5DJYA

Fc heterodimer design 20.8 y349s/t366v/k370y/k409v + e357d/s364q/y407a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVSTLPPSREEMTKNQVSLVCLVYGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyA01
4X4MA 1SJXA 4ZUSB 3E0GA 3MR9B 3P9LB 2FEDD 3CDFA 5E2UH 4C55A 1WV7T 5E2WL 2ADJB 2XKNB 5IEHA 1VACB 3GSNB 5H8DA 5DQJB 1OT1A 1XF4B 4EQ2A 3LAFA 3WE6B 5DR5H 5D9SB 5L2KA 1AD9B 3C8HA 1LDPL 3TVMA 1BPVA 4OZ4A 3MGTB 1AH1A 5GRUH 2HVKB 1NEZG 3RTQB 4X0KB 5CMAA 5D96B 2YWYA 2CIKB 4HKXB 3FT4A 1QEWA 5CS7A 4OZIF 3GMRB 2EDTA 4FABL 1J0KA 3TT3H 1DBAH 4M1DL 5EOCJ 3D69B 2XQBL 3UJTL 4LLVB 3W0WE 3DRQA 4MD5B 4ELME 1XGPB 4EOWH 2VB5A 2EEBA 2ED9A 4LLWB 4RFEA 4N90E 3VG9B 1QFWM 4P46A 4RQQB 4G8FA 2FX9H 5EORH 3RI5K 1YN6A 5LXGH 3L95A 4WWKC 2CSPA 5JW5A 3NN8B 3BFOA 2R9HD 4L1DA 3QWOB 4NQEE 4JM2B 5E95B 3RUGA 3G04A 2SEBB 3S36X 2IBZY 4NBYB 3FRUA 3QR2A 2HT2C 3PJSA 1JCKA 3FZUD 2XWTA 1QFWI 4RWYL 1VDGA 2R4RL 4U1NA 2DLIA 5E8NA 4WVRA 4NKMA 1S7SB 3KPLA 4HS8L 2JB5H 4HKZA 4H20L 3VGAC 4OZFG 1U8NA 2Y06H 4GG6E 2XZCL 4CAGA 1OVZA 3RDTA 1CK0L 1KN2L 4XTRD 4ZTOL 3NIDE 1ZLSH 3UPAA 1WTLA 1FFNB 1RZJL 3QNYA 5CBEB 2HTKC 2B1HH 3KYOB 2VH5H 4M1GL 1ORSB 2HKFL 4JDVB 1KNOA 1SVZA 5IV2A 3MODL 3X12A 3CFEB 2FIKA 3LIZL 1JL8A 2VXQH 1RK0A 4EUPH 4IIQB 4IRSD 1RY7B 3QDJB 4WUUD 3FKUS 5IHUL 3PNWA 3LN4A 1J18A 1MCLA 1KIPB 2YRLA 4PGCA 4NQCE 1BX2A 1JUFA 3C5SB 3ZSSA 1KN4L 3STZA 3CFBA 3T0ED 1WAAE 2FSEA 4HJJH 5DJDA 4LFHD 3GNMH 2J12B 5F7YC 3ZKQD 2R2EB 3MJ8B 3BZEB 5E9DE 2X4SA 1J86A 2FIRT 2ATPB 3RY5A 5F1IB 1QRNB 2BJMH 2DQUL 3U9UA 4EDXB 4RSVA 4IMKA 2CRIA 3DOSA 4MJ5A 2NY6B 4XVUC 1Q1JH 1OGAD 3SE9L 5I8CA 5JA8B 5CD5D 3HG1E 3H0TB 3QCTL 1MAML 2DQGL 1HSAB 3HTLX 1NLDH 3HNSH 3DXAE 3WFEL 2DYPB 1SJHB 1NC4A 2VL5B 3B2VL 1MRDL 3BUYA 4G8GB 3DO7B 5EFIB 3UTSE 1T5XB 5JZ7C 3TCXA 3KJ6H 1KB9K 1XGYH 4HFUL 2NNAB 3V6OE 5B38B 2ZUUA 4LSDA 4F58H 3GBNH 3NIFF 4M62H 4KK5D 4WWID 5DJ2A 1MCCA 1HQ4A 2WWKT 1KJVB 3IDIB 2GK0A 3BP7B 4WU7A 4XCNB 3ARXA 3MC0A 1TLKA 4MB5A 3IB4A 4M1CD 1U95B 1I8LC 4YHZH 3AUVA 4OGXH 1VFUA 3M8OL 3O6KH 3WS3B 4WW1B 1BF8A 3OHXB 4JM2F 5D1XA 3FN3A 2XPGB 3GKWL 2Y72A 3ELAT 5E1AA 3H3PH 2HMIC 3AAZA 4DW2H 1F8TL 2R29L 3O6FD 1LO5B 2VXTL 1KB5H 3G6DH 4HJ0D 1T2QH 4OF6A 2AK4A 3BSZH 3LQAC 4UV7H 5F1NA 2XTJD 5CBAB 2NR6C 5HJ3A 2X42A 4BSWB 1X5YA 2P5WA 1PKQE 3RTQC 4CL7A 3KYMB 4N9OB 3FRPA 2W1NA 3KYKL 1LO4L 3AU1A 2FJHB 2R0KH 4ISVA 5HHPB 3BZFA 4XGZA 5D2NE 1IAOA 3VXUB 5ISZD 3DBXB 1IE5A 2E6PA 2VRAA 4Y5VB 3DTXA 1DEEA 3QEQB 4D0DB 1Y18A 1EFXA 5BS0D 2WBJB 5AG8A 1ROWA 3S6CA 3VG9C 3GSUA 4ZPTA 4FFVD 4N8CL 4ZO8A 2WIIB 4PJEB 3SJVB 5HI5D 5GJSL 5JHDE 2BVEA 3CZFA 4ONGH 1FNGA 1W0WA 2XY2A 4RCAA 3T77A 4Y4FD 1DANT 1T1ZB 3IFPA 4PJ7A 1X6LA 1IGJB 1TDQA 2CXKA 3FONB 3V52H 5E00B 5AUMB 2GSIB 3LVEA 4JFQB 4CW1B 1F45A 2R2BB 3WYRA 4FG6D 1D6VH 4MNGA 5GZOD 4X7SH 4WI6A 5IEKB 4J4PD 1JGLL 4MJID 4CDGC 2DTSA 1A3LL 3UROR 4KMLB 2CKNA 4POYA 3DGGA 4CMHC 1JMXA 3SPVA 3GJEA 4FQ2H 2DD8H 5DK2B 2NZ9D 1RSFA 3LS5L 4Q7DA 3SDDA 2I9TA 4MZ3A 2I07B 4AEIL 5JQ6H 4XZUA 4DVBB 1JP5A 2XY1A 4LQFL 5E8EB 4LSPH 2ESVB 1UH2A 3FO0H 5KVFH 3W2DH 1IT9H 5F88A 4IIQC 4UT6H 3PIQB 4AZ8A 2X89D 1FE8H 1J05A 5MENB 3O3AB 3RKPA 3BYYA 3NCFB 2ADFL 3O0RL 4WU5A 3R0NA 1BHGA 1A1MA 4KJQC 4X7DC 2AI0L 3RWIB 3RNKA 4L3ED 2P24A 1E6JH 3G6AA 3KLDA 1U8HA 3HI1A 3DV6A 1QLFB 1Q9KB 1S9VA 3OKEA 2PW2B 1JHTA 4U7KA 2YPLA 3S4SB 5HHQA 4NC2B 3GSRB 2VLKE 4HUUA 4HGWB 2WLZA 3GM8A 5I30L 1UWEL 1MIEL 1OSPL 2VNCA 2D2OA 4XPTL 4OCMC 1T89C 1K85A 3TPKA 4AL8H 1H5BA 1UB6A 3QZWG 4ZFOL 4Q0XL 1NUFA 4N0CC 2X4RB 2WSKA 4NO5B 3MRKA 4E9LA 1A1OA 4E42A 1RURH 4WW2A 5HHMB 5L9DL 1MCWW 3FO9A 2NX5B 4KFZC 1YN7A 4LP4A 3SGKA 2YOCA 2ZP0T 1MCHA 3TYFA 3G6JB 3GJFA 5EU5A 5J0BA 1HH9A 4TUKH 3M17A 2IWGA 2J4WH 4NFDA 5IOPA 2Y5TB 3SKOA 1I8KA 5GHWH 3QIBB 4ZO6A 3FB5B 1LILA 1CDUA 1LE5B 3FT3A 3QUYB 2DB8A 5JQHC 1I7RA 2ID5A 1D5IL 1Q8MA 3HZMB 3DX6A 1ZANH 4G42B 4OUUA 3IDJA 3GMOB 2P5EE 4N90D 1MFAL 4JDZA 5F7WC 5T1KA 4NO2A 2MCPL 3MNWA 4XP5L 4JQVA 4EI5D 4NQED 1QA9A 3X3FH 3DLQR 4O02L 5IB5A 1CBVL 1RIUH 5ALBL 5I1CL 1RJLB 2G75B 3BDYL 5KJRH 1RFDL 1JTPA 4H1LA 3MLWL 3BPNB 2NXYB 5D2LE 2EZ0C 1A3RL 5DWUH 1FCCA 4XMLH 3PWJA 1QYGL 2O5YL 1KF9B 4GKNA 4QHMA 2CKBB 5BZWA 3VXRB 3VXQB 2B0SH 2N7AA 1BIHA 3D0VA 3CFJB 1FC2D 1JPTL 1UCTA 4Y5VC 1CS6A 3VXNB 5J89A 2R39A 2OL3A 1MFDL 4YX2H 4QRRE 5EC2B 2BVQB 3AVEA 2WBJC 1X4XA 2BVPA 5TE6L 5IF0A 5CZVL 1SMAA 3LHPH 1HHHB 2OK0H 1J9CT 3LSOA 3TV3H 4PJBB 1UKSA 3FFCB 3KDMB 4ODXB 3LEXA 4J23A 1CF8L 4CVZA 2BVOB 5FV1L 2MFNA 3VFRA 3HPJB 3QI9A 2GAZA 3O3DB 4M7ZB 2YUWA 5F21B 5TDPB 1CICA 2NLJB 4LKCA 4Y4KD 4QF1A 1OAXH 5EZOL 5IFHH 2PYFA 2YUXA 5GGUA 4MMXC 4PV8A 4OT1H 5E9DD 3ZL4L 3QIWB 3ILQD 1RZKL 5CWSA 4XVTL 4KHXH 1YNKH 4JRWA 1X5LA 4BJLA 2VLLA 3TBVA 2RHEA 2ITCA 3MZTA 5HI4D 3OJ2C 4HZLB 5ALCH 1U58A 3HG1D 3MBEC 4ELKB 1JWSA 1JNNH 5D71H 3RZCB 3MA7A 1BQHA 1K5NB 1E28A 5E2UL 2AGJH 4OIAA 3V6ZB 3VWKB 3P9MB 3EUUA 4G43A 3RVXC 1UM5H 5T3XE 5MERA 3UTSD 3K2MC 1CXLA 4ODUB 4H0GA 5DR5L 3IJHA 3IJYB 4JKWA 1TFHA 5J13B 3W9EB 1BBJB 4WCYH 4M6OH 5GRUL 5B3NA 3AGVA 2F8OA 1UA6H 5IVZA 5FK9A 