3HNTH

Cs-35 fab complex with a linear, terminal oligoarabinofuranosyl tetrasaccharide from lipoarabinomannan
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGTVLARPGTSVKMSCKASGYSFTNYWMHWVKQRPGQGLEWIGSIYPGNSDTNYKQKFKGKAKLTAVTSASTAYMEVNSLTNEDSAVYYCTRFGNYVPFAYWGQGTLVTVSAATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CS-35 Fab Heavy Chain
publication title Structural insights into antibody recognition of mycobacterial polysaccharides.
pubmed doi rcsb
total genus 46
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hntH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hntH02
4WJ5B 1U95B 5DO2D 1EEYA 1UZ6E 3JV4B 5DDHB 2ATKA 2EC9T 4NO0A 4ZTPL 4M6NH 1BJMA 3IYLW 4UZGA 4POZD 4EI5C 1QEWA 3BRFA 1R3LA 3GKZA 4D2NA 4HS6B 3BEWB 3GK8L 4L9LA 3TBSA 5CIPB 3P0YL 3RNKB 1NBZA 1FVEB 4NQED 4ACPA 1OSPH 2E6QA 1A14L 3DI3B 5TE4L 3T4YA 2DLGA 3T65A 1HILB 1X5LA 4N9GB 4YHPB 3IRPX 4TUOA 4UTAH 4M62H 5A43C 1TTUA 2WBKA 2Q6WB 3INUH 4J23A 2RIKA 1C08A 1YY8B 2A83A 2FSEB 2VXTL 1GGCH 1RZJC 3CFJA 5HGBB 1BBDH 3O6FA 4I0CC 4GRWB 5ETUA 4K8RD 2NY1B 3DVGA 1H3WM 1HIMH 1CXIA 2QKIA 2W38A 4P9HC 4QRUA 3WHE1 2PF6A 4EUPG 5CZVH 3H9ZA 5HBBA 5BQ7B 2PXYA 3H9HB 5EU5B 5AG9A 5JW5A 4Y7MA 2YHGA 1RHHB 5B38A 3AS0A 4WCYL 5E5RB 5D7JC 5CWSB 2HA1A 5A3IC 1BPVA 1NFDA 1BLNB 2UUDK 3EGSB 2DM4A 2M1KA 3T1FA 3WHXA 3ARVA 4AY0A 1X5IA 1CGXA 5I1DA 1A6AB 2XY2A 2ICWJ 4UOW0 3BZEB 1FBIL 2L0DA 3AREA 3HC4L 3NAAH 3OZ9L 1KJ2A 4FXKA 4FQ1H 4YDJB 4F7PA 5I2IB 4M61B 1X4ZA 4NWUH 5KSAA 4NCC2 4QHLA 5EFIB 3OQ3B 4LAQH 2YPKB 4H0HB 3RDTD 3L5HA 3QHFH 4DOHE 4F9PA 4QY8B 1Q9LB 3CFBA 4XPGL 3PWPD 2HLFC 2ITDA 3VWKD 1R6VA 5DURD 1ORSB 4XH2A 2AEIT 3TVMA 4HULB 4PJIA 1W72L 5JMOC 1BECA 3EZJB 4V1DE 1F58L 1N6QL 4KI5F 5JXEA 5E2VL 2XN9B 3BKML 4TPRL 1XCQA 2CH8A 4NQDB 4NN6C 4YNYA 4JFXA 2VWEE 4GAJL 4JZJA 2EO9A 1AFVH 5DVLA 4PJGB 4G6MH 3U30C 1AO7A 2FR4B 1KXQE 2IF7A 1N8ZA 5TE7H 4X7CC 2KDGA 1MFEL 1GGYA 2A0LC 3G6JB 2ZCKL 1JK8A 4G9FD 4LVNC 3RWFA 5JOPE 3P77B 2BNQB 1QRNB 2IH1B 2HFFA 3KPRB 4FABH 2OR9L 1KTDB 4I2XE 3UTTA 4TULL 1KGCD 3O9WA 1M7XA 1JGEB 2H8PB 3EYQC 3S8WA 1HHJA 4L4TB 1T7XA 5EPMB 4KVNH 3AUVA 3GSWB 3O2VL 3T0XA 1EAPA 4W6YB 4NQCA 1GGIH 3GMNA 3UJTH 4ZS6C 3NACL 4OKVA 3VFNA 1R3IL 4JDVB 5FA3A 1BD2A 1D9KB 4F3FA 1MQ8A 4MLIA 3SCMA 4QT5B 2BJMH 2FJGB 3TNMB 4JO3L 3L3KB 3RBSA 4LSUH 1JTPA 4HLJA 1MCPH 2IANA 3B5GA 4IIQA 4QXWA 4QKXB 4FG6C 1B2WH 1PEZA 1QYGL 1HQRA 4OJFH 1TIUA 3EOBB 4N90E 3VRLE 2V9TA 2ZUSA 3VWJC 1LO3H 2Z91B 2R4SL 1MJ8L 2Y1VA 5GQBA 1FVDB 2EDRA 1OAQH 1LEIB 5MEND 2LVEA 2RCSL 3MLYL 2OBGA 3PWJA 1KCVH 4ZUTB 4JFDD 4UOJA 1RUML 2IFFL 5B38G 5SX4H 3P73A 3P30L 5E1AA 4NSKA 3CFIC 4R6UA 1WWAX 4HKZA 1YNKL 2YD3A 4AYFA 1ZT4B 3DX9B 1QSEB 4OBSA 2FEEI 1VPOL 4GS7C 4NO2A 4H20L 5DS8B 3VXNA 4PJHA 2J5LC 4S10A 5F7EH 4NP4L 1BHGA 3LMJH 2OI9B 1CVSC 2AEQL 1KENL 1QBMH 1HQ4A 3UBXI 3UYOD 3ARWA 3B9AA 3QQ9C 4M6NL 3OR6A 4AL8H 1H15B 2F53E 1CD0A 2X9XA 1RMFH 2H6PA 5D96C 1TJGH 3L3DA 2DDQH 4X9GA 4OQ1A 2NY7H 1RSFA 3MCLH 1HHHA 1ACYH 1LE9B 4PJBE 1HXYB 2YD8A 3PF2A 1OSPL 3WO3B 1K3ZA 4RFNB 5CBAB 4JRXD 5I71B 3WE6B 2A6JA 5DMJB 3RNQA 3ARBB 4GUPA 1JTTA 1KPRA 4UTAL 4M62L 3U7WH 3RVXD 3SDAD 3MXWH 3MZTA 3INUL 2I9LA 3PABB 2VN7A 5KS9E 4Y4KD 4XNXH 3SDCB 1GGCL 4OM1H 2VLRE 2EICA 4F7MA 1AP2B 2ZUWA 3ZDZE 4O00A 1AGFB 1BBDL 1EEZB 2VC2H 4ZTOH 1HIML 2GUOA 1LEGA 1E28A 5KZCD 4RAVB 5CZVL 1WIPA 2JB6B 4PRHE 4OZGE 3MRCA 2AXGA 5DZOA 2ERJC 5IKCB 4XNQA 4XZUA 3IKCB 5A40E 3QUMH 1SVZA 1UB5B 1P9MA 3SDDB 5D96B 1IT9H 2JK5A 5DK2A 4JJ5A 2EXWC 3AY4C 4LSQH 1MWAA 2PTTB 1OM3H 3T0EC 3CMGA 5I8CB 4G8GD 2ZUTA 4WU5B 5DHYA 1NKRA 4APQB 4B50A 1E27B 1U91A 2PYFB 3NAAL 3P3YA 4HDIA 4FQ1L 5ESAB 5I1LB 4MCZB 3HG1D 1U8IB 5D7IB 5JNYA 5DJ8B 1FDLH 4LAQL 4UQ2B 3BZDA 4P5TA 5SWSA 3LS5H 1VKXA 3SJVE 3VMPA 3QHFL 1P7HL 5SX5H 4WJ5A 1U95A 3JV4A 5DDHA 4YHNA 1QHPA 1SJHB 5EIVA 3V8CA 2YD9A 2CLVA 1JZ7A 2FNBA 5CINH 1AGDA 2O93L 5JQHC 1A6WH 1BZ7B 3RNKA 4Z7NE 1AFVL 1NCDH 4G6ML 3PJSA 4NNYB 1FNSH 3RHWK 1Y6MR 4NYLB 1HILA 1PW3A 5C07B 5IGXH 4N9GA 1WTLA 1U8JA 5TE7L 4D9QD 3TEUA 4JAMB 4KI5D 2WLZA 4LCYB 4HFWB 2V17H 1YY8A 1P7QB 5DMIH 2K7QA 4FABL 4X5WA 1MI5D 5FO9B 1WCQA 5HGBA 2CKNA 4QO1A 2E7LC 3ARFD 4AMKH 1CQKA 4L3EB 4U1IB 2NW2B 3KPPB 4N0UE 5EO9B 5BQ7A 3H9HA 4X0KB 5EU5A 2GT9B 1GGIL 2XTJE 3UJTL 3STLA 4LCWD 2FJHB 1G6RB 2AERT 4Y2DD 2ZJSH 1NUGA 3FQWB 2BJML 1K4DA 1S3KH 3HE6C 4L3CB 1E6JH 2GJJA 35C8H 1A6AA 4LSUL 3QRFM 2EYTB 1MCPL 2LV4A 3TLRA 3PWNA 4MVBC 2ARJB 4XAKE 2HYMA 5I2IA 4M61A 1B2WL 3L3JA 3FCTB 4OJFL 4X7FC 1DEEB 5CZXD 1NC4D 3EZ8A 1LO3L 3VU2A 4QY8A 1TDQA 1OAQL 5H94B 1WIUA 1ORSA 1P53A 4TYUA 5GSRB 3W11D 2IFGA 4U0QB 4DW2H 4FS0A 3EJYC 5FCSH 3RWJA 2XN9A 3SGDH 3ORJA 3PGFH 1W0WA 3V6FA 5AWNH 4WI5A 4FHBD 1B0RA 3MTRA 3QNZB 1GYAA 1TPXB 4KKNA 4GMSH 3IDMB 3MNWB 3LMJL 2IJ0C 2P8LB 2C1OA 1QBML 1XEDA 1DBJH 2ZSVA 4QOKA 2CDEA 3VI4E 5F88B 4AL8L 3QNXB 1RK1B 3C5SB 2YEZB 4ZXBA 3P77A 1QRNA 2V5TA 3NFPB 3N1PC 5EZOH 1TJGL 4NHCH 3QO0A 2DDQL 1V7MH 2NY7L 1YN6B 3S35H 1ACYL 3VXTB 4NOBA 4WO4C 1JGEA 2Y36H 2H8PA 1MFDH 5EO1B 3Q6FA 3WNLA 4L4TA 5EPMA 5FM8A 5DC0A 1ZGLM 4HXAH 5HGDB 2CXKA 1IAKB 3U7WL 2AS5M 3H7LA 