1RZ8B

Crystal structure of human anti-hiv-1 gp120-reactive antibody 17b
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
228
structure length
228
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of tyrosine sulfation and VH-gene usage in antibodies that recognize the HIV type 1 coreceptor-binding site on gp120
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab 17b light chain
total genus 43
structure length 228
sequence length 228
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rz8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rz8B01
2BJML 4PJ9A 4QOKA 1KB5L 5HDQH 1DDHB 4KJQD 4I3GA 5E6ID 4Y4KC 1LO3H 1IAIH 3O3BA 2IQ9H 4POZC 5GS2D 5GS0D 1D6EA 1I75A 4PRIE 3HRPA 1BX2B 2VUYA 3MV01 1C7SA 5E9DB 4JRXB 3OJDB 2DD8H 5HDOA 4KI5C 5DUBB 3UP1A 1I1AB 5F7YC 1WZ1H 4FZEH 1AGBB 1K8IB 1PYWA 2YA2A 3P9LB 3BIAX 2DQTL 4OCXL 7FABH 2ID5A 3AC0A 3TIDA 2GQHA 2JE8A 2X4RB 4PJ7A 2JKXA 1VESA 4R8WH 1AGFA 3F7YA 1KLUA 4DKFL 4LLAA 4L8DA 2J2ZA 1KPVA 1R5VB 4G6AC 2WP3T 2YPVL 2X1WL 3LKSA 1ZHNB 2EDRA 3QFJD 3FFCE 4KRPB 2LTQB 1GYAA 1F2XK 5CMAB 5IW1A 3MXVH 4I0PA 4LVHC 4N8PA 3N1PC 3VI3E 5C09B 4KI1A 3GSRA 4M4RA 1QSFA 2YD6A 3D9AH 5E8DL 3WDJA 4HUUB 4IMKA 2XG4A 3QUXB 4D9LH 5DD1H 3IAQA 3PWNA 1OGAD 1T5XB 2W60B 1EJ6A 3VXTB 2J5LC 3PIQA 1MH5A 1UB5B 1MQ8A 2ITDA 3IFOB 1CE1L 4RWHA 5E5MB 1BJ1H 5F3HA 4D9RE 3TPUB 5IGXL 1S7VB 3E8UL 3RNQB 1NFIB 2VISA 5E1HB 1T7XA 2IH3A 4GAJL 3P3YA 4ELME 1I1AC 4JFQB 3VWKA 4Z7UB 2ZPKH 5IB1B 2F5BL 1NL0H 2EIBA 2XY2A 3TZVB 3BQUB 1UWXH 4KK5C 4MMZC 1GC1H 3O6FB 5HYQA 4HCRL 4OZFG 4D0CB 1VEOA 1T1ZA 4G80A 1DUYB 1K6QH 4JFFD 5CS7A 4NKOB 4X80H 1JWSA 2DI9A 3W82A 3K8KA 1J86A 4X6CE 1U93B 1UWGH 3REWA 3T0DA 3S35L 2AJVH 3BSZH 4OFYD 1Q9OA 1A4JA 2DQJL 1HZHL 4KV5E 3OJ2C 1F90L 3DMMD 1HEZB 3MRNA 4PRPD 3A0OA 2HJKA 2KZ1B 1KC5L 1MFEL 4ZAKD 1ETZA 2XQBL 3OKKB 2FIKA 3K74B 1MHPH 4LARH 3IDYB 3SDXA 5GGSA 5J9PA 1NGQL 5SWSB 4PJHF 3IDXH 5IVZA 4KK8D 2HT4C 2UYLB 3D18A 4JFDA 4HZLB 4QXGL 4G8IB 5GRZA 4EUPH 1KEGH 4D3CL 3MOBL 3PXJA 3L9RB 2V7NA 2G5BA 5DA4A 2VXSL 3GGWB 2YPLD 1FN4B 3VXUE 1JF6A 4NSKA 3IYLW 3BRGC 1VFOA 3VXRA 4FMKA 4Y2OA 4ZUVB 4LSTH 3O6KL 1T7WA 4C83A 4LOUD 1RIVH 3S35X 3NIFF 2EEBA 1P1ZB 4O58H 2FIKB 5I30L 3GKZA 2DM2A 4Z7QF 2OP4H 3TF7C 1ITCA 3MZGB 4NUJB 3S36L 4YK4B 4NFDA 5IVOA 3SGDH 3SKNB 2IFGA 4JRXA 1BBDL 4NGHH 4JRYD 2APTA 3LY6A 5L2KD 1DSFH 1KB5A 4JPIA 1WCBA 4PJFA 4EXKA 2EDKA 4YQXL 4R26H 4NPYB 1K4DB 1HWGB 3S97C 2DM4A 2HKFL 4JDTH 2W60A 4NFCA 4LLQA 1UCBL 4XP5H 3QISA 2QSCH 3MOAL 2EC8A 3D85B 1D5MA 3QAZB 1P5VA 2A1WH 1NMAH 4ELMA 5AG9A 5E99H 4FQXA 4OKDA 3RBSA 4OZIB 5EU4A 1PYWB 2ADIB 3ULUE 5EU6D 4GBXA 2WBKA 1SJEB 3TNNB 1QO3B 4DQOL 3LKPA 4TVPE 4QHLA 3WXVL 5IKCB 4AL8L 2FBJL 3FONB 1E4KA 4AT6B 3ULSB 5EO1B 1JZ7A 4MAYD 1B0GB 3MROA 2EECA 1U8QB 5GRUH 2GY7B 1FG2B 3SBWA 2ZJSH 5T1LA 5IM7A 3QUKB 2HJKB 3BFOA 3SQOH 1G0YR 2F8OA 3F8UB 4P49A 1HHIB 4P3CH 3RUGF 4OM1H 4ZG1A 1WZMA 3R0MA 2RCSL 2R0ZH 5KJRH 4UTBH 2DM3A 1SBSL 1Q0XL 1IFHH 1ND0A 3MRHA 4EVNB 3VD7A 1FFPA 1WC7A 2PTVA 4KGJA 3S5LG 2H8PB 1FNSL 3RGHA 5CJ5A 1CDHA 1VGKA 1YZZA 4PG2A 3JV6A 4G42A 3CDCA 1S9WB 1CFTA 2NYYD 3DO7B 3MJ9A 3WHXA 1NBQA 1YNTB 3QEQE 5D1QC 3STLB 3T77B 3PNWA 4XPBH 4TSAL 1OAYL 3U0WL 4PGBA 4RWYL 1C16B 1DVFA 3BXNA 3BPCA 3U7WH 3MRGA 3VG9C 4QWWD 1T1YA 3ZTNH 4LVNC 2FB4H 3J7HA 3QO0B 4JE4B 4MQTB 1TPXB 1F4AA 1GPOL 3TBWA 3ECBA 1F6AB 1ZEAL 1N0LA 4HIHA 2HG5A 4ODHH 3QUZB 1U41A 2AVGA 3ECBB 3C5SA 4MA3B 5H37H 1BZQK 1N4XL 1IGFL 2VLLB 4HPYL 3QUZD 3BZ4B 2FSEA 5CBEA 4Z5RB 2NY3B 4WU7B 4A2LA 5C9JB 1S5IL 2Z31C 4U1GC 2VTFA 2Y06L 3LDBC 2ENSA 2QSTA 3B83A 4PLNC 3PWJA 4LLYB 2PXYC 1LNUA 2PW2A 3VFMB 3BWUC 5ETUA 5KS9A 5CJQH 4F8TA 3BKMH 5EN2B 2CD0A 2D31B 1KCRL 4GBXD 1TTFA 5GS0L 1EEQA 3QNXA 1YMHB 3BPNC 4PJHB 2OR9L 3DXAD 4Z7WF 5KSAA 4KDWA 3MLUH 4ORGA 4LBEA 2HN7A 5ITFA 3VDBA 2ZSWB 1BVZA 4MDIA 1KJ2B 2FJGB 4HGWB 1BJ1J 2HVJB 3WNPA 3QNYA 4ONGL 2ESVA 1K9TA 5MP6H 1CXLA 5KOVC 3S3PA 1ZT4A 2X9YA 1U8KA 2CJUH 3EHBD 5F1NA 3BO8B 1JWMB 4XHJD 3MLXH 3HE6C 1B6UA 4ZFOA 1UA6H 3ARGC 1F4WH 5F9WC 2IPUG 1ZWIA 4HH9B 1KIPA 3V4UL 3D25A 1N2RB 5HHOE 1U6AH 4IRJB 3VMPA 1YEFH 2DN7A 2NY2C 1QSZA 2Y5TA 3GNML 1FO0B 5E2TL 5FDWB 4KVNH 1EJOH 1JGVH 3UYRH 3QH3B 5HHNA 2OJZH 2YUWA 3KPRD 4WCYL 1NDGB 3LQZA 4PJEA 4JG1L 1CLZL 4PJBB 4XPHL 5B3JF 2APFA 2X4NB 3A6BL 1CD9B 5JZ7D 3L3IA 4QY8A 3H7BA 2ZSVA 3KLSA 5FHBL 5JOFA 1K5NB 2ZCLL 2H26B 5J1TC 2LFGA 3O9WD 4YFEA 2HP4A 1LDPH 2P44B 4M7LT 3UJJL 3QUMB 2NY0C 1XR9B 2W9EL 1T0MA 3W9EB 4X9GA 5CIPA 4L9LB 1J1XH 5LAXA 5DS8B 5JHDA 3O3EB 4HIEA 1FE8L 3DHJA 3IJHA 3KYMB 5EA0H 4U2ZA 2IFFL 3JWDL 1TJHL 3P11L 4L9LA 3G6JE 4F8QA 4NWUL 4C56A 1DE4B 1Q94A 4ZMAT 2IADB 1LO0L 3D39E 4POZD 2D3VA 2X70B 5C0GA 2R56L 4S11A 1ZAGA 1Z3GL 1KT2A 3TN0A 1UXWB 32C2B 3NFSL 4RGMC 5TJWK 3EAKA 1T83A 2I27N 1FC2D 5DJXB 5H37G 4NSKB 1AIFA 1RULL 2EH7L 4C54A 2X4NA 4JRXE 3IDGA 1R24A 4WW2A 5FYLL 1BZ7A 2E3VA 5HPOA 1N5YL 4Z9KB 1AGDB 2PXYB 1WBZB 4HWUA 1T2QL 1TQCB 1AGCB 3E2HC 4MQXD 3CX5J 4PRHB 2G60H 4RGMB 1U8IA 3EYFA 5F7MC 1CFVH 5E8EA 4PRDA 3VFPB 3OBAA 1JF1B 4I4WB 1L6ZA 1N0XL 4G6KH 3TBWB 3FOMB 3RU8H 4IOIA 5C6TH 2MCPL 