5BRZE 2UY7A 4F80A 1S7UB 2ADGB 2VIRA 4YPGB 1OP9A 4K07A 2Y25A 4UU9A 3VDAA 1C16A 3TT3L 1DBAL 3PL6D 4D0BB 3IETB 1YEKH 3E6FA 5FKAB 5INDB 1TCRA 2GK2A 1IGMH 4LCYB 2R69L 1AQDB 4K7FB 1RZIB 4GRLD 4EOWL 1KJ3L 2YA1A 2CPCA 4IRJA 4XPAH 1FIEA 2N1KA 2FX9L 5EORL 5LXGL 3IDMA 1EFQA 2EYTA 4X6CB 3T09A 3RL2B 5AEAA 2GTWB 1XCTA 3IDGA 4FQXD 3PGDA 4LRNH 4EN3B 2GJZB 4Q9BA 4W6WB 2OYPA 5EIQA 2HG5A 4QRSA 2A83A 3BP6B 3T0BA 1E4WL 3GB7B 2HH0H 1BECA 3QIBC 4GMTH 1N6UA 4LHUB 2Q7YA 2Y36L 3QUYC 2JB5L 4H88H 2IANE 3VE0B 2J8HA 1MJ7L 2BC4B 2Y06L 5J1TC 1Q9LA 2Z8RA 5BV7B 3SOBH 2DBLH 1MFBH 4PJBF 4X6BB 5F9JA 2EXWC 5A3ID 5C07A 1ZLSL 4KKCC 1IGFH 3O45B 3V6FB 1KJ2H 4Y2DA 2APWA 1S8DB 1D7FA 2QADD 4DUVA 5IMOA 1AXSA 2YK1H 5JHDD 1A6ZA 2VH5L 3CCHA 1J88A 2VWEC 5MHSE 1CDYA 1F4WH 2VXQL 5GSRB 1EH9A 2ICEB 1UKTA 5C3TA 4KJYA 4Z7NE 3BPNC 4PJGA 4L8SC 3MROA 4NZRH 1EO8H 4MXQC 3MRGA 2J88H 2H41A 2MJWA 5C0JA 4HJJL 3TH2T 4Y4HA 3EW3B 3GNML 3NTCL 4PRPA 3IDYB 5E94B 3OR6B 3P2TA 4I4WA 3O3BA 1XT5A 4MQXD 2W0LA 3A67H 4P4KB 4JANB 4HK3N 4ORZC 1BWWA 3IU3B 2BJML 2XZAH 2CLVA 2VQUA 2Y5EA 5D1ZD 1PEZA 1Q1JL 4I3SH 1QHPA 2AAVA 4J3SA 4HAFA 4NM4H 3U0WH 4MGXA 3SDYH 1OGTA 4YK4B 1WFOA 1ES0A 3DX8A 2ZNWA 3S35H 3QUKB 2XG4A 4EXPX 3HNSL 3QWRA 2A74A 1FAKT 1UB5A 3QEHA 5KVGH 2CGRH 3U0PB 3S3JA 1LE9B 3DVNA 3T65B 2VYRE 1Y0LA 2C3WA 2PXYA 2X4NA 3MV8E 3BESR 2OTWA 1CVSC 1T66C 2VLKD 3SE4A 2FEEI 3QIWC 3KJ6L 4TSBH 1DLHB 5HGAB 1WBYA 1OOAA 1XGYL 2C4FU 4NN5C 3QUXD 3WO3B 3BT2H 1K4DA 1N5AA 2Q7NA 4F58L 1S7RB 3GBNL 4XWOC 1DDHB 4M62L 1I1FA 5EZIH 1FO0B 4DTGH 4FQLH 1MHCA 1QVOB 4DK3A 1MLBA 4YHZL 3BKYL 5IG7A 4WDIB 4X6CF 4OGXL 4FZ8H 1RULL 4MS8C 3O6KL 3RZCC 4Q58C 3P4NB 4ZXBD 3H3PL 3KNBB 1ZA6A 3SQOL 1T7WA 3GSQB 4BK4A 4DW2L 2C5DC 5JDSB 4RZCA 3CSYA 4NO3B 4X7TA 1FH5H 4UV4H 1KB5L 1NFDF 3G6DL 1T2QL 3JWOC 2EXYD 5EIIB 1XMWA 4UV7L 5KS9E 4I18B 4R7NA 3GMPB 3OXRA 5J13C 1OAUH 3F58H 1X3DA 5HHNA 4LBEA 1AI1H 5FA3A 5CKAA 3IF1B 3LMJL 3KPOB 2Z93B 4EEEA 1S7QB 3MRPA 3KLHD 4H8WL 5MEOA 4DFIA 2MKWA 3FTGB 3ZHDA 3OJDA 4MDIB 5SX5H 1MY5A 4POZD 5E08H 1JTOA 3BGMA 1YEJH 2ZZUT 5BCAA 4WENB 2CDGA 3MRDB 3BIKA 1JMZA 1BVKB 3MRLB 4ONGL 3FO2A 3SBWC 2A6KB 1RIVH 1Z9LA 5DEGA 1R5WB 4EN3C 3TA3D 3WUWA 5EO1A 1U8IA 3V52L 2FLRT 1TJIH 2XACC 2WINA 5C08A 4OZHA 1U8KB 2R1YA 3DYMA 3V0WH 3VFWA 2AJUH 4LAQH 4UIKH 1D6VL 4KV5F 4X7SL 4XWGH 3LPFA 1RK1A 1UXSB 1ZHLA 4C59B 4OLVH 5GXBB 4QRRD 4TVPD 1K3ZA 4E41B 3Q5TA 1SY6H 1NMAH 1DQDL 2KL6A 2ZUXA 2DD8L 3O41A 2QQLH 5AAMA 5JQ6L 3VXTA 1WT5C 3L3GB 3WNLA 4XRCA 1OP5K 1RUMH 4KHTH 1QSFE 5CP3H 4XAWH 3W2DL 1IT9L 5KVFL 4UT6L 1VKXA 3EO9H 5E24E 5D70H 5M95B 1FE8L 4HS3B 3ABZA 3K0WA 2VDOL 1RHHB 1O0VA 1YEIH 2BY3A 2BP3A 3VJ6B 1FCGA 2H9GB 2VSCA 3K4ZA 1A9BB 4TOYH 1E6JL 1L9NA 3NFNA 2G5BA 4XCYA 4LMQI 4QEGA 4WGVB 1UZ6E 2YD7A 5T3XL 3EYFA 2HJFA 2X05A 4OGZA 5ESAB 1HKFA 3PHQA 1WVZA 1D6EB 3PQYE 4RAUA 1OQOA 1U8NB 1KPUB 3ZHLA 5IHZA 4AL8L 4MNQA 4PJ5E 4Y16C 4WIQA 3MOQA 3OX8B 3AFLA 4YK4C 3G5ZB 2NTSP 4L4TE 4ZOBA 1MCIA 1RURL 2APVA 3GRWH 4M00A 4FXLA 5T3XD 3HN3A 4Y0GA 2IF7A 3OAYK 2VN7A 2XTLA 4JFDA 3HI5L 2D7TH 5DO2D 4QOKA 3TFKD 1RZ7H 4JVWA 3FN9A 4MAYD 4MYWB 4TUKL 5BRZD 5IVXE 3RWHA 1J1PH 3VXME 5I0ZA 3IDUA 1EEZB 1T83A 4Y7MA 4FTVB 5JR1H 1CFSA 2ZOLA 5GHWL 3QDGA 4PLOB 4WV1B 3O8XA 5DJDB 3R06B 4O2FA 3GSNH 1W72B 4LDOB 3RHWK 1ZANL 1HYSD 1E27A 5SV3A 1WWBX 4OV5B 5SWSA 3LQAH 5FOBA 2X6MA 1I8IA 3VI3F 1PBYA 1N2RB 3CFCH 4D3CL 3SGDI 1HH6B 1RIHH 5DMGD 5E4EB 4HWZA 4QRPA 4KJWD 1A6AB 5T1KD 2CK0H 3H9SB 5J1AA 4N1HB 3TZVA 3X3FL 4PREB 4Y5XB 3GI8H 3DUSA 1RIUL 1ZE3C 5DC9B 1T1WB 1AGCA 4I18C 1IRAY 2Z92A 4JY4A 3ARFA 4JFPA 2X70B 3VGBA 2IAND 4P3DB 4JQXC 5EG6C 5DWUL 3KXFB 4XMLL 2X4OB 4PPTA 3IFLH 4IOIA 4BKLB 2B0SL 4X9GA 1AJ7L 4KTEH 4L3CB 5DI8A 1ERNA 3G08A 3LN5A 4K9EC 5BJTA 5DVLA 1OAKH 3U7WH 1FVDA 2DF3A 3BVNA 4IHOA 4NJAH 4YGAB 3T3MF 5MHSD 4DVRH 1FG2A 1YMMB 1EV2E 5TQ0H 2OK0L 4LK4A 3W0WA 3TV3L 3VCLB 5F7NC 3EYVB 3Q3GB 1U3HA 1FZMB 3TM6A 1T7XA 1RUKH 3WHXA 3C5ZB 3LKQB 2EDKA 3QCUH 5FCUH 4QXTB 2V2WB 5D7IE 3UTTE 2VL4A 3N0PB 1WBZB 1AD0A 3PGCA 2EIZB 3QFJB 2HRPH 1WGOA 3ZDXF 1OAXL 1U8JB 5CUSH 4OFDA 5IFHL 3T4AA 3VXSB 1CICD 3HAEB 5F1NB 5AG9A 4IS6A 1KCRH 2GQHA 4LQ1A 5H37G 4OT1L 3O4LA 1JE6A 2BFVH 3SN6N 1IQDA 3KYNA 5HY9A 2AJ3B 1YNKL 2C3XA 4JPWH 1DEDA 4YUEH 1M6OA 3NPSB 3HI6H 5ALCL 5E2TL 4B50A 1N0XL 4ZSOE 3CK0H 3NVQA 1RQ5A 2JJWA 2JK5A 3HKFA 5D71L 1WBXA 1NMBH 4KJPD 4BQBA 2AGJL 2R2CA 3OXSA 1T20A 4Z8FH 1QSEB 5J11B 1UM5L 3SCMD 4YZFE 3LS4H 3MV8D 1MRFH 1T22A 1NAMA 5ICXA 3BKMH 2QQKL 5HVWA 2B8OT 2JCCA 1PAMA 4NNYB 1S7TA 4WCYL 4M6OL 4PGBB 4BUHA 3UPRB 4NQCA 4CU7A 5BQ7A 4HFWA 4R2GC 3RRQA 4RGNB 4Q74A 4BZ1H 4Z7VA 1IEHA 2ADIB 5IJKA 1G7JB 4MWFA 4QHNA 2ICWA 4J3VA 3ZKMD 3VFTA 4A6YH 4PJAB 1LK2A 4Y1AB 1IGML 1JWMB 5CGMA 3DGGB 4ZUUA 1EAPB 1ACYL 3QNXA 1HHGA 3PWUB 3FOLA 2JF1A 1FPTL 3X11A 4NNPL 4Z76A 5B39A 5SWZB 4C4KO 4XPAL 3OAZH 4OKDA 3MCKA 4IRJD 4XP1H 1JZ3A 3PWPA 3BJLA 1DUZB 4YR6A 1HILA 3MACH 3DXAA 4LRNL 1MUJB 4NZJA 3VXPA 4JFFA 5K9KB 2HH0L 1N3NA 4GMTL 1BJ1J 2LU4A 3QP3A 4FQQB 3IAGC 3MJGX 5DD1H 1I1AC 1IKNA 3MFGB 1QFWH 2XT1B 5LG1A 1KTDA 