1RZ8B

Crystal structure of human anti-hiv-1 gp120-reactive antibody 17b
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
228
structure length
228
Chain Sequence
b'EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 17b light chain
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rz8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rz8B01
3BPCA 4H0HB 1NJ9B 2QTEA 3LQAH 3VWKB 4IEFB 4JRYE 3BGFB 4XCCL 1Q38A 4OZFH 1DN2A 3VXSE 2EDWA 1JPGB 2CXKA 1YMME 4PGJA 4Y4HA 1D5IL 3LS5L 3GHBL 4ZUVA 3STZA 3P4MB 2J6EH 3NOIA 4JFED 4RQQA 1JNLL 4WHCA 5I30H 4BH7B 2OI9B 3ZKMD 4TUJB 2KZWA 1OF2B 1YDPB 1HQRA 3RWEB 4H1LA 4ZYKA 3K81A 5IMOB 1U92B 3WIHL 4XNYH 1KF9B 2H8PA 1EGJA 3MFFA 1A21A 1KLUB 3HC0A 4JR9L 5L0QB 2PTUA 4OLEA 3K7UA 2XG5A 2LFGA 3RWDB 1CFTB 3M1BB 2OCFD 1I8LC 2MPAL 3HAEG 3OGCA 4LLUB 1T7XA 5DJXB 4Z95L 5J0BA 4CBPA 5L88L 1NBVH 4HIIA 2VQTA 3Q3GB 3CK0L 2NXZB 1JWSA 1F4HA 4F3FB 3CX5K 5D1ZB 4MJIB 5J11C 4JHAH 2FD6H 2VWEC 2X1WL 4L8DB 3O8XA 5DLMH 3FT2A 1OAXH 4MCYB 5C07D 3VD9A 1D6VL 2BX5A 3NTCH 1J12A 1RD6A 5I71B 4UT6H 1I75A 3S5LA 2WBJA 5IWLC 2B1HL 2ZOKA 4KXZI 5DD0L 3KJ4B 4AM0B 2VXTH 2P44B 3ULSA 3BOVA 2ED9A 5GIRB 1FYTE 4HW6A 1A4KA 1FL5A 5HDQL 4CVXB 3U48A 4HDIA 3QEGL 5I8CA 1T7ZA 1WC7A 4URTB 4U1LA 3AS2A 4J6RL 4KTDH 5D5MF 1KOAA 3V4PL 1NLDL 5D7IF 4HWEH 1AGCA 5IW6A 3OZ9L 4Z7OF 4F7EA 4HWUA 2H1PH 4ZFOL 5B3JF 1TETL 4QWWD 2NW2A 1QD0A 3H9YA 3ESVF 1EK3A 2WWMD 3HUJE 3VXRB 4S2SA 4YFEA 1JZ4A 3T2PA 2P7TB 1HSAA 4WNQA 4QHMB 5CFHA 4JREC 2YD8A 3IAPA 1C08B 5F9OH 2LTQC 1GC1L 1N59B 3H6JA 5IEHB 2LE9A 1KJMA 4G6FD 4KPHL 5C0DB 5MERA 3ECBB 2K3TA 1X5LA 3LS4L 4YDKL 4Y1AE 5C0EB 1TZGL 3JWDL 4D9LH 4E41E 3V5DA 3MRFA 1WWAX 1NSNH 1U58A 3GZKA 5HGBB 1C5CL 3ZSSA 4Y2DC 2A73B 2EIBA 5IUSA 3RVVD 3DO7A 3LEYL 4P9HC 5C2BL 2X4UB 1BOYA 1KB5H 2GJ6A 4UB0H 5CGTA 5KTEH 4JG0H 3V6OE 1M71B 4XC3H 3G9AB 4GBXC 1N8ZB 2JELL 5TE7H 4OCWH 4LEXL 3W39B 1SYSB 1GZQB 3AXLA 1CS6A 3FQTB 5BXFB 4HKXB 2W60B 4EDXA 1RZGA 4ACPA 5L6YL 1FO0A 3HNSH 4FTVB 4K3EH 2AAVA 3KPQA 3VXUA 2AXJA 1NC4D 4DOHE 4QXUH 5CP7B 2IADB 5ESAA 5D7SH 1JZ2A 3OG4B 4HIJB 4LF3A 2HTLC 4BK5A 3EYOB 3O3UN 3BP6B 4PJ8C 4TTDC 2W65A 2CKBA 1C16A 1C5DB 2DIAA 1FZJA 5HD8C 1BAFH 2XZQL 2NY0B 3CIQA 3U4AA 2NY4D 5DFWH 2YPLB 3P4OA 5EZIH 5SX4I 4Y88A 1LDPH 4M43L 1TQBB 1GAFH 3PQYB 4O2EA 2DQUH 2W38A 4IS6B 3KPPA 2OL3H 4WV1A 4XPBL 5I8KL 1D9KA 3V6FB 4U6HA 5F1SA 3MOAL 1JPFB 1U8MA 3BUYA 2EYRA 1N26A 3BPOC 1I8IA 4Z5RA 4KI5D 3SKOA 3IFOB 3BDBA 1FORL 4ORZC 1Z5LB 4GO6B 1HWHB 3LCYA 4FABH 2XRAL 5ANMB 1T83A 1QSFA 2RFXB 4OM0H 1P6FA 5JHLH 1XGUA 1C8PA 1O5DT 4HS6A 3QIWD 4FG6C 4IDLA 1WZ1L 2V5SA 1A7PL 1EBPA 4MQXD 1ZE3C 1WBYB 1TQCB 1XF5B 3MBEA 5ESVA 4ZAKC 2GTWA 3B8YA 5TPWL 3TN0C 4PJAE 3EYUL 2ZNWA 3GBMH 1NFIA 2JJVA 5LWYL 1URLA 3R06B 1MWAL 4LRNL 4ZO6A 1LO5B 5EC2B 1NDMB 3H9HB 5I1DA 2YWZA 4Z7UE 4AIZB 5L7XH 3SO5A 4CMMB 2HFGL 3GSXA 2OP4L 4JFZH 1JPSL 4KRPC 1U3JA 4L8CA 4MMZC 4P9MH 4P9HH 4PJIE 1IL1B 1CFNB 1FV1B 4X7DC 4LVNC 4M6NL 2ZG1A 4LMQE 4L4VD 1Q0XH 3DHMA 4KK5C 4Z7VE 4YQXH 4QXTB 5C6TL 1D3CA 2AS5M 1JIBA 2R2HB 1EEZA 5DEGA 3V95A 3V6OC 1RPQA 1FE8H 4KKLC 5D1XB 3OXRB 4YIQB 5FGRA 1BX2B 3I75A 4H5SA 2XQBH 2Z8SA 3MLVH 2HT4C 4Z9KB 3MGOA 3KYKL 3MRCB 1ND0B 4KTEL 5JOFA 4HCRH 1PD6A 5KVDH 3BP4B 3HZVA 5F7YC 3VGEA 2AABL 1GIGH 1KENH 2V2XB 5SWZD 3L5JA 1UXSA 4RIRB 1JGVL 3KG5A 4FQXB 4M7KL 5DUPH 3PDDA 5I0ZA 5EU6A 4LDLB 1I1YA 2F9BT 3T1FA 1P7QB 4R3SB 3G5ZB 3BVNB 3VRJA 1YC7A 2DTMH 3VMOA 2R2BB 4MD0B 3GSNB 5C09A 1QR4A 1WIUA 2ERJC 4L1DA 5GGQL 3BKML 1FFPA 3M17B 3D3VE 4FP8H 4OZFG 3ZE2F 4KRMB 4OM1H 1X4YA 15C8H 1TITA 3RGVB 5FGBC 2BC4B 4PJEA 3QXVA 2NPLX 2PYEB 3V7AG 4HWBL 2H6PA 2R2EA 4F7CA 4ZTOL 4HGMA 1MFBH 3C8HA 3FO1A 1HH6A 5KVGL 1TVBA 4O4YL 1B0GA 4PJBA 3H2WA 4FZEH 5DQ9A 2CRYA 1IC7H 1U93B 2XA8H 1S7TA 4HJJH 1EA9C 1WCQA 3EJZD 5C6PB 1CGYA 5JORB 3WUWA 5F9JB 1QA9B 2QQLH 4QXGL 4C56E 3NIFE 3RTQD 3WDIA 5IFHL 4F7MA 4LGPB 5GGUB 4WW2C 3NH7H 4ZO8A 4ZFGH 5D7JA 3QI9D 3DVIA 4RWHA 5FUCE 5GRUL 5EOQL 1Y0LB 4N90D 1PBYA 4OCSH 4YK4C 2DM3A 1MJUL 2VSDA 1CXLA 3TH3T 4POUB 3DURA 2EDBA 5FECA 1HHGB 2ESVE 4BQCA 3BAEL 1U8JB 3OXSA 1H8NA 1G0DA 4OSUH 3QQ9C 1JL8A 4XH2B 1A02N 1CT8B 3MRPB 3BZFB 1AXTH 2C5DC 1ULVA 5C0GA 4PGCB 3W81A 2P5EE 3DX8B 1I1AB 4EN3D 5TDOB 5HJ3A 1JTTA 3O3EA 3HI1B 4NRYB 1AD0A 3RUGA 5KVFL 1QFWM 4KDTA 2K9UA 1UH2A 5DC4B 3ZO0A 1F42A 4PRDB 4PREB 3SDDB 2QLVB 1TLKA 4PLOB 1XF2A 1YY8A 5IOPA 4I9WD 3QHZH 1JTOA 4MD5B 4PRHD 3VFNB 2NX5A 2EDHA 2DLEA 4L9DA 5HGDB 3HMWL 1QO3B 1DQQA 3O41B 4H88H 4P5TB 4Q2ZA 5CGYD 2QV2A 4CGTA 3OKLB 4HFUH 4C83B 3BIBX 2XWTB 4LEOA 4TUKH 4PJXF 4K3GA 3G6JF 5C1MB 1QBLL 1XGPB 1CFVL 1LK3L 2KH2B 2XN9D 4JFQB 5GSVA 3BFOA 4I8DA 2NNAB 4BQ8A 3DV6B 3Q0HA 3DRQA 4YAQB 4GQPH 2Y72A 4X5WB 4NQXA 2ICEA 4PP1D 2VXQL 3K8LA 1KCSL 3E2HC 1U8NA 3WUZA 3N1QC 3UO1H 2AV1B 4AQOA 5BO1H 3WKNA 3C60A 4DEPC 3WMSA 2ZUQC 1X5AA 3MV9A 5D70H 4CRPA 2VZTA 3OG6B 5TE4L 1AY1L 3P11H 2B4CC 3QUXC 2LU3A 3QNXA 4CU7A 4WHTB 2I9TB 2ILLA 5F96H 4P2RE 2QSQA 1CIDA 1AXSA 4QNPF 1IAOA 4AYFA 2C26A 4YXKH 5J3HC 1HXMB 2JLLA 3PHQB 1I4FB 5E1HB 2VLMD 2EEAA 2EKSB 1I9RL 4KROC 3S4SA 