1RZ8B

Crystal structure of human anti-hiv-1 gp120-reactive antibody 17b
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
228
structure length
228
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 17b light chain
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rz8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rz8B01
1KPRB 3CUPB 1RUKL 4WHTA 3CXDH 4FABH 4H0HB 3LQMA 3QYCA 3S3PA 3KS0H 3DVIA 5IJVB 3SDCD 4RA3A 3RVUD 4A2LA 1Z0NA 3C6LC 4OZGE 4WW2A 3ZE1E 3D18A 5E1AA 5E2WL 3VGEA 5IIEB 4IRJC 5DMIH 1K5NA 3WFZA 1IGML 4M1DL 3BEVA 4X6CF 3NN8A 3NAAH 2GK2A 4PJ9D 2VLJA 3WCYA 3UTPE 3WFHB 1RY7B 1DR9A 2CK0L 4I8DA 5C9JB 5DSCB 1F3JB 3JWOC 1C1EH 4GKNB 3GKZA 1YMHB 4KY1H 1CDBA 3SDDA 4NP4H 5GPRA 5E5UB 3SDCB 3F8UB 3QUMH 4JG0L 3RJQB 3MROA 1IM3A 5DJYB 1FLRH 3BZFA 2R1YA 3ZDXE 2ZJSL 4G6FD 5EUOA 5BO1L 1OGAD 3EGSA 4XVUC 4YIQA 2EH7H 1FNLA 3G08B 4Q97A 2RQ8A 1LILA 3VFPB 4FQXC 4HKBA 3MRMB 4P4KD 3THML 1IEBB 1E28B 3JVGA 1UA6L 1NUGA 3MUGA 4G6FB 1A6WL 4FP8L 5DO2C 4MNQA 2FZ3B 1OGAB 1JGLL 5C0CD 1N64H 5HDOA 5E6IA 1BFVL 4EDXA 4OF7A 3JWDH 3IVKB 3TO2A 1EHXA 3GSNL 3PABA 1JVKA 2JB5L 2FWOB 1N3NA 1G7JA 3VRLF 2RCSH 4JZNB 3CXHJ 3QI9D 3MSPA 5IM7B 1TVHB 2HVKB 5F9OH 3VFTA 3SDXB 3H2WA 3HZKA 2EXYD 2X70B 4HX1B 1J1OL 3IAQA 2EDXA 1GAFH 2IPUG 4S1DD 4NRYB 5AYUH 1A7RL 1X4ZA 2W9EL 4YC2B 3T3ME 5SWQB 4MA7L 2R0KH 3D6GA 1JYNA 4EOWH 1EHLH 3G6DH 4TTGA 3RRQA 5E8OA 2WIIB 1BQHB 3TN0D 4P3DB 1OB1A 3QI9B 2FECI 4PP1D 2PXYB 2YEZB 4OCMC 4ZUUB 5KW9H 3E6FB 5KBNC 5SWSD 4M7KL 2IBBA 1P7QA 2NW3B 3UPCA 3LIZL 3MFGB 4C56D 1L9NA 2DKMA 1B0RA 4PJAB 1INDH 1BJ8A 1JNNH 2W60B 1WFNA 4FXKB 3DROB 5I75B 2HT3C 4WFEE 3TN0B 5FM5O 5EUKA 3VRJA 1CD0A 1Q9LA 3GJFK 1A6VL 1NH6A 1XAUA 3CFEB 2H32H 3IU3A 5TE7L 1YEFL 4GT7A 1E0OB 1JHTB 3C87A 3DSNA 3BGMB 1MPAH 1U8IB 2UV3A 4Z9KB 1HINH 2BP3A 4WI4A 4QRRD 3VGAB 4YHIB 1N59A 1BPVA 3WUWA 1NCBL 1VGKB 4F9LC 3GSNB 2J8OA 2FEDD 3GIVB 1UWGL 3KLHC 2ZCKL 2ZG3A 1VKXA 2IALB 3DV4B 4G80B 3GO1L 1IEHA 2QSCH 5B4MC 1XR9A 4OLWL 1IGFL 4R4BA 3KPMB 5FYJH 2DM3A 4LCIH 4AH2B 4QRRB 4NN6C 2VISA 4UINH 4PRNA 1HYRC 1FG2B 3ZE0F 1CDUA 3T0DA 1N5AA 1S5HB 5F7WC 3AB0C 1I7UA 3VXRA 4HF5H 1KJ2B 3H3PL 5BS0A 5I2IA 3WV0A 4YJZL 2F8XC 1L4IA 3EYUL 3B6SB 3MRCB 1H8SA 3DVGA 1OAYL 4P2OA 1YNTB 3MLWH 1B4RA 1AO7A 4P23B 3DUUB 2VLRD 3IXAA 3KPSA 3OJVC 4PY8J 4KUZL 3QDJA 4Y19A 3RGVC 4XP5H 3ZHLA 2M8XA 4NT6A 4F7TB 4I18B 4KJYB 4NO3B 3QUZA 1OAXH 3RX7A 3Q5OA 2D9CA 3CLFH 5D96C 1CS6A 5C0BB 1EO5A 2VAAA 4NC1E 2C1OA 1OAZH 4MAYB 1ZWIB 1QSEB 5K9OB 4F57L 4WHTB 2VLJD 2GUOA 1CF8L 1MIML 3LS4L 3TWCH 3UO1H 4MYWB 1T2QL 4D9LL 4JAMA 4J1UA 3STBA 5GGVH 1LK3H 4WW2B 3D18B 1RUAH 5E1AB 5CD3A 1K5NB 1FNEA 3BEVB 3NN8B 2R2EA 4IDJH 5AZ2L 2VLJB 3QUKA 4YQXH 1HI6A 1EO7A 1TQCC 1MCOH 1W0VA 1XF4A 4JZJA 1AC6A 4WFHE 4RAHA 1WFUA 3SDDB 1EPFA 4BQCA 4LDEB 1VSCA 2NY6D 3MROB 1IM3B 1I3RA 3BZFB 4M93C 3ZO0A 4NN5B 2VDOH 2R1YB 1A4KA 3HMXH 4DZBA 1RPQA 1F11A 1RJZA 3R8QA 5EUOB 5CIPA 4MNQD 1CFTB 4KZEH 3EGSB 4YIQB 4D9RE 5E6ID 4LSTH 3V6ZA 1QLEH 1F58H 1KENH 2CR3A 3D3VA 3QO0A 4HKBB 2NY6B 2Y06H 1NGYA 3CK0H 4DUXA 3MUGB 3HKFA 4WU7A 1CU4H 2X9XA 5E6IB 4EDXB 5F93C 4WVRA 4PTTA 1SBBA 1Q0YH 2HRLA 3TO2B 4HC1H 2XICA 4XI5D 2A74A 3PABB 5I1EH 1N3NB 4K7PX 1G7JB 2C9AA 4RRPG 3W11C 3L3KA 4NDMB 5C2BL 5F1KC 3MV8A 3LN5A 4UQ2A 3NACL 3VFTB 5DMGD 1HN1A 2K7QA 3HZKB 2AXFA 4XAWH 3WSQH 1J05A 1F90H 2EIEA 3QEQA 5J11B 5HYSG 3QO1A 4OT1L 3K0WA 4YHMH 4DAGH 1FGVH 5ALBH 5MI0B 5E8OB 2GJJA 2HWZH 5KJRH 1OB1B 4P57A 2W9LA 1R24B 5CJBA 1A3RH 4XPFL 15C8H 1P7QB 2Q3AA 1Q1JH 3PL6A 3I2CL 3HCVA 1B0RB 4RGMB 5EULV 3OPZH 1CIUA 3UTSA 2NX5E 4U4BA 4S1QL 3QCVH 3AM8C 2HTKD 2OMBA 3VI4E 3VRJB 1Q9LB 3CVHH 4HIJA 5FKAA 5FECA 2EECA 1I9RL 3IU3B 3OAYK 2A9NH 3QPQD 4QTHA 5ANMA 4PBWD 1N59B 1NFIA 3WUWB 4DK6A 3BT2H 2QKIA 3VXRD 5TF0A 1VPOL 5DJXA 1VKXB 5ITBL 1FL3B 4CMMA 2GIYA 4OFIA 2MQCA 4XAKD 3WNKA 2PNDA 4UDUA 1X5HA 1XR9B 3BDXA 4RMVA 5FK9A 1FC1A 5F97E 5IB5A 2WMPA 2VISB 4PRNB 4P2OD 2CMRH 1N5AB 1NCTA 3BPLB 4JPWH 2O61A 5C8JA 2XT1B 3BE1H 3VXRB 1I7UB 3KPSD 4NGHL 1B2WH 4Y19D 5BS0B 5EORH 5I2IB 5DD6A 1V7ML 1NUNB 4LSRL 5FOBA 3UBXG 4IIQA 1IAKA 1UM6H 4B5EA 3QUZD 1WBZA 5C0AE 3DVGB 4P5TA 5C07A 4P2OB 2CRZA 4JFOA 1V8HA 3VWJC 3SO3B 1AO7B 3G6JA 1FPTL 2ZUXA 4NZTH 3IXAB 3KPSB 3T2OA 5LQBL 4RGOH 4Y19B 1FH5H 3QDJB 4LCWB 2CIIA 4J3VA 1HXYA 3V0AC 1UKSA 3FL7A 3CFCL 2GYSA 3QUZB 1MHCA 1HIMH 4TULH 2BNQA 5IMKA 2VAAB 1C5CH 2C1OB 5DMKA 5KANG 5C71A 3GHEH 4FMFA 5F88A 5DJ2A 3SE9H 1NEUA 3RX8A 2GUOB 3EJYC 2J6EA 1CFBA 1F2XK 4DCQA 1U3ZA 1TZHA 5L6YL 4KTDH 5ACMA 3S4SG 1V7NH 4JAMB 1U3HA 1CR9H 1NGZA 3VI3E 1LDPH 5TQ0H 4AEHH 4P5MA 4UNTA 3VH8G 5CD3B 1NDGB 1P69B 9CGTA 1FNEB 1EAPA 2R2EB 4JQXC 1MRDH 1SEQH 1BECA 3KR3H 3PWVA 1IGYA 3T0AA 1ZE3C 3QUKB 5KZCD 4ODSH 1HI6B 1MFDH 3CX5J 5EOTA 4ZFFA 1W0VB 1XF3A 1XF4B 4JZJB 1R6VA 3WFDH 5BW7C 2HMID 4FHBD 4HIXH 2QR0A 3CZJA 1UXWA 3SY0A 5IT2L 4KKLC 3GHBL 3D3VD 4LNVA 2A6IA 3K8LA 3TPKA 3V7AG 1I3RB 4OD2A 3PIQA 1A4KB 3KJ4C 1TZGL 1F11B 1RJZB 4P0DA 5L2KA 5FGBC 5KZCB 5CIPB 3HZYA 3QQ9D 4FNLH 3V6ZB 3D3VB 3QEGL 4KI5D 3QO0B 5HHPA 5IBUB 1KB5L 1U2HA 3H9SE 1EJ6A 