5DJYA

Fc heterodimer design 20.8 y349s/t366v/k370y/k409v + e357d/s364q/y407a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVSTLPPSREEMTKNQVSLVCLVYGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 36
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyA01
3PGFL 4FQXD 2WMPA 2FL5A 5C2UB 3QP3A 5DDHA 3L3HB 2BNQA 4UU9A 3HN3A 1JHLH 4MHHG 1RZJH 3PQYB 3RL2A 3RJDA 5EH1A 4WO4C 2HLFC 2NLJA 2X4TA 4KV5E 2V17H 3JTSA 3GMRA 4MJ6B 3S36L 4CL7A 4LVOB 4P59L 4KK9C 3IDGA 5GS0C 4PJ5E 2NY6D 4PGDB 4N8CL 4RAVB 2MOVA 2L7UA 3SGEH 4DEPC 1BZ9B 4OM0H 4P5MA 3EOBB 2Q8BH 3I50H 1MRFL 3KPPA 3OBAA 4MDIA 3VGDA 1R6VA 3IFNH 1AO7E 4X6FB 2GY7B 2Y4SA 1MFDL 1J1OH 4GW4A 3QUMH 1FL6A 1VFOA 4ZXBB 4UB0L 1XGQB 2Y36L 2YUWA 1U8NA 1JF1A 1YJDC 3PWLB 3BN9C 3T2OA 2QSVA 3OX8A 4EI5A 5T1KD 5C07B 1URLA 1S5IH 3AMLA 4F9PA 3SJVB 3U6RB 1KOAA 4E0RA 3I2CH 1U8QB 4KWUA 1SM3H 1CGSL 3STZA 3CJJA 5GIRB 3TH2T 3HE6C 3GSQB 3WNNA 5I1KL 4RGOH 1I1FB 4EI5C 3MBED 5ELIA 4DGIL 2LQRA 4OD2B 4OGAC 1BJ1H 2BP3A 3CPLB 3INUL 5D96B 4R7NA 2FCBA 5FO7B 1J1XH 2YMXL 2M2DA 1F58L 1SMOA 4FRWA 4FZ8L 2DWDA 5IF0A 2ZNXA 4N90E 5LQBL 4HWEH 8CGTA 5EUKB 5IUSA 4BKLB 1RUQL 1KENH 4M43L 3VGFA 2O5XL 1FLTX 1DBAL 3PXHA 3VXOA 4G7VL 2ADIA 3TZVC 3WNMA 5KVDL 5FB8B 2ZUVA 1S7VA 4MMZC 5JHLL 3PABB 5K59E 4MNHB 3D39D 1NEUA 2WUCL 1P4IL 3SDCC 4U2ZA 3IDIA 3WS6C 1N6VA 4EVNA 4B53A 5I1JH 5MEOB 4ACPA 5J0BA 1CQYA 3L3JA 3NFSH 2OSLB 3ULVL 1C7TA 4M7LH 3TZVA 4FTVE 2CUMA 5FYJU 5L2JB 4XNYH 1J0KA 1OTSC 1T66C 3SBWC 5JOFB 3U46A 4UTBH 1ZWIB 1HH9A 1FJ1A 1UKTA 4DFHA 5KJRH 4BJLA 3RZCC 2J8UE 5DZNA 3HRZA 2BMKB 1KIUA 2X4PB 5BZDB 4BFGA 5HHQA 1MCJA 2HLAB 3ZMRA 1ROWA 5T3ZD 3O3BB 1KN4L 3SE8H 2H3NA 1S7RA 4FQ2L 1J8HE 1KJ2A 2FGZA 3REWB 1TENA 1QFPA 4I18C 4PV8A 3WS3B 1MCNA 3VXUE 4RFOL 2Y06H 3O9WC 5FV1L 1FGVL 5DJ8A 4GW5B 4JRXD 3HZVB 4RBPK 2G2RB 3C2AL 5I1LB 4NHUB 3N1MC 2DM3A 3KPMA 3NBNA 1TZHA 4HC1A 3SOBH 4RMRA 5EA0L 1U8JB 3RNKA 1KT2B 1AGCA 1KPRA 2EDDA 3OHXA 3QEQB 4EJ1C 