4JN1L 3T77A 5EO0B 1KT2A 1BF2A 2ARJQ 8FABA 1ROWA 4K8RC 4ELMF 1E4KA 4ISVB 5SWSE 1I7UA 2HG5A 3PWNA 4JFHE 1T1YA 1QSEB 3N9GL 3WS6A 4IJ3C 1I85C 2PCPA 3L95B 3V0WH 3VXMA 3QFJB 5FO9A 4UIMB 3MRDB 4HWZA 2NY2B 5E8NB 1Q72L 4LPVA 1T6VN 5ABDE 2AEQH 1VESA 5BZDA 2F8XC 3WXVL 3CXDL 2W0KA 2ADFL 1PYWB 3PXJA 2XT1B 2IFFH 3F7RA 1EAPB 4J4PC 3MA7B 3EO9L 3FOMB 2Z92B 1U8HA 4JJ5A 1S9VA 2NXYC 1A6WH 3KPRA 5GGTL 1F6FB 4OGAC 4GMTL 3RVWD 3SKJL 5KANI 1YQ2A 3C5JA 4NRXB 4QRRE 2R23A 1LO0L 2BHZA 3HMXH 4X6DF 2BSSA 5TQ0H 3L3DB 1FNHA 3PG2A 4PGDB 3IXAB 3SGKA 3HHRB 2L7JA 5D2LF 2OTWA 5KN5A 3O4LE 5F93C 1L0YA 1D5BA 1SJEB 5KW9L 4NNXA 3IFPB 2Y36L 3MODH 2DBLH 3WLWD 1RZFL 3LH2H 3T0EA 2YZ8A 3TNNB 4ONFH 4R0LC 2LU7A 3QBTB 3KNBA 4KVCL 4JM2B 4L4JA 3SOBH 4LVHB 5F1KC 4HUKB 4JKLA 4N5EC 5BOZG 4PJDE 3MYZA 1U8PB 1OTTC 2L0DA 3BZDA 1RZ7L 4FQHA 2C4FT 3BO8A 4OF6A 1CF8L 1DQMH 4OLYL 4I3RH 35C8H 4I48A 1AQDB 4Z8FH 5AYUH 5A16B 1R3HA 3TBVB 3IGAB 1RI8A 3WLBA 3AY4C 2R9HC 5FHBH 1C5BL 4PV9B 4Q6IA 5DTFB 3IFLH 4G8IB 5JXAL 1QOKA 4S1RH 1MCKA 1FFNA 1BVZA 3VWJA 1N7MH 1NEZG 2EH7H 2YD6A 2EXYD 3QWRD 3GJEB 1OGTA 1XT5A 5F70A 4J3OC 3MROB 4ZS7H 1CZ8H 2B4CH 4Z0BH 1V3LA 2W1NA 5F72S 4XP9H 5JR1L 1IM3A 4HQQL 5EOTB 2CPCA 5ADPL 1IGYA 4WEMB 3ROLA 3MGTB 3AVEA 1OARL 2CLZB 5FKPA 3PWPB 3BIKA 4FQIH 3F7YA 1IC4H 2CGRL 3LMJL 4PRPA 2YK1H 1WEJL 1A9BB 5E5UB 1RAMA 4XMLH 4CJ0A 2K1MA 3MNVB 4F9PC 2DQJL 4K8RH 3Q1SL 3BWAA 4CW1A 1YNKH 4YHLH 3D6GA 2FEDC 3LQZB 3DTXA 2UY6A 4XHJD 3D85A 4Y4HD 2BP3A 2GW5A 4ZUUB 2VSCA 5DRXB 2FX8L 3QG7H 4JFXA 4P59H 2VH5H 3A67H 2Y23A 3BESR 5E8EB 1KJVA 2I5YH 3RVUD 4PS4H 1J05B 5HBBA 3GSUA 5INDB 4XB7A 5C07B 3GO1H 4K7PY 4U6TA 2UZIH 1ETZB 2WQ8A 3SDCC 1JV5B 4BKLA 5BVPH 1CFSB 3EHBC 3TYGH 2VLRB 5F7DB 3NA9H 5EZLB 5E6YA 4O2FB 3WSQL 1PLGH 5J1AB 4YHYC 1EJOL 2EDDA 1J0IA 3BIAX 5CKGA 1E28B 1YPZF 1KBGL 4M4RA 4TVPL 4LAJH 3HE6A 1T89C 1OW0A 4PG9A 1DUZA 1YC8A 3BD3A 4YDIH 3B9KA 5IF0B 2ZG3A 4Z77A 5I1HL 4OZ4B 3O8XD 5I73C 3LV3A 2FJFA 5FAAA 5EUOB 4LQ1A 4PRIE 1DBJH 5IHUH 1QLRB 1K4DB 4I2XE 3QEUA 4JPWH 2WBJD 3WS3B 1IKFL 9CGTA 4EZMA 2CKBL 5D1QB 4M1DH 4NNYB 1JYNA 4U6YA 1G9ML 1K3ZA 2YC1A 1HHIB 5DGQA 4G6FB 4LNRB 4PRNB 1CLOL 1RJYA 3AU1B 2C7UB 4ZPTA 1DCLA 5J1SC 4ZDHB 3MX0A 1T2QL 3LOWA 3D18B 5JTWA 4OLWH 1OP5K 3BW9B 3MLZH 5INCA 2DQCH 5J13B 4WW1B 4HIEB 3L5HA 1T3FA 4J3WA 3KPOB 2C3VB 4O51A 4N9GB 4LRIA 4ZUTA 4GRWE 3OJVC 4YHKH 4WCYL 5I1JL 1IAIM 1QYGH 3DMMB 4G7YL 4K7FA 3W2DL 2ZCHH 4MAYC 3AMLA 1M05B 2MKWA 1I1FA 1KTLA 4YE4H 1NCWH 2ZUVA 4ELKA 3BX7C 1KNOB 2DWEB 3DETD 1DQJB 1ZHLA 3UPCA 1MCJA 4PTUB 2YUVA 4YJZL 5JIIA 3C2AL 3WXWL 4JPKL 3CPLA 1NC4B 3R4DA 1ZLSH 5IVZB 2VXVL 3OR7B 2E27H 2DLHA 2EDNA 3KJ6H 2FEEI 4U1HB 1BP3B 2GJ6D 4MNHA 3BD5A 5C08B 4KQ4L 4X6CB 1OM3H 3ULVL 5FA3A 2ICCA 2PETA 1QVOB 2FX7H 5L2KB 3PWJA 2BNQE 1OWRM 2NY4B 4F57L 3LN9A 4JZJB 4EUPB 4LBEA 2BSTB 4MA8H 3PDOB 2F5BL 4PJAF 2RBLA 5IW3A 1NCNA 2VJXA 1CXIA 5I75C 4L8BB 1AR1C 1BFOB 3VXUD 1B88A 1UB6A 5HGAB 1EUUA 1ORQB 1XGTA 5JIKA 4RA3A 4Z7UF 4GQ9L 1IFHL 2WBWB 3SDYL 3TJEL 1M6OB 1FVDA 1QRNA 2BNRE 3C6LC 1EIBA 2VDNH 1QZ1A 1K4CA 3NCEB 2HKFH 4PJIF 1KPUA 3ZMRA 3GSOB 1T1XB 2BRQA 4Z7VF 4KHXL 4L4TE 4N68A 5BW7C 5JZ7C 5BOPA 2WIMA 1DN0B 2UWEB 5GISH 3F6LA 2YPVH 3HFMH 3EKCA 2V2TA 1BD2E 4AEHH 3ZKXC 1ZGLM 1D9KD 4U1KA 3U9UB 1J8HE 4AEIH 3MTRA 5HTSA 1MNUH 5T1KA 1Q94A 1UWEH 4HXBH 1U8LA 5TFSH 5C92A 2HJKB 2P24A 1SJHA 4JRWA 4PJGA 4M8QB 1QSFD 5FGCE 3RNQB 1NGPL 4XZUA 4LFHD 3QR2A 1K8DB 5IG7A 2A83A 3OGOE 4G9FE 3C5SA 3UBXA 1MFCH 4BSJA 1L0XA 1KJ2A 3CDCA 2XIDA 5I19H 3MBED 1CE6B 3HRZB 3VG9B 2XWJB 4O02L 3OHXA 5GGVL 4XI5C 5FHAL 1JHLL 1MCRA 3MV8A 5DQDH 4HKZA 2E7BA 1UKTA 3QUZC 1Z9MA 1M7DA 1UCBH 1P4BH 2ZCKL 1YYMH 4XCFL 4LPYA 3LDBB 2Z4QA 5CSBA 4DZ8A 3NCYP 2AEPH 4PR5A 3VGAC 1SY6L 3MACL 4NWUL 3S34H 1UJ3C 3TBYA 3OKNA 5DJZA 5SWZB 1R3JB 2R4SH 1CICA 4N8CL 1RFDL 4DGYL 1MH5A 4P2YA 5HDBE 4XCYA 3P0VH 3ELAT 4XBEL 1JHTB 4YBLB 5EO1A 1XIWC 1AHWC 3HAEA 1TJIH 4JEGB 3KPSD 4AIOA 4M6ML 1OAZL 4P46C 2F19L 1L9NA 3VFMA 4X8JB 2GFBA 4H0IA 1DBKH 3WCYA 5J9PB 1G7IA 4YWGH 3ARDC 1XCTB 3HG1B 1WV7T 1W0YT 3DGGA 1BZ7A 4ZFZB 4QRTB 4KZEL 4I18A 5IV2A 1JGUH 1ITBB 3BH9A 2V5TA 4IIQA 5EU6D 4HFWB 4J3TA 3ZDXF 5F1OB 2VDPL 5TQ2L 2W9EH 3KPLB 3W9DA 2BNUA 1JYVA 5C09D 4QRPE 3PGCA 1CLYH 5CKAA 1NCCL 4KJQD 3QI9B 2VR5A 2NYYC 2QADB 2FEEL 5GGSB 1S9XB 1MHCA 4ONHA 1FNGB 3SGEI 3IJSA 3V0VB 1DSFH 5C0BE 5CJBA 2R69H 3E6FB 3FMGL 3QUKB 1AQKL 3EFFB 2J4WH 4ZUSB 3ILQC 4UQ3B 3RX8A 3TBSA 4OV6F 4RWYL 1NH6A 3FB6A 1FLTX 3QULB 1CDHA 4QRSB 1U95A 3EGSA 4UUJA 1QFUH 1T0MB 4RAVA 2DKUA 1AE6H 2P5WA 3BP5A 3CLFH 4TUOA 4X4XA 3BZEB 4L8SB 4EOWH 4Q58C 3T4YA 5DMKA 3KYOB 4RCAA 2NY7L 2O5YH 2GT9B 2OR7A 4QT5A 3THMH 5SV4A 7FABL 1ES0B 2CUIA 1NL0H 4PJ9C 3QXUA 4XCNA 4GRLA 4U1GB 5IR1A 1G6RA 3MJ9H 2X70A 2JIXA 4GRWH 3NBNA 1OTUD 3QFDA 3DI3B 4B50A 4PRHB 1KIUA 5HYSA 4PBWD 1G7PA 3PWLA 2AXFA 1BOGB 1DQLL 2AXGA 3N1MC 2A74A 4DKEH 3FB8B 1YEIL 2X1PA 1EMTH 3REWA 2YPKB 4NCC1 1YEFH 1CQKA 1J1OL 4FXGA 2CH8A 3CDYA 3QPQD 2EYTA 3F58L 1YEHH 4K23H 4JKPH 2CKNA 3MJ8A 1JGLH 4P23C 3T65A 2OJZH 1HHJA 4AZ8A 2IFGA 3N1PC 4YNYA 1NGXB 1LO4H 4K94L 