1D6VH 1NGYB 3FQWA 1J86A 1VDGA 1RK1A 4WU7B 3MV8D 1PLGL 5B22A 4EUPA 4KK5D 4XP1H 3STLA 4PTTB 3GSRA 4Q9BA 4DEPC 2DLIA 2EDEA 3QEQD 2A74B 4ELME 2EE6A 1ZAGA 4YHOL 5C3TA 3L3KB 4CU6A 3N0PB 3FB5A 5TE4H 4PRHA 3MV8B 3EYFA 3LN5B 2HKHL 4N0RA 2VZ3A 1LQSR 4UQ2B 4EDWH 1I7RA 1MFAL 1YNKL 5ADPH 1EJOL 2AXFB 4XPBH 4I77L 2R29H 4K7PL 4UV4H 1J1XH 1J05B 3QEQB 3PL6D 3DX8A 2YUVA 3QO1B 4CRPA 3CCHA 1JYVA 2BK8A 2DLFL 4PG2C 4DGIH 4TSCH 4XBGA 4HFUL 4GAJH 4P57B 5KVMC 1KC5L 3MJ7A 3ARRA 5MP6L 4QXUL 2EDFA 4OGXH 1CDIA 1CGWA 3PL6B 2VXTH 5L9DL 3HCVB 1PKQE 2BY3A 4M7LL 4GS7C 4XP6H 3CFIC 5IBLC 5JXEA 1K4DA 3FZUC 4C4KT 1NMAL 1D5IL 3UTSB 2B0SL 3VFGL 2FX8H 4JFXA 2V9QA 2VDPL 1XGYL 4WO4C 4HIJB 5FKAB 3FQNA 5FECB 4KRNA 5I1DA 3GJEA 1A9EA 4OLEA 5J6GA 5EO1A 1XH3A 4QTHB 4Q6YA 43C9A 5ANMB 5HSFA 1X5GA 1JNHA 4RFNB 1F4HA 5C70A 1AGEA 2J6EL 3FKUS 1NFIB 4ZNEA 2YPVL 1VEMA 2QKIB 3NCMA 2EDQA 1QTYT 1QRNA 3ARDD 5DJXB 2FRGP 4CMMB 4X4ME 4ZO9A 4LSVH 4UDUB 2OQJA 2VKWA 1Q9OA 2EZ0D 1HK6A 5FK9B 4MS8D 1TPXB 5IB5B 1AC0A 4J3XA 5I8CA 5IK3A 4AL8L 3D85A 5JOPE 3ZL4H 3V6BR 3D39A 3HB3D 1S9WA 5F7EL 2O61B 5C8JB 3IJYA 1I85A 1Q72H 3KPQA 3O6KL 5IEKA 5DD6B 4M1GL 4F33A 5FOBB 4IIQB 2V5YA 1IAKB 3KPTA 3I50L 2K3TA 1WBZB 4C58B 5HHOA 4HPOH 4LLDA 4P5TB 2WZPD 2BNQD 2QQLL 3HAEH 5C07B 2R0ZH 4JFOB 4BYHA 2XZCL 2GSIA 3G6JB 5T5FL 3FB6A 3O45A 5EO0B 1RUML 2CIIB 1HXYB 5FA4A 2Q6WA 5IW6A 5MEOA 2YPKA 1RVFH 1N6QH 1MHCB 1XGRA 3ZE2E 1CDJA 5EOQL 3TO4C 2BNQB 4LFHG 3LMJH 5DDHA 5IMKB 2G5RA 1OARH 2ITCA 1W8OA 5DMKB 4I9WD 3UTOA 5F88B 5DJ2B 3MA9L 4I5BA 5BJTB 5IV2A 4DCQB 3TIEA 1Q9WA 2R69L 1TZHB 4KKAC 2CGRL 1UFUA 4ZOAA 3P77A 1NDMA 1GOHA 2E27H 5SX5H 1U3HB 4P3WA 3DI3B 3QIUD 1X3DA 3P4NA 2YRLA 5JPMA 4P5MB 1JGEA 4KXZH 4PJEE 2B39A 1EAPB 5EU5A 4ZG1A 2CJUH 1BJ1J 2YN3A 5EBWA 1U36A 1IGYB 3PWVB 2LV4A 3GFUA 5EOCL 3KPPA 3N85H 2FO4A 2VH5H 5EOTB 4ZFFB 1XF3B 3N1QC 2QR0B 3SY0B 1UXWB 4M02A 1UWEH 3WLBA 5GGQH 4HQQH 3EFDH 2A6IB 2J8UF 2MQ0A 1RIVL 3TYGL 1FFRA 2E8ZA 3PIQB 1I1RA 4CVWA 4PJ8A 2R2CA 5L2KB 4WI2A 3HZYB 5CKGA 3HR6A 3D9AH 4JPKL 4XHQA 4TRPH 5MENA 1CWVA 3HZVA 4I3GA 4XHJD 1DSFL 3WFEL 5HHPB 1YEKL 2H2PC 1KOAA 2IBZX 3C5ZA 4OCSH 1FVEB 3FQWB 4HK3N 3PXJA 5I1GL 1RK1B 4PRHD 3V2AR 1UACH 1HNFA 4EUPB 1IM9A 1G7HA 5DJDA 2MWCA 1NCDH 2HT4D 3L3GA 2NY3C 3STLB 5IJKA 3ARYA 3GSRB 4R8WH 4PD4J 2DQIL 2DTMH 5ISZA 2W0KA 2FH8A 1EVTC 2CKBA 2R23A 3C60A 3FB5B 5CSZA 1NCUA 4PRHB 3EYFB 4LQFH 3VA6A 4KJWD 1LVEA 4R2GD 1I7RB 4D0BA 3BPCA 3QCUH 3HAEG 4X7EC 1VB9A 3QDGA 3VWKC 4M7ZC 4TVPL 3GI9H 3ARTA 1SVCP 3DX8B 5JXED 3CCHB 5DRZA 1ITCA 4XBGB 1NAKH 2EICA 2ERJB 1G84A 3AU1A 4R2GB 4MSWA 4HWEH 3MJ7B 3RIAF 3S97C 4GO6B 3ZSSA 1JPGA 1U8LA 2VSCA 3ORJA 5L0QB 1PDKA 4DVBA 3ZYZA 1K4DB 5ELIA 1QRND 3HG1A 3O4LB 5J1AA 1A02N 1CT8A 1EXUA 4OI8A 3FQNB 5I1DB 3GJEB 3QHFH 1A9EB 4OZHB 1PAMA 2NY1C 5EO1B 5J6GB 1XH3B 4M00A 4OCYH 43C9B 5I73B 1KEML 2DQEH 1JNHB 3O11A 3NGBC 1HZHH 1OGAE 3D85D 4TVPD 4K94L 4PR5A 1AGEB 3TT1H 5D6DC 4LSDA 3D39D 1A14H 2XKNA 1QRNB 2A0LC 1CTNA 3JV0A 4UIKH 2FO1A 4GAGH 3IRZA 4YFDB 2GQHA 2OQJB 1BBDH 1Q9OB 4JDTL 1SBSH 4GSDH 4Z7UF 5HHOD 5JW4N 5I8CB 5IK3B 3D85B 4RA0C 3SDXE 1FZOA 5IHZA 1MJ8L 3ARBD 3D39B 1S9WB 3F6LA 3MBEA 4G9DA 1RAMA 3TYFA 3IJYB 4WNQA 4YH6A 5ETUA 4ZS6C 3KPQB 5IEKB 2ZKHH 2CKNA 3P4LA 3VGDA 1BVLA 3EYSL 1XEDA 3X3GL 5HHOB 4LLDB 4GJTB 1FC2D 1NFDA 3GKWL 4XPGH 5TJWK 2GSIB 3L3DB 1LP9F 1CFNA 3FB6B 2AJSL 3O45B 5K9QG 1JZ4A 4PJAE 5HD8D 5C0EA 2X1QA 5FA4B 2Q6WB 5IW6B 1JNLL 1T6WA 2YPKB 3OZ9H 5MEOB 3CDGA 4FXLA 5CJQL 3MPCA 3UXFA 1XGRB 5D7JA 1CLCA 1HHHA 2MJWA 2ITCB 4M5ZL 3SOBL 5IVOA 3B5GA 5GS0C 3GUTA 2OP4L 4WGVB 4H88L 5KOMC 5IV2B 4XNQA 3TIEB 1RJLA 1KTRL 4X6DB 4L3AA 1Q9WB 2MKLC 2CKBL 3P77B 1NDMB 3SQBA 3WHXA 2A6JA 3GM0A 3P4NB 3MYZA 4F7EA 5JPMB 3IDMA 1JGEB 3BP5A 3T2QA 1ITBB 3RL1B 2ZCHL 2XA3A 4GW1B 5EU5B 3EDKA 4PJ8D 5EBWB 5E0QA 5I1IL 4OD1H 3KPPB 5JZ7C 4QRRE 2FO4B 1AHWC 4XMKL 4JVWA 4TUJA 3V0VB 5MEND 4WY7L 1LO3H 5TQ2L 3WLBB 1BVZA 2DBJA 2JTDA 3C5ZD 2PUQT 2BRRH 3GB7A 3T77A 5IB2A 1M05A 2XWTA 2PO6C 4GG6A 4MCZA 4PJ8B 2ARJQ 4WW1A 6FABH 5SV4A 4KK8D 4JB9L 4YC2C 3EBAA 4LVEA 5FO8A 3HZVB 3ZKQD 4EQ2A 3NH7H 1KN4H 5MENB 1I1AD 1YJDH 5KSBF 5ISZD 3QI9C 2X4RA 3C5ZB 4J12A 4P99A 5ALCL 2PXYC 4HWBA 3C8HA 3C60D 2EXYC 4NZJA 2B2XH 3MGAA 4FQJL 4YHYB 2VDNL 1UH4A 4OZIF 1IM9B 1G7HB 4PRPA 5C0BE 4FFVD 5DWUH 2E7LC 3L3GB 3QDGD 4Y8AA 4GRWF 4MA1B 2QBWA 2F54A 5AWNH 5HYFA 2IAMA 4PY8I 1QSEE 1TTFA 3L3JA 5I75C 5ISZB 2OXHA 1NMBL 4K7FA 2VKXA 3BH8A 2X7LA 2FEEL 1QR4A 5TF1H 3HNVH 2AGJH 2R23B 3C60B 4OCLC 5CSZB 3LEYL 2WBKA 5DRXA 4XWGH 2VN7A 3BPCB 3FO1A 5I1CL 5F8RC 4TQEL 3VGAC 1MJ7L 3QDGB 1S7XA 1A1MA 3BKCH 5F1NA 2YS4A 2DWEA 2VLJE 1WIOA 4HW6A 4N0YL 4HXBL 5DRZB 2KUTA 4G3YH 3V4UH 3HG1D 3AU1B 4MSWB 4QXWA 1RZJH 4NM8H 4KMQA 4AZ8A 3MRHB 4PTUA 1RUPH 5D7KE 1FDLH 4LIQH 1JPGB 1HXMA 3NCFB 5EUOE 4DVBB 5LJYH 4HWNA 2XA8L 5GRVK 2J88H 5HGAA 1A22B 4LOUD 3W5MA 3HG1B 3GBMH 5J1AB 1B6DA 1EXUB 1DQMH 1D9KA 3OGOE 4OB5L 3GJFA 4RX4A 1JI2A 5FAAA 4QNPF 3JV5A 4C57C 3CSBA 3O11B 4TPRH 4J4PC 4P23C 1LEGA 1PG7W 2I60H 4PR5B 3NCCB 4K3EH 1TJGH 2R8SL 3MBED 4I18C 2XKNB 4U2YA 3PWJA 3F7VA 