ4L 3OBAA 4P2OB 4AYSA 4UNVA 1QLRB 2XWTB 3UBHA 2A73A 2BOBB 2ZUYA 3FT9A 4PB9H 2WAQA 5HTSA 2J4WH 2E9IA 1FVEB 3G5WA 1TCRB 1NGYA 3ARDD 2NY1B 3CCHB 4DP8X 3IJHA 1I8LA 4U2ZA 8PAZA 3VI4A 1BM3L 5F7HA 1DQLH 2DIEA 4ZQKA 1JDCA 1IQWH 2E9JA 2VR7A 4YSEA 1F4WL 1VSCA 2BNQD 3MMEA 5KVFL 1KCLA 1S7XA 5D93C 1TT6A 1R19A 2OV0A 3K72B 5HD8C 3D50A 3GRWA 2PYFA 4U1IA 2WXQA 3BEVA 1PKQB 4GAGL 2WYIA 3B6SB 5T8IA 3P0VH 2VMJA 4Q0XL 1N2RA 3G6AB 3FUHA 5HDBB 1GGIL 2WIIA 4M48H 3F64A 4XGZB 4UT9A 2X89A 3FO1A 1CDYA 2BERA 3LZRA 3AS1A 1GZPB 3T6WA 4LEOA 3WIHH 1IC1A 2AI0L 5ESVA 1T7VA 3BPNB 3QWOB 4U6HB 5CEZE 4JFDE 3V6FB 3ILPB 2ZT9C 3V9CA 1HHJA 3LQMA 4NQUA 2IADA 4N2KA 3LN4A 1UM5H 3V0JA 2AEOA 1JVOA 2NY5L 3JWDC 1BXAA 1GC1C 4ZW3A 2Z31D 1L9NA 2HPOA 3E3QE 5GS1A 5JXAL 4N22A 5C0CD 3HR5B 1A3QA 6CGTA 2OSXA 3DX6B 3QYMA 2QZ5A 1T04A 3V4UL 1G4MA 4P2QA 1C7SA 4OKVA 5FM5M 1BM7A 2EUXA 4WCYH 3NCJL 3S3PA 4NNXA 3C75A 4NQEB 1ADWA 5GGVH 5EZPA 2XYBA 1T7XA 1WYJA 4TRPH 4FI7A 3E7JA 1KYOK 5D7JC 3C6LC 5HDOA 1S5HB 3V0WL 3MRMA 3AADB 2ICWJ 3KM2A 2O30A 2OL3H 5LN8A 5IQMA 4WEMB 4OLWH 5DVOA 3AMKA 3FRUB 4X6DB 5C07B 1RURH 2QHRL 3KWWB 2NY3C 3MJ9A 3FB6A 3O3AB 1HH6A 2ZX9A 2YQGA 1SRDA 3QDGE 3ZHDA 5FYJL 1CLVA 4M3KB 1R46A 4JO1H 3GXDA 4KROC 1IE5A 2YD2A 7PCYA 3TF7C 1URZA 3L3HA 1YNTF 4YHYC 3C09C 3ZKMC 3MRGB 4EO5A 2XKNB 3NK3A 3PF2A 1OL0A 2QVIA 4WHYH 2K45A 1JPFB 2Y7MA 1HIMH 4YFLI 5KJRL 3OC8A 4WO0A 1CD9B 1M9SA 4IEFB 1E6OH 1KBGL 4Y9BA 1QNIA 5GS3A 5FGSA 4F57H 5DMYA 2TSBA 4P59L 1RPKA 4DVRL 3D39D 1U8QB 1M3IA 1E3FA 1A2YA 1F4YH 1A6VH 2PW1B 3DX2A 1A1NB 1BQRA 1K6QL 5FOBA 1FV1B 1PD6A 1KJVA 4HAFA 2CUAA 5DJXA 5B1JA 1I4FB 3KYKH 4MJIB 4EIUA 3TEZA 1SDYA 2N56A 5ISZD 4GQ9L 2A38A 2XZAH 4Y19A 3ROOB 3SDYH 4LVOC 3FYEB 3GMOB 3K71B 1N68A 2LHAA 1KB5L 3GSXB 1UWEL 4L5FE 4YZWA 1OLLA 2B7DT 5CBAB 1WVZA 4OUUB 3VTTA 4O4YL 1FL5A 1NC4B 5D4IA 1E4JA 2EZ0D 3IFLH 4KBPA 5DHDA 