4FXKA 1HYSD 3GKZA 1N5AB 2NY3C 1EXUA 3ZYOA 3T0BA 3DRTA 4YFLF 2NX5D 2QHRH 3S96B 1Y18A 4KI1A 1WFUA 3DJ9A 3BWUC 3G04A 4JFDA 4UBDD 4JY4B 3PHOA 4EDWL 3SCMA 4U1MA 2H9GB 3L3GB 2C1PB 4MAUH 1K85A 1OPGL 1HZHL 3QIBA 4NGHH 1T5WB 1I9EA 1OAYL 3MOQA 4MQ7B 1MCPL 1BFVH 2Z31A 5K9KB 1PSKH 4GXVH 3FCTB 4EI6B 1G7JA 2FL5B 4NP4H 2X9XA 3QH3B 4LLYA 5DI8B 4A6YH 5BJTB 1ZA6B 2X4RA 4LU5H 4LLWA 5BV7B 4OLZH 1JUFA 2Y7QB 3L5XH 3CZJA 5IFAL 5F9DC 3C60D 5CEXB 1CL7H 2ICWB 3B6SB 3BKJH 5CCKH 4UILL 3HKFA 1BJ8A 4LLDA 3MRIB 1GYAA 4FFVD 1KIRB 2EDRA 1GC1C 3MZTA 5HVWA 2NY6D 3ARYA 4OQTH 3JV5A 4OGZA 2BK8A 5BMFH 4Y4FA 5CD3A 4M93C 5DMIH 3JWDC 3KXFE 5EIIB 3TESA 1ONQA 1Z0NA 3DUUB 4JFOB 5D5MB 5FFLA 4XCCH 1NDGA 2X4TB 5D7IB 3ES6B 3DVGB 2F58L 5EZOL 1NGWB 4ODTH 3QQ3B 4FRWA 4I5BA 4I1NB 3EOTL 1NCDL 2HN7A 4HC1A 1FCCA 5EORH 5CEZD 2E6PA 1D5IH 1ED3A 3GHBH 3NPSB 5T3XL 3S35L 1GOFA 2DM2A 3SGJC 2XFXA 2YHGA 5DK0B 5KSVB 4JHZA 1UM6L 3FQWB 5ID1A 5KS9A 4OUOA 1T66D 3E1F1 1GJIA 2VISA 4XGZB 5BZWA 4U0RB 1HCVA 3ZSTA 1FVCB 3GNMH 2WAHA 1MHEB 4L9LB 3WIHH 4NJAL 3UTZA 5BRZB 3VXMD 3MJGX 3DV4B 4JR9H 4M7ZC 3INUL 1P4LB 3VFPB 3VMNA 1NFDB 2GUOA 4PIRF 4HPOH 4XCEB 2IBZX 3DROA 2V7HB 4GUPA 4CVZB 4BZ1H 3KPRD 4Z95H 1KLGB 4KK8D 3FFCA 3GSVB 2XXCB 3LEVL 4DGVL 1S3KL 3G6DH 1O7VA 2QR0B 3QEQE 3SE4C 3EO0B 1AGDA 4OAWA 1YEGH 4ZQKA 1KV3A 1A7QL 4WFHE 4IMLB 4PG2A 3QNYA 3HZYB 1IGML 1X5ZA 1I3UA 5GS1C 3T0ED 5ESQB 4LLVB 4DN3L 1S7QB 2DIBA 4MNGA 3SEPA 1AP2A 4ZXBA 1A3RL 4YDJA 4P5MA 4R6UA 4GT7A 1MJ8L 2VQUA 3ZHLA 3FOLA 3LEXA 5T3ZL 4J6RH 3UBXI 4LSUH 4ODVL 5MEPB 3V4PH 5FF6B 1FL3A 2IAND 1QBAA 1JHKH 3O0RL 1GGIL 1Y6NR 5D71L 1XF2B 1Z2KA 3BPCB 4M6OL 4G8FB 2UVFA 3OAUH 3WE6A 4AENA 2UUDH 3LSOB 3RAJL 2Z93A 2GTZA 4KPHH 4ZUVB 3G5YA 4LSVL 2MQCA 4YDKH 4RQQB 3JWDH 4YFDB 5DHVH 3ZE1E 4GG6E 5DEFB 5E95B 1HQRB 3QZWB 1C5CH 4ZYKB 1RZ8A 2GHWB 3BZ4B 3CAFA 4K3JH 4BJLA 1CGTA 3HC0B 1MEXL 2Q8AL 4PRPD 5I8OL 3LEYH 1IAMA 3CC5B 5DVLA 4OF0A 1FIEA 1SBSH 4NJ9L 1QQDA 2Y06L 1XF1A 4IRSC 5AWNH 2A9ML 4ODHH 4JKKA 3VFRA 3CSBA 3MUHL 3IXTB 1A7BA 2JELH 5I15H 5ITFB 2M2DA 3D85D 4HIIB 1P84J 4MCZA 1CD9B 3Q2CA 1H5BC 1X5HA 1LE5A 1RHHA 3O6LH 3QO1A 1SHMA 4Y5XC 3FN3A 5IQ7L 3CDGB 5KSAB 3O8XB 4RDQF 5C0ND 5ALCH 2DL2A 2NY5C 4I0PA 1EFXA 3S5LB 5F3BA 3C6SA 2HVKA 5HHNA 3AAZA 5D9SA 2XZQH 3CUPA 4NQTA 4PUBL 3OKDB 4FA8A 4MJIE 1UB5A 3F8UB 1U8QA 1CDJA 3VW3H 2NLJA 3HE6D 4HDIB 4M02A 4ZNEE 2X42A 2X1XR 3MSPA 3O11A 3BT2H 2HLAB 5C0CB 1FZOA 1WJ3A 1WUNT 3B9KD 2AJSL 5I8KH 1RUQL 1AGCB 2XTJE 5IW6B 4PB0L 3QUMB 2JJSC 4C57C 3QHFH 1HQ4B 4S2SB 3VD3A 1IEAA 2Y1VA 1KB5A 5GS2D 2XRAH 4WNQB 3RDTC 4NZJA 1JPTL 4BUGA 4JPVL 3KPNA 1HIML 1T7YA 4RGOL 1KJMB 2GEEA 1WZ1H 5I74C 1A7PH 2XZAH 3V5DB 4R96B 1FAIL 3GGWB 4M7LL 1MAMH 5IB3B 3KYMA 5DVMA 1I8LA 2Z91A 3VXRE 4G3YL 3TCLB 2N4IA 5HGGS 3L9RA 4JG1L 4WY7L 3EYUH 5AZ2L 2G75B 1LEIA 2HT2C 3FJTA 4DWHA 2A77L 1IM9B 3X14B 3AM8C 4LCWA 2FH8A 1ZVSA 1RV6X 4OCNC 5KAQF 2HFGH 4HMCA 3VE0A 4RA0C 1FJ1A 1JPSH 1YNLL 1N0LA 1V3KA 4TSAH 1ADQH 1D5ZA 5FCUL 4EDXB 1NAMB 4LKXA 1P7KA 1RZGB 2J88L 4S1SL 1KJ2L 3VWKC 3BGFC 4W4NA 1XR8A 2R1XB 5IWLA 2IALB 5IB2A 2BFVL 4NSKA 5EWIL 2OL3A 1P5UA 3P4LA 3VXUB 3T2NL 1I3RA 1T21B 3IS1X 4GRMA 1OAKL 4JO3L 4Q9BA 4WEUD 4G8EA 4HJ0C 5ESAB 1MFDH 3VFVA 6FABH 1TJGL 4BA8A 4Y4KD 2OI9C 4RMVA 3TCXA 4KTEH 1QPXA 2W65B 3HLAA 1C16B 4L29A 1FZJB 2GAZA 4R8WL 1VCAA 4QHNA 1AGFB 1G6VK 1QBMH 2W0PA 1JFQL 3PGFH 5L0QC 1JGVH 2QKIA 3P4OB 2M26A 4UINL 4M7KH 4DW2H 4CU8A 5EIVA 2NY5H 4FTVE 1IT9L 4JFFD 4KUZL 1WIOA 2XQYG 4O2EB 2P1YA 3KVQA 4F33A 4XWOD 5I16A 4P3WA 3KPPB 5DC9B 4HAGA 1T03H 4JHWL 3RY5A 4RNRA 1MAKA 2FIRT 4Y5VB 3K3QA 3BKMH 4MB4A 1D9KB 4U6HB 3D5OF 2VERN 2NXZC 4X7SL 4WFGD 5E2WH 4KAQH 1U8MB 3BUYB 5D1ZC 3WO3B 5FM4A 1QRND 4Z5RB 4ZTOH 1SM3L 2B8OT 4HWBH 5D6DC 3PHSA 4EI5A 5ADOL 4O9HL 4PYHA 5HDBF 1H3WM 1QSFB 1CK0L 3QT2A 3PQYE 1XAUA 3KLAA 1UZ6F 3ZHKA 4Y2DA 1XGUB 5I71C 3G6JB 4NHUA 2GJJA 3VXQA 3NAAH 3KJ4C 1YMMA 5FYKL 2R0LL 4X9HA 1II4E 3D87B 1NEZA 2HA1A 5DD6A 1U0QA 4AQ1B 3UC0L 2HT3D 3WFBL 1NFIB 2VQ1A 5T1KD 4X4YA 3I02A 3CFBB 5GHWL 5GRUH 2LV4A 5ANME 4UTBH 4X4ME 2DTSA 1DVFA 2CMRL 1MJUH 1G7HB 1V05A 2OQJB 3BAEH 3HNVH 4D3CL 1BLNB 4L8CB 2OMNA 4OLVH 5F44A 5HYIA 1OAUL 4TULL 1H15A 1R5WB 4G6JH 4DK6A 4RAUA 3FB7A 4JAMB 4HK0A 5CJXC 3W9EA 3NABL 1NCAH 1CLZL 2Y07L 4FFWD 4PJ8A 3UTSA 4DK3A 5F71A 4EXKA 3OB8A 5C0RL 3KPSB 4PJCA 2JK5B 1X6NA 1EEZB 3WFZA 1LILA 5DEGB 4IOIA 1QEWB 5E03A 4HV8B 3I75B 4H5SB 4S11A 2JTDA 3MRKA 1N6QL 1IEHA 4GH7B 5KVFH 3TBTA 4ELMB 1JPST 4GXUM 4GAYB 4NQCD 5FV1L 2EIZA 1CICD 4IOFC 4PV8A 3MBXH 1NKRA 1FYTA 3VMPA 2R8SL 3EOAA 5CGMA 1PG7H 3VRJB 2WINA 5TGBB 5TH2B 4F15B 3ZYIA 4NWTL 2A6JB 1FFPB 3MLTB 4OD2A 3QRFM 1NBQA 4NC1C 4X9GA 1QBLH 1RUPH 3IDYB 1RZKL 3D9AL 1LK3H 4L1HA 4BH8B 4K07A 2H3NB 3OKMA 1DQDL 2ENYA 2R2EB 4QRUA 3HUJA 1WBZA 4X6DB 1TVBB 4TTGA 5DQ9B 3TN0A 4UV4L 1CTNA 4LHQB 3RY6C 1S7TB 2HWZL 1J88A 5KVEL 5DJ2A 4NDMB 3WUWB 1FBIL 3RWFA 5LBSL 3ILPA 1F4YL 5TE6L 4F7MB 4E0RA 4Y1AA 2AP2A 3HI5H 3DIFA 5J57B 5DR5L 3EYFB 3H42H 4P4RA 2VAAA 1MHPL 5H2BA 5IBLD 3TF7C 5CBAB 3O9WB 4Z7QE 3DURB 3N1FC 5FECB 3IDMA 5JW4N 2E9JA 2ZSWA 