5DO2D 3ULUF 2Y06L 2A83A 1RJLA 4KMTH 4N1HB 1CLCA 1I7ZB 3T4YA 3MFFB 4O9HH 2HVKA 1G7MA 2HKFH 1SJVA 1WBYB 1VACA 4GFTB 5DJYA 1V5JA 4U6XA 3MV7A 5FM8A 3NGBB 4GXVH 5D4QA 5GGVL 4H20L 4NBZB 1QRNA 1L6XA 1ZWIA 3E6FA 1XR9A 4OAWA 1MIEH 1ZT1B 3W9DA 4UZGA 1BVKA 3HHRB 5IJVB 5D8JH 5KSBF 4KXZI 3QQ3B 3RDTB 4I1NB 4JGUA 5FIEA 5E95B 4X6DF 3KYOA 1B3JA 1T2JA 1CFQA 2ADFH 5FF6B 4KUZL 2VLLA 3WIFA 5TH2B 1CGXA 1XGYH 3SPVB 2MCPH 4BQ6A 3NIGE 1G9NH 1PBYA 3QNXB 2WWMD 4MQXC 4G43A 2R39A 4QXWA 1ZLVH 2VABB 2NXYD 4NCC2 3RX7A 4JGMA 5JPMA 2V6HA 4PRAB 4QRQB 1AE6H 2YEZB 3BP4A 3MLVL 2F58L 3WFDH 1S7TB 1VGKA 5EWIH 1RULL 4WY7L 3TBWA 4XXCA 4HV8B 2PNDA 3SCMD 3IDUA 2C1PB 3SKJL 2Z0BA 4XMLL 1QD0A 3ZE0F 3SKNA 4LLMA 4NP4L 5IOPB 3U36A 5ACLA 2AJXL 4U1MB 2DN7A 5DRWA 1IAKB 2JK5A 3GKZA 4JN2A 4K9EC 3HE7D 4M1DL 4MX7A 1ADQH 5DD3L 2XXCB 4PJXE 5GHWH 2HTLC 3SDAC 4OFYD 4HEME 4M48L 4W6YB 5HI4D 3LKOB 5AYUL 1HXMB 3PL6D 4WI2A 5K9KA 3CCHB 2M8XA 1FFNB 4PP1C 5K33A 1KXTB 3QFDA 4FG6D 2CIIB 4QHNB 3TNMA 4G8GE 2VDOL 3PGDB 4JFFA 1JL8A 4L9DA 3WXWL 4NO5A 2VZUA 4FQLH 1BX2B 4FABH 1UYWL 4N0YL 1AXTL 1PKOA 2X4RB 3RY6A 2HG5A 1PX4A 4C4KT 5I19L 1UQSA 4JDZB 1J8HD 1N5YL 2YMXH 1DVFA 1L9NA 1T22B 2GFBB 1MJ7H 1ZLWK 2YWZA 5EG6C 3K7UA 4FQIL 4WI8A 4Z95L 3SDXB 4XNUL 4MXVE 1VGKB 3FOMB 2F53E 3IFPA 3WFCH 1U8LA 1FZOA 5C3LD 3NN8B 1KELL 3H3PL 5BZWA 4FXKA 1FGVH 2H32B 4OZ4A 5J9PA 3D3VA 2XIDA 5FA3A 1FORL 4JFDB 4WV1B 3EHBD 5LBSH 2BFVL 5FA4B 2KBGA 4JN2B 3FFCA 1NUDA 4TOYL 4EOWL 1J1OL 4BQ8A 3QDJB 4BSWB 3ETBF 4EN3D 4X4MA 5KVMC 3U46B 2DLTA 3LKOA 1YMME 1BHGA 4L29B 5T3XE 4JRYE 3MNVB 1J87A 3U7WL 4MQ7B 4HCRL 4OJFL 5EU5A 1BGXH 2COQA 3VGEA 1RV6X 4JPWL 3MODL 2E7LC 2HKHL 4FQQB 5D1XB 2YPVL 3DRTB 3BRGC 4HC1L 2P1YA 3CFEB 4M7LL 5EU7E 1AD0B 3G5YB 5EZJB 4AH2B 3O41B 4JZOA 2X4RA 3S36H 2IFFL 2HG5B 1K4CB 1EMTH 1E4XH 2IGFL 3WKML 3NCJH 3DO7A 1KG0A 3LEVL 3S98A 2EE3A 1BF8A 1YEDB 3QI9B 1BQHB 4HJJH 3L3GA 2FIRT 4KZEH 3VFSB 4LDLB 5IEKB 3L7EA 2GI7A 4Q6IA 4WWKC 