5C6PB 5JORA 5IBLD 2BNUB 3MXWL 1D9KA 1UM5H 3PWPE 1XF2B 3KXFD 5E2WH 4QT5A 4XNXL 4BFEA 1RUPH 3GSXA 1FYTD 4OZHE 1ITBB 4OM1L 4RDQG 5T1KB 2ATPB 3TNMA 3L3KA 5FGCB 4LF3A 4WI8A 2DWEB 4F58H 2VC2L 4ZTOL 3CX5K 1CIDA 5DRWB 3EOBA 4CAGA 4Z0XB 4ZSOA 3QUML 4L5FH 1FVDA 3TWCH 1A6PA 3B9KD 2F54B 3O4LB 3MRFA 1L9NA 1IT9L 1LGVA 2JCCF 4EN3C 2KZWA 3LRSB 4ZUTA 1KOAA 5D1QD 4LSQL 4Y5XC 1OM3L 1IAIM 3SGKA 4NDMB 4E9LA 4JZNA 4GAYB 3QG6B 5DVOA 2VXVH 1E4XI 3D39D 1CXLA 4OB5H 3KR3H 3KDMA 1S5IH 3DX9A 1QSEA 1KGCE 1FDLL 2LQRA 2O26U 3LS5L 2A6IB 2A74B 4FQXB 3QAZB 1KXTB 3V52H 3H9YA 3BJ91 1KUMA 4PJCB 4XVUD 1RJLA 2DQIL 3SOBH 3BT2H 2CXGA 4Y16C 1U42A 4JN2B 1HNFA 2N1KA 4XCCH 3FFDB 1HYSC 3PWUA 2EXYD 4Z9KB 3DUSA 5CINL 5C0AD 5ELIA 3TBYB 3VG0H 5IEKB 1A6WL 4M7LT 3ZYIA 1LE9A 3NIFF 3V5DA 1A4KB 1NCDL 1UXSA 5CBAA 4JB9H 1CFQB 1FNSL 1OT2A 5IGXL 2KQNA 3T2OA 2YD1A 3N06B 1ND0B 3QCUH 4N1CA 4HGKC 2O61A 4Y5XB 4Y4HB 1U0QA 2V17L 1PSKH 5EBWA 5C2BH 5MENE 5DMIL 3SDCA 1L9MA 5D2LB 1LWRA 1AGFA 1H3PH 1EEZA 2BZDA 4LGSB 1KB5B 5I1CH 4AMKL 2WP3T 2MCPH 3HE7C 4JFPB 4PYHA 4FQLH 4GG6B 1BIHA 4RAVA 4MJ5B 4BA8A 2JB6A 4HW6A 3RWGB 3NIDE 5DZLA 3JXAA 2VLLB 4LAJH 1AC6A 3IKCA 1WSST 1SY6H 2V7HA 4NO3A 3BD4A 3SDDA 5J1AB 2LTQB 2ZJSL 2EDHA 2VR9A 2NR6D 4KPHH 2PTTA 1S3KL 1T0MB 2PYEB 5IHUH 2J4WH 1EFXB 35C8L 4WU5A 1OGTA 2RHEA 2EH8H 2PYFA 1EH9A 5ESAA 4MCZA 1ZMYA 4KJWD 4ODXA 1VFBB 4UQ2A 5CS7A 2V2WB 1QFWM 5DJZA 5JHDE 3TH4T 4PJDB 5DJYB 2YUWA 1F4XH 1UKTA 4OZIF 5C0CD 1MCKA 4JRXE 2DMKA 1VADB 5TFSH 5I76B 2OJEA 1IGJB 3WFDH 4GOSA 5D1ZA 3LD8B 1ACZA 2H32B 4DW2L 1MCDA 4MQ7B 2CRMA 1XGTA 3ZE2F 4LVHC 4HUWA 3PGFL 1F00I 4QRRE 2MSPA 1BZ7A 1S7SB 5AWNL 4NBXB 3GSRA 4NQXB 4NNYA 2AGJH 4LCUA 4GMSL 1JNJA 2X4SA 2AW2A 4TSBH 1I7UB 4JAMA 1NJ9B 1DBJL 3G9AB 3FFCD 4RRPG 3ZL4H 3WNPA 2I5YH 2NTSP 3WNMA 1CTNA 3FZUC 1FFNA 1P7QA 1A9BB 4LVEA 3O8XC 2RBLA 5FO9A 5EZOL 4NHCL 3MRPA 4ELMF 1V7ML 5HYSB 4OT1H 2VSCA 4PLKC 3S35L 4G8GE 3VXQA 4J3UA 4L3EA 4U1IA 2VQUA 2Y36L 3KPPA 1MFDL 4HWZA 1OTTD 4H1LB 4JEGB 2GJZB 1UWXH 4X0KA 4HXAL 3HG1E 4NT6A 4G6FB 1I7TB 2ADGB 1AC0A 1G6RA 3E6FB 4JRYB 2A9NH 3QHZL 4LDLB 5E2WL 1FN4B 1QFHA 2R1YB 1RUPL 5FK9A 3U7AA 1U2HA 3P0GB 1FL5B 2V2XB 1JF5A 4F58L 2HP4A 3BN9C 3VGDA 1KPVA 3UXFA 3I50H 4U1KB 2X4RB 1P4BH 1G6RH 1VESA 3V4PH 5KVEH 1MIEH 3CUPB 1I1RA 3FCTA 5J1SC 3VXUD 1ED3B 1ZA3B 4JQVA 3BMVA 3OKOA 4Q74A 3UDWC 5ISZD 4L5FL 3TWCL 1IAMA 4M02A 2W65A 4KI5E 5K9JH 5IW6B 1OARH 1DE4B 5CFHA 1FSKB 2W60B 1I9JH 2YRLA 2NY2B 1VSCA 2VXVL 1NANI 1DQLH 4K7FB 3S34H 5JMRA 4QRTA 5BVJB 4OB5L 3KR3L 1S5IL 3DURB 4PIRF 4X6DA 5CILH 1NC2A 1Z9OA 3MV8A 4YBLB 1SMAA 3MNWA 3BYTA 2P8LA 3BW9A 3V52L 1MLBA 5KSVA 3M07A 4FTVD 1IC7H 1RJZB 2P43B 1KJ3H 5F88A 5T1MB 3QNXA 5C92A 1RK1A 3SOBL 1ZVSB 2JELH 3BT2L 4JJHA 3VFMB 1CDYA 3NFPA 4PRPE 4F15B 1JHKH 5F96H 4WGWB 3MA7B 3VG0L 1YN6A 3RQ3A 3VXTA 3DRTB 1A1NA 1NCUA 5EO1A 2DKSA 5FV1L 5E4EB 4JB9L 1GOFA 4MSWA 1A5FH 5HGDA 1IAKA 2ZP0T 4CNIB 3QCUL 4JREB 4JO2H 5DI8B 4EOWH 3WO4C 2BNUA 2X7LB 4U1HB 1PSKL 5LKNA 1CFNB 5D93B 1UCTA 3KPSD 5EUKB 3DO7A 1D6EB 2GSIB 3OKMB 1H3PL 2DWEA 4ODBD 2AXHA 4GG8A 4MNHA 3L95B 3GSOB 4NQVB 1XFPA 5I1CL 4WV1A 1TNNA 2MCPL 3NFNA 4FQLL 4MJIA 3RTQC 5DRWA 5C08B 1UA6H 3TA3B 4DCQB 4PG2C 5INDA 5T3XE 5DEGA 5K9OB 1EJ6A 1SY6L 4BSWB 4KV5E 5HHQB 2F54A 3RZWA 1TNMA 2R69H 4LLVA 3NCFB 2HN7A 2MPAH 3LRSA 1T6WA 1X5AA 5E24E 4KPHL 3VH8B 4DUXA 1XGRB 4YDLC 5IHUL 2J4WL 4Y1AD 3HMWH 3PNWB 3KNBB 4JM4H 2ZUQB 3RI5K 4GAYA 2PW1B 2EH8L 3BOVA 2ADIB 2DQEH 1KT2B 1MF2H 2X1QA 3PL6D 4O5LH 3RUGF 3RWDB 1F4XL 4BELD 3ROOB 3T8XB 3CDGB 4KRPC 3B8YA 5TFSL 4HWEH 3U4EA 3WFDL 1NGXA 3RY6A 5D72H 2UWEA 4JN2A 4LHJB 1XF3B 2XKNB 4DVBA 3FFDA 4FQJH 3FOLB 3KXFE 1CGTA 4FA8A 2HJFB 2KPNA 3TBYA 3T1WA 3U46A 3MROB 1DVFB 1F4AA 4YHKH 5J4MA 1A4KA 2X4NB 2AGJL 1CFQA 4RSVA 3T2PA 4TSBL 3IDNB 1JVKA 1ND0A 1NFDF 4TUKH 5HXMA 3ZL4L 3RGVD 4Y4HA 1A7QL 2X1WL 5F9WC 1XIWC 4OBRA 3BPOB 5KTEL 4ZDHB 5D2LA 3NCJH 3TPKA 1FQ9C 4OT1L 4Q6IC 1XGQA 3OKDB 2R29H 4RFEA 4MQXC 4JFPA 2KQMA 5DVKA 3S35X 4ETYA 5J11C 5FECA 2ITCA 4P23C 1BQLH 3OKEB 4PJ8D 1WC7B 1KN4H 1CL7I 1ZT1B 3D39E 1QSFD 1IEAB 2VLLA 1I7ZB 3QUZD 2R0WH 4DZ8B 4OF5A 2VRAA 3G5VA 1KB5H 5DMYA 3V79C 1B6UA 2A9NL 3JWOC 1YQ2A 3BGFB 2X4PB 3VMOA 3ZTNH 1CCZA 3QWOB 1I8IA 4AK1A 1EFXA 4OFPA 3FO0H 1P6AB 1ZWIA 4QLRA 1F4WH 3HZMB 1AD0A 4FFWC 4KZDH 3I50L 2IMNA 1U8NB 1P4BL 1G6RL 3V4PL 5KVEL 2JJVA 4NWTH 5C0AE 4RIRB 2V2WA 2WMPA 3B83A 3CSBA 4WWKD 2X4TA 4E41E 4FQIH 1D5MA 3OJMB 4C83B 1VADA 1MCHA 3KG5A 5I76A 3S7GA 1HEZA 2P4AB 1XMWA 3VFUB 2FGWH 3MJ8B 3OL2A 5K9JL 1DANT 1OVZA 2PUQT 5J6HA 2G2RA 2H32A 1OARL 5CJXC 4Q6IB 1N6VA 2DMCA 5HY9A 1DBKH 1I9JL 3D85B 4HIEB 4P23B 4QF1B 2OL3B 1JPFB 1TTFA 2VE6B 5FKAB 1RVFH 4JFYB 1DQLL 1O7SA 4UBDC 4XNUH 5F7DA 3CFDB 3S34L 4CU8A 1E0OB 1PKOA 1ZHNA 1DBAL 4HUVB 5F9AC 3DETC 4NQXA 3NFSH 5CILL 5D8JH 4YHLL 1WZMA 3OHXA 5E9DD 4DVRH 3STBA 2H32H 1ZE3C 2DS4A 2IC2A 2R8SH 4GLRH 1I7UA 1NJ9A 3MNZB 1IC7L 4X9IA 3BDYH 1KJ3L 4MNQE 4P57A 1AGEB 3QI9A 5D1XC 2JELL 2D0HA 4LHUA 1A9BA 2BOCB 2IBBA 1S9YB 3LDBC 4RNRB 1JHKL 1IM9B 1AJ7H 4G8FB 5F96L 2P7TB 4HCRH 5CJBA 4JDZB 3ARGD 2PW2B 1GC1C 3GGWB 5I75C 4L8SA 2APTA 4H1LA 