1B3JA 4OI8A 1Q9WB 4MB5A 3OXSB 3V6OA 4L3EA 2WUCH 3NMEA 4WFEE 5T1MA 1F4AA 2J8HA 1TTGA 5IBTH 1JF1A 5ERWA 3KPMB 5C0GB 2P5WD 4LHUB 5HJ3B 5JIPA 3FQXA 5CLTA 3N9GH 2E8ZA 5FKAB 1ZANL 4YPJA 3O3EB 3P9WB 4L5FL 4YBQC 3STLB 1Q72H 1TQCC 1AD0B 4M8VA 4LPWA 3CXDH 4IDJL 1WF5A 4GRLD 1LP9F 4X0KA 2JIXD 3VXNA 3PABA 1EZVX 3BRDA 4OD3L 2NX5B 3SKJH 5GGRY 43CAA 3U4BL 4FXLA 1DP0A 1LO0H 2RGSA 1DQQB 2WP3O 5FGBA 4Q2ZB 2IH3A 3K46A 3K4AA 1DE4B 4KJPC 4DUVA 2HFTA 2LABA 4RFOL 2OK0L 3B3IA 5F7HA 4ZPVB 4HH9A 5DUMH 3I85A 4JLRB 2YXFA 1RIHL 1KTKE 3TFKC 3OTTA 5FOBA 1MCBA 1RZFH 3O2DL 1RULL 2FYYB 3DRQB 3IVKA 4NM4L 4WW2A 2W9LA 2ICEB 1KB9J 4W81A 5D1XC 1J1PH 3ULUD 4LIQE 4YDLC 4HMDA 2FECI 4XBGA 1T1WA 4WHYG 2R4RH 1J7VR 3C60B 1CFBA 3JV6B 1MCIA 3NCBB 4JFDD 4OLUL 2VDLL 4HK3N 3UYPA 3SCMD 1G9MC 5F1NA 4OLYH 4Q9CA 3FFDA 1WTLA 2NY6B 3QQNA 5LGKA 1NFKA 1VFBA 1YPZB 3QIBD 2YBRB 1GCFA 2Z31D 4KKAC 4W6YB 5I1GL 1IAOB 2APWA 3RPKA 3LQAL 1YEEL 3DECA 1UACL 5C0AE 1LE9B 5C3LD 2EEBA 4GFTB 3QEHA 3H8NA 4NT6A 1R3KB 1P1ZB 3RGVC 1E6OL 3S4SB 4KDVA 2D3VA 3N1GC 3PV7A 2J6EL 1KT2B 1CD0A 1EJ6A 1AI1L 2IQAB 2YUXA 5KG9A 1XFPA 4M5YL 5I30L 2RQ8A 4FQPA 1CFQB 3MFGB 3U7WH 5IGXH 1T1YB 1B90A 3VXPA 4YHPB 2X44D 4X6FA 3PNWB 3IDXH 5JOPE 2PCPB 4XVSH 1EDQA 3VXMB 2CGRH 3LMJH 5FO9B 3T2QA 4HWZB 1WEJH 2ZUTA 1RIUH 5CSZA 3PWVB 5BZDB 2XZZA 2D7PA 2WK2A 3Q1SH 4XNXH 1VKXB 1U8HB 2A6IB 2BVOA 1LEKB 4P2QE 4R26H 4ZNCD 2KQMA 1XR9A 3P3YA 4NO3A 1EEYA 4F80A 1LEGA 4DUWA 2FX8H 3C5JB 2CXGA 2R23B 3V4UH 4IBLT 2VR4A 3LVEA 3ULVC 4JHAL 5FYLE 2FD6L 3QFJE 4FZ8L 1MRFH 5MHSE 3K1DA 4GS7B 2OTWB 2X4SB 5KN5B 3OB0H 1OAXL 1D5BB 1L4IA 1UYWH 3LKNB 5LGJA 4NNXB 3ZDZE 4UT6L 2FJGA 3U0PB 1FG9C 3L3KA 2YSSB 1I1AC 3T0EB 3I6LE 3VD5A 3U0WH 4IRZH 3ZE1F 5FDWB 1EJOH 3ZT5A 5ICXB 1V3JA 1ZLWH 4GG6F 2X41A 3FFCD 2E7HA 3QUXA 4NKDA 4KK9C 5E9DB 4KTDL 4F7TA 3I50H 2PF6A 2YRLA 3BO8B 5JHDB 1OTSD 4I48B 3WLBB 4GAGH 4PGEA 2IANB 1D7FA 1MI5B 2ARJA 1XGRA 1W8OA 4P5TC 2FR4B 4R7DA 1IKFH 1W8NA 1A6PA 4M62H 1H0DB 1G9MH 4ZXBD 5L8KB 2ZPKL 3W11D 2VXSL 1I9JH 1U36A 1VACB 1BJ1H 1I85A 4QEGA 1VGKA 1ZWIB 4D9LL 3U46B 3PXHA 1U9KA 5FYJD 3GSNH 2C3XA 3WNNA 3ZKND 1T2QH 3D0LA 3O6KL 4HEPG 1IGYB 4J4PA 3TJHC 5FKPB 4K9EC 3E8UL 5T5FH 3F7YB 3GMMB 12E8L 3JUZA 3QDJA 1B0RA 4Z7VB 4TNWF 2IPTH 1ZGLP 3L3JB 1BPVA 2ZCLL 1QP1A 4J3XA 5E5MA 4DTGL 4UB0L 3BWAB 3DPBA 4CW1B 3WFDH 4XC3L 5E70A 5ILTH 5IMLB 2VUYA 3GMPA 4L3AA 4WCYH 2EDXA 5TE7L 4OCWL 2YR3A 3X12A 3D85B 2FECL 4DAGH 2XWBA 1ERNA 4W6XB 3PWPE 5CHNB 1KJVB 1JI2A 4J1UB 1LD9B 4JPKH 4P2OC 4R0LA 5D7SL 1P2CA 1QLEH 3BE1H 4F9LC 1WGOA 1A7RH 3CH1A 4UV7L 3P30H 4HJGA 2NQCA 4X98B 3BXNA 3ULVH 3UAJC 2G60L 4BK4A 1FRGL 4XNUL 4OF7A 1BAFL 3U36B 3BGAA 2NY2C 1G1YA 3T3ME 1LDPL 3MV01 3AY4A 3UEZA 1GAFL 2DQUL 2F5BH 4ONGH 1DUZB 3T3PE 5FM5M 2DF3A 2EDTA 5C07E 4MX7A 1I8MA 2OL3L 1IZJA 3H7LA 3DUSA 3UPRA 1UH3A 5I6XB 4C56B 2DOCA 2O61B 5DMJB 1W0VA 4I3GA 2X4QA 1V7NH 1IFHH 4DFIA 1VFUA 1FN4A 4I0PD 3SDYH 1EFXD 1X4XA 2VNCA 5IQ9A 5J12B 3ZT7A 1FLRH 2ATPA 4FABL 3O4OB 2PW1A 3ZTJH 4U6YB 5MEOA 3MRJA 1GGCH 5JHLL 4KHXH 3UYOD 4M1CC 3BRFA 5FK9A 2A6DB 3FN0L 1J0YA 1FG2B 1OP3H 2EC9U 4F9PA 4KHTH 2Q86A 3FAXA 2YXMA 4JM2C 3FB5B 5HYJB 4LVHC 4U3HA 3UDWC 4TNVF 2XQYK 3VA6A 2AI0H 3BRGC 2O5XL 1KTRL 1T3FB 3IU3A 1D5MB 3OAZK 4OZHB 3V7MA 4HXAH 3MC0A 1NGPH 3ROOA 2BVPB 3DGCR 5JQHC 5HXMA 2CD0A 4K9EH 1I7RB 4K7FB 5B38B 4MSWB 4P9ML 3RVXC 3U1SH 3SDCA 4HKBB 4ELKB 1MHHA 3BI9X 1BMGA 1Q0XL 1ZHLB 3PIQB 4G8GD 2BCKA 2Q76B 4X9BA 1MELA 1P69B 2WP3T 2OM5A 4QRQA 1KB9K 1I1RA 2XQBL 1A6TA 3MQIA 4WU5A 1T89A 1DL7L 4Y4KB 2IBBA 4MNHB 4B0MM 5I76A 4HCRL 1YEDA 5FA3B 5KVDL 1BFTA 2IPUG 3MACH 5E2UH 3PWJB 4P4KB 3MNZA 3IS0X 4N8CH 4A2LA 5DUPL 5D6CA 4JFFB 4PBVC 4LBEB 5E94A 1G7QB 4LCIL 1U6AL 3UROR 2DTML 3P9LB 4K94C 1U8OA 3HTLX 4M6MH 3O6FC 4PJDA 1V5JA 5ISZA 5FYLH 5I1CL 4FP8L 5HHQA 4OM1L 4WDIA 5EDXA 4X6CE 1FVDB 4EKXA 4Y5YB 5L2KE 1X4ZA 2VZVA 1K4CB 3FO2A 4BSVB 2XNAA 1MFBL 5GGRA 4PJHE 1N4XL 1KPUB 4FZEL 3H0TA 1IC7L 5AAWA 2DJ4A 2XA8L 4FQ2L 4KZEH 4MA1C 3MRLB 5DJAA 3TBWB 4BZ2H 1YN6B 1S9YA 2H2PD 4HX1A 1ZVHA 3R0MA 2B2XH 2DB8A 3OKEB 5TQ2H 5FA4B 4U1KB 4ZFGL 4EEEA 5EZJB 3Q6FA 4KI5E 1WQVT 4HLZH 3SJVA 2MNUA 1Q94B 4MAYA 4MJ4A 2HFFA 5CJ8A 3RWGA 5EFIA 2P24B 1SJHB 4OCSL 4EI5D 1JWUA 3UTPD 3H9SB 4GW1A 2Y4SA 1B4RA 1IEBA 4XZUB 2UUDK 3F7PC 4QWWC 1F3DH 4WIQA 4CADA 2UWEE 3FMGH 3CFDB 4ZSOA 5ITBH 3TV3H 4OSUL 5IM7A 3MRRB 3MYJA 4UT9L 5EBWA 1J10A 1YMMD 3C2SA 4LHJB 5D1QC 4XRCA 1AXTL 5D2NA 1BJMA 1KJ3H 1P53A 1FVEB 1M1SA 1X5GA 1BF8A 4QRRB 4G6AC 5EU4A 4P5KB 5JNYB 3JTTB 1M7DB 5H37H 1ZVYA 1TPXB 1DVFD 2Z4QB 4YHNA 3FRUB 4JGMA 1BVKB 3MLYL 2GQHA 2YRPA 3U7YH 4NQCB 4U7SA 5DJZB 3QHZL 4N0YH 1MRCH 3T04D 5E2VH 4PBXA 1MH5B 2HTLD 1G7LB 4XCYB 3C6LA 5EO1B 4PJ8D 3UTSD 4H88L 4TTDD 4HZLA 4LNVA 2NW3A 3ZKSD 4J8RB 2DYPA 4JKWA 5HD8D 4WFFD 3DMMC 4X6EA 1J1OH 5B3NA 3HPJA 4D0CA 4Z7QF 1BREA 5BW7A 3MJ7A 3C8KB 3SQBA 1KPVA 5SWZE 4U7KA 4I2XA 2VUOA 2JE8A 4K94H 5HI4C 2B1AH 1TVHA 4GJTB 5FEBA 4XBPA 5IKCA 2GITB 4JCLA 3BH9B 4HUUB 1FYTD 4IIQB 1B4JL 4HF5H 5BO1L 5C9JB 2FO1A 1X5XA 1FNAA 1WZLA 3HPLB 1XH3A 5EB9A 3KDMA 4AJ0A 5D70L 3PGCB 4LCCB 