5IROC 3X14A 2YRZA 1VF5C 1SJXA 1BREA 1ZPLA 4LU5L 3GLZA 2EIZA 5HGHB 2YQ2A 5INDA 4HIIA 3Q1SH 1ZHNA 2HFTA 4HLJA 5FUOL 4PJ7A 2CLRB 2G9KA 4UT6L 4WKXA 1UADC 5J13C 1NBZB 1GHFH 1LDSA 4AKPA 1WV7T 4QRQA 3Q43A 4NKOB 4I9WD 1BZDA 4IBZA 3S34L 3DK2A 1HAWA 2WTRB 3VFNA 2AERT 3T0EB 3UTTD 3MRJA 3QPXL 1K5NA 1DQTA 3FQXA 3VXSE 2IWGA 2IPUG 1Z9MA 3G5VB 1IVLA 3PWLA 4XN7A 1KTRL 1N7MH 3OAUL 3FCSA 3PAZA 4QGYA 4BHUI 4KXZH 4GRWF 3EFFA 1I1AD 3FOLA 3LB6D 4NO0A 4RAVA 3QZWG 2VXVH 2A9MH 2GUOB 3DI2B 4QHNA 1HL8A 1Z1WA 4RAUA 1XDTT 5IREA 1HILA 1TTUA 1OGAE 2CO3A 3VQ2C 2EDYA 4MD0A 4WW2F 5CILH 3T5WA 3C2AH 1UXSB 3AWFA 4GUQA 5ERWB 1G7JA 4ONGH 6PCYA 4K07A 3CZSA 5D1ZC 2GJRA 2R2EA 1QQDA 2IPUK 1UH4A 2VDNH 4PJIB 3S8WA 1HHGA 1L0XA 3MODH 3RX9A 1SFHA 4Y4KC 5IR1A 4HUVB 4WEBL 2ZWYA 4NRZB 1S7SB 1NEUA 4D0DB 3QJTB 4PJCE 1H3TA 4P23B 2JKSA 4MMXB 3MRIB 4Z7QE 3FQYA 2D31A 2XPGA 1EJ6A 3APFA 3C8KA 2F1BA 4DAGL 1C5BH 1JOIA 1MXDA 3IRPX 4MJ4A 3TBSB 2EDHA 4NWUL 5B4MC 3GWJA 3LS4L 1FIEA 1E4XL 1OEZW 2DQCH 4MAYA 3TO4B 1DQKA 3MNZB 3PV6B 2FATL 5I6KA 2YXMA 5FGCE 4MCZB 3C5ZC 5CZKA 4LMQI 5C08D 4JM2B 1J86A 1RK0B 5D7LE 3US1A 1A8JH 2JB5H 3GC3A 3QG6A 4KDTA 4U7KA 3ARBB 1H3PL 1S9VB 1P7QD 5FO9B 4F15C 4FA6A 5IJCC 2NYYC 1BOYA 1DVFC 2BSBA 4K23L 3KLHC 3S4SG 4U2YA 1U8HB 4JDVB 5I30H 4PTTB 5I8KL 3LKNB 3FQ1A 4WO4D 3Q5OA 2CUIA 4PB0H 1AGEB 5L2JA 1CYWA 3QNXA 4PCTA 1X7TA 3H8NA 1MH5B 2HFEA 4B9JA 1AMXA 4R7VA 5T3XL 4ZSOA 4YX2H 1QMUA 2FBJL 2E7LA 2M26A 4Z7OE 4OFDA 4PJGB 1NCWL 1AGDA 3HAEH 1KY6A 3REVB 2AJ3B 3UEQA 3DJ9A 3AREB 4PJ9D 2DEWX 2FQDA 4JZJC 4FNSA 3QZPA 2NDGA 2D0HA 2FRGP 5F3BB 3VFPB 3Q06A 4UZUA 1MELA 1V3KA 1FYTA 1TEYA 2P80A 4LCCC 4MYPA 2LVCA 4GG6A 1J9QA 1EAJA 5D2LA 3SPVB 2ZG2A 1G9EA 3A4DA 1D5BB 5E1HB 4PIBA 3M6DA 3E6HB 1N0LB 4TQEL 2FQFA 2LV4A 1KIQB 4U0QB 4FQIL 1F1GA 5LNDA 3W56A 3CFCH 5IQ9B 4TF4A 5LCVL 3P3YA 3NTCH 4S1DC 4FCHA 5T1KB 2CDGA 4AGQA 