2GT9A 1H0DA 5D72L 1WICA 4FQ1L 5D6CA 1T7YA 4PJBF 4Q0XH 3TESA 3M07A 3P9WB 3SCMC 3F58L 4JN2A 4O58H 1T5XA 4MAYC 2L4OA 3H9YA 4LKCA 5SX5K 3BHBA 1T1YA 2AP2A 3QFDA 5IHZB 1FZOB 5F7MC 5DQJA 3MBEB 4G9DB 5J57B 5JW4R 3K2UL 3LHPH 4IMKC 4HH8A 1BWMA 1PZUB 5ETUB 4WNQB 4M9PA 4HCRH 3A67L 2CDGA 4JFZH 1HKLL 3IFPA 1LEIA 4Q74A 3VW3H 4OM0L 1NEZA 1RJYA 4I0PA 1BVLB 3K8MA 3ELAT 5ERWA 5HVFB 1WTGT 1NFDB 3NFSL 1OSPH 4HPYH 1CZ8H 4Y4KA 3GK8L 1CXKA 3SDYL 1IGJA 5JNYA 1YMMD 3SDDC 2VABA 5C0EB 3O9WA 4V1DD 3CDGB 5TDOA 1XGUA 4HWBL 3VJ6A 2APVA 5D7JB 1J10A 2NR6D 1HHHB 1OY3B 3TJHD 4BFGA 2VE6B 4NUJA 5FCUL 1FNSL 3H42L 1DQLH 3O0RH 2X4OA 4YPJA 3GUTB 2AV1A 4XNQB 1AGCA 1RJLB 4XCCL 4Q9RL 5L8LB 4F15C 3JVGC 3MODH 3ULVH 3WHXB 2OZ4H 4LHUG 1U95A 4H0GA 2A6JB 4K3GA 4F7EB 1PFCA 3IDMB 3BP5B 4BH8A 3CLEL 2ZUQC 5E08L 4YDJA 2H2SD 4FA8A 3BP6A 4NJ9H 3U82B 4JO2L 5DRNA 5T33L 4ONOA 4TUJB 3NCYS 1DDHA 1JFQL 2OR9H 3VXRE 5D1QC 3ES6A 2VDQH 4DGYL 5KVGL 3GB7B 5IB2B 3T77B 5BS0E 1M05B 2XWTB 4XAKE 4GG6B 4KPHL 4MCZB 1NCCH 5E2UH 2OSLA 3RU8H 4WW1B 1MWAA 4HBQA 2J8HA 4R3SA 5I15H 5FO8B 4BFBD 1JZ6A 5MI0C 2IAMD 1AO7E 2HJLA 3KPSE 4HSQA 4F9PA 2F8OA 2X4RB 4Y19E 4RGND 3QDJE 4LCWE 2LAAA 5DMGC 1KELH 4LARH 2IQ9H 2XV6B 4N9OB 4OD3L 4PRPB 1FQ9C 4RGMC 1DCLA 2Q7YA 4KVCH 2F54B 4NOFA 3PGFH 2IAMB 3L3JB 3DI2B 5ESVA 2P46B 4GRWH 1T1XA 4KK9D 4K7FB 4RGNB 1OCWL 2XY1A 3BH8B 2X7LB 1SM3L 3H7LA 3WDJA 5DRXB 1BFTA 5KTEH 5E03A 2DI7A 4NYLA 1OQXA 4AG4L 1S7XB 3FQXA 1A1MB 2W91A 4YPGA 5F1NB 2HTKC 2DWEB 3TV3L 4AY0A 2GJZA 1NLDH 1RMFL 3MNZA 3LPFA 5F70A 4FQIH 3S36H 3V52L 5LGKA 2XQYK 1DBAL 2GJ6B 3QPQC 3E8UL 3F7YA 3O6LH 4BA8A 5DXWA 3INUL 4ZXBD 3AAZA 4NBXB 4PTUB 1D9KD 1QLFA 3W2DH 5A40E 2WBJA 3BPLC 4K9EC 1HXMB 2J7LA 2CSPA 1NJ9A 5DD3H 2M1KA 5HGAB 1PZ5A 1TVBA 4U6VL 2DQJH 3D3VE 4YHZH 4YX2L 4O02H 1CYGA 4R96A 5LGHL 1CGSL 4M6NL 4X7TA 2CDFA 1D9KB 3GJFB 4P2OC 4HFWA 3SO3C 1LEGB 2UUDH 1N0XH 2E6PA 5AG8A 2R2BA 2WP3T 3PWJB 3TEUA 3F7VB 2GT9B 1H0DB 3QUZC 5J13B 5D6CB 4OF0A 4QKXB 4EN3A 4A6YB 4JN2B 2APXA 1T5XB 4GKOA 1T04A 5IFAH 3OG6B 4LKCB 4O4YL 1IC5L 4OLZL 3MV8E 5JW4Q 3MRQA 2YMXL 1T1YB 2VL5B 3QFDB 1HHGA 4QEGA 1DEEA 4D9QE 3I75B 5DQJB 1M7XA 5C0RH 4J3TA 2EO1A 2NY7L 3QEQE 1F8TL 3WKMH 2Q8BH 5DD5L 2CDGB 3MLPA 1X5JA 3IFPB 3T2NL 5I30H 3L9RA 1LEIB 2Z9TA 4LLYA 4TOYL 1NEZB 1RJYB 4I0PB 3OMZA 5LCVL 3MJ9H 4HXAH 5IBTL 4HJJL 3ZT5A 2IMNA 3B5HA 5ERWB 1CDYA 1OTTC 4XPAH 4I4WA 3FT4A 3I6GA 3GI8H 4ZD3H 4M5YL 3QWOB 5DR5H 3QUMA 4Y4KB 1IGJB 5A3ID 5JNYB 2VABB 2DTSA 3O9WB 2G9HA 1A7QH 3UTSE 4QWWD 5TDOB 1XGUB 1RD6A 3VJ6B 1GPOH 1J7VR 3OAUH 4NUJB 4Z7WF 3EJJX 5ID1A 4TSBH 2X4OB 3GNMH 5ANME 5F7FA 1IKFH 5HGBA 2AV1B 2R9HC 1AGCB 3KJ6H 4ZPVA 4OV5A 4AK1A 1JF1A 3DLQR 3TGXA 3VXSA 5C0GA 1U8KA 3A0OA 3HE6A 3NPSC 4PYGA 4BH8B 3H9ZA 3QQ9C 5GGTH 4Y7MA 4YDJB 4Z8FL 1IT9L 2APTA 2P5ED 4CVZA 2XPGA 3MNWA 5DRNB 3S37X 2VAJA 3O2DH 3RVWD 1DDHB 2OI9B 2VZSA 4CAGA 3ZMRA 4L1HA 4RMQA 5E99H 3ES6B 1MFBH 3HC3L 5GJTL 2H41A 1WZMA 5AUMA 2C26A 4MD5B 2OSLB 5E7BA 1MWAB 3VD7A 2ARJA 3ARZA 4PLKD 2MPAL 4FFYH 4R3SB 5C07E 3P30L 1AQKH 4F58H 2VDLH 5GJSL 2RFXA 2ATPA 3OXRA 3QNXA 3G6JE 2HJLB 4HIIA 2YKLH 3V7MA 4AENA 3CSPA 5L7XL 4HS6A 4B7IA 2OK0H 3N1MC 2KZWA 3PL6C 1W0YT 5AAWA 2AJZA 3QUYA 2BNQE 3OKKA 2Q7YB 3X3FH 4GQ9H 1CL7I 1VGEH 2FGZA 1T1XB 2AERT 2NZIA 1TMCB 2H32A 3NPZB 2HFTA 4IRZL 3S35H 1E4XI 3MJ6A 4EI6A 3CXDL 4FABL 2X1PA 4NYLB 4RFNC 1NL0H 4XB8A 3BEWA 4NWUH 2W0LA 3FQXB 4I9WE 3RVVD 4UV7L 5SV3A 4YPGB 4NOBA 2GJZB 2MNUA 3MNZB 4YDIH 4QHUA 5C09A 5DMIL 1LO2H 4RSVA 3NAAL 2BFVH 3F7YB 1TPXC 4XH2B 1YNLL 3AAZB 1QLFB 1CD8A 3Q6FA 2HVJA 2WBJB 4KY1L 4NP4L 5L2KE 2YPLE 2WW8A 3QUML 4RRPA 1S7VA 1NJ9B 1IC7L 1FLRL 4MZ3A 4HJ0D 1PY9A 4HAGA 1PZ5B 1TVBB 4HMCA 5FGRA 5DJCA 1WBXA 4R96B 4MDIA 4X7TB 2CDFB 4P5TC 2EH7L 4EN3D 3UPRA 5CEZH 1JF5A 3VGBA 3ZHKA 4HFWB 3HB3C 4JRXA 1NKRA 3JV4A 5L2JA 1P4LA 2F74A 2R2BB 4M3JA 4W68A 2WM0A 5E2WH 3GMRA 5J6HA 4KC3B 5LGJA 5JUEH 1YY8A 1IGMH 1MELA 1RURH 1N64L 4L4VD 3GSUA 4H8WL 2IEPA 4EN3B 3RHWF 5F9WB 4PRAA 2I5YH 2DKSA 2FX9H 1T04B 2LVEA 3JWDL 1QFPA 5FDYA 3E6HA 1C08B 4J3UA 4PRHE 1EUUA 1S5IH 3MRQB 4X7DC 4FQLL 4XNMA 2VYRE 1HHGB 2VO5A 3L3OA 1ACZA 2MOVA 4JG0H 2DOCA 2NZ9C 1MQKL 4M8QA 1U3HC 1GGIH 1YEJH 2ZJSH 3QDHA 2JF1A 3L9RB 4LLYB 3RZWA 1NBQA 4X6CA 1GAFL 5AYUL 3BGFC 4NQDE 1U8HA 3MO1A 2R0KL 1EHLL 4I4WB 3FT4B 3G6DL 3I6GB 3THMH 3QFJB 3QUMB 3C2AH 3MXVH 3D25A 4J2XA 3HMXA 2G9HB 4FP8H 5KW9L 1N5YL 5JLZA 1JGLH 1P84K 4Z7OE 1U3JA 2VTFA 3VXSD 3O4LE 1JUFA 5E9DA 5HDQL 2I25N 3HE6D 4GXVL 3WS3A 1JNNL 4OZHE 1X5ZA 1GZQA 1SJHA 5DC0A 4MCYA 5ID1B 1NUFA 4MGXA 3MUZ1 2IPTH 3QISA 5HGBB 1TQBB 3MFFA 3RAJH 2Z8RA 4ZPVB 4FQCH 4XCFH 3UBXA 1D5ZA 4ZNEE 1JF1B 3VXSB 5C0GB 1MPAL 1QRNE 2FSEA 3JWNC 3QNYA 1U8KB 1HINL 1CE1H 5FKPA 3MLZL 5HI4D 5HHVH 1QFWH 4JY6A 2W9EH 4HC1A 2NXZD 1YA5A 4PB9H 4CVZB 2XPGB 3MNWB 4MMZC 1EFXB 4UT9L 4N8VG 4TVPE 5E8EB 2QSCL 1F42A 1CGXA 3D39E 1FFQA 5IMMA 5FYJL 1XIWA 2P1YA 4UINL 1W0WA 2D9QB 5AUMB 4GLRI 2HT4C 2EDKA 2ARJB 5HHOE 4HF5L 5C08D 4OI7A 4MVBC 4X6FA 3S4SA 2RFXB 2ATPB 3OXRB 4EI5D 3QNXB 4HIIB 1HHIA 2ERJC 4KJWC 4AENB 4P2QB 2JK5A 2YN5A 1FAKT 4U31A 