2GJZA 1YMHB 1K4CA 1NDMA 1A5FL 3VW3H 43CAB 1MY5A 3HCVA 4JO2L 4EOWL 4FRWA 3E6FA 5C0CE 5EOTB 1U8LB 3C60D 3DMMA 5D6DC 1G9MC 1F02I 2R1YA 4LSTH 4H1LH 4U1MA 5E6IB 5H35B 1E6OH 1JZ3A 2AK1H 5IJKC 3OV6A 1FL5A 2V2XA 3EYFA 1QKZH 3BPLB 4WFGD 2Q7YB 4PJAE 1S7QB 3RVVD 4MXVF 4U1KA 2X4RA 1T89A 1UA6L 5JW4M 5DUPH 3EDJA 2VLMD 5EBLA 5GS0H 1MFNA 4EXKA 4R4NC 5KG9B 4KUCF 1U8QA 5DJDB 2R69L 5JW4N 2MPAL 2UZIH 3FFCE 1ZLUH 1DE4A 2CK2A 3HMWL 2W60A 4JM4L 5JPMB 4WHTB 3OB8A 2AABH 5IROC 4OD1H 4K7FA 4U1NB 3WD5H 5BVJA 4DOHB 4NO0D 2DQEL 2WW8A 3DURA 4BSJA 5ADOH 5I1JH 5GIRB 1MF2L 5I15H 2D4DA 3FT2A 4O5LL 4QGTA 3JV0A 4HAFA 5F44A 4HIHA 5HYFA 4V1DB 3NZ8B 2VR5A 4HWEL 1JL8A 3TBWB 4JDTH 2N7AA 5D72L 3C6LA 3BZFA 5I0ZA 5J6GB 5L88H 3QDME 4FQJL 3VA6A 5EU3B 4S11A 3R0NA 2Z35B 3T77B 2ED8A 3ROLB 1QZ1A 4YHKL 2HT3C 1A2YA 3VFGH 1CDIA 3EYOB 3EDEA 1CF8H 3TO4A 3QSKB 1SYVA 3O6FD 4CNIA 4TUKL 1AH1A 3I6KB 5DI8A 2X7LA 4U1HA 4I2XB 2MKWA 4KDWA 2CGRH 2PXYD 4DQOH 1OB1A 5EUKA 2GSIA 5KSUB 4ZFGH 1UKSA 5IW3A 3NCJL 4OGAC 1KCSH 4IEFB 4LNRB 2JIXD 4GRMA 2R29L 4KTYA 4WTWA 2VAJA 3H0TB 4U1GC 1BQLL 4DCQA 1KN4L 4P3DB 2CIKB 4KK5D 3LKSB 5K9OA 3PQYA 3BP7B 5HYSG 1OL0A 5LBSH 1C1EH 1WAAA 3F7PC 4XBGB 4BSWA 5HHQA 2R0WL 5BZWB 5MP6H 3K8LA 1FNEB 1F6LL 3ARED 4KKCD 4MGXA 1KB5L 3E0GA 4H1LG 3T0BA 3P11H 3ZTNL 4MNGE 3PNWA 3FO0L 2EDNA 5IVZB 1L6XA 1F4WL 3F8UB 4XXDA 4LOUD 4KZDL 5FYJD 5AYUH 3AU1A 4IS6A 1IM3A 1ZGLB 3TVMD 4X7TB 4NWTL 2WQ8A 4N0CC 4RDQF 2YN5A 1CGSH 4UV4H 4F9LA 5TDOB 2BVOB 4TVPL 4FQIL 2XWTB 3HI6H 5JXED 3GRWH 3S37X 3V95A 2FHFA 3IDYB 2DJSA 2WBJB 4X8XA 5GGVH 1JV5A 2FGWL 3KYOA 5J9PA 5LAXB 3U2SB 1AO7D 5HD8C 1DBKL 2VH5L 1HXMB 4Y19E 3L7FB 4KVCH 2HJFA 3NIFE 2NY4C 4NN5C 3KPSE 1RVFL 1NEZB 4X6CE 1FNHA 1UJ3C 5D2NC 4Z7WF 1G9NH 1BMGA 1DVFA 5CEYB 4GT7A 3S88H 3NFSL 5B22A 3MRGA 3WKMH 4DVRL 4UNVA 3LKRB 4OUUB 3IJHA 2R8SL 1CDHA 1HN1A 1LO0H 3KYMB 3UTTD 2F53B 3FO2B 3S97C 4QTIH 1QFUH 3O9WD 5F97E 1C8PA 3BDYL 4NIKB 4C56E 3VFOB 4KKAC 2EDWA 1ZLSH 3GNMH 4WNQB 4NQCD 4ZDHA 1AJ7L 2JJSA 4PJBB 4HCRL 1SJEB 3BVNB 5GXBB 4UDUB 1OSZB 3EDDA 5FUCE 3O2WH 4ODTH 4UIMA 5HHOB 1LO2H 3CSGA 3SCMD 5IFJA 3VW3L 4U1SB 1I7ZA 3GSNA 5D7LD 5JOFA 2PCPB 5KS9B 2CUHA 1K8IB 4DZ8A 3FRPA 2IAND 4GAFB 4HUUB 3UTZB 2VLRB 2EYSA 6CGTA 3BUYA 4MD0A 4LSTL 1UFUA 1E6OL 5MEQA 2AK1L 4IRSC 4KDTA 1QKZL 3AM8A 4PRHB 4OZGB 5EB9A 4M5YH 3W0WE 2L7UA 1HHIB 3F5WB 3TNNB 3CC5B 4KTEH 2OTPA 4OZIE 4RIRA 5DUPL 1FNGB 3BN3B 5GS0L 4LSRH 1HI6B 4C83A 4HEME 4MAYC 4WW1B 3VFUA 1M71B 3MJ8A 1YMME 1ULVA 5GISH 2P5WE 4NN7C 3ZE2E 2I24N 4EVNA 4KDVA 1A21A 1KYOK 2NYYC 3SE9H 1DQJB 4QF1A 2OL3A 2VE6A 4RGNE 2ESVB 2AABL 3VGBA 3QIBB 4OD1L 4U1JA 4NM8H 3CFDA 3SJVB 3WD5L 4KUCD 3BJLA 4HUVA 5ADOL 5I1JL 5I15L 3B9EA 5KVDH 3TZVC 5JDSA 1DLFH 5DJ6A 2OL3H 2M26A 4C59B 5BZDA 3EFDH 4JDTL 3IFNH 3MBEC 5DO2C 4ELME 3RVTD 1MCWM 4ZPTB 1S9YA 4RNRA 2GCYA 5L88L 4POZC 5EOCH 3TV3H 1ZLWK 4JDZA 1MH5A 4XVSH 4IMLA 4JPVH 2VKXA 3HS0B 5IFHH 1JZ6A 1YMHA 4ORGB 3VFGL 1NBYA 4OZFB 3UAJD 1GZPB 2H3NB 1M4KA 2E7MA 43CAA 1CF8L 1Z9MA 2F8XC 5IR1A 2ZWLT 4PD4K 5EOTA 1U8LA 3V4VH 2EDOA 2CGRL 3V5KB 2R0KH 4DQOL 1QFOA 5H35A 1HDMB 5I17A 2ADJB 3LSOA 4ZFGL 3CFCH 3O0RH 4N0UB 9CGTA 1D7FA 1KCSL 1G7HB 1RUKH 3RIAF 3QUXB 2XTJB 5SX4I 1S7QA 1F3RB 1QOKA 3FRUB 1MPAH 1MQKH 4QCIB 5JA8B 4HHAB 4K8RC 5IV2B 3CU1A 3MRBB 4GQPH 4S2SA 2EDLA 4I9WE 4WHYH 1X4YA 5LBSL 1C1EL 5KG9A 1UYWH 1T4KA 5HHPA 1IKNC 5MP6L 3U48A 2VDNH 1RUAH 1OT1A 1YA5A 4YDIH 3P11L 3PHQB 1WJ3A 3DV4B 4P5TD 5SWSD 1Z9LA 4Q0XH 4XC3H 3FRPG 5JPMA 3QH3B 5E8EB 4WHTA 5E2UH 3CFKA 3H9SD 3SKMA 5AYUL 4R96B 1ZHBA 3G5XA 5C0BA 4X4ME 3TJEH 3FO9B 5IMKB 1AGBB 4ODVH 5GIRA 3CDFA 1MRFH 4N5UA 3OR7B 2UY6A 1CGSL 4UV4L 5IFAH 5I73B 3MJ6A 1Z0NA 2EEDA 3HI6L 1JGVH 4RGOH 3GRWL 4V1DA 2FX9H 2C4FT 3MQIA 1PJ9A 5GGVL 3PXHA 1BOYA 4BSVB 3VWKC 4M93B 5EA0H 3RPIA 4M48H 1JMZA 4PP1D 5K59E 2OSLB 5J6GA 4KVCL 4P2OA 1FC2D 4LHQB 3C09B 1QNZH 2Z35A 3KVQA 1DEDA 3I6GA 1G9NL 4XBEH 2YOCA 1H5BB 5CSGA 3ROLA 2BMKB 3S88L 3FTGB 3DLQR 3WKML 3GMLB 3EYOA 3JWDH 3UP1A 1DFBH 3DX6B 3W2DH 1LO0L 3FN9A 3OKLB 4I4WB 3I6KA 2HT4C 4QTIL 1QFUL 3QDGE 3IRZA 3BX7C 4I2XA 2XPGB 4JFFE 5C70A 5FO8A 4HUNB 1ZLSL 3GNML 3FQRB 4HJ0C 3G6AB 5T5FH 5KSUA 4Q9QH 1VFOA 4JPWH 4LNRA 3I9GH 1BREA 4ODTL 4KUZH 1C7SA 1XH3B 3QXTA 1KNOB 5DUBB 3O41B 3V6ZA 1LO2L 2CIKA 3RDTB 4ODSH 3LKSA 5IHLB 4RGMC 3PWPB 5BZWA 5DTFA 4EI5A 1FNEA 3MO1B 4OGXH 5MI0C 4OZHB 3M17B 4ZOCA 3B8SA 3MOAL 3ZKXC 4RX4A 4IHOB 4LLQB 2GQHA 2VAAA 5IVZA 5L0QC 2A38A 4M5YL 4QGYA 3RUGE 2F8VA 4KTEL 1ZGLA 1PVHA 4X7TA 2I07A 4WHYG 3PDOA 2BSED 5TDOA 4LSRL 2XWTA 1NFIB 2XN9D 3DYPA 3IVKA 1T1YB 1ZSDB 3NPZB 5F3HB 5I9QB 4JCLA 3IFOB 2WBJA 3UJJH 2XWJA 3JTTB 5GISL 4OLWH 3Q5YA 3ZT5A 1UVQB 4NZTH 3L7FA 3SE9L 4XPHH 2R2BA 4F7CA 1IZJA 1NEZA 2EDEA 3BKJH 4NM8L 4QOKD 3W9EB 1ETZB 25C8H 1RZJH 1T83C 4ZXBD 5KVDL 1QRND 4WIQA 1Q9KA 3KAAA 3KYMA 5GSVB 1DLFL 1KG0B 2OL3L 3EFDL 3RKDD 4MX7A 3O3EB 3SKNA 3IFNL 4L4TD 5F89A 3VFOA 2R15A 1VFMA 4O58H 2YWZA 4G8IB 4PJBA 3MLRH 2R1XA 5EOCL 4Z5RB 3BVNA 3TV3L 2AJ3B 4A2MA 2G75B 1DN0A 3T0VA 4M9PA 4XVSL 4JPVL 1CN4A 1D9KD 1QA9B 4KWUA 5IFHL 2AK4E 5FYJE 1R5VA 2QSCL 1IAIH 2Q8AH 4U1SA 1NCAH 3LKPA 