5EU6E 2C9SA 5DHEA 3RQ3A 5KANI 1AACA 1AZUA 3BQUD 3TV8A 4PD4J 3MUGB 4JJ5A 3WKQA 2J55A 3ROLA 5DURB 4KHTL 3K2UH 4ZFOA 3EHBC 1JG9A 4FQPA 1H15B 5E6ID 4WJKB 2B2XL 1HL9A 5J8OA 4X5LA 3SKNB 4KK6C 3UTPD 4NO5B 5DCCA 1CG9B 1BJMA 1S9YA 3OB8A 1KLGA 2C4XA 2MJWA 4N2AA 1HXMA 5DJZB 3V4LA 1B0RB 1U8LB 3N6YA 2AEQH 5ADOH 4FHJA 1WWAX 4DQOH 5IQLA 4J1UB 1SXZA 2P5WA 2J21A 3H9SD 1L9TA 4OCRL 1XTMA 4POZD 2Q8AH 4KMTH 4PLJD 3CFKB 2ZCKL 3VFRB 4L9LC 5HY9B 4HS8L 4JY6B 1MQKH 3DA0A 4JQVC 4MDJA 1IGYA 4GI9A 4I77H 4A2FA 2YAFA 3FUFA 1Y18A 1OSPL 5CGBA 3RWCA 5LXGL 1J0HA 1XGUA 2CNZA 3WGVB 1LEIA 1WITA 2Y7LA 2ED7A 1M05A 1TEFA 3KVDD 1RQ5A 2AKRB 4Y1AB 4NN6B 2AEIT 2M83A 5DD5L 1P1ZB 4WI0A 4EIBA 4HUNB 2BCKB 1SGKA 5SWSE 2BVQA 4OFIA 1TFPA 1WDAA 3DUHA 3EIFA 5H94B 1FZOA 1VZIA 4DCQB 5HYEA 2J6EA 1WA2X 1RAMA 1N26A 1H3WM 1N64H 4XXDB 1FC1A 1S46A 2VDPH 3HRZC 4CDGC 3DO4A 3SDCA 1AR1D 4OBRA 5KAQF 1KB9J 4OUOA 5B38G 8FABA 1EDQA 1RZKC 1CF8H 4D0CA 4TLKA 4ZUWA 1RJLB 4WF7A 4AYFB 3B3BA 1RZ8A 2WWOA 4X99A 1XF5B 1EK3A 3ARFD 5HHNA 4ISVB 4B9IA 3QXVA 3WTWA 3P77A 3EH1A 3HE7D 5HYJB 1HSAB 3WTXA 1WAEA 4PGCB 1CE6B 4RZKA 3HG3A 4KUZL 2NT1A 4ERSH 4HHAA 3MNWA 2XBZA 1AJ7L 4RA3A 3FO0H 5I74C 1M57B 4YPGA 2GT9A 2EEBA 3LY6A 3VWKA 4DVBA 4GKNB 2GTWB 4HCIA 4C83B 3BUYB 4CADB 1IC4L 4PS8A 2ZCLL 1HYRC 3ZDZE 3KWXA 1LHZA 5DMGD 5FGBC 3WLBA 1PQZB 2OCFD 3D25B 3QHZH 4FLRA 5EC2B 1LM8V 2GJ6E 5E9DD 4A1RA 5GGTA 3FQTA 4JRFA 4JGNA 1SJEA 1GTNA 1SHMA 4J12A 5EBWA 2DLIA 5EEYA 1CFTB 4GINA 2HPTA 1FO0A 4QHKJ 1BP3B 2X4NA 3KJ6H 3ULUF 5E7BA 5EN2A 3KL3A 1ERNA 4NQVA 3SDAD 5FYJU 1U8CB 3A4EA 1FRGL 2W9DL 4JFPB 4LLYA 1W6LA 2JXMB 1BF2A 1UZ6F 1XH1A 3GTNA 1I1FB 2F58L 1AHMA 3O4LD 4EI6B 3DOSB 4H26B 4OGYH 1T5WA 2F2HA 4WV1C 1WBXA 5CLXA 2P8LA 1FNEA 4KOCA 4D7BA 2IGLA 1XR9A 2XIDA 1Q0YH 3JWNC 5I6MA 4EDWL 5HVHC 5DUBA 1EUTA 1KBKA 1HL5A 2F1AA 1S7TB 3W1ZA 3UC0H 3DIFB 3CD4A 4N2NA 