4BM7A 4D8PA 1JWSA 2AJZB 3QUYB 1D5XA 2NPLX 5FIEA 3OKKB 4XP5L 2J1KA 1QPXA 4J23A 1R5VA 4EIGB 4OGAD 3CVHA 3GO1H 1OAXL 5HJ3A 3H9HB 2H32B 3S34H 3CLFL 4OLWH 4X6DE 1F3DH 2UUDK 3F7QA 3B9EA 3MLRL 5C09D 4JM2A 4UT6H 1JPTH 5FYJD 2ZZUT 1AY1H 2FCBA 5I73C 4EI6B 3OBAA 2VXVH 3TWCL 1J8KA 2WQ8A 4HS3A 4UQ3A 3BEWB 3DPBA 4JVPA 4QHKI 4OFPA 2YD4A 1MCDA 4AMKH 2AJXH 5GGVL 4H25A 1LK3L 4LASH 4QHUB 3BAEH 5C09B 3S9DB 4ALAH 2XTJD 1AJ7H 4IDJL 1X6NA 1JP5A 4YQXL 1MCOL 3Q6FB 4KUZH 4Y2DA 5CJXA 3CSGA 2HVJB 4JRXD 4Z76A 4EXPX 3FFDA 3HE7D 2YC1A 1S7VB 1EHNA 2PTUA 2GSGA 1SMOA 5MENE 4F7CA 2VDOL 3EJZD 3HMXL 4FFWD 4CJ1A 2B4CL 1N6UA 5DJCB 1EK3A 1WBXB 4MDIB 3BXNA 3MLYH 3UPRB 3MZGB 4LSTL 1JHLH 3LS4H 5E2VH 5HYJE 1IEAA 5HYSB 3FONA 1G9NH 4JFEA 5JHDA 1F58L 1KENL 3JV4B 2UYLA 5L2JB 1P4LB 2N7BA 2F74B 3DMMA 3EO0A 5KAQF 1S7QA 1DLHA 3CK0L 2B1AH 1XR8A 3QEHA 5IHUH 4MNGA 3JV6A 5J6HB 3GMRB 5LGJB 2NY4D 2E7HA 4YR6A 5ISZE 1YY8B 3GSUB 4PRAB 3X13A 2M26A 1Q0YL 3E6HB 4HC1L 5C0JA 4XNZB 5I1EL 4K94C 2V2XA 4XNMB 2CLZA 1QSEA 2J12B 3L3OB 2D31A 5GSVA 4X7SH 1FFPA 2I07B 1M7IA 2NY4B 3DHJA 1AR1D 4M8QB 3B5TA 4ZAKA 3QHTC 5KSVB 1H5BA 2D4DA 3DUHA 2Q20A 3WHE1 5I1AA 1MNUH 1TXKA 2FJGA 1A9BB 4NKIH 4M4RA 3WSQL 4X6CB 4LLMA 5CMAA 1CGUA 4X0KA 5E9DD 1U8HB 3OF6A 1I4FA 3MO1B 4YHML 3SGJC 3SKOA 2BERA 1FGVL 5ALBL 5HHNA 1XGTA 3FT3A 2HWZL 3K74B 2CO7B 3FJTA 3BZEA 3D25B 1A3RL 3LN4A 2HKFL 5J9PA 5JLZB 1XCQA 1URLA 2IGFH 1Q1JL 3HG1E 1JUFB 2GITA 5E9DB 1JJUA 4N0CC 3WS3B 3OPZL 4WFGD 1GZQB 1SJHB 4MCYB 1UXSA 4FQPA 4XMLH 4P46A 1FP5A 2HTLD 3P2TA 3CVHL 3C5ZC 3UBXB 1D5ZB 3NACH 2A9NL 2FSEB 3MCKA 3QNYB 1BZQK 3DYPA 4YHYC 5FKPB 4HUWA 4KK8C 1PX4A 3U1SH 4JY6B 5IJKC 4MA1C 3BT2L 5JHLL 3BOVA 5ENWA 1KYOJ 2Y6SC 3ESVF 5JDJA 1RZGA 3QSKB 1BD2A 5IMMB 3VXQA 1NCNA 4XPFH 1XIWB 5DC4B 2VR4A 5IB4A 1W0WB 4K55A 1CDCA 4G5ZH 2CMRL 2BVUA 1D7FA 3FN3A 4JPWL 4APQD 5DFWH 3QJHA 4GMTH 4S1QH 1B2WL 4KK6C 4N0FA 4X6FB 3S4SB 1NFDE 2NTFB 4PJ5A 5CGYD 3K3QA 1DQQA 1I9RH 1UM6L 1HHIB 2MFNA 4K2UH 4LCCC 2JK5B 2NW2A 1NAMA 4S1SH 5CLTA 4NZTL 1JWSB 3AVEA 4YO0A 2A6DA 4DN4H 4B50A 1FH5L 4ELKA 3S8WA 1D5XB 1K6QL 4HG4K 1R5VB 4YHPA 3MBXL 1RV6X 3CVHB 2AJUH 5HJ3B 1HIML 4M8VA 3VE0A 2NY5H 4NKOA 4TULL 1ONQA 3D0VB 3JUZA 4JM2B 2E9BA 4NKDA 1MI5D 3E1F1 4YZFE 3KNBA 3SE9L 1T66C 1T22A 1VA9A 1ES0A 4X83A 1R3JA 4HS3B 4UQ3B 3CFJA 4NGHH 5T3ZH 4NFCA 3HI5L 4HV8A 4Y2DD 1BWWA 1CR9L 1EA9C 4H25B 5TQ0L 4AEHL 4E42A 3OKYA 2P45B 4HUVA 5CKAA 2W07A 1OD7A 5E24E 3UYRH 1MRDL 1SEQL 3GSOA 3NA9L 4BSJA 3KR3L 3RTQA 2F19H 4ODSL 1MFDL 3LB6C 4PLJC 5JW5A 5F1IA 3WFDL 4GG6E 3T04D 4Y2DB 4HIXL 5JHDD 5I1LA 4Z76B 3FFDB 1O5DT 2YC1B 3AS1A 1TITA 3CFCH 1OVZA 2GSGB 4LCYA 4F7CB 3AMKA 1KF9B 2I24N 3QDMA 1LO5A 4HEME 3HAEA 3BXNB 5I6XB 2L7JA 3CMOH 4FNLL 4XBEH 2JJSA 4KU1A 4LGPB 1IEAB 2ZPKH 3FONB 4JFEB 3VI4F 5JHDB 5L6YH 5BOZG 2UYLB 5GISH 4PRPE 3DMMB 3EO0B 1D6VL 1S7QB 1DLHB 4GBXA 4BZ1L 1IBGH 1XR8B 3QEHB 2F54E 1MCCA 2FHFA 4MNGB 2Y4SA 3JV6B 4R4ND 5HVHB 2NCMA 4ZAKD 5EC1A 5D7JC 4RGNE 5J89A 4OAWA 5EU4A 5JIPA 3X13B 3RJDA 5C0JB 1Z6JT 3D69A 1TJIH 1TNNA 3OF6D 2V2XB 2CLZB 1WF5A 1DN0A 2VWEE 2D31B 5GSVB 1DZBA 1FFPB 5TE4L 1A1OA 1M7IB 2W0FA 4ZAKB 3LCYA 5D5MF 1TZGH 5ADPL 2F53D 1A7PH 1EZVY 2NR6C 2FJGB 5I1AB 1N4XH 1QNZL 4XPBL 4ZO6A 2R29L 4UV4L 3U6RA 2FYYA 3L6FA 2GJ6E 2HT2D 1VHPA 4LLMB 5CMAB 5CJ8A 3SGEH 2J4WL 4X0KB 1J0JA 5GHWH 5HYQA 2P48B 3HN3A 1I4FB 3DETD 3QEGH 3SKOB 3WS6A 4Y2OA 4N8CH 1KB5H 5HHNB 1LO0H 1XGTB 3FT3B 2VMFA 4TSCL 5C7XL 4OFVA 1GOFA 4P46D 1T3FA 3PNWA 3ULSA 3T4AA 4GAJL 4LVNB 3BZEB 1MF2H 1YUHA 2BOBA 3I02A 5JQ6H 5MEQA 2C3GA 3LN4B 5MHSD 5J9PB 3U0PA 1XCQB 4OGXL 1NAML 2H2SC 2XTLA 2VXTL 2IG2H 2GITB 4YBLB 1UZ6E 2G2RA 2YK1H 3RGHA 4GUPA 4OSUH 3IF1A 1UXSB 4DK3A 4YHOH 4P46B 3F7RA 4XT1C 4LRIC 2SEBA 1MJJA 2HKHH 4JRYA 1YNKH 1BD2D 2N1KA 3MCKB 1ZLWH 5FYJU 1EJOH 1RUQH 3ZKMD 3TH4T 1KFAL 4JZOA 4HUWB 3ZSTA 1IMHC 1HDMA 1OP9A 1KLGA 2ATKA 4HKXA 2Z92A 3OG4B 2IAMC 3I3DA 2ZWLT 4LGSB 1I8KA 5M95B 4NO2A 1FSKB 3HMWL 4KMLB 1RZGB 1UB6A 1BD2B 4PJ5D 3VXQB 5MP6H 1QP1A 1YDPA 3MCG1 5IB4B 5L9DH 4M7LH 2VWEC 2HA1A 1NMAH 1D5IH 3VFGH 3S98A 3UTZA 3QJHB 4KK9C 1Q72L 2NNAB 4DQOL 1OAQL 4PJ5B 2YOCA 5KAQG 1DQQB 5JIHA 1XF1A 3LY6A 3FFCA 4IRSA 2DLEA 2NW2B 2NYYD 2R0ZL 4OZFH 2FL5A 4JO4H 1DL7L 3C8DA 1AR2A 2FJFA 1EAJA 1I9IH 1MCSA 2A6DB 2LFGA 4XXDA 5HYIA 4ELKB 1PY4A 4QHLB 2YD5A 2ZG1A 3PG2A 1N6QL 4N1HB 2NXYD 3VE0B 4CL7A 1ONQB 3LKOA 3LMJL 1WFOA 4NM4H 1OARL 4R97C 1D9KC 4XNYH 4NKDB 3ZDYF 5GS3A 4ELMF 3KNBB 5IW1A 5E4IA 5F7EH 1T22B 3RTQD 1ES0B 3D2UD 1R3JB 2DQUH 3CFJB 5IVNA 4HV8B 2E27L 3OKEA 4OF3A 5J13C 3I50H 4E42B 2JJTA 4DZ8A 3HR5A 3MV11 1X5YA 1R0AL 2MCG1 2QQLH 2CJUL 3QDMD 3GSOB 4W6YB 1S7SA 3RTQB 1F4WH 2XZCH 3N85L 2ICCA 3TBSA 2Z8SA 2VH5L 5JW5B 5F1IB 2D7TL 3B4NA 3IDIA 5I1LB 5EZOH 2DBLH 3VXOB 5TDPA 5GGQL 4HQQL 2V6HA 3EDEA 2HLAA 4OF5A 4GBXD 4LCYB 1A5FH 2XKUA 8FABB 3QDMB 4JDZA 1LO5B 4I0PC 3HAEB 4P3CH 5E95B 3QIWA 3D9AL 3MA9H 3VFUA 3LPWA 5HDBE 3IXTA 3V5DA 4GXUN 3T0BA 2R69H 2CGRH 4NCC1 3NFNA 4Y4KC 1JHKL 2HJFB 2M2DA 4OCSL 4GBXB 3O9WC 5JW3L 4Z18A 4ISVA 4PJIF 2EKJA 1UACL 5EC1B 3WUZA 4OAWB 1A47A 1SEBA 