2YBRB

Crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
112
Chain Sequence
GGGGSEIVLTQSPATLSVSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLFSDASNRATGIPARFTGSGSGTDFTLTISSLEPEDFAIYYCQQYRYSPRTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT 9004G
publication title Structural Basis of Neutralization of the Major Toxic Component from the Scorpion Centruroides Noxius Hoffmann by a Human-Derived Single Chain Antibody Fragment
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 112
sequence length 112
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2011-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ybrB00
3VGAC 5KW9L 3KLSA 1AGEB 5FYKE 2Z8VC 1QYGH 5KSVB 2FLRT 1AP2A 5EN2B 3QBTB 4UZGA 2P8LA 1S7XA 3B9DA 1KC5L 4FQQA 5AG9A 2PYEE 2ZSWB 2NLJB 1NFDF 2OCFD 2CUIA 1EEYB 3VFWB 5F7UA 5A2FA 1NLDH 1RZ7L 1ND0A 4OCMC 4OUOA 1QO3A 1A3RL 4OLYH 3S5LB 1ZT4B 4MB3A 4FG6D 2EO1A 5T3XD 2VE6B 4WV1A 1AGFA 1RZKL 1MCLA 4X6BA 1UCBH 3LKNA 3LKPB 1SQ2N 1GAFL 3FRUB 1ACYL 4N8VB 5L2KB 3BDYH 4OV5B 1K8DB 3C87A 1LO0H 4QRQB 3SQBA 1T2XA 5GJTL 3IU3A 1P69B 4E41E 3GSNH 3AU1B 4HDIA 1T22A 5FUOH 1Q9WB 3MUZ1 1PSKL 1TJIH 1NGWB 2XWJA 3VRIB 3TIEB 1FAIH 5JQ6H 2M8XA 3QUXA 2R0LL 3RWIA 1JV5B 2RIKA 3MR9B 2P5EB 5IHBA 4PRBB 1J1PL 5DJ2B 5DURB 3BP6B 3CAFA 1AO7B 4UT7H 2I24N 3PGFH 1J12A 1EH9A 5JPMA 1JPST 2VLKE 1OGAD 3B6SA 1KENH 5GZNC 3UTSA 2CRMA 3CJJA 2JB6A 4HWZB 5IHZB 3BAEH 3KXFB 5IB4A 3ILQD 4N0CC 2B39A 4GRWH 1CFNA 1AXTH 1JGEB 1IGJA 5FIEA 3NIFF 5D1QB 3DHJA 3LKQB 2AJYL 4EKXA 4UOJA 3U4EA 1Q9OB 4NQDE 4XTRD 4MA1C 2V5TA 5FUCC 1NGQH 1T21B 1EZVX 1ZTXH 4M1CD 3H2WA 1U8QB 4R9HA 2Z31C 5HTSA 3P3YA 5T33H 5D7LA 3GBMH 3QUYC 3FQTA 3BW9A 1HHKB 1K5NB 2AERT 1JL8A 2H6PB 2CKBL 3FQUB 5CIPH 4DK3A 5I1GH 1BWWA 2Q6WA 1YMMD 1ULVA 4P2RB 1BEYH 4JLRB 1FORH 2O5XL 5L9DL 1XF1A 3C5JB 3NCCB 3HZVB 4NKOA 1MCWW 2F8OA 4ZUTA 3VA6A 3MCLH 4WFGD 5D2LE 1MIEH 1QBAA 4HKJB 4QHLA 4XP5L 2A6DA 4XC1H 3QDMB 3OR7B 1G6RA 3BZEB 2VL5B 3FT3A 3SDDD 4OZFB 4ELMA 4JY4B 3PWJB 1ZS8B 4LVNB 4G42B 5I2IA 1RZKC 2EEBA 4PGEA 3ARWA 3KYKL 5CJQH 4MNHA 4MNQE 4YHKH 1HXMA 3VH8B 3VW3L 1NL0L 3H9SB 3STZB 1RZFH 2FX7L 1LWRA 5IT2L 3VGHA 2EDBA 3OKKB 1G84A 1RUKH 4WHYH 3QDGA 1FVEB 2Y1VA 4Y5YA 1PY4A 4U2YA 3O3DA 4N8CL 4N9GB 4PJDE 5A40E 3QRGL 5DI8A 2J88H 1C5DB 2BOCA 5DVNA 2QHRL 4G9DB 5D6DC 1BFVH 2OR8A 5J13C 5HHXH 4YBQC 3MZGB 5B8CA 4HH9A 2AQ1A 2X4OA 1L0YA 1AP2B 3PE9A 2QEJA 2P8LB 1S7XB 4XMKL 1OQOA 4FQQB 5INCA 5A1AA 4HPYL 4YBHA 1OARH 3O2DA 4NQED 2ORBH 3GK8L 1ND0B 1QO3B 1NAKH 3NCJH 3BSZL 3AMKA 4ODSH 4RGNC 5TDPA 4DWHA 3O9WD 1M1SA 5DMIL 1T6VN 3GMRA 4ZUWA 3T4YA 1JWSA 1URLA 2PTVA 3L3GA 4WV1B 3SDAC 1AGFB 4BZYA 4KPHH 2B4CH 4KTEH 1QSED 1QBBA 4X6BB 3UP1A 3LKNB 2QADB 1M7DA 1M6OA 2BP3A 3CX5J 5E6IC 2DBLH 3IU3B 1OHQA 2DTMH 3TT3H 1HN1A 3QNYA 4HDIB 1T22B 3TT1L 4WWID 1CFSA 5JHDD 4HPOL 5BOZG 2XWJB 2Z9TA 2NY2D 4OZIF 2R0KH 4KTDH 2ITDA 2AVGA 1ZWIA 4M48H 3RWIB 4DUXA 5J9PA 2ARWA 3CSPA 4OZFG 3FFDA 2ZPKL 1IFHL 3VH8G 1WBYA 1WGOA 3ALWA 3VG0H 1CDBA 2FJFA 5EBGA 3VXNA 5JPMB 1B0GA 3B6SB 3RVTD 3UTSB 2HFGH 1JTPA 2JB6B 5IMMA 4FFWC 5MENA 2XACC 1AXIB 1A6VL 5EULV 4TTDC 1LP9E 5EA0L 5JTWA 3SJVD 3V4UL 1GGCL 5IB4B 4BH7A 3ZHLA 4OTXL 3I84A 5IMOA 1CFNB 3H7LA 3O6ML 3BEVA 3F5WA 2B7DT 1IGJB 4HIIA 2YPLA 5HYJA 3DX8A 3RQ3A 1K6QH 2FZ3A 1RFDH 2FLBT 2YXMA 1I9JL 4JJ5A 4YDJA 3U4EB 2F15A 4YHIA 4ORGA 4NJAH 5JDSA 1IEAA 2XRAH 1PGRB 3B8SA 5D7LB 3WIFA 1MELA 3C08L 3FQTB 2R0WL 3BW9B 3OZ9H 2WW8A 4PRPA 5D71H 1NGYA 4WW2A 1MCSA 2Q6WB 4LSSH 1SVZA 2N56A 1C12A 3PP3H 5BXFA 5EBLA 3TYGL 3UPAA 2OX5A 5E6YA 1QP1A 4NKOB 1JWMB 3PWUA 3W0WE 4ZUTB 4PR5A 4NZTH 5F7LB 15C8H 2BVTA 4QHLB 4BUHA 3VRLF 2ZCHH 1GCFA 5KVEH 2EDHA 1UWGH 4IMKA 4K2UL 1G6RB 1G7LA 2Z4QA 3OF6D 3PDOA 3FT3B 4ELMB 1UZ6E 5C6PB 2Y72A 1BIHA 5I2IB 4PGEB 4H1LH 4MNHB 2NYYC 1A2YA 3DVNA 3QHTC 3GSRA 1AC0A 4HFUH 4HV8A 4JN1H 1CBVL 3Q5YA 1JNHA 3NCMA 1I1FA 4P3CL 3JTSA 2LU7A 1FDLL 3O3BA 4X4ME 4Y5YB 1P6FA 3O3DB 2HMIC 4LSVL 5F9OL 4RA0C 2VLJA 3MACH 2QHLA 5DI8B 4P23D 5IOPA 2BOCB 4LPVA 4O58L 4GRMA 4F9LA 2X6MA 1Z9LA 2JTDA 3I50L 3HI5H 3NGBC 1CXKA 1U91A 1YA5A 5EZIL 3RY5A 5B8CB 4HH9B 1YJDH 2E8ZA 1UGNA 2X4OB 1LHZA 3PGDA 2AXHA 4MDJA 1I1AD 4PJIF 4Y7MA 4NFDA 2V2WA 5INCB 5I75C 5AYUL 5BVJA 1RVFL 3IAPA 3DMMD 1FNSL 3V6OE 4JM2A 3ARDD 4LCIH 4PLKD 2E7CA 5TDPB 2XWBA 3WJLC 3GMRB 3O4OC 4JVPA 4ZUWB 3T4YB 1JWSB 3L3GB 3WEXA 1NCAH 5A2IH 3SE4A 4RMQA 1M7DB 1M6OB 3PL6A 5DZNA 3QUMA 3QNYB 5D2NA 5AWNL 5EOTA 1CGWA 2APBA 1AFVL 4J12A 4QCIA 4QTIH 1CFSB 4P57A 2VXVL 1NLDL 1KFAH 4MD0A 4OLYL 3T0BA 4NDMA 2ITDB 1ZWIB 4P46A 5KSBE 5J9PB 2LABA 1U3JA 5IJKA 3T1WA 3TIDA 3FFCA 1L6XA 4GS7B 1UCBL 5JIPA 3UTPE 1CI5A 2QLVB 4GMSH 1S7VA 1WBYB 1OAYH 3BYYA 2JJVA 4LSDA 2FJFB 3UTOA 3VXNB 5C0BA 4QT5A 1B0GB 4F7MA 4YXLL 3IFNH 1TJIL 5B3NA 3CDFA 5IMMB 5MENB 5JQ6L 3D39E 4PJBA 5KTEH 2DQGH 4BH7B 5SWSD 1DBJH 4U1IA 5IMOB 3BEVB 3F5WB 4HIIB 5HYJB 2YPLB 2J7LA 3ARQA 3DX8B 3S37X 4UT7L 2R29L 2FZ3B 5C0GA 4KJWC 4CN6A 1A5FH 4Z0BH 2AEQH 1KENL 4JJ5B 4YDJB 4YHIB 5E5RB 5E9DD 4ORGB 1N5AA 5JDSB 4X7DC 1IEAB 3BAEL 5HJ3A 5HHQA 2NY7L 2NZIA 3WIFB 4MAUH 4PRPB 5GQBA 5DC9B 5I1EH 1NGYB 