3HNTH

Cs-35 fab complex with a linear, terminal oligoarabinofuranosyl tetrasaccharide from lipoarabinomannan
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGTVLARPGTSVKMSCKASGYSFTNYWMHWVKQRPGQGLEWIGSIYPGNSDTNYKQKFKGKAKLTAVTSASTAYMEVNSLTNEDSAVYYCTRFGNYVPFAYWGQGTLVTVSAATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPRIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CS-35 Fab Heavy Chain
publication title Structural insights into antibody recognition of mycobacterial polysaccharides.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hntH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hntH02
2EDDA 3P73B 2ORBH 3OAYK 1S7WB 3D3VB 1SMAA 4I0PB 3X13A 2ICWJ 1PBYA 3HMWH 4O58L 3CAFA 5D71L 1MVUA 1OF2A 1V8HA 4N0FB 4Y0GA 3MLYH 1EEZA 4P2RA 5AD0B 2YRPA 5FF6B 5E8DL 2IAMA 5FECB 4PGCA 1ZLVK 1XFPA 1U3HB 5CSBA 2YXFA 2WWMC 4ZTOH 4M9OA 1S3KH 5J56B 4P2OB 4ZTPH 1EO5A 4NM8L 1ORSB 2NXYD 3DXAA 4N1CA 5ID0B 1Z6JT 4O5LL 4WEBL 3CSBA 1Q9KB 1N59B 1YN6B 4U6HA 5DJ0A 1F6AB 3GSNA 1NJ9B 1T7YA 4F8QA 3GSUA 5AG9A 4WGWB 4X6FB 4XX1G 4ODHL 2X4OA 4ZO8A 2ZZUT 4P9HL 2YUVA 2R4RH 4Q6YA 3WSQL 4OV6F 4DEPC 1W0VB 2MHAB 3T3PE 4L8BB 5ISZE 4LLUA 5AAWA 1DSFL 3SE8L 4JHAH 3QCTL 4HK0A 1LO4L 2NY1D 2KBGA 4M6ML 3VU2A 3SJVA 3OB0K 2P46B 2NY3B 4M7ZB 3OAZK 4GXVL 4BK5A 1IEBB 3KDMA 4L8DB 3IDGA 3FT2B 3ZT7A 1UACL 3PWNA 2FX9H 1RVFL 4H0IA 1ZLUH 3DURA 3MUHL 1U58A 5F72S 4OFYD 4RAUB 2VIRB 1AXSA 2VDLH 1EJ6A 1P84K 3QUKB 5F21B 4F9PA 2JB5L 4OTXH 4KMTL 3D69B 1LDPH 2XPGA 4MJID 1KBGH 2OTUB 2JIXA 4XBPB 4QO1A 2ZOKB 1Q9LB 4TUJB 5I76B 1LE5B 3S37H 4X5WB 3QJHB 4TNWF 1PKQE 4R0LB 1RD6A 2H26A 4YBQC 1P2CB 4ZFFB 1W2KT 1HQRA 3MLVH 3QO0A 3AB0C 1T5WA 4ZNEE 3FZUD 2B1HH 1IGFL 3LKSA 4R9HA 5JO5B 1YEGL 2JCCF 2AXHA 1DVFB 4U0RB 5D9SB 1ZHLA 4U7KA 2P5WD 5JDJA 4GRLC 4HIXL 1H15B 3HC4L 5JLZA 3RY6A 3B6SA 1V3MA 3STLA 4HKJA 1JF1B 3NA9L 1OD9A 1WF5A 1T5XB 1FYTE 4RFEA 3FQXB 3WIHA 2UY7A 1CD0A 1P1ZA 1N4XL 3CFEB 4BFGA 1R5IB 4ORGA 2AJ3A 4XVUD 2DQJH 5CJOH 1YMHB 5D72L 1TENA 1R3HA 1PVHA 1X5YA 3DWTA 1W8OA 1XGPA 3WKMH 3OKEB 3PWLA 3G5YB 3RNQA 1KIQB 3BDYH 5FYLE 1OW0A 3TWCL 3VCLB 5K9OA 2QQNH 3L5XH 5E2VL 3D9AH 2P5ED 4GQPH 4OZHA 3K8LA 1OGAD 3VWKC 1TQBB 3BMWA 1DLFL 2IEPA 3KJ4C 2FJFA 4J8RB 3P0VH 1YEHL 3EO1B 3VD7A 4N0CD 4WTZA 1J0YA 3AS1A 4XZUB 4M93B 5A3IC 1JMZA 1IKNA 1MFAL 1XGTA 1QSEB 3DVIA 4XPFL 5C0EA 4X7CC 4EI5D 4KMQA 4OGYL 4UILH 4BYHA 5TPWH 4WO4D 5F7KC 3D1MC 5F9WB 1FO0L 3OG4B 3HUJB 12E8H 1AFVH 3WIFA 3AAZA 1DN0A 3Q3GA 5KVEH 3FT3A 1C1EL 2Y1VA 2AEWA 2NXYB 1LEKA 2NLJB 3OXRA 4N8VB 5CILH 4BM7A 3LEYH 1L6XA 1W0YT 4U3HA 2Z4QB 4U31A 4D9RE 3L9RB 1F02I 2EDFA 4JY5H 3IJSA 3D87B 4XNYL 5KJRL 3KPOB 5KS9B 3DVGA 3QIBC 2N7AA 4P5MA 4TRPL 3ZE1E 5DSCA 2XWJA 4HCRL 4U1LB 1ND0A 1TZGH 5BRZA 4UT9L 5IBLC 1XIWD 2IFFL 4YXKL 4MD0A 3QFJE 5D2LA 1CGSH 15C8H 1K5NB 4NQSB 1AKJD 1U3JA 3WD5L 3HZVB 5T1LA 3LQZA 4YPGA 4MXVE 5K59F 3V0AC 1GPOL 1H0DB 3UBXG 1MCIA 5J3HD 4ZPVA 2FZ3A 5JOPD 1JPFB 1VESA 3M45A 4GQ9L 3QUXC 4GBXC 3LZFH 4JR9L 5FO7B 1WBXB 2PR4H 4NQUA 3KYMA 3CFKB 1F58L 2I24N 3BH8B 1MCEA 4RISH 2E9WA 1JCKA 2ZUXA 1G7JA 3ARFA 5IM7A 2B0SH 4LVOB 2C4FU 3REWB 2EDQA 5HHXL 3AREB 1F3RB 3FB5B 5BQ7A 4JM2C 3VE0B 1NGQL 3AU1A 5JTWA 4M00A 4M5ZH 5HGAB 1JHLL 1EHLL 4XX1E 2X1WL 1DQLH 5D8JH 1I1AA 5IJKC 2DLGA 1U91A 3FN0H 1JPTH 2L7UA 4GRMB 3DIFB 5C6WH 1D9KC 1VADB 1A6VH 5INCB 4R7NA 5IKCA 3VXNA 2EYTA 3RWHB 1U8NA 1KIPA 5EZJA 1U2HA 4MMZC 1G7MA 3BZEB 3RHWF 2ZPKL 5HHQA 5M95B 3PABB 3P9LA 4LMQI 4XNZC 5GS0C 5HHOB 2XQBL 1QLRB 2YRLA 5DJZB 1VGKA 4W4OC 3IB4A 3EOBA 1I3GL 5I19H 5C0BD 4BQCA 5E1AB 1UENA 3TZVD 3MR9B 3PL6C 4NCC2 5FM4A 4P2QA 1KJMB 1RUML 4JQVC 4AENB 4PJXF 1IZJA 1AGCA 4AYFA 2GSIB 4HIIA 3UTOA 4J7RA 1NUGA 4B41A 1BVKB 2J5LB 3VGHA 3MACH 4LQ1A 4YK4B 1NCUA 4JPWL 1AR2A 1FNGB 4KRMB 4PGEA 4P57A 1DEEA 2NY0C 4UOJA 3TYFB 3P0YL 4N5ED 1UJ3B 4Y5XB 1RUQH 1OQXA 2CPCA 2DF3A 2H3NB 3ROLA 3DO3A 2ATKA 1EEYA 2OL3B 3ARUA 3EGSB 1LGVA 1U8KA 2KPNA 3QNZB 5IVXF 3O4LE 3PGDB 4NN5C 4YHZL 3VRJA 1A6TA 4ZFOL 1EEQA 1S7WA 3KXFA 1NCDH 3PHOB 5IB3A 4BA8A 4H8WH 1CFVL 1LP9A 4EBQH 4MXQC 2J8HA 4YZFF 5D5MF 2Z35A 2IAND 1OAZL 4OF5A 4XH2A 4P46A 1ETZA 1DBBL 4M5YH 3EUUA 2F74A 1CT8A 3D0VB 3O8XA 4M62L 3RVTD 2H1PL 3BEVA 1UKTA 2AABH 4ODWB 3C2AH 4MHHG 2MSPA 1I4FB 3MLXH 5FXCH 3MXVL 4I18C 3NA4A 4WO4B 5HYFA 5D2NB 5F1SA 2EXYD 5EBGA 3WJJA 1HWGB 3VXQA 1XH3A 3VXMA 3SGJA 1PLGH 3WS3A 3GBNH 3BEWB 1IT9H 3RWCB 2G75A 4U49A 1QFOA 1BFOA 4OGXL 5I73C 4YHLL 1ZGLP 3S96A 2FR4B 1P7QA 2HRLA 4M1GH 1FO0B 3H0TB 1D5ZB 2W9DL 2YMXH 4OD1H 1T83C 4QTIL 3BP5A 3QFDA 5EFIB 4NQEA 1IRAY 5JXEC 2GJZB 3C09C 4XCFH 3GZKA 2BVPB 5FA3A 2WP3O 5DD0L 1T0MA 32C2A 1A1OB 3MGOB 3H7LA 5I1JH 4MD4A 2VZSA 2D7PA 2AK1L 2V9RA 3WNOA 1TDQA 1Y18B 3CX2A 2VDRL 5HHPB 3GSRB 4L4VE 3QXDA 4ONGL 1WAAA 3SKUD 5HYJB 5D70L 3CXDH 1HI6B 4FTVA 3UTSE 2R2EB 4J3TA 4Y5YC 1ERNA 3UZQA 5F7MC 4D8PB 2R69L 1I1RA 4M1CD 2BNRE 1B0WA 4JANA 4F7PA 3FO0L 3BPCB 4KZEL 4RNRA 3O9WA 1FAKT 5I8CB 3RNKA 4Z95L 1KPVA 5ESVA 5H35B 3S88L 3HS0B 1PG7L 4C56E 5DRWB 5C2BL 2ZSWB 2D3VA 4OGAD 1AJ7L 5FUZH 4QXTA 5H8DA 1KLUA 5F9JA 1NBZB 2BVQA 5E4EB 3V95A 4KUZH 3W9DB 3FB6B 3B9EA 