3IDMB 4JRYD 3U1SH 3WFZA 3RWIB 3FOMA 2BZDA 1ED3A 4CMHB 1A6VH 1G7JA 1N64L 4GBXA 1OM3L 1H8OA 5I8EB 1BJMA 1I8LA 2N7AA 1E0OB 1D6VH 3MRPA 5BZWB 1WF5A 3MNZA 3V79C 4YXHH 2NW3B 5IKCB 1E6JH 5D7IA 3U30B 4Q6IC 2J8OA 4KJPC 3D1MC 3LIZH 3H7LA 4CDHA 4JFPA 2C4XA 4LQ1A 4MXWL 2CQVA 1T7VA 5HGDA 4A6YB 4K07A 4QOKE 3QDJA 4U05A 3OKNA 4BSWA 3VCLA 1RVFH 3T0WA 4HQQL 3D25A 5J1SC 3C60D 3LEXA 4X9HA 4ZO6A 4LRNL 3MOAL 2XN9B 5DC0A 5HBBA 3HAEB 5DMYA 3BW9B 2VN4A 5EN2A 2GEEA 4GBXD 4MA8L 1ODAA 3WLWD 1JGLL 3IFOA 4XRCB 2WLYA 5F93C 3VI3E 2FGWL 5C08E 6FABL 3MA9L 1AD0A 4I3SL 5EBLA 4BFIB 1P4LB 3QIUA 4F58L 3DX8A 3X13A 2YWYA 1IM9A 2ED9A 2BY2A 2A1WH 2Z93B 3TO4A 3IRZA 2K9UA 3KLDA 2DQFB 1V3JA 4E5XB 5D1XC 4LIQH 4NUGL 3EYUL 1RI8A 5SWSB 1SYVA 4H8WC 5E2TL 5HHOE 3HLAB 4BUHA 2J8UA 4PB0L 5FM4A 1T5WA 4Y89A 1CDUA 1JGUH 5DD5L 3HE7C 4WUKH 4P2OD 4JPKH 1ZVYA 4EKXA 4HGWB 3TO4C 1I75A 1KEMH 3GM0A 3BI9X 1KCVH 1I85C 3W0WB 1INEH 5JZ7C 2XPGB 5DSCB 5C08D 2BOCA 5SWZA 1WQVT 4L1DA 1NANH 1BVLB 3IKCA 3HE7A 4ORGA 3V2AR 4ZNCD 4Y19B 3OAUH 4LLYA 3CU7A 5F7KC 3HR6A 1R3LB 4KKAC 4QNPF 3HS0B 3MREB 4U1GB 4U1NB 1A6UH 4OLXL 5IB2A 4JFXB 1WFUA 2X7LB 1NSNL 2DQEH 1FH5L 3UYRL 3V6ZB 1NPUA 1CE6B 1QSED 3TIDB 2ZG2A 1XF5A 3IXAB 2BVYA 3QDME 3N9GL 4JFED 3T2NL 2Y72A 1RZ8B 4RMUA 1AR1D 3BZEB 2DDQL 3SO5A 5AAWA 4W68A 5GS1C 2GTZA 1KJMB 4R4BB 1HNGA 5C0AA 5HHXH 1CDJA 2Y07H 2F5AH 3EZ8A 3R8BB 4F9PC 5GGSA 1IM9B 1X5JA 3VRLE 5BQ7A 4HGMA 1RIVL 4YDLB 1A2YB 3JWDC 3LAFA 4BH7A 5GZOC 2OK0L 2HJFB 2NY2B 5D2LF 1YPZB 3AU1B 1LEGB 2W0FB 3QRGL 3W11C 1GH7A 1Y6NR 3VD3A 5IHZA 3MYZA 5EBMB 4DAGH 3FAWA 1YEGH 4MLIA 3MXVH 5D71H 1KACB 4JFEE 3R06B 2UWEF 3EO9L 5C8JA 1MLCB 4HIHB 2ARJA 4DOHE 3FB7B 4S1QH 2R29L 3P9LB 3MRJA 1Q1JH 3EJZD 1DQDH 3I02A 2N56A 2ZCHH 5J9PB 1N8ZA 5K93A 3MREA 3UPCA 3KLAB 4IRSC 3MLSL 4D0CA 1JNNL 3GHBH 1TLKA 5IWLC 2P5EB 4PJDB 2DQIH 5JZ7D 1QBAA 4O51A 4HC1H 1F4WH 2ZCLH 1AC0A 3JTTB 4QHKI 3TO4D 4N8VG 1VPOL 2NCMA 5DZLA 3DX6B 4OTXL 3TBYB 4QXGH 1TNMA 