2P8PB 4W4NA 1SJVA 2BNRD 1CGWA 4MVBC 3HNTH 4ZAKA 5J13B 1IKFL 5ISZE 5C0JB 5CLWA 1ZS8A 1N7MH 3KPSA 1FSKB 3RP1A 3MNZB 4XBGB 1A1MA 2HYMA 4I18A 2F58H 4M1GH 3D1MC 2NXYC 2BVTA 1D6EB 1TJGL 1CGVA 4G8EA 2QHLA 4JDZB 4QTIL 4PTTA 4F57H 1X5KA 5B39A 2NX5B 3O6FD 3JV4A 5EOCJ 1YNKH 1UVQA 4XCEA 4HWNA 2ZSWA 1AFVH 3KPMA 2VXUL 3CMGA 2D7QA 1YYLL 3D0VA 1IJ9A 4EOWH 2BFVL 4NBYB 4GRWF 1UADC 2F9BT 3MBEC 4KZDH 4FOMA 1KCKA 2DI8A 2AJXL 5I16B 5FDWA 1PSKL 4KUZH 5IW6B 5I8OL 5C0BD 5DRZB 3D25B 1B4JL 4PJAA 1T20A 2JJWA 2NY5C 2VE6A 1B2WL 3UJTH 2J3SA 4ORZC 4X5XA 5DO2D 5F89B 4JFZH 5IQ7L 1NBZA 3ARYA 2QJDA 2HLFD 4OF5A 5JIIA 4PJ9D 4PLOB 1MCKA 1XF3B 5I1CH 1L7TL 5B39B 1IT9H 3CC5A 5CEZL 2LVEA 3GHBH 3REWB 1FIEA 5LQBL 3E6HB 1CU4H 1T4KA 3FL7A 4XBEL 5EZIL 1A7QH 2WIMA 5JMOC 5L9DH 3MRLB 3VWKB 2A9NH 3O8XA 4WVRA 2F5AH 4O51B 3UTOA 3WNKA 5FFLA 4KVCH 3CFDB 3GSWB 1HHIA 4JZOB 4HBCH 4UAOB 1LQSR 4O51A 4JHAL 2D7OA 2UY6A 4JKPH 4M6ML 5CHNB 2DLHA 4X7CC 3E0GA 1INQB 1V5JA 2J6EA 1JNHB 3BJ91 1AKJD 3SDCB 1QBAA 1FZMB 4JG0L 3BKJH 2VLRA 4IEFB 2GUOB 4M7KH 3ARPA 2R4RL 4YUEH 2BVQB 4MYWB 1P6FA 3UAJC 2VITA 5GRJH 4F7TB 3HI6H 1NJ9A 1UCTA 3GSQB 4WHTA 4HQQH 1QBML 3MRLA 3TT1H 3QDMA 4JGJA 4PR5A 3M8OH 3QXUA 4K3JH 4NQVA 3VFTB 4Z78B 4MNQE 3TIDB 4XCCH 4HXBH 3WHE0 3DTXA 5IFJB 5FO8B 2FJHB 1NUFA 2E7MA 3GZKA 5DUML 3MLTA 1OSPH 5HYIA 1A1MB 1UWXK 3LMJH 3AMKA 1JHLL 1XH3A 1B9ZA 3LKRA 4E0RA 2VDOL 2OM5A 2MHAA 4O02H 1VACA 1EHAA 1P5UA 3OAYK 4DN4H 3BUYB 3C6LC 3HE6A 4KJPC 3V6FB 1PEZA 4B7IA 5E6IC 4J3WA 1J0JA 3EKCA 5D71L 5GGTH 1A4KA 3WFCL 1WUNT 1AQKL 1HIMH 3MRHB 4ZUTB 3GI9H 3P4NA 5DJDB 3X17A 2VDLL 4MXWL 2C3VB 2DQDH 1ZVSB 1OOAA 5GZNC 3CU1A 5SX4H 4MD0A 3D2UB 1JHKL 1JPTH 5EBGA 5DUPL 4X6CB 4KHTL 1A5FH 1R3IH 1EEZA 1HQRA 5FHAL 4RQQB 5T3XH 2AW2A 3DV4A 4U1IA 3MACH 3IFOA 2IJ0C 4EBQH 4DOHB 4JDZA 3RKDD 3NBNA 3DX7B 4S1RL 5EZJB 1GZQA 5EU5B 3VDCA 4YEFA 5C0AD 3I6KB 1IEAB 3SY0A 1HSBA 1IC4H 4FN0A 4HXAL 3L3JA 5IKCA 4ONHA 5ITBL 4ORGB 4OUUA 4RISH 2FLBT 2OJEB 2KUTA 4DGYH 5EU6E 3QUMA 3T0ED 4YBLB 3DXAB 4JN1L 4DZBA 3WFZA 2E9JA 5HBBA 2R29H 5HHMB 4FP8H 1IC7H 4MNHB 5HGBB 3IJHB 5SWZB 4JQIH 3B2UC 3AB0B 3HUJB 3HNVH 5ADPH 1L7IL 4JVUA 4IRZH 1H3GA 4E41A 1DVFD 3GMQA 5IBLC 2EDTA 4CMHC 3O3EA 1JZ3A 1KENL 3CSBA 4J4PA 4CKVX 2DWDB 2IC2A 4BFBD 2H41A 3KPQB 5L8KB 3LEVL 2XG5A 2PXYD 1AY1L 4BZ1L 1VDGA 3EGSB 4BQ8A 4G7YH 5IT2L 3LB6D 1KOAA 3MRJA 4PJCF 3LPGA 1MAML 4K23L 5ECJE 3VFVA 3GMMB 3UTSA 1EVTC 1KJ2H 1YPZB 4PRHA 1GGBL 3LEXB 3NH7L 4HUVB 2D2OA 3ME0A 5B8CB 3SHSA 4PUBL 3Q5YA 4JPWL 2D0GA 4QCIB 4FFVD 5F3BB 1MFDL 3IAPA 2A0LC 4YDIL 2L7UA 4QRQB 5CILL 5D2LB 3BW9B 4ELMF 1FVEA 4PJEF 4EJ1C 1YECH 2GITA 2YBRB 4YDJB 3VWKD 5I0ZA 3BZEA 1WFTA 1AP2B 1AHWA 1OCWH 2P5EE 3ARDB 2XA8L 4HX1B 1ZA6A 5ALBL 5EU7E 3SGJC 1RIUL 1X5YA 2AKRA 1ZGLB 5E7BA 4TPRL 2KZWA 3CFJA 2HH0L 5EZOL 1ZS8B 4HZLA 5JIKA 4QRPE 2H9GA 3P0VH 2MWCA 5ETUB 4LCCB 4EN3B 2A9ML 4HS3A 2Y6SC 4YXKH 4Y1AE 3PXHA 5IFHL 3GBML 2VNCA 2O5YH 1XIWD 3HPLA 5EC2A 3V6BR 4E9LA 1NANI 5B38G 1BQLL 1RD6A 2VABB 1UZ8A 3L95A 1DVFC 4WUUB 3EO1B 1MSPA 4LBEB 4X6DF 4ODXB 3ZKXB 1MJ7L 3HB3D 5DVKA 1SEQL 4IDJL 5ACZA 1IGIL 1IGJA 4JRWA 2XZQL 2AK1L 5IW1B 5C0NC 2D9QB 3NIDF 2CUIA 1CXEA 3WNOA 1HE7A 5I8EA 1IAIM 3WE6A 4N90E 5AEAA 5HYJA 1F42A 1AGFB 1MF2H 3QRFM 3TYFA 3T1FA 3V7AG 4LLWB 4NWTH 4TQEH 4DZ8A 3I6GB 3BRFA 3SE8L 2MJWA 1OPGH 3HZYA 3TBTB 5DURD 1KEML 1R3HB 4Q6IB 5A16A 1I3GL 4U1GB 4TSBL 1A9EB 3RDTC 5FUZH 3SOBL 3FOLB 3NN8A 4M7ZC 4R90L 5EIQA 4LHUB 4HJJL 5FGRA 3VJ6A 2Q8BH 4U1LB 4PS4H 1ZT4B 2E8YA 4Y5XA 1ZOXA 3WKML 1J5OL 2Z91A 4N90D 5F71A 1IAII 4GKSB 4JM2B 2HVKB 3I75A 2CUMA 4OF3A 2FCBA 9CGTA 1CVSC 4GKNA 1JMXA 5DMKA 1KPRB 3PGDA 1IAOA 1OGAB 5HY9A 3PNWB 1RURH 3W81A 3VFNB 1S9WA 1REIA 2DIJA 4XMPH 5CZXD 1S7TB 3PGFL 5CWSB 1W72H 3QUXD 5IF0B 1A2YB 3JWOL 3P73A 4GW5B 4UV4H 1UM4H 1F58L 1J18A 4IDLA 1T21A 5FYJH 3EYOB 5T33H 4ZXBA 3QEGL 3RJQB 3GMRA 2VZTA 4WEBH 1G6RH 3UXFA 5IESL 4WUKL 3F65A 1U8HA 1GIGH 1VFBA 4Y16D 3ARGA 3SDXE 3NCCB 3G04B 3VCLA 4P5KB 4XVTH 4X0KB 5SWZA 4ODVH 1JV5B 2D7TH 4CRPA 1OW0A 4H8WH 1A14H 3ARGB 1C5BH 1ADQL 4Y89A 5JW4N 2E6QA 2XPGA 1XIWB 1U92B 1FORL 1MCLA 1A1NA 3DYOA 5DD5L 4RMWA 1R0AL 4EI5C 5I1DB 5BS0D 3V0WL 5I18H 2OK0H 3WEXA 3L95B 1G9NH 2UUDH 3V6OA 4Y4HD 1RJYB 1YY8A 2Q8AL 1AP2A 2F54A 3S3SA 4G5ZL 4KROD 2FRGP 5F1IA 3MODL 1C16A 4LEXH 3DV6B 3MV7E 2NX5E 1RY7B 4GBXC 3PQYD 2AV1A 2WINA 4JAMB 4PJGE 4JY5H 3FMGH 5F9JB 5T5NF 3WE6B 2FJFA 3BDYH 3HR6A 1GGCH 2R39A 4P46A 4WO4D 4XAKD 1T66D 4P59H 1IGML 3CVHL 3OZ9H 1ZHLA 4LLQB 5GGQL 4IMKC 4EUPB 2FECL 2DTSA 4ZS7H 2XKUA 4TSCL 5CBEB 1X4ZA 4AYFA 4FQQA 4LDOB 4HWEH 3WXWL 1FZKB 3MV7D 5KSVA 1PKQE 5BVJB 1P6AB 4JPIB 3PHOB 4Y16A 4PLJD 1NC2D 4TVPL 2AQ3A 3DUSA 3IVKB 1A7NH 5F1IB 2VAAB 3I50H 1JYWA 2J4WH 4Z76B 4LSRH 1UH2A 4P2RE 5DVLA 4X6BA 3U82B 4P2QB 5GIRB 3PWNB 4P2OA 5E4EB 2D9CA 2O93L 3X3FH 3GSVA 2I26N 2JJTC 1O7VA 4QNPF 3LV3B 3ZSSA 3GSXB 4KJPD 1HQRB 4OQTL 4XVSL 1MPAH 3ZE2F 1G7MA 4HDIA 1OGAE 3R8BB 4GBXB 2EZ0D 3RVVC 1MREL 2UZYB 3DIFA 2VKXA 4AT6A 2EH8H 4Z7QE 3VXNA 2A6DA 4UDUB 5F6HJ 4BZ2L 3UTTD 1NCWH 4OZGA 5BMFL 1IGTB 4PRID 3M1BB 2YPKA 5DJZA 4KTDH 5L2KB 1TIUA 2Z9TA 5IBUB 