5DJYA 4P2RA 4YQXH 3SOBL 1MFBL 4NT6A 4AIZA 4ZDHA 2I9LB 5IBLD 2RJMA 1T6VN 2I24N 1IGFL 4ZTPH 3NFPB 1PD6A 2DMBA 4BFIB 1KJ2L 1JFQH 2F53D 4P99A 2YK1L 3F6LA 1A14H 1FVEA 1ZLVK 2MNUA 3SGJA 2CRMA 2OZ4A 1RI8A 4NWTH 1C08A 5DK3A 1D9KB 3GDBA 3H8NA 1H0DB 4KROB 4Y5XC 5F97E 5HYJB 4PJFE 4TTDC 3MV7D 3WS6A 3PHOA 3TBYB 1MVFA 1CD1A 4MD0B 2Q6WB 4GAFB 4MMZC 5JO5A 2NY3C 5DRZA 3WN5B 2HLAA 2JB6B 4NZRL 1EO8L 1BD2B 4GS7B 1T7YA 2J88L 3NIGF 3ULVF 1A9EA 2VO5A 2N7BA 5T33H 1ZGLA 3NCYP 2VE6B 2J8OA 3IDXH 1NJ9B 5E5MB 5J56B 4FFWC 2AABH 2H3NB 2XG5A 1JZ7A 2YZ1A 1AGBA 3IU4L 2YSSB 1QR4A 1CFQA 3A67L 3EJJX 1J8HA 2VLRE 3PF2A 2XZAL 5I1AB 3KGRA 5D2NA 3VFNB 4DN4L 4OI7A 1QSFD 4I3SL 4ZFZA 2D7PA 1S9YA 1M71A 2HN7B 4NM4L 4P23A 3U0WL 3NCEB 3SDYL 3BKJH 4O51B 1JGVH 4PJ7F 3B9KA 3C5ZC 2UWEB 3MNWB 1J0ZA 2X41A 2QQNH 4Y5YC 3IKCA 2CLZB 2A2QT 4ZYKB 5KVGL 1PGRB 2B7DT 2CGRL 1MCOH 5IB4B 4LF3B 5HYIA 2ZUVA 4Z78B 4G80B 5EBMB 3QFDB 1NCBH 1N64L 4QRTB 2I25N 1T5WB 2DQHH 3PQYD 4TSBL 3QQ3A 4GG8B 3BT2L 4GXUN 5IBUG 2UYLB 2AEWA 3SDXB 4PJ5D 4JRXE 1HEZA 1I3RA 1K8DB 2D03H 4IOSD 1UVQB 1N8ZB 3BQUB 5EZIL 2A0LD 4DTGL 3ULVC 3NPSC 4FQLL 3AREA 5HI3C 3TCLA 1NDGA 5IBTH 1PYWB 4L29B 2FJGB 4D8PB 4FZ8L 4A2LA 1M7DA 1AGEB 5DVOA 3ARGC 5F3HA 2DKSA 2BVPB 5ICZB 3S97C 5JW4N 1B2WH 2NY1D 5J11C 5KVEL 1XIWC 3D3VB 4W6XB 1U91B 3MRFA 3L9RB 1FH5L 4UV4L 2CR6A 1CTOA 3VXMD 5KW9L 4ZAKA 2DTML 5F1OB 1ND0A 4O2CA 1E4KC 3DARA 3F58L 2OTUB 3RJQB 1IQWH 5DVMA 1OHQA 5GRXG 3QA3B 3MRIA 2DKUA 3GHBH 1AI1L 3VW3H 1EHNA 1LEKA 4RGNC 5C09E 3TBWB 3QUMA 4GBXB 2YPKB 4HIIA 3ZMRA 3C5JB 1G7LA 4XCFH 3ARDB 5KG9B 3TBVB 4X99B 4NN6B 1I75A 4BFEA 3CD4A 1LDSA 5HD8C 3CU7A 4I48A 4GO6B 5E08L 5E2VH 5IJVA 3Q6GH 4S0TD 2IH1A 3VI4E 4R7DB 4JREB 2UUDK 1XGUA 3UBXA 1TQBC 3BEWA 2C7UA 1RIVL 1D5ZA 3TBTA 1EGJH 4PJHA 2BK8A 3L3JB 3Q6FB 4Z7OE 1DQJB 4BSVA 1P1ZB 4LSUH 1TJIL 4V1DB 4HIHA 2IAMC 5TPWH 3V0WL 2AJUL 1H8NA 4LAQL 4PJ8D 3U48A 3P0VH 3RWFB 4K94C 3RU8H 1KT2B 1F4YH 1KCVL 1FFOB 5I16B 2BDNH 2LAAA 4OLVL 4MSWB 5FUOH 3GIVA 3MRHA 1SY6L 3S7GA 4QT5B 2VIRB 1NMAL 2FNBA 2E7HA 5J8OA 4N0FA 5EU3A 3STBA 2UWEF 5ESVB 1NGXB 1VGKB 4P57B 4JM4H 4RBPK 5SWQB 4OIIH 3VD9A 2QQLL 4X6DE 3TO4A 3SDCA 4EVNB 5CEZH 3T8XB 1MCEA 2P5EA 4RGMB 1D9KC 2ZUSA 4KROC 1RUML 1U8LA 3NA9H 1DJSA 2Z31B 3VDCA 5CIPA 4XAWL 2VLJA 3NACH 4RISH 3EO0A 1ZV5A 3EO9L 5D70L 4HEPG 3BMWA 2P45B 4HLZG 5LGJB 4NRXB 3MNZA 3ARBC 1Z3GH 4L9LB 3WN5C 3L5WA 1YEIL 3WL9B 4GS7C 4JCLA 4F9PC 4QXWA 5J6GA 3GI9H 4TOYL 3BP4A 3P4OA 3ME0A 1QBBA 5F3BB 5FHAH 2BY1A 3DWTA 3ZDZF 3O11B 1W8NA 5J9PA 1DUYB 2LU7A 5DJAB 2VOTA 1T1YB 5FDWA 3U0TA 1KCKA 3V0AC 2E27H 2ZSWA 2HT3D 4NSKA 4GKOA 5CEYA 3GRWL 2HKHH 4HIEB 2HTLD 4ONHA 3I6LE 1NAKH 2FH8A 5HGDB 2ZOKB 2NCMA 2F15A 2VITA 5JMOC 5EOQH 4WI8A 4KJYB 5ACZB 4XI5C 1Q0YH 1TQCB 1UKQA 2X10A 5JR1L 1C7SA 1DVFD 1IBGH 4LCIH 4Y19E 4JFEA 2LAGB 5MI0C 5DMIH 3U4EB 3BQUC 3GSNL 3O8XD 1EHLH 1N7MH 1UXWB 4I13B 4S1QH 1T7ZA 1Z9SA 3P73B 4NGHH 1ZWIA 3TH4T 4ONOA 3LQAL 3S98A 4EDWH 4U1LA 3CFCL 5K9JH 2WMPA 5BXFA 3RVWD 1G6RA 2EYRA 3OKLA 4DOHB 2FR4B 1NCAH 2YD3A 1IEAA 1QBMH 1GXEA 1FZKB 3QO1B 4RDQF 2HMID 1H8SA 3NBNA 1G0XA 4ZOEA 5MEQB 3GI8L 5GS0D 2K7PA 3F7YA 4LGSB 1J0IA 2GW5A 3QYCA 4GSDH 4HDIA 5TDNA 4UTBH 1UWXK 2X4PB 1XF5B 3SKJH 3G6JE 5HVHB 4U6YA 3V7AE 3ARFD 5I1IH 4FQIH 2NY0D 1GOGA 1KPRB 3FQWA 4GBXC 3IFLL 2LTQC 4WGWB 1GVIA 3KAAA 5ID0A 3N50A 4WI9A 5EDXA 3ARDC 5FAAA 3KWWB 3K74B 1OAKL 5CINH 3U7WL 4FQHB 4YBLB 4NN6C 1AGDA 4NJAL 2APFA 5DS8B 1JHKL 1P4IH 3HMXH 3T0EB 4DVRL 1MLBB 4R0LA 3MYJB 2BRQA 4BZYA 1J11A 4HUXA 5JXEA 5I76A 4JREC 5HVGB 2WM0A 4L4VE 3MO1B 3EZ8A 5IMMB 2YMXH 1RUKL 4PJ9A 1H3TA 2PW1B 3QCUL 4UZGA 1FV1A 2ZWLT 4UT7L 5FCUL 2VWEE 1S7WB 4CMMA 2APTA 2J8UA 1OGAB 3U46A 4POUB 2HRPL 1A7BA 1RJCA 4NJ9H 4G3YH 1CXEA 4K23H 5CUSL 5DC4B 3U79A 4I77H 4XCEB 1S9XA 5CEXA 1KCRL 3G5XA 2O93L 5FM5M 3ARQA 4HUNB 1T3FA 3RWDB 3RWGB 1D5BB 2BFVL 2H6PA 3U2SA 3W81A 5FA3B 4JPWL 3QIUA 3SKUD 3I3DA 4YUEL 2YA0A 5T1MA 3HI6L 4LVHC 4BQ8A 1NC2A 1JPST 1EZVX 4RGMC 3PXHA 5MEOB 3CK0L 4TVSa 4K3EH 5DJZA 1C1EH 3GGWB 3FRPG 4FXKB 3UTZB 4NRZA 1E0OB 2B4CC 1TVBB 5DHYA 4XXCC 1IAKB 4YWGH 1AXTH 4Z8FL 1ZT7A 2VZSA 2OLDA 4L9LC 3LS4L 1MRFL 2E7LA 3EOYG 5J6HA 3P0GB 4LPVA 1ZTXH 4OCWL 3BKML 1G7HA 2K7QA 4R8WL 1RJYA 2FEDC 4JPIB 1I8MA 2A6DA 1B6UA 2P43B 4LVNC 1R3IH 3RWJB 3O6FB 3CFKA 4BZ1L 3VFPA 4H5SA 1FYTA 1FLTX 1UENA 3ARPA 3S5LA 3LKSA 1DQQB 4A6YL 2XTJB 1CE6A 2YBRB 3P4MA 2Q86A 3S35X 4O58L 4LLMB 4RIRA 5C92A 1QZ1A 2R0ZH 4PY8J 4WFFD 4Q97A 2YRZA 5KSBB 1JGUH 4KRPD 4N0UA 4GH7B 3IDNA 1KPVB 4X98A 3WJLA 4FHBD 5C2BL 2EEAA 3MV9D 4IM8A 1QR1B 2DRUA 5ISZB 1U8PB 5IMKB 3MRMA 1QBAA 5JORB 2IQAA 4R4ND 3BP5B 3OWEA 3MACL 4HWUA 5BS0B 2B2XH 1UC6A 1FYHB 4JJHA 4YHLH 2Y1VA 3MQIA 5C09D 2PR4L 1IGTA 4YFLI 5HHVH 1MCRA 4ODVH 5I0DA 4KK9D 5DD1L 4Y4FB 5ID1B 4J7RA 1K4CA 1QFWL 4P5MB 4YQXL 2PYEE 5IM7B 3ECBB 3FZUC 4ZTPL 3RY6A 3X13A 5DD6A 2P7TB 1WK0A 4U3HA 2K3TA 4MNQB 1X5JA 1I9IH 1A14L 5C0CA 1GGYA 3MGOA 2C4FT 4NWTL 4MJIB 1MVUA 4KK8C 3LRHA 4UQ2B 3DIFA 2C1PA 4K7PY 2NTFA 1KXVC 3H7LA 1R3KB 4N8PA 4XTRC 1B0GA 4UTAH 4KUZH 1OPGH 4M4PA 2D7MA 