3KR3L 4F37K 4KVCH 2JIXB 4OZHA 5IWLA 4FXGA 1LO4H 5ICXA 4MQ7A 5EU5B 1Y0LA 4HPYL 2ZPKL 1U0QA 4L9LC 4I0PB 3CDYA 1WLHA 1H3VA 5JDSA 5FK9B 1WISA 3RZCA 3TYFA 2QSTA 4JDVA 3TVMA 4LLWB 5B38A 2DQDH 3DXAA 1SEQH 4YBLC 4NQXA 3C8KB 3O2VL 3GMQB 4MA7L 2W9EH 2FL5B 2VLKA 1II4E 3HC0B 1P84K 4LDEB 1RMFH 1V7ML 1P1ZB 3QIWC 5EUOA 4BUGA 1VEPA 3BPOB 3MRKA 3JTSB 1P84J 4U6HA 4OCRH 4PJIB 4Z95H 3CD4A 3NIDE 3FB7A 2VL5B 1ZLUH 5TGBA 2NY0C 4GBXB 2CO6B 5EOCL 1K5NA 4YQXH 4NPYB 4D0DA 3QO0A 5F44A 3KLAA 2DQCL 2V2WA 5I0DA 1G7PB 2IAMB 1KIPA 5I30L 3VFOA 4NZRH 1T1XA 4M02A 3LHPL 1FGNH 1Z0MA 4IEFB 5F8QC 4L4VA 4Y8DC 5E2VL 2ITCB 2P24A 2C9AA 2WV3A 2YD3A 3LEXB 4HIEA 5GQBA 5CEZE 5DUPH 3L6FA 3GSXB 5T3ZL 3B8SA 5KSAB 2DMBA 4LRIC 2V9QA 5JOEA 3LQAL 2XTLA 3N1QC 1FCCA 2NY0D 4HKZA 5F7DB 4MNQA 4ZFOB 1ZTXL 1OAYH 3TYFB 1E6OL 3C08L 5F88B 3O45A 4OCRL 1ZSDB 2XWTA 5GIRA 1MCKA 1IL1B 4Y4FB 5M94B 4OCWH 4Y5YB 2Q6WA 1NCAL 3GSQA 5JOFA 3QIUB 5TE4H 5DTFB 2EIZA 4QRSB 3G6AB 5D2NC 2JJTC 4TVSa 1X5XA 1D5ZB 4R4NC 3VFTA 4DGVL 3T77A 1LE5A 5J1TC 3EYQC 1WZKA 3KXFD 3MLXL 5CBAB 3QXWA 1J5OL 1Z6JT 1CL7I 3EDJA 4X7TB 1T89A 3VXUB 2JJTA 2WBKA 3O3BA 1DQMH 2EDKA 1MWAL 4BYHA 5TE7H 2HTKD 3VXRB 2DI9A 1KIPB 2O5ZL 3D0VB 4UTAL 3TJHC 1BP3B 4KH2A 5IW1A 4WEUD 4JFYB 1ULVA 4QHLB 3JBG7 3CFBB 4ZUTA 3TZVB 3KG5A 3T0EE 5DHVB 4ELME 2ADGB 1IC4H 5IJKC 4KTEL 1NFDA 3O6KH 3GB7B 3MA7A 5C07D 3BUTA 3MV8A 1WEJH 2EH8L 3DBXB 3HR5A 1IEHA 5BW7A 5KW9H 3VW3L 2HJKA 3PNWB 4FQXC 2AV1A 4L4TA 2NMSA 3TCXA 3ALXA 4MJ4A 1RMFL 1MCQA 5ADOH 3ILPA 4ZOEA 4JZNB 4PRIE 3SDAA 4R4BA 5HHQB 4QRSA 3IAGC 2PYFA 3E8UL 5E2UL 2A0LC 1BWMA 5BRZE 3QI9C 1DN0A 4KRPD 1CGVA 4OZIA 1IGML 4OZGF 4JM2D 5L88L 3BQUC 4M61B 3QRGH 1KFAL 1CICB 2BRRH 5GSVA 3GMMB 5D7LB 5CZKA 5F7YC 5I1AA 3H6JA 3K3QA 2NY3B 5GS2H 4PGBB 1CN4A 2P5WA 1GYAA 2E7HA 5EC2A 4OGZA 5T1MB 3BQUA 3UZEA 1J88A 1KPRB 3C2AH 5HVHB 4D3CL 1ZK9A 4KQ3H 5DHVH 3OGOE 1LMKA 2AQ3A 2YPKA 3TPUB 1WAAF 4K71B 4G43B 3S3SA 1Z9SA 3FKUS 1PEWA 2P8PB 