3ARTA 4KK8D 3S3JA 5JW4R 4CDGC 5KS9A 3EYUH 5MENB 2E8ZA 3UTZA 2VLRA 2FIRT 3V4VL 4MJ2A 5HVHB 3DX7B 1N2RA 1YEKH 5DFVC 2WWKO 5GGUB 2R0KL 3SDAC 2UV3A 2DIJA 3X11B 3CFCL 3O0RL 3EKCA 2E27H 3HC3L 4PRHA 1RUKL 1U3HC 4OZGA 4I18C 5L9DH 2K1MA 3F5WA 1HHIA 4X6DF 4TTDD 1MPAL 1MQKL 3CC5A 1S7UB 4YK4C 3SGDI 1G7LB 3CNKA 1M7IB 5E8DH 1W8OA 3EOTH 1UYWL 3GB7A 5J12C 4H8WH 4X6BB 1P5VA 2NXZD 1ITCA 3VXPA 2VDNL 3MRKB 1RUAL 3UTTE 4YDIL 1QSED 4Q0XL 4XC3L 1DQJA 3NPSB 5E2UL 5DXWA 1DCLA 4M00A 5JHDB 4PY8J 5CHNB 4L29A 3TJEL 4ODVL 2YRPA 4JRXB 1MRFL 5I18H 4WTZG 1R5WA 1U8HB 5IFAL 3VFWB 3F6IA 2FL5B 3BH9A 4TNWF 4CRPA 1JGVL 4RGOL 1XR8A 2FX9L 3ESVF 5D7LE 4KRLB 4PGJA 4Y4KB 5EA0L 2IANE 4M48L 4N5EC 4ZPTA 4Q97A 1IGFH 2K3TA 3BE1H 4FXGB 1QNZL 4U1LB 1A47A 1YY9D 2Y72A 4UTBH 3MRJA 2R56H 5KZCB 3AXLB 4XBEL 4TOYH 5FO7B 5C0NC 3DX8B 3HS0A 4Q9CA 3QIUC 2BY1A 4P5MB 4X7EC 4ORGA 2F74B 5CJOH 3SDCD 1GZPA 3JWDL 1DFBL 3W2DL 1QPXA 4RMWA 4YGAB 3TYFB 1NEZG 1FZKB 5DD5H 4UIKH 4KK9D 1JNNL 5IF0A 3OXRA 1EVTC 2G9HB 1EUUA 1P84J 1QFWH 5IQ7H 4WW2F 5KSBA 4G8GB 1HDMA 5T5FL 4ZPVB 4Q9QL 4N0UA 3MGTB 4JPWL 4MXVE 1G84A 1G7HA 5JZ7D 5DJAA 3OPZH 3QUXA 5LGKA 3MYJB 3RL2A 3I9GL 3GSVA 3HG1B 4Z6AT 3MV7A 2AJUH 4YHIA 3SDDD 4KUZL 4QCIA 3CDCA 3O3UN 2GK0A 3ARFC 3OJDB 4ODSL 1I1CA 4HG4J 4HWNA 1AHWB 3QBTB 3X14B 4OGXL 1YC7A 4ZFZB 3TO2A 2UWEF 4OCWH 4LLDA 4LLWB 1T1ZB 2EDJA 5B8CC 1Q9OB 2D7TH 3DV4A 3ULVC 5DJCA 3EO1B 1C16A 3H2WA 5CGMA 4UQ3B 3IDUA 3QH3A 4TNWK 1DUYB 1J1XH 1Y18B 4R96A 4LIQE 1CLOH 4HMEA 1AGBA 5D1ZD 3OR7A 3IDJA 1AD9B 1M6OB 3OKNA 2FLBT 1I9EA 3I02A 3I75A 1L7IH 4BK5A 3UJJL 1HHGA 3CSYB 2XG5A 4LSPH 4BSVA 3OAUH 1L6ZA 4OLWL 5D2LF 4HJGA 4NZTL 2CUIA 2J7LA 3QQ4B 3WS3B 4XPHL 3ARFB 3BP5B 25C8L 1RZJL 5GGTA 3FTGA 2BY2A 2OXGA 1P7QD 4LCWB 4X9FA 3DX6A 4I4WA 2PTVA 4XB7A 2BSTB 3SKOB 3V9FA 2HFEA 4ZFFA 4OSUH 4Y2DB 1KTRL 3AY4A 5ADPH 4L3ED 4PRPB 3ZO0A 4LMQE 5ID1B 2D7PA 3T0EA 2XPGA 1X9QA 4U3CA 5GGTH 4O58L 3FQRA 4MA3B 3G6AA 4K3JH 1A1MB 3MLRL 2D7NA 4OD2A 3EOYG 1GJIA 4LPTA 3ZE0F 3LN5B 1QVOB 3KPLB 1XH3A 5DUBA 1KNOA 1NC4B 1OW0C 3H9SE 3O41A 4Q9RH 1CFVH 1FORH 1IAIL 2AKRA 2HG5B 2Q8AL 4J12A 1NCAL 5GRZA 3L9RB 2FJFA 4RA0C 4GXUM 5F9JB 4GBXD 1JP5A 3V5HB 2NTFB 3EYUL 2GEEA 1NPUA 1KEGH 4OZHA 3M17A 2V5SA 5F1NB 1MCQA 1FG9C 4M7ZC 4NC2B 4NOFA 1YEKL 4L8CA 5BMFH 3S96A 3VD5A 3BMWA 2VTFA 3LKQB 4LLQA 1CGVA 2Z31B 4F7TB 2E27L 4ELKB 3HLAA 5L9DL 1J8HA 3QCTH 3OGCA 4JE4B 5EBMA 2C1PA 5E8DL 4AQOA 3ET9F 3EOTL 4LPVA 5FYLE 1NFIA 4PJ7F 1A1OA 1T1YA 4H8WL 5F3HA 1AR2A 3GJFK 1GSMA 4ZS7H 1FRGH 1OCWH 3IFOA 4JPIB 4BM7A 2VLJA 3GJEA 4WUUA 5KBNC 3B9KC 5IT2H 4J8RA 1NC2D 3MV8D 1B88A 2E7LA 1UVQA 2IAMC 1TQBC 3FAXA 4CVZB 3CH1A 5D1QC 3JVGA 5GRXG 4Z7WE 4NRYA 3QDHA 1T3FB 3D3VA 2APVA 3W9EA 5I1AA 5I16B 5I18L 3ABZA 1FZOA 2F58H 2Y7QB 4V2CB 5FB8A 3AROA 1KG0A 5C0JA 3CK0H 1ONQB 5MEPB 3O3EA 3KXFB 5TQ2H 2D3VA 3O81A 1IGFL 1NAMA 3BE1L 1BM3H 1LDSA 4O2EB 1TCRA 2CR3A 4Z5RA 3HUJF 2AJ3A 3FAWA 2G75A 2QSVA 4UTBL 2R56L 2EXYC 4TOYL 2HTKC 1QA9A 5CJOL 4J2XA 3WN5B 1B90A 1K2DB 2W92A 1NAMH 3FQXA 3L5IA 4CU7A 5DD5L 4Z7VA 1G0XA 4UIKL 2X1PA 1J8KA 3MRNB 4MJID 3DX7A 1D5XB 1QFWL 3DV6B 5GGUA 5IM7B 1EHNA 4QWWD 2HJLB 5HYJE 3QEHA 3X11A 2WK2A 1BQHB 3SGEH 3OPZL 3T0AA 4CN6A 3D39B 2F54D 4S0SD 1XF4B 2AJUL 1C5BH 3JTSB 3P9MB 4LCIH 3K2UH 1WK0A 4QOKE 1M7IA 1U41A 4IOIB 2PETA 5EU7C 5J13B 1DSFH 3S9DB 4DEPC 4KK6D 5F3BA 4X6BA 1PFCA 4OCWL 5SWZE 1EIBA 3ZLQC 4R0LB 4G42B 5CD5D 4WI4A 2DIAA 4QEGA 5ICZA 5GS1C 4MB3A 1J1XL 5C0AB 4P9MH 2BY3A 4OFDA 5JHDA 3P4LA 1TTGA 5CHNA 1CLOL 4NZJA 4E41B 3NMEA 5JO5B 1U8HA 2UUDH 5DJXA 3HN3A 3VFWA 5LJYH 3CPLB 2NXYD 4GW5A 4RBPK 5CEZD 1JHTB 1L7IL 1MCNA 3NN8A 5DMKB 3F65A 4LSPL 3OAUL 4Y4KA 3N85H 4BFIB 4EZMA 3U1SH 4QRRA 4FXGA 2ZUYA 2YC1B 3REVB 3K1DA 1CFTB 1OGAA 3ZHKA 2VERN 4MQTB 3ARDB 4EXPX 2QEJA 4ZSOE 5FO7A 3DX8A 2W0LA 5IEHB 4P5MA 4GRLA 2HKHH 4N8VB 2F74A 4OUOA 1WAAF 3PGDB 1WFNA 5ICXA 4MNQB 1W0VB 3CCHA 4OSUL 1FZKA 1JGUH 3SDXA 4X5LA 1CS6A 3V4UH 1BF8A 5ADPL 1RZIB 1ZHLB 2G9HA 5DJ2B 3U83A 5GGTL 4KY1H 4K3JL 4ZPVA 3F7QA 3TP4A 3G04A 3B5HA 1U6AH 5DEFB 4XI5D 1VERA 4M5ZH 4Q9RL 4P2QE 1CFVL 3OJDA 1FORL 2X44D 3T2NH 1QQDA 2CRZA 5C0CB 1AHWA 1EFXD 3JV6B 4JFQA 1R3JA 5JLZB 4BH8A 1KEGL 4ZFZA 1G7MB 3F7YA 3HRZB 2EYRB 2IPKB 3ECBB 1F6AA 3O4OB 1T1ZA 1TCMA 2AXFB 4HIJA 3KLHD 5BMFL 3OG4B 1U8PB 1Q9OA 2HT2D 4NPYB 7FABH 1TFHA 4UQ3A 2NY0C 4O4YH 2YS4A 1X7QB 5TDNB 3BGMB 4FMKA 4DZBB 3QCTL 1R24B 3GO1H 2Z4QB 3LPWA 1ZS8A 1MVFA 1QLRB 2FZ3B 1ORQB 2VMFA 4AH2A 5IJVB 4ORZC 1JN6B 2X40A 3FFCB 4K2UH 4ZS7L 1HH9B 1FRGL 1OCWL 3MGAA 4LKXB 1C12B 1F11B 1CICB 2Y25A 3NTCH 5IT2L 4QHUB 3MCKB 2FATH 5GHWH 3N0PB 3IU4H 4QRPA 5JQ6H 4P4KB 3QQ4A 2P46B 3WS3A 3MUGA 2NY5H 3MRQA 2GY5A 2AJYH 3KYKH 2R1WB 4OLYL 4U33A 4OKDA 5LWYH 3QI9D 1I1AB 4WWID 4LHUD 1FLTX 2F58L 1HSAB 3UPAA 3HMXA 3CK0L 2P42B 5GRYA 4PRPA 2DN7A 2CSPA 5ID1A 3QDMB 5GZNC 3V7AG 5TQ2L 3V7MA 2WWMD 2DJUA 4MA3A 1Q1JH 3QJFA 1A1MA 1BM3L 3ARQA 3QULB 4ZUWB 4ZQKB 4M6MH 3HMXH 3LN5A 5IWLC 1QVOA 1MVUB 3DMMD 4BUGA 3MUZ1 2GK2A 4PRIA 2BHUA 2HG5A 5GS0D 5EOCJ 1NAML 3NA4A 5J1TC 4S1SH 3UTPD 4N0FB 1REIA 3U6RB 4H25B 1AGCB 1FAKT 3CDYA 3TJHD 3LKQA 2ZUUA 4L4JA 2Z31A 