2CK0H 2YUZA 3WFHA 1LWRA 3MOBH 4JZJC 5CUSH 3U0TA 3P11L 3HG1E 1OAYH 4FG6D 5JUEL 5DT1H 1MHCB 1CD1A 5F96L 2F5AL 3QIUB 1TFHA 2L4OA 4YXKL 3E6HA 1ZLUK 3Q48A 2RHEA 5CIPB 3HB3C 4PB9L 1JWMA 4QOKA 4Y8AA 4GW5A 3RL2B 3VRLF 5C9KA 5IFAH 4KI5C 3V5KA 3QUZA 2DM4A 1T5XB 3TBSB 3LKQB 3FB6B 4GOSA 1AO7A 4Y1AD 1PKQB 1U95B 3EGSB 4UUJB 5HHOA 4RAVB 3BP5B 1A7NL 2FBOJ 4N90E 1UJ3A 3CGTA 4KRPD 3V0WL 5FO8A 4QT5B 4DQOH 3EZ8A 2AEQL 4G80A 1ZT7A 4OIAA 1B9ZA 4Q9RH 1XIWA 4AEFA 1AHWA 1HKFA 2IFFL 2F58H 4ORGB 4MDJA 5EZOH 5IR1B 1G6RB 1SQ2N 2X70B 1YZZA 2FBJH 4Q9QH 3LKSB 4LPCA 5KOMC 4P46A 1A6WL 4L3ED 3TNMB 4KKLD 4U49A 5HYSB 3S35H 3L6FA 3PWLB 2AXFB 2J8UA 3HMXL 3IETB 1BZ9A 2A74B 2BVEA 3ARDA 3KLDA 2AJZB 3IJHB 2C1OA 2BVUA 1FL6A 3CFEA 5CZVL 1A6ZA 32C2A 1UQSA 5I1AB 4NJAH 3ZTJG 2MHAB 4NUJB 1A3QA 2EYTB 3K74B 2HJFA 4CVUA 1JZ8A 3VG9C 4I9WE 2O26U 2DBLL 4OIBA 4PRIB 1QNZH 4PRHE 3GJFK 3GMLB 2F53D 4TOYL 3LH2L 2BNRA 2HRPH 4GKZB 4GKSA 4Z7WE 4DZBB 4MNQA 1PZ5B 1BM3L 3LEVH 4GKNB 4KKCD 1S3KH 3QDGA 3LDBC 2DLFL 4JZOB 3U83A 4HD9A 1A2YA 4JFPA 4JFDB 3HE7C 1XF4B 3PHOB 4LPTA 5C0IA 3SCMB 4U1MB 1BD2A 1DQML 4I3RL 3QISA 35C8L 1Q0YH 1A7QH 4Z8FL 1OB1A 5DJ0B 5FHBL 4YBLC 2EECA 2D31A 1J8HA 2Z31B 2DN7A 1AIFA 1HWGB 3IFLL 4S1RL 1GZPA 2B7DT 5F7FA 4DCQA 1S7UA 2J8OA 1N7ML 1DANT 3IDIA 5EG6C 2EH7L 4KV5E 1A3RH 3HRPA 2WW8A 3B5HA 1JUFB 1KG0A 2B4CL 4Z0BL 3GUTB 3PP3K 4ODVH 5IK3A 4XP9L 1JNHB 3ZDZF 4LLDB 5DSCA 4PJ9A 2Q6WA 4XC1L 4B41A 3RQ3A 1J0JA 3WIHA 2FB4H 4FQIL 5D7LA 3DXAA 1IC4L 3O3DA 1TTFA 1LHZA 2ZUWA 3QQ9D 4R7NA 5GZOC 3O0RH 1ZGLA 1GGIH 2YK1L 5D71H 4E42A 3I2CH 4M6OH 4K8RL 2R56L 1CG9A 1NDGB 3LIZL 2VLME 5LAXB 4YHLL 2XKNB 2QADC 1HOCA 1PY4A 2CK2A 2HN7B 3RAJH 1G7MA 1YECL 4NKMA 5TDNA 3GMOB 2XFXB 1AKJA 4P23A 1V7MH 5HSFA 5IESL 1ACYL 5E00A 4P59L 2VISB 5E6IB 4MA3A 4WUUA 4F58H 5GSRA 3VFOA 4LP5A 2PTTB 3GO1L 5I8OH 5D5ME 3TIEA 1JI1A 5D7IE 1HEZB 1YUHA 2GUOB 1CCZA 4NJ9H 2Y06H 5BVPL 4LCUA 5B3JE 1PX3A 3LKOA 2P49B 4IHOA 4UDTA 2BRRL 2YD5A 1C1EH 2YD4A 1HCFX 2G2RB 5E0QA 3GSRB 4QHLB 1SMAA 4L4TB 5BRZE 3P4NB 5IQ7H 1UGNA 5ICZA 3DX7A 4OAWB 1LGVA 1KIQB 1NFDE 4ZQKB 4ZFOA 2Q20A 1LK2B 1DBJL 4K2UH 4XPFH 5IHUL 4JPWL 1FGNH 4ZUWB 5CGYC 5DHYB 3TC9A 4UAOC 3B9VA 5E4EB 3WYRA 1NGQH 1TZIB 4M1DL 1JGEB 4U1JA 3R0NA 3CU1A 4MNGB 4HT1L 4P49A 1BBDH 4ZXBB 3MMEA 4JO2L 4TRPL 3GRWH 4LPXA 1SYVA 4TNWK 1H8OA 3QUXD 3QCVH 4RZCB 5SV3A 1WBXB 2I27N 3GEWB 4OGXL 4HGKC 5I66B 4MYWB 2EZ0C 1HSBB 3QJHA 1NGZA 1R3LA 5DHVA 5DYOB 5H37G 2AJSH 1HXYB 3PV6A 1RUQH 2FSEA 3FT4A 3MLZL 4XPTH 5IFJA 2C3GA 2Q3ZA 2J12B 4KROD 3SGJA 3FO9B 4K8RD 3T3MF 4HGWA 5TDPA 1QKZH 2D0GA 4M03A 1N6UA 3WE6B 2RR3A 3T3PF 1MF2L 3C5ZD 3MUGA 4I13B 2ZUUA 1HIMH 2GTZB 3FO0H 3X3FH 4CL7A 2ZCHL 4QHKJ 4OBRA 1F97A 4WTZG 2BMKB 4YE4L 1FAIH 1NCWL 2QQQA 4R9HA 5I17B 3S35X 4DFHA 4J4PD 3WD5L 1JK8B 4WY7H 2JCCA 5AZ2H 3QDJD 3L3OA 5F3HB 4OGAD 2A77H 3OAYH 4AG4L 5EU7E 2XY2A 3F12B 1QQDB 1R24A 4WI4A 3P73A 4K55A 1OM3L 5FM8A 3VFRB 2EIEA 2FX7L 4Z0XB 1YNLH 2APXA 4MJ5A 4OKDA 2EIDA 2IBGA 2X2YA 5I18L 1QR1A 3LB6C 4KJYB 1FFOA 3GBLA 3MZGB 1DQTA 1ZAGA 5FCUH 3OKOA 1F45A 4O58L 1F58H 1IAKA 2DKMA 3F5WB 3HZMA 5GS1A 4N8VB 4G42B 5EWIH 1KXVC 5EO9A 4WWID 3T2NH 2R1WA 3O3BA 3AGVA 2LAAA 3D69B 2D03H 5DO2C 4A2MA 1OAKH 4JO3H 3NPSC 3RVWC 4Y16B 1V3MA 4I0PB 5F3BB 5JDSA 2PO6B 2VDNL 5GS0D 2HVKB 5F8RC 4V1DA 1OTTD 2HKFL 4Q74A 3LKPB 3KLHC 2ZSVA 2NZIA 4HUXB 3CUPB 3DO3A 5DQJA 1JYWA 4UINH 1YEKH 4TNVK 1U8QB 4JRXB 4PGZA 1AGBA 1RZKC 5C0BB 3ARTA 4KUZH 2CJUL 2EDLA 2A1WL 3O11B 4EXPX 4HHAA 5HVHB 5DVKA 3WEXB 5TF0A 4JHWH 1A0QH 4AEHL 4U1SB 5DZOA 2VXUL 3L7FA 1XZ0B 1H8SA 4NM8H 3BKCL 4X7SH 2ZNXA 5K9JH 1AFVH 1MNUL 1MLBB 1A4JA 3WO4B 1F11A 2BOBA 1DDHA 2VN7A 5ACMA 4AK1A 4O9HH 4KQ3H 5HHPB 4W68A 1ZS8A 3TA3C 1A6VL 1KEGH 5C0CE 4DUXA 4JQXC 3L5WA 4O2CA 2OTUA 3KPNB 4YZFE 3W0WB 5A3IC 3GM0A 1VADB 3LRSA 4XHQA 5MENA 1MFCL 1T22A 2R0LH 2QSCL 2P46B 4GG8A 5I19L 1UKQA 2EXYC 3UX9B 3SE3A 2AKRB 4G8GB 2DWDA 3L9RB 3UC0H 2FEDD 5DQDL 2J1KA 4N0UB 4PFEA 4PJHF 3L3HA 4NO0A 5GHWH 3OR6B 4YDVA 5HVFB 1H5BA 4UDUA 1UCBL 1P4BL 4OCLC 1YYML 3V4VL 4Y5XA 2CMRH 3IF1A 4ALAL 1FJ1B 1X7QA 3D25B 3GSWA 5BV7H 1EHLL 1CDBA 4B5EA 5D72L 5KZCB 2JB6B 4UU9B 1PEZA 1D5ZB 4UOW0 4M7LT 4LKXB 1WITA 5KSBA 3SDCD 1UZ8A 1I8KB 1XR8B 3EHBD 1KYOJ 4NQEA 4NSKB 2GY5A 1CL7I 4Z7NE 3QEQA 2V5RA 1NBYB 1VB9A 4GRMB 4U1IA 4XMPL 5DURD 3QNZB 1N6QH 3VFVB 1DBKL 5EUKA 1UG9A 2AJVL 4YWGL 4BQ6A 4UOJA 4HWBA 5D96B 4Z76B 1HK6A 1I1CA 4PGBB 2WWKT 5CSGA 3VXUE 4NKOB 2JJSA 4F33B 3P0GB 4ETQA 2FIKA 1H9VA 2X6MA 3CSYB 2W9EL 2VABA 3V5HA 5BS0A 1TNNA 4KZDL 1LP9B 3FQRA 5CEYA 1MJJB 1CLYL 3DWTA 5ISZD 5DRNA 2LTQB 3RDTA 4YPGA 4FFZL 2UY7A 1RZKH 3D9AH 4S10A 1S7WA 4EI5B 5KSAC 1MUJB 4XPAH 1S7RB 1INEL 4PJ7A 1NUGA 5DRWA 5DDHA 1JP5A 2A38A 2DQFA 5H35A 3D0VB 4QF1A 1FBIH 2J4WL 2PN5A 3GSQB 2VL5A 5CILH 2R1YA 1F4YH 5TE6H 1INQA 1IGJB 5ACLA 4CMHC 5DD6B 4AL8H 1OP5H 5DR5H 4EOWL 3SJVD 3I02B 4D94A 4MAYD 5JLZB 4FQQB 1QSFE 4R2GB 4JZNA 1GOGA 3RGHA 1MHPH 1NJ9A 1DVFB 3VWKA 1NL0L 1W2KT 3G6JE 3UYRH 3GJFB 4OZIF 3MJ9L 1T2XA 2GSGB 4X9FA 3QWQB 3SDXA 3A6CL 3P4MA 5SWQA 1S8DA 5GQBA 3FB7B 3SKMB 4HK0B 1J0ZA 