2PYEA 1FDLL 5HI3D 1XMWA 5IVZB 4Z7WB 4JREC 3WUWG 1YPZE 4OLXH 2C3GA 5CJQL 4JM4L 4KTDH 3V0WH 4U33A 4MNGA 2YKLL 3LN4B 4FQPA 1YY8B 35C8L 4XMPL 2ESVE 2Y5TA 4YBLB 3FQTB 2YXFA 3QQ3A 5KJRL 5IROA 4N5UA 3FT2B 1B4RA 1LD9A 3FN9A 3BZFB 2X70B 3MRCB 5IR1A 1K85A 4EVNB 1P2CB 1CXHA 5JW4M 1NGWB 1MAML 1VSCA 2ZOKA 3RZCB 1PFCA 1QHOA 4F3FB 2J4WH 3GUTA 1MHHA 3BSZL 4NN6B 1WTGT 3BPNC 2GITA 5GSVB 1FIGL 3O3UN 4LCYA 5DRXA 1JCKA 4X8JB 5D6CB 1S9XB 4R0LB 5HYJE 5BMFL 1TQBB 4HUXA 1GSMA 2LABA 2O61B 4G42A 3KJ4C 1G6VK 4OM0L 4BM7A 3MPCA 4DZBA 2IG2H 1NGXB 4F2MB 2E6PA 1TETL 3QDJD 3WLWC 5E2WL 5E08L 1QO3A 4NKQB 2HN7A 3TPUA 3WD5L 3FQXB 4NPYA 5FOJA 4FFYH 4D0DB 3DSFL 3U2SA 4LSQL 4G6JH 3PP4H 2VDRH 1DVFB 3QEUB 5DJ8B 3MCKA 4X5XB 4NNYB 2QLVB 3VMOA 1L0XA 4I3RH 4DKEL 2Z92A 3BZ4B 3HFMH 1J10A 2DLHA 4IDJL 3WDIA 1TJGL 3G08A 4P5TB 4LCUB 1RZ7H 1CVSC 4XBEL 3MCLH 1CD1A 1U3HB 5E08H 1P2CA 3O9WD 4LLVA 4PB9L 3Q1SL 3MO1B 3VGAC 1YPZF 2VZSA 3GBNL 2A74B 2XZQL 5I1IH 5FECA 3B9DA 3VFGH 2JF1A 4JHBA 4U3CA 5D7SH 2FHBA 2CSPA 2LU4A 4OV5A 1TFHA 1OP3H 2OS7A 1VADB 4PPTA 5ITBL 2A1WL 1IAIL 2P49B 1BFSA 5E9DB 1S9VB 2G9HA 1M6OB 4N0FA 4P49A 1U42A 5JNYB 5JPNB 3ZT5A 3ELAT 2P47B 2AQ1A 4OV6F 3FL7A 3TA3D 1ZGLP 3UTPE 1EEYA 1R5VB 2I9TB 4FQQA 4M6NL 5D1XA 5TQ0L 3EYFB 3PIQA 2BOBB 2A6DB 1CDCA 3FN3A 1V8HA 3KPOB 2ARJQ 2XFXA 3K0WA 4XP5H 4OJFH 1CGUA 5TPWL 1CL7H 2VLJA 1U8LB 5CD5D 4KC3B 2IPUK 3ZLQC 4OM1H 3MCKB 4X5XA 1YY9D 3L5WB 4Y2DD 3ULVD 4EDWL 5LXGL 1G84A 4JM2B 5CJOL 5IB1A 3VXPA 1RUPH 4P5TA 2AJYL 5D2LA 2JJUA 3DARA 2ZOLB 5JQ6L 5IB4A 3LH2H 2W9DH 2I60H 4FZEH 1NEZB 4IIQB 3HZMA 1VCAA 3FB6A 4GRLB 3BP7B 4C56A 5KSVB 5TE6L 1TVBA 4JQVA 4QTHB 4S11A 2WQ8A 1OWRM 2ITDB 3OKNB 1I7RA 1GRWA 4X8XA 2HMIC 2HVJA 1IGTA 1PG7H 5J8OA 3TT1H 3C5JB 3CXHJ 5GJSL 5F1SA 5JNYA 1TJIH 2F5BL 2GIYA 2CXGA 3QT2A 4KROB 5LJYH 4JVPA 4GG6A 4JAMA 4UQ3B 2DQJL 3GSVB 5JOPE 1K6QH 3OKEA 1I1AC 4QRRE 1LO0H 3WXWH 2XQBL 4CN1A 4W70A 1IEAB 2QKIB 4MXVF 2DYPB 4HGKC 5SWSE 3BQUB 3QUXD 