2APWA 4HUKB 5IB1A 5B3NA 4R8WL 2V7NA 2DTML 3D69B 3FOMA 3FT2A 5A3IC 4NRXA 4PB0L 4X4YA 25C8H 1DN0B 3VXMD 5I74C 1RIVH 4QWWC 3KPLA 1A0QL 4FTVA 4KTEL 1A1OB 4LQFL 4UZGA 2W0FB 2YRZA 5FXCH 4OZFG 2BXYA 1K4CA 2FX7L 2FH6A 3U6RB 2FYYB 2P49B 3L6FB 3T4YA 3GI9L 1DSFH 35C8L 2BSTA 5HYQB 5J1TC 5FF6A 5IESL 4MJ5A 2PW2A 5FO7A 1A7NL 5BV7H 3E2HB 2OI9C 1T3FB 3PNWB 2IANA 3A6CL 3ULSB 3T4AB 4HWEL 1CIDA 3SGDH 2VZUA 1YUHB 1QSFA 2J8UA 2BOBB 3I02B 4HJGA 5MEQB 3UJIH 4JRYD 3U0PB 5D2NA 4HWUA 1GC1C 1ZVHA 1MCHA 4OV6F 1F45A 3DX9A 2G2RB 2DQIH 5CSGA 3IF1B 3ZE2F 2AVGA 3WDHA 5DZNA 4YK4B 3U0WH 3FO0H 1MJJB 3QHFL 3AXLA 4JRYB 4NQCA 4OCYL 3FHQA 1Y0LA 4E41A 2DQEL 1HZHL 4JZOB 5DZOA 3CC5A 1HDMB 2VLLA 3DIFA 4PLKC 1MCKA 3TT1L 3P40A 5CGTA 1KLGB 2ATKB 3UZVB 1A14L 4CMHB 4HKXB 3MV7A 2Z92B 4CKVX 4HUMB 1I8KB 4NO2B 4GAGL 5BOPA 1UB6B 3C08H 3R0NA 2C7UA 5H94A 4OKDA 4GSDL 1YDPB 3FFCD 4KROB 3WNNA 3NZHH 4BELD 5B8CC 3HUJF 2A9ML 4L4JA 3P3YA 3DX6A 1NMCB 3UTZB 2CRMA 3ULUC 5GRJL 1WJ3A 5D8JH 2J2ZA 3WDIA 3O8XA 4KMTL 5HHXL 1TVDA 4LHUA 3RNKA 3QFJE 3FFCB 4IRSB 1KEMH 2FL5B 2H45A 3W39B 1BAFH 5DEZA 3TZVA 3TNMA 2FJFB 2WBJC 4XXDB 1AGFA 4G8FA 2BHZA 5BVPH 2FBJH 5IHBA 3LKOB 2YHGA 1CI5A 1PSKH 3G9VA 3P4MB 5BRZA 1MJ8H 2O5YL 5INDA 3VXSE 5T3XH 5IROC 5IW1B 3ISWA 3KLSA 2P7TA 2PF6A 4GMSH 2GY5A 4HJ0C 3RA7L 2DLGA 3JSSA 3HNSL 1U91A 4URTB 4DZ8B 3HR5B 4MA3A 2MQ3A 1JWUA 3DYMA 4EN3C 5F9WC 2X5PA 3ARQA 4M7LT 4BJLA 1S7SB 4Z7UA 4OD1L 3QIWD 3TBSB 4D94A 2MKWA 2AJSH 4NN7B 4LKXB 1LO3L 2XG5A 4QRPD 4R0LC 1VESA 3IDIB 4ZQKA 3BZDA 1IC1A 5DT1L 3GMMA 5TDPB 3DARA 5SWZD 2BHUA 2HLAB 4NPYA 3MRRA 5EU6D 1MCWM 5DUPL 4YGVA 2BHYA 3P0YH 4JDZB 2A2QT 4F37K 3ROLA 4M5ZH 6FABL 3SOBH 2O5ZL 3VFUB 4P2QE 4PGDA 4X7FC 3IXTB 3V5DB 3NH7L 1KN4L 1YJDL 1OTSD 4JKMA 2BX5A 2QSVA 3C6SA 3DTXA 4OQTH 3MMEA 2CKBH 3NFNB 2W38A 3P4OA 4TUOA 5D1ZC 3PV6A 2KDGA 2B2XL 4FTVD 4ISVB 5HHMB 2NMSA 3AS0A 3MZTA 1BF2A 5I1HH 5AD0A 1SEBB 2B1HH 5DWUL 2VLMD 2LU4A 3PDDA 4JHWL 3RPIA 4WENB 2V7NB 3FOMB 1A6UH 3FT2B 1ZLVH 4NRXB 1ZLWK 4X4YB 1TQBC 3HNVL 3HC0A 2AGJL 3MNVA 3U79A 1GJIA 2WWKO 3BRFA 3KPLB 1DVFA 4FTVB 2IAND 3D48R 1MCQA 4HAFA 4KHTH 1ADQH 1QSFD 2Y7QA 1K4CB 5C09E 3JWDC 5IVXF 5FYJE 3T4YB 4ODUA 3BN3B 5HY9A 2BSTB 5FF6B 2P8PA 4MJ5B 1QBAA 5FO7B 4DKEH 4G3YL 3V4UL 2IANB 4S11A 1RZJL 4NM8L 2VDNH 1QSFB 2J8UB 3O3BA 4HJGB 3WJJA 4NQCD 1FDLL 5D2NB 4LIQL 4E41D 1G0XA 4HS8H 3DX9B 1FL5A 3QT2A 1MREH 1NMBH 2J88L 5K59E 4O5LH 2VR9A 4U2ZA 1DANU 1FZKA 1QRKA 2AXGA 4TNWK 3MV7D 5KSBA 2DAVA 3GBML 4AEIL 5DK2A 5E56A 3AXLB 4NQCB 3GM8A 1Y0LB 3Q6GL 1IFHL 4E41B 4TQEH 1QACA 1RZ7H 1MJ7H 3I6LE 4J8RA 3UAJD 1JGDA 2VR5A 4TPRL 4JQIH 5CP3A 4OZIA 1D5MA 3CC5B 2VLLB 3DIFB 1OTUD 3QUYC 4K3EL 2CDEA 1TJGL 1FAIH 1CG9A 2BNRA 1ORSA 2VOTA 1MEXL 3MV7B 3GBLA 2GW5A 5GS2D 4Q0XL 2X41A 4OBRA 3TH3T 4Z7NE 3O8XD 2ZUVA 3KYOA 5H94B 2C7UB 2EDRA 2GI7A 1EGJL 1B4JH 3QDAA 4ZOBA 5J56B 3B2VL 2ORBL 1RFDH 1DBKH 1KUMA 3TZVD 4OGAC 2XA8H 4X6CE 3DX6B 3UROR 1LD9A 3K1DA 3LQAH 4JFZL 3O8XB 1I7TB 4LHUB 3SE8H 3VW3L 4LCUA 3RNKB 4Y5XC 2AJVL 32C2A 4QF1A 4AEFA 3RDTD 4Y5VA 1BZ7A 4JKWA 4WEMB 1OSPL 5BRZD 4HPYL 3TNMB 4CNIA 1CZ8L 5FYLD 5E9DE 5KS9F 4NQUA 5D72H 1AGFB 1J9CT 5GGSA 4EXKA 3RI5K 3VG9C 3PGCA 3F58H 5CHNA 1DBBL 1OW0A 1U41A 1F6AB 4WGWB 4KV5F 4UOW1 2KPNA 1MCRA 5BRZB 5LKNA 1TTUA 5A1AA 5INDB 3O0RL 3K2UH 2P7TB 3MRNA 3MODL 1HKLH 4Z0BH 4GW4A 5EFIB 4M6AA 1U91B 2F15A 1EDQA 4MA3B 4PJBA 5KVEL 5I8OL 1JWUB 1OD9A 2C4XA 1QO3A 3OAZK 5E70A 1D6EA 4KGLA 4K3JH 4Z7UB 3NFSH 1RSFA 4LNRA 3SDYH 3GK8H 5EZJA 4ZO7A 3MUY1 4ZQKB 1BLNA 3GMMB 2OR9L 3AY4A 4MXQC 3GMLA 2DS4A 2NY4C 4P2YA 3ARGD 4NPYB 3MRRB 1R5WB 1VCAA 3QAZB 3MJ9A 4S0SD 3LDBB 4YGVB 1MOEA 4DKDC 1G0DA 5E2UL 3ILQC 4OF6A 5EUOF 3RU8L 3ROLB 1SVZA 1QOKA 4PGDB 2AEIT 5I15L 5CILL 1Q0XH 1FFNA 2KH2B 4B0MM 3C6SB 3DTXB 4XCCH 4Q9RH 4IHOA 3MMEB 3V79C 3P4OB 5GS0H 1AR1C 4LMQE 1M6OA 3KS0J 2X4SA 2UZIH 3PV6B 1DVFD 4P2RA 5E08H 5DA4A 1A6ZA 3V7AE 5AD0B 4V2CB 2OXGA 3X17A 2R39A 4KVCL 3EZ8A 4JO2H 3RPIB 5I66B 2R0LH 3R4DA 3MV01 4WDIA 4LDLB 1AGBA 3HC0B 3QB7C 3MNVB 4DGYH 5D9SA 1DVFB 3BKMH 4FRWA 4LLQA 1QZ1A 5KTEL 2HP4A 1C5DA 5FUOH 1FHGA 5GGTA 5D7LA 2Y7QB 2PYFA 2X4PA 2YD2A 3VFMA 4ODUB 4MXVE 5HY9B 2QADD 1CDGA 1NLDL 2YA1A 3O2DA 4JREB 3SKUD 3S36L 2P8PB 1B0GA 3ZE0E 3O6LL 5C0NC 4IEFB 1XIWC 4U3HA 3O3BB 2DM7A 1QSVA 3W2DL 3DECA 2PR4H 1U8QA 3RWHA 4CW1A 3STZA 2QADB 1FL5B 3V8CA 2C3XA 4IOFC 1U6AH 1OCWH 1S7UA 1CD9B 1FZKB 2AXGB 1H3PL 4JFEE 2DQDH 5JHDE 5KSBB 2DQJL 4O02L 5DK2B 5M94B 4YWGH 3QQ4A 4BSVA 4MNGE 4ZFOA 4J8RB 1JGDB 4G7YH 4LQ1A 4OZIB 1D5MB 3DNKA 1CCZA 2CDEB 4DKFH 4NZRH 5F3HA 1BOYA 4GRWB 4PJ7F 1CG9B 3CAFA 4WI7A 2BNRB 1ORSB 5AZEL 3IGAA 3GRWH 1U8PA 5B3JF 3E8UH 3SKJH 4QO1A 3BWAA 4RWYH 2FR4A 2ADJA 4JM2C 5IFAL 1MCPH 5ICXA 4HWZA 4BFEA 3KYAA 4CBPA 3J7HA 4Q6IA 2CLRA 3G6AA 1K8DA 3PDGA 3W0WA 4GAYA 5C0RL 5EG6C 1O0VA 1WIPA 5BVJA 1LD9B 1KCVH 1S7WA 2Q8BL 2ZUTA 2LU3A 1CD1A 4PJ9A 4XWOC 3HFMH 5I30L 1KULA 5DI8A 4ESKA 4LCUB 5DHYA 1VERA 1HYSD 4HXAL 5DRWB 1KN2H 3OTTA 3U36A 1JN6A 32C2B 3DUSA 1S9YA 5JR1L 4QF1B 3ME0A 4Y5VB 1BZ7B 5K33A 3GI8L 3RL2A 4ZD3L 4CNIB 5DR5L 5CJXC 5HI5D 4AYFA 