5IESH 5IB1B 1BAFL 4Y4FB 3WEXA 1GGIL 3DUSB 5CGTA 4IOSD 3U0WH 3B5TA 5I30L 1EJOL 2VAAB 4JQIL 4WY7H 1UXWA 1LD9B 5KSAD 4OIIL 5DFVC 3VRIB 3ZT6A 5BOPA 3TBTB 1RSFA 1HOCB 1ORQA 3LS4H 3KYNA 1PZ5A 2DQEL 3BW9B 1HSAA 3SGKA 2BOCB 2WUBH 4ZDHA 2HKFL 3P2TA 3QEHB 2AERT 1NAMB 3TZVB 3VMOA 4YR6B 1YY8B 1CLZH 2AQ2A 4ODTH 2GJ6D 1MRDL 4L8CB 2MCG1 3FOLB 2NQCA 3GSQB 5CMAB 4RDQF 1HH6B 2VITB 1CR9L 4JKKA 3MREB 3PDDA 4Q74A 4G9FD 4ZFGH 4R2GD 3RZCD 2D7TH 4E41B 4F2MA 3K4ZA 1T04B 4LLDA 5DD1H 4QOKA 5GGRB 1SJEB 3LPFA 3PP4L 4NOBA 3UYOD 4S2SA 4YFLF 5HPOA 4N8PA 4ODUB 4WHTA 4KK8D 3ARGC 3IS0X 5EBLB 2DQHL 2X4PA 4RMRA 1DQJB 1OPGH 1J1OL 2NYYC 3QI9C 1CLOL 4PJ9D 1A3LH 2XN9B 2R2CA 4G8IB 3P9WB 3SGDH 3OJDA 1OWWA 3MBEC 3RVXD 4OF3A 4LLYA 3QCUL 3B9KB 1HNFA 1J9CT 4YDKH 2ZUUA 4AH2B 3E6HB 5C6PB 2LE9A 2R0ZH 4RGND 1NFDE 4J2XA 3WFBH 4H26A 1XGQA 4YH6A 3KLSA 5ANMA 1J0KA 3N9GH 5HJ3A 1ZTXH 4OI8A 5F7HA 3T0VA 1T66D 4M43H 4R26H 4FQXA 4WW2C 2AS5M 4Y16D 2GY5A 4JZJC 3D85D 3KPRD 3PGFH 3GHEL 4FNLH 5C0FB 2VDOL 3B8SA 2CDFB 1L7TH 3LKNA 3B43A 1OP3K 3GDBA 2XTJD 1KNOB 3SE9L 4BSVB 4PJXB 5JXAH 4UQ2B 4ZTPL 1MHPH 4LPVA 1I8KB 3TA3B 3DO7B 4IRSD 4ZYKB 5D6DC 5LGHL 4NFDA 5BMFH 4MYWB 1SYSB 4DVRL 1IGIL 3HN3A 4PJDE 3GFUA 3UXFA 4XXDA 1QYGL 1WZLA 2B5IB 5LBSH 3EOAB 1KTKE 2P8MB 3BKJH 1YA5A 2R4RL 3T2PA 1IGYB 4L3AA 3VI3E 3HI6H 4DFIA 2HFFB 1BP3B 3DLQR 4ORZC 3RJQB 1D5XB 1MNUL 5J1AA 3QPXL 1ZGLB 5IVXB 2EDWA 1ROWA 3KNBB 3FRPG 4KY1L 1ZK9A 4YHYB 5MEQB 5J89A 1JUFA 3QQ9C 3LHPH 3LQAH 1AXTH 4OFYA 3MRNB 4KRLB 3ZTNL 2GY7B 4HJGB 4NNYA 4MJIA 1CFSB 3R8BB 3CFJA 1NC4B 1QVOB 2VDLL 5C08E 4PTUA 5IFJB 4IOIA 5LGJB 5AZ2H 1A8JH 3CDYA 4QWWC 5DD3L 4AEHL 1JRHH 4OTXL 5E94A 4NHUB 1LEGA 4XP4H 5DMJB 4R3SB 2X4UA 4KUCF 2APVA 2WIMA 1A9BA 3P77B 4GUPB 4UTBL 4RRPA 1DANT 4KJQC 5IWLC 3OR6A 1JN6B 1WFTA 4XNXL 3VH8B 5C0DB 3U2SB 1TJGL 4X6DA 4AT6A 2A6DA 1MCCA 3UTTB 3NCFB 5DJ2A 1BOGA 2P5WA 5F1IB 1U92A 1UM4L 1YECL 3HC0B 4RDQG 3QDHA 3N1GC 3SDAA 5D1ZD 1MQKH 3OZ9H 2VB5A 4MAYB 2ESVD 4H25B 43CAA 1KCLA 2MTPA 5CGYD 4PREA 4JKLA 4QXWA 2AV1B 2VLRE 1K85A 1MCRA 3KLAA 5EORH 3EJZD 3OSKA 3L3IA 3KPLA 2P42B 4HPOH 4R2GB 1U8HA 3ILQD 2D7QA 4PGBA 5IW1A 1TCRA 3RVWC 4ODSH 3IFLH 3D39E 5C9JB 2X4TA 4X7SL 5DGQA 3MJ9L 3JTSB 5CJOL 1FGNH 3GB7B 3BP6A 2P5EA 4Y89A 1FNFA 3WKML 3TGXA 1G7LA 1OGAA 4S10A 4MQSB 4XWOC 4Z0XA 2IH1A 3QIWC 3WO4C 3BDYL 2HVKB 1V3KA 3JV5A 5DQJB 1TVDA 3HRPA 3BZFB 1VFBB 1X3DA 1PAMA 2QQNL 3HB3D 3L5XL 3OGCA 4DN4H 3VJ6A 1AQKH 3INUH 4CU7A 1INQB 3BP7A 1Q0XH 5CJQH 1AGDA 3MGTB 4ODWA 2XACC 2Y36H 4EI5A 3O2WL 3P0VL 5H2BA 4DZBB 4GKZA 1S9KC 1K3ZA 3T1FB 5GGTA 4I2XE 3UC0H 3DV4A 2AQ3A 4ZFZB 1CI5A 5EO9B 5L2JA 1HDMA 2Y23A 3OKKB 5IROC 5GS1C 3RL1B 5F1NB 3IFOA 1RZ8A 4R96A 3MRIA 5TPWL 3CH1B 5BS0E 3QIUC 4UT7L 3RWIB 5IHUH 3K8MA 4DGVL 3U9PL 5KVEL 1J8HE 5D5ME 5EWIH 5DRNA 2V2TB 1JGEB 2NNAA 2C1PA 2BFVL 3SPVA 3C5ZB 4HKBB 4WU7A 2R56H 1XIWA 3I6GA 5IBTH 3WXWL 4KJYA 4EN3D 1PZUB 3UROR 1AKJA 3E6FA 3WUWB 3QDME 4GW1B 1FQ9C 4RAVA 5CEYB 3HG1A 2X70A 4HCRA 4KJPD 3OJMB 4JREB 3T04D 2GQHA 3ROOB 2E5EA 1HQ4B 1XGRA 4M61A 2X4NA 5DK0A 4OIBA 1CGSL 2DICA 5ADOH 3L3OB 3VXUB 4KHXH 2VLJE 2OQJA 5F6IC 5DJXB 4PLOB 3BPCA 4HIEA 1IGJA 2ARWA 3V4PL 2CDEB 3MLSH 3MRFB 3T0WA 3LZFL 1HILB 1I7ZB 4Z7VF 5I8EB 1PG7X 2PR4L 4G6JH 5I1LB 5ISZD 3TO2A 5GHWH 4RISL 2UVEA 1ACYL 2B0SL 1YNKH 2C26A 1MFDH 4CADB 4CMHB 5TGBA 4XVSL 1B0RB 3MZGB 1A7QH 1DQLL 1F3JB 5FA4A 4YXLH 3EYUH 1BQHB 2OP4H 3HPLB 1AQDA 4NC1E 5C0IA 1AGEB 3WO3B 3WNMA 4J3SA 1A6VL 3HR6A 4TQEH 4ETYA 1OAQH 5DK2B 2ID5A 3RKPA 4PP2B 2DJSA 5SX4I 1JVKA 5I66A 1U8MA 4NBZB 5C0BA 3EHBD 1X5JA 3JUYA 1C5DB 3UDWC 5F88B 5ESQA 3P4NA 1ADQH 5DWUH 4EVNB 4XCCH 3QEGH 2W65B 1NDMA 1XF5B 5I19L 5E7FA 1OL0A 1ZHKB 1DBKH 3K2UH 1GHFH 1JPGB 5D7IA 2NY5C 2ADFH 4J3UA 5FYKE 4U33A 5EC2A 4JZNB 4QHLA 2PYEE 1S7QB 3QO1A 3RWFB 2DTML 4NO0B 2Z31B 2WV3A 1A7RH 4CW1B 3MACL 4ODUA 3LDBC 4OF7A 3F7RA 2XKNB 2DN7A 2VDMH 1IQDB 4HWBL 4X7EC 4ZUSB 1JZ4A 4NQCA 1U6AH 4IRZH 4RFNC 1NCAH 1PY9A 3WN5B 2I9TA 1KEGH 5K33A 1I85A 1RUQL 1GXEA 2ZOLB 3FO9B 3DX9B 1FYTD 2HRPH 3A67H 3SKOA 4F7CA 2IANA 4P3CH 5FYLL 5GJSL 2XFXB 3OGOE 3EDJA 4ZFOA 4PLNC 5HI3D 5GGSB 4H8WL 2VLME 4CMMA 1FORH 3GK8H 1RMFH 4Y88A 1QFUL 5K93A 1S9VB 2CXKA 3OR7B 2P49B 4PRPE 1E28B 4CVXA 4M5YL 4YHPB 3MZTA 3DTXB 4YFDB 1HXMA 4EUPA 1WVZA 1S7XA 1KNOA 3MLXL 5GZNC 4OAWA 3TBYA 1JI2A 1M6OB 3DROB 1KXQE 1J0ZA 4NWUH 3EOTH 5H94B 3BZ4B 3IFPA 3RY5A 5LCVH 2Y06H 1QSFE 5SV4A 4XAWH 3IKKA 3VW3H 3G6AB 4X6CF 5EU7C 1AY1H 4P4KC 2GJJA 4UOW0 2VQTA 2YMXL 1SJVA 1ZA3A 2KQMA 2R8SL 1BIHA 3QZWA 1CDCA 1LHZA 4YWGH 3OKDA 2J88H 1D5XA 5IQ7H 5MEND 4H20H 4XCFL 4U2YA 2R0KH 5FUCC 3OB8A 5EO1A 5HHMD 3MNVA 3EFDL 1QP1A 1OP9A 4TTGA 1NCCH 4U1KA 1KEMH 3QDGD 2C7UB 1OOAA 2BC4A 3SDCD 4D9RD 2ED9A 3IXTB 1P7KA 1NKRA 2JK5A 5TH2B 3TBWB 3IU3B 1TNNA 3ZSSA 2Z93A 5DVNA 5FGCB 4R97B 3UJIH 5ISZB 4HC1L 1G7HA 2VC2H 1JTTA 3QFJD 1WZMA 1NGYB 2ADIB 2QBWA 3LN4A 1LO5A 4O2EB 4M9PA 3SDXE 3WYRA 5J11C 2Z91B 3QUZD 2EIZA 3CZFB 2QEJA 3I3BA 2WIIA 3U46B 4GRWF 2YPLB 1IC5H 2NXZD 5SX5H 4O9HH 5F89B 3L3DB 1QRKA 5FUZL 3QEUB 5KSAA 2D7MA 4X4XA 5AUMB 3LS5H 5JW4N 2MQ0A 2HYMA 4CUCA 1XF3A 3MNWB 3PV7A 4KUZL 