4P4KD 4TUKH 5J4MA 2CK0H 1P53A 1BZQK 3AB0C 3NH7L 3NTCH 2R1WB 5F70A 1DUYA 4PB9H 3UJTH 3MACL 4BH8B 3U6RA 5D2LB 2VE6A 2EYRB 4M1GL 1DQJB 4PJEF 4L8BB 5FUOL 1GAFH 5ADPH 1A1OB 3VJ6A 2QQKL 3WSQH 1A1NA 2FSEA 3OKMB 3BP7A 5SWZB 3VRIB 5DFVD 3CPLA 3BW9A 4XMPH 2GJ6B 3MCG1 4WHYG 4CVZA 5IW6A 5DJZA 1AXIB 1OAQL 2NTFA 2NX5B 4QHUA 5I1EL 2NR6D 5E5UB 1D3CA 2R0ZH 5C0AD 1F90L 3UAJC 5FO8B 1NJ9A 3BXNA 3FO0H 4YGVB 2FEDC 1RQ5A 3FT4B 4NHCH 4KK8C 4QY8A 5ILTL 1X6LA 3BHBA 4G8GB 3BDXA 1ZVHA 5IV2A 4WUUA 4OQ1A 1J0ZA 1EVTC 5F89A 2BNRE 2FBJH 1F8TL 4P9HC 4F7PB 1P7KB 4JKLA 4PY7B 3RI5K 4H5SA 5EBWA 5ITFA 1D7FA 4WW2B 3FO1A 3PGCA 3TV3H 3C5SB 3CDFA 2QADD 2B2XH 1OAZL 4Y4KB 4DN4L 1S7WB 2WSKA 1BD2D 4DK3A 4PGCB 4GXUM 3KPSD 4MXQD 1MCHA 3QXTA 4QF1B 1MAMH 4C4KO 3FCTA 3DROA 3MRQB 1A7PH 1FJ1B 4P2QE 2BSRB 3HE7B 4TQEH 5INCB 4LOUD 3VFPB 2VC2L 3PXJA 1NC2B 2AI0L 1MCEA 4NM8H 1ONQB 3BIBX 4JRXE 1HYRC 5HYSG 5FCSH 2X7LA 5I9QB 1LP9B 3RWFB 4EDXB 2ESVA 1VESA 1A3QA 3P9MA 4JJ5A 4DKFL 4PJ8B 2CUHA 3B6SB 4APQD 3HNSL 4ONHB 2R0WH 5FDYA 1PDKA 2NW3A 5IKCA 1T03H 4OGXH 3IXTB 3DIFA 4EUPG 4L8SA 1B4JH 3KPPB 3QUKB 4LRIA 5IG7A 4NHUA 3CH8A 1ADQA 4DVBB 3UO1L 4ZD3L 5I6XB 5FYKU 1G7QB 3H7BA 4JO4H 3LB6C 12E8L 3UTQA 2BHUA 1U8NB 3L7FA 4MA7H 1RJYB 4DJMA 1C7SA 1DBKL 3UBXI 2UWEB 1FNFA 2P46B 1Y0LB 1RUMH 4Z7QE 3EJZC 2FEEL 1VFBA 4QXUH 4LLUA 1JWMB 5DJYB 4E0RB 1O7VA 1MAJA 1EO8H 1T20A 4R4FH 2R2EB 5F8RC 4HIXL 4MB5A 5C9JB 3GSWA 4RNRA 2RCSH 4X6CE 3TVMC 3WUZA 3T0AA 3RUGA 3OJVC 2MQ0A 5SWSD 5D1QB 3RAJL 3SBWA 2ATPB 3VGBA 2YD8A 2VITA 4JFOB 2RAMA 4M5YH 1KCLA 4NQUA 4JO3H 4HKBA 4KTEH 3P9MB 1ZTXH 1XR8B 5C0JA 5TF0A 5E03A 3JV5A 1KCUL 5L2KE 4I48A 2ADIB 3BD4A 1HH6A 3SKOB 4KY1L 3EOAA 1AR1C 1EEZA 3O8XA 3ZE1E 4D0BB 3IDJB 4R26L 2OI9C 3TESA 2JCCF 5HI5C 4PLJD 1SBSL 1KCRL 4P5KA 2EYSA 1JMZA 3DXAB 5DR5L 3V6BR 5CIPA 1A3RH 2R69L 5DEFB 3GGWB 3GSXA 5EO0B 5KSAA 4HZLB 4RWYL 5A2KH 1TPXC 5HI3C 2ZKHH 3KJ4B 5HDLA 2EDRA 3TP4A 1QA9B 1P9MC 3MBEC 4Z8FH 2NY2C 2RGSA 