2NLJA 4W70A 4KKBD 4W68A 4U49A 3B6SB 1WCBB 1C5BL 3WUZA 4LLYA 4LCIL 3D69A 5T1DH 1T66D 3K2UL 5DFTA 3ZT7A 2OQJA 3QJHB 5ESQB 4EJ1C 1DLHB 4X99B 5AAMA 5L8JB 2A6DB 1DSFL 4ZUSA 2NY2D 3BQUC 4K9EH 4Y5YC 4LEOA 3EHBD 4JPIA 3SO5A 1XAUA 4MNGB 5T3XH 4GLRI 3FQTB 5F9OH 4Z7UE 1I75A 3X13B 4G7VH 4KFZC 1KJVA 4P9ML 2CRIA 1T3FA 3HA0A 4HX1B 3UTSE 2C3WA 2W1NA 3C6LD 4LU5H 1IVLA 1I3VA 2FYYB 2FD6H 5I19H 4YHYC 1KIUA 5ECJE 3PL6C 4YJZL 4Y5VC 5EZLB 1TQCC 1XF1A 1KIPB 3VA2C 5MEPA 4Y19B 3D6GA 4J7RA 4KAQH 1JGDB 1GZQB 3N85L 3QO1B 3KPSB 4X6CB 5DVMA 3U1SL 3TH3T 2QQQA 2V7NA 3DSFH 3TO4D 3UX9B 2AEWA 2AQ3A 3QXVA 1MIMH 4NNXB 4D8PB 4X4YA 1OTSD 4PJ5E 4JPKH 3UDWA 5D7KD 2HKHL 3QYCA 2QADC 3WN5A 1K2DA 3MRDB 1RZ8B 4C56B 4BKLA 1JGUL 1VACB 3V4UL 1MFCH 3MRNA 1RQ5A 1UACH 3D9AH 1PD6A 1A02N 1D5XA 2F15A 3DV6A 2HJLA 3RVWD 4KY1L 5EC2B 2WUCH 2EDQA 3IFLL 3PQYD 1YC8A 4X6DE 1BQHA 4KXZH 1U6AL 1N5AB 1XF4A 1PAMA 3NCBB 1Y0LB 3JTSA 3P9MA 4M5ZL 1UM6H 3I6LD 3MNVB 3T2NL 4IOIA 3MYZA 2J6EA 4PJ8C 2AJXH 5ACMA 1UC6A 2BVPB 1XT5A 1WZLA 1I7RA 3QUZC 1JNLH 2Z9TA 4OV6F 3TFKC 1Q38A 1RK0B 4R0LA 2OP4H 4HJJH 5C86A 4G42A 2OTWA 2OZ4A 3BZ4B 3P2TA 2CLRA 3W0WB 7FABL 3EFFB 5GJTH 4N0YH 5EO0B 4YXKH 4LRNH 3REWB 4O4YL 3T3MF 2VKWA 4OZIB 2J6EH 2XXMB 3VFPB 3WJLC 3GO1L 3EO0A 1BIIB 2FB4L 4NUJB 1TVBA 4E41A 1Q8MA 3VDCA 4YBQC 1DQQB 3ARUA 1N0LA 2OZ4H 2PO6B 3VFVB 2B4CH 2VDKH 3CPLA 3ULUF 1AE6H 1YMMB 1NCNA 1SYSB 4N1HB 2P5WB 4WWKC 4AIXA 4ZOBA 3RGVB 4K2UL 4BUHA 1JHTA 4KRNA 4NKMB 4PRAB 1DVFD 3NTCL 1MUJB 4BFBD 4RGNB 5GHWL 2FATL 4BFIA 5K33A 1KCKA 1RU9H 5HHXH 3MMEB 5JQ6L 4MJIE 4FFVC 4PGEA 2YC1A 3CD4A 4IMKC 5FYKU 2NY5L 3F7VB 4PG2A 2AJYL 1BFTA 3ARDA 3KYKL 5AZ2H 5LWYL 3C8KA 4HSQA 4N8VA 3LHPH 4LL9A 2A73A 3PGDA 4JFOB 4MNQA 1KSRA 2VJXA 2XACC 4ELMB 4KJQD 4U31A 4PJEE 1YEIH 1ZHLA 3NGBC 3QA3B 4RAUA 5DJ2A 2GTWB 4PV8B 3J7HA 1Q1JL 5D9SB 2X10A 1QSZA 3VRLF 4U3HA 5B4MD 4RZCB 1F45A 3IJSA 4M6ML 3HMXL 2DQTH 1DQTA 1CD8A 3CAFA 1MCIA 1EK3A 3W5NA 1A4JB 3PIQB 4WWKB 2YPLA 3ARGC 3VJ6A 5DEZA 2UWEE 5JLZA 4W4OC 2VABB 32C2B 4S1SL 1G7MA 2KUTA 3QXDA 3AS1A 5IMLB 1IJ9A 2EYRA 5AAWA 3VRIA 5CEZE 2AXFA 3BYYA 4LLAA 1TZIB 4MXQD 4PJAA 4ZYKB 2B1AH 3GMOA 4NPYA 1F3DH 2IBZY 4HUKB 1IRAY 3UROR 1S7VA 3BGMA 2X70B 4HKXA 4YPGB 5TDNA 1R24A 5DSCB 3LPGA 2Z4QA 3MXVH 3ULSB 5T1DL 2WSKA 2FZ3A 1ORQA 2IH3B 4R4FH 1BQHG 5E7FA 5IJVA 1CE6A 1M05B 4K9EL 1BFVH 1XIWA 1CYGA 4NFBA 5T3XL 5F9OL 4LKXA 1F11A 1CICA 3C2AH 3EYSH 4PJBF 4QHUA 3MCKA 5AD0B 4IJ3B 2YXMA 4G7VL 1T7VA 2WIIB 4CADA 2WWKT 4P4KA 2D31A 1PX3A 4Z95H 2YD5A 2BX5A 3LRGA 3CX2A 2R1WA 1JE6A 1I1AA 1NBQA 2EIZB 4LKCB 5KS9F 1HSAA 2FD6L 5I19L 2C3GA 1MRCH 3QB7C 3O3AB 4XRCB 2GTZB 1NMAH 2HVKB 1MLCB 3QDMA 3C60B 5EU6A 1D5BB 4L9LC 2FHCA 3QISA 3S98A 4ODUB 1UB6B 4OZGF 3ZE0E 3DSFL 3QULA 4ZUWA 4ENED 2VQ1B 4R97B 4ZQKA 4JG0H 1RULH 3BPCB 4OI9A 4R2GD 1MIML 3Q5TA 5L2KE 4JPKL 1MVUA 4BQ6A 4Z76B 4U0RC 3VGFA 3QDGB 1JWMB 3K1KC 2A1WH 4JFFB 5IVOA 5JIKA 3DGGB 3NCYP 1MFCL 4N0FA 1UACL 3QCVH 1MJJB 3O6FC 3D9AL 4N8VG 5HGAB 5BO1H 1AGCA 2VXUH 4OCYH 3WXWH 4GKZA 3RWEB 2WUCL 5KANG 2PXYC 4R4BB 3B6SA 1LP9A 1EEYB 4MMZC 1FZJA 4XCEA 3T09A 2VDPH 1UM6L 5TQ0H 1R3LB 4NCDA 4B0MM 4D0CA 3QJHA 4PJ7E 5ESQA 5HVWA 1DLHA 2A9MH 1KACB 1QTYT 3TBSB 4KK5C 2AJXL 2AV7A 1VENA 2HFGH 1JHLH 1JNLL 1NBZB 4MD5A 1Z0MA 3DHMA 3D2UA 4MNGA 5C0BD 1JF6A 2EC9U 2OP4L 2Y23A 4HJJL 4FQHB 3AREC 4KKCC 1UADC 3T65B 3RUGB 1RD6A 5KSAC 5GJTL 4N0YL 4YXKL 4LRNL 2J6EL 4OFIA 5AZEH 3RAJH 4V1DD 1AR1C 3PV6B 4HX1A 1PEWA 4F9PC 1CTOA 5ITFB 1C08B 4FFYH 2VDMH 5HPMB 5GGSY 2FEDD 3CFJB 2OZ4L 3TVMC 2B4CL 2VDKL 3OAZK 1AE6L 3O6FB 5C0EB 4P2OD 5EZLA 5D6DA 2QKIB 4YC2C 4QRUB 3GSQB 4HUMB 5C9JB 2C9AA 4Y19A 5JXEC 5KSBF 1DQDH 2PXYB 1GZQA 5JW5B 3UTPE 3QO1A 2MCG1 3HUJE 4X6CA 5HHXL 3KPTA 4JZJC 1ZHKA 4JM2B 4BFGA 3QT2A 4PG9B 5SV3A 4JHWH 2JIXB 2XZZA 5JOPD 2JE8A 4LPYA 3ULUD 1NFDB 4MD4B 5AZ2L 1IBGH 1WBZB 3E1F1 3T1FB 3WHXB 1ADQA 5INCB 3LHPL 4A6YA 1EZVY 5IMOB 5E6YA 5I1DB 3MRDA 2NY6D 1RZ8A 4C56A 3U79A 1VACA 5I1HH 3OSKA 1KJ2B 4YGVA 4F7PB 1YEIL 4UAOC 3CH8A 1S8DA 3K8MA 2NY3C 5D71H 4QHLB 1IC1A 3G6DH 1T6VN 4LGRB 3EUUA 3DROB 2AK4B 4EI5D 3MC0A 2DQTL 5ITBH 4K07A 4K7PY 3MNVA 2IWGA 5CMAA 2X09A 4RX4D 5LXGH 1U3ZA 5DQ9A 1NBVH 5IUSA 3RZCB 2WP3O 3UJIH 4X98A 2BVPA 4N90D 4YNYB 4JFXB 1EEUA 2R0LH 3O2DA 4IIQC 5FGBC 3BZ4A 2B1AL 3W0WA 3DO3A 4PPTA 5EO0A 3REWA 1LE5B 2D0FA 4OCRH 3S36H 1IKFH 1LQSR 4R9HA 4LQFH 1BIIA 1JK8B 2WBJD 4X6EB 4NUJA 3MXVL 5GGRY 5IBTH 3DXAE 1DQQA 1YPZA 1SHMA 3O2DH 4R4FL 5JXAL 2PO6A 4UAOB 4YFDB 4ZO6A 3UTTB 1YMMA 1TZGH 4G3YH 5D7KE 3O9WB 2P5WA 1BFVL 4GO6B 4ZNEE 1T2QH 3DUHA 4NKMA 4QHMB 1HHJB 3C2AL 1MUJA 1U9KA 3EYSL 2DQJH 4XPBH 3NBNA 2ICES 3GMNB 3MMEA 4OKVB 5A3ID 2VDLH 4AZ8A 4Z95L 3T3PF 1XGPB 3FJTA 3F7VA 1CLCA 3PQYE 3GMRA 2BDNH 1FO0B 3SCMB 3L5XH 1T20A 5DK3A 2AEPH 5D7LB 1MRCL 3UTOA 3NCCB 1QLFA 3I6LE 5T5NF 2IANB 5KAQG 5CSBA 1NMAL 3DIFB 3LIZH 4R7DB 4KROC 3QA3A 4LLMB 3CMOH 2GTWA 4D9LH 5D9SA 1TJHH 1TZHB 4P0DA 2OTUB 4RZCA 2A77H 2GSGB 3KJ4B 1B0GA 4JG0L 1RULL 3HC0A 4UUJA 4BH7B 4DAGL 3RWIA 3G08A 2VLRD 2P8MB 1RZKH 4TTGA 1BZQK 1A4JA 2A2QT 3BH8B 3CXHK 3PIQA 4HS8H 2J8UE 3QZWA 4NZDA 5EUOA 2A1WL 4KJPC 5FF6A 