4NZDA 4KKBC 1XF3B 4PJ8B 3UTSB 1SEQH 3LD8B 1YDPA 3RWEA 1I3GH 2IAMA 4PJCB 3UTTB 4UTAL 2DICA 4LSDA 3FN9A 3OWEA 3TH2T 3RJDA 1YEFL 1KLUA 5DFVC 4X7FC 3NFPB 3H3PL 1YEHL 4K23L 3D2UA 3WNKA 1CFTA 3HS0B 3DETC 3TBTB 1N0XH 2OJZL 4LGSB 4LLUA 2D2OA 1LO4L 3LY6A 5DJXA 1AR1D 1P7HL 3H3BC 2EIZB 4RMTA 1M7IB 2FJHB 4AT6A 2D9CA 3Q3GA 4FOMA 4OD3H 3ZKQD 2D0FA 3G6AB 4PV8B 3O2VH 3KPSE 4F3FA 1GXEA 2QHRL 4M48L 5D1ZA 2KPNA 3C6LD 3BPOB 4P0DA 4PJ5A 2YD1A 3PWUA 2OK0H 5CJQH 3QYCA 2JJTC 2WINB 4OCYL 4RFOH 3EDJA 5D6DA 5KSUB 3WIIL 4L8DA 2DYPD 3QA3B 5F7EH 4OD2B 4LLAA 1LO2H 2P8PB 4MAUL 1A1OA 4ELME 5FV2A 5DD3L 2NY1B 5JZ7D 3GMQB 1M7XA 3NFSH 5GGVY 1GGBL 2I9LB 4GXVL 3O2DH 1NMAH 4KFZC 4NP4L 5A2LH 4NM4H 5EU6E 4A6YL 5IMMA 1QLFA 3I9GL 4LU5L 4OLZL 5DRZA 5HPMB 1IMHC 5C09E 3ILPB 1OP3K 1CL7L 2Z0BA 1LNUB 3I84A 4E0RB 4WJ5B 3E3QE 3BKJL 2VDLH 2D4FA 2E7LC 3DIFB 4GG6B 4ZO9A 4PJEE 3DVNA 1T2JA 2AJXL 3VXRA 4X6DE 4Z7WF 4OQTL 4PJBE 7CGTA 5L9DH 1U3HC 2VAAB 5DMIL 5IVXF 2ICES 4Y5VC 3VXTB 1BQUA 1YEEH 3AREA 3GIVA 3JV4B 2AJ3B 4R90L 4RMRA 1D9KC 3NN8B 1C08A 1BQLL 1UACH 3IDMB 4XI5D 1N59A 3FQUB 4ODTL 4QOKD 5C0FB 2I07B 3LZFH 2QEJA 5GGTA 4XVJH 5EORL 2OYPA 5I1KH 5C0EA 1E6OH 1UM4H 3QUZD 3CSPA 1FPTL 4U6VL 2XXMB 1AI1H 5E1AB 4M5YH 1JF1B 1AO7D 1QFOA 5HHOD 4R4NC 2IMMA 2A73A 3NACL 3GNML 4HUMB 3QUMH 1VA9A 1Q9OB 2HJLA 3WFEL 1MCCA 4CU6A 2IF7A 2X4UA 4MJ6A 3RWCB 1NMBL 4KV5F 4LASH 2CIIB 4HPOL 3O2WL 1P4IL 1UWGH 1XIWD 1MREH 3L1OL 1EH9A 2F53B 2B39A 4X0KB 1VFOA 3IRPX 2ERJB 4BZ1L 4P46D 3W39A 1SYSA 1GZQA 3VFSB 5BXFA 2YA2A 4HKXA 43CAB 4V2BA 3G6DL 4HPYH 1MCEA 4RMSA 1YA5A 3S88H 1TENA 1B6DA 3NIDE 2E7MA 1HILB 3GI8L 4KRLB 3ARDD 4X5LA 4MWFB 3B3IB 5IIEB 2PUQT 4FZ8H 4LSPL 1YEGL 4HH9B 4IRJC 5CP7A 4J23A 3RY6A 4CUCA 2A0LD 3EDEA 3CLEL 3EYOA 1R5IA 2XTJB 1L7TL 3QPXH 4G9DB 1EV2E 3BP6A 1EHNA 2R0KH 2AXHA 2BNRD 4X7TB 5DD1H 4RGNC 2NX5E 3IVKB 2QHLA 2YKLL 4I4WA 4MNQD 2YPLA 4JM4H 4K3DH 1F4WH 3L3IA 4H8WL 1NAMH 3PQYA 3QDGD 4XBGB 1T1WB 4PY8J 2QSTA 4YK4B 4LSUL 3WIFA 5CWSB 5F1NB 1BD2D 1OD9A 1PQZA 5DVOA 1JPFA 3RPIB 2SEBB 1WAAA 1JHKL 4PD4K 3EDFA 1J8HD 3VI3E 4XNQA 4JE4B 3ILQD 1MPAH 2HLFC 1Z5LA 1EHXA 4R97B 4F15C 2W59A 4NHCH 5ANMA 1KYOK 1XCQB 3OAUL 4KJQC 4GMSH 3IDYC 3E3QC 2ZPKH 3QHTC 3ZYJA 3QEHB 2VXSH 2P8LB 1FSKC 3DX9A 4RBPH 4P99A 4RMUA 1WBYA 1NFDF 5KG9B 1XF5A 5E4IA 2CO7B 1YPZE 4I77L 4PJ9D 3O45B 1RIVH 3O6KH 3VXPB 1FFRA 3CDFA 2Q1EA 3E8UH 3S36H 5D7LD 4K3JL 12E8H 3DXAD 4ZOBA 1BGXL 4N1EA 2BY2A 3R06A 4LLMB 1LO5A 5EC2A 2ZCLH 5CSZB 1SBSL 3H9HA 3SKNB 4DTGH 4AIZA 5I1EH 4DN4H 2AJUH 5AWNL 4NC0B 5CEZE 4ODHL 3QXTA 3U9PL 3ETBF 2BVOB 2UZYB 3UTQB 3ARBB 2X40A 5I15L 4XP1H 3UPAA 1MJ7H 3V6ZB 1J0HA 4NO3B 1IL1A 1FV1A 3O6ML 4CAGA 1AKJD 3O6LL 4P23D 3G5VA 5FCSH 3O9WC 2G5RA 4HKJB 4LVEA 4QXTA 4WUUD 3VXME 2Q7YB 4WGVB 4Y7MA 3X3GH 5DJCA 3CMGA 4YX2L 2NY3D 5D1XA 5ALCL 5GS3A 1HKLL 2KDGA 1PVHA 5LGJB 4DKFL 2VLLA 2FJGB 3MRCA 4OZGA 3UMTA 3CCHB 4UV7H 2X7LB 4JFYB 2G60H 3DLQR 1NKOA 3I3EA 1FRGH 2V2XA 4XNUH 4RIRA 1C7TA 3GKWL 3VW3L 3QUXB 4NKDB 1RVFH 4IOSD 3BT2L 2HH0L 1M4KA 3BPLB 2FGWL 3BVNA 3G5ZA 3OQ3B 4EQ2A 2DJUA 4JO4L 5F7UA 3GSNA 1MIEH 3U4EA 3H7BB 2FZ3B 3M17A 3SE8H 3T0EE 2UVEA 4FQ1L 4PLJD 5F7LB 4CN1A 3EO1A 3RGVA 2BC4A 2PYEA 3QHFL 4MXVF 1NQBA 4UBDC 4RX4A 2HVJB 3UJJH 5EH1A 4LCYB 1O7SA 3C5ZB 5E9DE 2H32B 4IJ3B 1HNFA 5JORA 3FN0H 1QA9A 3MRMB 5JHDE 1DZBA 2XZAL 4Q6YA 4M3JA 1MAML 5ELIA 3V8OA 2IANE 3D0LB 1MI5E 3X11A 2AK4A 3HN3A 4UI2A 5DUBA 4ODWA 3CVHL 1Y0LA 2O5XH 5IB4B 2K7QA 2FHFA 4FFVC 3EAKA 2NY6C 3QZWG 2AVGA 1J11A 2XY1A 1YYLL 4APQC 1BWWA 1ADQL 25C8H 3BQUB 4TSAL 4XH2A 3VRIB 3MRPA 1OQOA 2XWBB 3AUVA 1CXKA 3BSZL 2MJWA 3IKCA 2ADJA 4PGCA 1I1AA 1MCFA 4PRPE 1F8TH 4PLNC 1JVKA 3LKRB 3RFZC 1WFNA 5EBMB 4RRPG 1GPOL 3WBDA 3QB7C 3BH8B 5C0JA 1BQHG 1MFDL 6FABL 1DL7H 4X83A 3T0VA 4F37K 4PRDA 4NOBA 4JO1L 4YZFF 3QO0B 3QXAB 2WNGA 3OSKA 4AH2A 5T1LB 4MD5A 1QBML 3PGFL 2CLRA 4G6ML 2ATKB 1CR9H 3ARQA 3QXDB 4NN5B 4DW2L 5LQBL 2NY5L 3DX6A 5HGDA 3O3AA 1ZKAA 3TZVC 3O41A 3S5LG 1VENA 3OKLA 4NN7B 4LCIH 1U6AH 5IVOA 1T03L 1I8MB 1RJLB 2XWTA 4KK6C 4C58B 5I1CH 2NTFB 1FN4B 5E2WL 3NIGF 4KAQL 1CLCA 4MA7H 2ICWJ 4NNPL 3B43A 3ARRA 1BEYH 4V1DD 4D0BB 3MLRL 1PJ9A 2R0WL 2NNAA 3FT3B 3DV6A 1SBBA 1T4KB 4YAQA 1N4XH 4GS7C 2IPKB 5MEOB 4FQ2H 1UEMA 1E0OB 3U6RB 4HBCL 1A9EB 4XNZB 2AV1A 4Z7NF 4HIXH 3T0EC 3NAAL 4NQVA 1ZSDA 2YZ1A 1PY9A 4Q0XL 5E8OB 2VITB 2WLYA 1VFMA 4XAWH 5HYQA 4WHTA 1BQSA 3IU3B 4UTBL 3S36X 5F1IA 3DYOA 1OQXA 2YEZA 1LMKA 2VLKA 3MCKA 3B2UC 3HCVB 5L8JB 1HXMA 3ROOB 1SY6A 5F7MC 3IU4L 3TO4C 5JQ6H 3HNVL 4P2OA 5FYJU 4OLVL 4UT9H 4FQLH 4PJFA 5EO0A 1DLHB 5MEND 4M1GH 4G6JL 4F9LA 5HYJE 3SDCB 4XP6H 4ISVA 3RY4A 1NCAL 5D4QA 2O5ZH 3NZHL 5GRVK 1QSEA 1ZHKA 2W07A 3ZDXE 3X17A 3L7EA 4QRQB 4NO0D 4OZHE 43C9B 4MLSA 4RFEA 5IEKB 1JN6A 1PYWA 1EAPA 1WZKA 5I76B 1YEDB 2ADIB 3MA7A 4HG4J 1Y6KR 5HHMD 3MLYH 2H41A 4ONOA 3AS0A 5CEZH 4PLKC 5DF0A 1NC2B 1ORSB 1VSCA 5D6CB 3MBXL 5E94B 3QUYA 4OT1H 1J1XL 1K8IB 1PG7L 4NQED 1S5HA 3L3DA 3ALPA 4PGDA 1U8OB 3QEQD 2XZCH 2BHUA 4MD4B 1HHHA 2AJYL 4FNLH 5HHQB 4WDIB 1RUPL 3IFPA 3OJDB 1E6JL 4WFHD 3FO2B 5I9QB 5GGRB 1IGTB 4JQIL 