5I26A 3NSDA 1QKZH 5FLVA 5DVLA 2ICWB 4P07A 4HEPG 4ZO7A 2E74C 5HXMA 3OAZH 4KJYA 2PO6C 4LGSB 4G8AC 3SD5A 3WJLC 1GGBH 3EG9A 1FZMB 1HZKA 1LO0L 3RWJB 2Y72A 3BGMB 5JXED 5F9JB 3DX8B 1BOGA 2QQKL 4ODXB 3PP3H 3CBJB 4KTDL 4O02A 4ZYKA 3IKKA 2ARJB 2EDLA 1LGVA 4NIKB 2VITB 4N0CC 1BFOA 3SDDD 3QIBB 2AC0A 4QF1B 1BZ8A 3KEDA 1U58B 4PGZA 4KVPA 5F7EL 2GITA 2GBUA 4JFDA 2JJSA 4CU6A 5K9QG 3RB7A 5EF1A 1HZLA 3ZBMA 3O2VL 5MHSD 1AIFB 4DPAX 4KITB 1T1XA 4HFUH 1ZT4A 1JCKA 1TKWA 1N70A 2QVFB 3H1ZA 2EKSA 1WBYA 3B34A 2FEDD 3EOTH 2FWUA 4KX7A 3I84A 2ZZUT 3ZRSA 3V6ZA 1R24A 1GJUA 2AITA 2BSTB 4JRXD 3RWEB 1JYWA 2AXGB 2CLVA 3QQXA 4BXVA 5I16A 3LNGA 1W0VA 2G5RA 4ZW5A 3DO3A 3ZL1A 5C0EB 1NBYA 2EECA 1KB9K 4OJDH 1NLBL 3F62A 2WUCH 1AXSB 1QLFA 3TA3B 3TH4T 2NTFA 3RVUD 5D6DA 5BRZD 3LQAH 4EKXA 2ILLA 3AU1B 4WIQA 3D33A 2Y69B 4IOSD 2R7EA 3WS6C 4L0YA 5JIDA 2DQJL 4XCNB 4UT6H 3DECA 3FW6A 1U30A 4WWKB 2UUDH 3QUYA 1M42A 5DT1H 1R6VA 5INCB 3GLAA 3MHZA 5E4OA 3F5WB 1C8QA 1XMEB 2YEZB 2OSWA 1C12A 1FAIL 4NZTL 1ZCRA 4NJAL 3I6KB 4WNSA 1H3VA 4XCEA 2OS7A 1LO5B 1A3ZA 5K1JA 5FF6A 2ZPKH 2B59A 2J25A 4Y2DA 2HLFC 3S4SB 5AZ2H 3OAUH 1DANT 1KT2A 2FDBP 3QDGA 1PTZA 2WIMA 3OKLA 4FQXD 2EIDA 3QDMD 4BDVA 5C6PB 5LGJB 5SV4A 1AC0A 2QJDA 1E90A 2NX5B 1GYVA 3JTSB 4RIRB 3RVTD 1AZZC 1XWVA 4L3ED 4M93C 3PGFH 1RLBA 1J10A 3HI6L 1DBAH 1URIA 2DI9A 3EO0A 4M1CC 2IMNA 3L3KB 4YWGL 3R06B 2IV9A 3BP4B 4MXWL 4LHUD 3T1FB 2OMVB 5E8DH 1UM6H 2WLIA 3THML 1HCYA 4KKLD 1VRSA 2NQ3A 4U1KA 3V5DB 3SGKA 3EYSL 4MZRA 3GGWB 4O9HH 5CMAA 2HJKA 2VL5A 3CFJB 2FSEB 3ME0A 3LRSA 5KSUB 1F58L 3DGGA 3V8OA 3DPBA 5KYXB 1A9VA 4DEUA 4LSRL 2BOBA 35C8H 4FNQA 1NCBL 2HTLD 3CN4A 4WGKA 1KF9B 2IANB 2Y4SA 5HJ3B 1QW9A 3GSQA 4Y9EA 5HI5C 4K3JH 1ZT1B 1W15A 1FCCA 1KTKE 4LASL 2ED6A 3MO1B 2V17L 3DUUB 3HBGA 3A4FA 3I6LE 5KVGE 3QEQD 4MHHI 1A7PH 4R5XA 5K93A 4P5TA 3O8XA 4KXAA 3CHQA 4XNYL 4FYRA 4ZODA 1Z9OA 