4I5BA 3QNZB 4F8QA 4ZNCD 3FO1A 2MWCA 4NQDA 4CADB 3QH3B 3H9HB 2GCYB 1ZSDA 4JO4H 4KDTA 5JXAH 3F7PC 3IFNH 5DK0A 3MNVA 1CLCA 3MLVH 5CP7B 3GIZH 3GMLA 2P49B 4PJCA 3BN9D 5KS9A 5T33L 4MA3B 4IRSC 1NGWA 3IDXL 4JRYA 3D2UB 1CL7I 1KJMB 1FAIH 1U8QA 2AABL 4I2XB 2FGWH 4HK0A 5I17A 4M7JH 4YBLC 4UNUA 1RZJC 4N1CA 2BNQE 3KPRA 4L3EB 3T0EC 1LEGB 3MPCA 1OW0C 4IMLB 1K3IA 5EZJB 5C0AA 12E8L 3T3PF 2VZOA 3BYTA 4M02A 2M2DA 4Q2ZB 4OGAC 1QO3B 5DHVA 3BKJL 3OAUH 3T2NH 4LDLB 3MUGA 5AYUH 1J10A 2QQNL 3MREB 1YC8A 4TSCH 4G9DB 1FGVH 2V9TA 3T0WA 5DGQA 3RJDA 1F02I 5DTFA 2FBJH 3DUUA 4JLRA 1NCBL 5GS2H 4M6MH 2X1OA 2DQHL 5H2BA 1MI5E 2DJUA 5GGSA 2HFEB 4X6EA 2J7LA 2ATKB 2DL9A 3BPLB 2XN9D 5KSBF 2D03L 1ED3B 2PTVA 4TNWF 2RGSA 2AERT 1QG3A 3CVIH 5I66B 5DMKA 4ZFOB 4KH2A 3EDDA 5IBTL 3EOAB 5KSAD 2IPTH 1YYLH 5JOFA 5BJTB 4H1LG 1P5UA 3MBED 1JPSH 4JZOB 4RMTA 3I6LD 3UPCA 4L8CA 1XGTA 32C2A 3CDYA 3CC5A 2R4SH 3S9DB 4G8EA 1YNTA 1B2WL 1M7IA 3EYUH 5EU4A 4PY7A 3CPLB 3MRQA 4NYLB 4M1CC 4ELMB 2P8MA 3VFOA 5I1KH 3L7FA 3WNMA 1OSZA 4OD2A 1IL1A 3PABA 4YJZL 4RX4A 4Y19D 2VAAB 4HUVB 1EK3A 5EUOE 2AK1H 1IQWL 3S8WA 4PJXA 4S0SD 4G9FA 2DQFB 4F33A 1V3JA 4ENED 4EI5B 4NQEB 3BXNB 1D5XB 3O6FC 2J5LB 4J6RL 3HE6A 1DL7H 4HJ0C 3FCTA 4F7EB 2XTJC 3ES6B 1PG7W 3WNOA 4MCYB 5EBLA 2R1XB 3E1F1 2HAZA 2GITA 5T3ZD 5D1QA 2OI9C 3V0VB 3OMZA 4AM0A 4GG6B 3EJYD 3EO1B 3KR3H 1F13A 5E2VL 1B0RA 3CH1B 4X6FA 5DZNA 3NABH 3C9NB 3DROA 3K1KC 3B43A 4K7PH 4X5WB 4L4TA 2OQJB 4MJ2A 1RV6X 3HC3H 1EGJL 1NGPH 3ARRA 4RRPG 4LSUL 4FFVC 4QNPF 4U33A 43C9B 4MCZA 2CH8A 1JN6A 3CIQA 5HI5C 1A8JH 2CLRA 2YPVH 3P0VL 4N0YH 3HUJE 5HYSB 5JIIA 1NUNB 4LPXA 3ALWA 3RU8L 1FL3B 4Y4FC 1F4YL 5E8PA 2BDNL 4P3CH 5EBWA 3SE3C 3GSWB 4R97C 4PJDA 2D9QB 4LLQA 4Y2OA 4Y4KB 3GMMB 4FG6C 4MWFB 4BSJA 1S5HA 4RDQG 4JM4L 4J4PC 4L4VD 4OIIL 4DWHA 4I8DA 5E9DB 4P2OD 4ZUUB 4X80H 2W60B 1WISA 4RISL 3NACL 1R0AH 4PRBB 1PY9A 3NMEA 3OGCB 4I0PD 5K59F 1C12B 5TGBA 3K1DA 4RAHA 3DYOA 2YC1A 3V4VH 2NZ9C 3V6BR 3HG1B 1H3VA 2Y9RT 1Z3GL 1JV5B 4YLQT 2YD5A 1T0MA 1P2CB 3P11H 5EOCH 2XFXA 3DXAB 2FL5A 3GI9L 4RA3A 1HXYB 3UTPE 3WIHA 4WUKH 4ODTH 2BSSA 4WWKA 4ODWB 3UJIH 5FHAL 2V2XB 5LJYH 5J12C 3L6FA 2XKUA 4YIQA 3DURA 4Q6IC 3UTSB 3ORJA 1A5FH 5DRXA 3KPTA 3ARYA 4P2QE 1ZK9A 3ROOB 5C70A 5K9OB 4F2MA 4ELMF 3V5DB 1S7VB 1L0YA 3IFOB 3P40A 5AZEH 2E27L 5DJ6A 3OR7B 3KLSA 1NAKL 2OJEB 3PL6B 3V5HB 1YEDB 4YAQA 1TVHB 2RCSL 4C56E 4OZIA 4KUCF 5EOQL 1TVDA 5HDBE 4PRIA 4R26H 4GRLB 3X14B 3BZ4B 3UTTA 3WO4B 4HC1A 1Q0YL 3HE7D 5DRZB 3SKMA 4U1HA 4G6AD 2HJLB 4RMRA 5FOJA 5EU6E 3HNVH 5FO8A 2H26A 3LKNA 5DEFB 4D2NA 4GG6F 2FO1A 1YJDH 4MHHG 3SY0A 5LGKA 5DMIL 1BGXH 2EECA 3NIDF 1PKQB 2IALB 4FQXB 3RPIA 1N7ML 1EHLL 4BFBD 1BLNB 4S1QL 1TJGH 5TE4L 1FZJA 4EDWL 5ANMA 3H9ZA 5ETUA 5L8LB 5CP3A 4CDHA 5K9JL 5D2NB 3ZE0E 2JIXA 4MS8D 1F6LL 3REWA 1ZT4B 3WUZA 1NCAL 1QBML 1Z0NA 5E6IA 5I8EB 1HXMA 3SGDH 3JTTB 3TLRA 1T1XA 4FZEH 1G7MA 2JCCF 3D87B 5KSVB 2A73A 2ARJB 5L88H 5HYQB 2QADB 4UTBL 5JHDB 4QHKJ 1FNHA 3SKJL 1WAAF 1BQLH 2XZQH 5LGHH 2R1WA 3T0XA 1EXUA 2W0KA 4EI5C 4U6XA 5I1IL 1R3LB 1I7ZA 2EIBA 2DIJA 4FQIL 5DA4A 5C7XH 2J5LC 5IK3A 2PYED 1I4FA 3CDGB 2PTTB 4PUBH 5CINL 1FFPB 4KZDH 1JF1B 3ULSB 1ZT1B 3LRGA 4WNQA 3ARSA 5T1LD 3W82A 4JO3H 3HMXL 1P4IL 3O2DL 2DICA 4NHUA 2P8PB 4XHQA 4HG4J 4K94H 1Q9WA 1TNNA 1HNGA 2VKWA 1WFTA 2VTFA 5GRZA 4DEPB 4EUPB 4LLUA 5SX4I 4U1SB 2ICWJ 2Q3AA 3FB7A 5DD5L 3VRJB 2YMXL 4XHJD 4KTDH 4ODHH 2E7CA 3OB8A 5DSCA 3C6LA 5FUZH 4XMKH 3N1GC 5D1ZB 2AEQH 1I3GH 4N8VB 4ZUSA 5D7LE 3MR9A 3P9LA 4OFYD 4XX1G 4NJ9L 4G3YL 1J8KA 4K23L 2ADJA 2XKNA 3TH3T 3GUTB 4JY5H 1VACA 3GSNA 3D39E 1CDBA 3BW9B 2BNQD 1MQ8A 5DQJA 1XF4A 4YHOH 3EDKA 3TIDB 5F9OL 1X7QB 3WE6A 5D9SA 1AD9A 3D0LB 3JV4B 3S96B 1VFMA 4Y4KC 3MGTA 5I2IB 2HVKA 5F7EL 3RTQA 4W68A 4X0KA 2IADB 3VFVB 1XZ0B 2VLKB 1N59B 2CIKA 4HKXA 5I1GH 3ILQC 4HH9B 1NC2D 3GMRA 3QUXB 1ADQA 5TF0A 1C1EL 3QWQB 4WEBH 1X5XA 3D69A 5HI4C 1AXTL 1IM9A 1U36A 1HHKB 2VDKL 3VD4A 3DV4B 4MD5A 1XGPA 4MJ6B 1JRHI 3KLAB 3QJHB 4J3UA 4LLWA 1V3MA 1ZTXL 2V5SA 2FRGP 1MI5D 1S9WB 4RQQA 4PGJA 1G9MH 2C1OB 4NZTH 2FO4B 1NCCL 1BZQK 4LMQE 3O3UN 2V5YA 4I3RH 3TIEB 3NN8A 1L6XA 4ZXBB 3BKCL 1E6OH 3QWOA 5D7KD 4JZJC 4Z0XB 5B3JE 3WFBH 1R3IL 2SEBA 3X3GL 4XNUH 4NZUH 1BVLB 1KLGB 1NFKA 1DSFH 1FYTD 4PGDB 1S7SA 5B4MC 5BVJB 3CXHJ 5JUEL 2R0ZL 3RX8A 3D9AH 4J1UB 4JB9H 1AR1D 5DZOA 1VENA 4NCC1 4XPFH 3MJ7B 2FZ3B 4OUOA 1FFNA 2Z9TA 1KB5B 5CBEA 2X1QA 2VXUL 3TN0D 4MD4B 3KYOA 2MPAH 2ZKHH 5GJTH 1ORSA 4JDVA 2YKLL 2IH3B 1B9ZA 4XBPB 4GRLC 2O26U 2EO9A 1Q72H 3WO4C 3ZSTA 2XICA 3CFEA 2B2XL 4IIQA 3QDJA 5J6GB 3OPZH 4P46C 5HHVL 1JHLH 4ODVL 4EXKA 1EEYB 1KIPA 4E0RB 4DQOH 4FQXC 2BSRB 1B0WA 5D2LB 3RP1A 3TA3B 3C5SA 3SGEI 4CVUA 5IWLA 3I02B 3GSVB 1WZLA 4YBHA 3MYZA 2H32B 4W4NA 4PJAE 2R2EA 3MJ8A 4LVOC 3BZEA 4JR9H 3BEVB 4MQ7B 5TFSH 4J3WA 2FX7H 1M1SA 1AP2B 2ATPA 4QRRB 2VZTA 4KDWA 5F1IA 1QRNA 5IKCB 1T89A 1SYVB 3RWCB 4EDXA 4UTAL 4KUZL 1OPGL 5DURD 2CXGA 2W59A 3RDTC 2ZCKH 4AEFA 5GS3A 4M8QB 4WO4B 3MX0A 1KYOJ 3H0TA 4JO4L 1HSAA 3IFNL 3NZ8B 3MLVL 3GIZL 1T03H 2DYPA 1SJHA 5KAQG 5GRYA 2AEIT 5C6TH 2VL5A 4H0HB 