4PJCE 3DETD 3OG4B 4WW2B 5EU6D 4IRZL 4WU7A 4PYHA 3TP4A 4R4BA 1C12B 5BXFB 5GRZA 3LS5H 5EBLB 1A6UH 3PWUB 5A2LH 4PR5B 4Z7VE 5HVHB 5ACLA 3N1QC 3P9WB 4JFYA 4GXVL 3S9DB 5F9DC 1BD2A 2LU3A 2WWMC 3EBAA 1G7LB 4XB7A 1YNTA 3PDOB 1NC2D 5T33L 3GBML 1MQKH 5I1GL 3O0RL 4XC3H 1D5IH 5JXEC 2E6QA 1BQHA 2Z35A 5I9QB 5LWYH 1A2YB 1CXIA 3DVNB 3GSRB 1BEYL 4JRYD 3SDCD 4HV8B 5K59E 2EXYD 1JNHB 1I1FB 3JTSB 2NY5C 3O3BB 4OBSA 5DEZA 3MCLL 4TYUA 1CLCA 4JHAH 1MIEL 4KROD 3MA9H 3SGJC 1Q72L 4QYOA 4XC1L 4ONOA 1IAOA 2VLJB 1Q9LA 5EWIH 4GAJH 5IOPB 4JPWH 4JZJA 1IM9D 5LJYH 3QDJA 5CJXC 4OLUL 2OBGA 3GM8A 3OB8A 4QXTA 2HLFD 2ESVA 1RZFL 1VCAA 2NY1D 4S0SD 1U91B 3GBNH 5IEKA 3SKOA 1MIMH 2XQYK 1JIBA 5FYKD 1NEZA 3OJMB 3WL9A 5HHMB 4GSDH 3RY4A 3PGDB 2YRZA 4MDJB 2NZ9C 2VDPH 3U4AA 2NR6C 4B5EA 2OXHA 4RFEA 3TH3T 3ZYIA 4QRRE 1OWRM 2V2WB 2YC1A 3WDIA 1AJ7L 1HEZA 5BVJB 1BM3H 4R4NC 4GW4A 4L4VD 1BFVL 3B5HA 1XR9A 1BOGA 3LPGA 3W2DL 2IAMD 2R69H 4JM2B 2VUOA 2XWBB 5BCAA 3T0EE 3PWPA 4ZAKC 1SMOA 5I6XC 2G9HA 2Y9RT 3WEXB 2Q3AA 4OM1H 3PL6B 4V2BA 4U1SA 2V2XA 3QUMB 5D2NB 5EOTB 2ZUQC 2D2OA 4QCIB 4XP6H 2VQ1A 4OD3H 4P57B 1A4JA 1X7QA 3B5GA 2ORBL 2W92A 1Q94A 4D9LL 4MD0B 1RMFH 1NAKL 4NDMB 3NCJL 1I7RA 4P46B 1HHIA 5TQ0L 2WWKT 2HTKD 1GPOH 3FFCB 2B4CL 2GJ6A 2DQCH 3DHMA 4NQVB 3BESR 4GMTH 4TVSa 1H3TA 3OKEA 1AD9A 2DBLL 1S7VB 2DTML 3TT3L 5ANME 1F3JA 4MMZC 5C0BB 4QT5B 4F7MB 5E56A 2W0FA 1FC2D 2R0KL 4PJBB 4M48L 3RWHA 1Z0NA 2HT2D 4U1IB 3TFKC 1T2QH 3RWGA 1IAIM 1JCKA 1OAXH 3P9LA 2PXYD 5CSGA 2OJEA 4GRWE 3MTRA 1ZLSL 1MCJA 2VN4A 5C0GB 4F80A 3VG0L 4XPBL 1UKTA 3G04A 2X41A 3HE6D 4X83A 5IQ7H 1N5AB 3F7YA 1JZ7A 2JKXA 5HJ3B 5HHQB 4LU5L 5DRWA 5DK2A 3MLPA 1V3LA 3L3OA 2G5RA 3BYTA 4Q9CA 1WEJH 4WU7B 3LD8C 1OT1A 1W72L 4R4BB 3RVUC 4K71C 3JUYA 4NO3B 5KN5A 1TCMA 5M7QA 2V9RA 3SKNA 4XXCC 3S96A 4JFYB 3AB0C 3PDDA 1BD2B 2DB8A 4BQCA 5ADPH 2D4DA 1YNTB 4R26H 3W5NA 5E0QA 4WO4C 5D71L 1Y6KR 2FGZA 4K9EC 1BQHB 2Z35B 2UVFA 4LSSL 3HG1A 1RULL 1KN2H 1DUYA 4MNQD 4Z8FL 4U7MA 4NZTL 4KZDL 3FKUS 2VDOL 3P4MA 4KZEH 2ZCHL 1BJ1J 3OJ2C 4QYOB 1UWGL 2CKNA 1IAOB 4DUWA 4NNPH 1Q9LB 2BNUA 3BEWA 3D48R 5E8OA 3HUJA 3BPOB 5C0CA 4OCWL 1MFBL 3PQYA 1CU4H 1TLKA 5DGRA 4JZJB 3QDJB 4QGTA 3W11D 3ZKXC 1U3HD 2XFXA 4QXTB 3K46A 2FCBA 4Y4FA 2A74A 4JN1L 5KVDL 1C5CL 2BRQA 5IEKB 4QOKE 2DLFH 3SKOB 4ZXBA 4WY7H 1KCRL 3FQWA 4XAKD 1NEZB 1N4XH 1PFCA 2APFA 2NXZB 4RFEB 2YC1B 3CFJA 3KPSD 4DZBA 1HEZB 2KPNA 2V5SA 4GW4B 3HR6A 5C0AE 2YZ8A 3VFVB 4ESKA 1XR9B 1BOGB 1KJMA 3HI5L 3RTQD 4J3WA 3BD4A 1YJDL 4WCYH 1H8OA 2OP4H 3PWPB 4GRLA 2G9HB 2IMNA 4MNGE 3O45A 1J0YA 1XGQA 4MAYA 5L8JB 4BQ6A 4TNWF 1LK2A 2WANA 1BJ1H 5FGBA 3C6LD 4U1SB 3O3AA 2V2XB 3TJEL 4EBQL 3RVVC 2VQ1B 3X12A 1X6LA 1A4JB 1X7QB 1Q94B 4G3YH 5EB9A 1OLLA 4LCIL 1I7RB 5F9AC 5INDA 1HHIB 5IBTL 1P7QA 3VGGA 4X8XA 5KG9A 5IB3A 1NCAL 2GJ6B 2HT3C 3KPNA 1BQHG 4PJHE 5GRYA 5C0FA 3OKEB 1AD9B 1C5BH 5F7DB 4X6CE 3VWKD 1F3JB 5L2JA 2HH0H 1EEUA 2DLTA 4IHOA 1UM4L 4J2XA 2W0FB 3Q48A 2GITA 3H0TA 3VMNA 3NCYP 4M1GH 1J8KA 1KELH 2EDWA 3F12A 1JPSH 3RWHB 1DVFD 4Y88A 4PB9L 3VD5A 2VC2L 4PB0H 1GIGL 4ZFOL 5CCKL 1FNHA 1OSZA 4HIHA 3RWGB 3P9LB 3VI3F 2OJEB 4GMSL 5I30H 4Y4HB 1OAYL 4IJ3C 3G04B 4TUOA 5F9WC 3EUUA 1SHMA 3GRWH 4MHHG 5ICZA 1NEZG 4Y16A 4N1EA 3F7YB 3EDFA 3W5MA 5KTEL 4LNVA 1RK1A 3T2NL 5DRWB 5DK2B 3K74B 5HI5D 1DBJL 2GW5A 5C6WH 1J1XH 3FCTA 4W6YB 4W4NA 5JMOC 4XNXL 4Z0BL 1RHHA 2AEQL 5KN5B 5C7XH 3SKNB 3W0WD 4U1GB 3S96B 4DK6A 1CE6A 1KB5A 4D2NA 2VDNH 1YJDC 2AABL 2G2RA 4MAUL 4BKLA 1OTSD 5I1EL 2CRZA 3HG1B 1DUYB 4M61A 4XHJD 4HS3A 3LS5L 3WFBH 2C3VA 4O4YH 4D8PA 2NXYB 1FG2A 4U6YA 1WFNA 3P4MB 5F70A 4JY6A 1CCZA 3WO4C 5DJDA 1ODAA 4QGYA 2VLRD 1R3LA 1FYTE 1GZQA 5CEXA 2BNUB 3BEWB 5E8OB 1YUHA 3HUJB 3PQYB 3NA9L 3S34H 1D5IL 3MNZA 5LWYL 2XFXB 3AC0A 5HHOE 1VEPA 2WAHA 2A74B 4Y4FB 2Q7NA 3RUGA 2O93L 3DNKA 3CX2A 3JV5A 3K1DA 4ZXBB 3FQWB 4XVSL 2NW2A 4E5XA 4KDTC 4DAGH 1JMXA 3RPIA 3PUCA 4G6AD 1ITBB 4H20L 1FNAA 4CVUA 2EIEA 3CFJB 4QY8A 3NIDF 2ZZUT 4G8GE 4DZBB 2Q1EA 4XBGA 2P8MB 4ZUUA 5JOFA 3VCLA 1HCVA 3T2OA 4ODVH 3QXAA 4RAHA 4DEPB 1KJMB 1F4AA 5MP6H 3SKMA 4N0YH 4KKAC 3FB6A 4GRLB 4HW6A 5KZCD 3IDYC 3O45B 1BZ7A 3TJHC 1XGQB 4GSDL 4MAYB 2O5ZH 4Y2DC 1LK2B 3LRSA 2GTZA 5GISL 3WKML 2X40A 3QFJA 3O3AB 5EU7C 2YWZA 3X12B 3P30H 4IIQC 1YEJL 3KS0J 5EFIA 2R69L 5INDB 2W0PA 1FNGA 4M8QA 2MTPA 3WIHA 4R4FL 1P7QB 5KG9B 5IB3B 4QF1A 1RUMH 3GIZH 4B7IA 5C0FB 5LG1A 4OM1L 3O2DH 4YHOL 3UTPD 3TZVC 3C09C 5CEZD 3BKJH 1DEEA 1UC6A 1BP3B 4PUBL 1ZGLA 4OD3L 4IHOB 2GITB 3H0TB 4I13B 1RMFL 1ZEAH 4DVRL 3F12B 3L7EA 3D39D 4A2LA 1VKXA 5H2BA 5DD3L 5E2JA 2VDLL 1T1ZA 1R6VA 3RVWD 3MPCA 5I8KH 2DQCL 1OSZB 4HIHB 5EU7E 3CMOH 2ZOLA 2DL2A 1NFIA 3MRFA 4TUOB 3DVIA 2E3VA 5ICZB 5A16A 3PWLA 4Y16B 3IRPX 3RX5A 1EUUA 5C6TL 5E70A 3KS0H 3JSSA 1RK1B 3MBEC 4XI5C 4G8EA 4NCDA 1PW3A 1T2QL 1HSBA 3FCTB 4U0RB 1WZLA 3CSYA 4L9LA 3HA0A 5HY9A 1XF2A 3SGDH 3GZKA 1RHHB 4EDWL 2IFGA 1IGFH 4NIKB 2AK4E 2Y07L 4FZ8H 2J6EH 4Q9BA 4GAYA 3ULVL 3AREC 4Z7OF 1H8SA 1N6UA 1CE6B 2D31A 4ZNEE 1KB5B 4KGLA 4M6NH 1CIDA 3ZTNH 3UPCA 1G7IA 1SJXA 4BKLB 3U30C 4POUB 4JN2A 1WEJL 4OLVL 4GKNA 4M61B 5FAAA 1N7ML 4HS3B 3ZE1E 4L8BA 4ZO9A 4K3EH 