4HWZA 4LAJH 3U0WL 4XXCA 1OTUD 3B3IA 3TCLB 5K9KA 4WFED 1MJJB 5DJ6B 1MJ7H 1I9IH 4F9PC 2GJ6A 4PJEA 2WQRA 2CIIA 4JO3H 3BUYA 1QHPA 3LS4L 1OD7A 5EOCJ 3CU1A 4NZUL 3FQWB 2CLVB 4FQ2H 4HXAH 5J1TC 3N85H 4TUOA 2WUBL 4G9FA 2EIEA 5I1GL 5BZWB 1OARH 3RZCA 4WNQA 4CJ1A 1OSPL 3JTTA 4EOWH 3IGAB 3MRHA 5B8CB 3W11C 3VFPB 1HZHL 1AC0A 3GJFH 5KG9B 4M1DH 5LVEA 4R8WH 5FYKH 2ZSVB 4LHUG 4DGIH 4M6NH 4PJGA 1MI5A 2E8ZA 4QRQB 4XPGL 4Z7VB 4PJ9A 4JB9H 4EJ1C 5DD1L 3ZL4H 3N1QC 1XF4B 1KACB 2W38A 2H2SC 5J13C 3GSVB 3NCCB 5B39G 3RY6C 4EEEA 2A1WH 1DQTA 1S9XB 4G43B 4F33A 1GZPB 2EEDA 4Q2ZB 5FO9A 1AHWB 4K7PH 3ZE0E 1JV5B 1A7PL 2AXFA 3V6ZB 2EICA 3MCKB 5HPMB 3DMMC 3QXTA 1CDIA 5FCUL 2A77L 2UZYB 2XWBA 4OB5L 4PJCE 1RUKL 3NIDE 4Y16A 3HR5A 3IJYB 4EQ2A 2R0ZL 1UB5B 1R3JA 4Y4HD 3D85A 3KPRA 5GSRA 3WFBL 1QR4A 3AS3A 4LSQH 4APQA 1OW0C 2UV3A 2PKDA 3UMTA 4PJBE 3S4SG 3O4LD 1LQSR 1JBJA 4M43L 4HMDA 4R26L 1YPZA 3QCVL 3CFDA 3RWIA 3NIFF 5C09E 4LCWA 3HZMB 3U9UB 4EDWL 1C5BL 1YQVL 3C6LB 3PGFL 4IRSA 4KZDH 1OQOA 4FNLL 3B2VL 4AY0A 4MLSA 4WV1A 4K3DH 2A6JB 3KPSE 5DRZB 5ID1A 1B88A 4NC0B 1IKNC 2H45A 1FV1A 1MRCH 1T0PB 3EDKA 5C0JB 4PY8I 2LTQC 5ESAB 1EFXD 2EC8A 2APWA 1HHKA 5DQ9A 2X09A 2P48B 3OTTA 2E6JA 5LBSL 4AK1A 3FFCE 1HYSD 1UGNA 1BM3L 2C1OB 1DBJH 1RK0A 2CDEA 1OWRM 3TNMB 4H1LG 3BD5A 3C9NB 4CNIB 3QQNA 3LQAL 1AD9B 4RGMB 2BDNH 1Y0LB 2Y5EA 1RV6X 4QHMA 1WBZB 4GFTB 4OZGF 2A6IB 4KHTH 2VQ1A 1X4YA 2CXGA 3U0PA 2ZUYA 3D2UB 1V7NH 2OSLB 3P9MB 4IMLA 4TTDC 4L4VD 2EYSA 1A7NL 2WZPD 2VXTH 3HPLA 3V6FB 3BAEH 2VL5A 5E6IB 5AZ2L 1G9EA 1LMKA 4K8RC 3UTSD 1JRHL 1T4KA 4XP4L 3SN6N 2OMNA 2WBJD 4L8SB 1LNUA 2BNRD 5EC1A 2GT9B 3PXJA 4PRHE 4Y19E 2ZG1A 3QG6B 4X6CB 5TDNB 3PQYB 3TPUB 1CK0H 1G9ML 1YEDB 4Z7UF 5D1ZA 3PJSB 4UBDD 4AM0B 4C56D 1NBVH 2ESVA 3JZ7A 4PJHF 4O51B 4JRYE 2ZJSL 2OR9L 3NTCH 4C4KO 1WT5C 1LO2H 2V7NA 3QUMB 3P4OB 3W5MA 4DKEH 4FQLH 5CJ8A 4BKLB 4CVUA 1TVHA 3OZ9L 4ZOBA 2YSSB 5F7WC 3QNYA 4G7VH 4XC1H 1DUZB 1CIUA 1Z9OA 4OKVA 1FZMB 4JFOB 3T3ME 2EDHA 2OBGA 1CICA 4KDVA 4ZXBD 4LCCA 3QWQB 4LCUA 3S5LA 3MLRH 2F53E 5HVWA 1OHQA 4HPOL 3MRJA 1NMCC 4P9MH 1YUHB 1Z3GH 4JFYA 4ODSL 1F4YH 5C0AB 2V5RA 5D1XD 5DS8B 4AIZA 4GKNB 3LKQB 4IM8A 3IRZA 2VO5A 2CK0L 1FGNL 2OI9B 5HYSG 1A6AB 4NUGH 1FBIH 4NJAL 1CGWA 3DSNA 1UWXK 3TJEH 1TPXC 4ZS7H 3WE6B 4QHNA 2Q76A 5DR5H 2N56A 1HHGA 2GTWB 3T4YB 2W9LA 2BSSB 3IDUA 4BH7B 2DQTL 2Y5TB 3D48R 4DN4L 4PUBL 1AQKL 4YO0B 2WWMD 4LLVB 2VE6B 1NKOA 3M1BB 4X0KB 5CJQL 1QD0A 4Y4HB 4FZ8H 5B3JF 5I1DB 1NL0H 5IQ9B 4ZSOB 1QRNE 4QRRE 4FQHB 4DTGH 1HN1A 3O4LB 1WZ1H 3TPKA 4PLJC 5TF1L 3UC0L 3DX7B 1MHCB 4MA3B 1N26A 1P5VA 1GZQB 1N7MH 4OZ4A 5E6YA 2F54E 4B7LA 4LK4A 1QBBA 1S9WA 1I9JH 1FCCA 1BBDL 1CD1A 5TQ2H 4P46C 3C6SA 1CE1H 4EN3A 1FGVH 2I07A 4QHUB 3C60A 3O8XC 1FVCA 3G04B 3X17A 4OCNC 3S35H 1J12A 3K81A 3VD5A 2YD3A 3FTGB 2LFGA 1UZ6E 1MVFA 3A6OA 2R56L 4JDZB 3ZYOA 1YYMH 3PDOB 3SO3B 4TNVK 2Y6SC 1K8DA 3PXHA 3BKML 4AEIH 3NFNB 5DA4A 5CP7B 1QFWI 1MREH 4F3FB 2B4CC 1T1WB 5EA0H 3KPNA 3EYQC 5CZVL 1JHKH 1CVSC 2CJUL 3UJTH 5ADOL 1J5OH 5FK9A 1AIFA 4KHXL 1TQCB 1J88A 4QRPD 4O4YL 5L6YL 4YDJA 4G6MH 3R1GH 1BVLA 3MLSL 4K23H 1CDJA 2X4RB 3QH3A 4O00A 4G7YH 25C8L 3IJHA 3G6JE 5IIEB 3S98A 4G6JL 4D0DB 5GSVA 5D1QB 5GHWL 5IGXL 3FHAA 3L3DA 4O2CA 2HMID 3O11A 1OGTA 4PJAE 2HFGH 5I1EL 5B38G 4MXWH 3L7FB 2JJWA 3ZKSD 1RZJC 3VFWB 4UNUA 5TFSH 3DYPA 2HJFB 2WBJB 5DEGB 4C83B 3PNWA 1H5BA 4HUUA 1A7QL 4NO3A 5ACZB 3OKYA 3EYUL 4GRLD 2OP4L 2R29H 2UUDK 4WI2A 1KLGB 1VFAA 4X5XB 2RIKA 4NDMA 3RY4A 4C56B 5C08D 2G5BB 2NY6C 1QFPA 4DVBA 3H9SD 1EUTA 5L2KB 1PKQA 3QQ4A 4EXKA 4OM0H 4C58B 2R0LL 2YD5A 2ILLA 3GM0A 4GW5B 4M7LL 3FFDA 2XTLA 3WLWC 1I7RA 5DWUL 4XCCL 5KG9A 4XCYA 2BZDA 2VR4A 1YEIH 1DQMH 2G2RB 1WUNT 4HWNA 3K2UL 4HV8A 1L0QA 1GHFL 4JRXB 5CBAB 1JZ7A 2ADFL 2J8UF 3V9FA 2PTUA 3ZDZE 5IMLB 3MJ8B 5CEZE 3F58L 5DHYB 3VWKD 4NN6C 1KYOJ 5KBNC 3P4LA 5JHDB 3HRZB 3TM6A 1FYTA 4PB9H 1G0DA 2W9EH 2FIKB 2VDML 2VXUL 1P7HL 3BWUC 2P8LB 2VLRD 3BGAA 1KJ2B 4YHOH 5BV7C 4JJHA 2H8PA 2BMKB 5A3ID 1U6AL 5JNYB 3UPRA 3IVKB 5AZEL 5C92A 1KEGL 3G5XA 5KN5B 5IB4A 4JKPL 4WEUD 2ADGA 3D39D 2YD1A 4X4ZA 4GMTH 5E8OA 4MDJA 4P3CL 4GW4B 4RWYH 1IE5A 3CUPB 3ZDXF 3IDNB 4PV9A 1SM3H 4QRUB 1TETH 4HGWB 5FUCE 2FLRT 3MODL 1S7RB 2ARJA 4Z7UB 2EEAA 1FORL 4Q9QH 4OLZL 2Z92B 5A16A 3DXAE 4NO5B 4PJHB 1C08B 1M71B 2VTFA 4OCSH 5D6CA 2NMSA 5HGBA 4GKSA 1X44A 3RI5K 5FOBB 3QIBD 4NRYA 1UZ8B 4JDVB 4L29B 2BNQB 3L5WB 3AC0A 5IBLD 2BCKB 5LXGL 4IHOB 4NWUL 3EOTL 5LCVL 3RIFK 1BIIB 5F6HJ 5T1MA 3FQNA 1UKSA 5FDWA 4XAWL 5MENA 2FHCA 2VZ3A 4FQXC 1LK3H 3CK0H 3SJVE 4LEXL 4OCWH 1AY1L 5ERWA 1WIOA 2AJVL 4NC2B 4WW1A 3QDGA 2V5TA 3QUXD 4GBXD 2Q8AH 1HKFA 5BS0D 4X9FA 1CBVL 2AJXH 1KB5B 5CKAA 3RWEB 3BOVA 4YWGL 3SDCA 2J88L 1FNLA 4H20L 3HZKB 3ARDC 2R0KL 3KGRA 3QP3A 1J8HD 3ULVF 3PWPD 2YA2A 3P11H 1S5HA 5J1SC 1NCCL 4P3DA 4PGJA 5GRUH 4JM2D 1JNLH 3MROA 2AJYH 3P4MA 1RZIA 2XICA 4PG9A 1KCSH 4R90H 3OKOA 1CS6A 2DMBA 3V8CA 3OXSA 3CVHL 1ZVSA 3NACL 3QFJA 3MOBH 4PYHA 5F7EH 4KV5F 5MERB 1ZT1A 3BXNA 4H0GA 1D9KD 3TIDB 4X98B 3OX8B 2PETA 3QUZA 2CRMA 3PUCA 3SGEH 1FAIH 4PJFF 1YMME 3A0OA 4HC1A 3HFMH 2VC2L 5EO0B 4RWHA 3HZYB 3IDJB 3AB0B 4U1JB 2VSDA 