5CU9A 5KOVC 4RMSA 3EGXA 1T20B 5D8JH 4BINA 3BX7C 2KZKA 3IJ9A 3U0TB 5FAAA 4TNVK 4IIZA 5DRZB 5DJCB 3CSPA 1T03H 1BF5A 3V10A 3T6VA 4F2MB 4XVSL 4BFJA 1ZAGA 3SKUD 1MCKA 1IBYA 2YSSB 3V7AG 2MCPL 3VXSA 5DZVA 3GT6A 4X80L 5E99L 3C87A 2FECL 5CZVH 2H1PH 3A6CL 4PJEF 1YYML 4AIZA 3K81A 4KI5C 4OCSL 1C08A 1UJ3A 5FFGA 5JOFB 5FLUA 5JYLA 4JDEA 3QFDB 1VB9A 32C2A 3FCBA 1E8YA 2EINB 4L8BA 4N90D 1NCWH 4WEEA 5T33H 3N43B 1AOZA 2B4CL 1ZLUK 1ZV5A 2ZYHA 5D4JA 2NY2C 1OGAA 1YEFL 3TVMB 4OB5L 1DFBH 1PCXA 1QUPA 2G75B 2EH7L 3AQZA 4FZEL 3MBXL 1ZV9A 3MNVB 4QKTA 1MF2H 2PLTA 2DI7A 4BUQA 5HD8D 5JHLH 4YR6B 3FUDA 1DQQB 5IBTL 3OL2A 4HAKA 4LVNC 4CUCA 4HJ1A 4PV8B 4PJCA 4GIPD 2H3NA 3PJSB 1F3JA 4PRDA 2X4UA 5B38B 1F3RB 1NFDF 3A4AA 5IY5B 1W9XA 1DQJA 2ZKHL 5F89A 5FA3A 1N67A 3C60A 4X50A 4HJUA 4YSRA 4V1DE 3QSKB 4LLUB 1ICTA 2DQEL 2PCFA 4XMKL 4B9KC 5D96B 2XQ0A 5I6OA 4N2MA 3H42H 1GY1A 4PW9A 4V2CB 3TPUA 1C5DB 1V7ML 2QADB 4GMTL 3T2LA 3RX5A 1DVXA 2W07B 5D7LA 4EDXB 1Z9SA 3WHXA 3MJ7A 3UTQB 4MX7B 5TDOA 3BRFA 3EYFB 4P8QA 4JPIA 2HN7B 3SZ6A 5IUCA 3GBNL 4IHOA 1KXTB 3IDJB 2OMYA 2UY6A 4RSVA 3CVHL 4F1SA 2WJ5A 3CHRA 4ZFQA 1RULL 3RUGF 3K7UA 3DVIA 5C0AE 1QWNA 4JFOB 2L0DA 5F44A 1LQBC 4R97C 1JWMA 4LAJH 4RWHA 3GPEA 4G43B 1UCBH 5D7JD 5CUSH 3C6LD 3CAFA 4YC2B 1A4AA 2YUZA 1QFWH 4Q56A 3WD5H 5L88H 2GBTA 2CIIB 2BVOA 2CAKA 4LLMB 4UUJB 3K71A 4PJHB 3FN0H 2EDEA 2Y2WA 3T4AB 2B1AH 2NY3D 1G7MB 3C9NB 4YLCA 2VSMB 2CJUL 1HYSC 2VR6A 2XXMB 2DL9A 4KXBA 1SYVB 2WLYA 2BNRE 4KROD 4UCFA 4N25A 3BKML 5I75B 3MJ8B 2JJTC 4KY1L 1K72A 1RERA 3R1GL 3ZKMD 3MRLB 4ZT1A 2XQYG 4K8RC 4P48A 3LZFH 3RB5A 1JPGA 1MOEA 1ZE3C 3OKEA 4J39A 4FABL 3EF4A 1XB6A 3BP7A 3IU3B 3U4KA 3V52L 2F7IA 3KLAA 3SJVB 1CGWA 5EU6A 4GSXA 7FABL 3ZKSD 1DQMH 1AS7A 2QFPA 4KGJA 2WQVA 2OX5B 4AX3A 1I8IA 3DUSB 3GXMA 5KWYC 4AYMC 3FFCB 3ZYJA 4H40A 4DEPC 1JBJA 1TIUA 1A4KB 5F1NB 2IFFH 5FC9A 1DJYA 1T0NB 