1J11A 2C3VB 3MLXH 3NCFB 4D8PB 4S1DC 2AXJA 1T83A 1FG2B 4U6YB 2P47B 1JN6A 4JY6B 4KKNA 3RHWF 3MLTA 5DJDB 4OQTL 1R3LB 4JG0L 1GZQB 5CEXB 1YUHB 1QG3A 4XP4H 4ZO7A 1YNLH 5T5FL 3MNZB 4LEOA 4PJ8C 1OY3B 1YMMA 4LRIA 1FNFA 3RUGB 3PNWA 3MXWH 5E2WH 2Q76A 2NW2B 5KS9F 4E5XB 7CGTA 4KJYA 3RPIB 2GY5A 4F8QA 4V1DD 4JANA 3CFCH 4NN5B 3M1BA 4QY8B 2IG2L 3SDDA 3SGKC 5TGBA 4N90D 4U33A 4XBGB 5JOFB 3QEQD 3MUY1 1DR9A 2YMXH 4HUMB 3VCLB 3EYSH 1XCQA 1SMAA 3QXAB 4ACPA 4WDIA 1LE5A 3SKMB 4OZGE 5D1ZD 2DLFL 1BFOA 3HRPA 3FB6B 5A2JH 1CS6A 4BQBA 3T0ED 1BZ7B 1CTNA 1N4XL 2XZQH 3LRSB 2GTZB 3SDXA 3B9KA 4JREB 3QFJB 3C8DA 4U2ZA 4YDLB 1JFQL 3U9PH 2VIRA 3T0DA 5F6IB 5I0ZA 5EFIB 2DQHH 2Y23A 3MMEA 3UDWC 5GZOD 1FNGB 3UJJH 4WCYL 2OP4L 4M8QB 4L4TE 2VXSH 4C83A 4M5YH 3ULVC 3K3QA 1ADQA 4U1MA 4QF1B 3FB7A 3GI9L 1IZKA 1DEEB 4U4BA 1ZGLB 3AROA 4ZDHB 1L9NA 3QH3A 3BRDA 4CJ1A 4CU8A 4NQEA 1CQKA 4G3YL 1S9VA 3PABA 4PP1C 3SCMD 4MXVF 4U1HA 1AH1A 3BGMA 1CL7H 3QXWA 1EIBA 3L7EB 2Q7YA 1SY6A 3O9WA 4YWGH 1VKXB 1MCDA 3JUZA 5GGQH 3CNKA 1F42A 1B9ZA 1T1ZB 3ARGD 4L9DA 5L2KE 1QSEA 32C2A 1F8TL 4I0CC 3VFRA 2ZOLB 5F21B 2PNDA 4F2MA 4UI2A 4XMPL 5D1QC 1X5AA 4F37K 4I4WA 1NFIB 3MRFB 2HH0L 3KPRD 5ILTH 5JHDA 5A16B 3PWLB 3HRZA 4M1GL 4XWGL 4YDIL 3U7WL 1FO0A 1HSAA 1IT9H 1JPSL 3N1MC 2YD5A 3ULVE 2P5EE 1QD0A 1H3UA 4G8EB 2F53A 1HSBB 4PRDA 3CSYB 4L9LB 3RIFF 5LBSH 5HY9B 4UINH 1XF2B 1CF8H 2ZP0T 4UUJA 4GAYB 5F8QC 3MNVA 5F8RC 3ZLQC 2D31B 1XIWD 2WLYA 4KUZL 2D7NA 3SJVA 1TZGH 1G7IB 3U36A 4JN2B 4LVNC 1YY9D 5HGDA 4L5FH 4GKNB 3B5TA 4KAQH 4L8BB 3D18A 4LGSB 1TCRA 4DKEL 3D3VE 4U3CA 4XMLL 5C7XL 4FTVE 3NAAH 4OF6A 1UM6L 1KIQA 1JN6B 3R8QA 5CD5D 5DLML 3MLTB 1DQLL 3S36L 3BZ4A 3WDHA 1MQ8A 1V3JA 5DHXB 2VDNL 5JIIA 1EGJA 4Z95H 1WAAE 4H0GA 3ULUF 4QRPD 2Y25A 4ZG1A 3IJYA 4LEOB 2NPLX 1MJUL 1N6VA 2BX5A 3QPXL 5IHLB 3AVEA 3QI9D 4CVZA 3PNWB 2QSCH 1KYOJ 2Q76B 3MV8D 1SJVA 1KTRL 1HCFX 2ZCLH 4DGIH 4OGAC 2W59A 4KJYB 4TNVF 1F90H 3MV9E 4NUGH 1U6AL 4JANB 3ARXA 1M05A 3SE3A 3M1BB 1U9KA 3OF6A 4X7CC 3SDDB 3S3JA 3FJTA 5TGBB 3CIQA 1N5YH 1O7SA 3H9SE 1EMTL 4Z7NF 1XCQB 2E27L 1NMBH 4APQD 4HBQA 2LFGA 3K2UL 4WDIB 1PEZA 1LE5B 1BFOB 4CW1A 3TN0D 5IW6A 4K7PL 4WV1C 5E24E 2W07A 1Z3GH 3VFOA 2QL1A 1KB9K 4NQXA 3SDXB 3B9KB 2QADC 2W38A 4MCZA 4P23A 5H35A 4PJEA 4AEFA 2VIRB 3TYFA 4ODVL 3FN9A 3FMGH 3MMEB 4EJ1C 4N0YL 3BDXA 4HKBA 1CT8A 2DJUA 1PX4A 2YZ1A 4C83B 1WCBA 4NJ9H 4U1MB 3JWDH 4M6MH 2AP2A 4HGWA 1I1AA 3FB7B 2X5PA 3WIIH 1LO5A 1QSZA 1CG9A 4DOHB 3QH3B 3P30L 4NQEB 1R0AH 1MCOL 3BMVA 1S9VB 3PABB 3ZKMD 4WI3A 3IDXH 4U1HB 2FBJH 5HBBA 3BGMB 3ARDA 5I15L 4JPVL 2Q7YB 5GGTH 5HYIA 3O9WB 5BRZD 3H42H 3O81A 1DUZB 3RI5F 5T1DL 1QSEB 1RUML 32C2B 1OAKL 3GIZL 3VFRB 3UJIH 3O2DL 4F2MB 3TBSA 3RX7A 5I1KL 3SE8L 3BKJL 4I4WB 3CFDA 1SEQL 3V0WH 5JHDB 2FHBA 4XVTL 3HRZB 2NY2B 1FO0B 1HSAB 4BFGA 1ZEAL 1YMHA 5CLWA 5BZDA 4HUXA 2ED9A 2F53B 4LSUH 5I8KL 4PRDB 1WBXA 4HF5L 3LIZH 4HWNA 5IVXA 2A0LD 2HJLA 3HLAA 4QXGH 3UTSE 2HFTA 4Z76A 4JFZH 4UUJB 5EOQL 2EXWD 2DQDH 1TVBA 3MNVB 1R3JA 5TFSH 4FQXD 3SJVB 2HAZA 5SWSA 3U36B 1FJ1A 1LO3H 5JXAL 5HI3C 4X6EA 2WUBH 4Z0XA 4NWUH 5HGDB 5BO1H 4FZEH 3C5SA 2J8UF 2BMKA 2AJSH 3D18B 1TCRB 3VXQA 4JO1H 5DD0L 2ENSA 4H8WL 1IGFL 4FZ8L 2J6EL 5B39A 2GQHA 1KIQB 1T0MA 3T08A 5IUSA 3MLYH 4Y5YC 3VXRE 3BZ4B 2IBGA 3JV0A 5I8EA 4OZ4A 5HVFB 4U1NA 4BK4A 3LQAC 1I3RA 2F5BH 3IJYB 3R4DA 2I5YH 5EU6A 1OWWA 4MXWH 4W68A 4FFVC 4CVZB 5HHOD 4GG6A 4OGXL 4K3EL 3MLXL 1R3HA 3DX7A 3CSBA 3HUJF 3BT2L 5B8CC 1J0ZA 3N9GH 4PJAF 5I8OH 3JZ7A 1TTFA 3CZFA 3DIFA 3EJYD 3OL2A 1M05B 1NC2A 3GB7A 4XP4L 2R0ZH 2I60H 4PBVC 5E2TL 1YNLL 4YXHL 4G8GD 3DVFA 4FQCH 4KMQA 3MRDA 3MZTA 4JRYA 4J6RH 3SDCA 4F58H 3MXWL 1RIUH 3QDGE 5E2WL 3N1FC 5DQ9A 3PWVA 1QFOA 4CW1B 1NLBL 4O2CA 4AT6A 5I1HH 4Q58C 4PLJD 4NGHL 5IW6B 3KLHC 4XVUC 3KAAA 1I85A 3NIGF 3E0GA 3F58H 3VFOB 2AKRA 4NQXB 3CFCL 5FDWA 2NW3A 4MCZB 4P23B 2XKSA 1WZ1H 4LQFH 1X5LA 5H35B 4PJEB 2YSSA 5FO7A 1IM9A 1PYWA 2YMXL 3EYSL 3TYFB 5DMGD 3QIBA 4HIEA 2ATKA 5GS2H 4PPTA 3V4VH 1I1CA 1K85A 4HKBB 1CT8B 1WCBB 2A6IA 1IMHC 4KI5F 1Q38A 1DQQA 1UCTA 4HGWB 5C70A 2XZQL 1I1AB 4GS7C 1J10A 3AS2A 1LO5B 2J8HA 1QNZH 1X4XA 1RK0A 1CG9B 4DTGH 4Q9RH 4L4VA 1OAQL 4ONFH 2DQHL 5FK9A 2IAMA 3ARDB 5E08H 3UJJL 4DW2H 4H8WC 2OZ4A 4LPCA 4M5YL 1YEFH 1DFBH 4Q0XH 1A6WH 2DWDA 5D72H 1X5KA 3TBSB 3CFDB 5DHVH 8FABA 1YYLH 4YH6A 2FX8H 3OAYH 1CGTA 3JBG7 4OI8A 2IPTH 3AY4C 5AEAA 2YD7A 4DGYH 1YMHB 35C8H 1XZ0A 3C9NB 4YWGL 1KJ2A 5BZDB 4POZC 5GGQL 1U95A 4NOBA 3KHOA 1AQKL 3QUML 1WBXB 4KVCH 4WW2C 2E9WA 4CL7A 5IVXB 2CGRH 4ZD3H 2IBZY 1PLGH 3HLAB 3W82A 5ILTL 4Z76B 1EHLH 2AK4D 1RZIA 5HVHC 1TVBB 1R3JB 1HILA 5ITBH 1FZJA 1EFXD 4IMKC 3KLAA 5SWSB 5GGSY 2HT4C 1FJ1B 4X6EB 4P9HH 4Z0XB 2PXYA 3C5SB 5I9QC 4K55A 2Y36H 2BMKB 5LBSL 1MRFL 4UINL 1FL3A 3VXQB 4Y5XA 3WNMA 3V52H 1U2CA 2X4SA 3HE6A 5B39B 1T0MB 1INDL 4AIZA 5I8EB 1A9BA 1G7MA 5DMJB 1TZGL 4OZ4B 4YAQA 3BN9C 1JGLH 4U1NB 3TO2A 1I3RB 4W4OA 2R4RH 4CVWA 1AE6H 5EU6B 4L5FL 3SO5A 4NQTA 2C7UA 4KAQL 2VB5A 4F9LC 2FATL 4GG6B 3KLDA 5HI4D 1ZMYA 1R3HB 3DX7B 1K9TA 3NFPA 3EDDA 1KB5H 4Z77B 4IOFC 4PJ9A 3JV6A 1F02I 5D2LA 3CZFB 1YEIH 3DIFB 2DM7A 1PZUB 3IKKA 4ENED 1NC2B 3MRRA 