4NSKB 4PRHD 3UAJC 1INEH 4HKZB 32C2A 5CJ5A 3QCVL 3T4AB 5BO1L 4NO2B 3VXNB 2VXUL 4OCYL 4ZYKA 1F5WA 5JPNB 1EVUA 1G0YR 4O2CB 1UJ3A 1J1OH 2NZ9D 1HQ4B 2BNRE 1BFSA 3IJYA 2X70A 5DSCA 5BRZE 3LQAH 2XA8H 2VDPL 3U9UB 2BSSA 3S3PA 3UCRA 5GGQH 3LB6C 2A9ML 3L3DB 5FKPB 4JANA 4WVRA 1HHHB 3K46A 2HFGL 1JHLL 1XF5A 3QUYC 4OCMC 1C5CH 4YXHL 2NX5A 3BRDA 5C0FA 1HHKA 4GUPB 4MDJB 2PTUA 1BJ8A 5AZEL 3RAJL 5FDYA 1SJVA 2I9LB 2JLLA 4FFYL 2VDML 3C5ZA 5GRWA 5C0GA 5TF1H 3LEYH 2EIZA 4LKCA 4AQ1B 1G7IB 4Z7VF 4F7MB 2Y5EA 3NVQA 2Y07H 3BI9X 4XRCA 1IAII 1RUQH 2GTZA 1UT9A 4OF0A 1U3JA 1MLCA 2GUOB 1N64H 4I3GA 1DQDL 2YMXH 4X83A 4UT6H 1KPUB 1UB6A 2EZ0C 4XZUB 3NIDF 4NZUH 4JHWL 1OP9A 4WFFE 3BPCA 4FMFA 1IBGL 2JK5B 5DK2B 4JJ5B 2XY1A 1MWAB 3HPLA 3BDXA 3QDGA 1JWMA 1TVDA 3EYVB 3PHOB 4JFFA 5I1HL 3DGGA 4HDIB 2YD7A 1RY7B 2XTJD 1IQWH 3MV7D 4JZOB 1HZHH 3WUWB 1J87A 2NY1C 1ZTXH 3G6DL 2MKLC 4P5TB 2NPLX 1KXVC 3QG7H 5FEBA 3RWEA 3AB0B 3QQ9D 3H9SB 3MA9H 2W9EL 4P46B 1CWVA 4YHNB 5ITBL 4ZMAT 3JBG7 1FFQA 4PR5B 1NBVL 2FBJH 4XAKD 3UJIL 2CLVB 1AGDB 5T1LA 1Q9WA 5IHBA 4CW1A 4KC3B 3PJSB 3QZWG 4FQHA 4XPAH 2R0LL 3RU8H 1GCFA 3PGCA 5LGHH 1V8HA 1EBAA 3RUGA 1U8JB 4XP1L 2VLKE 4OCRL 3S36L 1IKFL 4LQFL 3PV6A 4OV5A 5ITFA 5IBTL 3WDHA 5HPMA 4ONHB 2JKXA 3O2DL 4X5WB 2OXHA 1WT5A 3SDXF 1Q0XH 4WHDA 5C0EA 1A3QA 3MRRA 1TZGL 4G3YL 4XHJD 1X5KA 3RFZC 3STZB 1T2QL 3GSQA 1DN2A 5C9JA 2N56A 3OX8A 2DQJL 4AEFA 4Z7WB 4XPBL 5EZIH 1OLZA 2VO5A 3STLB 3WIHA 4ZFOA 5JW4Q 2VDLL 4JM2A 5E1HB 4PG9A 1RJYA 5M7QA 2JIXA 1QFWI 4NGHL 2X42A 2EXWD 4MD4A 1WBZA 3T0ED 2BDNL 3L5XL 5INCA 1SQ2N 4WFEE 1K4DB 2AEPL 5IMOA 4ZD3H 3KS0J 3WFEH 3PWNB 3LIZL 1CFSA 1A7RH 5LVEA 3L3JB 3CMOL 1XZ0A 4D9LL 3RKDC 4BQCA 5C0BE 1D5ZA 4YFLF 5E8PB 1TJHL 4XTRD 3VRJB 2A77L 3FKUS 3DROA 2AK4A 1D5IH 1MCBA 1KJ2H 4UV7H 2HLAA 5HDLA 1RZKL 2AP2A 1JPSH 4HS8L 4JGMA 2WM0A 3TBVA 1D9KC 3RWJB 2YBRA 3RZCA 1INEL 5A2JH 4NZRH 1J8HD 5FYJH 4KK8C 3ZKND 1W0WB 3CU7A 3N9GH 5HYJB 3V6FB 1MEXH 3WYRA 3QXAA 4R3SB 1B0RB 1PG7H 3MJ9A 4WRLA 3T3ME 3MFGB 3E3QE 3MRIB 2C1OB 1LE5A 1J1OL 4MLSA 5IVNA 4NFCA 2ZSVB 1INQB 5LG1A 4QOKB 1QD0A 2CDEB 1CXFA 4MZ3A 1IGYB 3LQAL 4X6EA 2XA8L 2VLJD 4ZXBB 4WUUD 3UBXA 3ULUE 4GQ9H 4TTDC 4G43B 4I0PB 4MB4A 3MJ9H 5SWZB 3QO0B 4JHBA 3X12A 3D3VD 4FQPA 4D94A 5DQJB 1U93A 4QHMA 3Q6FB 1C5CL 5FAAA 1YEFH 1CZ8H 1HWHB 3IETB 2DQHH 1YN7A 3TCLB 2OYPA 2SEBA 1MAMH 4H0IA 4DKEH 4N9OB 1XGPA 12E8H 1K3IA 1O5DT 3VE0B 5JORB 5I1KH 2OI9C 1T21B 3HE6D 5TF1L 1FO0A 3LEYL 3QNYB 3GSXB 5D7LA 4ZAKB 4LF3B 2Y07L 4MVBD 1I3RA 5T33H 3P4OA 4OGYH 1RUQL 2ICEB 3DIFA 4R7DA 3BEVA 1N64L 2QHLA 4LLMA 3VXRD 1PY4A 2YMXL 4UT6L 1FO0H 5DRZB 4MB5A 1TZHA 4ZSOB 4NZUL 1JZ4A 2OTUA 4RFNC 2GSGA 2ED9A 5I71C 3LKOB 4NRZA 3W5MA 4HMCA 3H3KA 3MRFB 4K3GA 3BPNC 3O6LH 4B7IA 4KV5F 4BH7A 2E9BA 3ZYOA 3ARBC 2P8MA 3EJYD 5HYEA 2W0FB 3BH8A 1V3KA 4W4NA 1KEMH 4NC1E 4JZNB 2NZIA 3SDCC 4YDVA 2NXZB 2XZQH 4KH2A 3KDMB 3T4AA 1HZHL 3V0WH 1ZTXL 3DBXB 2RB8A 3QG7L 5JPNA 4O2CA 5J57B 4K71B 4OLVH 1RPQA 3MA9L 3QFJA 4P2QB 5B39B 2VDRH 1RJLB 5JZ7C 2B1HH 3U9UA 3GMQB 4JVPA 4YZFE 4XXCC 8CGTA 5FM5O 3SDDC 4HGWB 3IDXH 2FBJL 3L3GB 3PWUB 4HPOH 4JFHD 5FKPA 1NMCB 3DUSB 3QDJD 5JHDD 3KPRE 2APWA 4APQC 3GMPB 3V5DB 1UXSB 5B21A 4XPAL 3RU8L 4XWOC 5LGHL 3BPNB 2IMMA 2FO1A 3KJ6H 4P3WA 4MDJA 2O61B 4P48A 4XMKH 3S36X 1RFDH 1NSNH 3HNTH 5EBWB 1G7PB 2X4OB 3RHWF 3H8NA 4QRQA 4QRRD 1G7IA 2NW3A 1Q0XL 1T2XA 4LIQH 2FECL 5IVXF 1EO5A 2ZUXA 1OGAD 1Z2KA 1V3LA 4PRNA 3VXOA 5EZIL 1KPUA 3MGOA 4GRLD 1U3HA 2V7HB 1XCTA 2CPCA 2FX8H 4NO3B 2KBGA 3VDAA 3DJ9A 4MA1C 3SE3C 4GXVH 3UZEA 2YA0A 3SGEI 1EA9C 1S78D 1VA9A 5FFLA 3EYVA 4ZD3L 1OGTB 4ZFOL 3PHOA 2X4QA 1IEHA 3WFEL 2I26N 4ODXB 1A7RL 4JZOA 1JPST 4NWUL 3WUWA 5SWQA 4LRIC 4RISH 5DJZB 3LAFA 4RWYH 3VMNA 3AS2A 1MWAH 1OAYH 4AT6A 3H9SA 3DUUB 3D0VA 5DLMH 1D5IL 4P46A 2OJEB 4Y16D 1LMKA 1KJ2L 4UV7L 5FV2A 5D1ZB 3GM8A 1JPSL 4FP8H 4PR5A 3RKPA 1HYSD 3WFHB 4PV9B 5F1IB 3U4BH 1XGTB 4JGUA 1A22B 5E2TH 4HXBH 1BWMA 1CE1H 4TSCH 4HUWB 4NZRL 5FYJL 3VGHA 3N9GL 5KJRH 1MEXL 3SQBA 3GSRB 2GFBA 4HPYH 1PG7L 4LCUB 4MA1B 4HKJA 4LCCA 2X4SB 2Q3ZA 1B9ZA 4DKDC 3B4NA 3VXME 4HWBA 4MJ6B 3TN0B 5HDQH 2CLZA 3QUKB 5CEXA 1I85A 4HZLA 1H3UA 4U6VH 4ONHA 1FFNB 2FGZA 4GQ9L 1KELH 1GH7A 4I3SH 4KGLA 1F3DJ 3MJ9L 3MRPB 4QRPD 2YZ1A 1OF2B 4OF6A 4QXGH 2ICWA 4Z7UB 3QDAA 5IQ9B 5KSBE 3MREB 3VXQB 3STZA 3KHOA 4HWBH 4HWZB 4KVNL 1YEFL 1CZ8L 4Z7WA 5KN5A 2DQHL 5FYLH 3RWCB 3WNKA 1MAML 3MV7E 2IADA 3UTSB 4NT6B 4DKEL 2AV1B 12E8L 1TPXC 4J4PA 3D18A 4PRPD 5I1KL 2H26A 2J8HA 3GFUA 5FK9B 3CX5J 5DJ0B 1I8LA 4GBXB 3QQ3A 5T33L 5EWIH 4OGYL 1KPVB 3QEUB 3WFCH 5B8CA 5DR5H 2Q76B 5JIHA 3CSPA 4PJAF 1A7PH 5BS0A 2CK0H 3VG9B 1FO0L 5GRVK 4PRID 3OKOB 5EU4A 1MCRA 5E8PA 2IPTH 1HNGA 4PJ5B 1MJ7H 3I3EA 3VRJA 4M8QB 1OP5K 2W65B 3O6LL 4HT1H 1JJUA 4X5XA 1KCVL 4G6KH 1KEML 4XP6H 3GHEH 1ZANH 2Z31D 4YEEA 1B0WA 2DBLH 3V2AR 3G5YA 1BBJB 2XZQL 4QRTB 5HYJA 2DQGH 5T3XD 2RAMA 1ZLWH 3V0WL 4R3SA 2XWBA 4X6DB 1NC2B 3MV8B 1TITA 2OR8A 1T22A 4FN0A 4YFLI 1FE8H 5F7EL 1T03H 1YEDB 4KHXH 4NRXB 3MRIA 4W6WB 3BW9B 4OLVL 4D0BA 1MLBB 5KSVB 2V6HA 4QWWC 1INQA 4PREB 4F7EA 2Z8SA 3WUWG 1IGYA 2VDRL 3O8XD 1MHEA 4JFZH 2R2EA 3U0TB 