5GZOC 2AERT 3CCHA 5CSZB 5FCUH 1M7XA 2JIXB 2NY6D 3FO1B 3IXTB 4GQ9L 4U1MB 2D03L 2GYSA 3VXMD 1RZIB 1X5XA 4Y19A 1XF1A 2XKSA 3OB8A 5JLZA 3P4OA 1AGEA 3VXPA 4U1HA 1CZ8H 1GAFL 5FA4A 8CGTA 3V8CA 2J88H 3G6DL 1GZPB 5DJ0A 1FO0L 3DX9A 3DSFL 3UPAA 1IZKA 4Z78A 4LMQE 1DBJH 2CPCA 1FVCB 3L3OA 4Y1AB 4GW4B 1IGYB 4G6ML 3L9RA 1OM3H 3PDGA 2BC4A 4WY7L 5E2UH 2B4CH 4ZO7A 1QEWA 5D1XB 4YX2L 5GJSH 1S7WB 1OAZL 4HD9A 1ZLWH 5SWSD 1TNMA 3IXAA 4WI6A 1ZA6B 3AREC 2P47B 5I66A 1FL3A 2VWEC 4UILH 3K2MC 4Y2DB 4YDJA 3B4NA 5KVFL 2A73B 2J6EL 4MXVF 4L8BB 3V5KA 1MRCL 1RUPH 5J57B 1A6VH 1JGDB 2BDNH 4G8IA 2GT9A 4QT5B 1T89A 4RGOH 3EGSA 3TJHD 1TNNA 2R69H 3CFKB 4J3XA 3DTXB 4XC3H 2GUOA 4XNUH 2YEZB 4G9FD 5A3ID 5ISZD 3VFVB 4DFIA 4U7SA 5IHZA 1OT1A 3GSNH 2X4RA 2XY1A 5D5ME 1TVBB 2XTLA 1N64L 4PJ7E 5E6ZA 4XNYL 3P0YH 4L4VD 4F80A 5K9JH 2HLAB 4D0BA 4K3EH 3QIWC 2DLEA 3PWPD 1ZHNA 1OF2A 4AIOA 3VFTA 5HHXH 4FFVC 4F7CB 4JQVC 5EC1B 3MLZH 3OKEA 2UZIL 5DJ6A 3BPNB 1BZ9B 4G9FB 2BY3A 4Y2DA 4ZYKB 3N9GH 1BQHB 5I17B 4M6AA 3HUJE 3FZUD 4QTHB 3ROOA 2C3VA 2DQUH 3KXFB 1JMZA 1T5XA 4XXCA 2IMMA 1AXTL 4EUPA 1F4XH 5BRZE 2VISB 1MFBH 3DV4B 1P4LB 2ED9A 3MRKA 3RA7H 3RZCC 1I3RA 2IANA 5C07A 5C09A 5EU5A 4DUWA 4Y4KB 2ITCA 3VG0H 4PJCA 5B3NA 2H6PB 1NKRA 3L3GA 4HUUA 2HFGH 2AK4A 2JK5B 2WW8A 3CX2A 5DWUH 1NFKA 3GSNA 4MNQD 4N1HB 1VKXB 4ZTPH 4ONOA 4OGAC 4HC1L 4R3SB 5IGXH 3H0TA 5L2JB 5J89A 1WWAX 2DLFL 4Z0BL 4QHMA 3TZVC 1IQWH 1J8HD 1D5IL 5GRVL 3T0AA 4W70A 2CK2A 1QLEH 4I77L 4WWKB 1Z9LA 1HH6A 1R5IB 5DMKB 3F6LA 5KANG 2M8XA 3TC9A 4UT9L 1BIIA 5TDOA 5D7LA 4TNVF 1MIEH 4H88L 3ZKSD 4KJYB 4LLMA 3IFNH 1K6QL 1UQSA 3CFDA 5FO7A 3EYOA 4XNQA 5LGJA 1YQVL 4F2MA 2DQJH 1ED3B 4GKOA 5GZND 3VI3F 3D3VD 5FYLE 3DI2B 1XCTA 4Y2DC 4ZFZA 4QOKB 5B4MC 1X5LA 4X5WB 4U1JB 2WUCH 3DHMA 2V2XA 5CZXC 1C12B 2NY5L 5KAQF 4TUJB 4LPTA 4Y5VA 4WW2F 1T22B 1DTUA 1NGQH 3L5WB 4LSVH 1A9BB 1J1OH 3IDXL 3P4MA 3U4BL 3TA3D 3LKNA 3BE1L 3H9SD 1RZ8A 1WT5A 4M93C 1U2HA 2P5WA 3O6ML 3ARED 1DLHB 2Q6WB 2ZCHL 4TVSa 4Y4HA 5EG6C 3ILQD 3SE3A 4PRPB 3DGCR 1MCRA 4L4JA 1R24B 1TZIB 4FABL 1INEL 3U1SH 1BAFH 4KAQL 2DICA 3QHZH 2R8SH 5CHNA 1E28A 2CH8A 1I4FA 1CIDA 3FQUB 3GHEH 4N8VA 1QEWB 5D1XA 1TCRA 1NLDH 2YMXH 4FQCL 3PUCA 1WTGT 2HTLC 3V52H 4NP4L 3ARVA 4XMLH 3QJFA 1XCQB 2YD7A 2XWJA 1JV5A 3MV8D 2QBWA 3BUYA 2P7TA 1Q9LA 3KLHC 2VLJD 4HEME 2FJFB 1GC1C 3TV3L 1E6JH 5F72S 1V3JA 4G8GA 1M7IB 4IS6A 1NH6A 2A83A 1UXSA 4JKKA 4AIZA 5IB3A 3P4LA 4KI5F 1EO7A 3RFZC 1BM3H 2K9UA 1MNUL 3JTSB 4XTRD 1DBAL 3RVVD 3PP4H 3MCLL 4PJDB 2VR4A 1U8OA 3TYGL 4LU5L 1C5DB 1KF9B 1PG7W 3T4AB 1LO5B 4R26L 1U8PA 3D0VB 2EDJA 2YD4A 1U3HA 1ZGLM 4HEPG 4OCRH 3BI9X 1RUAH 2G9HA 5MI0B 2DJSA 3EOTL 3GJFH 4HULB 5C0IB 5T5NG 3T1FB 3O3DB 1UKQA 4JRXD 5E8OB 5INCB 3MBXL 1EAPB 4RNRB 1AO7B 3BIBX 4OV5B 1XR8A 3PL6B 4QRUB 1T1WA 2BSED 2P48B 4HAFA 3EFFA 3E6FA 3G6JB 2DAVA 3QPQC 5SV4A 4AM0A 5LCVL 4O4YH 2HRPH 4ODTH 5J11C 2QQLL 5ESVA 2M1KA 3Q3GB 4OLUL 3BESR 3QNYB 4PV8A 3UZQA 3OGOE 4W4OA 3UTQB 2YRLA 1P4BL 3O4LB 5JW3H 1CE6B 2VAAA 4V1DA 2NZ9D 1NGPH 2VLJB 4OM1L 1WAAE 2IADA 3U4EA 1KYOK 3MLWL 1CL7H 3RKPA 2X4OA 2F53B 4N0YH 1EEZB 3V7AE 2EKSB 4K2UH 5J12B 1KSRA 3HHRB 4NM8L 1NLBL 1YDPA 4MQ7A 3GM8A 4PRNA 2AGJH 2PW1B 3GO1H 1A3QA 4MAYA 3WS6C 3NOIA 2X70A 3P4OB 1FNSH 1KTDB 4FQLH 2OLDA 4QHKI 1O0VA 1F13A 4B7LA 3DJ9A 4OGYL 4G3YH 1UM5L 2O5ZH 2GW5A 4M48H 1QRKA 3GJFA 4G8FB 1D6VH 3IDGB 4ETQB 3TWCL 1ZGLP 1QFWI 4DGVH 5HTSA 5I1AA 1FNFA 4M5YH 1GL4B 3O4LA 1T1XA 4KI5D 1FV1B 3S98A 1Z5LA 5LXGH 3VRLE 1NFDB 2NXYB 2Y4SA 3B2UD 5I1GH 5TQ2H 4RBPK 3MLSH 2JCCA 1EFXD 1L4IA 2UZXB 4R7NA 2AKRB 3C08H 1H5BC 1TVHB 4LMQI 2K3TA 4PY7A 2VAJA 3W0WA 3JTSA 3V7MA 2IAMB 5CD3B 4N68A 4YBHA 4GUPA 1FNEB 1L0XA 1YN6A 4LF3A 1OARH 3BKCH 1IAKA 4XP1H 1FLRL 5FV1L 5IJKC 2R4SH 3ISWA 3T4YB 3T4AA 3DRQB 3U9UB 2N7BA 4S0TD 1UZ8B 3OG4B 3W39B 1TETH 1Q9LB 4Z76A 2EDLA 3GJFB 4G8FA 1XCQA 1J8HB 1QLRB 4IJ3C 1UT9A 1H5BB 1IM9B 4H1LA 4HUWB 5EBLA 1FNHA 2A83B 3V5DA 3HMXA 3DVFA 4E5XB 3WMSA 4PB0L 1YYML 2CLRB 4MD5A 5I2IA 4IMLB 5HVFB 4YDVB 4M1DL 4YFLF 1F97A 5F8RC 2HKHH 2ZCKH 2W9DH 2VDKL 1XAUA 3VRJA 1U3JA 4TTDD 4BSWA 3LS5L 2GCYA 2BSRB 3DVNA 3S3JA 4NZDA 3IU4L 3GRWH 5AYUL 1HHKB 5B8CC 4X6CF 4KK5D 3DX8A 3QAZC 1I8LA 1CE6A 3QG7H 3SE4C 3T4YA 1J7VR 1VACB 4Z7WB 4X6CA 4N0UA 1PAMA 3VFWA 3FO0H 3PHSA 1UXSB 3ZE0E 4AIZB 1G7HA 2YN5A 3C5ZC 3L3GB 4XCYA 3RY6A 1X7QA 1IEAA 3ZE1F 4L3CA 3T2QA 2NLJA 2CRZA 3DUHA 1U8LA 1U8KB 2CJUL 1U2CA 2E7HA 4F15C 1ZHKA 1CFNB 1EK3A 4MX7B 2RHEA 3RL1B 4N1CA 4UT7L 4PY8I 3ROLB 3FQNB 5D7SH 5FYJD 3GMNB 5KSBE 1NC4A 1HOCB 2BHUA 3FQTA 4L4VB 1I8KA 5CUSL 1NUNB 4MQXC 2QHRH 4GKZA 1RHFA 3HZVA 1NKOA 5E08H 1JRHL 1ONQB 3VW3L 3AB0C 1UJ3C 2HMID 1A7RH 1FDLH 3MA9L 4L8SA 4YXHL 3WFDL 1P84J 1AJ7H 3MZTA 3NVQA 1EGJH 4NYLB 5I1KL 3CXHK 4I3SH 2PN5A 2MPAH 1FFPB 5I1IH 3OR7B 1MJUH 3NAAL 3L6FA 3V6OE 4PY8J 1G9EA 2GJZB 4V1DB 4HMCA 2ZKHL 3U36A 2JJTA 2YUVA 3JUZA 2NY4B 3GMPB 4RFEB 1FCCA 1CR9H 5IROC 2I07B 1I3UA 5MENE 1T4KB 3QCTL 4LLYA 1I3VA 3VFSA 4NQVB 3FO2A 3QI9B 4MJ5B 1FZJB 1V7NH 4WDIB 1TQBB 1ACYL 4NRXB 3K7UA 4R4BA 2RJMA 4XH2A 5DRNA 3EJZC 3H9SA 2OI9C 4F7CA 3QRGH 2JB6A 4RAVA 5FO7B 5KS9E 2EYRA 2B1HH 