3SDXE 3LQMA 3TH3T 3W0WE 5L2KA 4U1HB 1PAMA 4U1LB 4HHAB 3ARGB 5TE4L 3MRIB 4P23B 1G7LA 3LPFA 4P99A 4PJDE 1EZVY 3QXAA 3V4PL 2ZUSA 4Q58C 4GSDH 5I1CH 4KJWC 1NDGA 1NGQH 3VFRB 1QBLH 1HXMA 1GOFA 3UYRH 2AK1H 5IHZB 1DUZB 1GC1C 1HHIB 3HI5H 4RGMC 2BVOB 4H0HB 1LK3H 5C2BH 4G7YH 3PGDA 3ZKMD 1L7TH 1MH5B 5IQ9A 3V52H 1D5BB 2FBJL 3DYPA 3VFNB 3ZZ1A 4DCQB 3O8XB 1MELA 2GJ6A 4RGNC 5IW6B 4D0BA 3QUZB 5ILTH 3GNMH 4UT7L 2E3VA 1R0AH 2VZTA 5DD0H 1N8ZB 5LVEA 2YRZA 4RISH 1EO7A 2CLVB 1LHZA 2XT1B 1R24A 4YQXL 4JO1H 3BAEL 4QY8B 1YEIL 4DUVA 1KULA 5E56A 4W81A 5I1HL 3HKFA 5E8OB 5CJ5A 1FCGA 2VQUA 3EYUH 2HJKB 4YFEA 4FQCL 2VIRA 3T77B 2JCCE 4PJFF 3BPCB 5DFTA 3ARED 1XCTA 1SM3L 2IJ0C 3VD5A 4GRWF 4M8QA 4S1RL 4R96B 3BGFC 3SN6N 3DMMD 2DQUL 5DHYA 5GGTA 2VLJD 4OD1H 2SEBA 4N9GA 3NZHL 1QHPA 3OG6B 1DLHB 4U1JB 1UWGH 4H0IA 2B4CL 5JW4Q 4PJAA 2VNCA 2CK0L 3BPOC 1KTKE 1SJXA 1YC7A 3CXDL 2X4QB 4JM2C 1T0PB 1TDQA 1ZA6B 2IF7A 1QFUL 1ZAGA 3LDBC 5INCA 1OGAD 3QNXA 4GW1A 3HAEH 3S5LB 1W72A 4MVBC 3K8MA 2P5WB 4U1IA 3DXAE 5FYKH 2CKNA 4EI6B 2X1XR 4DCQA 4QRQA 2HA1A 3QFJD 1JHKL 4MDJB 2HT4D 2GAZB 5MERB 4JB9L 3DV4A 4XH2B 5HVWA 4HWNA 2OL3B 2FIKB 2R1XB 3WMSA 1T3FA 2XZCH 4GRWB 3GSRB 5L2KD 5HHPA 3WEXB 4H1LG 1CGTA 5ESAB 3GDBA 4YJZL 2NY1C 4BSVA 2WAHA 4MNGB 3S34H 3T1WA 1SHMA 4NO0B 1H3PH 5J13B 3MR9B 4K7PX 5HDQL 5IHBA 4IS6A 5J1AB 5A40E 4E41E 1FLRH 5C0FB 3NCJL 4LPWA 1F6FB 1R5IB 2ICCA 4LARL 2AERT 4K3DL 4M8QB 4EQ3A 4WJ5A 4Z78A 3OR7A 5E1AA 2F54E 4ONGL 1JWMA 4P4KA 2HYMA 4Q9RH 3HZYA 5ICYB 5K9QG 3RUGE 4NRYA 5DK2A 4ODVH 2D9QB 4XBGB 5B38G 4GOSA 4ZTPH 5C9JA 5DEZA 2XKNB 3U7WH 1V3KA 1KTDB 2JB5H 1FNGB 4NO5B 4PJBB 3CUPA 3C9NA 3BGFB 3NZ8A 5DRXB 1Z3GH 1PZ5B 2WINA 4RRPG 3PQYE 2J6EL 2FHCA 2H2PC 2GJZB 4F58H 5T5NG 1BOGB 3MZTA 4WDIB 6FABH 2NX5E 5CHNA 3S4SB 1PJ9A 3NZHH 4LCIH 2H41A 3UJIH 1P4BL 1AIFB 4OB5L 4HG4K 5DJ0A 4TPRH 5J6HB 4NQED 3IJYA 4S1RH 5ALCH 4PJIF 3I9GH 3X11B 2J6EH 4J3XA 3IF1B 4G3YH 4G6KL 1FSKB 2OM5A 4HQQH 3HC4H 4XHQA 