2F5BH 1T3FA 2XQYK 5JA8B 1ETA1 3T0AA 4PPTA 3BN3B 3QJHA 4QRBA 4J4PC 3K2KA 4HZAA 2YC1B 5IROD 5AD0A 4KDTC 4QOKB 1YN7A 3PDDA 4XMTA 3ZY7A 3PRZA 3FZUC 4TNEA 4HHGA 4NZ8A 2XTJE 1NPJA 1MCPL 5I2IB 2W9DH 3VGBA 1G6RH 1J8HB 3HZMB 2AVGA 1B2YA 3QW9A 4I2XE 2HSIA 4PN6A 3NDYE 3GSNL 1VPOH 1SEBB 2Y7QB 1NEZG 1QBMH 3MCLH 4BXSV 3WLWC 4OIAA 3QCUL 5MI0B 4EXKA 5A16A 1JTOA 1G7IB 2FT7A 3G5XA 4ZZFA 4JM4H 3NP3A 3L9RA 2X6AA 2FJGA 1CGXA 4KK5C 4YHMH 5SWSA 2ATKA 3PGCB 4KAQL 4LXFA 5A7EA 2CHZA 3RHWK 4LZKA 2DMGA 1U8PB 3VXNA 5H35A 2V6HA 3NOIA 3QG7L 1HCFX 1T5KA 3QEUA 4OF5A 3CHSA 3V0AC 3ZZSA 1YPZF 1XIWB 3CZJA 1QR4A 5CZXC 4JY5H 4K7FA 3HVNA 3KLKA 5LBVA 3FUIA 4TQ8A 4X7TB 4XVJH 5EU5B 1NOAA 2IH1B 3IJEA 4Z7VE 4JG0L 4ZZKA 2N0KA 2XY1A 1EJOL 1KGIA 1P4BL 1LK2B 3VXRD 3U83A 2FX8L 5AVXB 3GRWH 5AW9B 3DURB 5D1ZD 4BQBA 3IDYC 1CBVL 2G60L 5GJSH 1B4JL 2ED9A 3PWVA 2C3GA 4Y4KD 5KYNA 3MGTB 4QAMB 4UT9H 1ITBB 4TNWK 1T1WB 3AJ7A 3PHQA 2AQ2A 3EGDA 2V3EA 3DOIA 4CC1A 2V2XA 3HS0B 3ARGA 3H7BB 3TL5A 2DLHA 1U8IB 2XVGA 4MSWA 5DMKB 4IU2B 1QLEB 5DD3L 3P2DA 1FFPB 3IXAA 3JV0A 5IHZB 1E5CA 2AXHA 4OZFB 2GJ6A 3HG2A 4MMYB 1L9SA 5B4MD 5FECB 4I5BB 1TR7A 2DICA 3H0TA 4MCYA 2ALWA 4XHQA 4RZCB 2EILB 4YSTA 1L9QA 3RVWC 3C5ZD 2N1KA 3HPJB 4QTHA 4CDHA 3HG1A 2BSEA 1PYWA 4L3FA 4IKIA 4QT5A 4EN3A 4TUJA 5ALCH 2NYYD 1DVFD 2P24B 3UTSB 3KLHD 3TNMA 5BV7H 5DO2C 1RIVL 2A6IB 2VWEC 3N2JA 1A9EB 1UYWH 3FO2B 3HKZA 4QRTA 5CN2A 4HBQA 4MFHA 5BS0E 1FVCB 2ALAA 4WNJA 4ZUTB 3BZFB 3NACL 2EDMA 4PJDE 1CL7H 3CZFB 2HJFB 2J72A 3HI6H 4PJAB 2PWDA 1JF5A 4B9ZA 2D73A 4F8NA 2AJZB 1ROWA 1NCAL 2D7MA 4W9DC 4MZIA 2ZUXA 5E00A 3SDCC 4K3DH 5MEPA 5A2AA 4Y5XB 4S0HA 3QRLA 4AQEB 2YMTA 4AEIH 4BIKA 3DX9B 4XN5A 1EEYB 1I7UB 4HSCX 4XC1L 1EZVX 3V79C 2WNKA 2VM9A 2CO1A 2K3TA 4JUTA 3WKYA 1Y6NR 3DRTB 5FV1L 1L5GA 2APXA 2DQ6A 4U4BA 2NLJA 2QQLL 3BVVA 1Q9KB 4JHAL 3SPHA 1K4CA 1MUJA 4UBDC 4PS3A 