1RMFL 3KPMB 1CT8B 4P2CG 4G43A 2FO4A 3IDXL 4I0PA 4PLKD 5SWZA 3T0EE 4HPOL 2HTLC 3R0MA 3MCLL 1G0DA 4DN3H 1MREH 1ZLVK 1DQMH 2Z8VC 4TQEH 3TCXA 3TT3H 1A1NB 5DQJA 2IGFH 4HUXB 4KK6C 3IETA 4MSWB 4XCNA 4P5KB 3TCLA 3T3PE 1T7WA 3KJ6L 2OLDA 3V6OC 4XMKL 5CD5C 1OW0A 3GIVA 3VE0A 1RFDL 2MQCA 3IDIA 4FQXC 1NSNL 3QAZC 1T21A 3HNTL 2FCBA 4C58B 5EIIA 2DM7A 3O3BB 2GJ6E 4U6HA 1ZOXA 3QNYA 3GKWH 2X4UA 4NHUB 3DO7B 3KPQA 3BN9D 4ZAKA 5C8JA 4LIQL 3RY6C 4GG8B 4MNHB 3KPOB 3NCEB 4ONGH 1QP1A 5DYOB 4PJXF 3DECA 4MA8H 4WV1B 2ICEA 5HHVH 2BXZA 2UZYB 4L8DA 3NFNB 4MJIB 4Q2ZB 5INDB 1J8HE 4YIQA 5DRZA 5DEGB 1CG9B 1LP9F 4L9DA 2FX8L 2YUVA 3RJDA 3LKOA 4LLVB 2HN7B 2LAAA 3NABH 4AENA 2F9BT 3MFFB 4GXVL 1I8MA 2W0FA 4PJEB 4Y4HC 5CLTA 4WW2B 2VLJE 1AKJB 4WUUE 5JR1H 3WL9A 3P0VH 1CIUA 2IAMA 4RISL 3H6JA 3RBGA 4RWYL 3DBXA 3D3VE 5IESH 1MWAL 2QQKH 3CIQA 5E03A 4Z0BH 1OAYL 4WFHD 1OQOA 1T2JA 2EEAA 4PGCA 4XAWH 4FXLA 5KAQF 4P2QA 5DLML 5B39A 4K3DH 3U4EB 4CN4A 1NGXB 2HWZH 3GMQA 4FP8L 2UWEB 4KRMB 3HB3D 2LTQC 4DVBB 4HGWA 1H9VA 2W9DH 2NXYB 3L3GA 1FFPB 3U4BL 3FB8A 5E2TL 4HXBL 4PRBA 1CE1L 2X9YA 4TSCL 2VIRA 3U46B 3IKKA 2I27N 5KJRL 3GMPA 4X6CF 4E41D 4HPYL 3CZJA 5I8EA 2UY7A 4GMTH 2YXFA 1PG7X 1DUZB 1CU4H 3KLHC 3VXRE 4MXWH 1MSPA 4Z77B 2XYCA 4MWFB 1MHHB 5HDQL 2LU7A 4QTHB 2BVQA 2BRRH 5J06A 5GS3A 1G7PA 2HKFH 4U6VL 4Z7VE 5E00B 2X4OA 4X7DC 4I3SL 1KELL 3CLFH 1UEYA 3UZQA 4N8CH 4DGIH 3LD8C 3MV9A 1ZA6B 4HAGA 4QXGL 43C9A 1XGQB 1F2XK 4POUB 3C08H 4RFEB 4HWBL 3ARDD 2D2OA 5FECB 2ITCB 4LVOB 5HI4D 3GJFB 1HK6A 5FYLL 1EEQA 3BP6A 3GDBA 4MNQD 4N68A 3W9DA 5F8RC 1VB9A 2VXQH 3G5VB 5CGTA 4KXZI 1RURH 3LZFH 3P40A 1I8IB 5CGYD 3S5LA 3SEPA 4GKSB 1S7XA 1CQYA 1E6JL 4UT7H 1NGWA 1ZWIB 1AD0B 5EWIL 3WFCL 3RX7A 4M1CC 5DR5L 4JFHE 2Q20A 3OWEA 1QBLH 1A7PL 3QDJE 2CK0L 3HR5B 2IG2H 1VEPA 4P2RE 5L6YH 2YPLD 2P5EA 2X4TB 2IPTL 1MJ7L 4L8SC 5L2KB 1D5MB 3IDGB 2WWMC 3V7AE 3DUUA 3DHJA 4HT1L 1HEZB 1YPZF 2GIYA 4G6KL 1KV3A 4L8BA 2G2RB 5J6HB 5I6XB 5HY9B 3WFHA 3L1OH 3GHEL 4PV9A 3KGRA 5F1IA 3DMMC 2DBLL 5GS0C 5DRXB 2BCKA 5F7DB 3MUY1 2DQGL 5EOQH 1EX0A 1ZHNB 3EOAB 1X5HA 4E0RB 3JSSA 4RQQB 1OGAE 3OHXB 1DANU 1OTUC 2VITA 3TIDA 1FE8L 1T03L 3CVIH 4KHXL 1T89C 3TJHC 1XIWD 4MJ6A 4PJ7B 4KKBC 1S5HB 3TN0A 3QUKA 4P57B 1CFBA 3QI9B 4JFZL 3IU3A 1CICD 4LHUB 3SDXE 1I1YB 1T5WA 5CP7A 1IGIH 1OF2A 1F3JB 4P4KD 4MQXD 1T66C 4Y2OA 5B39G 4DN3L 4Z7UA 1MREL 3D25B 1DR9A 5IQ9A 3MREA 4P4RB 1DQML 1FSKC 4TQEL 1MHCB 3TT3L 5DHVA 2IGFL 1WICA 4L8SB 2NY2C 1EPFA 1I1AD 1K4CB 1NDMB 3FB7B 3EHBC 3RWCA 4G6JH 1KIRA 3HCVB 3UTSA 2AV1A 4YBLC 3GI9H 4EQ2A 4XCFH 3B9DA 1UM5L 3QDMD 2G5RA 3DMMB 2APXA 5EU6D 5T3ZE 5EUOF 4U1MB 5KANI 3GKWL 5DJ0A 2CIIA 4GBXA 3EYFB 3PDGA 3LS4H 4Z7OE 1KCRH 4ONGL 5EG6C 3QEUA 4Z18A 3HUJB 4MA8L 5HHVL 4F15C 2Q76A 3QFDB 2C3HA 3LQMA 3DNKA 2CRYA 5EBLB 1S7TA 3SHSA 4PJ5A 2V2TA 5E4EC 2VOTA 1U8QB 4M8QA 4TNVF 3S37H 4Y4FB 1LVEA 3FQNB 3OB0K 3NABL 1ES0A 4LFHD 4JREC 5GS2H 4PJ9B 1OTSC 5E5MA 4HBCH 2CO7B 3PP4H 5D93C 4HLZH 1BBJA 1NCWH 1U8OA 3DETD 4YAQB 4QRPE 3P0VL 4X7SH 4QHKJ 2N7BA 1BWWA 1PQZB 5HPOA 3S5LG 3FT2B 1X4XA 5IESL 1KC5H 2DLHA 4M4RA 2QQKL 1A7BA 1YEDA 4HIHB 4NRXA 4Z0BL 3RI5F 3TA3C 4XAWL 4PJFA 5ICYA 3RVWC 4PREA 5D1XD 4K3DL 4JR9H 3D2UD 2HWZL 2VDQH 1X5YA 3C6LB 2LE9A 3BZFB 3U0TA 1RAMA 3KPMA 4XCCL 1CT8A 2W9DL 3DVFA 1MCLA 4OFYD 5K59F 4TSAH 1BEYH 2ZUQC 4HUXA 5FDWA 1A2YB 1J1PH 3KYAA 1I4FB 1T5XB 4GMTL 4P5KA 1WWBX 2MJWA 1CU4L 1MCOH 5LGJB 3U0WH 4MXWL 3TO4B 1SYVB 3DXAB 3SY0B 3MJGX 3VD9A 4PRIE 3K4DA 4F33A 1J11A 1CDBA 1CR9H 4YDKH 3HR6A 4PBXA 2BRRL 4Y19D 3VFSB 2HKFL 3O3BA 5C2BL 1HOCB 1G9NC 4D9RE 3CLFL 1OB1B 3D5OF 4NHUA 4QNPF 4TUJB 4N8CL 2V5RA 4X9HA 4DGIL 4TNVK 3KPOA 3H3BC 5DYOA 3AGVA 4GRMB 1H0DA 3C08L 5TH2A 1BZ9B 4Q2ZA 5JUEH 4H0GA 3T0DA 4K3HA 5TF0A 1KIQB 1G7QA 2DOCA 3MLZH 3LEVH 3PQYB 1DVFC 1FL3B 1CG9A 4M1GH 4C56D 3N1MC 4CBPA 1WBXB 2AAVA 1QFPA 1RZ7H 2VXQL 2MQ0A 1FNLA 5BV7H 3MFFA 5L2JA 2DI8A 1H8OA 1RURL 3LZFL 1S9VA 3BQUA 4PJEA 1CGYA 2ZG3A 4UT7L 4GSDH 4WW2A 4LPCA 1AKJA 3DVNA 3BPOC 4XXDB 2RGSA 3AU1B 4IS6B 1IM3B 4OF8A 1QBLL 1M7DA 1P1ZA 2DLIA 2IG2L 5L6YL 2DM2A 4RCAA 4PY7B 4XP9H 1PLGH 4BK4A 5CKGA 4F37K 4RMUA 2IPUK 2J8UB 1JV5B 3Q0HA 3KYOB 5J9PB 2BRQA 2YD4A 1LD9B 1BOGA 3ZDYF 3L1OL 3W0WD 4HLZG 1WUNT 1FFPA 1ZEAH 3BGFC 3EJZD 2LVCA 2HT3D 4KDTC 2WZPD 1T80A 3AM8C 3TESA 3MRGB 2BNRB 4JM2F 5JIIA 3CVIL 1DUZA 5BRZB 3IJHB 2PO6D 5JIPA 1YMMD 4Z77A 1NGPH 4MWFA 5CEZH 1E4WH 2P5WD 1G9EA 1MHHA 2I5YL 1WQVT 4QTHA 5E00A 4RGND 1FIEA 4IRJB 1HE7A 1K6QH 5DWUH 1TETH 1IGIL 5IVXE 2EE6A 3MACH 5F6IB 2W91A 1ZA6A 4KJYB 2X6MA 4UIMB 1S9XA 4IBLT 4J1UB 3GJFA 2Z92B 4W6XB 5IFJB 4G6JL 3U36B 3GSNB 4IOFC 1FFOB 4JKPH 4LSDA 5JOFB 3ZHLA 3GI9L 4J3VA 1W8NA 4XCFL 2E9IA 1NAKH 4WFHE 1NL0H 2EYSB 5EORH 3WFZA 5F7LB 3BUYB 3GJFH 4MD0B 1JFQH 4GKSA 4ALAH 5MEQB 3L5WA 1XGUA 3LS4L 2OCFD 1KCRL 5F7NC 4MZ2A 5M95B 4N0CD 2Y9RT 1MIEL 2DI9A 5GGSA 5KVFH 3HR5A 2AJZB 4OI8A 1FJ1B 3ZTJH 1PKQA 3ZKSD 4HV8A 3WLWD 5L2KA 1EHLH 3IDGA 3S37L 5DRNA 5F8QC 1MAJA 4ENEC 1J9CT 5I8OH 4PBWD 4EVNB 5JHLH 2NY4D 4HBCL 3PP4L 2Y5TA 3V8OA 1NCWL 5DRXA 4U1JB 5E6IC 5HI5D 4X7SL 1PZUB 4I9WD 2GKIA 3EOAA 2Y6SC 3LH2H 4E0RA 4RQQA 3BPLC 