3QO0A 3KR3L 2Y72A 3CPLB 4RAVB 3NFPB 1OAXH 2W91A 5KOMC 4MNGB 2MHAB 3SDDD 2YSSB 3AVEA 5JXAL 3HCVB 1BWMA 1K4DA 2H1PH 1FAKT 3L7EA 1DBMH 3QIBC 1SJHA 4RMUA 1X5JA 3HG1D 1M05A 2CO7B 3A67L 1HYSC 2ZZUT 4OLWH 3MBED 5GS3A 3HE7C 3RWGA 1DFBH 1FL5B 1RUMH 1AI1L 3C8KA 4P4KC 2YD3A 3OSKA 4KDVA 5IFAH 1QKZL 5CINH 5LGKA 1YN7A 4OLXH 1UJ3A 4JO1L 4DKEL 4JGUA 3IJYB 3RWDB 3LEYH 1J0ZA 2BOBA 2APXA 1LNUB 1L0YA 2OX5A 1IC5H 4OZ4A 3TCLA 4E41D 2X09A 3NCFB 3ROOB 4PGEA 5IHZB 2X10A 3S4SA 4ZUSA 4HK0B 1ORQA 3O6LL 4YHMH 1F3JA 1TCRB 3TGXA 3QJHB 2XZCH 3GIZL 1OD9A 2HLAA 5I16A 5I1LB 4LSSH 4LGRB 1KN4L 5C08E 3LN9A 5L6YL 1HXMB 4NM4L 1J87A 3QEQA 4JM2D 2B5IC 1MCHA 1SEBB 2ORBL 1NC4D 4M4PA 1GZQB 3HS0A 2IH3B 3HN3A 3DX6A 2XNAB 1RFDH 2EIEA 5SV3A 3QP3A 4YEEA 1AKJB 2GK0B 4M62H 5EU3A 1BWWA 4M6NL 1T3FB 2EIZB 2VYRE 4KUZL 1K4CA 3S7GA 2IBZY 1MAKA 1B4JH 5JW4R 4TVPD 5GS1A 4OCSH 1U9KA 3NIGE 5T5FL 3MV8E 4P2OB 15C8L 3QIBA 1GZPA 3FTGB 4G43A 4UQ2B 5EU6A 2CGRH 5CEYB 1CIUA 3B9DA 1AGEB 2AV7A 1F3DH 4HIJB 4LGSB 5J3HC 3SDXB 4OF7A 5C0DA 5KSAD 3TFKC 1NCDH 4ZSOA 4MZ3A 4KRNA 5JOPD 3VU2A 4U31A 2X05A 1ZLSL 4ESKA 1NDMB 3DYMA 1A4JB 4XBEH 3IXAB 2VDNL 5IR1A 1LE5B 3MLPA 5C2BH 4GRWE 1MWAB 3P73B 4GW5A 3MNVA 3QCUH 4KKLC 2VH5L 4R4ND 4DVBA 3L5XH 1AC0A 1DDHA 4DEPC 5DRWA 2EDYA 2G2RA 4H26A 4GG6F 4FQ1H 2BRRL 4UOJA 4MJIA 4JY4A 1BX2A 2XYCA 1D5BB 3IFLH 4JKPL 4M6MH 5EUKA 5TDNA 4CW1A 4DWHA 1I1YA 1YY8B 1RUQL 5ADOL 5KSAC 1H0DA 3EZJB 1WSST 4JY4B 4W6YB 3TM6A 1DBBL 5E4IA 3N85H 4Z0XA 3RVWC 1JZ8A 5ILTL 3OAUL 3W0WE 3ZZ1A 1JBJA 2NR6C 4HJGA 1C1EH 1FN4A 3OX8A 1FQ9C 3MYZA 4LVOC 1C7TA 1PX4A 4OFIA 2FH6A 4Z5RA 4YWGH 5EOTB 3WJLA 1J9CT 2DDQL 4O00A 3K1DA 5EFIA 4DVRH 5AD0A 2DBLL 4IIQA 5E1AB 3ESVF 1EZVX 3SJVA 3HE6D 3MFGB 2XFXB 4HKZA 3BN9D 2VLKE 2DLTA 5L7XL 3DV6A 2AI0L 3X13B 3INUL 1KIUA 3TCXA 5JPNB 5C07E 4GRLD 3WIHL 2D7PA 1G7LA 2WLYA 4AH2A 1HILB 3QUMH 2GJ6B 4S1SL 3NZHL 3QUXA 5E2JA 1QFWL 4P46B 1C8PA 1EXUA 5HHOB 4ZO9A 4XGZB 3MMEA 1QSEB 1SY6H 2RFXA 3T8XB 4CVZB 2VZVA 3K3QA 3KJ6H 5IVXE 3LSOB 4YGVB 1Z6JT 3SDAB 3CFEB 1XFPA 1SM3H 2EC9T 1KG0B 1LK3L 5I76A 3U2SB 3KVQA 2Y23A 3QPXH 4ZQKB 4EZMA 4YHKH 3HPLB 2F53A 1XF3A 3BDBA 3JTTB 5BRZD 1DLFH 4U1LA 2NTFA 1FIGH 4ZD3L 1RK1B 3RWJB 1NDGA 5I9QB 5EOCL 2I24N 4WW1A 1A9EA 4LASH 3SJVB 5CGMA 3MUGA 4LCYB 2VDLH 5HHPB 2CLRA 4MD5B 2DB8A 3UTQA 5I2IB 3KPRA 4PJHE 3VXTA 5C07D 4XNMA 4OD3L 5HHPA 4XPTH 4Z7UF 5EU7C 1CE1H 4YLQT 1F3JB 1A5FL 4O9HL 3M17B 1T03L 3MRRB 4BM7A 1OB1A 3T2OA 4FFYL 5IB4B 5JHDB 2UV3A 1JNLL 1I8KB 3FAWA 1NBYB 5BOPA 2AXHA 4DZ8B 3JV6B 1CS6A 4G42B 3S36X 4CDHA 4HKJA 1CGSH 1KG0A 5IBTH 3U2SA 5I76B 4J4PD 1A2YA 5T3ZE 4UIKH 1B0RB 4O2EA 3KHOA 5ITBH 5GRYA 5I8CA 4UV7H 1K5NA 1EGJA 4DGYL 3MOQA 3V4PH 3BSZL 4DN3H 1X7QB 1Z9OA 5KVDH 1CBVH 3NTCL 3O81A 2X4TA 3N1FC 2CQVA 1JWUB 5GGVY 3BRDA 4XT1C 2VL4A 3I3BA 3V6OC 4PJGF 3L3HB 2JIXA 2DTMH 1DUZB 2H2SD 1QD0A 4ZNCD 5MEOB 1X6LA 3K2UL 3QXWA 3A6CL 4WHYG 4TUKL 1N59A 4I18C 3WHXB 1IM9A 3BJLA 4H1LB 5EBLB 4UNTA 5CZVL 5EFIB 1BFOA 5KW9L 2LV4A 2Z0BA 3E1F1 3SKOB 1N6QH 2WIIA 3BX7C 4MA1B 3QFDB 3IETA 2V6HA 2DRUA 4JPVL 4WJ5B 5EOQH 2WINB 1FZJA 3WLBA 4OAWB 2HTLD 4PJ8D 3AGVA 3FQUA 3S37L 3QDJD 1A1OA 2YD8A 4K23H 5D2NB 5DQJB 5FF6B 3C60C 3TA3A 4GUPB 1WEJL 4MNQA 3O2DL 5ID0A 1A1OB 3DNKA 4U2YA 4HS6B 3RPIB 3P40A 3X11B 3SGKA 1UACH 2Y36L 5BZWB 1KFAH 3CJJA 3DETD 4HFWA 5DJ8B 5IMLA 1P1ZA 4P99A 5E70A 3DUUB 3P30H 4PGCB 2XFXA 3GK8L 4QOKE 4JQXA 5MEPB 4WUUA 3VG9B 1CWVA 3GKWL 1H0DB 4N0RA 1S7UB 3WBDA 4Y1AD 4PTTB 1ZGLA 3UTSD 1DBKL 3VFGL 1AO7D 4PGJA 5EORL 3VWJB 2OZ4L 3MJ7B 4BQBA 1YJDC 4AQ1B 5LWYL 1CDCA 5ANMA 4R4FL 2ARJB 5F9AC 3CDGB 2VSCA 4M43L 3GSUB 4XNMB 1J8KA 5E8OA 3ALWA 4N0UB 5LGHL 3JBG7 1HOCA 3BZFB 1B3JA 5BJTA 1BEYL 1MCOL 2Z35B 4PGEB 5F7HA 3QUKA 5GISL 4YGVA 3F58L 3GSOA 4FFWC 4LIQH 3TBSA 3BD3A 4Y8AA 2R23A 5CBAA 4OZFA 4X98A 4FZ8L 3LQAH 4ZFOL 3UJIL 2AK1H 4L3CB 1WBXA 5DVNA 3R8QA 5M94B 1T66C 4PJEE 1RVFL 3AM8C 3FOLA 3NN8B 1B0RA 4AG4L 3E3QE 3FFDA 2R2EA 3QCVH 4K8RL 1QSEE 4MSWA 1F8TL 1RZGA 25C8L 1JI2A 1IEBB 1E4XL 1RZ7H 4XGZA 1HDMB 2WQ8A 4CNIB 2P4AB 1QYGL 1V7MH 4L3AA 5C09E 4ZFOB 1HH9A 2WNGA 1NGWB 5HDBF 4ZFFB 1R3HA 5DT1L 2BVPB 2X89D 3RX5A 4NC2B 4N9GA 1S7VA 3RNQA 2ESVE 4Q0XH 4RQQA 2BVUA 3CSGA 5C0IA 1F11A 3AREB 1TZGH 4JO3L 5ALCL 3FQWA 1KTDA 4F33B 4J3VA 4PS4L 1VEMA 1EEYA 2AJ3B 1SEBA 4PRNB 2FBOJ 5IEKB 2HFEA 1GOFA 4GG8B 2FGWL 5DMIH 2GTWA 4N0CD 2HMIC 3NCJL 3MTRA 2LU3A 3FCTA 5AZEH 4I13B 4K9EC 1MCWM 3DXAA 2GK0A 2ZUSA 3LDBB 4OF8A 5E5UB 2PO6C 2VERN 5DZOA 1BREA 1GXEA 1F58H 5FDYA 5LKNA 1SJHB 1LD9A 3UTZB 2YXFA 1G6RL 5JOEA 1Z0NA 2JJVA 3W11C 3ZSTA 3EYUH 3K4ZA 2E7CA 2H9GB 3WL9A 2G75A 4NBZB 4D0DB 3D18B 4RRPG 1YEJL 3B3IA 2I9TB 1QR1A 1KB9J 2J8UA 4PJ5E 4OF6A 1MLBB 3C8HA 5EZLA 4OZ4B 1JGLH 4XPAH 4HBQA 1UH4A 5JORB 3AAZB 5FYJE 4ETQA 5DD5H 5JO5A 4HLZG 2XWJB 1KXVC 3V0WH 4QHUA 2OK0L 4YHYB 5K9OB 1FL5A 1CI5A 3ARGD 4DVBB 4L8SC 5I74B 4PJ5B 5DRNB 5KSAB 2AXFB 1MCPH 5JPMB 4LEXL 5F9WB 1TZIA 3O4OC 1W0YT 2A6IB 3NABL 2IPTH 1KBGL 1I9IL 1NAKL 3IVKA 5DD0H 3KJ4B 3RZCA 2BOBB 4C56D 4RDQG 5JPNA 3N0PB 5JQ6H 1KCRH 3JV0A 3ZDXE 3OJVC 1UYWH 2IGFL 4EN3A 4H25A 1HHHA 5GGQH 4U6HA 5E9DD 