1KOAA 1FAIL 1PX4A 4LPUA 4YHYB 1BFOA 2FGWL 4G8GA 4GW5B 3DO7A 4M7JL 1ZS8B 5EFIA 5JMRA 1T5XA 5GGVY 2M26A 4OF8A 2NNAA 5B38A 1EA9C 1WEJH 4W4OC 4PYGA 3IRZA 4GW4B 2PETA 4OTXH 1KJVA 3LQZB 4DEPC 1P7QB 2V5RA 3IDIA 3BP7A 3OAUL 4WTZA 4XCNA 3SDAD 3T2NL 4MQXC 3ULUH 4M7KH 2Y23A 1U95A 3KPPB 1I9RH 2VZVA 4JN1H 3ZKSD 4TSCL 4BQ6A 3WS3A 4WW1A 1FGVL 5D1ZC 3OHXA 3UTPD 4J3XA 2XPGA 4ZUTB 2FBJL 3I2CH 4LASH 3BAEH 3BGFB 2F19H 4M6ML 4PFEA 1SJVA 1ODAA 2EDXA 2QSQA 1X5KA 1EERB 3C09B 1LO5A 3I6KB 4OFIA 2B4CH 4P2QD 1LD9B 1BZ7B 4Q9QH 3CDCA 5CBAA 2FEEL 4BSWA 4MAYB 2NY7H 5BRZB 3KYMA 3RKDD 4WTXA 1YYLL 5EA0H 1VFOA 1EHAA 4ZPVB 4JGUA 3PGFH 3U1SL 1JPSL 2FJHA 1EO5A 5GS2D 4ERSH 5HHPA 3VXUA 1EEUA 1P4BH 2R4SL 3DBXA 3QXAB 4Y5VA 4C56D 3EYUL 4NUGH 4NZDA 3QEQA 1X6NA 4JFXB 4D0DA 5GS1B 5D8JH 2O61B 7FABH 2WBJA 4U6TA 4NDMB 4PJ9B 2WIIA 1CDCA 4PJEA 3SJVA 5EU6D 5D2LF 4WY7H 1KG0B 2AK1L 4LCCB 2MQ0A 1FORH 4XAKD 3Q5OA 4M3JA 1T1ZA 1NBYA 2VDPL 1IGJA 4G9FD 4U6VH 3FONA 1DL7L 5E00A 1A64A 5AUMA 2GSIA 2EXYC 4JFQA 4CW1A 2R56H 3QDME 1QLEL 2R2BA 4YHKL 2WANA 3KPSE 1KIQB 3SDXE 1B90A 3LKRB 1JYNA 5IEKA 4JQIH 2IANB 5JIPA 1F42A 3LV3B 5D1QD 4N5UA 5L8KB 4HJGB 1BEYH 3KR3L 4PG2A 5LCVH 1URLA 4U0RB 1GPOH 4H25B 2EE2A 4OI9A 3NABL 4NKOB 3O2VL 3KLHC 4K7PL 5C0BE 2ZCLH 5DK2A 4F7MB 2I07A 3P77B 2XQBH 3AY4A 4DVBA 1NGPL 2G2RB 4POZC 5E8EA 1LO2H 4PIRF 3TYGH 2ESVA 2F54E 2ZUQB 1YC7A 3PIQA 2VC2L 2YPVL 4HWEL 5MENA 3O3AA 3MLXL 5CSZB 4N0YL 1H3GA 2GUOB 1MRCH 2AW2A 1A3QA 5HSFA 4M61B 4P3CL 5EIVA 4H8WC 3RWIA 3MJ6A 1CXIA 4WHCA 5E6YA 4DGIL 2GJ6E 3RIFF 1QLFA 1Q9KA 4WRLA 1AQKH 5GGVH 1A6TB 2PW2A 3TNMB 1OCWH 4MHHI 2R4RH 1ITBB 4QHLB 3S4SA 3P4MB 4HGWA 3B8SA 5A2JH 1ZVSB 4H20H 4X80L 4OCSH 4KI5E 4CJ1A 4XVJL 1ETZB 3IT8D 1R0AL 3DECA 3BWUC 1MCBA 3KPMB 2X4RA 4NO5A 3V4VL 8CGTA 4PY8I 4OFVA 3OAYH 4GRWB 5FO7B 1VFBB 4HMEA 3L7EB 3SDDC 3LD8C 1U93B 3D39D 3P11L 5EOCL 2X44D 2NX5A 3Q48A 4WUKL 4ODTL 2BOBB 4DKEL 5B39G 3UJIL 1IMHC 1KLUB 3G6JA 2MMXA 3L3OB 5D7JD 5IHUH 3SCMB 3EYQD 1RZFH 1NCDH 3MV8B 2DQCH 2UVFA 1A5FL 3HZKB 2DQDL 3ULUE 2QLVB 2Y5TA 4DKFH 1NCWL 3UMTA 3QIBA 2EDQA 4PRAB 3FB5A 1LE5A 3OSKA 3QUYA 5AZEL 1DBMH 3E2HB 3ZKXB 3ZE2E 1YEFL 2Y6SD 3HZMA 4M48H 5D6DA 4CUCA 4G42A 3GMOA 2VERN 4N0RA 2AXFB 2EDFA 2GT9B 2MOVA 3QG6A 5GISH 4OQTH 3TBSB 3VGEA 1X5FA 3T0DA 3EOTH 4GT7A 2UY6A 3BGFC 4R26L 3U4AA 3V4PH 1T4KB 2AP2A 1X5GA 4J2XA 1NUGA 5DO2C 1RJLA 2G75A 2W0FB 5KS9B 3TFKC 1YJDL 2EICA 3QAZC 4K8RL 3SGKC 4MAYC 1BGXL 5KSUB 5DD3H 5EN2B 3B2VH 1MRDH 1U8QB 2B5IB 4GW1B 4Y89A 4UMGA 1U2CA 1WJ3A 1HHJB 4NPYB 4UT9H 2CKBA 3VXQA 3VXRA 1Q94B 3IXAB 4GKZB 3MUY1 3CFJA 1DLFH 2NY4B 1GJIA 3ARGD 4LHJB 3VXNA 4LCWE 5EC2A 1EBPA 2BVQA 3VGHA 1HYSC 4K8RD 5E6ID 4FZEL 1LO0H 1RJZA 4LIQH 4P59L 4Z7NF 1HHHA 4RMQA 5DMGC 2F53B 5L88L 4PJBA 4KJWC 3FFCA 4MDJB 4V2CB 3KDMA 1BQLL 3MSPA 5DTFB 2XZQL 4OF0A 4JGMA 5LGHL 3MV01 4JO1L 4ODXA 1MEXH 1MCNA 5C7XL 2BVOA 2AKRB 4OQ1A 1F8TH 2R29H 3HPJA 3O3DA 5TDPA 4UI2A 2NLJA 3MV7B 4OI8A 5C0IB 1G84A 5E5UB 4LCUB 4W70A 5FIEA 1DBJH 3QSKB 4KZDL 1KJ2B 4FFYH 4EBQH 3QIWA 4JO3L 1CN4A 4HWBH 1IJ9A 4WI7A 4OGYH 2A6IB 1AKJD 4K94L 2V2TB 3CVHH 4HZLA 4NO0A 4KTDL 4L8DB 4ELKA 2BZDA 5D5ME 4ZNEA 1ZHNB 1K9TA 3C6SB 3Q0HA 5FUZL 3RZCA 3NPZB 1QSFB 4PTUB 1I3GL 1K5NA 4UUJB 5IW6B 2JJSA 1I7UB 2IAMD 3V6ZA 3P9MA 4KAQL 4WJ5B 4JY5L 4EZMA 1A4KB 2FD6H 3T2PA 4PJIE 4YHOL 3P9WB 2PO6D 4ODUA 5HHOD 2V6HA 5F93C 1VGEL 1HOCB 3W9DB 3IJYA 4PRHE 5DJCA 4NFBA 1PEWA 5FHBH 3W9EA 1BBJA 3KHQA 4WUUE 1CICC 2IJ0C 1INQB 4GAYB 2ADGA 1NH6A 4YPGA 1U8OB 5KVDH 2YWZA 3PQYB 4XB8A 5I1GL 2WAHA 5A40E 5DQDH 4DKDC 3JV5A 3BPOB 5E03A 4D0BA 4PJ5B 3IETA 3T0EE 5FKAA 5INDA 4WEBL 4LCYA 3HCVB 1IAMA 1AQDA 4K7FA 2Y7QB 1RZIA 4L4TB 4NKIH 5KS9F 1BF2A 2YHGA 3QEGH 3ARBD 1MAKA 3MJ9H 4AEIH 1G9ML 2ERJB 4KJPC 3CXDH 5K93A 5FGSA 2AJSH 3RBGA 4MCZB 3SBWA 1JN6B 4X6CA 3TEUA 1AO7E 2K1MA 2VDMH 4MA7H 3RL2A 2GTWA 3WFBL 4EN3A 1NCNA 2GJZA 1GZQB 3UBXG 1OTSD 1EHXA 5IVXB 3SKNB 1TXKA 3VXMB 4XNUL 4JM2D 3BP6A 1CWVA 3GB7A 3PDGA 3QXWA 5HBBA 4LNRB 5TF1H 3GK8L 1DSFL 4LHUA 3SE8H 4PR5B 3WIFB 4LLQB 5LVEA 3VE0A 5ABDE 3E2HC 2NW3B 5GGRB 2BC4A 3D9AL 4FQJH 1UH4A 4X6BA 5C0ND 1VB9A 3O45A 1UWEH 2NY2D 4XPFL 3V6FA 3IRPX 3ZKMC 1ZLVH 2D7OA 1F4HA 1S8DA 1NBVH 1ZLWH 2QTEA 1FSKC 3MTRA 4WHDA 5GJTL 2R0LH 1Q72L 3C8KB 1NBZB 4NQXB 4ODBD 3V4UH 3ZYZA 3G9AB 4XI5D 5GSRA 2DQIL 2ICEA 3QDMD 4IJ3C 3OPZL 4IRJC 4LKXB 4HIJB 4X83A 1JHLL 3QDJD 3VWJD 1QNZH 3RGVD 4WWKB 5HPMB 4DQOL 1F00I 5D7SH 4OF5A 1R6VA 35C8H 4OCYH 1BIIB 1EIBA 4MXWH 1P4LB 4MX7B 3IVKB 3LPGA 3O4OC 4PJ8B 1V8HA 4LIQE 5E94A 1Y6KR 5C0BD 3OR6A 3CU1A 4JR9L 1UZ8B 2FX7L 5FGCE 4P4KA 4JANA 1IC7L 3PWLB 4RA0C 5IUSA 1D5IH 3IU3A 4HMCA 3QXVA 5IBLC 4HUWB 4QTHB 3M1BB 2F54D 4CN1A 2NY6D 3EOBB 1ZA3B 5CLWA 3QUKA 3NCMA 1UZ6F 1BFVH 1T03L 4RMWA 1RHFA 5D7IB 3UTTB 1CXKA 5EU7C 4U1IB 3U0PA 2GJ6D 1LE9A 3RX7A 1XF2B 5ALBH 4ZO9A 2ARWA 3T65A 2QEJA 3NCYS 1RFDH 3MA9H 5GGTH 1DLHA 5HGAA 4OZGE 1CL7H 4K7PX 3ZTJH 4KI5D 1GSMA 4FN0A 1S7RA 1WEJL 4PRDB 3AROA 1DDHA 2BNRE 4NQUA 4OTXL 4M7LL 2G9HA 25C8H 4ZOAA 1FO0A 3QBTB 1QVOA 3LY6A 3ULUL 5JW4R 4M7KL 4DAGL 1I9RL 