3OXSA 1C16A 3GB7B 1QHPA 1MJ8H 4AZ8A 4JO4H 4D94A 3MRDB 1UA6L 4JRYB 4MNQA 1Y18A 3SDCB 3UO1L 4HJ0D 4Y0GA 5GHWH 2QSCL 4M7JL 3MCG1 5DQ9B 3PWVB 4JM2C 1FNLA 1Q1JL 4HWBA 4O2CB 4AT6B 3ZKND 2ZCLL 5ISZE 3ARFD 4DGIL 4KROB 5F7EL 1ZT7A 5FA4A 4ETQA 2AKRB 1IILE 5FDWB 3RFZC 4JQVA 2NW3B 4PJDA 3PL6C 4P2QD 5D2NC 2YSSB 5FO7B 1IM9B 3TBTA 4L3AA 1PYWB 3ZDYF 1A9EA 4U49A 5MHSD 2FWOA 3QIBB 1U3HA 4HIEB 4P2OD 2ATKB 3UTQA 4OCRL 4L29A 3WCYA 2NY1B 5JIHA 1AR1D 3VXUD 4JGMA 4P46C 4NZJA 4JDTH 3FQRA 2FH8A 1IQWL 3KYAA 5IJKC 2A6IB 4LIQH 1RY7B 1DQQB 5FYJL 4RBPK 1J88A 2EC9T 4XVJH 4KRPD 3TO4A 1RK0B 3QSKB 1T80A 3EHBC 5B39G 4F15B 4L4VB 1UJTA 2ZUYA 1NFDE 5FK9B 1ZLUK 4AM0A 2IAMB 3QQ3A 3RTQA 2X44D 4O2EA 3MOAH 4TVPD 3ZDZF 2DWDB 1NH6A 3WIIL 5JQHC 3C6LA 3S35L 3PHOA 4LNRB 8FABB 2BK8A 2UWEF 2FBJL 3G6DL 3L5XL 4DN3L 1DQDH 1D9KD 1XZ0B 3RVXC 4ZS7H 1KJ2B 3H42L 1U95B 1B2WH 5B3JE 4L4JA 2G60H 4PJGF 5JPNB 3AS0A 2V17H 2FGWL 5FGCE 3UJIL 2H41A 5C0BE 4JKMA 3GJFA 3ABZA 5C92A 1D6EA 1H3VA 4L8CA 3V0WL 5IB1A 5T3XH 1RZIB 4KVNL 4JPIA 2RQ8A 1HILB 5IIEA 3D5OF 4ZTOH 1FZJB 1MY5A 5I1DA 3KLAB 4TTGA 5HVGB 3CD4A 1EA9C 2NTSP 2PXYB 3IJSA 2AQ2A 3FT4A 2XKNA 3NVQA 4FS0A 3QB7C 4P49A 4NQUA 1FL3B 3NZ8A 4QXGL 4QXUH 2X4SB 3HE6B 4JFZL 1HNGA 3D3VD 4FTVD 2DQDL 4NQDB 3UYPA 5TFSL 4AIZB 4HXAH 4BZ2H 1A9BB 1BVKA 1G7MB 4N0CD 4YAQB 2YUZA 43CAA 2VZ1A 3TO2B 3BPOC 3I3EA 2WUBL 1N26A 1FZMA 4NWUL 4JZJC 3CSGA 2C7UB 4GXUN 5JMRA 3EJZD 5C8JA 3CH1A 3HMWH 3NFPB 4WWKA 4NNYA 2XXCB 3W0WA 1I7TA 3MLYL 4PJ9B 1BD2E 1CXHA 1YPZA 2X1XR 3JV6B 5D2LB 3WNPA 3MRRB 3OXSB 2E8YA 1C16B 2NXZC 4GBXD 2HA1A 2XXMB 4LASH 1KTKE 2F5BL 4FXKA 1LO4H 3VI4F 1VEMA 4MXWL 5FM8A 4MNQB 1Y18B 3GSXA 1KLUA 1INQA 3HB3C 5GS0H 2F19H 4LARL 5D96B 3BVNA 3P0VL 3EOTH 3N9GL 4UV4H 5I8OL 4X4MA 4HHAA 1ZT7B 3LKOA 1EEQA 5FA4B 1CR9H 4ETQB 4M7LH 2VLRA 4G6KH 3DRQA 4PJDB 1CE1H 2I60L 2UY6A 3D1MC 3F8UB 4XXDA 5DTFA 3TBTB 4FQCL 1A9EB 2ESVE 2FWOB 5T3ZL 3U9UA 1U3HB 3KYOA 5E99H 3I6KA 3UTQB 4L29B 5EZJA 5IGXL 3MO1A 3EIFA 3FQRB 4P4KD 1WCQA 2YKLL 4CJ0A 3P40A 5CJBA 3TO4B 4LQFL 4LBEA 4LSRH 3LQZA 3C8KA 3PV6A 2CO6B 4YHPA 2X89D 1IC5H 3MBXH 4JFOA 4K94H 2HWZH 4Q2ZA 1OD7A 2F58H 1FFOA 3B9AA 3P77A 4ONGH 1MAMH 4AM0B 3QQ3B 3RTQB 3PWPE 4K8RC 3V6OA 2K7QA 4HK0A 5JW4N 4O2EB 3ZHDA 4P3WA 2P43B 2VLME 5DO2D 1RU9L 3RWCA 4OLXL 1KULA 3C6LB 4UV7H 1A7RL 4Y4HC 3PHOB 3DSFH 2PUQT 5CMAA 4TQEL 2XY1A 2ZUTA 4RGND 4U0QB 2VKWA 2YD4A 3SY0A 2B8OT 1ITCA 1DJSA 2D7TH 2EE2A 2OK0H 4J4PD 5KSBA 1BPVA 1YEFL 1DFBL 4Q0XL 3RA7H 3MJ8A 1KNOA 5FHAH 5D72L 3GJFB 4I3GA 3ZL4H 3L5IA 3LN4A 3VMOA 1D6EB 1YYLL 4L8CB 5IB1B 3MSPA 4HT1H 4U1GC 4JPIB 4WEUD 3GJEA 5FV2A 4DGYL 5IIEB 3TPKA 3D39A 5I1DB 1LP9B 5TH2A 4HFWA 4HAGA 3MGTA 4X4YA 4QNPF 3HNTH 2VOTA 5E2VL 1EEZA 4RSVA 5I1CH 3F7QA 4KVCL 3IJSB 2E6PA 3EYQC 3FT4B 2XKNB 5DT1H 5TE6L 2E9JA 4ZD3L 1TJGH 3NZ8B 1PLGL 1JNNL 5HYEA 3ULSA 2NXYC 4J3UA 3WXVH 4FP8H 1BVKB 4TNWK 2A73A 43CAB 2ZNXA 5GGVH 2O5YH 4P9HL 3FAWA 1FZMB 1MNUH 3N85L 4RWYH 3AFLA 3O4LD 5CJ8A 1CFQA 5C8JB 3CH1B 1RSFA 4UTAH 4WWKB 5HDOA 3V52L 1PKOA 4NNYB 2NTFA 2AV7A 1A7NH 3HC3H 1NAMA 4ZXBC 3W0WB 4X7FC 5GXBB 5IESH 4Z7VA 1FPTH 1I7TB 1YPZB 5HYSA 1Q0XL 3CMGA 5C0NC 2PKDA 2EIDA 1U8LA 3S3SA 1IM3A 2APWA 4FXKB 1AE6L 5I1LA 2MKWA 5E95B 1TXKA 1KLUB 3GI8L 1INQB 4PTTA 3OSKA 1YDPA 2F5AH 4DEPC 2VR4A 5J89A 1KB5L 3E8UH 3BVNB 1QUNA 2LAAA 3KHQA 3B83A 5DFVD 1N64L 4GRLC 4HHAB 3LKOB 1YEIL 3V7AE 3V5HA 4MAYC 3CK0H 2VLRB 4JQXC 3EFDH 1YEGL 5C0CE 3PQYE 5D70L 5EORH 4FQ1H 4R7NA 5FGBC 5KSUA 1CDCA 2NYYD 1J87A 1MJ8L 2YD6A 4JO4L 3U7YH 1BJMA 5DTFB 4XXDB 4BQ9A 3NH7L 3U9UB 2PCPA 3KYOB 4KI5C 2ZG2A 3I6KB 2YD3A 5EZJB 3MO1B 4YUEH 2O61A 1MJ7L 1JPGA 5FB8A 2Q87A 3QCVH 2CRYA 1KGCE 5E4IA 1MFEL 2L7JA 4X7SL 4B7LA 4V1DA 4RIRB 3DWTA 5MEPA 4DFIA 1OM3L 1A3QA 1A14H 1BAFH 3D9AH 4LBEB 5KANG 1PDKA 3NMEA 3LQZB 3C8KB 3PV6B 3QEQA 4YHPB 4XPAL 4JFOB 2CUHA 4Q2ZB 4N68A 3WO3B 4CAGA 3P77B 1FFOB 5D1ZA 4NOFA 2DLHA 5AAMA 4JVUA 4JDTL 4RFOH 5KZCB 4HK0B 5FHBH 3T0EA 5B4MD 1CIUA 1YEDA 2NY3D 4LIQL 1Z2KA 4OZHA 4M62L 4XVJL 3WUWA 3RKDD 1KACB 4KKLC 5CMAB 4P9HC 3BE1H 1QFWM 3GSNA 2E7MA 4Y16C 3SY0B 1L6ZA 1GRWA 4R2GD 4DN4L 3ZTJG 3D0VA 5KSBB 5LCVH 2F74B 4NO0D 3CXHJ 2Q8BL 3MJ8B 1KNOB 4U0RC 1JI2A 4ISVA 1X5IA 1L9MA 5SWZD 3OMZA 3EO1A 4ORZC 3OKDA 4YHYB 1I8LA 4U7KA 3LN4B 5ANMA 4M43L 4L3EE 3TVMA 4H25A 3WIHL 1KTDA 3PHSA 3MRKA 3SCMA 1F5WA 3GJEB 2DRUA 1DQDL 5GRJL 3BUYA 5IVXF 3D39B 5TH2B 1J0IA 4JR9H 1KXTB 4HFWB 2XPGA 3MGTB 4X4YB 1B2WL 4I8DA 3S8WA 3ARGA 1EEZB 4TUJA 2DBJA 1WISA 2V17L 2IPUG 1JZ2A 4ZS6C 1LO2L 3MV7E 1FBIH 3C60D 4D0DB 3O11A 4BH8A 4NO2A 3CFKA 1ACZA 3ULSB 5T3XL 3OWEA 1DDHA 4D9RD 3O2VH 5LAXA 2X05A 5BV7H 2A73B 1HKLH 4ZTPH 4XNYH 2MHAA 1OLZA 1QKZH 1CFQB 1AKJA 3IAGC 2IQ9H 5CIPA 2JJWA 1F3DJ 2EDNA 1PZ5B 2NTFB 2AV7B 2KH2B 1NAMB 1FSKB 4ZFZB 4IDLA 2HVJA 4Z7VB 4WI7A 5HYSB 4BZ2L 1JGVH 1XIWA 2DF3A 4ONHA 4NN5C 4HGMA 1U8LB 1IM3B 3KPTA 2RCSH 5I1LB 5AG8A 4Z7WE 4KWUA 1CVRA 3FT2A 4PTTB 4LCUA 3HMWL 3QHFH 1ZLVK 2WWMD 1G9ML 5ISZD 3V5HB 2G5BA 1V7MH 4OIIH 3SGDI 3HC0A 1F4WH 1C1EH 4R7NB 5KSUB 4JREC 4LASL 1PBYA 1DE4A 3MXVH 1LO4L 1ZXQA 4YDLC 4XCYA 2PCPB 3RUGE 3QI9A 4KKCC 3H9YA 5F6IC 5D1XA 