3MJGX 4NQCE 4LKCA 1MFAH 1QACA 4RMVA 5EH1A 5D7LE 3QULB 2GTZA 1OSZB 2HFTA 2OR9H 5DJCA 4J6RH 3BT2H 4L3EB 3RVUD 3MRMB 4NQSA 1I7UB 3TZVA 4HT1L 4DGIH 5CCKH 1JE6A 3EFFB 1IKNA 1MJJB 4A6YA 5F1SA 1WFOA 5C0AA 4P23D 3QA3A 2J4WL 1ZTXL 1XF4A 2FX7L 1P4IL 5DC0A 2E7BA 4LCIL 3CMOL 4BKLB 1R5WA 4XWGH 2FD6L 1QHOA 1B0GA 4YDKL 4PJCE 1NCCL 4JO2L 3GMNA 4QNPE 5EWIH 4GG6A 2E9WA 5DHVH 2Z31D 2AEWA 2QADD 4PBWD 5IW6A 1CICC 3IFPB 4XPHH 5DZLA 3OXRA 3TT3L 1MI5B 1TJIL 4XP4L 1M6OA 5B39G 2ADJB 5EB9A 2KQNA 1T0PB 2ZCLH 5F6IB 3QFJA 3WFEL 4Y5VC 4WFFD 2I25N 2VXVL 2V9QA 4WFGD 5DJXA 3UJJH 4MZ2A 4EEEA 2W9EH 4R2GC 4M8VA 4OCXH 5J3HD 1G1CA 2MFNA 3RWCA 4TUJA 4Y4HC 4FFZH 2ZUQC 1S7WA 4ZO8A 3NCBB 4F9LA 4EN3C 5HI3D 4R4BB 4WWKA 1S7TA 1XGYL 1E6OL 5C8JB 3O8XB 1JPGA 4O2FB 3OJMB 4LPVA 1HCFX 2BVOA 1DANU 3CK0H 4WW2C 4LLDB 1I1CA 1WCQA 4Q2ZA 4UQ3A 1KCVL 4FQJL 1NSNH 4R0LA 2FECI 3O3BB 1A7OL 2R9HC 4L8SB 2P8PA 3MRPA 1DZBA 3RWHB 3S5LA 3SO3B 1PY4A 1JGDA 4P9HL 4Z8FH 2F8XC 1AGCA 5F44A 4EKXA 1XZ0A 4EI5B 1MOEA 3IGAB 4BZYA 1OAZH 1I8IA 1KXTB 4N5EC 4KKAD 3I3DA 3VXUA 1Q0YL 5IMMA 5E8EB 3SE4A 1LVEA 3VXUB 3FRPA 2WM0A 2MQCA 2B1AH 1R3JA 4JB9L 1OSZA 5DJCB 4OCWL 3O11A 2EKJA 1MVFA 3CZFB 1PFCA 2Q86A 4M7LH 3ULUL 2NX5A 4XMKH 4MJ5A 5H8DA 2ZUVA 2RIKA 3B3IB 3BP6A 3VDAA 2I9TA 4NRZA 5DUBA 4UT6H 4KMLB 5E24E 2XACC 4HCRA 4OV6F 3O8XD 43C9A 4XXDB 1WBYB 1FFOA 1EZVY 3WUWG 1H3PL 4PGDB 1J12A 2YS4A 5E00B 3MLTB 4XNYH 1RJZA 3IF1B 3KXFA 3T3ME 2DYPA 1VENA 4QTIH 3JXAA 4ZPVA 5AWNL 4PJBE 4MA7L 1I7UA 1S9YB 4MAUH 1KCLA 1QSFE 2HT4D 1H8NA 4KJWD 3DETC 1KYOJ 3I6LE 5I8KH 2YZ8A 2ATKA 3OF6A 5DJZB 2B4CC 1FYTB 2DQGL 2X7LB 2AK4D 3CC5B 1NAMH 3VWKC 1QUNA 3QZWB 2AJXH 1X5HA 1AE6H 3BKYH 4ZFFA 1FSKC 3H3PH 2CKBL 3NGBB 4XXCC 5D1ZD 5A2IH 3VD4A 3HFML 2CRIA 5FUOL 4CNIA 4IIQC 3L3DA 4L3EA 2H3NA 4MAYB 4IRJA 4KJWC 4NHCL 4XP9H 3OXSA 1NEZA 4BSVA 3K4DA 5HXMA 4K7PY 3ZHLA 1FNAA 1PDKA 3QDGE 2WP3O 5T3ZL 4XAWL 3RI5K 3T0BA 4PJXB 2G5RA 3QIWB 4QRRB 1RJLA 3MLRL 4X5LA 5D72L 1SVZA 2HT3D 3ARTA 1DE4A 1Q94B 1DSFL 5IBLD 1VPOH 2IH1A 3QUYB 1C08A 3QWOA 3QXAB 1EHLL 5SX5K 1FV1A 2DLFH 4BELD 4LDEB 5E8NA 1D5IH 4XX1E 4X5WA 1VADB 4DKDC 3TPKA 4OBSA 5CJXA 2PYFA 1RU9L 3MJ8B 2FO4A 1KN2H 1RHHA 5HDBE 4KWUA 1DN0A 5ANME 4LCUA 3G6JF 2V5YA 3ETBF 5E6YA 3Q6GH 4C56B 1BFOB 3DO7A 1QRND 3EFDH 2ZUWA 1L9MA 3O2DA 4UI2A 5DQDL 3WFBL 2Q7YA 4OIIL 5JHDD 3PQYA 4X7TA 3NA9L 2EDEA 3FO9A 5A2LH 5K59F 5EZLB 4AEIL 4QLRA 2OSLA 1PQZB 2AJUH 3HMXL 3ZE1E 3N50A 3UBXA 2MKLC 2R9HD 3MV9B 4N0FB 3Q6FA 1IGCL 3KPTA 4OCLC 3RPIA 3DRQA 1Q1JL 4PGCA 3S34L 2OL3L 3HI6L 3ZL4H 4P3CL 1UKTA 1HKLH 2DLGA 3I2CH 4KXZH 3Q5OA 3F5WA 2RCSH 3VGFA 1NFDA 4PJIF 3C5ZB 2ZCHH 4HSQA 2V2WB 3HNSH 4U6VL 4S1QH 4OZHE 4PRHE 5C0FB 4PREB 4BSWB 1ORSA 1QBLH 4XPGH 1Q9WB 4JJ5B 2ZOLB 3K4AA 4NZTL 5GGRY 1U8OB 1F00I 1MAJA 1JWMA 2FZ3A 4J8RA 5BJTB 1G7JB 1NC2A 3LPFA 3TLRA 3IF1A 3GSOB 1FFNB 1QFUH 4LSPL 1NMBH 1G7JA 1NC2B 4MNGE 3RX8A 5BOZG 2WSKA 1M7IA 4IS6B 5E6IA 5D7IB 1P7QA 1RK1A 3RWJA 2QADC 1I9EA 4HUWA 5D1ZA 1FPTL 1XR8B 3SE9H 4MWFB 3MCLH 4HC1A 4KZEH 4KQ3L 2DQIH 3QYCA 1IGJB 3G5YA 1GPOH 1BFVL 1E27B 2R1XB 5E56A 4F7EB 4WI7A 1KPUB 4CMHB 1CICA 3F7RA 4KMTH 4P2QA 5GIRA 5D93C 2WUBH 3R0NA 4GQPH 4Y5XC 2NY7L 2B7DT 2VLMD 3MCG1 4WWID 3U6RA 4V1DE 5DFVC 2F5BH 4LAQH 3RGVA 3RDTB 3I6GA 1NCNA 4ERSH 4KUCF 4UUJB 4HWZA 5TE4L 1QLFB 2GKIA 3RZCD 5J6GB 4JFHE 2LVCA 4NQTA 1I7ZA 3NACH 5DD3L 4LHUA 1AD0B 4G6FD 5FV2A 1IC7L 1YEGH 1JPFB 1I7TB 1H15A 5JXED 4PJ5D 3MV9A 4M00A 3MBEA 1EO8L 2DQFB 1UM6L 3EO9L 2NMSA 1MVUA 5HYFA 4Z95L 1BQSA 3QEHA 4NJ9L 3UTTE 1AR1D 1K8DA 3WJLC 5MEOA 5C0RL 3WS6A 5IB2B 3EYSH 3EDDA 1NBYA 2OR7A 1A6UL 4ZTOL 5IB2A 2CDFB 3N1QC 1VB9A 2QQNH 5T1DH 5EUOB 4F58L 2XKNA 5TDPA 4OGYH 3RQ3A 2ADJA 4WU7A 4QXWA 1NGYA 5CJ8A 1JN6B 3TBVA 2VLKB 4OD2B 4NKDA 5DHYB 1QSED 2P7TB 5HHOD 2D0HA 2H2PD 2O61A 1JPFA 3QUXC 3VXRB 3C5SB 4MA3A 2N56A 2Y1VA 1W2KT 4NC1E 2A77H 1HINH 5EOTA 2G5BB 5CSGA 5DJ8A 5IMLB 3GI8H 1PJ9A 3RL2A 2NY1B 4RIRA 3DLQR 1WAAF 4OTXL 1LEKA 1P7HL 1R3KA 4KKNA 2BK8A 5GS0C 3O6FC 3ARSA 4TPRH 5ACZB 4H20H 4I2XB 4JFFB 1FNLA 3UTSE 4JFXA 4MJIE 3GIVB 3LKPB 1P7QD 2P8LB 3R1GH 1FZOA 3T3PF 2IANE 1H3XA 4L4TE 4UINH 5T1KB 5EO1A 4I0PB 5AG8A 1PZ5A 5C2UB 4F37F 2ZG3A 4PRPE 5D7JC 1G7PB 3MR9A 3MMEB 4GAGH 5INDB 2Q76B 1MHEA 2Z8RA 1WCBB 2VXTL 3NCEB 1MUJB 5CEXA 5I19H 1DQQB 3GFUA 5MEQA 1WWWX 4L1DA 1HXMA 3NFSH 3KPOA 3ARUA 1ZT7B 4K3GA 3EJYD 2IAND 4U1SA 3FB8B 4YHZL 3OF6D 2AXGA 3O41A 3V6ZB 1EXUB 1QPXA 5HHOA 4PV9A 4WFGE 1HSAB 1N5YH 4LLWA 5MERB 4NNYB 1X5IA 5L2JA 3CFBA 5BQ7A 3CVHB 3MRBA 3P9WB 3TO4A 1A8JH 2XI9A 5GJTH 3L7FA 4LNVA 4R96A 3BAEL 5GSVA 1NFIA 4PJXA 1UWEH 4U1IB 4LSQH 1PKQA 4K71C 5J6HA 4KKCD 3P9MA 4O5LL 1BVLB 1LMKA 5DEFB 3QQ3A 4FFWD 4P2RD 2UWEF 4HS8H 2EEAA 4JHWL 4O2FA 4I0PC 3O6FA 5HYQB 1JP5A 4M93B 1KLGA 3ULVL 1PG7H 2AJSL 5GRWA 2UYLA 4OGXH 4FQXD 3HAEH 5EU3B 2QHRL 1HXYB 1NFDE 2FX8H 5DRWB 3OKNB 2EYSA 1W72L 3BQUC 1NDMA 5HGBA 3LD8C 2A74B 1S7SB 2Q87A 1OAYH 3U0WH 2FR4A 4POYA 1NGWA 1Q8MA 1LE5A 4TRPH 1J88A 3CVHA 5E9DE 5TDNB 4GLRH 1HI6A 1GSMA 5GGSB 2ADFL 2X4PB 1LD9B 4NC0B 2NW3B 4YE4H 2VL5A 4G43B 4UQ2A 2FNBA 5EU6B 4PP1C 4FQIH 2VXUH 3W2DH 4KTEH 5IG7A 