4YEEA 4AG4L 1MWAB 4N9GA 4M8VA 1UWGH 5CSGA 3BH9B 3QWOA 1DFBH 4H88H 3F6IA 4ISVA 1QA9A 4GG8B 4K3EL 5HHNA 4OV5B 2CLZB 1U8IA 4GRLB 5C86A 5IEKA 4G8EB 4E42A 4MA8L 3K4AA 4YQXH 1L6ZA 3VD9A 4KKNA 3LS5L 3I85A 3RX7A 5C08B 4Y4KB 2OTWB 3VA2C 4G3YH 2R4SH 3D18B 2IQ9H 5DRXB 1EPFA 3JWDH 1MJ7L 4H1LH 3WHE0 2W59A 4FN0A 4PRNA 3NABH 4G8GE 1WZKA 1KYOK 2VLLB 2NY0D 5CSZB 1IAIH 4GRWH 4HXAL 3ZDYE 1ZAGA 1F3DJ 4B5EA 1W0WB 3RGVB 4F37K 1OARL 1A47A 1AR1C 1DDHB 2H2PC 4EOWL 4JY4A 5FO8B 2J2ZA 4PPTA 1S7VA 2YC1A 3DV6A 2X9YA 4M1DL 3VWKB 1XCQB 1V3JA 1J1PH 1NBYA 1A6AA 2CUHA 4OZHE 5FYKL 3GBMH 3KJ4B 3U4BH 3MRMB 5CEZH 3SDAC 4Y5VA 2YA1A 2PO6C 4MA7H 4MXQD 2OR8A 3H7BA 3U6RA 4I5BA 2EYRA 1H8NA 4JB9L 4XB7A 3H9HA 3VXRA 3O3UN 2QKIB 4NN7C 2FIRT 5L7XH 4IOFC 4NQDB 2UYLA 3O2VH 1S5IH 5FYKD 5GRZA 2HTKD 2EDKA 2ZCKH 4HG4K 4DCQB 2PYED 4EI6A 4RMWA 4LLMA 4OUUB 5DK3A 3NN8A 4JN2A 5LWYL 4K7FB 3TEUA 4Y4HA 4S1DC 1EBPA 1BLNB 3ZKXC 2NTFA 2EH8H 1PGRB 2FRGP 5DEZA 1E0OB 4Z8FL 2R2BB 2GAZA 1F2XK 1LK2B 3HCVA 1QQDA 1CFQB 3V0VA 4BFBD 4FQIL 5EUOF 3G9AB 3VXTA 4UQ3B 3JWOC 4X9GA 4KQ3L 1A64A 3O45A 4WENB 3NIGE 2PCPB 2O5XL 3FB8B 4HIJA 4W6XB 3I2CH 2ZUTA 4Z76A 1D7FA 2VLMD 4KZDL 4EI5C 1CG9A 3HC3H 4K3DL 3FTGA 1EFXA 5CUSH 2J8UB 1UKQA 4D94A 4I2XB 2JB6B 5B3JE 3OAYH 4E0RB 3QXVA 3G5ZA 3WNNA 4LIQE 1A6UH 3QUXB 1SJHA 4YFEA 3EJYC 2AGJH 5GGUB 1EK3A 5DEFA 4NKQB 4IMKA 5DHVB 1B2WH 2IJ0C 4A6YL 4WI8A 5GGVH 2VDKL 2ICEA 4PJIF 1RK1A 1QSFD 2RJMA 3MLUL 4QEGA 3EYOB 4DKAA 2EDTA 2H9GA 1ZLVH 1N8ZB 1DBJL 5GISH 1UFUA 5JOFB 1CFTB 5EU5B 3WFHA 2AJZA 1CZ8H 1XIWC 1D9KB 3QDMB 1MUJB 2YPKA 4L4VA 5DHXB 1X5HA 2BDNL 5TQ0H 5ICXB 4HLJA 1QKZH 3FHQA 4PB0L 4U6XB 3CVHB 2J1KA 3NGBB 4NP4L 3UTSA 4KHTL 1CGYA 4TNWK 5DFVD 4HUXB 3I75B 4LRNL 2XOTA 4X5LA 4ETQB 2VLJB 3BQUC 2BNRA 4Q6IA 3RWJB 1B4JL 2C3VA 2VXTL 2HJKA 5E08H 3BAEL 2A9NH 4MS8D 5EU6E 4RMTA 3PL6B 1I3UA 4Z7WE 3OAZH 1HEZA 1T1XB 3MRQB 2HP4A 4NUJA 4OQ1A 4P2QE 3NZHL 3GSXB 3T8XB 1QO3A 2BY2A 4HULB 2PUQT 5CKGA 4FFWC 3C5SB 3QPQC 2FHBA 1UQSA 3HA0A 4KGLA 4S1QH 2IPKB 4ZXBA 2YD9A 4FQLL 3UBXA 3FQUB 4I3GA 1P4IH 2F5AL 1RIHL 1X5GA 2I26N 1HNGA 5IMLA 4OD2A 3ARGD 4NPYA 1E4JA 3K3QA 1ZHNA 5D1XA 4KI5F 2NYYD 3QI9D 4L5FH 3UYRL 4NN5B 4M4PA 5EBMA 4BFEA 3MBED 4P9ML 4Z77B 2VLKD 2NZ9C 3RKDC 1HHIB 1Z3GL 3NZ8A 2H32H 1R3KA 4HAFA 1F4YL 1T21B 1LP9E 1QLEH 4IIQB 4PJFB 3JV4A 1NEZB 5E5MB 4KU1A 2W0LA 4F9LC 3ECBB 3HAEG 4KTYA 4NUGL 3BP4B 2Y9RT 1V7ML 1FBIL 2JCCA 2V17H 1JGVH 1ZHBA 3HTLX 3CFBA 4I18B 4EDXA 3PHQA 4G80B 5DR5L 1G6RH 5ICZB 2IFGA 4XMKH 2Z92A 4JFPB 35C8H 1SY6H 4G9DA 3H42H 5HY9A 3X11A 3DX6B 3QG7L 4OZFG 3CSYA 1BZ7B 4B50A 5D7LB 4LCIH 5GGRY 5K9JH 4RQQA 1NL0L 3X12A 4DK6A 5SWZB 3BVNA 5TE7L 2VDPH 2CR6A 1WK0A 2DKMA 1HK6A 4JHWH 2YEZB 4L29A 1NFDA 4DTGL 5DVKA 5IV2A 3C09B 3KYKH 3FRUA 3NMEA 1N7ML 2FNBA 3O6ML 1CGXA 4MCYA 2QSTA 1JHTA 1T7VA 1TTFA 1TZIA 4HD9A 1IGMH 4PRPB 1GGYA 4EQ3A 5EN2A 2Y7QA 1YC7A 4JFDB 5JQHC 1FL5A 3VFOA 2WUCL 1KB9J 1NGZA 1OY3B 4JFQA 4QRSA 1XZ0A 5TE6H 5ACMA 1OAYH 1EAJA 1FZJA 4MLIA 3QQ9D 3HZKA 5C09D 3S35L 1Z9LA 1L0XA 4JKWA 1Q8MA 2LVCA 4UV7H 2R1WA 4K8RH 4NKIL 4X6BA 3KPSD 2PXYB 3T09A 4QY8B 3JV6B 4AEIL 4PJDA 4QRPA 3LEVH 3LN5A 5F96H 2DQUL 5FHBH 3ZT5A 2DQGH 3LKRA 4NQVB 3B5HA 4A6YB 1RI8A 2W60B 4QWWD 1JNHB 1G7QB 4X9IA 1J5OL 3QNXA 4PJ5B 4KJQD 3LKPB 4LDLB 1N0XH 4LCYA 4ACPA 2R1XA 1UM6L 4MB5A 3R1GL 4KH2A 3FFCD 5IMOB 4G7YL 1IQWH 4KQ4L 1EO8H 4YXHH 4PGZA 2BJMH 2D7NA 3O3AA 3DRTB 2BHUA 3Q6GH 2HFGL 3MOQA 4YAQA 4MXWL 4PGDB 1IM3B 4X99B 1KT2A 2HT2C 2V7HA 3H9SA 1T20B 5TFSL 4CGTA 3F5WB 4JG1H 2VDNL 1JGLH 2VZTA 1I8IA 4MWFA 5BW7C 2BK8A 5HVHC 2K1MA 4NZRH 4P49A 3LMJH 4HDIB 1JTPA 3RVWD 1FLTX 3W5NA 4KKCC 1P4LB 3P3YA 4NM4H 3SDDB 1CGVA 1DDHA 2UY6A 4CN1A 4UIKH 3MRBB 4YHIA 4PRHD 4Y19D 1FJ1B 2GK0A 1ADQA 4XGZB 4XWOD 3VWKA 4X4YB 1BWMA 2VISA 3QIWD 5F3HA 4N1HB 4XXCC 3MRMA 5T33H 4DJMA 2GW5A 4JRYD 3MLPA 1F42A 5KSBF 4MNHA 1EZVX 5CIPB 1RZ7H 2VLRA 2YWZA 4U6YA 3E8UL 2DLFH 3KLDA 5GGQH 3ULUF 4P23B 5E9DE 2G5RA 2GITA 5TDPB 4AMKH 3GMOA 2W9EL 3RZCC 4YDVA 3D39A 4JN1L 4WW2B 2F53D 3DNKA 3HI5L 2R23A 3TVMB 1MFCH 3GJEA 3U0TA 1FFQA 1J05A 5DLMH 2MWCA 5C8JB 4ONHB 1C5CL 2CRZA 1DLHB 2ZUQC 4GMTL 4FQ1L 3VFNA 2VABA 1KPUB 3QIUD 3QXAA 4C54A 2CLRA 3MV7E 4HW6A 1F8TH 1SM3L 5CINH 1TZHB 1TETL 2PN5A 4JPIB 5BVPL 3RVXC 4LSPH 1MF2L 1S7SA 3QIBA 1MCJA 4PJ8C 2FECI 4Q9QL 1UVQB 3WFCL 4KROB 3C08L 4JFZH 1KB9K 3U1SH 2P8PA 1UCBL 3GGWB 5T3XH 1NGXB 2P7TA 1RJZB 3M8OH 1S9YB 3JVGA 2APBA 3CC5B 1ONQA 4JFEA 3S8WA 2JB6A 3EYSL 3K1DA 4MJ5A 3CLEH 2QR0A 4U1GB 4KXZH 5DJ8B 3MRRB 5ITBL 1MEXL 3K8KA 1QRND 4QRRD 1FFNB 3QUXA 4GBXA 5BS0A 1RAMA 4APQC 3VMPA 4NBXB 4LHUD 4CU6A 5C09B 1J8HA 5D5MA 5BXFB 2F54D 5EIIA 2YS4A 3PWPA 4OCWL 1M7IB 1E27A 4N5UA 4DW2H 5HSFA 4IS6B 5DJDB 1MCPH 2DBLH 1S8DA 5I75B 4BH8A 4ZOCA 1W72B 4JM2A 1RZJH 4Z5RB 4ELMF 5DO2C 2Q8AL 3MRCB 2XWTA 2AJXL 1J0JA 3EYFB 5L8KB 2D0FA 4WEMB 4L3EE 1KGCD 4S1RH 4MJIE 3RPIB 1CFTA 1G7PB 3ULSA 2VXVH 4HPYL 4CVWA 5I0DA 5IJKA 3ES6A 1BBJB 1K8IB 5JW4M 4QHKI 5GRUL 4K7PY 1JI1A 2AJYL 4ODVL 1KCSL 3RDTD 3EZ8A 1NCWH 2HG5A 5E8NB 5CBEA 5JW5B 4XRCA 2WMPA 3ARZA 5GS2H 4FOMA 5J6HB 1P6AB 1MHHB 3MV8B 1MCWW 4G8FB 3VGAC 5EBWB 