1MCBA 2EKJA 2O61B 1JPGB 4QOKA 2C4FU 5FB8B 1RHFA 4UV4L 1F3DH 4LLYA 4RNRA 2CJUH 1A7QL 1CR9L 1EHAA 4NQCE 3OQ3B 1J5OL 4V1DB 3U1SH 4LIQE 1WF5A 5DUPH 5JNYA 5MEPB 1J8HD 3V0VA 5CP7A 4G8IA 4ODHH 3QEQB 3WD5H 3OKYA 4HEME 5E99L 3FHAA 4APQA 5C0AA 3V7MA 4OAWA 5D1ZB 2HKFH 1HHGA 5KVGH 3PJSA 4FG6C 1WTLA 3T0EB 3V5DA 5DJXA 1YEDB 4MNGA 3QUZD 4ODWA 3UJTH 1EVUA 4AEIH 2EKSA 3QFJE 4HQQH 4PBXA 2DQJH 5BZWA 3F7VA 4HKZA 2DIAA 3CZJA 1EERB 3TGXA 3WUWB 3ROOA 3T0AA 4LSRL 4K3JL 5F7KC 2BOBA 3MFFA 1YEEL 4LVOB 4YX2H 1T7YA 1IC5L 3MBXL 1AGBA 3SBWA 2H8PA 5IVOA 3GSNB 4PV8A 5HYSG 5JORA 4CRPA 4HC1H 3D0VB 1P4IL 2L4OA 4MJ2A 2DM2A 1X3DA 4LLUA 1TMCB 5BW7A 4ISVB 3VXSE 2QQLL 3EO1B 3OKDB 4L9LC 2RAMA 5ANMB 1TPXB 3VMPA 3TVMB 4H25B 1KTDB 4DQOH 3MRKB 4U7SA 1SEBA 2IADA 5T3XE 3BUYB 3JVGA 3ELAT 5K9QI 5BRZA 2OK0L 2XPGB 4HCRA 3ILQC 3CGTA 1G9MC 3ARGB 4K3GA 4TUJB 3RA7L 1RIHL 1AHWA 5FHAL 2VN7A 4HXBH 3N1PC 2FO1A 2BJML 4GRWB 3DTXA 5FEBA 2D0GA 3ZL4L 3O11B 4BH8B 4NO2B 3CFKB 1KJ2H 3KWWA 1T83C 1FVDA 4JO2H 4XTRC 2EIBA 5LAXB 4M1CC 3UEZA 1MWAA 5F93C 2VQTA 3BJLA 1EHNA 2JK5A 4UDTB 1UYWH 3HNTL 3EKCA 1F4XH 2MHAB 5T1LD 1AKJB 1CL7I 1O0VA 1OGAE 1TJGL 1FO0L 5CIPB 4LRIC 1MH5A 4LLDA 5CD3A 1UB6A 3P11H 1MCIA 2HVJB 3WLWD 1G9NL 1SBSH 3KPQA 4FP8L 3EYUH 1XIWB 3MLZH 3O2WL 4FQXA 5BJTA 4ONHB 4TUKH 5E1AA 3SDDC 5GGVL 2DMBA 3CVIL 5CSBA 25C8H 3LEVH 4LCWD 5CS7A 5M94B 4UTAL 4N0UA 3NTCL 4H1LA 3ISWA 4LPXA 1CICA 1A7NL 4OV6F 1U8JA 3HC3L 1S7QA 2ZNWA 5LGHL 4P59H 2GT9A 2G5BB 2MQ0A 1F4YL 1UEYA 1I7ZA 3HC0B 5HGAA 3B9KC 1HE7A 2HLAA 1DE4B 1QZ1A 1YMME 4G6MH 4UAOB 3OGCA 3L3IA 3ULUH 4XCYB 5E7FA 1B4JH 4Q9QL 3QI9B 5HHOA 5D1XB 2VXUH 2F5AL 2P5WD 3IF1A 5F1OB 4QRUA 5DJAA 4WFGE 4PJDF 2EDQA 1EGJL 4QOKB 1DN2A 1T4KA 3IDNA 3OAZH 4RNRB 1EAJA 1YECL 3OJVC 4EI5A 2WIMA 3CK0L 3P4NA 4U05A 2VDML 4N1HB 2FECI 5EORL 3RIFK 5JNYB 3V0VB 1S78D 5CP7B 1XMWA 3U7YL 4G8IB 5D5MF 4G8GA 1NCBL 1T5WB 3OTTA 4APQB 1VDGA 1ZHBA 3H8NA 5C0AB 1IQDA 4OAWB 4YUEL 1HHGB 2QSVA 4NNXA 3UAJD 3O9WC 3PJSB 3G5YA 4IRSD 5DEFA 3V5DB 5DJXB 3QCVL 4MNGB 5FKPA 5HGBA 1I1RA 3MRQA 4ODWB 1BZ9A 2EKSB 3S4SA 5BZWB 4DJMA 3F7VB 4HKZB 4TN9A 4WU5A 4KUCF 1A14L 1BAFL 3D9AL 3ROOB 3ZMRA 4XWOD 1L7TH 2R8SH 2BOBB 4YDKL 3MFFB 1AGBB 2H8PB 4PV8B 5JORB 5J6HA 4WIQA 3RY6A 2NY2C 3LN5A 4C57C 3CXDH 1V7NL 1OP3K 1F6FB 5EO1A 1G9NC 4LLUB 1BQUA 1DTUA 5I1IL 4YBLB 1VGEL 4JRXD 1FFRA 4TSBH 3OXRA 3GKZA 2P45B 3H9HA 4MQSB 3INUH 1QLEH 2C3WA 1T7XA 3BE1L 3IDGA 1SEBB 2IADB 4TNVK 3QIUD 4WHYG 2LVCA 5BRZB 2HT3D 5ERWB 5GRVL 5LCVL 1QSEE 1NCWH 4IEFB 4MHHI 1AHWB 4JFHD 4PRNA 2WQ8A 4OFKA 4P4RA 3DTXB 4U6TA 1MY7A 1C08A 2BHZA 1LP9F 3DX9A 4AIXA 5JHDE 3KWWB 5ID0A 5EUKA 1FVDB 1B3JA 1RZGA 4J3XA 4NC1C 3IRZA 4P9MH 4MJ5A 3LH2H 3QPQD 4K23H 1GC1H 1MWAB 1RD6A 1ZHNA 1BOYA 5M95B 2SEBA 2UV3A 2JK5B 3P0YL 3L5HA 4O00A 1EX0A 4I3RL 1FCGA 4G8FA 1FBIL 2BRRL 2VNCA 1IAIH 1MH5B 8CGTA 4LLDB 5CD3B 1UB6B 5CZVL 3X11A 2AK4A 3MOBH 2ZJSH 2PYFA 5A3IC 2Q3ZA 3KPQB 3SJVE 4HGKC 3O2VL 1X5GA 4FQXB 3EDKA 5BJTB 1EFXA 4ZNEA 5BV7L 3SE3C 3L9RB 1T20A 5E1AB 5HHPA 5T5NG 4K3DL 2C3XA 5DEGA 5ACMA 4ZTPL 4XNYL 1U8KA 2YD8A 1QKZL 2XA3A 1N0LA 2B5IB 4N0UB 1OTUC 4H1LB 1F2QA 3EYOA 1CICB 5JW4R 1U8JB 1S7QB 3RI5K 5DK0A 2GT9B 1Y6MR 1NJ9A 1W0YT 2COQA 3QYCA 2R1WA 3MRJA 3K8LA 4HKXA 1AIFA 1I7ZB 4PS4H 4FXLA 4TRPL 5HGAB 3F6IA 2HLAB 4X98A 1B0WA 1S3KH 2YS4A 4P23C 2RCSL 4MLSA 3OGCB 4LPYA 3FONA 3L3IB 2UZIL 3LV3A 4JZNA 1HYSD 3CLEH 1KCVH 5HHOB 1NCCH 3GNMH 2D0HA 3IF1B 2B0SH 3QHFL 4QRUB 1HIMH 5DJAB 3W9DA 1T4KB 3IDNB 5CKGA 5GS2D 4G6JL 5ADOH 4EI5B 3P4NB 3L6FA 4MZ3A 3U79A 1I1AC 1F4WL 1C1EL 2DYPD 4G8GB 1IGYA 3ECBB 1IC7H 1CDGA 3NIDE 1ZHBB 2VXQL 5J56B 1IQDB 1SM3H 1NCUA 1MFCH 4ERSL 1FIGL 1NBQA 4JFFE 2EYRA 3ARDC 4PLKC 4OZGA 5IW1A 4H88H 4M7KH 3G5YB 5DEFB 2CJUL 1QQDA 2N7AA 5FKPB 5HGBB 3A6OA 3QIWD 3MRQB 2H45A 1BZ9B 4RA3A 3S4SB 2A38A 5DUPL 4OCLC 4WU5B 4P2QA 5I71B 1E4WH 4BJLA 1MUJA 2OI9B 2H2SD 2OSLA 4PJ5D 3WD5L 1RV6X 3RZWA 1LDPL 2R9HD 5J1TC 4P2OA 4KKAD 3BH9A 4PJ7E 3WE6A 1UADC 3VGDA 2MPAH 3QRFM 2HKFL 3LN5B 5GSRA 1P4BL 5EO1B 4L4TA 5T1KA 4PGBA 4Y8AA 3UJTL 4AEIL 4HQQL 2DQJL 1UM5H 1LK3H 4MWFA 4MA3A 3OXRB 3H9HB 4H1LG 3L7FA 4JVWA 4NSKA 5KSBF 4PRHD 3MV01 1UWXK 1YYML 3P0GB 1PG7H 5FYKL 3IDGB 2ARJQ 1JK8A 5IBLD 4PLNC 4KU1A 3M8OL 5DR5H 3UTTD 2XICA 1MREH 2KBGA 2OR9H 3LB6C 3WFHA 2IBZX 5KAQG 4PRNB 3JWOH 4AENA 4EOWL 4MQXC 4P4RB 4GUPA 3I6LD 1C08B 2KQMA 1NBVH 3MV7D 3DX9B 4M6OL 1MVUA 3VFUA 4P99A 2OZ4L 5ID0B 5EUKB 4DQOL 1RZGB 4MJ5B 1D9KA 1ZHNB 2BZDA 4HK3N 1SYSA 2SEBB 2GIYA 2OTUA 4G7YH 5CEZH 1BGXH 4UILL 2BHUA 1TQCB 1J0HA 4HXBL 3B2UD 1CWVA 5KVFL 3O3EA 1UWEH 1A6AA 4G8FB 3O8XB 4OIBA 3ME0A 5H94A 4KQ4H 1KJ2L 3X11B 2AK4B 4Z7UF 1XGYH 2PYFB 3V2AR 2YPKA 4PJCF 4LDLB 1CQYA 4XI5D 5SWSE 5FM5O 1EFXB 4N5ED 3S4SG 4CU7A 1T20B 3QO1A 5HHPB 5DEGB 2EH7H 4EQ2A 1ZV5A 1U8KB 4U6VL 3MJGX 2HRPH 2VL4A 5EOCL 4ZSOE 4S2SA 3WBDA 2FB4H 2JJTA 5DD1H 5C09E 3SDCC 4AG4H 2EXYC 3EYOB 2APXA 5E9DE 3P11L 3QWRA 3D3VA 1BQSA 4BQ8A 4OI9A 4FTVA 4LOUC 5DK0B 4FQPA 4KROC 2ZUWA 4YDVA 1NJ9B 1I85C 2ZKHH 3MLZL 1JI1A 2R1WB 2A1WH 4NM4H 3MRJB 4HKXB 1AIFB 1GOHA 1B88A 3K4ZA 1WAAA 4TUKL 4XNZB 2AJUH 4X98B 5C07E 5TDNA 3RBGA 1VA9A 