2VTFA 5EA0L 1XGQA 3BGMA 4JFFE 5C0NC 3H0TB 3GMNB 4JM2A 3UDWA 4PY7B 1S9YB 4HX1B 4WO4B 1B4JH 5C0AB 4KVNH 3ARFC 1Q9LB 1H3VA 4XAKD 5BS0D 1W72B 1NCUA 2WUBL 2P8MA 3IFNL 4WFGE 4FN0A 1YN7A 3HI5L 3RDTD 1NANH 1AQDA 3Q6FB 2IEPA 2JJWA 4LFHG 5A16A 3IGAA 2FCBA 3SJVB 1RQ5A 3H42L 1YMHB 5JUEH 4WTXA 4MLIA 3SGDH 4MAYB 4B7IA 4G8IA 1AGEA 3MV7B 2VKXA 3RWGB 2F5AH 2AV7A 1JWUB 2PXYC 4GW1B 3GJEA 3MR9A 5GRWA 5IHZA 3MROA 4PB9H 2HT2D 2WUCL 5HHVH 5IM7B 4PP2B 4XP5L 5EBWB 5J12C 5FUCC 4D2NA 4P2QB 5IBTL 4XRCB 2IH1B 5D2NB 1NCTA 4ENEC 1A7NH 3CH8A 2CRIA 3MGTA 1YQVH 1AJ7L 3PWPA 2P42B 1OWWA 1ZTXH 4WWKA 1G9EA 4U1NA 5DMGC 4PJGE 1EVUA 1RZIA 3IDUA 4JDZA 4ZS6C 3H9SE 3OAYK 4WTZA 3MRBB 3VI4F 1GGTA 5AG9A 1FZMB 3LQZA 1J0KA 4Z6AT 3O6FA 1H3UA 3M07A 3GM8A 5AZEH 4BSWB 1PZUB 1UVQB 1EVTC 3F7VB 3DARA 4PJEF 1FZKB 3F62A 4FQJL 2IAMD 5E8EA 2CIKB 4PJBF 5I8EB 3TYFB 1J05A 2DYPB 3ZLQC 4U6XB 5INDA 5CZVH 1VERA 3S8WA 1CWVA 1F5WA 1CU4L 4NKIH 2EDKA 5DUML 1QUNA 3D2UD 4JDTL 3VH8G 3CFKB 4NQCE 3MJ7B 2VLRA 5F7DA 1KPVB 4TOYH 2D7NA 2FHBA 3ZKXB 1H3XA 1FHGA 2BY3A 1WCBB 2QQNL 5KJRL 4XBPB 1E28A 1J1PL 2OR8A 3EYVB 1BM3H 3BDYL 3VCLB 2VDML 3VA2C 5D1ZD 4D8PB 4Y4KC 2DLFH 3K4ZA 2ITDB 4PJ5D 3RWHB 5B4MC 2R4RL 3C9NA 5A2JH 2DAVA 4OZ4A 4P4KC 5FB8A 3V79C 5EUOA 1MCDA 1NBZA 3AROA 3WFHB 3U0TB 2F54A 2HFEB 1AXIB 2RCSH 3IDJB 3NCCB 3WS3A 3MUJA 5D1QA 4NNYA 3MJ6A 3NIDF 1JWMB 1EO7A 4R4BB 4LNRA 4Y5YC 3WJLA 3QUZB 1MCWW 3RUGF 1S7VB 4JFEB 2NR6D 4WHDA 1FAKT 1AO7B 3D18A 1XGYH 5GRYA 3T0DA 3U7WL 5HHOB 5IGXL 4XC1H 3MREB 3V8CA 3IDXL 3MXWH 4DVRL 4WW1A 4HIEA 4XVSL 4BQBA 3CNKA 2BVQB 4O00A 3KPOA 2C3VA 3I6GB 1RIUL 1XIWB 3ARED 2R56H 1BBJA 3LIZH 4XNXL 3GIZH 3S37L 4LHUG 1IQDB 5H8DA 3DMMA 4ODBD 1YECH 2WBKA 1IRAY 4R26L 4AIXA 3CFJB 1PKQE 3BD4A 3G5XA 4F8TA 4W70A 4HSQA 2GSIA 1JNJA 1TCRB 2WMPA 4QGYA 1KNOA 2DWEA 3V4UL 2J8UB 5IESH 1ACYH 1BZ9B 1OAQL 5EPMB 3ARDB 5BVJB 1JZ5A 1KCUH 3OX8A 3VI3F 2C1OB 1MRFL 1SEBB 1Q9KA 1UQSB 5IVZA 1ZHBB 1DEDA 5DXWA 4IOFD 1UYWL 1WT5C 2X4OA 4YUEH 2HJFB 4EJ1C 1KC5H 5C08A 3V2AR 4X6CA 3VJ6B 5D8JL 3VXOB 4P3DB 1I7TB 1QVOA 4XXDB 5DFTA 5L2KA 1CDIA 1FNEB 3U0WL 3SQOH 4IRZL 4X9IA 5F89B 4MNQB 1VEMA 4Y19A 2EE9A 2BRRH 4MS8C 2Z35A 4JZJA 2BSTA 3QDGB 1TPXC 1VHPA 3LQMA 1PFCA 2Y5EA 3I50L 5LKNA 1BFOA 2HMIC 2FO4A 4B53A 1ORQA 1R5VA 1KTDB 3MA9H 2VIRB 4GAGL 1MCLA 1OB1B 3MCLH 3NCJL 1U91B 2D31B 2XOTA 4RGMB 1AIFB 4M62L 1GZPB 5DHXB 3ULUE 4QCIB 3IDIB 3TO2B 4HT1H 3GSOA 3K2MC 2YPLD 4JO2H 1DTUA 4TRPH 3PJSB 4LSQH 3PL6A 1KG0B 1I9JL 5IJVB 4JFDE 4OGXH 2UWEA 2HTKD 3VU2A 4LSSL 3GSNL 4X80L 2ITCA 5F7KC 3RWJB 4PJ9B 5DSCB 5I1LB 3U9UA 4HG4K 2OJEB 3AS1A 5D7LB 5T5FL 3P77A 3RIAF 4OI7A 3S4SG 4JGJA 2IPTL 1IC5L 1B0WA 2EXWC 2HJKA 5JPNA 4M8QA 5DK3A 4UNUA 4LCCC 3WFDL 4H20L 5ILTL 1MF2H 4CJ1A 1HOCB 2CRMA 3ZTNH 1G7MB 4NKMB 5TDNB 4YBQD 4DAGL 3ARGC 3SN6N 1ZMYA 3ZDYE 3QIUC 2CRZA 3HRZA 5DZLA 3FTGA 5GSRB 3WD5H 3VFOB 1TJHL 2NY3B 2OX5A 3TIEB 4D0DB 5F88A 2MTPA 4AG4H 1E27A 1QLEL 3BE1L 3U2SA 1A7RL 2D9QB 4LCUB 1QBBA 5TF1L 4KJPD 3P30L 5JW3H 3LKOB 5LJYH 1ZT4B 5GRZA 3HE7A 4OFDA 4IHOB 3HNTH 2DQEH 1KULA 5KS9E 2X4NA 5I18H 4PJHB 4TVPD 1RJCA 3EOBA 4O58H 1CDGA 1OT2A 4ONGL 1WVZA 1TIUA 2ZOLB 2C4FU 5ICZB 4X7CC 4YXLL 5D1XD 4ZFOB 1I9IL 2YRZA 4X8JA 2O93L 1V7NL 4HULB 1ZHNA 3CD4A 1U8KB 5J9PA 5BCAA 3NGBB 3JV0A 5HPOA 3CFCL 1XCTA 3HG1A 2Y6SC 5GJTL 1FLRL 3IJYA 1GVIA 4U1JB 5MI0B 4QRTA 3JTSB 4XTRC 5JPMB 2V9RA 3FKUS 2Q87A 1GGCL 1VFAB 1ZA3A 1SYVB 1TVDA 4HFWA 3QIWB 2CJUH 2A1WH 5E5RB 4KKAD 4TYUA 3T0WA 4M93B 1R3LB 4LIQL 2WSKA 3X13B 2VXUH 4KHTL 2FSEB 3FT4B 1TTUA 4F7PB 2LU4A 1CGWA 5DJDA 3BKCH 5IFJB 5GGSA 1S9XA 3RGVD 4HUVB 2AI0L 5T5NF 1FNGA 2PYED 3V0VA 4UT7L 4MNGE 2CLVB 4X99B 4RX4D 4HGWB 3SCMC 1CXHA 5EOCJ 2Z9TA 4ODUA 4HXAL 1A6VH 3E6FA 3MUGB 3GHEH 2QSVA 4K9EL 3ISWA 3EFFA 4WUKH 5FYJE 4UQ3A 3U1SL 4F2MB 1W72L 2PYFB 1LO3H 4PYGA 4QRSA 2QSCH 4L4VB 1T0MA 3TWCL 5DGRA 1F00I 3BZEA 4NO2A 2AK4D 4LARH 3GMRB 2DM7A 1OOAA 2GT9A 1IBGL 3TT3H 2W9DL 1ES0A 3V4VH 1HHKA 1R24B 2F8VA 3ULVD 3P73B 4ALAH 5CIPH 5A2KH 5C8JB 5E2UL 1EHLH 1I7ZB 5D72H 3OPZH 4GAFB 5JO5A 3B2VH 3TH4T 2EE2A 1BOGA 1IAKB 5GS1B 1UZ6E 1WICA 1UEYA 2R15A 2F74B 4EBQH 5CBEB 2YPKA 3NCYS 4OZIB 4XMPH 5FYLL 2VLJA 3ZE0E 1UKSA 4MVBC 1WIPA 2R39A 5D93C 4KK9D 4LAQL 5JDSB 3BKYH 2AJVH 5E6IC 4NIKB 4V1DB 1G6RH 3JVGC 3WN5C 5T33H 2ZSVB 1N5AA 3BN9D 2E8YA 1AGBB 3B83A 4BZ2L 4BFGA 1QRKA 4HHAB 2ZUYA 1EEUA 2B2XL 4OIIH 5L2JA 3RTQB 1MFNA 4OZHF 4JY4A 4KZDH 5B8CA 3L7FB 1JGDB 3L3GA 4FFZH 1T5WA 4NBZB 4MQ7A 1ZEAH 5IW1A 1RJZB 1A4JB 5K9KA 4DGIH 2BOBB 1DDHB 1MWAB 4KU1A 3FCTA 5FUZL 2FL5A 1NLBH 4TVSa 4JRXE 1T20A 1ZS8B 5DI8A 3QDMA 5BJTA 1ZA6A 1INEH 3ARSA 3TJHD 1NUNB 5D2LE 3L5WB 5ITBL 3TV3L 1VPOL 4RBPK 4QYOA 3MLSH 4K7PH 5E4EC 5MENB 3VGGA 3B6SA 1K5NA 2GJZA 1KJ3L 4ZXBC 4HAFA 1KIRA 2OZ4L 5EU5A 4OUUA 2V7NB 2XKUA 3OV6A 5D7JD 3W11C 5BQ7B 4EN3B 1NAKL 4MGXA 3MNWA 1OSPL 5B38G 1OLLA 3L3HB 4NO0B 2EC8A 4H0GA 1VGEL 1H5BB 4UDUB 3DUUA 4JFOA 2VLKD 2V17H 3IF1B 5D5MA 2X4TA 5D7IA 3PGDB 3ES6A 3W0WE 3V0AC 1NGWA 2GK0B 3QAZB 5HHMB 3QQ3A 3GSWB 3U7YL 3U82B 1R0AL 4TSBH 1B6UA 4P2OD 4N0YL 2G5BB 1MRCL 2BVTA 3A6CH 5E2VL 4OCRH 