1KPRB 5F7AA 3VRLE 4NJ9L 1V27A 1HAUA 4AEHH 4S1DD 4B50A 4EUPG 3T3PE 3AXLB 4Y8AA 2CBQA 1IBDA 3VWKC 3VI3B 3TN0A 1RUAH 1LEGB 1U41A 1FLRH 4RGNC 4C59B 1NL0L 3EHBD 3LHPH 4N3TA 2X2HA 4KK6D 5J9PB 2ADJA 2FE0A 4I3GA 2VLKB 4WI2A 1S5IH 1OCRB 2GIXA 3CPLA 1B88A 3D4ZA 3BJ91 2D3VA 3ET9F 4N9OB 4ODVH 4FAAB 1A3RL 2L04A 2C4FU 1KFGA 1CXIA 3GKWL 4X9IA 2EVGA 3QR0A 4Z5RA 4ZD3H 4AMKL 3FUNA 2Y23A 4LRNL 4M4PA 1P2CA 2HVJB 2DL2A 4XBEL 1P5VB 3UBXG 1NAML 2QQNH 4NI6A 3LKRB 3ABGA 4OZGB 5T1DL 4BFKA 5C7XH 1Q9OB 2DLFH 2ZXDA 3B7SA 4JZNA 5I8CB 5K9KB 3V4VB 4Z7UF 4G6MH 2FD6H 3NSCA 4OM0L 4X5WB 4ZXBB 5F7NC 4W4OC 2XZCH 1LD9A 1SVZA 4E41E 2KDGA 1M71B 4Q4IA 5BNXD 4FTVD 4WFFD 4HKZB 3W5MA 1IGIH 4O2CB 5CN1A 1EVTC 3CFDB 5HHMB 2NY0B 3RL1A 4IBLT 4OBSA 3P11H 5FX3A 3IE9A 4A6YH 4CU7A 5KBLA 5CJQH 5DFVC 4PU2A 2VERN 3BP6B 2B9BA 3T65B 4BCZA 1FHGA 4XH2B 1MFVA 4NP4H 2W94A 3O9WB 1EAQA 1F1DA 3PWJA 4V33A 3QFJB 1I3GL 4HKJB 4AT6B 2ZUQC 2MQGA 3WXWH 2JJSC 2QSQA 1OP5K 1QRND 4U3CA 2EYRA 1IRAY 4XOAA 2XICA 3KPTA 3OR7B 4ODUA 4GAYB 1U21A 1I9JL 1JZJA 2N7SA 3N1GC 5FGRA 3WFEL 3V7AE 4N0RA 1UXLA 3DDGA 2KHAA 3VCLA 3NJMA 5IFHH 1D5XB 4YDKL 3RJDA 3HG0A 1QYGL 4MDIB 3QULB 3RTQC 2FGWH 3S35L 3TT3L 2IAMB 4HZLB 2CO7A 2GTZA 3L2LA 3WIFB 4JO5A 1M1XB 3B1UA 3QZWA 4XAWL 3B37A 1YUHA 1TU2B 4NQDE 5AW5B 1FC2D 4KDVA 1MFCH 2KLSA 2C9QA 2ZOOA 4MDRA 5H37A 3TZVC 2FL5A 2E7HA 2W9EL 3DJTA 2IWEA 3OWRA 4H8UA 4NKDB 3HNVL 4YUEH 5TE6L 4DP6X 3VTMA 2X4RA 5JW4N 4AEFA 3PJLA 4HQQL 1KCKA 1OAJA 4JZOB 3SE8H 3P1VA 4RBPH 4HOXA 3P0YL 1KY7A 1THAA 2A74A 3MAWA 5EZIL 1T0MB 1JZIA 4YSUA 4KVNL 5CGTA 2NY4B 4H2CA 1PZ5A 2JFCA 3ZDWA 3MFFB 4Z7AA 3VD2A 1FVDA 4Y2DC 3ERXA 1SDDB 5J06A 5HGDA 1NEZB 1IKOP 4KO9A 5FYKE 1FNAA 4MWFB 1N9PA 4HU2A 1CDUA 5D72L 2NTSP 5TGBA 4H7VA 1CLZH 4JQIH 1Q9LA 3D0VA 4E0RB 2VRKA 3WNMA 4LSTH 1G7LB 2CLZA 4TNGA 4D9QE 5TF0A 5ID1B 1ZVHA 2CWRA 2YMXH 2L3BA 1T4KB 4U3SB 