3VFPA 3FONB 25C8L 3LV3B 4K7PY 4JZNB 3VDAA 1TVDA 2ICWJ 3QIBC 3GHEH 4M93B 2HLFC 1FGVH 2AEPL 1BFSA 1NEUA 3CU1A 2NY1C 4MVBC 3W9DB 2W9DH 1WWBX 2OXGA 3R1GH 5C9JA 2C1OA 3S88L 1WBZA 3L6FB 3HI1A 3MV9A 2BY3A 3QXDA 4NQCD 3U46A 5KS9E 4HUUA 3T77A 4GBXA 1QRNE 2GAZA 2BNQE 1X5XA 5ETUB 5IFJA 5CKAA 1IGYB 4JRYE 5E8NA 3V6BR 4F15C 1B4JL 1U58A 1H9VA 3GEWB 4F37F 4KFZC 3NZHH 2IAMC 2A9MH 2EYRB 4OZGB 5IW1B 2K7PA 2AGJH 1T7VA 1QQDB 3KPOA 1AI1H 2XQYG 4P2QB 1ZAGA 1MUJB 2OSLB 4HWBL 1MI5E 3DXAD 1E6JH 4ZOEA 4P2OB 1TZHA 2DD8H 2PF6A 3BH9B 3WE6B 5HD8D 4H0HB 4NKDA 2IH3A 3EZ8A 2ADJA 4H0IA 4NZUH 3HS0A 4TSCL 5GSRB 2DL9A 1A64A 5J11B 4OF8A 2P8PA 2VLLB 4L4TB 2F8VA 4P4KA 2HTKC 4RAUA 3IETA 5D7IA 5T1KB 3A6CL 2J4WH 2YD2A 4PGBB 4XX1G 3WFEH 4MWFB 1LMKA 4MA3B 4KRPB 4GQ9L 5KJRL 3VXSD 3L7FB 4NSKB 2C5DC 2DDQL 5IMLA 5JR1L 2R8SL 4L4VE 5JDJA 1KEGH 3ARTA 2X89A 5EU5A 1EJ6A 3T0VA 1JK8B 4WI8A 5HHVH 3QDHA 4S1RH 3SQOH 1V3KA 4MXVE 5DURD 2APVA 3WFHB 3V79C 2HT2C 2ERJB 4MZ2A 1EPFA 1IGIL 4HWEL 2B2XH 4AENB 4PG2A 2PXYC 2EDYA 4RAVB 2E6JA 4GUPB 4RGMB 4HS8H 3INUL 1QLEL 1MVUB 3BQUD 2UY7A 4PP1D 3VFUB 3RKPA 3HE6C 2DQIL 1WUNT 3KXFD 1UACL 1D9KB 3GRWA 2I9LA 3QWOA 1FRGL 1SYSB 4TPRH 5EU4A 2OTUB 4J4PA 4WI2A 2WQRA 5C08D 4P5TA 1CGSL 4W4OC 2R56L 2CLVA 4GXUM 3O3EB 2FJGA 1A6AB 3HMXH 3ZYZA 4YQXL 2XTJE 3AM8A 1P5VA 5H94B 4OB5H 4YEEA 1D5ZA 2YPKB 1L0QA 4PJ9C 4MQ7A 4K23L 1GC1L 4OSUH 4RCAA 4FQLL 2CO7B 2C1PA 2HKHH 3QO1B 1MSPA 4OM0L 4MA8H 4OT1H 4P2RD 3QZWG 4NCC1 4XNUH 2E7BA 2FBOJ 3IS1X 5LXGH 4S2SB 4PJXF 5FYLH 1IAIL 5BVPL 3OGOE 5K9KA 5D96C 3D3VB 3T65A 4KHXH 4FTVB 2W60A 4YNYA 2ZJSL 5GS0D 1IGMH 3MRGA 4YDVB 1ES0A 3VXRA 4R90H 1EZVY 4NQSA 4JQVC 3VG9B 5TDNB 4FA8A 2R1XA 3VFPB 2YPVL 4KMTL 2VZ3A 3TBWA 2EYTA 3W11C 4NP4H 3O4LA 1R3KA 1U3HC 3QJFA 3ULUE 3VD7A 3O6FD 1QBMH 4ZOCA 4U6HA 5C9JB 2YN5A 2MNUA 3BD3A 3I6GA 1WBZB 2PO6D 3MV9B 3HI1B 3QXDB 1U8MA 3U46B 4HUUB 3T77B 1UXSA 4GBXB 2GSIA 4KQ3L 2GAZB 5IFJB 3TO4C 5E8NB 3OV6A 3G9AB 2EE6A 5JIKA 2VDRL 3CLEL 1U58B 5I66A 3HNSL 3GO1L 1EO8L 1M7XA 3NN8A 1RZJH 4HLJA 5JUEH 4PJFF 4G6FD 1HIML 4OGAD 3RTQC 3K4DA 4IS6A 3S3PA 1HQRA 5JW4M 4ZO6A 3KPOB 2V5RA 2DQEH 2ADIA 1KCUH 3RWDA 4X5LA 3C6LC 2YA0A 5L88L 1YZZA 4XBEH 1GXEA 1TZHB 2MCPH 5DHYA 2IF7A 1ORSA 4NKDB 3MCKA 2IH3B 4XAKE 5EUOF 1FAKT 2ADJB 3HS0B 4R3SA 2X4PA 4EIZC 2P8PB 4XP9L 1TIUA 4M7KL 4P4KB 4RAUB 3IETB 2JE8A 4JDZA 5D7IB 1A7PH 1CD0A 2YD9A 2KKQA 1QBLL 2VUYA 3KPSE 1BVZA 3BKML 5J12B 2W91A 1E4WL 5IMLB 4LKCA 4JHZA 1DBAH 3JWNC 3TV3H 5EU5B 4GLRH 3PGCA 2QQKL 4PJHF 2MPAL 4LLMA 4A6YA 4X6CF 2BXZA 4N1CA 3EGSA 2M1KA 1WZMA 1TITA 4HMEA 3VA2C 4TSAL 1A8JH 1UM5L 1LK3L 1A7OH 2UZYB 2BERA 5F7NC 2LQRA 1CDHA 1XH3A 3ZE2F 1BMGA 1PG7L 1INEH 2XZCH 5I19H 3QUXB 2I9LB 3QWOB 3UYRL 5EU4B 1MREL 3ZT6A 5GGRY 4P5TB 5ALCH 2FX9H 3RP1A 5HI5C 5IFAH 1EXUA 3IKCA 3D69A 2CLVB 1FGNH 4O9HH 4Z6AT 2FJGB 5SWZA 1NBVL 3N1GC 4OLWH 1LDSA 4WWKC 1YEKL 5E94A 4HCRH 1NANH 4MQ7B 1GGBH 2J6EA 2I9TA 2NY0D 1IC4L 4FQ2H 2C1PB 5CEZL 1QFHA 1BGXL 1OTSC 3Q6FA 4JE4B 2CK0H 1UWEL 4ZPVA 3C60A 4X9FA 4QHNA 1JHTA 1MWAH 1KIRA 5K9KB 4P0DA 3QCTL 1WLHA 2W60B 4YNYB 1XGYL 2J8UE 3BIAX 4PP2A 5FYJU 3G6JA 4MLIA 3MRGB 1ZA3A 2RBLA 1ES0B 3VXRB 2R2HA 4QRTA 2F9BT 3BGFB 4NQSB 2OJZL 3NOIA 3IXAA 2R1XB 3WFCL 2EH7L 3TBWB 2NMSA 2EYTB 2HRPL 3O4LB 4PD4K 1R3KB 1JZ3A 1WWWX 5F71A 2FB4L 3QJFB 4HJJH 3R06A 4AG4L 4P3DA 3VWJD 3IDIA 4I3SH 5MEOA 1YPZE 2WBJD 2A6DB 5HVWA 5KAQF 4U6HB 4YFLI 5D93B 1A1NA 3IDMA 2R4SL 5SX4H 3I6GB 2A1WL 4NM4L 5DMYA 3EO9L 2QSTA 1K3ZA 1MFAL 1RIVH 1U8MB 2EZ0D 3LZFH 3WHE1 1UXSB 4YHLH 2CPCA 2GSIB 1CLYL 2UUDK 3IGAA 1NGPH 5L0QB 5IROA 4BM7A 1HXMB 1NAML 2XNAA 5CSZA 2EH8L 4UQ3A 3ZE0F 5I66B 1SJHA 3GHEL 3NN8B 1PKQE 3NFSH 5CUSH 1W8OA 4OLZH 4U1KA 5C2BH 1RQ5A 4NZRH 3V6OC 3QDGB 4IS6B 4JFFD 1HQRB 5TE7L 3R1GL 3Q5OA 5ISZA 2VLRE 1KIPA 4YK4B 2ADIB 2YD1A 4XP1L 3RWDB 1IBGH 1I9IH 3NIGE 4GAFB 4LEXH 3TA3D 5DS8A 1NUNB 2GFBA 4HH8A 1A0QH 1OGTA 4JY5L 1CFTA 1NBZA 1NCDH 4Q97A 2H2PD 3WDJA 2QKIA 4MSWA 2AXGA 5DHYB 1H3PH 1JNJA 3LHPH 1ORSB 3MCKB 3KLHD 3NZHL 5J4MA 4XVUD 2A9ML 1QSFE 2YK1H 5ENWA 4LHUD 4R3SB 2IJ0C 5I1JH 3KPLA 3HAEH 4JDZB 4OCSH 5J6GA 1XF5A 1YY8A 1EBPA 3KJ6H 1YNKL 4BZ1L 4BA8A 1RURL 4LLVA 4JRWA 4LKCB 4YHYC 3FZUC 1E6JL 3PGCB 3LPFA 1CK0H 2DD8L 2X1QA 5JZ7C 1XR8A 2IWGA 4LSQH 4A6YB 1NFDA 4LSPH 4XCNA 1QYGL 5TPWH 2OS7A 1Y0LA 1YQVH 3EGSB 5DUBA 2NY4D 2BY0A 2NY3B 5IVZA 2J4WL 3VD9A 3QUZA 2V9TA 3WFEL 4EN3D 3T4AA 2V2TA 1VERA 2ILLA 3I9GH 3OKNA 1T0PB 5FKAA 5GRUH 1KEGL 1XH3B 4S1SH 1MCPH 4TULH 4NKIH 5EPMA 4BSJA 5D7SH 3T2PA 3OG6B 4R2GB 5F88A 3FFDB 4WI6A 1EXUB 1BF2A 2YPLD 3IKCB 3D69B 5L8KB 2DIBA 2B2XL 3BDYL 5CEZE 3NPSB 1LO0L 1UB5A 1CDUA 5SWZB 3GSNL 3QCUH 1VFUA 4HS8L 5FUOL 1EBAA 5FM4A 1ONQA 3VFNA 5AZ2H 3VD3A 4QWWD 5E94B 1I4FA 1FSKC 2Z91A 1FAIL 4POZD 5GGRA 2WUCH 4TPRL 4Z78A 2I9TB 2OL3H 2XI9A 5DQDH 4NKQB 3Q6FB 1S7WA 3EDEA 1PX3A 5E8PA 3MLSH 4I48A 1R3IH 2AXFA 1MHCA 5D8JH 4ZPVB 5GS3A 4CBPA 3PGFL 3C60B 4QHNB 1JHTB 5EC1A 5C09D 3FOMA 1KIRB 3LS4H 4X80H 4OB5L 4PP2B 3G6JB 1ZA3B 2R2HB 1OP5K 4PBWD 4QRTB 2HKHL 4Y4KA 2Y6SD 5IB5A 3IXAB 1AXTL 1OSPH 2X09A 1DEDA 1REIA 5C07D 3EYVA 3GDBA 5FO9A 2VITA 4BELD 3R06B 2QJDA 