4N8VA 1BFSA 3L95A 3GSWA 3IJHA 1OWRM 1A7QL 5ICZB 5GGSB 2BC4A 4J7RA 3PGCB 3K46A 4ODVL 1GPOL 5CHNB 4OQ1A 1F97A 2DRUA 3OAUL 1T1WA 5I6XC 2KQNA 3IJSB 2YMXH 4P4KA 4TSBL 3GNML 5GSRA 1ZOXA 1BQLH 3U7AA 1IKFL 5D7SL 2NY7H 1GCFA 3KJ6L 3MRNB 3KYMA 1F8TH 3DMMC 2ADIA 2EC9U 1A7OH 1REIA 5DD5H 1DQDH 4JQVA 3LRSA 4WV1A 4GW4B 4TOYH 2AW2A 2XXMB 1QFWM 4PJBB 3EOBA 1ZLVK 5GGTL 4HJJH 1QO3B 1BD2E 3MXWH 3QH3A 5J1SC 1KCUH 1WK0A 1D6EB 2V9RA 3IT8D 4M5YH 4UB0H 4LNRB 2J3SA 3CVIH 3KPRD 3CFBA 3O2WH 3W9EA 1BLNB 4MD0A 3U7YH 3T1FA 3GMLB 4R4NC 5E99L 4NSKA 2VZOA 1MFBL 4ZAKC 1JRHH 1VFMA 2BY0A 2IWGA 3MUHL 1S78D 4RAUB 1CLYH 1I75A 2A73A 4PJ5E 3T0EA 4P2RD 1SJXA 5DD1H 4KTYA 3WLWD 4U3CA 5FM8A 1YQ2A 5DVNA 3FQUA 4FFYL 4F58L 1FFNB 2FLBT 2VDLL 2AI0H 1K2DA 2GFBB 3OHXA 4IHOB 4LPYA 5SWSA 2YKLL 1M6OB 4N5UA 1KB9K 2X4SB 4OCRL 3SJVD 1MFCL 2VRAA 1KEGL 5F9JA 4P2RB 5FYKL 4PGJA 2HT2C 1DN2A 3ARXA 1A6ZB 5J0BA 4Z8FH 4YBLC 5D7LD 1AD9B 3DETC 4Z7WA 1VGEL 2W0PA 3BPNB 1BF8A 4P46C 4WDIB 1AGBB 1JTTA 2KZ1B 3VFRA 3HC3H 5GJTH 2R4SL 4LLQB 4NIKB 5I71B 1C5DB 2JJWA 5K9KA 1HCVA 3LZFH 5D7LB 1H3UA 5DJ0A 2PYFB 2X4PB 4NWUL 1GGTA 3VFMB 4LLAA 5KSAD 5C6TL 2ESVA 3RIFF 4YDIL 3EHBC 1B0GB 1FSKC 4PRDA 1LO2L 2BFVL 4BQ6A 3K80A 1Z3GL 4X5XA 1NCWL 2VUYA 5FYKD 3RWHB 4CW1B 3QDME 3STZB 1UYWL 3NIFE 4JJHA 2VDMH 1YN6A 4KRPD 1S7UB 4R7DA 4WI9A 1AXSA 1MCWW 1KJVA 1OP5H 2VLRA 2FEEI 3QQ4B 4BSVB 3QPXL 5CEZL 3HS0A 2R2HA 2KQMA 3SBWC 4ZFOB 3RZCA 1NANH 3TVMA 4UV7H 2QSTA 5DFTA 1K3IA 3W0WD 1MHEA 5KVDH 1DBML 4H5SA 5E2TH 4KRPB 4Z6AT 3DGCR 5F3HB 5JUEL 3IGAB 2ADGA 3NIGE 1U8PB 1RURL 2NYYC 2FR4B 2ADJB 2I5YL 1YNLH 2FX9L 2YD7A 3HRPA 5ICXB 1YPZF 3VD3A 4HWZB 1S5IL 5GQBA 3W5NA 4Q6IB 2CLRB 4XTRC 3UJJL 3G6AB 1K8DB 1TTGA 3W0WB 1KT2A 1U3YA 4GAYB 3O6ML 1UT9A 1IC7H 1FIGL 3RBGA 5BVJB 4PJHB 5H35A 1S7WB 1GGIL 1RZKL 1YEJL 4HZAA 1CD1B 4PJ9B 1BOGA 3G5XA 5DI8B 1T7WA 4Y4HA 5BCAA 5DLMH 1P5VA 5DHYB 1X5XA 2W9DL 5F71A 1K85A 5FV1L 5IFJA 3U36B 3DUSB 1FJ1A 1S9YB 3RTQC 5CEZD 2FDBP 1AXIB 1EUTA 3JBG7 3WXWH 3IDXL 1NC2A 1NKOA 3RL2B 3ZDZF 3C2AL 3BO8A 4N8VB 4POZD 3MXVL 4Y1AA 3L95B 1YZZA 4HKZA 3GSWB 4Q9QH 3IJHB 4H8WH 2BC4B 4JG1H 2BY1A 1T1WB 5FV2A 4JRYE 2X89A 1EEQA 4FQLH 4P4KB 2JJSC 1J1PL 5GSRB 4IMLB 2IPTL 2D0HA 4UU9A 3RAJL 5JOEA 1J12A 1MQKH 3KYMB 4FQCL 1YEDB 2ADIB 4I2XA 4XCFL 5ESAA 4JO1H 1GSMA 1ZMYA 5C0CB 5LXGH 3LRSB 1DJSA 4IJ3B 4WV1B 1CE1L 5HVWA 5IP4A 5HHVL 3EOBB 1QFWL 5EBGA 3T0ED 3QH3B 3MLUH 4L8SA 4PB9L 4L9LA 1CN4A 1GIGH 4G8GA 3CFBB 3W9EB 5CZXD 3UJTH 4MD0B 3T1FB 1N5YH 4U7SA 1CGTA 4NSKB 4Z77A 4PRIA 5HDQH 2A73B 4GXVH 3T0EB 4LPTA 1J0KA 1P1ZA 3FFCE 4U0RB 4P2CG 3FQUB 4KQ3H 1JK8A 1S9XA 3LKSA 5I18H 1HSBA 3WS6C 4IOIA 2H3NA 1K2DB 3OHXB 3E2HC 5SWSB 1F02I 3PWPD 3UC0L 4TYUA 3S88H 4C56B 4E0RA 4QOKD 3CDFA 4UTBH 3T0XA 4CU8A 3MLZH 3BSZH 5D1XC 5F9JB 5JA9A 2X4UA 4EEEA 3DXAA 4TTDD 1UH3A 2V7HA 4Z7WB 3V6OA 4UT9H 4LSQL 5E7FA 1H15A 4LVOB 3S34L 4YK4C 2ESVD 2AEPH 3VFRB 1DUYA 4UT6L 1JPTL 2C3VA 2EDHA 4NO0A 1AY1L 4DTGL 3S37H 5IR1A 2FHCA 2VXVL 5DJ0B 1E4KC 4M43H 4PJFF 5IUSA 4XB7A 2LQRA 2DLTA 3ZHDA 5DD0H 4NZDA 4AMKL 1H3WM 2AJXL 1MSPA 1HQ4A 1LO4L 3MRFA 4MJID 2ESVB 1U92A 2NY0C 4LASL 3BAEL 4PRDB 4ALAL 1AJ7L 1NBYA 5DZLA 3KHQA 3MRLA 3IAGC 1YQVH 2BDNH 4KROC 4X5XB 5I9QB 3TBWA 2AQ2A 2ZOKA 4YHKH 2CXKA 3RZCD 2ED7A 3TVMD 1NMCC 4YXLH 3T65A 4TN9A 5CJOH 1YN6B 5L88L 4Z7OF 5I8EA 3MLRH 4R7DB 1AXSB 4N5ED 4OZ4A 4OZHF 1KJVB 4IRSC 1TNMA 2VLRB 1UWXH 3MLYL 1CXEA 1EO8H 3AFLA 1JHLL 5CS7A 2R2HB 5E2VL 5CEXA 1G9NL 4W6WB 5HHME 3RZCB 1G7PA 3ARUA 3TVMB 2R1XA 2WUCL 3V0WH 1QBMH 4H5SB 2B1AL 5IHUL 1EEYA 2DQCH 1IC4L 2XZAH 2ADGB 4XPHH 4HMEA 1I1YA 3EAKA 2LAGB 1EFQA 3BN9C 3KYKH 3MRBA 4Y4HD 4FTVE 2P5WA 2H9GA 2D3VA 2DQHH 4EZMA 3IFNH 1KT2B 1ZHLA 2VLME 1NC2D 4X7SL 2D7OA 5H35B 4Y1AD 1KTLA 2B4CH 3K4DA 1MNUL 1BOGB 3G5XB 4NKIL 2Z31D 2LABA 4WCYH 2IANE 3IKKA 5IFJB 1FJ1B 1KBGL 1QSFE 2J8UE 5EIIA 4NN7C 2X89D 3B9KD 3B2UD 5D2NE 1NC2B 5JMOC 5F7UA 4LSPH 3BO8B 3QQ3A 2EKSA 1U93A 1A2YA 4HKZB 1NGXA 2HH0L 2P4AB 5I1JL 1YEGL 2C4FU 4MNQB 2IGFL 5FO9A 1KTKE 4MLIA 4BKLA 4NQCE 2Z8WC 4E41E 1QYGH 4XMLL 4XP4L 4MAUH 4NC1C 4UU9B 4X6DF 3IU4H 4G8GD 1RI8A 4PBXA 4I2XB 1QBLH 5F9DC 4LU5H 5ESAB 2DQGL 1K8IA 2UVEA 4ACPA 3MV7E 4AIOA 4HUUA 1IJ9A 1I7ZA 1L7IL 4PRID 3HHRB 3U1SL 3IAPA 5EWIL 1YEHL 4L8SB 3EFFA 1XMWA 3RUGA 4L9LB 1XZ0A 4G8GB 2E7CA 4JPVH 2EDNA 3DOSA 4W70A 3DVNA 2FHBA 1RIUH 2F5BH 4FQXD 3ZKXB 2HKFH 4Z77B 1N8ZA 3R1GH 3LKPA 1U8NA 1OOAA 4PRIB 3FOLA 4JN1H 4G5ZL 4QRSA 4Q58C 4QXGH 2BOCA 1RQ5A 4U1GC 5FYKU 4QHNA 5ESQA 1N26A 4IOSD 3TBYA 1P1ZB 4GMTL 3DXAD 1BMGA 5AG9A 1T03L 1KB5A 1WV7T 1JK8B 1S9XB 3LKSB 4H1LA 4LIQE 2QHLA 5EUKB 4FFZH 1HSBB 3QIBC 4FG6D 4IOIB 2C1PA 1EV2E 2H3NB 2IPUK 1WSST 4K2UL 4E0RB 3TT3H 4F3FA 1XF5A 4NQSA 1U8MA 4NO0D 1HHJA 2X4UB 4S1SL 5HDLA 1CK0H 4DN4L 3DXAB 1JYXA 2FGWH 5JHLH 1YJDC 2V7HB 4GG8A 5BRZE 3FRUA 4LK4A 2AJUL 1H15B 2NY5L 2CIKA 4R4BB 1DUYB 1FL6A 3OB0H 2C3VB 4NO0B 3LPGA 5IR1B 1KTDA 4C83A 4GW5A 3VCLA 1U8JA 4UOJA 3ARDA 1MFEH 1F00I 3UYPA 3ILPA 4ORGA 5T3ZL 4G6AC 1CLOL 1ZVYA 1HQ4B 1KSRA 3MRFB 4Z7UE 5KVFH 1U92B 2EYSA 1SY6A 1ZSDA 2HT3D 3UYRL 1YYLH 2DIAA 