4JN1L 4WDIA 4ZSOB 1MFDH 1HXMB 1OAZH 5A2KH 5IVXF 3P4NA 3I2CL 4LASL 3QQNA 3KNBA 2F19L 3GSQA 3QDAA 3OKMB 1U3YA 5JDSA 1G7IB 4NO3A 1YQVH 1YYMH 2B4CL 3ULUD 4ZUWB 5EIIA 4I18A 4EIGB 3GMPA 4YDVB 2D31B 5HGGS 1JYXA 4QHKI 2NY7L 5C2UB 4Z5RB 3IF1A 2QJDA 1DVFB 3SE4C 4O5LH 3ZL4H 4ERSL 2QQQA 3KPOA 2Z93A 1S7QA 3P4LA 3S3SA 3ZYJA 1INDL 4YHPB 4S1RH 2A0LC 1T0NB 3QUZD 4NUGL 4W81A 1N4XH 5D8JL 1MCFA 3FTGA 4LDEB 5CJXC 4MDIA 3QEQD 7FABL 3UYPA 5INCB 3ALXA 4M4RA 1YPZE 3MRDA 3W5MA 4WY7L 4D9QE 2IC2A 1A1NB 1BVKA 3MRLA 4KK6C 2NY1C 1FORL 3LOWA 2A6KA 3GZKA 2ZG1A 2F5BH 3MRCB 2ICWI 1R5WA 4U6VL 1G7QA 3QQ4B 2R56L 1U8KA 4BQCA 2N4IA 3FAXA 1I3UA 4JQIL 1UXSA 3DMMD 1CGXA 3DUHA 4LCWD 1UADC 1OP3K 4E41A 2NY0B 1BEYL 1YZZA 3EDJA 4L3AA 1QQDB 4GXVH 5D93C 5LCVL 1GPOL 2BMKB 5H35B 4YEEA 1P69B 2FHCA 1UQSB 4RBPH 3AC0A 2IBBA 1JNLH 4ZD3H 2ZCLL 1YUHB 3I3BA 4WI3A 5D7IF 4XNYL 1V7MH 2R69H 1EUUA 5ITFB 4JEGB 1IM9B 1SVCP 3BO8B 3FFDB 3L3GA 1LO2L 3TYGL 6CGTA 1KJ3H 3FMGL 4PJFB 4HS3A 2ESVD 5CJ5A 3UX9B 1MJ8L 2DQTH 4ZO7A 1MRCL 1RHHA 3VJ6A 2GEEA 2H9GA 4D9LH 1A9BA 2BRRH 3K2UH 4FXGB 2QV2A 4LSVL 1AQKL 3DI2B 5GGVL 1E4WH 4PJ8C 3FQTB 3H7BB 1OCWL 1T04B 2WV3A 1FN4B 5ESAA 3RX5A 2Y36H 1D6EA 4OCSL 1MJ7H 4KK8D 2APXA 1KPUA 2VLRB 4PP2B 5DJXB 2IG2H 4YZFF 4UAOC 4GRMB 4CMHB 2PN5A 1BP3B 3OX8A 4G8IB 4NOFA 3S5LG 3EJZD 3G5ZA 1K2DB 2ZG3A 2AEPH 1OTUD 2X9XA 2Z4QB 4S1SH 1U8MB 3D6GA 2UVEA 2AXGB 1WWWX 4PRHD 2A77H 1LQSR 1QTYT 1RZFL 4KGJA 3JWDL 1NCDL 2DQCL 4TRPL 3V2AR 1T0PB 4F7CB 1EEZA 2VZUA 4FTVA 1IFHL 4DKFL 1U41A 3BHBB 4WV1A 3WFDH 4JRXB 5DJ0B 1FZOB 3R06A 1IILE 1EAJA 1DBML 4U1JB 1MCWM 4M48L 1W72A 3NTCH 1NGYB 1HIMH 4OGAD 5DQ9B 1BJ1H 5LAXB 4OV5A 5IQ9B 3O6LH 1R5VB 1F6AB 1N2RA 2QHRH 1AXIB 5GISL 4OQTL 1HH6A 3EOTL 3AXLB 2R0WH 5EUKB 1A6AA 2OTPA 4HV8B 3H9SA 3EFFB 3HA0A 3MCG1 1AO7D 2HT3C 3L3HB 1CFNB 4KRPB 2HTLC 3BPCB 3HZVB 4PREA 4Y5XA 3V4PL 3H2WA 1T1WA 1UWXH 2VDLH 3JTSB 3T04D 1EVUA 4YHMH 4X4ME 2X70A 5DD3L 4APQD 4A6YB 1HHIB 4O2EB 4P3DA 3KXFA 1BFOB 4JFOB 2NXYD 5HYFA 2X4OA 2IMMA 4OV6F 5C09B 2UZIL 1T6WA 4UT9L 1DVFC 4BKLA 4F37F 4ZQKB 1BMGA 1LEIB 1DLFL 4L3CA 1DN2A 3BIAX 4ZS7H 3O8XC 5L2KE 2KQMA 3EYOB 4LSQL 5ENWB 4BUGA 4PJFF 1T21B 2OMNA 3V5KB 4G7VH 1LO0L 4LIQL 1YMMA 1HNFA 3BKYH 3FB8B 2GSGB 3RFZC 1RULH 3RVWC 4JZNB 3VCLA 3EYVA 3Q3GA 1FZMA 4HUMB 4OB5H 5C0EB 3C5ZA 4P5KB 3LKQA 1MEXL 3SQOH 4Y5YA 4QXTA 2V2WA 1MCKA 3W39B 1FNSH 2EKSB 1F4AA 5GS0C 1WBZA 4WHYH 2EIZA 3QFJA 1C8PA 3P30L 1U8JA 3VXSA 1IGCL 3HAEA 1DBJL 3GBLA 4XVSH 4FFYL 4EBQL 3ARFC 1I7TB 1S9KC 4OLXH 4I0KA 2NY0C 3UBXI 1IARB 5GZND 4HWBL 2AJ3A 4JHBA 4OGYL 2Z35B 3LMJH 3C60D 3RUGE 1J5OL 1N26A 2VN4A 1G0DA 3CVHL 3KPNB 4DFHA 4H8WH 1CVRA 4X6DB 2OR7A 4D9RE 3LEVL 3Q1SH 2J6EA 4WFHE 3VRLE 4B7IA 5SX4H 2H32H 4QXUH 5T1DH 5IGXH 1OLLA 1QSEA 1INEH 4TVPH 2WBWB 3VWKD 2FD6L 1X5ZA 4JFHD 3CSPA 1U3HC 1HCVA 1NBYB 1VA9A 1S78D 4HCRA 4OIBA 4NNYA 5FHBL 5L2JB 4ZODA 3HC4L 1E4KA 2BNRD 4PGBA 1JWUB 3UPRA 5F7LB 1OB1B 5DVNA 1XGRB 2L7UA 2V7NB 2IPUG 5KVDL 1QLRB 4YH6A 5DQDL 1A6UH 2ADIA 1B3JA 1G7JA 3T1FB 2H8PB 2XN9B 4PJAA 4Y1AA 1JWMA 1DQDH 1TMCB 4NNXB 1GGBL 5E56A 3MUZ1 1EAPA 4M43L 5KSAB 3PWUA 1ZHKB 4NKIL 2FB4H 4R96B 3QEGL 1BZ9B 3MBEB 5SWZA 3MJ9L 5M7QA 5HHXH 1MHHB 3CXDL 3PE9A 2AQ3A 4F9LC 1QPPA 2AJSL 4WEUD 1JRHH 1JNHB 2VDML 1DUZA 3QCVH 4MA7L 3FAWA 1MUJA 2OCFD 2VDOH 5K9KA 2CUMA 5TF1L 4YGVB 4Y19B 2GYSA 3JUZA 3AS0A 3D25B 4URTB 3SE8L 4FQQA 1KXQE 1X4YA 4XBGB 5L0QB 5T3XH 3VI4F 5ADOH 5C0DB 4PG9B 4QXGH 4FQJL 5GRVK 2I9LA 1A7RH 1YEEH 3I75B 1W0YT 1RU9H 3NFPA 4BFIA 4D9QD 1NBVL 4Z7OF 3BJ91 4TNVK 1R5IB 4UDUB 3U36B 2R0LL 1D9KA 4KRPC 1FVCB 3I50H 5H94B 1H0DA 3V4UL 4LU5H 3TNNB 1D3CA 5HYJA 1YQ2A 4LHQB 3FQRB 1U3JA 3TBYA 5EO9B 2BHYA 3HI5H 3MXWH 4MD0A 3DETD 2Q6WA 1QNZL 4R4NC 2DIBA 2QBWA 4PGEB 5JOEA 1CCZA 3WN5A 1CT8B 2JB6A 1MJUH 4UBDC 1BD2A 5D7SL 1JYWA 4F9PA 35C8L 3QB7C 4OCYL 4HHAB 4MXWL 2VE6A 3I6GA 5I9QB 4P48A 1FRGH 5E5MA 1NJ9A 3O9WD 5KANI 2H3NA 4JVUA 4KK9C 1QSZA 2AK4E 4XC1L 2YSSA 3SGEH 2C4XA 5IROA 4BFGA 1GOFA 1LK3H 4PJEF 5I1AA 2P5WE 3VFNA 4P4KD 1PX3A 4HMDA 5CSBA 2XNAB 2HN7A 2IFFH 4XH2B 3QG6B 3QHFH 1MFEH 4D3CH 4OFPA 2VUOA 4X7CC 2CQVA 4H1LH 3HPLB 4L4VB 4O51A 1XH3B 4LOUD 2UWEA 1BFVL 2E8ZA 2CLZA 1R24B 4ZYKA 3U4BH 1A7NH 3UTQB 2X40A 4X5LA 4I0PB 5IB4A 4LF3A 1DANU 2D0HA 3UZEA 4Z78A 3CFDB 4G80A 5EBMA 3QFDA 4LLYA 4QRTA 3MA9L 1T5WA 5GGTL 2VZ1A 4L8SB 1CL7L 4GG8A 3BN9C 4OF3A 2UYLA 5IMLB 2CMRH 2EIEA 2FJFB 3KPSA 1DN0B 5EC1B 3SDXA 1XF3B 5KN5B 1K8DA 4P4RB 4H26B 4GAGH 1OLZA 1UVQA 1N8ZA 25C8L 3BQUA 5IHBA 5BZDB 1AJ7H 5J57B 3QXDB 3VD7A 1PYWA 4L29A 2HFTA 4MNGE 4M9PA 1K8IB 5JPMB 2EDRA 2FJGA 4D8PA 4HXBL 4TVPE 5FA4B 4B53A 1AGEA 1RJZB 5ICZA 1OAZL 3BZDA 4NKQB 4PLKC 1KV3A 3D3VA 1U3ZA 1U91A 3L9RA 4BM7A 2QSTA 3P0YH 1YQVL 1SQ2N 1YYML 4IDLA 3B6SA 1P9MC 4YFEA 4DN3H 1UM6H 3T1WA 4NWUL 4P5TD 4DUXA 5GQBA 4Q9RH 2OTUA 3G5VB 1FL6B 3QA3A 4GRWH 4PTTB 4BK5A 3HE7B 2DLHA 3DX7B 3TBWA 1OF2B 4GBXA 2YPKA 4O5LL 4NN5B 3C5JA 3BUTA 1F11B 4UINH 3ARDA 2YN5A 3LKPB 4S1RL 2X7LB 1N4XL 5KG9A 4X99A 1UJ3B 5KSAC 1VPOH 2X4QB 4RRPA 5E2TH 4NO0B 4XNZC 3FQNB 3DPBA 2YPLE 1N0XH 