4P3DB 1II4E 1HINH 1ZT1A 1WC7A 2I25N 3IDIB 5MEOB 3ZT7A 5J57B 4KHXL 1NGQL 1ZTXL 1IGML 1NSNH 1A1NB 2AJVH 3IDMB 1XGRA 3BN9D 5IB2A 5D9SA 4RDQG 1FH5H 1KTLA 2Z4QB 1DBBH 1TQBB 4N0RA 4WTXA 2Y4SA 1I3UA 2NY6D 4M5ZH 4HAFA 1QRND 3IGAB 3AXLA 2BNQD 5B22A 3UCRA 2XNAB 5CSZB 4F33A 4UQ3B 1FORL 4LCWA 1SJHB 2Q20A 4XXCA 4U1KB 1UVQA 4XPTH 3T3MF 2MJWA 3V4PH 5D1ZC 3L3HA 1QPXA 5ISZB 3T0EC 1KIPB 1MVFA 1EK3A 4RFNB 4RQQA 3NBNA 4X7TA 3ZYJA 5DS8B 2GFBB 2OQJA 3ZYOA 5CJQL 4GRMB 4YHKL 1CFTB 1NBZB 3D2UA 4G7VH 5EG6C 4E0RA 4LVOC 1MI5D 5BMFH 3V8CA 2QKIB 4MSWB 2AXGB 1KEMH 2V7NA 3ZDYE 1RUKL 5ENWB 4M1DH 5FA3A 1R5IA 5GZOC 3MRLA 4U1LA 1MCNA 3KPLB 4V1DE 4G5ZH 5J6GB 1KN4H 1XF5B 2DQEL 1YY8B 4IRJD 3D6GA 3OPZH 4N90E 1FNEA 4LLVB 2J88L 3QEQE 4PYGA 5IK3A 5E4EB 1I8LC 4XBEL 3RL1A 1TPXC 1NFKA 2HTLD 4H26A 3C5ZD 5HHXL 3TVMC 4HJGA 1XR8B 2FJHA 1NFDB 1UJ3A 4LAQH 4XCNB 4C56D 1T89A 2DJ4A 1Y0LB 3QO0A 3FFCD 4IRSA 4YZFE 5DUBB 4FMKA 4OZHE 5IVZB 1MCRA 2JCCE 3QUZB 3ARGC 5GGTA 2FEEI 3T4AB 2V2TB 5FKAB 2VWEE 1OARL 1DBAL 3U4BH 5EPMB 1F58H 3MOQA 4ODSL 4LVEA 2WSKA 5F88B 4I0KA 2UWEE 3TIDB 1MFDH 2B1AH 4KPHL 1OW0A 4KTEL 4OZIA 1X5JA 1U3YA 4G9FD 4QHKJ 2WBKA 1UB5B 4JRXA 5FGCB 1J1OH 4O5LH 3Q6GH 2APTA 3ULVF 1A21A 2XTJD 1SYVA 4JB9H 1PG7W 4OF3A 4XB8A 1ONQB 3VFNB 4M7ZB 4G43A 1I4FB 2XZCL 2Z91B 4KTDL 5GGRB 2FSEA 5DJZA 3QIUA 4TVPH 4Z78B 1XIWC 3FQXA 2IALA 3TBYA 2DI8A 1P84K 5ALCL 4HZAA 5IFAL 4PIRF 1S7WB 2VJXA 2GYSA 5E8PB 4I48B 1FGNL 1YY9C 2XA8H 2AXFB 3MUGA 5K9QG 1MHCB 5K9OA 2R2BA 3Q1SH 3KPRE 4CGTA 5ITFA 5EC1B 3TWCH 3ZDXE 4OLWL 3FOMB 1GGUA 2HFGL 3DGGA 5E2UH 3LDBB 5FYLE 4HCRL 3F7PC 3QNXA 5I18H 1V05A 4S1QH 2BVOA 1TNNA 5LQBH 4Y4KB 5IB5B 3GIVA 3EYVB 2PTTA 4UAOC 4LL9A 1K6QL 5IFHH 5FO9B 1RFDL 2VITB 3QI9C 2IANE 4HX1A 5D1XC 5EIVA 4LMQE 3ULUD 1ZT1B 1MWAL 1WC7B 3FB5A 1BX2A 3HN3A 4NJAL 3HHRB 5IB2B 2XRAL 5D9SB 5C0RH 4OF7A 3IFLH 1KTLB 1MPAH 4UNTA 1QVOA 3OZ9L 3QDJD 3AXLB 1XEDA 4KY1H 4F33B 4LCWB 3RAJH 2BVPA 4APQC 4HJJL 1I7UA 4LK4A 1UVQB 4I3SL 15C8L 2ZG1A 3L3HB 4U3HA 1ZLWK 3B4NA 5KVEL 4NO5A 4JG1H 3U2SA 2GKIA 5KVMC 4RQQB 3LZFL 3AS1A 1RIVL 4X7TB 3SOBH 4QRPE 4YHLL 2OQJB 1NGPL 2B4CC 3QNZA 2YRPA 3D2UB 4E0RB 4HFUL 2ESVB 5C2UB 5KW9H 3SBWC 2CQVA 4FABH 5CUSL 4OLZL 5C2BL 2V7NB 3MV8E 2N1KA 4X5WA 5FA3B 1R5IB 3MRLB 4U1LB 4F7TA 5HDBE 3WL9B 1U42A 3T8XA 1JZ4A 1KC5H 1I8MA 2X70A 3CFBA 3MACL 4IM8A 3VFTA 1IBGL 5BW7C 4YBLC 1I9IL 1FCCA 1FNEB 2DYPA 5IK3B 1FV1A 1MF2H 3RL1B 4POYA 4PJIA 4H26B 4HJGB 3Q2CA 3LHPL 2FJHB 4KDTA 1UJ3B 3FOLA 2YK1L 1NUGA 3JVGC 2Z93A 5I1JL 1B4RA 2FEDC 1KCSH 1RZKH 3QO0B 3SKUD 1EO7A 2GJ6D 4IRSB 5IMKA 1FFNA 1GAFH 3QIWA 1ACYH 1AHWC 3P4LA 3GMQA 2AJXH 1PSKH 4PJ5A 4M9PA 3HTLX 1AC6A 1NDMA 2ZCKH 4K8RD 1JHKH 4Q7DA 3MREA 2R0LH 2YUXA 5DHVA 3IAQA 3QXTA 5ICYA 3E6FA 1DANT 4ALAH 3OB0K 1J1PH 4W70A 1P9MA 4WFHE 5DZOA 4Y4HD 3MNWA 4JRXB 1QEWA 3WS3A 2A0LC 3DLQR 1D5BA 4QTIL 5GRUL 1SYVB 12E8H 4S1SL 4L3EA 1KFAL 4PGCA 2EXWC 2X2YA 4J8RA 5D7SL 5BRZE 2FSEB 5DJZB 3QIUB 5GPRA 2NX5D 4FQXC 1MCFA 3FQXB 5IF0A 2IALB 3NACH 4M3JA 3TBYB 3VFMA 2X4QA 1NC4A 2EDTA 1CXEA 3HE7D 3GKWH 2VO5A 4H5SA 3MUGB 2AJYH 5K9OB 2R2BB 1WSST 1PVHA 3QCUL 5ITFB 3MV7A 2B5IC 1QLFA 3IFNL 3DGGB 5ECJE 1BHGA 1CICC 5AZ2L 1DCLA 3QNXB 5DFWH 1U8OA 2DQGL 1LEIA 3FO2A 2BVOB 3L3OB 5DQDL 2CKBH 5IW3A 3RGHA 4BUGA 3LPWA 3K8KA 4LCCA 2PTTB 3MLSL 1R3IL 3MRIA 5L9DH 1P6AB 5D8JL 4IBLT 3GBLA 1A5FL 4OGYH 4HX1B 2NXYD 3UZEA 1MCCA 3A6BH 3LS4L 3FB5B 4C58B 1BX2B 3L5WA 1TNMA 1D7FA 1XT5A 4KK5D 1S5IH 3BWAA 4WJ5A 4R97B 5GS1A 1SJEA 4EI5C 3EJYC 3N06B 1QVOB 2FIRT 1H5BA 3QJHA 1VHPA 3QXUA 3BZFA 1OSPL 4JFQA 3VW3H 5IT2H 4Z7WA 2R2EA 4N0UE 2BVPB 1A6UL 1F4HA 4E42A 5DYOA 3VD4A 4ELMF 3RGVA 2WINA 3E6HA 1AQDA 1T7ZA 4PLJC 4WGWB 1CGXA 5C0ND 2AJVL 4NO5B 2CXGA 3I3DA 2VKXA 2GK2A 5AUMA 5HPMA 3U2SB 1FH5L 3QRGH 3IYLW 1DBBL 1IAII 4OJFH 4Y19E 5C0CB 1MQKL 4LLQA 4M5ZL 1JGDA 4XC3L 5CP3H 5I71C 3QNZB 2QHRH 2OI9C 4KXZH 1JF5A 4F8TA 5DMGC 1X5HA 5E1HB 4X9HA 3IB4A 5FM5M 3RY6C 4GO6B 4KKBD 4PFEA 4X5WB 4XPTL 4F7TB 1QSFD 4JHAL 4MAYD 5KANI 1HH9A 3MA9L 2I07A 4JFDD 3T8XB 1KIUA 2GY7B 1I8MB 1RUPH 2X70B 3CFBB 4NQCA 5EWIL 5FV1L 3VFTB 4GAJL 2DYPB 3PP4H 4JPWL 2YR3A 4KI5D 1IAKA 1FV1B 3GK8H 4PJIB 4D0CA 4QKXB 5BMFL 2EDFA 1AGEA 1JUFA 3VJ6A 3GBNL 5DMIH 1KEML 3FOLB 1MIML 2Z93B 5CZXD 5C0DA 5IMKB 5CGYD 4G5ZL 1FFNB 2VDPL 3QIWB 1KN4L 4Z9KB 3M07A 4L8SA 1S5HA 3OPZL 1VSCA 3GMQB 1I9RH 1MCKA 1CZ8H 4AH2A 1BM3L 1G7JA 3WFZA 4PJ5B 1JP5A 1E0OB 1NDMB 3CVHA 3DXAA 3MREB 4RDQF 2DLGA 5DHVB 4MS8D 1ROWA 5ICYB 3E6FB 4KDVA 4LAQL 2ZPKH 3R0MA 4JGUA 1TETH 2DQUH 1S8DA 3KPNB 3WYRA 3GSVA 4AYFA 1E4JA 3L3KA 4F7PA 1TQCC 3MNWB 4KKLD 3EOAA 1QEWB 2MSPA 3WS3B 3VXSA 5L2JB 1D5BB 4XP6L 3O8XC 3MRNA 4A6YH 4NZDA 4P5KA 4L3EB 1YN6A 4PGCB 3RDTD 5EA0H 4J8RB 2IFFH 3G08A 2GCYA 3W39A 3V4UH 1GGCH 1V5JA 5J3HD 1N59A 3V7AG 5IF0B 3VFMB 4CVXA 3RNKA 2X4QB 1GPOL 1MFDL 1NC4B 2N4IA 3K2MC 3S36X 2X4UA 1CD8A 4EZMA 4H5SB 4GMTL 4X99A 4OBRA 3X3GH 1J1OL 5EIQA 5TJWK 3MV7B 3BQUA 1QLFB 4JB9L 3IVKA 5GGVY 1U8OB 3TEUA 1X9QA 3BIBX 4EUPH 1LEIB 1FE8H 3FO2B 2R0WH 5C08A 1JGEA 4XNZC 4ETYA 4WNQA 1LEGA 1OAXL 4LCCB 5F7YC 1RJCA 2XA8L 2QQNH 3MRIB 3TYGH 3DYPA 2VXTH 3Q1SL 