1NBYB 3H6JA 1EERB 3MRLB 3UAJC 5GXBB 2F19L 3TBWB 2ZOKB 1K6QH 1FYHB 2OCFD 5DJ8A 4NT6B 4HMDA 1G7LA 3BKJH 3I3EA 5T1LD 3MBXH 2E9IA 5GRUH 3AM8A 5I8EB 3O8XC 3KLHD 1RZJC 4OZ4B 5F21B 4OZFA 3F5WA 4U1LA 4KUCD 3CMOL 4XBEL 1YC7A 5E6YA 5CEXB 2ZPKL 4G9FA 2P5WD 1G7PB 2MCPH 2R1XB 3HI5H 5GISL 4J1UB 3LD8B 5T3ZD 1CICA 1IBGL 3GIZH 4TNVF 1FVDA 1EEYB 4NZUH 3NA9H 1I1YB 1JF6A 2APFA 3I85A 5EO9A 3ULVE 3MRBB 4KJPD 5F3BA 2P5WB 3AC0A 1QHOA 4U49A 1TJIL 4M9OA 5IG7A 1WCQA 4G43A 3QIUA 2AK1L 1ZHLB 4LDOB 1MJUH 2WAHA 3QWQB 3NIDE 1W8NA 4RMRA 3OB8A 1KTLB 4DZBB 1GGYA 1I3VA 1A7PL 5GS1A 1N4XL 3X12A 5B21A 1MHPL 2QHRH 5GHWL 5EIIB 3VWJA 1F4YL 4N8CL 1LO0L 4PV8A 2QQKH 1CBVH 5I17A 2BVQA 4BZ1H 5GZND 3BMVA 1U93B 3BD4A 1MF2L 1A2YB 1NGXB 2GTZA 5JQ6L 3QAZC 4JKLA 5JDSA 5FO9B 5KSBE 2IG2L 2ZUYA 4JFPA 5D96B 3TJEL 4KJQC 1NBVL 2YK1L 1YN7A 1MLCA 3QCTH 4UILH 4BKLB 2N56A 4OSUL 2HFEA 3SPVA 1MVFA 4HLJA 4OZIE 3D1MC 5GGRY 5SX4H 1FORH 1K8IB 1FNAA 4GRWE 5DJZA 3UMTA 2BNRE 2Y5EA 1QNZH 1RUQL 4HUUB 4R90H 1AI1L 1I9EA 1I7ZB 5C2UB 1P2CA 2J4WH 3IETA 4H20H 3RUGB 4YXHL 3EFFB 4P4RA 4WRLA 1XZ0B 5EDXA 5C7XH 1HH9A 5CD5D 3L3IA 1KCRH 3ULVC 1SY6L 3DVNB 5FDWA 2ZNXA 4XMPH 3OKOB 1N8ZB 1QBBA 1NAMH 1U8NB 3LKPB 5D5MA 5K9OA 2W1NA 1N7MH 3FOLB 4QRSB 2BOCB 3FMGH 1A8JH 4QHNB 5ESQB 3TBYB 1T2XA 3BESR 1GH7A 1KB5B 1P6AB 4JREC 4H1LB 3PHOA 2YA2A 2C1PB 4U1NA 1YY9C 1H9VA 3V5KA 2ID5A 3MGOA 4WWKA 4I48A 3W11D 1T5WA 4ENED 4JO4L 4F3FB 3WJJC 1KFAH 1XF5B 4NQSB 1U8MB 1HHJB 4O51A 2VLKA 1I9IL 2QADC 3MOBL 3CFDA 4OIIL 2ICEA 4GG8B 4JCMA 1UWXK 3FRUB 1JGUL 4QNPE 3HMWH 1DFBH 1H3TA 4OUUA 1KLFA 1IE5A 2CIKB 3BYYA 4NM4L 1FL6B 2EDDA 4JM4H 5AEAA 4XNYL 1V3JA 4PJCF 4CVXA 4C83B 4GW5B 3VCLB 1U8JB 2DQUL 4PJBE 4JFDA 3ARDB 3AGVA 3ILPB 4ORGB 4WFHD 4DQOH 1J5OH 1OAQH 4EVNA 2EYSB 4QRQA 5J7CC 4PG2A 1ZSDB 1RHFA 4UBDD 1OQOA 3EOAA 4X99A 1FV1A 1NGWA 3RBSA 1DL7H 4D3CH 4ERSH 3ARBA 1F4WL 1PEWA 4D9RD 1F13A 3SEPA 3VRIA 3B9VA 4G9FD 5CINH 5DJ8B 5EZOL 1G7LB 2DBLL 1P5UA 4MA8H 4XXCA 4UTAL 4PLNC 1CICD 4LL9A 1A5FL 1V05A 3SQOL 1KPVA 4P3CL 1UZ6F 4OZFB 3F5WB 4U1LB 1GGBH 5DS8A 4G9FB 4Y5VC 4P2RE 3WFBH 4WWID 3M8OH 2OR8A 3H9SA 3WD5L 1MCLA 1CICB 1NGZB 1FVDB 3NMEA 3C09B 1R0AH 5E4EB 1HYSC 2JIXA 1WQVT 5J8OA 1OW0C 5EO9B 5DVKA 3RVTC 1BFOA 2ENSA 3IFOA 2AEWA 3EOTL 1RZ8A 2N7AA 1BZ9A 2D7TH 3OR7A 5IG7B 5HI5C 4MB4A 4G43B 5D7LE 3VWJD 25C8L 3QIUB 2YZ1A 3O4OB 4YLQT 4Z7VF 4OD2B 1KIUA 4YHNA 5GS1B 3WJLA 4UAOB 3X12B 2LTQC 2Z4QA 4JR9H 3BUYA 2VZTA 4UT7H 4M7JL 5I16A 3VWJB 1GXEA 3S3JA 4MQTB 4LSUH 1JHKH 4PV8B 4XGZA 5BV7L 1NLBL 5I17B 2BVQB 3EJYD 5JW3H 3AY4C 1MY5A 2EDWA 4ZUWA 2GTZB 3UJIL 4JFFA 2XI9A 5JDSB 1BX2A 4GKZA 1FYTA 2R56H 2VL4A 3UBXI 4JFPB 3TO4A 3ZKNC 1I1AA 1PKQA 4RIRA 2MMXA 1YN7B 1MLCB 2HFEB 4OQTA 4HULB 3SPVB 4PB0H 4AIZA 1WUNT 4NQXA 2AABH 3U0WL 3FO0L 1A0QH 4KTEH 4KDTA 3P0VH 1WWWX 1QFUL 2ZUUA 1S78C 4FQ2H 5DJZB 4KKLD 2FX7H 4Z0XA 2NY2C 4PJIA 4LEOA 1P2CB 5F7HA 1I1FA 2CO6B 35C8H 3IETB 4K8RH 4OCNC 3UPAA 5IESH 4P4RB 1WAAA 5KANI 2ICWA 3BPNC 2C5DC 1A7NH 3HRZA 1WISA 1HH9B 3L3IB 1YYMH 3A6CH 4QGYA 3W0WE 3C08L 4PYHA 3NBNA 5TPWH 1R3KA 5FDWB 1EEUA 2EDLA 2ED9A 1ADQA 5C0AD 4WWKD 2ZG2A 4PJHE 5I71C 2ZCLL 5D5MB 4KRMB 3NZHL 5GZOC 3VFVA 4U7KA 3BIKA 3CGTA 5D7IF 2VLKD 3CH8A 3Q3GA 4JFXB 4YXKL 4KI1A 4MHHG 1E27A 3PHOB 5D8JL 3S5LG 5BV7B 5L8JB 4KZDL 4CN6A 4LMQI 4U1NB 1KXQE 3V5KB 3GMQA 3MGOB 4WWKB 4I48B 4NUGL 5AYQA 2DIBA 1T5WB 1CDHA 5DEFA 4DVRL 4KKBC 1BAFL 3C5SA 3CPLA 3LEVH 3CNKA 4O51B 2VLKB 1E6JL 5TFSH 1RIHL 4RZCA 2LU7A 1NC4D 2BZDA 5F7LB 5CEZE 4JFDD 2ICEB 4WUUA 1CLZH 4RWHA 3OWEA 4ZFGH 5BVPL 4X80H 4OUUB 2FBJL 4YBQC 1PSKL 5I8KH 4CVXB 5C0CE 4L3EA 5T3XL 1NGPH 2A9MH 3GMOA 1SYSA 5DJ6A 5J3HC 4JFDB 4GMSL 4G42A 2UY7A 5GRJH 1P84J 4Y88A 4GKSA 1HCFX 1Z0MA 4KMTH 3CZFA 4F33B 3TH2T 4EVNB 5HHXH 5IBLD 5EPMA 3P9MA 4QRQB 4WFFD 3QG7H 1OAUL 1L6ZA 1OP3H 3EOAB 4X99B 1FV1B 1NGWB 3ARBB 5DVOA 2Z91A 5H37H 3VRIB 3NCJL 3HUJA 3SDCC 3RVUC 3T0EE 3N50A 1HEZA 4CGTA 4LPVA 4JY5H 1A3QA 3H9SD 4UIMA 4PJ9C 4Y5YA 2IQAA 1NGQL 5DDHB 2Z35A 3P0YL 1KPVB 1IZKA 2WBWB 3SGKA 3TPUA 5SWSE 3QULA 2JIXD 3RKDD 2O5YH 4C56E 4I5BB 2ZSVA 3NCBB 1YMMA 4QHKJ 1DANT 1P7KA 2JE8A 5DS8B 5T3XD 4DGVL 4V1DA 4OQTL 2KKQA 3RA7H 3QEUA 3HNSH 1I9JL 1G0YR 3RWDA 4Z7WE 1T7VA 2VXSL 1SHMA 4M6ML 5I1HL 2JIXB 4K3DH 2B1HL 3UCRA 2JLLA 2PW1A 2F8VA 1BFOB 3IFOB 1RZ8B 4P4KC 1BZ9B 4NBYB 3OR7B 1A6UL 2O5XL 5DT1H 4ONGH 5DFVD 1KV3A 5CBAA 1H3GA 5D70H 2WV3A 5DUPH 5IJVA 4PJXA 1NBZA 4IJ3C 4KHTL 4YHNB 2ESVE 1ADQL 3F6IA 4JFFD 2O5ZH 2Z4QB 3BUYB 4LHQB 3EDFA 3QXDA 1FYTD 4U05A 3TO4D 3V8OA 5I16B 2E7BA 4NNXA 1XT5A 1IGIL 4LP5A 4MXWH 4XGZB 4DKEL 1EVUA 4X5WA 2B20A 4ZUWB 4KKAD 1AXTH 4S1DC 4JFFB 3OL2A 1WVZA 1BX2B 3IFLH 5DJDB 4GKZB 1FYTB 1T1ZA 3TO4B 4JHWH 1I1AB 2DL2A 4HS8L 4RIRB 4U0RC 1MREL 1KNOA 3TN0C 2VLRE 3PF2A 4O5LL 4PP1C 2CKBB 4AIZB 4PGEA 1PX3A 4NQXB 2IFFL 2VQUA 5DK3A 2VZVA 1UB5A 4YBHA 4D0BB 2V2WA 4YGAB 4KVNL 2Y5TA 1RZ7L 5IF0A 4Z0XB 4U7MA 4PJIB 4JQIL 5JOPD 5H37G 1I1FB 3BFOA 1OM3L 5K9JH 1FAIL 2ICWB 2J5LB 5E8PA 5GS2H 2DI8A 1AHWA 3HRZB 4R9HA 1A3LH 4F7MA 5HTSA 2BSED 5GGUA 4NFBA 1R3KB 5L8KB 1VEPA 2H2PD 1FBIH 1B4JL 