3D85D 3G6JF 5CGYD 2E7BA 1KTKE 4R7DA 2HVJB 1NGZB 2I60H 2F5BL 5GSVB 3BDXA 5IP4A 3L3JA 5JLZB 3Q6FA 1DQJA 1RD6A 1P1ZA 4V1DA 4ZAKC 2QQKH 1MQKH 4UOJA 1SYSB 3RWFA 4N5ED 3GSXB 2CDFB 4LNVA 5DJCB 4PGZA 1KT2A 4ENEC 5L0QC 1FFOA 5L2KD 5I16A 5B4MD 3TVMD 4MSWA 4Z7UF 4QT5A 4GXVL 2PYEB 1A7PH 3VH8B 4E41D 1UYWH 4ZD3L 1JNLL 5ESVA 2W9EL 1NGXA 4X9FA 1VGKA 4P57A 4MJ4A 4XPGH 4Y8AA 5SWQA 5EOTB 1V7ML 4EVNA 5A16B 3T8XA 5T1LB 3EJYC 2EYSB 1ACYH 3GM0A 3TJHC 1TJHH 1FPTH 2Z31A 4NNPH 1Z5LB 2VQTA 3ESUF 4XXCA 1B4RA 1MSPA 5LGJA 2ENSA 2F58H 2QKIB 4NRXA 4JG0L 2HFFB 4OKVB 4P46D 2DQTL 3FOMB 4L9LA 2DKMA 3PDOB 3WL9A 4D9LL 2BRRL 5F6IC 3K2UL 4AT6B 5I9QC 1PZUB 1NANI 4FQ1H 3QEUB 5F3BA 4F7TB 1NEZB 4LPWA 3O11A 1NFIB 2BNQB 1DUYA 4D9RD 1NGQH 5DJAA 4LPCA 4WFHD 1WZ1H 2IG2L 1T1YA 3RDTD 1RUQH 1YY9D 1UEMA 4AEHH 1CG9B 1CIUA 4M03A 3LB6C 4HIEA 5E8OB 2AEPL 4P2OC 8FABB 3SDCC 2Z8VC 5CKGA 4S1SL 1ZLUK 5EBGA 5HGDA 4AG4L 1P6FA 2ZOKA 4I0PC 1QP1A 1KIRB 2A77L 4L1HA 5ACZA 4HXAH 2AXJA 3NZHH 3ALPA 2HWZH 2Z91B 1MI5B 5EO0B 5GRWA 5HTSA 2AS5M 4NP4L 1D5MB 3WFDL 4GQ9H 4AH2B 1CLOH 3U4EA 1SEBB 3EBAA 4M6AA 2OMBA 1HIML 1UXWA 4OZFB 3IU4H 3P73A 2Q3ZA 5FGBA 3O6LL 3CUPB 4K3HA 2F8XC 2QHRL 1RZGB 5C3LD 4DN4H 1PQZB 4Y16B 3VFGH 2R0WL 2FR4A 4PLNC 5J1SC 3GBMH 3UJJL 2Q76B 3MRRB 4NUJB 1FZKA 3QO1A 1XCQB 4GRWE 5MEQA 3QISA 3MGAA 4V2BA 2NXZD 1QUNA 3BISA 2VDLL 1KC5L 3TN0B 5CJQH 3H3KA 2B39A 2X4PA 5EUOB 4YHML 2KPNA 1XF5A 4FQCH 4PJIA 5B8CB 1NC4D 3HE7C 2ICCA 3HLAB 1N64H 4G6AC 5I74B 1KPRA 3B4NA 3HNTH 1F90H 1FFQA 4Z95H 4U7SA 3M45A 4UDTB 1OT2A 1JPFB 1G6VK 3BWAB 5JTWA 3KWWA 4ZS7L 3A6BH 4FQHA 4JKPH 1UJ3C 2G9HB 2IGFH 5C9JB 4Y8DC 5DS8A 1XGQB 4G7VL 2XOTA 3T0EA 1FNEB 3MYJA 1P7HL 1A4JB 4GKSB 4LL9A 5B38G 4XCCH 2OXHA 5AZ2H 5IB3B 3MO1A 4JAMB 5E4IA 5IMMA 4OB5L 3BRGC 2QR0B 4KVNH 5D1XD 2PW1A 2Z8SA 3HB3D 4OM1H 5KVEH 1BFTA 4WTZG 2VJXA 1S7WA 1FNSL 5DURB 2BY0A 3GMQB 1OGAA 3WFHB 2AV7B 5KW9H 1A0QL 4XCEA 2EE9A 2DTMH 2E8YA 3HUJB 4RFOL 4FNLH 1CLYH 4XVSL 5TH2B 2AK4D 1P84J 1PSKH 2KZ1B 3LQMA 3RWDA 1CE1H 1D5BA 4OLXL 3RWGA 5CD3B 4GOSA 2P5WD 1CFBA 4K2UL 3CJJA 3VD5A 4XXDB 2HFGH 1BFSA 3T2OA 2P46B 5K33A 5C6WH 3Q1SL 4B7LA 1PW3A 3GGWA 4FXKA 3UTZA 1TVBA 1EFXD 4KRLB 1IAKA 4QXUL 5MEPB 5T1DL 5IGXL 2F53E 5C07E 3SDAB 4HW6A 1INEL 2CO6B 3EYSH 2XKSA 4HBQA 4TVPL 4XHJC 1M05B 1QSED 2P42B 1TZHB 5IW1B 1DZBA 1H15B 4ZS6D 3MMEB 5FYKD 3UDWA 1KGCD 2JJVA 4L4JA 4BYHA 1G7QB 4JPIA 1BBDH 3QDHA 5EU7E 4ETYA 3MV7E 5F1SA 1VESA 3UAJD 2BVTA 3RWJA 3O6FA 2DQJH 3F12B 3HR6A 3RI5F 1A6UL 1KCVH 4P2QB 4PJGE 3INUH 1DQQA 5AWNH 2YBRA 4TUJB 4LLMA 4ESKA 4U1KB 4Y1AD 2XA8L 3J8F7 4J12A 4C57C 4M9OA 4M8VA 4QWWD 5KSBA 2FB4L 4PRPE 1KPVA 3G5YB 1AGFB 1MAJA 5EUOF 4ZFFB 5A1AA 1XAUA 3SDDD 1T2JA 4G6KL 4IEFB 5HHXL 3QULB 1QR1A 5ICYB 1WFUA 5ISZA 1U8PA 5IMKA 1VFAB 2G60H 5SWZD 4C56B 2GTZB 1JRHL 1G7PB 5JORA 4F3FB 3BP5A 3QCVL 4JJ5B 1WIOA 5BS0A 1MPAL 3HC0B 5HYEA 1UCBH 1HDMB 3VFUB 1QRKA 3NCJH 5EU6B 3BH8B 1KFAH 3PV6B 4ACPA 4Y4FA 5ID1A 3VMOA 1QBLL 4G6FD 2DM4A 3SE3A 4P5MA 5F70A 5ADOL 4R2GB 4QXGL 3OKOB 1A7RL 3OKDB 5IM7A 1YEEL 3ECBA 2KH2B 2YPLD 1RU9L 2EC8A 2P7TA 1Y6NR 5JPNB 4MB4A 4J4PA 4P9HL 4MJIA 4UQ2A 2DLEA 2AJYL 1G9EA 1GOHA 3I50L 3S4SG 4LU5L 1R3KA 3HUJF 1AR1C 1CGSH 4QHUB 1PZ5B 3BIBX 4YDLB 5F7UA 3QNZA 3L3KB 5FUCE 1TZGH 5IESH 3MXWL 1P53A 2EDJA 3TN0C 1GC1C 4RAVB 2MKLC 4CADA 3QH3A 3H9HA 2GCYA 1MJUL 5B8CC 2EDBA 4F7PB 5CP7A 5I74C 1BD2D 4MA3A 4NRYB 3VGDA 1FRGL 1L6ZA 2X89A 3D2UA 1KJMA 4X4YB 1GRWA 4I2XA 1CD8A 1P5VA 4L9DA 5GS0H 1I1AB 1LK3L 1EJOH 4L3EA 2R23B 1LEGA 4IMLA 5EZJA 5ACLA 4HLJA 4WI4A 4DGVH 1TTGA 3STLB 3QZWB 3V8OA 2IFFL 4Q2ZA 5IR1B 1QO3A 1DFBH 3QHFL 1MFEL 1QACA 1I1CA 2LVCA 3NCCB 1NEUA 3MREA 2FGZA 4O4YH 5D6CB 3U4BL 1A7NL 4G9DA 2DMKA 5D7LB 2YRPA 5GGQH 2AV1B 3ZT5A 1R3HB 3Q2CA 2OL3L 2VLME 2NY3B 3VD3A 3T2QA 3D39B 2GFBB 4KDTC 1M7XA 2HFEA 2DWDB 2CMRL 4HUKB 2ATKA 2W0PA 2ZCHH 1KB9J 43CAB 5ESQB 1ED3A 1GAFH 4GAGL 4I9WE 4UQ3B 5C08E 4EKXA 5D7JB 4OZHE 5I66A 1GH7A 4ZFOA 3EOAA 4KI1A 3HS0B 1S7XB 4JZOA 3NGBB 4U1MB 5HDBF 1JHKH 1C5CH 2LU3A 4N1EA 3L5IA 2ILLA 1WTGT 3CPLA 3SDAC 4Z77B 3BE1L 3I84A 4NYLA 3OJMB 2OX5A 5I1DB 4ELMA 4DK6A 4HAGA 1WF5A 1JZ2A 1LVEA 1ZEAH 3P0YL 3BGAA 4UT7H 4Y5YB 4DN3L 4JFYB 1UM6L 3PV7A 2VAAA 4HUVA 4Q9RL 5F8RC 4KU1A 3QI9D 2DQFA 4EI5A 4NQEA 4ALAH 3BXNA 1D5XA 3ZE0F 4NHCH 1JGEB 4PRNB 4F7EA 4JE4B 3ES6A 4HKBB 3OL2A 4MCYA 2FHBA 2R1XA 2YD6A 4UINL 2XQYG 3V0VA 5E99H 1VPOL 3MRNB 3QJFB 3RKDC 4GG6A 4P49A 5EZLB 2FYYB 4GUPB 3EO1A 1NAMH 2V5MA 3K4AA 2FCBA 3CH1A 3C9NA 5D72H 4JFZH 4X5WA 2A9NH 2OQJA 3ARGB 1Q0XH 2I60L 4I1NB 4FQPA 1CGWA 1WZMA 5C8JB 1KXTB 2XXCB 5JNYB 2D9CA 2QL1A 3EAKA 1XIWB 43C9A 2KDGA 4OCWH 2IPKB 1MQKL 1X9QA 4R8WH 5HYSA 3L3IB 3JV6B 4JFDE 1FL3A 1MOEA 5IHLB 4QOKE 5C71A 3DVGB 1HSBB 4YEFA 3GSWA 1WAAA 4KKAD 3DSNA 1A7PL 3CH8A 4PV9B 4Y4KA 1UYWL 3GMMA 4Z9KB 2Q1EA 4XPGL 1P84K 1ZHBB 4O58H 3QDGE 5E9DA 3N9GL 3A6OA 4YDJB 5D1QC 1TJHL 2W60A 1FLRL 4ODSH 1AKJB 1FNLA 1L7TH 4RNRB 4YDLC 1R3JB 4PRBA 3OGCA 5C2BH 1C12A 4G5ZH 4MXVE 4KWUA 2H1PH 2F58L 5SWSE 3HG1A 1JV5A 4BH8B 1TQBB 5DFWH 1BM3H 1GZPB 4QRPE 1P2CA 2V9QA 