3WFDH 2J6EL 1YY9C 4OT1H 4JZOA 4F7MA 3HFML 2FJGB 3IF1B 2VKWA 3OV6A 2R9HC 2NY5L 1MCLA 1P69B 2A6KA 1C16A 1ED3B 3MRLB 4BZ1H 4Y2DD 4E5XA 2JE8A 1UWGL 2ZG3A 4NYLB 1DFBL 4HX1B 4H88L 4U1SB 4EIGB 4ZAKB 4DK3A 5C0RH 4FXGA 5IB2B 5J6GA 2C4XA 4XNUH 4YQXL 4I4WA 3EYVA 2E7LC 4NT6B 4LSSH 5BV7H 2AKRB 2B1AH 1GJIA 2D03H 1RJLA 1LO3H 4G3YL 4DZ8B 2SEBB 2IQ9L 3HE7B 1MLCA 1RPQA 2A83B 2IBZX 1K4CA 3RTQD 4PYGA 3FRPA 4Y19B 4FFZH 2FGWH 1IAIL 3T0EC 3O3EA 5F3BB 5KANG 1C7TA 3V79C 3U30C 2V5MA 5IMKA 3CGTA 1KN2H 1OGAE 1EV2E 3OKNA 3VFUA 5DJYB 4A2MA 4JJ5B 3ARSA 4G6AC 5CGYC 1FLRH 4YPJA 2HFEB 1E6OH 3GJFA 3MMEB 5E5MA 2FH6A 1TJHL 4A2LA 1JWSB 1VACA 1KPRB 4LU5L 4IRJB 3EJZC 1Z0MA 3BRFA 5CEZL 1E6JL 2AK4B 3ILQC 1N64L 1H9VA 3O41B 2PYEA 1IVLA 4I18A 1ZS8A 3SKNA 3F7YA 1PG7W 5L7XL 1I7TB 1CICC 3BISA 3V5HB 3RWDB 5LKNA 5ICZA 5CEZD 5GS1B 1R6VA 2QADC 5TDOA 2ZKHH 3QIUB 4HJJL 4DKDC 5AAMA 4HHAA 1IC7L 5I71C 1N2RA 1T83A 4GS7C 3V5KA 2EH8L 1IGTA 3L5IA 5GRWA 4MA1B 4Z7OF 3CLFH 4XP1L 4P4KD 4TSAH 4KKLC 1CU4L 1U8QA 3OKMB 4YHKH 3T2OA 3R06A 5MEPA 2VSCA 1U3ZA 2HJLB 3V4UH 3RUGF 4NQTA 3GMPB 5KVFH 1KCRH 1A22B 3I2CL 4NKMB 4YDIH 3BGMB 4MZ2A 3HG1E 4G6KH 4KC3B 3UYPA 3RIAF 1QRNB 4QGYA 3S35X 3L6FB 5DDHB 3MOAL 1IAOB 3HAEH 5JOPE 3G08B 5CUSL 5GGSY 3LRHA 4Y5YA 2XG5A 3HPJA 3MJ7A 5F6IB 1HKLH 1KCKA 4GAYB 2YKLH 1QSFA 4U1IA 1RIUL 1A6UL 4DN3H 4TSCH 1SBSH 5T1KB 5FKAB 3W82A 2G60H 2AGJL 5IMMA 2X7LB 1NCTA 1CXHA 5E7BA 1B2WL 4OZFH 4XPHL 3QUYD 2IG2H 3L1OH 4EN3C 2W1NA 3C60C 3GMNA 1K3IA 3SJVD 4MSWB 4NWTL 1H3UA 5A40E 3FO2B 1AGFA 3MV9B 5GISL 3UTZB 3DI2B 1F13A 5EPMA 1N3NA 1XR8B 1U8PB 4UDTB 1CZ8L 4NIKB 1EA9C 5HGHB 4L1HA 2PYFB 2YA0A 1KELL 1YYLL 1M05A 5IB5B 5ALCH 3HI1A 1BREA 1KXVC 2ATPA 5CWSB 2NY4B 3WFEL 2WBWB 5DT1H 3DGGB 3BE1H 3LKOB 1ITBB 5I17A 1LDSA 4MD5B 1M4KA 1GC1H 3H8NA 2ARJQ 4XCNB 5E8EB 1A14L 3QISA 4WFFE 1A1MA 5J9PA 3QT2A 2A9NL 3SDXA 5E24E 1UH4A 4P59H 1YMMD 3IKCB 3MRKB 3F7VB 3CCHA 3W11D 4WDIA 5HVGB 4RBPK 1WFNA 1A7BA 1Q38A 3LDBB 1FZKA 3CFIC 3ARGA 5ENWA 4RIRA 1UEYA 5HI4C 3WIHL 3QI9A 3RX5A 3FQTB 4HFUH 2AJSL 2BSTA 3GMLA 4BQ9A 1R5WA 3MBEA 3QHTC 4KRPB 5LAXA 3EHBC 1DUYA 2H2SD 5FDYA 1P4IL 4NQCE 4ELKB 2VLKA 2R15A 2VUOA 4XMLH 1OP5H 1I75A 3L3GA 4L5FL 5CJBA 3VFTA 4P4RA 4NRZB 2X40A 4MNGE 1ZOXA 4BFIB 4XWGL 1PX3A 3O2DH 3DMMD 2W0KA 2ITCB 2XKUA 4G8GD 1FL3A 3TV3H 1QLFA 2VZOA 3BIKB 1RZKC 4BQ6A 1X5IA 1I1FB 1QLEL 3FMGH 4JZJA 1EX0A 3ELAT 2H41A 1KG0B 4NSKA 4HXBH 3UZVB 4OLYH 2YZ1A 3RA7L 4MDIB 4RAHA 1KN4H 1CL7H 2VH5H 5JIIA 1X5KA 3BKYL 2DM4A 3GI9H 3O6KH 4WCYH 3C5JA 1BX2A 4I0PC 4OCYH 35C8L 3H42L 1I3VA 5F7NC 3S34H 3X13B 1WWCA 1OSZA 3U7WH 1SVZA 2ZUSA 4LCIL 1MVUB 1OF2B 4JG0H 1S9YA 2DD8H 5K9JL 2IADA 5DTFA 4PJCA 4OSUL 4QKXB 5I1HH 1EEZB 4P2RB 4OFPA 4HFWA 2VDPL 5ETUA 1RUAH 2IAMB 2X1PA 4JHWL 4I48A 2OZ4H 4XAKD 2X4SA 1U3HC 4PGCB 5DJ8A 3KYKL 4LGRB 1FFNA 4K3JL 3ARTA 3EKCA 1T1ZA 4PJBA 3DXAB 4GMSH 5A2JH 2V9QA 5KVGL 1IGML 3UJJL 1M7IA 4U6HB 5DJ0B 1SMOA 2DJUA 5EDXA 5C07E 1OTSC 3GSNB 5KW9L 3GSUB 4OD3H 1MFBH 3OJ2C 4RSVA 4KTDH 4ZQKA 3KPSA 4XP5H 5TE6L 1DQQA 2X4OB 4ZUWA 1OAYL 3DBXA 4GXUN 1QBLH 4XVJL 1ZT4A 5JR1L 4LIQL 1BEYL 3S6CA 4LSRH 3GEWB 5C0CE 3NCMA 1A21A 1K8IA 4FS0A 5HGDA 3FB7A 4K8RL 4LLUB 1RIVH 4WHCA 1Q9OA 4HK0B 4TTDD 5JW4R 1FDLH 4OZIE 2QSQA 3SJVB 3W0WE 2HLAA 1EHXA 2DQGL 4TULH 2YD7A 3FFCA 3KDMB 3IDGB 4K8RD 5JHLL 1EGJH 2IPTL 2Q7YA 3PWNB 4R4FH 3IF1A 1PDKA 1I7UA 1U58B 4ELME 3C2SA 3BFOA 5I8KL 3BPLC 1AXSB 2YK1H 1UXSA 4U1HA 5DD5H 4B7IA 4ENEC 5TF0A 3H9YA 3CSPA 1EO8L 4HS8H 1UB6A 1B0GA 1UYWH 1X5ZA 1A4JA 4HX1A 2XPGB 1N5YL 1QEWA 1JF6A 3LH2H 5DJCA 2JIXB 2B2XH 3VMNA 1FVDA 4PJEE 5KSUA 3G5VA 2X1OA 3Q6GL 3H6JA 1QSZA 3IDIA 3RP1A 1PEWA 2H26B 4G9FE 5DMIH 1QNZH 4ZOEA 3QUZC 3B83A 1HQRB 4JG1L 4PBVC 1JGLL 2NXZC 2JJSC 1HE7A 3QO0B 1RFDL 4POZD 4NNXA 5F9OH 5C9KA 3LMJL 1T5WB 2DYPD 4PRHA 3LKSB 5DI8A 3JV0A 4U7MA 5GRXG 1DVFC 1MI5E 3MV01 1NSNH 1ZHLB 3QIWA 4U4BA 5EU6D 1NMBH 4OFIA 1CDBA 2CMRH 5L9DH 4JRYA 5JLZB 2IQAB 2WINA 3B6SB 3STLB 4HKJB 3UEZA 4KVNH 5IG7A 4P2QD 2GK2A 2DMKA 4N8CL 4C55A 4HMCA 4N0UA 4RFEB 4ZD3L 3OPZL 1P1ZB 1KPRA 2I60L 3X3GH 3ZLQC 1MY5A 4ORGB 2AJ3B 1IM9A 1ZXQA 5IF0A 1RZ7L 5I2IA 1R3HB 5EU3A 3SE3A 4YX2L 2F53A 3S9DB 3NCJL 5GGQL 2NY2D 3PWLB 2DIBA 4L9LA 4AMKL 5IROA 3QHFL 2FO4A 5B38B 5K9OB 3GHBL 3VRLF 5GRVK 4PLJD 5IHZA 3BSZL 1Q9WA 4QGTA 4OZHB 5FB8A 1WAAF 3WS6A 4FXKA 1MIEL 4LCWE 1LILA 1Z0NA 1EUUA 4Y5VC 3ARWA 5IBUG 2FJFB 3F7PC 3SO5A 4GG6E 4WTWA 4M93C 1F8TL 5CINL 3LPWA 1XGTB 4LLQA 1Q94A 1BF2A 1RZFH 4NQXA 1IC4H 3P0GB 3O8XD 4LSPL 5JOEA 5C0EB 2EH7H 4NRXA 3UZEA 2LTQB 5F9WC 2B4CL 1U8LA 2GEEA 3U1SL 3KR3H 4OQTH 4WWID 4QRRA 3WIFB 4D3CH 1AO7E 3RI5F 4M7JL 1RHHA 1NUFA 3AAZB 3M8OL 4NFBA 1DN0B 2HA1A 3Q3GB 3FT3B 1VEMA 5C3TA 4LHUA 3BESR 1LEKB 5IVZA 3OXRB 1NGWA 2F54A 4I3RH 3CLEL 3EW3B 3PGCA 4B53A 3TH3T 1II4E 1P7QD 3QULA 4UUJA 4KAQH 5CCKL 5T3XD 3EYQD 3RIFF 4R4BA 2HH0H 4WWKA 1IEHA 3IJSB 4G5ZL 4OLWL 1FNEA 3PV6A 5B39A 1YEJH 3DVGB 5BCAA 4TUKH 3I9GH 4P5MB 5DSCB 2XWJB 1A4KB 3KPTA 4DW2L 4MQ7A 1ND0B 1DZBA 4MQTB 1R3IL 5BRZB 5A1AA 3RUGE 1RZJL 3MGAA 1FCGA 3GRWH 4MD0B 3RDTA 1X4XA 5D2LB 3LIZH 4S1RL 1R5VA 2VXVL 4M48H 5T1LB 3LQZB 4UDTA 4YPGB 