4Z7WB 5DK0A 3QWOB 5KSVA 5KSBB 3FQWA 3BJLA 4G8GE 5GRJH 5IVXB 5F21B 1TMCB 3VDCA 4N0UE 1QSED 3UAJD 4HEME 1OGAA 4LVOB 1MHEA 2G9HA 4UTAH 4UIKH 5BRZA 5FYLD 4U1IB 3NPZB 3DV4A 5T1DH 5MHSD 1PW3A 4JY6B 5ETUA 2NY2D 3U7AA 2DBJA 3H3PH 5H94B 2XN9B 2F15A 2VWEE 4XCEA 1T1ZB 2XV6B 2FGZA 2YD7A 2V7HA 2XACC 2R29H 3MUZ1 5F6IB 5I2IA 1Q1JH 2XPGB 1WWWX 3QG6A 1K9TA 2B1AL 5E7BA 3SKUD 3T2OA 1P5VA 2OBGA 1VEPA 3GSVA 2GK2A 1T04A 3MRNB 5I1IL 2ADGA 2FHCA 2FH6A 3QUYD 1W0WB 4HF5L 4M48H 2QR0A 4JB9L 4OFKA 4AMKL 4ETQB 2FIKB 3EYSH 4PJGF 2X05A 4OCYH 5BS0B 3WFCH 4YGVB 3WIIH 3FQRB 1RK0A 3CVIL 5CEYB 2WV3A 3RL1A 4WI3A 3S97C 3RDTB 3TA3A 2CK0L 4H8WC 2OSLA 3MOBL 4JQXA 4M1CD 5CUSL 1ZLVH 3QSKB 3HZYA 5DD3H 3C08L 5DT1L 4KMLB 1GGBH 2DI8A 1S7WB 4S1DD 1H3TA 4LLVA 1KFAL 4PY8I 3MXVL 4PJ7B 4LDEB 4JM2D 3EFDH 4Y16C 3SDAA 4HZAA 2VMFA 5DDHB 3I9GH 2DQFB 3RP1A 5EU3A 5H35B 2PO6C 1B2WH 1LP9E 3N0PB 4PRBB 4NQDA 2VL5B 5IMKA 2R1YB 5MEPA 1INQB 3MV9D 2D0HA 5I0DA 5FF6A 5JW4M 2R0ZH 5IB1B 2AJXH 4YXHH 5HVHC 3JWOC 3UTPE 5GJSL 4OCXL 4DQOL 4G8FA 4YLQT 5ICYB 3OAZH 4Q9RL 4R90H 2Y25A 5HI5C 1BQLH 1G9NL 4MZ3A 5E8DH 2ARWA 3BJ91 5J06A 3LSOA 3ET9F 2FBJL 4Q9QL 3AB0B 4M61B 3SDXB 3RKPA 3WO4C 5SWQB 1S8DB 1FPTH 4EIGB 4ODSL 4U6VH 3CZFB 5FYJH 5DEFA 3O81A 3I3DA 4JVUA 1WZMA 3M45A 2HP4A 3QZWA 4LQFH 3K4DA 2IAMB 2EO1A 2VKWA 3PWPD 3NACH 3BZ4A 4WWKD 2EDQA 3VFTA 3PE9A 3VFGL 3WFEH 3CC5A 1Z9LA 2H26A 3D2UB 1NMBH 3O2WH 1P4IH 1S5IH 1UC6A 3L1OH 4JQVC 1QNZL 3IXTA 3O2DA 3VFWB 2HRPL 3O6FD 1KCVL 4RRPA 5ITFA 1JJUA 1O0VA 4AT6B 1QG3A 3VFUA 3UTSE 3BPNC 1BQHA 4HS8H 3K1KC 4PJCE 3UTTE 5IROC 5IHBA 4PJ5B 4WFFE 3PWUB 3GI8H 1CE1H 3CDGA 1MFAL 1YEJL 5KSAA 2VB5A 4LSPH 5JW5B 3WDHA 3ARVA 1OL0A 3QJFB 3DNKA 1A1OB 1Q0YL 4EQ3A 5LGHL 3CLEH 3TPKA 1L7TH 2VLRD 2IMNA 3ARWA 2DRUA 4NYLB 2BSRA 2AW2A 1ZT1A 3OKDA 2YKLH 5IMMB 1QLFB 5DJYA 4MXWL 4OZFA 4K71C 4XVUC 4KUCD 4H8WH 5AD0B 5DRZB 2HLAA 3ZL4H 5C0CA 3T4AA 5D96C 2J6EA 1WK0A 3RJQB 5J6GB 4P57B 4BFIA 2XA3A 1F6AA 2HAZA 2Q8BH 3EYQD 4K7PX 3JSSA 4E5XA 3DVNB 1F02I 1A6UH 1CIUA 2F54D 2FB4L 3QUMA 2H2PC 1IJ9A 3B5TA 4XNMA 3SHSA 1HQ4A 3AC0A 1F2QA 5D1QD 3I2CL 3NVQA 3AREB 3GIVB 3VWJD 3MRQA 3RZCA 3MO1A 4G6AD 5DVNA 4Y4HB 5T3XD 3STZB 3JWOH 1UJTA 3KGRA 1T7VA 4R96A 4EI5C 2IGFH 3GGWA 4OB5L 5JOEA 1V7ML 5AAMA 1RU9H 5IB3A 4I77H 5GRVL 4JPIA 3TCLA 4F58L 4H1LB 2G75A 8CGTA 2H8PB 2XTLA 5DJ6A 3ULUF 2HJLB 5HYSG 1IM9A 3MFFB 1BGXH 3X14A 4MJ6B 4YEEA 3TVMA 4MDIA 4L3EE 2JJTA 3U9PH 3OGCB 2E5EA 1A14H 1JZ7A 1R6VA 3CXHK 3DMMD 3BEWA 4R2GC 1NAMA 1C1EL 3O6MH 1ITCA 1JWSB 2VDOL 4NQSA 1DVFC 3RBGA 2R1XA 1EO8H 2IALA 4NZTL 4P3CH 3ARPA 5JW4Q 3RKDC 2B0SH 1T21A 5HI4D 3WNLA 4YX2H 3FT2B 4MXQC 5JA9A 3MV11 1A5FL 1HKLH 4K2UL 4XPFL 2LVEA 2VL4A 2F53E 4LDOB 4DKFH 1R5IB 3T09A 2WBJB 1FGNL 3BDXA 3LD8C 4OF5A 4UNTA 5C08D 2ZOKB 5L2KD 3MRGA 2EDEA 4UOW1 3ZDYF 1NGQL 1AGFA 3ULSB 2VYRE 3RHWF 4I4WB 2E7LA 4Y19D 1BBDL 1A4KB 1FL5B 3GKWH 4U3CA 3GRWL 3L3IB 1CD8A 3RIAK 4YHIA 5I8CB 4YHOH 1FC1A 3QCVL 1WC7B 5T3ZD 4U1LB 2HH0H 1U3HA 1IGFH 2FGWH 3IRZA 4JO4H 1RURL 2ICWI 4Y5VA 5AUMA 3WIFB 5D7KE 1A64A 1EEQA 1PQZB 4F7EB 4M00A 4RDQG 3HB3D 3G08A 2NW2B 3EDDA 4XPTL 4FQ1H 1UCTA 1Z9SA 4XNQB 1CYGA 2WIIA 2MMXA 5KS9F 6CGTA 2BZDA 1HSAB 1QKZL 1ZLUH 2EKJA 4C55A 4PJXA 3G6JA 3PL6D 2NY1C 4XPHL 4HS3A 5EBLA 3FO0L 5MERB 3DX9B 3X3FL 2YMXL 1WWBX 5GXBB 5DC0A 3MRFB 3RU8H 1U58B 1YY9C 1UADC 3LAFA 2DJSA 5CZKA 5ID0A 1DEEA 3CFBA 1EX0A 2MQ3A 2X4PA 4X4ZA 4WHYH 3DO7B 3CVHH 3TGXA 2VC2H 1KEML 5EIQA 4QHUA 2GJ6B 3KHQA 1G7HA 2OQJA 1MVFA 5HGHA 5A40E 3S6CA 1YYLH 1BLNA 1JE6A 3AXLB 3REVA 4IRJA 4YC2B 2X10A 3UZVB 1R5WA 4JAMA 3G5VB 3RX5A 3HI6H 1H3PL 1F58L 1FO0B 3BSZH 3KPSA 2JK5A 5DJCB 3KPQB 1QEWA 1FDLH 2D03L 3BN3B 3UP1A 1GPOH 3MLWH 4HV8A 3S3PA 4YDLB 4LF3B 2KKQA 2VLLB 2VDRH 4OZGB 1F3RB 4ELMA 4JO1H 3IAQA 2CKBB 3GJFH 5DS8A 5KAQG 4GAYA 3HE7D 1KIPA 3D39A 4G6MH 1YEKL 4S0SD 5LQBH 2V5MA 3VH8A 4RSVA 1EFQA 1MLCA 5TGBA 5TH2A 3T0XA 1A0QL 3U4EB 2A6JA 4WV1B 2NZ9C 3MLTA 1MFEH 4JJHA 4NM8L 1K2DA 5AYQA 2NCMA 4KKCC 5K9JL 4BH8A 5FXCH 4NNPH 1AFVL 2H3NA 3EO1B 2EYRB 1I8IB 3SKOB 3HG1D 3MLRH 4X6DA 2R0WH 4OBSA 3M8OH 4KQ3L 3B9DA 4KMTH 5D2LA 4YR6A 1KEGL 4JRYA 1NMCB 5JMRA 2XTJC 4HS6B 2DLGA 4HBCH 4NDMA 3VXSA 5GZOD 4JVWA 3D1MC 1A6AA 4OGYH 2F8OA 2YD2A 3PP3H 3ZE0F 4G5ZH 4RFNB 3MBEB 5ESVB 2GTWB 3X11B 3R8QA 2QADD 3EYFA 4GBXA 4Q0XH 2AK4B 4NCC2 1X5FA 4J12A 4XWGL 5DUBB 4ODWB 2J7LA 3KPTA 4UQ2A 4H25A 2HKHL 5CBAA 3O9WA 4POZC 5M95B 5I1DB 4OLXH 1GGUA 1C7SA 4HCRA 3GSXB 4NUGL 1Q9WA 3IU4H 4G6KL 2JKXA 4XB8A 5BV7L 1I3VA 4KJWD 2AQ1A 1FNFA 3KR3L 4R97C 3KPMA 3IKCB 2ADJB 3QDJE 2BY1A 3NZHH 4LHUA 3EJYC 5E2TH 4FFYL 3FONA 5FKAA 2M8XA 3MV8D 1RUML 5JMOC 4WU7A 4N0CC 3WJJC 1DBAH 3STLA 2DQGL 5C0JB 3MGOB 2BOCA 2H2SD 5JOFB 3WHE0 4N8VG 2WANA 4OFYA 3KWWA 5ECJE 5B39G 3HZVB 4AH2B 3BEVA 4J3UA 1UXSB 2CLRB 4JANA 1UXWA 1MQKH 3DX6B 3O3AB 5EU6B 2EEDA 1I1YB 5EN2A 1J1XH 1DE4A 3T1FB 3UJTL 3ARBC 4ZPVA 5C09B 4QGTA 5SX5K 4LLQA 2VLJD 2AJYH 4JLRA 5HDOA 2EDOA 3SPVA 1E6JH 2EZ0D 4N1HB 4PJEB 4F7CB 2H6PB 3OL2A 2FYYA 3KS0H 3FO1B 1HH6B 4JQIH 2EH8H 3ESUF 1B0GB 4PJBB 4XPAL 5EA0H 4ZAKA 1G84A 4JY5L 3LPWA