5CBEA 2KUTA 1OGAA 2DM4A 4M93C 5HI4C 1Q9OA 3TWCL 3MGOA 5E2UL 3LN9A 3L5WB 5IQ7L 4WW2F 3HZMA 1W2KT 1ZSDA 3BWAB 4WJ5B 4YC2B 5GS1B 1SJEB 1DN0A 4S1QL 4K7PX 3UROR 2G2RB 1H5BB 4ENEC 2QBWA 3BZFB 4XX1E 5E8EA 4JFQB 4C4KT 4TOYH 4Z7WB 2R2EB 5IFHL 2EDDA 1CBVH 3VXMD 4P3CH 5DJYA 3PV7A 2D9CA 4HJ0C 4E42B 5DYOB 3V9FA 1FDLH 4I9WE 3RGVB 2WINB 3E6HB 4HKJA 1AQDB 3ZKNC 2H26A 1CTOA 4LSVH 5F9OH 5C0RL 5AUMB 5ADPL 5HPMB 1MPAL 4R26L 1G0YR 2EDEA 3IDUA 4LLQB 4O58H 1JWUA 1JGDB 4DFHA 1KN2L 4KHTH 3I50H 3TCLA 1E6OH 4P2OC 4Z7QF 3QR2A 5EZIH 3Q3GA 2BVEA 3O6FA 4W6WB 3RWEA 3DRTA 4G80A 4I2XE 1HH9B 4KZEL 5J11C 2I07B 5DJ0A 4X9BA 4NC2B 4YJZL 2D0FA 2PO6A 4NNPL 2AV1A 4NQCB 3SOBL 3K80A 1CU4L 4KRPC 1AR2A 1IAKB 4ZUUB 4KKCD 4D0CB 4JM4H 3UYOD 2YWYA 4FFYH 1JUFB 4M7LT 3T1FA 3VJ6B 4FABL 4WY7L 4HG4K 3MRMA 3NCEB 3VRJA 2BXYA 3L1OH 5C0DB 1T03H 1HHJA 2ERJC 4L8SB 1S5HB 4P2QE 4JM2F 2QR0A 2NY5H 5AWNH 1AFVH 4QTHA 5MHSE 3FO9A 4AH2B 4RGMC 1G7JB 4UBDC 1MF2L 2VXVH 5C0EA 3CVHB 3DXAB 1F11A 3VXUE 4D3CH 3OR6A 1D9KC 4DCQA 1PEWA 5TQ2H 1KCSL 5C0JA 1S8DB 3GSVB 3L3KB 4F7PB 1OB1A 2AJXL 1ZA6A 1MHHA 4YXLH 3EOAB 4HLZG 4JGJA 3VXSB 1JTOA 3MRNB 3ET9F 4P5KB 3RZCD 2ZCKL 1YN6B 5B3JF 4Y89A 1U93A 4WRLA 1JHKL 5GIRA 3G08B 2GCYB 3W39B 1T1XA 4WVRA 3FHQA 5L7XH 1N59B 5H2BB 1A7BA 3RNKB 1QFWH 4ALAL 4CVXB 3OKLA 4OFIA 4TVPE 3L5JA 1KB9J 1Q0YH 4YGAB 2X4UB 1MAJA 3VGBA 1T0NA 4MA7H 4X99B 3TH2T 2R29H 5D7JD 1C5BL 4PJBF 2ICWI 4RMVA 5DRNA 2JJTC 2GEEA 3BQUB 3RPKA 4HBCH 4RMTA 12E8L 3IVKB 5E8DH 5FYLD 1KELL 3RJDA 2NY7H 4LHQB 4LLWA 3NACL 4PB0L 1T1WA 5C08B 3VG9C 3E1F1 1Z9SA 4WNQB 1LEGB 4IRZH 3GKWL 4ZODA 5I30L 1YC8A 3H3PH 5CBEB 4YPJA 1P53A 1OGAB 3EJZC 3FO0H 3GRWL 2IAND 3MODH 2MQCA 3MGOB 4FQJH 4HUKB 4AIOA 4GXVH 5K9JH 5JOEA 3HZMB 3HKFA 4KI1A 1OAUH 1ZSDB 1DN0B 2VSDA 2IGFH 3O0RH 3MUJA 4GBXC 4NN7B 5E8EB 1J1XL 2CIIA 2BY1A 3QG6A 3S5LG 4OGYL 5DJYB 1DQJA 1JWMA 4JZOA 5FOJA 2EDXA 4KK8C 3A6BL 4UIMA 1Q72H 2DWEA 5CFHA 2H26B 4KJPC 4CU6A 4WFEE 4N8VG 1S5IL 1NBYA 2VZSA 2VZVA 3O41A 5JOPE 1ZOXA 1DQTA 1NDGA 4AEHH 1JWUB 4OLUH 5FYKU 1YMMB 1RJYA 1WFTA 5EO9A 2MFNA 3TCLB 5DK3A 3WFBL 5FUCE 4O4YL 3Q3GB 3O6FB 1TENA 3VWJA 3DARA 3RWEB 2AW2A 2CRIA 1OAZH 3DRTB 4G80B 4L1DA 2WBJA 3FRPA 4OFPA 4P4KC 5DJ0B 5IJVA 2HJFA 3ARBD 3B9KD 2PO6B 2AV1B 2HG5A 2MKLC 1F2XK 3AS3A 3I2CH 4OJFL 1AJ7H 3S34L 1Q8MA 5J12C 3WS6A 2X9YA 3VU2A 5B38A 5IP4A 3W2DH 1I9EA 5DA4A 5IHUH 5HDLA 5D5ME 3T1FB 2IBBA 1KG0A 4G6FB 3T3PE 4BSWA 4X9GA 1MAKA 4NC0B 4JFFA 3MRMB 4DAGL 3VRJB 4Y8DC 4JHBA 4K9EH 4D9QD 1HHJB 4LMQI 3QUKA 5DO2C 1IARB 3K81A 1RUPL 4YE4H 2QR0B 4PG2C 2JIXD 3TA3A 3PP4L 4QTHB 5DVOA 3FO9B 4OKVA 5C0EB 1RJZA 4D9LH 5E5UB 2DN7A 1F11B 4NT6A 4MJIE 5MP6L 3OR6B 4PJ7A 3QUXC 5TQ0H 1T1YA 1CFVH 4DCQB 2VZUA 4LHUA 5D7IE 4I1NB 3GSOA 5C0JB 4J4PC 2D4FA 4HSQA 2O5ZL 2DI7A 4P5TC 1U8PA 4WFHD 1DSFH 3CCHA 4O51A 1MRCH 1OB1B 1FLTX 3ARZA 1I9RL 1MHHB 1ZA6B 1CZ8L 5IKCA 3AM8C 3DMMA 3LKRA 1U93B 5GIRB 1T1XB 2GJZA 4CDHA 3U0WH 1E4KA 2F53D 1H8NA 3OKLB 5KOVC 1TETL 2DQUL 3PIQA 4EN3A 1T0NB 1YEHH 1ZLSH 1AGCA 2DICA 4XPBH 3UPRA 2N7BA 2VABA 5DRNB 5F1NA 1ORQA 4A6YL 2XYCA 2AEIT 2XG5A 1T6WA 4RGNE 1BBDH 2IFFL 4LLWB 4LU5H 1WFOA 4PGZA 3BGFC 1JF1A 1T1WB 5BS0D 3FN0H 3IJHA 4PY7A 4GLRI 1MLBA 3CMOL 3QAZB 1MCWM 1Z5LA 1W72H 3X3GL 1U2HA 4QRSA 3BH8A 3D85D 3AY4A 4JCLA 1T66D 2AJZA 5D93C 4XCCH 2NY0B 1FE8L 4JO3H 4MXQD 4WEBH 1UQSA 1ZGLP 2EC9U 1RULH 5L0QC 2CIIB 3I75A 2V9QA 4Z8FH 2QQNL 5I16A 2XT1B 3QG6B 1U0QA 2VXTL 1DQJB 4JZOB 4ZSOA 2OMNA 1VEOA 5C09A 4KZDH 4LKXA 2VDOH 3I02A 5A3ID 4UIMB 1H3WM 5E9DA 2DWEB 4WFFE 5DFVC 2WM0A 4QHMA 5F89A 1HXYA 4X4XA 4M6NL 1QACA 1NBYB 3ARUA 2RJMA 3ZTNL 4YK4C 3O41B 1MFBH 4L8DA 4OCWH 3LMJH 3S37H 1JPFA 1NDGB 4Y19D 2ITCA 1S7RA 5C07A 3O4LE 5T1MA 1RJYB 5EO9B 1NANI 3QP3A 1OTUD 4TOYL 5KVDH 1C5CH 5H8DA 4M9OA 3PXHA 2Y5EA 1CVSC 1QFUH 1KCRH 4PG9A 3VWJB 1I75A 4F9PA 2WBJB 1RZ8A 5IJVB 1IL1A 2HJFB 2Z8WC 4RX4D 4PRAA 2HG5B 1S9YA 3V0AC 3CX5K 5KS9A 4PRID 1QRNA 3T0WA 2BNQA 2VR9A 3WUZA 5B38B 3S35X 4KHTL 3L95A 4UIKH 1E6OL 1KG0B 5HYQA 3DECA 1WWAX 4BSWB 4JFFB 2DKSA 2R2CA 2ZUVA 5B4MC 3X17A 2NY3C 3U6RA 3QUKB 3PP3K 3TJEH 3TA3B 4EBQH 4PV9A 3GUTA 3RKDC 3CFIC 4OKVB 1RJZB 4JM4L 2VAAA 1MI5A 5SX4I 4NT6B 3Q0HA 4FFYL 3DJ9A 1VFMA 4PJ7B 5IBTH 1FFPA 1T1YB 3CFEA 4LHUB 4R2GC 4IOIA 3GSOB 3L1OL 4DVBA 4XPFH 1T03L 1R5VA 1U8PB 1L0XA 4IRJA 1LQSR 3CCHB 4HC1A 4O51B 1NQBA 1RUQH 1AXSA 2KDGA 3NPSC 4WI4A 2NY5L 5IKCB 5CJ5A 1UH3A 4J3OC 3U9PL 1UM4H 5J1SC 1EAPA 3WSQH 3DMMB 2BHYA 3LKRB 5F6HJ 3C5ZA 4LP4A 2ED8A 4D3CL 2GJZB 1X5ZA 4PB9H 5DZLA 1ZVHA 2VC2H 4X6DE 4C56A 1GIGH 5CCKH 2VXSL 2NCMA 5TQ2L 5AAWA 3SDYH 2NY4B 2DMCA 4JKWA 3PIQB 4NQVA 4EN3B 1TDQA 1DQMH 3GMNA 1AGCB 3BP5A 3UPRB 2VABB 5CILH 5F1NB 1ORQB 4UU9A 2H9GA 3C60C 4B50A 4KRNA 2V5MA 1EHXA 3FRPG 1I1YA 3WHE0 5KSAD 1CL7L 5L7XL 2BSSA 4OFVA 3LB6D 3T2NH 4HUXB 2Q8AH 1QFWL 1A02N 3RU8H 1TTUA 1JF1B 4KV5F 1Q0YL 3IJHB 4PY7B 5B38G 4WW1A 2JJUA 1MLBB 4MQXD 4MA7L 5BV7B 4G9FA 5SWZE 1Z5LB 4XNXH 2LVEA 2OMBA 3QWQB 2HJLB 1EVTC 1PY9A 3EOYG 4QRSB 2X4RA 3BH8B 4HBCL 5E8DL 2AJZB 4NYLA 1IT9L 1IKFH 1CGYA 1S9WA 2AABH 1GOGA 4Z7UE 1TVHA 3REWA 1TQBC 2WZPD 1UQSB 5GRXG 1DP0A 4OCNC 5HYFA 3BHBA