1MJUH 2D2OA 2FCBA 5L0QB 3HLAA 4FP8H 4ZPVB 2PYFA 2FZ3B 3ORJA 3TESA 1NAKH 2HN7A 1NCWL 4WI9A 3KYMB 5IB5A 1ZGLM 1NUNB 2CGRL 3S4SA 3BPOB 1CLYH 4LVOC 2ED8A 1G7JB 3ARFB 3EFFA 5IM7B 3T0EE 3VXOA 3AREC 1BQSA 4X7DC 4Y2DA 5BQ7B 3W2DH 4OT1L 2NY6D 4GO6B 2BVEA 4XBGA 4JFFE 1UEMA 4LNRA 2EE9A 2ESVE 2BY0A 3AU1B 3RPKA 3G6JA 5GJTH 4LPTA 1I1AB 1U91B 2GI7A 5GS2D 3W39A 4JVWA 4BZ1L 5I16A 2GFBA 4R7NB 1KV3A 2EYTB 4PJAA 5JUEH 3LQAC 1U8NB 1KIPB 1VEOA 2LAGB 5EZJB 4P5KB 3EZJB 5C0RL 4XNUL 3CDFA 2APFA 1HHHA 1KCUH 5HHQB 4PJ7E 4XMPH 3RTQA 5HDBF 3P9LB 4LSSL 5BV7L 4M8QA 2B1AL 2D03L 4YBLB 1VGKB 3EOBB 1VPOL 4P48A 2FATL 4H1LA 4P2QB 1AGBA 3BUTA 4FFZL 2CKBH 3U36A 2P24A 1YJDC 2FHFA 1AGCB 3MXWH 1KC5H 4HIIB 1SBBA 2J5LC 1TPXB 3A6BH 3QJFA 1KN2L 4LKXA 4YK4C 2YHGA 2F9BT 4PRAA 2ZNXA 4L4TD 1DBMH 1FLRL 4JCMA 3TIEA 5JA8B 3L3JA 4G6FB 4PGEB 4P57B 1DEEB 4DGYH 3JXAA 1UJ3C 2UWEE 4HH8A 1YNTA 4GSDL 4BZ2H 5J12C 1GGCL 3FN3A 2CDGA 4MQXC 3ROLB 2P1YA 4V2BA 2ATKB 1EEYB 5D1XC 1U8KB 2XNAA 3VGEA 1BQLH 1A6TB 5EUKB 3VRJB 3KXFB 4YEFA 5IB3B 1LP9B 4HH9A 5E95B 5E9DD 4P4KA 3VFRA 2Z35B 1VHPA 4XH2B 4P46B 2CRYA 1ETZB 1RUPL 2WANA 2F74B 1CT8B 4WRLA 3Q5OA 3O8XB 1TXKA 3BEVB 3QB7C 1JGUH 4HQQH 4PS4H 5F7DA 1MCKA 3CLFL 5DD6A 4CRPA 4FQXD 3VI4F 4TSAL 5L8JB 1MCOH 4DUWA 4YHKL 1U95A 3VXQB 1XH3B 3VXMB 2XZZA 1YN7A 1IFHH 4UT6L 3WS3B 3MV7D 2WBKA 3V4UL 3ARDD 2G75B 4TPRL 5KVFL 1KCRL 1BFOB 2AEQH 4YDIL 1YEFH 5AYUL 3S96B 1P7QB 1PQZA 1BFTA 4G6KL 3LV3A 2DLTA 4HUVA 1YEEH 1JK8B 4X6DF 2HVJB 1FH5H 1NLBL 2IPUK 2DQDH 2Q87A 3BP5B 5HYSA 3QFDB 2IBBA 4NQEB 5FA3B 3QUYA 5E2TH 1T0MB 2YKLL 1CE6A 32C2B 3O6FD 1AH1A 4DN3L 4TSCL 4S1SH 2I5YL 1N6QH 4JO2L 1R3LA 4MD4B 1N6UA 2O93L 4UNVA 3QXDB 5T5FH 3MFFA 4YUEH 4MAUL 5DVLA 4FTVB 3HE6D 5E2UH 3WJLC 4G42A 3BO8A 4F15C 1EIBA 2KQNA 1BGXH 4JANB 4F7PB 3VDCA 4L3ED 4RNRB 3O9WB 1UH2A 4X7TA 1H3WM 2A73A 2NY6B 1A7OH 1KPVB 4UIMA 5ESVB 3RNKB 4O2FA 1FRGL 8FABA 1GOGA 3GMMA 3K46A 4WFGE 4LDOB 3BE1L 1G1CA 4HKXA 1YMMA 4QXTB 1KLUB 5F9JB 5A2FA 2XZCH 2IH3B 5H37G 2BVQB 1INEH 4ONFH 4Y4FC 5INDA 3WEXB 1EMTH 2HMIC 3X14A 4JPVH 4N8VG 4NO2A 1AR1D 3TN0A 5FM5O 3BRGC 2H2PD 1UXWB 4KVCL 3U7AA 1QG3A 5D7SH 1ORQB 4PLKC 4R6UA 3KYNB 1PZ5B 3SQOH 1HSAB 1TIUA 2IQAA 1WIPA 3L7EA 4OZGA 4WU5A 4ZDHB 3SDAD 2JLLA 2PO6D 2C9AA 1SQ2N 2VZUA 2BVOA 3DVNA 3AMKA 4HFUL 2ED7A 4IOFD 4BUGA 3DMMA 4ZS6C 4G8GA 4QYOA 5EOCH 2FECL 3ESUF 3MJ6A 3RRQA 4F2MB 4Z78A 2NPLX 3I3EA 3ILPA 4N0RA 3U48A 3JWOL 3QA3A 4S1DD 4LLDB 4QOKB 4FQJH 1BVZA 3QQ3A 4S2SB 5B38A 2Z0BA 3O0RH 3RFZC 4WHTB 3ARXA 3M17A 4JFXA 2H32A 2LV4A 2X4PB 3HNTH 3OJDB 4XCEA 3DI3B 4WIQA 1CDYA 4LLYB 1IARB 5HDQL 5GGTL 3QRGL 4K2UL 3FOMA 5DQDH 2GUOA 5A2LH 1CL7L 2VH5L 3ZSTA 1XGUA 5DZLA 5JORA 1OM3L 3OAUH 3GI9L 4ZPTA 3O6KL 4WCYL 3K4DA 1G6RA 4H26B 4Q0XL 1XGQB 5ANMB 4OCYL 1JYXA 3S34L 4M7LT 5HJ3B 3QEQA 3T0AA 3U7WL 4FQXB 3WNPA 3S97C 5ALBH 5MENE 3ESVF 4JG0L 3O3BA 2DD8L 5LQBH 2X9WA 5HHME 3MA7A 5I1HL 2H6PA 3EJYD 3QDGE 2OZ4L 3LKNB 3DX8A 3O3DA 1UWXH 1D6EA 1NFIA 3SGDI 2K9UA 2ICWA 4UINL 3MO1A 1AI1H 5K9QG 3IFNL 4GMSL 1NC2D 3ET9F 1MFEH 4OLVH 1A4KA 1F6LL 3OHXA 1MFBL 3O6LH 4KTDL 4I13B 1WBYA 4XXDB 2NY1B 4RZCA 3JVGC 4J6RH 3IT8D 1HHJA 2P4AB 4LSRL 4FA8A 3HG1D 4YHML 1URLA 4YNYA 1QFHA 4UZGA 2DDQL 3I3DA 1AD0A 5J1AB 1OCWL 1RIVL 1U93A 1G9NC 2O5ZH 3AROA 4FQCH 5D7IF 5FIEA 1FDLL 3BQUD 2E9BA 2XRAH 3L3HA 1JUFB 3U4EA 4PR5A 4TULL 3MPCA 3MCG1 4EKXA 1SEQH 4JE4B 3IETA 2LU4A 4NNYB 4OCRH 1XCTA 1QTYT 4WFEE 4MJIB 4QCIA 3SBWC 1WT5A 3CFJB 3MRDA 2EO1A 4PTUB 2NX5D 3Q5YA 4IOIB 3VFSA 5DURD 1D5BA 4X80H 1KIRA 4HS8L 5E94B 4FFWD 1J0HA 3PWVA 3QPQD 4OM1H 1LEGB 3TYGL 2X4UB 3LH2L 3SY0A 4P5KA 2XZAH 1A9BB 2VERN 4KGJA 5KVDL 5E4IA 3W9EA 1ZA6A 3OR6B 5B21A 2DYPA 1VFMA 4AT6B 1KTLB 1RZKH 4X6DB 2M1KA 2A6DB 3O4OB 4AIXA 4LKCA 3S36X 5EU6A 1DL7H 5DJ2B 1BOGB 2P5WB 1U92B 1T0NA 1VCAA 4Z7WA 3MFGB 5F9OL 3GMQA 3NAAH 4OLXH 3SDAB 2NZ9D 3RKDD 2ZP0T 5CD5D 3C8KA 4WFFD 43CAB 4QNPF 2O61A 4PREB 4HUNB 1NMBL 2I9LA 5L9DL 4LVHB 2E8YA 1QSEE 3KLAB 4HUWA 3VXRE 5JA9A 1JRHI 3CNKA 1VDGA 3L3IB 3KPLB 1DTUA 1U8HB 2EC9T 4FRWA 5MHSD 4PGBB 5IW1B 1TCRB 4NC1C 4U1MA 2UUDH 3X3GL 3HUJE 2X4TB 1HWHB 3K1KC 2D9CA 5D7JD 3EO9H 4FQQA 2DI8A 3AUVA 4CN4A 3BP6B 1RULL 2P5EB 4HS6A 4WVRA 3A6CH 4NQCD 1G7LB 1OGAB 5EUKA 4Z0XB 5JMRA 1PSKH 2Y4SA 3UBXI 4KDWA 2IH1B 4NZTH 5EIQA 4F7EA 3ZHLA 1ZVYA 5D96B 5KS9E 1K4DA 3OGCB 2YPVH 5F8QC 3VJ6B 1FC2D 1CXIA 1A0QH 2L7JA 1J18A 3BP7B 3LCYA 1AGDB 1H3PH 2HTKC 1TVBA 4EI5B 1WITA 4HS3A 1CDUA 2A38A 4WI7A 5H2BB 5ITFA 4GKZB 1I1YA 1I8MA 2PTTA 5EOQH 3ARBD 3DV4B 1RZFL 1IC4L 4PBWD 2WLYA 5L2JB 1HDMB 2EH7L 1I8LC 2VDQL 2EKSA 2F8VA 3IFOB 1RZ8B 4R96B 4PD4J 4PG2A 1CF8L 3MRIB 4LARH 1WFOA 5EG6C 2CO7B 4FXLA 4I77H 2Z8SA 4GAGL 3ZZ1A 1JK8A 4D3CL 2HVJA 2QQLH 4XPAH 5DRNB 5I18H 2NNAB 4JVUA 5KSVA 1A3RL 3VA6A 5E00A 5JW3L 2V2XA 4MVBD 1MJ8L 2C1PB 4ZO6A 3SPVB 5FGSA 3C5ZC 2GCYA 1GIGH 4AZ8A 4WTXA 4KAQL 4XP6H 2AXGA 1ZEAH 4WU7B 4LAQH 1XIWB 3I6GB 1UCTA 2HH0L 1ZT7A 1OAXL 4KJYB 3KWWA 5FKPA 3KPMA 4RFOH 2MKLC 3GIVA 1AKJB 1YEJL 4GAJH 2RCSL 3E6FB 1WCBA 2R1YA 4RAVB 4ZUVB 3I9GL 3HG1B 2X70B 3TNNA 2QHRH 4Z7NF 4XNMA 5EOTA 1KENH 4MJ4A 1XF1A 3GRWL 2YRZA 1JFQL 1XGRB 