5A2FA 3QDJB 2AV7B 4HIJA 4R7DB 3WIIL 2VL5B 2ICWJ 3K8LA 5BO1L 2QQKH 2YD2A 3ZYZA 4EOWL 3IDYC 4OBRA 3ZDZF 1TTUA 3OHXB 3OPZL 4JZJC 4L8BA 4CVWA 3GDBA 4Y19E 2WBWB 4Y5YC 1BECA 1YPZA 1K8DB 3C87A 3QSKB 1T89C 5GGVL 1F3RB 4I5BB 1JHTA 2IEPA 5IVXB 3SPVA 1MIML 4OSUH 3BWAA 3MODH 1R3KB 1KV3A 3BIKB 1CFQA 4WI3A 6FABL 1YMMD 3MV9E 2PETA 5KS9F 1HYSD 5D2LE 3SKJL 4C59B 3LH2H 2X4PA 5C0BB 3WIFB 5TPWL 1P2CB 1JI1A 2WWKO 3FMGL 3BKML 4XC1H 4BQ6A 3IGAA 1QFWM 4P9ML 4NT6B 1GGCL 2PYEB 1CK0H 1KJ3L 5C08A 3CVHH 1O5DT 3CSYA 3IRPX 4WENB 5E7FA 2ZUQB 3TPUA 5LJYH 5EZIH 3P9LA 1ITBB 1DQQA 3QQ9D 3RWEB 4LKXA 4WTZG 1X6NA 1S9XB 4R0LC 4X98B 3VXSE 5HD8C 4LHJB 3F7YB 1I9JL 5JDSB 1ZANH 2AXFA 5JPMA 1UVQB 4WNQB 2Z92B 1UGNA 3I50L 1JWSB 1UA6L 5IQ9B 2ICES 3EJYC 1FGNH 5C7XH 1RZKH 3QUZC 4LSRL 4QRRE 1PY9A 3JSSA 1VSCA 5C3TA 2AK4E 3DMMC 1NCAL 1U8NA 5F1KC 5IMKB 1U95B 4NHUB 4DK3A 1X4XA 3UYRL 3J8F7 5DJYB 1HH9B 4LLVA 5IWLC 3CFBB 3MFFB 2C1OB 4AMKH 1A6PA 1JPST 2BERA 4PJ8A 1J10A 2Z31B 4H0GA 2ZOKB 4D9QD 5IHBA 2QL1A 4F15B 1S7XA 2FL5A 2GFBA 2DS4A 2XTJE 2DQCH 1IBGL 5E94B 5IVZB 1BQUA 4PJ9C 2BHZA 1I8MB 1WZ1L 4FZEL 5H2BB 2D4DA 1RIHL 5BMFH 3K80A 2GJZA 4JRYE 4XCCL 3S96A 2NLJB 3FRUA 2VDQH 3X14A 2OTUB 5BZDA 4MXVE 1HNGA 1J1XL 3ALPA 1T1YB 3QEQD 3O4LD 12E8L 4JM2A 3SDCD 4LRNL 2X6MA 3KXFE 3U7YL 4OCSL 5JXEA 5E4EC 4BH8A 1NGZA 2QSVA 3ARFA 4P48A 3PWLB 1OVZA 5K33A 3CVIH 4TOYL 4X9HA 3WN5A 4JFEA 2J88L 2W07A 2DQHL 3KLAB 3B5TA 3QIUD 4MCZB 3LKOA 4YR6B 1DQMH 3PGCA 3D0LB 4K7PL 5C86A 2I60L 4U6XB 1PVHA 1OWWA 3VH8G 4P4KB 1CN4A 2R2BA 4K3DL 3MUZ1 1OAQL 3AXLB 2VQ1B 1Q9WA 4JJ5A 1RUKH 5I1HH 3T0EA 3MRDA 5F7EH 3VCLB 2FZ3B 2G60L 3UMTA 2VLRB 3OX8B 2H45A 5DDHA 5ACMA 3TN0C 2AV1B 1YPZF 1B0WA 3QEUA 4Y4KD 4PJ9B 5CGYC 1NGZB 1XGTA 2C3GA 5IJVB 3LN5B 4LRIC 1AXIB 1CXHA 1A3RL 4GS7B 2ZPKL 3EO1A 2XN9D 3C5ZA 2NZ9C 5D7JA 4Q9RH 4I9WE 3JV4B 1RJYA 3V95A 1KXQE 2B5IB 4RGNE 2C4FT 4XC3L 1A7PL 2AJVL 4MCYB 3OGCA 4LLUB 1HZHH 4GRWH 1H3UA 4F7EA 5F9OL 5I75B 5IMOB 3O4OB 3OG6B 1S3KH 2XRAL 4M1GL 5F7NC 3TFKD 5HYJB 1MWAL 4MJ2A 1SYSA 3ARFD 5K9JL 4AEHH 4CVZA 3G9AB 1MHPL 2QLVB 1ZVSA 4Z7WA 1YNLL 2DJUA 5L8LB 4ZAKB 3MFFA 4LPYA 1IM3B 1BD2A 2HLFC 1X3DA 4DEPB 2DKSA 3I9GH 3LN4B 1HCVA 3GMOA 4XCEB 1YYLH 1SJXA 1F6FB 3S88L 3QUML 3NZHH 1QP1A 2ATKB 1CFNA 2LABA 1PSKH 4ONHB 2ARJA 5DYOB 4GKNB 1LK3H 1XGUB 3FQXB 3M17A 1MFBL 2P8MB 3QPXL 5FGCE 4M9PA 4JFZL 5IQ7H 4O58L 3VG0L 3O0RL 3HMWL 2CLVA 5EOCH 1HKFA 4LASL 5CP3H 1F11B 3MUGB 3S37X 5CKAA 4ZSOB 4E41B 1HSBB 4I0CC 2X4OB 2VDPL 1T1WB 3HAEB 5KG9A 1J0YA 4RZCA 4PRHD 4Y16C 4OD3H 4X4YA 1NEUA 4MS8C 5ICYB 3CU7A 4QOKD 4PRBB 2R1YA 4PTUB 1SMAA 4KHXH 3UPRA 3S9DB 2X7LA 3D3VA 2J8HA 4DZBB 2IPKB 3MJ8A 5K93A 1FC1A 2FATL 1DANT 2IPKA 1LHZA 5T1MB 4GSDL 4HHAB 5DDHB 1GHFH 3ARXA 1U91A 1CQYA 3FQXA 3KYMA 2WV3A 2A1WL 3QDME 2W0FB 1NGXA 4JZJA 1I9RL 3AUVA 4YPJA 4LCUB 3OB0K 2HA1A 1XF5B 3O2WL 5HGAB 4PJFE 1ERNA 4PRDB 1HK6A 5J7CC 2PW2B 5HGHA 5IW3A 3RVUC 4YPGA 2Z8SA 4J23A 2XN9A 4CDGC 3MLUL 2V17L 4PBVC 4YUEL 3VH8A 3CLEH 3GMMA 5D7JD 3BEWA 2XT1B 5AZ2H 4A6YH 2VQUA 5GRJL 3DVIA 2ZUTA 3B9KA 4TQEL 4HMDA 1GRWA 1J1OL 3K1KC 2DL2A 2R0KH 4NQCA 5DLMH 5MENA 3IS1X 2Y7QA 5C0CE 3RY4A 3BW9A 4QRQA 4JPVH 4OI7A 4HUXA 4K3JL 4Z7VA 5BCAA 4G8GB 4D2NA 5MEPA 1F4WL 3MJ6A 4QRPA 2RGSA 3O11B 4N8CL 4U6XA 4KK9D 4PP1D 3KYOA 4HJJH 4KI5E 3SDYL 5AAWA 3U1SL 5MI0C 1T6WA 1LE9B 2AEIT 4ZXBD 3IJSB 4RFOL 2VITB 2WWKT 4X6FB 1XGRA 4LK4A 3QPQD 1KFAL 1CLZH 4DAGL 1VERA 3T08A 2R1WA 2BRQA 3EW3B 1WZKA 4ZUSB 3TESA 3ZYJA 2X4QA 4G7VH 3QHTC 5K9KB 4NJAL 4M02A 2L0DA 2DI7A 1DBKH 4OV5A 2R23B 3WCYA 5C0CD 5CBAB 4Q7DA 3PP4L 4NZJA 2FEDC 4Y4FC 5A3IC 3V5HA 5EU4B 1GIGL 4S1DC 1GOGA 1MJJA 5D2LF 4ELMB 2BOCB 4YXLL 2SEBA 3S4SB 4XVTL 4PGDA 1RUAL 5E00A 3U79A 1BJMA 5FHAH 2BY0A 4QTHA 1HILA 3THML 3D3VB 1BMGA 3SDCC 1GGIL 2PO6D 1K4CB 1YEKH 5GHWH 3WO3B 1WAAA 3D39B 4KQ4H 4ZUTA 3Q1SH 1MUJA 4OCMC 4JFDD 2EH7H 5F1NB 2UY7A 1NL0L 4H25B 1DQDL 4P3WA 4RMRA 2Y06H 4W81A 2F15A 1CFSA 3QG6A 1MH5B 1UB5A 4ISVA 2V2TA 5FUCE 2ATPA 3QCVL 1BJ8A 1T2JA 1S7XB 1UWGL 1R5IA 3SGEH 5JXEC 5C07B 4GG6E 3VXMB 1BVKB 2WZPD 5HDLA 3QWQB 4LSDA 1V8HA 3MNWA 3PL6D 5CJQL 1V7ML 2AJYH 5I71C 1CGUA 4BFEA 5LGJB 1G7QA 3G5XB 2PXYA 3NPZB 5BRZB 4OFDA 4YHOL 2ICWI 1YUHA 1CVRA 5C8JA 4ZFGL 4NQDA 5ALCH 2EE6A 2HTKC 2UUDK 3STZA 3HNTL 4RA3A 4RAUB 4ZS7L 1X44A 3FB5A 4Z7VB 1F4YL 5I71B 4KJYA 2R2BB 2VLKA 5EBWB 1X5ZA 4N8VG 3WL9B 2KBGA 1A7NL 2JJSC 4UQ3B 3G6AB 3P0GB 1CXKA 1XGPA 5DHVA 3ULUF 3MLXL 5IBUG 4PRIB 3BEWB 3U7AA 4X7SL 1MFDH 3L6FB 2GSGA 2E27H 5E0QA 3MNZA 5HI3C 3RAJH 3CZJA 5MHSE 4KVNL 2CSPA 4YNYB 1G84A 3OB0H 1MHHB 2I9LB 3BP7B 1Y18A 3ZDYE 2AABL 4Z6AT 4XNZC 4FQXB 1L9NA 3LQMA 1TZHA 4NRXA 1JPGB 2Z8WC 1RZJH 2CKBB 5C08D 3W9DB 3MLYH 1YMME 1LGVA 1GOHA 3VXSB 4S2SB 2AQ1A 5DA0B 3HE7A 5JNYB 4XVJH 4JDTL 3NA4A 3UJTL 1DEDA 3TBYB 4JREB 3G6AA 2JJUA 4HJ0D 3ZO0A 4GRLA 3QBTB 4NKIL 2Y7QB 4JN2B 3JWDH 1NMAL 2VDML 4NN6B 5JR1H 1EMTH 4NO3B 2CDEA 5BVPL 2WWMC 3WO4C 3KJ4C 1DQLH 3TIEA 4B0MM 1G1YA 2KQMA 3MRMA 1S9XA 3QQNA 3G6DH 4H5SB 5FOBB 1JGUL 3EOBB 5FAAA 2V5TA 4POUB 2A9NL 4DTGH 2IBZX 2BP3A 1D5MB 1QSEA 2X5PA 1WLHA 1DQTA 1T1ZB 1UYWL 5IVXF 4NWTL 4ODBD 