1JJUA 1HI6B 1HXYA 4C83B 4XPBH 3MLYH 4JPVH 1IGIH 4ODWA 1VEOA 4FQ1L 4HSQA 2PR4H 4TTGA 2IAMB 1YEGH 2V2XA 4OD3H 5SV4A 4U0QB 4JZJA 2OZ4H 3R0MA 3MLRH 4AJ0A 1O5DT 3UTSA 3UC0H 2DJSA 4HKJA 3BH9B 1NGQL 5K59E 2PO6B 5HHOB 1UT9A 3V6OA 2E9IA 3ROOA 5K9OA 1WZ1L 5FV2A 1U2HA 3U82B 3V5DA 1S7VA 1CXFA 5CFHA 3IFOA 4HQQH 1RUQL 3PHSA 4QGYA 4M5ZH 4AEHL 3AM8C 3VFSB 5C07D 3V95A 3WIIH 3MLTB 4LHUG 5FYJU 1MHEB 4QCIB 3OR7A 1P7KB 4Y2DD 1ZLWK 5DRNB 4KY1H 1TPXC 2OJEA 3PL6A 3V5HA 3IXTB 1YEDA 1WC7B 2IBZX 5B3JF 1TVHA 1C7TA 2EO1A 3H3BC 2A6JB 1S3KH 4LP5A 4PP1D 1S5IL 3U7AA 1TNMA 4GRLA 3X14A 4HXAL 3BZ4A 3NZHL 4PBWD 4HS6B 2E9JA 2HWZL 3ARBB 1JNJA 2CIIB 2HJLA 1CGYA 5L7XH 1JZ8A 2CR3A 2NMSA 3ARTA 5DEFA 4GQ9L 3TGXA 1CLOL 3I6GB 3IKKA 4FOMA 5D7JC 5EPMB 1PKQA 2IALA 3EYQC 1MWAB 4FQXA 5FKPB 4Y4HD 1BLNA 15C8H 4PRPD 1F3RB 2A9MH 3NGBC 5LWYL 1EX0A 3DRTB 3O4LE 3HFMH 4AEEA 3MV11 1CGVA 5DFTA 3VFGL 1ZT4A 12E8H 2X4TB 2Y6SC 3GBML 5CSGA 5I8EA 3JTTA 5L6YH 3GMNB 1QFOA 5JOPE 3DX9B 2NY2B 3O6MH 5KSVA 2ARJA 1DE4B 4QYOA 1MLCB 5F7DA 3ARUA 5HYQA 2ZUWA 3QWRD 5JHDA 1CFVH 5CJQL 4C54A 4NN7C 4FQCL 4PS4H 1RZ8B 1R3LA 1FIGH 5KTEH 3QT2A 4LLYB 4R4BA 3AMKA 3HNTL 4PJAF 1F90L 2PXYD 4Z95L 3QDMB 3CDGA 3F62A 1WITA 1F6FB 2PTTA 3KPSB 4U4BA 3VWJB 3RGVB 3A6BL 1FFPA 5MI0B 3H6JA 4U6HB 4JKPL 2JCCE 1FJ1B 1JF1A 3ULSA 2IGFL 4KTYA 3CGTA 3DVIA 1ZT1A 4XP4H 4BH7B 3E8UL 4CU6A 4DZ8B 2P8PA 4KQ3H 5IFJB 4W4OA 2AJXL 1XR9B 4OCXH 4Z7VE 4XCCL 5C0BB 5AZ2L 1ITCA 4EUPA 5FCSH 3VRJA 4U1SA 1NKOA 4KVNL 4KK6D 4WFFE 4UNTA 1YJDC 4OM1L 4K8RC 4LSTH 5E6IC 4BA8A 3BN3B 5HGBB 4KGLA 4LSRH 5DFVC 2NY5C 3QUMH 5D1ZA 4N8VA 4X9IA 2F54B 1LGVA 3MV9E 5T3ZH 4AYFA 3B6SB 5FXCH 2RFXB 3E3QC 3WCYA 4FNLL 1CLYL 3GUTA 4R6UA 5LQBH 1PSKL 3DO3A 3BW9A 3KS0J 3PWPE 1CE1L 4S2SB 3TIDA 2EH7L 3R8QA 1CDGA 1X7QA 2GJ6B 4J6RH 3D0LA 3JV4A 3N1QC 3S96A 3DVFA 1YMHB 1ZKAA 2H2SD 4Z6AT 2LTQB 2VR9A 4JFFE 5I2IA 5GIRA 4PLJD 4ZFGL 2JKXA 2HRLA 5T5FH 2OR8A 2IADA 3VFVA 2HFGL 1XZ0A 2VLKA 1N59A 2AQ2A 2YEZA 2OP4H 2BX5A 4HH9A 1AHWB 3QUXA 1QOKA 2GKIA 1CZ8H 3RWEB 4P2RE 1WIPA 4WTWA 3LRSB 3I9GH 1HHKA 4S1DD 3D48R 3EYSL 1FQ9C 3DV4A 4MJ6A 3QJHA 3KLAA 2VLMD 4QY8B 3SEPA 4JY6B 5C0FB 1S9WA 4XNQB 3OKYA 2C1OA 1I3VA 2FO4A 3NA4A 3C6LC 2QSVA 3PWVB 2RB8A 1BBDL 3ZE1E 3TIEA 4ZXBA 1NCTA 3LH2H 1HN1A 2OSLA 4I9WD 4M6NH 5C08D 4TUOB 4Z0XA 3THMH 1PLGH 3S37H 5FGRA 2DQJL 2PO6C 4X8JB 2X5PA 1BVLA 1KLGA 3INUL 5CIPH 5AWNL 1WCQA 1A6VH 2OR9L 4PGDA 3L3DB 4ZUVB 5BVJA 2EDHA 3HZYB 1TZIB 3T4YB 1X5HA 4LVHB 3TWCH 5D96C 2NZIA 4J1UA 2COQA 4N9GA 3MJ7A 2FZ3A 1J8HE 4HX1B 4XC3H 2G60L 1KB5A 4MD4A 1FL5B 3QUZB 4TPRH 5FECB 2E3VA 2IH3A 4XBPA 4KKLD 3MRBB 4B5EA 1J1XH 2CUIA 1QKZH 1UCBL 1SMOA 3OF6A 3SDXF 4WHTB 2YUVA 3NCJL 4W6YB 4XNMB 1F5WA 1JK8B 1KFAL 3B5HA 1EEYA 4L8BB 4E0RA 1ZVYA 5D2LA 1ONQB 2BSRA 1WCBB 4X5XB 3TA3A 1OTSC 4LVNB 4JM2C 5CJBA 1GL4B 1ORQB 2VQ1B 3TP4A 5F89B 3I02A 3GSVA 2EEDA 1VERA 2H32A 2XN9E 4YE4H 1G9MC 1VEPA 4LGRB 5CHNB 5LBSH 3BEVA 4MQ7A 3DMMB 4MNQD 4LCWB 1AP2A 2Q8BH 1AIFB 4QRRA 4YDIH 4CVXB 1JGDB 2CDEB 5C0NC 5IKCA 1SYVA 3RWCA 3RVTD 1CGSL 3QG7H 2VAJA 2NY2C 3RIAK 3WKMH 2GHWB 5BVPH 4A2MA 4M8QA 3WLWC 1TZGL 4CBPA 5IESL 4WO4A 4YHNB 1E4XI 2YR3A 2RCSH 4JFDD 1Z6JT 3MRJB 1LNUB 1MNUH 3NZ8A 4QOKD 1TTFA 2DS4A 4R3SB 2XWJB 3GSOB 2RIKA 3JUYA 4X9BA 3U7YH 5IB1B 2EE6A 3MLUH 3VWJC 1G6RH 3QPQD 4KI5F 3RGVC 4D0CB 2ZSVB 3D2UD 4GW5A 1T7VA 1ZS8A 3QDGD 3ARVA 2BOCB 5GS0L 1EJOL 5JHLH 1NDMB 3JSSA 2R15A 4YO0B 3TESA 5TE4H 2HJKB 4DGVL 2VISB 3QO0B 2G5RA 5IWLC 3FHAA 4XPHH 4GW4A 1DFBL 3LQZA 1P7QA 1Z2KA 5F1KC 5SWSD 5T3ZE 4Y88A 3KPPA 5D5MB 4O4YL 4QRPD 1SHMA 3B3IB 5F7FA 3B5TA 3TZVD 4X4XB 4ZUTA 5GGQL 2NY6C 3ULUF 4HBCH 3EDEA 2P8LB 4YXHH 4HGMA 4PJIB 1HQRB 3I6KA 2YZ8A 1LD9A 3ZE2F 4OCLC 1BZ7A 2ZCHL 4PJHE 5I15H 4PRHB 1GAFL 3WEXB 4IRSB 4CU8A 4MAYA 4WUUB 4LEXH 1Z9OA 3LZFH 5BRZA 4ZG1A 5C9KA 2PKDA 4ZPVA 1AHWC 1UM4H 3CAFA 4KI5C 4YBQD 3VG0L 1I1YB 4NQVB 1A7OH 1L7IH 3O2DH 3QXAA 1J0JA 1C5CL 3V7MA 2X4UB 4Z7WE 1MH5B 4JFXA 3WXVH 5GS1A 1Q9OA 3K3QA 5J3HD 4O9HL 1F2XK 2O61A 1G9NL 2R2HB 1MY7A 1KCUH 5AD0B 1YNLH 5DD5H 2BCKB 3GKZA 3IJSB 3W0WD 1KACB 1ZEAL 4NDMA 3QQ9D 1U3HD 4YDKH 3C2AH 5F96H 1JPGB 1KG0A 4LCCA 3C08H 2VLJE 1IEBB 4IRZH 1AO7B 1GGIH 1J7VR 4ALAL 1J0YA 1I9JH 2ITDB 3FJTA 4J3OC 1UJTA 3ULUC 4NHCL 3SO5A 1OWRM 5F72S 4KUCD 1C5BH 1KIQA 3O4LD 3FN0L 2DI9A 5E7BA 5F9OH 2YXMA 3LKRA 2XV6B 2APBA 2IANA 4APQB 3CMGA 1OP3H 4CNIB 5E99L 3LV3A 5F7EH 2ZUTA 3HAEG 3S88L 4HJGA 1NAML 4JG1H 5JOPD 1K6QH 4H25A 1A7QL 2FDBP 5D72L 4NKOA 4JFZL 4PB0H 2YD1A 2W9DL 2A9NL 4LLAA 1Q0XL 3QUZC 4F7MA 3F5WB 4OZFH 5GGSY 3P77A 4ORGB 2VDKH 3H42H 3L5XH 2ORBH 2G2RA 2AJZB 2ZG2A 4CN6A 3WKNA 2DJ4A 3BDBA 3ARZA 5CSZA 4LEOB 1NCCH 2MCG1 3HRZB 2GUOA 3HR5B 3BKCH 3N06B 4M61A 1FG9C 3EZJB 1U42A 1EZVY 4J8RB 3ROLB 4OSUH 2XWBB 4NQCD 3FT2B 3X3GH 1GC1H 2DQEH 1A6TA 3EDFA 5D5MF 3TNMA 4MA8H 4QHLA 4DUWA 4JFEE 3DMMC 1ZVSA 5FGCB 5JUEH 2OI9B 5T5NF 4OAWB 2I26N 1ETZA 4ODSL 1L7TL 3C60B 4PG2C 1JYVA 4UILH 4G5ZL 4PJIF 3KPMA 2H1PL 3RPKA 3OKNB 2GI7A 1U92B 3VFMB 1QFPA 2VXUH 1BM3L 2GY5A 5FO7A 1VFBA 5FEBA 1TTUA 3L7EA 5C0GB 1U93A 3WD5H