3GKWH 2X4NB 2Q7NA 4M61B 1SJXA 5DK0B 5C07D 3LIZL 3G6DH 4M48L 2OQJB 3I02A 1MJUL 2O26U 1T1YB 3T1WA 1B6DA 1JTOA 4FP8L 1M1SA 4HIEB 1IGJB 1BZQK 2HT2D 2O5YL 4IDJL 4PJGF 4Z7QF 5C0CD 1T03H 3GSOA 3TO2B 1J8KA 4D9LL 1D6VH 4QRTA 5FGRA 5E2WH 2X6MA 4X8JA 2IH3A 2ZUVA 3W0WD 3NPSB 4H5SA 3W2DL 2FX7H 3TT3L 1IL1A 1U8OA 5TGBB 4LF3A 4KKCD 4W70A 5FA4B 3MRPA 3ZKQD 1AQDB 5C0IB 2R0WL 3TCXA 1UG9A 3Q0HA 4MHHI 5LJYH 4RMSA 3ZKMC 3E2HB 5I66B 1U8MB 4FFYL 1FFOA 5C0BB 4MS8C 1KCUL 5IK3A 2IGFH 5T1DH 2HT3C 2F58H 3NPZB 3BN3B 3TT1H 1YPZF 5ESQB 2OJEA 3P4NB 3U7YH 1CXEA 5IP4A 1F4WH 2R2HA 5C0NC 3LD8B 4LP4A 1NDMB 4TVSa 3WCYA 2BSED 3BKCL 4JPKL 4L4TA 5D7IB 1HIML 3I84A 3SDYH 5ICYA 2JCCE 1T2QL 3MXWL 5EC2B 4FG6C 2Z31C 4QHLB 1KC5L 4HT1H 1I9RH 4MNQE 3A6BL 3QO1B 5D2NE 4LBEA 5LGKA 3WHXA 1T2XA 1MI5D 1FIGL 5H37H 5D71H 1X7QA 4NQCB 3WN5C 3DUUA 2MQCA 2I9TB 2XZQL 1J10A 5GQBA 3C8HA 5GIRA 2HKHH 4BZ2L 5E8DH 4PJ8D 1R0AL 5SWQA 4HUMB 3RL2A 5E9DA 3SKOB 4HZAA 4F7CB 2IANB 1JE6A 2ORBL 1JP5A 1BD2A 3N06B 3VFMA 1GGBH 4ZFOB 1D5MA 3KPPA 3TBVA 3FQRA 4O5LH 4WEBH 4PD4K 3IDYC 4FZEH 4W68A 4CMMB 3HMWL 3NFPA 4NKDA 1MHEA 5L88H 5JDSA 3AXLA 1IAIM 2JTDA 4K71C 3VH8G 1Z5LA 1JWMA 1KTDA 2D0GA 4CVXB 3MLYL 1A1NA 1U9KA 4JAMA 4N9OB 2BP3A 3D25A 4APQD 5HYIA 1HXMB 3UTPE 3ZE2F 1JGUL 4HQQL 4EUPB 3MV7A 1S7XB 3ARDA 3S3PA 4OAWB 3TBYB 1S3KL 4ZTOL 4LCWD 1MCOL 4MCZA 1DSFH 3SE8H 2GSGA 4R7DA 1IAKA 3NCBB 3EAKA 2HFTA 5DO2D 3IFPB 1XF2A 1IFHL 4NCC1 4ALAH 4WUUA 3NBNA 1PKOA 5EZIH 4GXVH 1YEFL 3RWGA 5JPNA 4TVPE 4QRPE 3WXVH 3O6FA 1YEEL 4FQPA 1FH5L 1ZA3B 2DQDL 4HGMA 5E03A 3PWJA 3HAEA 3QZWB 2YUZA 3OKDB 3L95A 1AO7D 1FVEA 4JFHE 5EO1B 3MNVB 4JHAL 1CIDA 4U1KB 1N6QL 4PTTA 1YY9D 3HE6A 3MUGA 2DQCH 2ZCHH 2BC4B 4U6TA 4OZFA 5I9QB 2R9HD 2YD6A 3EBAA 3FO1A 1P7KB 1HXYA 2JK5B 4L3EA 1FFPA 2FX9L 4R97C 5AYQA 1E4XH 2Z93B 1B4RA 3EJJX 3WL9A 1MAJA 5KOVC 2WSKA 1G7HB 3H9SE 1NDGA 3IDMA 1W8NA 2FYYA 2D7OA 3B9VA 4M6OH 5SWSD 1IGFH 5ADPH 4GLRH 5K59E 1RZGA 4P5TA 1LDPL 1MH5A 1KBGL 1OP5K 5DXWA 3LN4B 1LO5B 4E41E 1YJDH 4LDEB 3CDCA 3RU8H 2EIZB 5E56A 5IVOA 2WIIB 1XR9A 3QYCA 4HIXH 3S37L 3MRGA 4PJIA 4NNPH 2QV2A 3TFKC 1KTLA 1P9MA 5KSAB 4L1DA 4X4XB 4ONFL 1XF3B 3SCMD 5KAQF 4HWZB 3DHJA 3MLVL 3T0ED 4LPUA 5HI5C 3FT4A 2XN9E 4HK3N 2B1HL 3B3IB 4JFFD 2PO6A 5K9KB 1A2YA 2OL3H 1IAMA 3STZA 1EO7A 4G6AD 5CD3A 2GJ6B 4PJEB 2CIIB 5D7SL 3BUYB 3VXSD 1MCSA 3VGFA 3WUWG 1FL6A 4Z0BH 4TUOB 4G9FB 1FG2A 2YR3A 4UAOB 1TMCB 3RZCB 4WNQB 2DM2A 2P43B 5F7UA 3JTTB 3MRHB 1FN4A 1DN2A 4KK9C 1KJVA 2OR7A 1CICD 5J4MA 1MLBA 3IU4H 2DQJL 3F12A 1PY4A 5EOCL 2QADD 4PJGB 1MI5B 2ZUQB 4JM4H 4LLWA 1C12A 1F3DH 2MMXA 2R39A 3D0LA 4PJ9B 4FQJL 2XXMB 4PJXE 3PF2A 4J3WA 3O2DA 1FZOA 4Q7DA 4XPFH 2XV6B 3NVQA 3O0RL 4EIZC 4OGYH 4UU9A 3D9AL 4U2ZA 1ITCA 4F33B 1FO0H 3HNTL 4KKLD 5FO9B 2W07A 4RGNB 3T3PF 1BZ9A 2N7BA 1C1EH 2AXFB 2JJTA 3KYOA 1EVTC 1A9EA 1BQHG 3OWEA 3SE3C 2XWBB 1XGYH 4YIQA 4JFEE 4HF5H 1WJ3A 4Y16B 3HR5B 1HH9A 1R3JB 4L9LC 2KH2B 3D85B 3KPRB 5GSRB 5IVXE 3VWJD 5KJRH 4M7KH 4APQB 4UILL 2RB8A 5C0GA 1GL4B 2XTJB 2DWDA 1DANU 3CFCH 5FYJU 12E8L 1YPZB 3CFDB 5ALBL 1AFVL 1JYVA 4KK5C 3MSPA 4UT9H 4YZFE 4P2YA 4LCWB 3L3KA 2IFFH 3E3QC 3PWPE 3WS6C 1NC2A 4IRSB 3BWAA 2QTEA 5CILL 5BJTA 4WV1B 3WD5H 4MJ6A 2OZ4A 3VFVA 3LEYL 1GPOH 5ID1B 3TO4D 1QACA 4JY5L 1G84A 1FV1B 4HKZA 4GQ9H 3C60D 3I6KA 1VEPA 4TVPH 1MFEL 4ZUVA 1F58H 4OLVL 4PV8A 3BN9C 1V05A 1X9QA 3OKLA 1TZGL 1HHKB 3IAPA 1N5AA 3LEXA 5DQ9B 3TBSA 3O6LL 4WUKH 5HHXH 3GIZH 2B39A 4C4KT 15C8L 3ALWA 3BQUA 4X6EA 5CHNA 1AE6H 5HYQA 5TE4H 4TN9A 2NW2A 3UTTE 1JHLH 1T1YA 4QTHA 1RK0B 3HMXH 3ARYA 2O5ZL 1VKXA 2IALA 4WWKC 1G7IA 3LOWA 2XRAL 4R4NC 2JJUA 2Y25A 4Y1AA 3VDBA 2ZPKH 2NX5A 2N1KA 4HZLA 4QHMB 1NAMH 5I6XB 2FL5A 5I1AA 3F6LA 4OCRL 1EGJA 1ZANH 2VQ1B 5BZDA 3U0PB 3RDTC 1CLCA 4IMLB 4KJWC 5KAQG 4M5ZL 1SEBA 2K7PA 5D8JL 2EYSB 5IOPA 3V7AG 1DE4A 1I3GH 3FN0L 1JPTL 5E6IC 3MYJA 4CL7A 2JF1A 2VL5B 1ES0A 4X80L 2EECA 4EZMA 1JPSH 1U8JA 1T4KB 3AMLA 5HI4D 3CH8A 3KHQA 4L8SC 4CJ0A 1LNUB 2Y07H 5EC1B 4F7TA 1G0YR 2FSEA 3V4VH 4AQ1B 1CFNA 1VFUA 4JFFB 5D1ZB 1RZKL 4Y2DC 2ESVB 4YC2C 1GVIA 1DL7L 4WFGD 1MY7A 1V5JA 5CAYB 3V52H 4F9LA 2V7NB 1MAMH 3NAAL 1NCBH 1TVHB 1UA6H 3QNYB 4F58H 2XA3A 2KZ1B 5HD8C 4BSWA 3HNVH 5F9AC 4Q9CA 4OKVB 3FAXA 5E1HB 1QPXA 4YHZH 1CICB 5D7JA 4LCCB 3S5LB 4LCUB 1HCVA 3RVUC 4LNVA 1CFVH 3MRJB 4WHDA 3RTQC 3BHBA 4JFYB 2J12B 2X05A 4AIZB 1TITA 2L4OA 2H1PH 3CZJA 4I0PD 3NCEB 3JWDC 5KTEH 1T22A 4MNGA 3SOBH 2DL2A 3V5DA 3A6CL 1EHNA 1E4WH 1PSKL 3BD4A 3HNSH 2CIKA 3OJVC 1NCDL 4HK3J 4NZTL 3ZE1F 1JZ5A 4JCLA 4QHNB 2Q76B 1NEUA 1HHGB 4EBQL 5DFWH 4NKOA 2ERJC 4OGXH 1U3HD 3J7HA 4YHLH 2M2DA 3ARBA 1H3VA 1PYWA 2AABL 4MXVF 4OJFH 3C2AL 5KSBA 3CMOH 1UJTA 3K0WA 4HAGA 1XT5A 2Z8RA 1NLDH 1OTSD 2X10A 3VXUE 1X5LA 1G9NH 4N68A 3PIQA 4OZ4B 4QT5A 1PLGL 2ADJA 4X4MA 3GBNL 1IT9L 1S9WB 4LARL 2AV7A 3U4AA 4M1GL 1CD1B 1JZ3A 3IXAA 4ONGH 5JIHA 4OD1L 3C6SB 2QQLL 4XPAL 4EN3B 2I07B 3C60B 5FAAA 1FVCB 2NY3D 1ZE3C 6FABH 1QHOA 3RZWA 3MLZH 1S7TA 2R69H 1BFVH 4IJ3C 4XP6L 4XNQA 2EIDA 3FO0H 3SO3C 4KZEH 5I1JL 4OCMC 5C07A 4RFOL 4HIHA 1K8DB 3DRQA 1NANH 4XHQA 3K74B 1KUMA 5C2BH 2QHRL 2V2WA 1YDPA 2KL6A 1KENL 4ENED 