3TC9A 1U8LB 2PO6A 4TTDC 3VFVB 1RFDL 1IAIL 2FEDC 1DBKL 3BIKB 5IVXA 3Q3GB 3BPOB 4NRYA 1GC1H 4LBEA 1BGXH 3KHOA 3HI6H 1E27B 3LQAL 2R0WL 2NY3D 1JNJA 1CT8B 4WUUD 4AEIH 4ZXBA 3SE8L 4MQ7A 1PVHA 3GMQB 3MJGX 3Q6GH 1IFHH 5DEFB 1TCRA 4MMXC 3WIFA 3HC4H 4G6ML 3C5SB 3BJLA 3CPLB 4MNQE 5FYLH 2NW3A 4L3ED 4RZCB 1MEXH 2NY3B 3VWKD 2P8MA 4WUUB 1ZTXL 3TLRA 4H26A 4OBSA 4G6JL 3Q0HA 2QSQA 1MVUA 4I2XE 1EGJH 3ZTNH 3B2VH 3I9GH 4L3EB 1G9MH 2ORBH 1HH6A 2O93L 4C59B 3GMOB 2Z0BA 1SYSB 5DJ6B 3TVMC 3TYFB 4TNVK 5EU7E 4G42B 2EXWD 3VGGA 3GRWA 4GKSB 4U3XA 3CZFB 4WW2C 4Z0BL 4W6XB 3B3IA 4NO5A 1CFSA 5EPMB 3P9MB 4G8GE 3ULUH 5F6HI 2AJVH 1L0YA 4MJ2A 1ZANH 1UCBH 2QQNH 4Z7QE 1DE4A 3KPMA 3C2SA 5C6PB 4K3JL 4ETQA 2Z91B 1CFNB 2NY1D 2CXGA 4PRIE 2DJ4A 3HUJB 3ZKSD 4N1CA 4OLVH 1HEZB 4WTWA 4NN5C 4UIMB 2EH8H 1DBBH 1CXFA 4G7VL 4Y5YB 2IQAB 4C4KO 2Z35B 2A0LD 4ZSOA 4XC3L 3TPUB 2DL9A 2MHAA 3QULB 2Y23A 1FLTX 2ZSVB 1YMMB 1Q0XL 1P7KB 3QRFM 4V1DB 2NY6C 5GS0L 4UMGA 5TDNA 3DXAE 4I0KA 3QEUB 5KS9A 2DMKA 4Y16A 2UZIL 3RWDB 4JY4A 1TETH 3V6OE 3ARVA 5KVEH 2JCCF 5I8OH 5E6IC 3MLSL 3ZTJH 4AQOA 4TVSa 2PW1B 3SCMA 4KXZI 4P9HH 2DJUA 4LP4A 4R26H 2R0LL 2IJ0C 1E6OH 5IMOA 5IQ9A 5FEBA 3TP4A 4Z7NF 1BEYH 2QL1A 1HWGB 4HIEA 4IMKA 3BKML 5CBAB 4NKQB 4PJXB 1NBZB 5FUOL 2P5EA 2ILLA 5J11C 5EU7C 4XI5C 4HG4J 4QHMA 3QXDB 5CILH 4PJGF 1OPGH 4L8SC 1BHGA 3AS2A 4NNXB 4L9LC 4GOSA 4ZTPH 4BK4A 1Z2KA 1QEWA 3S6CA 2YD6A 5GS0D 4X5WB 1G7IA 3ZKXC 2OL3H 3U46A 2PR4L 2D7PA 5CP3H 4S1RH 1T1ZB 4OTXL 4UI2A 1CFTA 1KNOB 1U6AL 2B5IB 5JIKA 5IGXH 2DQDL 4PGEB 2BVOA 1ZHKA 2LVCA 4DW2H 5JZ7D 2EEBA 3I6KA 1UB5B 2F58H 3NVQA 4YWGL 5K9QI 2V2WB 3WNLA 3FO1B 4DN3H 1PJ9A 1A6PA 2Y5TB 5IF0B 4JKKA 4G7YL 3WHE0 2XRAH 2PO6D 2BNUA 4DKFL 2EC9T 4NZRL 3QXTA 3V6OC 4FG6C 2P5WE 5E8PB 1AHWB 3GRWL 4F7MB 1OT1A 2CUMA 4K23H 4R6UA 3WNPA 4DUVA 5T3ZE 3SKJL 5GGUB 4RWYL 4NDMA 3BZ4A 1W72A 1MCPL 5JORA 5IWLA 4FQQA 4ONFL 5D1QA 1B88A 3L5WA 4W81A 1PGRB 3TFKD 3EO9H 2PXYD 3MLVH 4JFHD 5MERA 2PO6B 4CDGC 5IVXB 3OJMB 4LBEB 1OP3K 1KCVL 1H3PH 4JRWA 1ZLSH 4RFOH 2DM4A 1KJ2L 3HFML 4ZXBB 4NFDA 1QVOA 1IGTA 4MQ7B 4ODHL 3ZTJG 1KN2L 1UG9A 2DQFA 1R24A 1TCRB 3WIFB 2YD9A 3MC0A 3Q2CA 5H2BA 3UTQA 4WI8A 3KGRA 2XN9A 2EIDA 3MLXH 5INCA 3N06B 2XQBL 5AZEH 1CXIA 2DLHA 1PBYA 2P8MB 3DURA 4KI5E 5T1DL 2Q8AH 4NHUA 4HKJA 1JZ3A 4H26B 2VB5A 3QXWA 1T2JA 3BGAA 4P59L 2HLFD 1MVUB 4B53A 4JM2F 3RY6A 2BVPA 5HXMA 3BHBB 2HAZA 4K71B 3V4PH 5E8DH 1HH6B 1BQLL 4WHYH 1G1CA 3SDAA 3LD8C 1A7OL 1YEIL 4L4VA 1DQDL 3RUGE 4PJ7A 1QLRA 1EH9A 2NY5C 3B3IB 5J12B 4NO5B 1CFSB 1FL3A 1WITA 1WIUA 2BSSA 1MRFH 4MXVF 4M4PA 3MXWL 5JR1H 1KCUL 1DE4B 3PDOA 2X6MA 1P4BH 4JZJC 2IMMA 3VD5A 4ETQB 5IW3A 4UB0L 1BQSA 3CVIL 3O2WL 3OSKA 1G7QA 3IKCA 4PJDF 6CGTA 3U7YL 4J4PD 4P23D 4D0CA 1CGVA 3L3HA 1CFVH 1JRHL 4XPTH 4O2CA 4Y16D 5FGCB 1CLYL 4ODVH 3QHZL 1NSNH 4ZSOB 4KJPC 1F3DJ 5DD1L 2MHAB 4KHXH 2HMIC 5C0BD 3QZWG 3SCMD 2AI0L 4MAYD 5D7SH 3IDGA 1ZEAH 1QSED 5D2LF 4M62H 5TDNB 3DHMA 4LCWA 5KS9B 1U95B 3FO2A 5FUZH 4Y16B 2HRPH 4JY4B 1V3KA 4BQ9A 4Y0GA 4YHLL 3BP6B 5F1OB 3SCMB 4KI5C 3DO3A 3ARPA 3FTGA 2D03H 4I3RH 5IMOB 2Q3ZA 5IQ9B 5GZNC 3P11L 4HIEB 3HNTH 4KK5C 4HT1L 3SDDD 1XF2A 4DUWA 1W72L 3LZFL 3N1PC 2P5EB 2UWEF 4RMTA 5D7KD 1NDGA 4N68A 4WI6A 4QHMB 4N90D 5TGBA 5F44A 3RIAK 1QEWB 3SE3A 4OCRH 1G7IB 1MFCH 2EE9A 3ZYIA 1KEGH 1TZIA 3CU1A 1LHZA 5FYKH 2BCKA 4X9IA 1WGOA 2VUOA 5JMRA 4YEFA 3U46B 5C08A 5DEGA 2X1WL 1KJ3H 4WHYG 12E8L 1GGCH 4EI5A 2FATH 4X5LA 2CQVA 3AROA 5ESVB 5A2JH 5CD5C 1ZLUH 2FBOJ 2VDML 3GMNA 4YFEA 2EIBA 1N2RA 4G9FE 2BVOB 1ZHKB 3WNOA 1X9QA 5FHAH 2R4SH 3I6KB 4F15B 4BK5A 4HHAA 5LG1A 5D1QD 2ZUSA 1G6RH 1JWMA 3LRGA 2EE2A 1ND0A 2ZUQB 5C6TH 2BNUB 1YECH 5KVDL 5E2TL 4YDKH 4RMSA 2R4RH 4JFQA 1FNGA 4ENEC 1Z3GH 3BZ4B 3A6BH 1W72B 5JORB 1LGVA 2BXZA 1MAJA 4FQQB 3MYJA 4IS6A 1NCWH 4ZO8A 5D1QB 3VFNA 4E9LA 3L5WB 4U1IA 5A2FA 1G9EA 5MERB 4NJAH 1UYWH 5CBEA 4CADA 3ARDC 3BP7A 1P7QD 4Z95H 5I19L 2FLRT 2H1PL 2XN9D 4K9EL 1H3VA 4IIQC 4O2FA 2EZ0C 4MS8C 1QVOB 3BWUC 5DLML 1IGTB 1J0HA 2E9JA 3QPXH 4XCYA 2R15A 2DQFB 1Y6NR 3T3PE 3VD4A 3WXWL 3HE7A 5H2BB 3UTQB 3VMOA 2GKIA 1C7SA 2QLVB 2XN9B 1DBMH 5INCB 2OTUA 2EIZA 1R5IA 4FZEH 4Q9QL 3DURB 3SDAD 4E5XA 4NHUB 4UBDC 2Q87A 4HKJB 1QA9A 3ARFA 4JG1L 2DF3A 2BVPB 3UEZA 3UJJH 4ZODA 1DEEB 2Y36L 3O6MH 4WTZG 5TE6H 3ZLQC 1FIGH 3KPOA 3SDAB 1KGCD 1VACA 3H8NA 1CICC 4JO1L 1RZKH 4L4VB 4PJ7B 5DUMH 5LXGL 3C09C 1QLRB 5E4EC 3VGFA 5BS0D 2BVEA 2W9DH 2EYTA 2BSSB 3BDBA 5FHBH 4U1MA 3MLUL 4ODTL 3PDOB 1YPZA 4P5KA 2WLYA 3IDXH 3GEWB 4K7PY 1J11A 1GIGL 3NFPA 5D5ME 5D93B 3QIUC 1G7QB 3IKCB 1IKNA 3UJTL 1U0QA 3TNNA 1AO7D 4D0CB 3VDAA 3O4OC 4L8CA 3SO5A 1NFKA 3L3HB 3QDJD 4LCWD 5HI3D 4O2CB 5GS1C 2CUIA 4UAOC 4OUOA 4U1JA 4OM1L 4Y4FA 2IC2A 3NIFF 3W82A 3WN5A 4OCWH 2Q1EA 1J1PH 4KQ3L 4PGCA 5I18L 3IDGB 2VLKE 4Y89A 2YD8A 3EIFA 4OV5B 1CQKA 2AJYH 1FGNH 5EO0A 4NRZA 3MQIA 3L5XL 3S88L 3FO2B 2RAMA 4U1HA 1AE6H 2JELH 3CIQA 2FIRT 3EYQD 4UTBL 4RISH 5ICYA 3HE6B 1RZFH 3BSZL 1WZLA 1T83A 4XHJC 3LS5L 4OZGF 3ZE1F 3FTGB 1S3KH 3CFKA 3NIGF 5BJTA 1OTTD 2AEPL 4JFDE 3EO1A 4R7NA 3DSFL 5ABDE 2CRYA 2KL6A 3UP1A 3S37L 2XWJA 1XF2B </