1KULA 4AUYA 4F7CA 3TS8A 1H8NA 5BOZG 15C8L 4XNZC 4LE8A 5FM8A 3OJVC 4DKAA 4N0CD 4GEJA 1MFNA 4P2OC 1JWSA 1EFXA 2X4OA 3MLTB 3QCVL 4V1DA 2CK2A 2NNAB 2OMTB 3O6FA 1B0IA 4I0PB 4M62L 3B2MA 3M1BA 4WJ5A 2NY1C 5C8JB 3QNZB 1ZS8A 3QO0B 1OAUH 3LIZA 4X0KA 1R0AH 4K4KA 4DGIH 5CJOH 4W1TA 4OD3L 4PBVC 5KG9A 5IM7A 4YZFE 4DK3A 3QDAA 3JV5A 1BIIA 2COVD 1XF4A 3DMMA 3U0PA 3N9GH 4P5TC 1ZLWK 3O8XC 3DBSA 1RIHH 5JOEA 4YH6A 1TZGH 2JELH 3Q9QA 4NSKA 1EUUA 4OIBA 2FLMA 5A6LA 5C0AA 5D5MF 3VXUB 4XMWA 4NQSA 3RIKA 4AH2A 3ULSA 3ARRA 3BVTA 3HUJF 3WDJA 2Q9OA 2WLKA 4Q58C 3VFTB 3BPNC 1RZFL 4G9FB 1JCVA 4GRLD 4KC3B 3BDBA 3IPBA 1A6WL 1X5FA 3WTSA 4Y4HA 3NT0A 1U8NA 2IBGA 3ULUH 1YY8B 1QEXA 1TETL 3BKCL 1WAAF 3O11B 3VG0L 4BA0A 3MLXL 4QXTA 4NX0A 2HLFD 3UTZB 3O6MH 3HHMA 3WSQL 1U2YA 3AY4A 2ZAHA 4A7GF 4H13C 5AAMA 1N4XL 2BNRA 1YMME 3G5YB 4FQ2L 4KKNA 4JFYA 1PNDA 4K7PL 1CLYL 1TPXB 4JM0A 5ILTL 5JNYA 4KDWA 1ZVSB 3S5YA 2D03L 3BFWA 2F5AH 5FKAA 5EEVA 4M1CD 3U36A 1ILSA 2VSKB 3IGAA 4WU5B 1IBHA 2J6EH 2VLJE 1EJOH 1TVDA 2X2IA 4H8WH 5GS2H 3BIKB 2VDML 3BQVA 4TSBH 3CVIL 3HW7A 1QBLH 4XVTH 3WL9B 4RMQA 2YAOA 1T2JA 5CR8A 4E36A 5EU4A 5I1DA 1OM3H 1B4JH 3GJEA 5F7MC 4ZPTB 4NIYE 4R2GC 5DEZA 5F93C 2X89D 4FL4B 1A0QL 1CFNB 1RK1B 1XGTB 4NPYA 3RFZA 3QYNA 3IMTA 5HHOE 2K0RA 2MWCA 1AGBA 2R1WA 3JWDL 1GC1L 3C60C 3QUXB 3RNKB 2BXZA 5TQ2H 3UZVB 5HI5D 2BCMA 5GISL 5GJTH 3JSSA 5D7KD 4F9LA 1C16A 1T1YB 4PJXB 2JKJA 4PJ5B 2A9AA 5B7MA 1JSYA 1CU4H 1QG3A 2I60H 1UWXH 2H0JA 5DSCB 1X6LA 3KPOB 5DJ2A 3U2JA 5AVRB 2X05A 5AOIA 3IJYB 2BVPB 3HLAA 5DEGA 2V7NB 4I89A 4I2XA 2WINA 3MRFA 4P2QD 4QRPD 4ABWA 5C0FB 3UJTL 3VH8G 4G8GE 3DVGA 3OKMA 1FO0H 4OV5A 2VR3A 2FGZA 4Z0BH 4L4TE 1ESOA 1EO7A 2ZJSH 4H0IA 4NOBA 4TSCL 3GMMB 1V3JA 4LLUA 3QUZA 1D7BA 4FQQB 2R4SH 1WGVA 1RPQA 2H2PC 2OMXB 3EJZC 3QJFA 1KPVA 5KSBF 2ZSVA 1RH8A 4AG4H 1SZNA 3IU4H 4U1GB 3SE9L 2G9HB 3GSVA 4KI5D 4U1SA