1YJDH 4F2MB 1KC5L 3T04D 1DJSA 5JDSB 5HI3C 4K94H 1FCGA 5DJ6B 4OAWB 4NJAH 2J12B 3LVEA 1U92B 5BZDB 5I74B 4XCYB 4PJ7A 1S5HA 4JR9L 5BXFA 3DRQA 1JZ8A 3VCLB 3D48R 2VDQL 3VGEA 1I1YA 2NX5D 4EUPA 4NKOA 2GCYB 4ODWA 4S1DD 1F3JA 4OF3A 4TSAL 3PWVB 1MH5B 3D25A 3V0VA 4P4RA 4IMLB 2XKSA 1BEYL 1MHCA 3UC0H 3B2VH 3OKKB 3C5ZD 4KKLD 2VLKB 4WTXA 1J1PL 3MRMB 1NBYB 3FB7A 5D5MA 1GHFH 1MCOL 1ZT7B 5B3JF 2HFTA 1MJUH 1R3IH 2GITB 4XNZB 3DGCR 5IR1B 4OCSH 2YPLE 3VGAB 4R2GB 2WAHA 1CR9L 2EECA 3GMMA 3HNVH 4IRSD 4K7PH 5IBUG 5C0IB 1YEGH 1I8KA 5I17B 4ISVA 3LSOB 4URTB 2B5IC 2FEDC 3JWDC 3HUJA 2VWEC 5DT1H 3FN3A 5TGBA 1EV2E 5GGRA 5JUEL 5I8KH 3QFDA 4UU9B 1H8SA 2H2SC 3WS6A 1Q94A 4S2SB 5F7FA 2E7BA 3MLZL 3LEVL 3OJ2C 3QDGD 1KULA 4M1GL 5HHPB 1T4KB 5A16A 4JFFD 4Y4FA 2DTMH 4HMDA 1P4LA 1RZ7L 3FQNA 5EC1A 4RBPH 5BV7L 1JPTH 2MTPA 4PJ9A 2HVJB 4L4VE 4GSDL 3CFKB 1N59A 2ORBH 3SKMB 4LLUB 1ZHBB 3G5XB 1DTUA 5C0BB 4AJ0A 4YAQA 1KTLB 3P4MA 1WLHA 5ANMA 2E3VA 4XMPH 3ZTJG 3CZFA 1PQZA 1X5XA 4XP9L 3DTXB 5CBEA 1PLGL 5IHZA 5I1EH 1KENH 5T1LD 4PB9H 1N3NB 3BXNA 3MBED 4KTDH 2B5IB 2DTSA 1KB9K 2LU4A 3RPIB 4WEUD 1WBYA 4P2OB 1ZEAL 5EU6E 4UILH 3B2UC 2AI0H 3I6GB 4O51A 1Y6NR 2M8XA 5BW7A 2C4FU 3S3SA 4E42B 4M1DH 1G7JA 1TVHB 1UWGH 3ES6A 3SGJA 1I4FA 5TDPA 1T5XA 1A9EA 5LGJA 2XI9A 2D7MA 3QIWA 3DXAA 1MNUH 1NGPL 3OTTA 3SY0A 1E4WL 2J2ZA 3FN0H 5CEZL 3PXJA 3VFSA 5DD6A 1HOCA 5FO8B 1CDJA 1K6QL 5DWUL 1DL7H 4ZNEA 3IDYC 2WBJC 1TETL 4NC1C 4TUJA 5ALBH 2NY6B 4PJXE 2YR3A 4JM2D 3MACL 4QHKI 3QWRA 2ZPKH 5C0RH 1BZ9A 5FXCH 4ZO9A 4LHUG 3V6ZB 1LP9E 1KIQA 4JKPL 1WGOA 1FL3A 3MR9A 2CO6B 3PWLA 1UENA 5DTFB 4EI5B 1A6TB 1WBXA 2BVYA 1GGUA 1NAKL 2DF3A 1YUHB 1NL0L 2ENSA 5EORL 4YH6A 1JFQL 1DZBA 4XVJH 4ALAL 4OCLC 3ZSSA 2VAAB 1G1YA 4NBZB 2KH2B 2OM5A 2AK4D 2E5EA 1KCUH 2J88H 2XQYK 2I07B 5KVFL 3MUJA 4PY7A 3PDOB 5DK0B 1IAOB 1EHLL 3IVKB 3RZCD 1PX4A 1KYOJ 5ENWB 5K9QG 2J8UA 3NOIA 3FO1A 7CGTA 1AIFA 2XWJB 1KLUA 5I8OL 1LD9A 1TJIH 5JHLL 3O45A 3MLUH 4OLUH 2V9QA 3QEQA 2R2BB 3RVUD 4F7CB 4XNUL 4H8WC 3LH2L 3VXSA 2FECI 3SKUD 1YECH 5D8JL 2BNRA 1YJDL 5D7JB 1J0HA 1Q9KB 2HT4D 5BRZA 2C3XA 4K94L 3PUCA 3MUHL 1UXWB 2EE9A 4NJAL 3ZKQD 4G6AC 2MOVA 2D0GA 4MX7B 3SKNB 4GJTB 2NZ9C 4HJ0D 4JKLA 4U3XA 5F89B 4IRJA 4PLOB 3K74B 1D6VH 4LARH 1JTOA 4Y8AA 2R1XB 4WI9A 2FWOB 3BWAB 4LGPB 1DN0B 4KJYA 3ULVF 3UC0L 4J1UA 3B2VL 3RL1B 3GM0A 2Z92A 4PD4J 1R5VB 3QIBC 1GHFL 2F8OA 4ODHH 3U36A 3LKPB 1FFOA 1IGMH 1MAKA 2KKQA 1MJUL 3LN4A 1N5YH 4OCSL 4J3WA 5J3HC 4X9BA 4WUKH 3HNVL 1N2RB 4HKBA 4K7PL 2BFVH 1YEGL 3P9WB 2VUOA 4NN6B 5MEOB 2RFXB 1HYRC 3GSNH 1U3YA 3U30B 5DT1L 2OX5A 5FGBA 4RWHA 5I8KL 5HVFB 1YDPB 4Y8DC 1KJMA 2AJZA 3ARYA 1EMTH 1IGCH 1FJ1A 2MFNA 3IFPB 1YPZE 3GB7B 4LVNB 2DTML 2IBZX 4JO4H 2D7QA 4IOSD 3VXPB 1S7RB 3VFRA 2UZIL 1JPTL 1J0YA 1IC4H 1OP3K 1N7MH 2ORBL 3QFJD 5CD3A 3WLBB 4L29B 4XMPL 4JVUA 3QUXC 4LASH 1R5WB 1UZ8B 4F2MA 2XTJC 1BF2A 3HHRB 3WHE0 3GI8H 3BH9B 4MDIA 3NZHH 3I2CH 1XR8B 4OAWA 5I1EL 1U92A 1S9KC 4PB9L 3DVIA 4XCYA 4KTDL 1CDCA 1QLEH 3VCLA 5HGHB 4YWGH 3MLTB 2QQLH 4CL7A 4DGVH 4UILL 2GHWB 2P8PA 2AI0L 3PWVA 4JFEA 3MRJB 3VWJB 2YN3A 5HJ3B 3OKKA 4M1DL 2VLKA 5DHXB 1UWGL 3MRMA 3VXMB 3RY4A 2FRGP 2HMID 1NLBH 3C8DA 3MJ7B 1UCBH 3C6SA 3KLDA 1FPTH 1ZT7A 1MNUL 2GITA 5HHOE 3FN0L 2DLEA 2BVEA 5DFVD 3MRHB 5EUOE 5I73C 5IF0B 3OXRB 1CGUA 5C09A 2VB5A 3OBAA 2Q86B 2E9WA 5C0IA 4KQ3H 5KSBB 1DL7L 1U3HD 1CGWA 1IC5H 5ALBL 4TRPH 3QUMA 4JGJA 4M93C 5DJAB 4GS7B 3RL2B 3GSVB 2J5LB 3MV7B 2BVUA 2ZPKL 4YHIB 5C0RL 5D2NE 4XHJC 4UU9A 5H2BA 3C09C 3ETBF 1NDGA 2GK0B 1KLGB 5ESVA 1H5BC 2X5PA 1GXEA 3MODH 1WFUA 2HAZA 3TO2B 2WBWB 4LLDB 3W39A 1ERNA 4F80A 1I1FB 2ZOLA 5KOMC 5CJQH 2HVJA 4XVJL 5F7WC 4GFTB 5DJCB 1C16B 3AMKA 3QXUA 3QUYA 2NX5E 4LLUA 1KCUL 3DARA 4P46D 3H7BA 2J88L 3R4DA 1KTLA 5D7SH 4XGZB 4EDXA 3SN6N 4J3TA 2P1YA 1YYLH 3JUZA 2ESVE 2R23A 3DTXA 4JQIH 3IDJB 3OKNB 3ZT6A 4GW4A 3RDTC 1QR1B 3I02B 2B2XH 3I75B 1N3NA 4XTRC 1HHGB 2BXYA 4N5ED 2XKUA 2DQIH 4HBQA 1F13A 1TJIL 4HJGB 3BHBB 3MLUL 2CDGB 4OLUL 3JUYA 4WEMB 4HS6A 3KLSA 4MS8D 3BEWA 5E0QA 5C0ND 5CIPA 1LDPH 1T7YA 3QIUD 2JJTC 3CFEB 3TF7C 4E42A 2ERJB 4B53A 2BK8A 1FVEA 5FYLD 1YECL 1TVHA 4LPWA 1QO3B 3ZKNC 2IQ9H 1UG9A 4EQ3A 5E8OB 2H1PH 2HFEB 4YHPA 5I1IH 4ZFFB 1QRKA 1D3CA 5C2UB 4CMHC 1W2KT 5CIPH 3T0EB 4KQ4H 2Q6WA 4QNPE 4M7LH 4DWHA 1RIVH 3GHBH 5I9QC 1R3HB 4HC1A 4B7LA 3TM6A 2FSEA 1D6VL 4LARL 4RMQA 1UGNA 4OD2B 1EZVX 1LK3H 2XV6B 5FOJA 5A2FA 4J4PD 3O2WL 3ULUH 4BZYA 3JVGC 5EIQA 2AKRB 2WQRA 4ODHL 3CVHB 4PP2B 4HC1H 1IGML 2FJFB 1RHHA 2GJ6B 1N5YL 3LQZB 5CWSA 3LEXB 1VHPA 1A6TA 2YSSB 3D87B 1WF5A 4GRWH 1YUHA 1BLNA 4WUKL 3ULVD 3EGSA 4LMQI 4L8CB 3S96B 5BS0D 2BFVL 3MZGB 4OIBA 1FCCA 2Q3AA 4K7PX 4JHAH 3GSNL 3A67H 3HLAB 1J8HB 3BZEA 4YDJA 5FM4A 3FT4B 3OGCB 2RR3A 5EBMB 2C1PB 5EFIA 1EMTL 4AIZB 1IGCL 2YPKA 4CMHB 5DK0A 1IAOA 5DD0H 5C0DB 4NQEE 1Q9LA 1A1OB 4YE4H 5ENWA 4LSSH 4JO4L 3EBAA 5HYJD 3ZDYE 4D0DB 2VLJB 3GBNH 1QUNA 3GJEB 4WUUB 4J8RB 1NMBH 4I13B 5E95B 1IC4L 5KW9H 4OCNC 1N7ML 4Z7UF 3CH1B 5HVHC 4NRYB 3D3VB 4NQDA 5I1AB 3MX0A 1FZMB 2FIKB 3LN9A 3WV0A 4JVWA 5D7JA 4LASL 4PJGA 1FZOB 2FR4A 4I0PD 3GI8L 5SWZD 3UYRH 5FB8B 1UXWA 2XZCH 3NZHL 3I2CL