4R96B 1MELA 2B4CL 1Z0MA 2Q3AA 3LRGA 5TF1L 5FM5M 2GTZB 1BZ9A 4G9FA 4IJ3B 4ALAH 3GRWA 4F33A 3MLVL 2Z35A 4P4KD 2YK1L 2H32B 2F74B 1WJ3A 3D69A 4HFUH 1E4XI 1QSVA 5F3HB 2Q8BL 3FN0L 4OT1L 1X9QA 1N2RA 3S8WA 1T6VN 1MI5A 1URLA 3OXRB 5J4MA 3WJJC 1RZIA 2NNAB 4D0CA 1FNGB 1ZLVK 5B21A 1N3NB 4EDWL 1FL6A 4XWOD 3DIFB 3IU3A 4OZHF 1FJ1B 1IAIL 1MJ8H 2JIXD 4M3KB 1OAKL 2CXGA 5SWSE 1MY7A 1LP9F 4QXUL 1WTLA 3AS3A 1J05A 2CK0H 2YPLB 3WLWD 2FHBA 4M61A 3UTTB 2FX9H 4TSAH 2R0WL 3PIQB 1ZLWK 2CMRH 4G8GE 3PWUA 3DROB 5T33L 4K3EL 1AGDA 3X3GH 1Z2KA 4WEBL 1ODAA 4Y19B 3N06B 2B2XL 3QI9A 1HHGA 4YXHH 4KFZC 2CLZA 1DVFB 3BXNB 1TMCB 2RQ8A 2XICA 3HC3L 4X4XA 3U9PL 1UXWA 4YHYC 4JPKL 4U1HB 3EYFB 4U3HA 3UBXB 3KYAA 5DC9B 1W8NA 3QQ3B 5D70H 5TFSH 1XMWA 2NPLX 5C0GB 1MJUL 5TH2A 3UCRA 4WI2A 3BD4A 4O02L 4OAWA 2Y07H 3BHBA 4HPOL 2ILLA 2QKIB 2BFVH 4L4TA 4R6UA 4YHIB 3SKUD 3OKMA 3LRHA 3PABA 4P5KA 1AC6A 5CJBA 3FOMA 1FVCA 4QHUB 3MXVL 3T0EB 5I0DA 5EN2A 2FO1A 3PJSA 2BVEA 3HC0B 3MREB 3PWPA 4GXVL 1F4XL 2O5XH 1XGYH 2HJFB 1F4HA 5IIEA 1JNNL 1DEEA 2VO5A 5DD1L 4NC1C 5CEZD 2L7JA 3RWGB 2EDHA 1T7ZA 2E6PA 1A7OH 3IAGC 4OJFH 5GPRA 2B1HL 4FTVD 1TVHA 4S2SA 3KR3H 5EUOE 4NN5C 3V5KB 3OMZA 5I1DA 5EO0B 4JM2C 3V0VB 3VI4F 5EO9B 4F7PA 4PJFF 5FKAB 5D7IF 5FXCH 1TQCC 5HYJD 4Q74A 3ZKXC 2DQEH 4HXAH 4U7KA 4A2MA 2G9HB 5HD8D 3HI5L 4HKXA 4OLWL 3KPNA 2NY3C 1QQDB 3TO4C 1YMHA 4ZNEE 3H2WA 3AMLA 3MJ9L 5D7JB 4KRPD 1IM3A 4FQ2H 3S6CA 4H88H 2W9LA 4JFFA 3UX9B 5ITFB 1DL7H 4P3DA 3HZYB 1CICB 2BX5A 3O45B 2WBJC 1A47A 5B38B 4HGMA 4M5ZL 1U42A 3T0EC 1HNFA 2H26A 4P46C 4OLEA 5F88B 4AIXA 3REVB 1NCUA 4FQQB 4CVXB 1G7PA 3MR9B 4HF5H 4PTUA 4JO4H 4ZUWB 4ODUA 2IG2H 4M7KL 1LO4H 3RVTD 1ZE3C 1BGXL 2R4RH 5HDQL 1F3DJ 1VGKB 2MOVA 4U6YB 3RWIB 3FO1A 2HVKA 3IXTA 3MOBH 4U1MA 2B39A 4K7FB 4XVSH 4QO1A 3SDAA 2PO6A 3EYQD 2VXSH 4AENB 2V7HA 3C6SB 4Q9QH 3GSXA 1I7RA 4XBPA 3BMWA 1ES0A 3ZE0F 2PO6B 3PG2A 1CLOL 2JELH 3HZMB 4GXUM 2VZ3A 3MV7A 4LP5A 4X6BB 5KZCB 4HWZB 4PUBH 2DOCA 4JPWH 1NCWL 4CN1A 4Y4KA 1INEH 2WQRA 5EIIA 1P7KA 1VFAB 1ZSDA 1S7RB 1X5FA 1VHPA 2XQYG 5SWZD 4O2EB 1WWBX 3K81A 2IALB 1E4WL 1TJHH 3P11H 4JFHD 4UIMB 5EBMB 4IRJC 1JL8A 4NGHL 7CGTA 2PF6A 4M6OH 4CU6A 4HIXL 4WGVB 4WI8A 5C0CA 4ZDHA 1Z3GH 4YH6A 2YHGA 5HPMA 1OB1B 1T7VA 5HGDA 5AAMA 4AZ8A 4L4TD 4WFED 5L8JB 1CG9B 1L0QA 4XRCA 3PHQB 2AEQL 4LOUC 3RY6C 2O5YL 1UQSB 3AXLA 1QLFA 5KVGH 3GI9L 1P69B 5E8DH 3MV7B 3LRSA 3WNMA 2QSCL 5JZ7C 4M7JL 2NY0B 3IETB 1MJ7H 3DRTA 4IHOA 1P7KB 5D7IE 4NPYA 5DUPH 3SE3C 2NXZD 1H3WM 2AAVA 3PE9A 5EC2B 1XGQB 4JVWA 3D48R 3VE0A 3KDMA 1WF5A 3ARFB 3WNNA 3D85A 4I3RH 2HJFA 1QNZL 4JDVB 4PGBB 3C09C 3PQYB 4X7TB 2V2WA 4NUJA 4JFEB 4FS0A 4AEIH 2BXZA 4RGOL 1DLHA 5DJ6B 3PHQA 3D2UD 5C0BA 3OKMB 1FL3B 2VXQL 3PABB 3ULSA 3QWRD 1ZT1A 3U0TB 4EN3D 5FUZL 3AFLA 4UTAH 5ICZB 1FBIL 5ID0B 3HNVL 5ADPL 1JTOA 4I0PD 3I2CL 5DD6B 5MENB 3MLWH 5H94A 4LARL 5FECB 1KENH 1W0VB 1H8OA 1U3HC 3BIKA 3MLZL 5BV7L 3F7PC 4EUPG 2OCFD 1A6WL 5D1ZB 4QXGH 3U48A 4H1LH 5IHLB 5TE7L 5F88A 5J13C 2DQUL 1OTTC 5DZNA 4D8PA 1QFWH 2O5ZL 2EEDA 2FEDD 4JR9H 5BQ7B 2HT2D 4MJ4A 1U8QA 3L3DB 1GGBH 3NH7H 4JFPB 1HSAA 3P4NB 5DJDA 4GO6B 2FB4L 1RMFL 3KHQA 3MRRA 1P7QB 4QHLB 2I5YH 3ULVF 1Q9OB 3RWEA 3IKCA 5L2KA 3QJHA 3QHFH 1KNOA 2F19H 3V4VL 4UU9A 2OQJB 1RJLB 2XWBB 2D7TL 3NFNA 5E2VH 2Z31A 1ADQH 3WS3A 2XA8H 5MEQB 5FYKE 3BQUA 3GMQB 5F96H 4N1EA 2R1YB 2VQTA 4NQCD 4J1UA 4Y5XB 4ZTPL 4PJXF 4WV1B 3MCKA 4CUCA 4HIHB 2NQCA 3HAEA 5IMKA 3DGGB 4O9HH 1QSFB 5FA4B 1CU4L 1FNGA 2EC9U 1EVUA 1SMOA 2C4FU 4NOFA 5DR5L 1G9NC 1QVOA 3Q48A 5A2KH 3MV9D 1JNLH 1T3FA 4N0UE 5DK3A 3SCMC 3ULVC 5GZOD 1QZ1A 3EO0A 5IV2A 2V7HB 5IHUL 4HBCL 3L7FB 4QYOA 3LEXA 2YXMA 3GSQA 5DVOA 4JFQA 3B2VL 1AR1C 3B8YA 1YYMH 1Y18B 3GJEB 3NACL 3VXOA 5D2LA 4X83A 1RI8A 2ZCKL 2DJ4A 4NZUH 5FYKD 2JCCF 5F7FA 4NO5A 1BOGB 3QR2A 5GSRB 2MQ0A 4DFHA 3CXDL 5GRUL 3LS5H 2OI9B 3RVXC 3IU4H 1IGYA 1HEZA 3BGAA 3ARRA 2EE3A 2AEPL 3MV11 2HJLB 1ETZB 3PJSB 1QBMH 3BP7A 4QRRD 2BXYA 5J1AB 4HAGA 4Z7OE 5KJRL 4RAHA 4YNYA 3SOBH 1JHTB 3T3MF 4R0LB 5DFVD 5F3BA 1MLCA 3CZFA 3TIEB 1BAFL 1MCWW 5E95B 5DMYA 5EUKB 3PHOA 4Y16B 3HE7B 5JNYA 2X89A 1LO2H 1KB5H 4JFXB 3G08B 5BV7C 3MRJB 4MJ6B 2E6JA 4JM4H 1QA9A 2A77L 3TBYA 3H9SB 3MA7B 1NCBH 4MJ6A 2WAHA 3PWPE 4WRLA 1MCJA 5DF0A 43CAA 2RB8A 3QO1B 4WTZA 1EDQA 3JWNC 5FB8A 1I85A 4RCAA 3VFGH 3TNMB 3QEGH 2ICEB 3HC4L 1XH3B 1INDL 2CKBA 5IWLA 5KSVB 1AJ7L 2C3HA 1VGEH 2NY1D 1NBVL 4KXZI 3FB8A 2MPAL 4BA8A 4PJXE 3O3AA 2VB5A 4ZXBC 3D3VE 5FYLD 3FZUC 1CZ8L 2HWZH 3PL6C 5FGCB 3H9ZA 3FAXA 3CCHB 5CSZA 4L3ED 2BNUB 2Z93A 4MDJB 3KG5A 3TO4D 3MRCA 2PR4H 1ZXQA 1WQVT 2Q3ZA 2VDRL 4U6HB 1T2XA 3HZKA 1CF8H 4G6MH 1CLYL 2QQLH 4GRWB 2Q8AH 3T04D 4F3FA 2A6JA 3X14B 3VGHA 5IB5B 4LQ1A 5IVNA 5JW3L 1OAUH 4M1CC 3GMRB 3ULUC 2JB5H 1ZHKB 5BRZA 3OTTA 3MO1B 5FYKH 5KVFH 3FQNA 1N0XH 1ZLUH 4YZFE 4RMSA 4ODSH 1IGMH 4AEEA 3ILPB 2D7MA 5GS0H 5I73B 2F74A 4LSQL 4GKZB 4LQFH 1IKFH 1MCDA 1WVZA 1J1PH 1HQ4A 3KS0H 3VFPA 1N7ML 2JF1A 3STZB 4HS8L 4JHWH 4HWEL 3RHWK 2BHYA 4NBXB 5CINL 4G3YL 4NQDD 1WFUA 1TENA 1MFEH 3RDTD 2IAMA 5CD3A 3IDJB 4D0DA 4ELKA 1D6VL 3BP5B 4FHBD 3CFCH 4NO0A 3VFRA 2PCPA 4LRIA 4DGVL 4F57L 