3KPNB 3CXDL 2OXHA 1SYVA 1ZSDA 5C0CA 4PRDA 3GRWA 3RX8A 4LSUH 3G6DL 1A6ZA 5FK9B 1AIFB 1BAFH 4MB4A 2D4DA 5BW7A 1LVEA 2MNUA 3QUYC 4YDJB 4OZIA 4WFHE 1BVLB 4J23A 1EJOH 3QH3B 3VGDA 1DP0A 3W0WA 3IJHB 4OIIH 3LRSA 1TNMA 3MNZA 1T03L 5D1QC 5GSVB 2DTSA 3S37X 2DQEH 1D6VL 3CDGA 5EZLA 4O2CB 5E2WL 3TF7C 2RQ8A 3AY4C 1MCHA 2HKFH 3O11B 1OGTB 3MLTA 1K2DA 2AEIT 4OCLC 4ELMA 5IESL 2FX7L 1DVFD 4UI2A 3BIBX 1MRDH 4PY7A 5IEHA 4ZUTB 3PNWB 2WNGA 3AS2A 1H5BB 4HUUB 4NO3B 2EDBA 4URTB 3GO1H 4WY7L 3ZHKA 1WISA 1VFAB 2A74A 4NDMB 3FONA 2G9HA 4U1NA 4Q9RH 2VLKE 4DVBB 2EDEA 1PKQB 4J1UA 3QQ4B 2IGFL 5T1DL 3PP4H 2VWEC 1CLZL 4ODTL 2CH8A 3FFDB 2J3SA 3DJ9A 3PDGA 3U7YL 3QWRD 1I7RB 1F4WL 1J1OH 1OB1A 2IMNA 4XCYB 1K6QH 3CX5J 1JNNH 2FEDC 4ZFGL 2IC2A 5FOJA 2D7TL 3TN0C 4HV8B 5DZOA 5JPMA 2BY3A 3MYZA 3LY6A 4L9DA 3WFZA 4DAGH 1IC1A 3SDYL 2CKBA 1M7DA 4HT1L 1I9RL 2Z9TA 2YD8A 5DUBA 4PJ8A 1FYTB 5GZOC 3GUTA 1SHMA 4L4JA 1OPGL 5DMGD 2W0FA 1A3LL 1QSED 2H8PB 3VXRD 7FABH 3UPRB 2YUWA 3G5XB 2AVGA 3GHEH 1ZWIA 5D93C 5IB4B 2HKHL 1EVUA 2VDOH 4L3CA 4YDKL 1GOFA 2ADGB 5E8OB 5DUPH 3SE9H 4MDJB 5CFHA 1IGCH 2CO6B 2DM3A 5DFTA 2CUMA 2XXCB 5IVNA 4PV9B 2EDRA 1GGBL 5EZOH 1BF8A 3N9GL 3RGHA 1ZTXL 5LGHH 2ARJB 4FZEL 5L88L 2X42A 1EAPA 2OK0H 5A16B 4DVRH 1IGIH 3WLBA 1JJUA 2DRUA 1WGOA 1QYGH 2KKQA 5D6CB 4GG6A 5HGBB 3RIAK 1RHFA 4GKSB 1L7TL 4FFVC 5FGCE 1B3JA 1L4IA 4NRYB 43C9A 1MNUH 4NFCA 5SV3A 5JXAL 3GSWA 1MHPL 3QPXH 3QAZC 2CSPA 1LWRA 4KY1H 5FHAH 5BMFL 2YOCA 4ALAL 5T1MB 1FPTH 3FQNB 1AO7A 5FDWB 2QL1A 3WV0A 5EZIL 5MENB 3ZTNH 2HT4D 5HHMB 3WXVL 3DYMA 2YPLE 3R4DA 5ERWB 2XY2A 5BOZG 3BKJL 4WW1B 3QDGB 3LSOA 1JF5A 3HI6L 5DYOB 4JQXC 3SDCB 4XI5C 1MIMH 3BPLB 4CVZA 3ARED 2NY7H 3KS0H 3V6OC 1S5HB 5DD3H 4AEHH 1C7SA 4P3DB 5L8LB 5IW6A 2HTLC 3MROB 3LHPL 3P4MB 1AXTL 2DQCL 1RZIB 2ZCHL 4PG9B 4UTBH 3RUGA 3OKOB 1MPAH 3OXSB 3CPLA 1ZVSB 2PW2A 3QFJB 4XNXH 5SWSA 5EU4A 1ZT1B 3BXNB 2E7LA 2FJHA 1TJGH 5A2IH 1E4XL 4JLRA 3ZYJA 3QUZB 1UM4H 1UWEH 1YECH 2NXZB 5DC4B 4RA0C 1J1XH 1EERB 3T2NH 1A6WH 4M6OL 2DQFA 1S7UA 2FWOA 5ADPL 1BJ1J 5HHOD 3EO0A 4ZUUA 5JQ6H 3MA9H 4N9GB 3SCMA 1YJDL 1OT1A 3T0EA 3PWUA 3T4AA 3RU8L 4Z7VE 1F11A 3QWOB 2MJWA 4ISVB 1QA9B 5HHNB 1U8IB 3MX0A 4JFFA 5IEKB 4NNPL 4E42B 4LPXA 3VXPA 1P4BH 1JZ8A 4LQFH 4Y4KC 1I3RA 3VXSA 3CX5K 3BJ91 2CQVA 1R24A 4X7SH 1OAKH 4N0UE 3T65A 3MJ9H 5C70A 5JMOC 5FM8A 1KOAA 1MQKL 3MUY1 3CXHJ 4PFEA 4WJ5A 2OL3L 1OTTC 3VGBA 1NFDF 3SGEI 2Q86A 4PRNB 2J8OA 5F97E 4NBYB 4X8XA 4PJ7A 3VDAA 2C4FT 4M3KB 4POZC 5EORL 4Z0BL 2HAZA 3RGVC 1M7XA 2D31A 4UB0H 4MQXD 3IFLL 2YZ8A 4JY4B 2DWEA 1S7VB 2YC1B 3DV6B 3IU4L 5DJAA 1NBYB 3O2WH 3E3QE 1IEAA 4Y5VB 4JM4L 4RBPH 3H7BB 3AGVA 1JWUA 4I5BB 3U6RB 2EYRB 3H9HB 3VXRB 1RJYA 3Q6FA 1FG9C 3G9VA 2UYLB 4PJDF 3Q5TA 4M4RA 2UWEA 4EI6B 3INUL 4MNQD 4UT7H 2RFXA 1IAII 4LLMB 1LE9A 4J3VA 4IBLT 1Q0XL 2NY2C 3NN8B 3VI3F 3U9PH 4JN2B 4DGVH 3E1F1 5ABDE 3VWJA 2Y36L 4BJLA 1NQBA 2NTFB 3LQMA 1QR1A 2BFVH 2DIAA 2GAZB 1T3FA 2FD6H 1XGYL 4XP9H 3HCVB 4HF5L 1QQDB 3V0VB 2YBRA 1CD8A 3WXWH 1NPUA 2BOBA 3VXTB 4Z9KB 5E8PA 4M7KL 1KTRL 1EXUA 5I74B 3O45B 5JZ7D 2RAMA 3CFCL 4UDUA 2DMCA 4HIJB 5IHUL 3TO4A 1KGCE 5F70A 3S3JA 2XI9A 2A2QT 2NW3A 2IPUG 4XTRC 5EWIL 4Z76B 3OQ3B 1WC7A 1CG9B 1TFHA 1EFXB 4OBRA 5IBTL 5HYJD 3V4PH 3UTPD 3G5ZB 3VG9B 5BVJA 1JGDA 4TVPL 1SJHB 4HEME 3F62A 4MX7A 4PG2C 5DEFB 2F5BH 1ACYH 4WUKL 1CWVA 2WWKO 2ICEB 1G0XA 4X6CE 5CEXA 1RK1B 3GIZL 3PQYE 4X9HA 5C2UB 1FSKC 2UZIH 4BK4A 1AE6L 4YGVB 3L5JA 4TVPD 2H9GB 4XVSH 5TE4L 5DMKA 2BSRA 1H3GA 3HMXL 1IBGH 3WFHB 2AJZB 2X5PA 2YPKB 4NCDA 1J87A 2BNUA 3KPQB 4JFHD 4HGKC 5A2KH 4L4VB 4Y4FD 1FP5A 1WV7T 3NGBC 1NAML 1YNKL 2Q6WA 3UTSB 1ZANL 1MFDL 4FMKA 5GRYA 3AVEA 4ZUTA 2BNRB 4PLKD 4Q6IB 4YXLL 2C3VB 5C0AE 2HJKB 2OYPA 3CXHK 3BPNB 4N90D 4PRBA 4TQEL 1MCQA 1JPSL 3FCTA 1OAQL 1VERA 4XPBH 1BFSA 4ODXA 2Y07L 1F5WA 1HEZB 2X4QA 4U0QB 4NUJB 2DTMH 3SKMB 2PTVA 3V4VL 4ZS6D 1QO3B 4D0BA 4GRWE 4E41D 1F2QA 4LASH 2DLHA 3ZKNC 1T6WA 4HWBH 1ADQL 4QF1A 1F6FB 1FYHB 3QEGL 4W4NA 5TJWK 3BI9X 1GH7A 1UQSB 3V52L 5AWNH 4ZXBB 3REVA 3Q2CA 3ULVC 1DBKL 1MAML 1X5FA 2DI7A 1NCBL 3UBXB 1UA6L 3LB6C 5J12B 1JZ2A 5DUMH 4OD2B 4F58L 4NGHH 4ZSOE 3IYLW 4NPYB 5FYLH 3HNVL 2VKXA 3P73A 2XN9D 5D1XB 1ZHNB 5GJSH 1A7RL 5HDOA 3D3VA 2MOVA 2WK2A 4I0PA 5EBMB 3B9KD 2LU3A 1QFUH 3NZ8B 4N0FA 1R3KB 4IRZL 4IIQC 1NCAL 4UTAH 1DR9A 3TH4T 3N1PC 5AD0A 3JV4B 2KUTA 4JM2F 5FF6A 2HRPL 5FECA 3PE9A 3A67L 4DUXA 5KTEL 3SOBL 1U3HA 2JCCB 5F7LB 5BO1H 1ZHBB 4MNQB 4OIAA 3CFBB 1E4WL 4P2OA 3HNSL 4EDXB 1ORSA 3PHQB 5ID0A 3N50A 1Q9KA 2FX8H 1N59A 1YN6A 3D6GA 3GK8L 1RMFL 1F6AA 1NJ9A 4HG4J 4G9DB 5HY9B 2E9JA 3FAWA 3X11B 3CSYB 4X6FA 3TA3D 1PD6A 3ARPA 3E0GA 2R8SH 5F9DC 4OJFL 4RQQB 3V2AR 3NFSH 3X12B 1W0VA 2MHAA 3CMOL 4L8BA 4ESKA 3BVNB 4DEPB 5F71A 1NLDL 2RBLA 1NFDB 5IV2B 3EFDH 1G9NL 3FRUB 5KVMC 4MCYB 2Y06L 5F7YC 1JHTB 1SVCP 4JFED 3VW3L 1TZIB 1IEBA 4L8DA 4LMQE 4NOFA 2Y7QB 5EN2B 3FT2A 3T77B 1FL5B 3VFOB 2FB4H 4ZO9A 1NGZB 2LVEA 4JFQB 1G6VK 1XZ0B 3NIFE 4QRSB 3QDJE 5DYOA 1FZJB 4DQOH 5IQ7L 4RAUA 6FABL 2VIRA 4HC1H 4U7SA 4F15B 3MLZL 1E4KC 3QUKA 3NCYS 1BFVL 1UM5H 2F8OA 2R1WB 3D69A 1KEML 2PXYC 4X6BB 1J11A 2CK2A 2OTUA 1NC4D 1MELA