4BUHA 3ARDD 4APQB 1FAIH 1XIWC 4I2XE 1JCKA 2J5LB 2X40A 1DUYA 4JFFE 4F7MB 4X0KA 2ARJQ 4PRIA 1U6AL 3DVGB 3KPSE 1NQBA 3OV6A 2KL6A 1Z5LB 5JQHC 2PUQT 3GMPA 1AD9B 3N9GL 3O2VL 4PBXA 4RFEA 5TQ0L 1RK0A 5F7DA 1WGOA 5F7UA 4BYHA 5ALBH 1OP5K 4G9DB 3ARBC 3C9NB 4WCYH 2Q20A 5ISZB 3NIGF 2G75B 3JZ7A 1T21B 4FNLH 4YBQC 5I8OH 1KIRB 2F54B 2EH8L 1AXTH 1G9ML 4Y4FA 3HB3C 3PP3H 2A9MH 2OTPA 3QDMB 1LDPL 1B2WH 3LB6C 4I8DA 3GB7B 4U49A 3ULUD 3TBVB 4MXQC 4TUOA 3LIZH 3NFPA 2FYYA 5FK9B 5HJ3B 2D03H 2HFGL 3F5WB 5DRZA 4K94C 4CADA 3OKLA 4OSUL 4TNVK 5CP7A 1S78D 5DEZA 4ONFH 3O8XC 3LD8B 2CRMA 4FQPA 5C0FA 4X8JB 1I3RB 5LQBH 5LVEA 2CGRL 3BEVB 4XBGA 4NQSB 4PG9B 1FO0A 2NY3D 1KGCE 4H0HB 4JDVA 5IJKA 3HLAA 4NO0D 3DBXA 3G5YB 4J8RB 3BN3B 1BBJB 3E6FB 3G6JA 1MIEL 3VRIA 1ULVA 2B0SL 2ED8A 4YDVA 3U0PB 1T2QH 4YC2C 3IDUA 1IAOB 3B9VA 5E99L 2LU7A 3DOSA 1HDMA 1MQKH 5KN5B 5BW7A 2NY6B 5D9SA 5TE6L 3DVNB 1MEXH 4PJHA 3KNBA 1KNOB 4M03A 3T65A 3U4EB 4H1LG 4G6KL 2X9WA 1MRCH 3RU8L 2ZJSL 4X4ZA 2BDNL 4P57A 5C7XL 1YEEL 3RI5F 3R4DA 4NQXA 3QXDB 2FD6H 4X5XB 5F89A 3VWJD 5CUSH 3RPKA 1BLNA 4D8PB 3M1BA 4ZS6C 5CZKA 4NQUA 5HGGS 3RDTA 1IFHL 1BZ7B 1NGXB 4JZJB 3QHZL 2R8SL 3TO4B 1MFNA 1FGVH 1G0XA 3TEUA 4CMMB 3CLFL 4DW2H 1OSPL 1U91B 3L3KA 5JIHA 5HHXL 4PYGA 4P5TA 1U8IB 2X9XA 1AFVL 4JLRA 5J0BA 3KNBB 1MRFL 4NQEE 3QUYC 4W68A 3HR5A 4H8WL 2R2HA 4U7MA 4FTVB 5E03A 1JTTA 1V05A 12E8H 5HGAA 4XP6H 1UENA 1I1YB 1A0QH 1CXFA 3ZKQD 1CT8B 3MCKB 3QXAA 4IOIB 1XZ0B 1SY6L 1TITA 4F9PC 1T0MB 3ULVE 1DBAH 1S9VA 4OZIF 1CT8A 5DRXB 2FYYB 1T1XB 2DMKA 1JTPA 1OTSD 2VZOA 3BQUD 1MWAA 3MNVB 4YHPA 3RA7L 4MA8L 3GM0A 2HRLA 1DQML 3KDMB 1FIGL 1JFQL 4OCYL 5JLZB 5IB3B 4ZUUB 3CXHJ 4J3UA 1RZKC 1HHGB 5HYEA 3NCMA 2GEEA 5C9JA 5BXFB 1NJ9B 1CFBA 1WITA 3DRTB 4IHOB 5CFHA 5K59E 2X1XR 3HTLX 5F7EL 1M7DA 3FKUS 1CGYA 5JXAH 4OM0H 5IROA 4JAMA 4JHBA 2YZ1A 4Z7VE 4NO5B 2H1PL 5FK9A 5HJ3A 4MB3A 3U30B 2EDDA 4Y4HB 4O4YL 4Z0BH 1MLBA 1A3LH 4YK4C 3IKKA 4FFYH 2BZDA 1QLEL 1SYSB 2QEJA 5IJVA 4ETYA 1ADQA 4CU8A 4KVCL 2R29L 3ET9F 4NNXA 5JTWA 4N5UA 5ACLA 5BS0E 4P4RA 3I6KA 3PL6A 4NUGL 2MSPA 3RTQC 5GGRA 2XQBH 2VLME 3QDGB 4UMGA 3QNZB 4HKBB 1QFHA 3V4PL 1CL7L 1CBVL 2HTKD 1FYTA 3IDNB 2ITCB 5F6HI 4JG0H 5HYSG 5DJAA 3O6LH 4YHML 3DGGA 1QRNB 3V0VA 3WNLA 3X3FL 3SDDA 2C26A 2BJMH 2YD1A 3WDHA 2ESVB 4K7PX 2Z4QB 3DUSB 2OTWA 1KACB 1UZ6F 1OY3B 1I1AD 4KY1H 1KJMA 4U3XA 5TGBA 1TDQA 4F9PA 3HZMA 3CFEA 2ED7A 3U4BH 2PYEE 4MDJA 4JHZA 2BY1A 4UU9B 4H5SA 2DD8L 5DMJB 3FQRB 3O6KH 4QRSB 2E9IA 1NBZB 5MHSD 4BFIB 4KTDL 2DQTH 1WEJH 3U4AA 4P2OC 4PJBA 2JK5A 2OP4L 4PJEB 5I8CB 1NLDL 2YMXL 5DFWH 5IQ9A 3ILPA 4E42B 4OCNC 1A21A 1FG2A 4IM8A 5B8CA 4P2CG 2R0LL 3MO1A 4YHLL 3Q3GA 1G0DA 2FHFA 4KGLA 5IB4A 1FLRH 4NNPL 3STLA 3T77A 1MCBA 1LP9A 4YQXH 5FM8A 4PJ7F 4XTRC 1YNTA 1EERB 2BCKB 5D71H 3DSFH 3IDJA 4ELKB 1I1RA 3CUPA 5AUMB 1NCDL 3KPQA 2APVA 3IRZA 2VN7A 1IKNC 5E8PB 1FYTD 2NXZC 4WY7H 4NCC1 3KPRE 3MOAH 5GXBB 2IFFH 1FRGH 3PQYE 5IB5A 4LPWA 2F54E 3TJEH 1LO0H 1I1FB 1F6AA 2OXHA 4FXKA 3HG1B 1CFTB 3EOTH 2O26U 5T3XL 4DQOH 4WUUD 4AL8H 5GISH 5J1AA 4UDTA 1C12A 1NANH 3RUGB 2EDNA 5MEND 1W0WA 4P2RA 2J6EH 2VMFA 1UFUA 2P46B 3VE0B 4L8CA 3BZ4A 1KELH 1PLGH 4HKZB 4ZAKC 4URTB 1JK8B 3QDAA 4OIAA 4RISL 4X80L 3V8OA 4AG4H 5ILTH 2XXCB 3OAYH 3S35H 1VFUA 4WI5A 4WHTB 4JN1H 4XNQB 1KEMH 2P43B 5DK0A 2XZAH 3CAFA 2R0ZL 1T5WB 1E4XH 1F90H 2NW2B 2VKWA 4APQC 4LCCA 1K3IA 3MA7A 2OL3H 4HJGB 3NMEA 2ESVD 4HS6A 3RHWF 1FYHB 4NN5B 3CX5K 4QEGA 4WO4C 1JZ4A 3CSYB 3SPVB 1TVBA 1SYVB 4HWBA 1DN2A 4ZOAA 5DTFA 5DK2B 2ICEA 3KPSB 4RMQA 2NXZB 4PRAA 5FB8B 5JORA 1LDSA 3FB6B 5DSCB 3CSPA 5D93B 4RFOH 5EC1A 4G7YL 5IT2H 5E08L 3HKFA 4XPBL 5DMIL 5DMGC 5I17A 4RWYH 4DAGH 5I6XB 4QHNA 3MROB 4E41E 4KKLD 3FT2A 4R4NC 1B90A 4P46D 1G6RA 1QFUL 5D7LD 3OKEB 3ARQA 3ZTNL 4X99B 3SN6N 5I9QC 3QQ4A 3GBLA 3H9YA 2XWBA 5DGRA 2AXGB 4K9EH 3VXQA 1YEDA 1R3LB 3MLSL 1F6LL 1JYXA 5L88L 1EFQA 1JPSH 4MXQD 3TVMC 3KLHD 3JVGC 1II4E 1TFHA 2MQ3A 3C6SA 4OLVH 1HHKA 2FGZA 4MB4A 4WFFE 4D9RD 3HE6B 3V6FA 4HPYH 4UB0L 2YRPA 4OZFB 2W38A 4JEGB 1BFVH 2H6PA 2VABA 1YEHL 4RX4D 4Z7UA 3L5HA 4XPTL 4ZOCA 5I73C 3S96B 4MD4A 1Z9SA 2WUBL 2VC2H 1NUDA 4R3SA 2X44D 3Q1SL 3QZWG 4J7RA 1U93A 5IFHH 3LZFL 4HH9A 1QVOB 2D4FA 3ZDXF 4HIEB 1DQDH 2BVYA 4L3EE 4XNXL 3VXRE 3OWEA 5KSBB 1K3ZA 2BVPA 3LV3A 2EXWC 3T2NL 3ES6B 1G7MB 4HDIB 5DD3H 1S7SA 3P9MB 4LFHD 1FVEB 2HKHL 2LU4A 3WS3B 4DCQA 3WSQL 2G2RB 4L5FL 2UWEE 1MFCH 2FHCA 4CN6A 4P5TD 1EAJA 2YKLH 1KBGH 4TNWK 5L9DL 5IEHA 4MHHI 5JOPE 4MGXA 4CW1B 1AQDA 5HHVL 4KRPC 3B9KB 5JW4Q 2HJLA 1MF2L 2NCMA 2O61B 2YC1A 4KTYA 5H35A 1OTUC 1EHNA 5CZVH 3BDXA 3EJJX 4TULL 3OKKA 4HIIA 2YEZA 4K71B 1U8MA 1D9KB 3H7LA 3KPSD 5JHLH 2YA0A 2FR4B 1IARB 2QQNL 5I1AB 4JY6A 2IQAB 4KAQH 4OLZH 2W0FA 2XZCL 4NKQB 4D0BB 3F7VB 1K8IA 3O2DH 2NW3A 1EJOL 3E2HB 4Z18A 1KN4H 2IQAA 2OZ4A 3P77A 4WIQA 3Q0HA 1YJDL 5KTEL 4X7SH 5E9DA 2JCCE 1LO3L 3WFHB 3SDAD 3MYJA 2J8UB 2IQ9L 5GSRA 3A6BH 5IEHB 4N0CC 4WEUD 3P30L 1ORQB 4UDTB 1EX0A 5INDA 1QSFD 5H35B 3JWOH 4UV4L 3RWFB 3VFOB 5EDXA 4YIQB 1OQXA 2AABH 1XF2B 4HUKB 2CDEB 2QQQA 1TZHB 1W0VA 5I1EL 3TA3C 1U92A 2IAMC 5CMAA 4PJAB 4RDQF 3RNKA 5EA0L 1BD2D 4ZPTB