1KB9K 1JK8A 5GGRB 2J8UB 1T5WB 3QWOA 5DK3A 3NGBC 1PY4A 3JV6A 2Y7QA 1KCVL 3G08B 5CIPB 5I19H 5D7LD 1HKLH 1ZANH 1QSEE 1J8HB 5FM5M 2AXGA 5CEXA 3RKDD 4AY0A 1J0HA 3QDMD 1TVDA 4NQEE 3C6LA 2ZUXA 2R1YB 3QDGE 3AS2A 2PR4L 3VA6A 2L4OA 2P8MB 5FYJD 3ZHLA 5D6DA 3Q5TA 4GG8A 5GXBB 5I75B 1CK0H 2FX8L 3KLSA 1OTUD 3D69A 3GIVA 4NQDA 3K2UL 5D9SA 3VXSB 4DTGL 4RFEA 3LZFL 1UC6A 3G5YA 1S8DA 2WINB 3OB8A 4XWOC 2G75B 5LWYL 3HNTL 5FYKD 3ES6B 3DECA 3F6LA 1BPVA 1YYLL 3W11D 4OQTH 4YXKL 4TUJA 3MOAH 1ZHBB 1KGCE 3OZ9H 3BZ4A 5T3XH 5E70A 4M6ML 5EU6A 4LCUA 2GCYB 1MREH 5JUEH 5KVEL 5DRNB 2JJWA 1CU4H 4M03A 4HDIB 3U9UB 3HUJF 4JY4B 3H3KA 3HPLB 3C5ZB 4DN3L 3G5XB 5GRUH 5ACMA 2R2CA 1U41A 5I18H 5GGRY 3MO1A 1ZMYA 4RFNC 5IB5B 1MFBH 1R0AL 1HILA 4NZDA 4XNXH 1E27B 3DVNB 4WU5A 4V1DD 3C60A 3HZKA 1NL0H 1IT9L 2X4NB 3IFLH 3TYGH 3ECBB 3IDXL 1H3PL 4WCYL 5BJTA 4NGHH 5JA9A 1KELH 4HS6A 1T7ZA 1MJUL 4OIIL 4ETYA 5C2BL 2EH7L 2CJUL 4XCNA 1I85A 4QEGA 2X1WL 4NM4H 4PJXF 2ED8A 3WO4B 4NN6C 2IPKA 1V3LA 4N5EC 3U30C 4ZSOE 1CVRA 1FL5A 4JRYB 1SY6A 5DC9B 4ZAKB 4Z7OF 3PV6A 2A6DA 4M4PA 4KQ3L 2YPVH 4XB8A 5BVPH 1HSAB 4R3SA 1RZFL 3RDTD 4P2RE 1QLEL 5JW5B 1RU9L 2DQFA 1G9NC 1BGXL 3S97C 3BH8B 1WBZA 1I1YA 5I2IB 5IFAL 2HTKC 1X44A 5DI8B 4Z8FL 2EDFA 4MJIE 2HRPL 1A64A 1W0WB 2J2ZA 5I66B 4GG6E 4QYOB 4JFHD 2XA8L 1FZKB 4LLWA 5CGYC 5JIPA 1WITA 4WW1B 1UCBH 2X4OA 2VOTA 2FRGP 1X9QA 5GHWL 4I0CC 4J6RL 2IANB 4PBXA 2BK8A 4NKMB 2P7TB 2DQUH 5HYJA 2A2QT 2R1XA 2VH5H 4CBPA 2D4FA 8FABA 3QH3B 2DJSA 5T1LB 3HZKB 3KPRB 1FO0A 1TXKA 1JUFB 4Y8AA 2DQHL 3E1F1 3UC0L 4Y88A 3NCYP 1XF3A 3QNYB 1JNLL 4OSUH 1JI2A 4YH6A 3JWDH 1KCUH 1U93A 5IEHA 5BS0D 2EH8H 4AMKH 1YJDH 4QRPE 1SVZA 1R5IA 1N5YH 1ORQA 3UBXA 1BFOA 1U8KB 2NXZB 4YGVA 4WHTB 5IQ7H 1BECA 3L95A 1AGEA 5T1DL 4LCWA 4IRSA 4OKVA 3RKPA 3EYOB 1BREA 3MV9E 3QDGD 4N8PA 5DJAB 5JHDB 3PL6B 3LY6A 3PF2A 3GJFB 1NBYA 3TEUA 5ENWB 3DVGA 1AJ7H 1L4IA 1QEWA 1NCDL 3QAZC 4XNQA 4YHPA 1MVUA 4WU7A 1ZS8A 4LP4A 3ULUE 1G7MB 1RY7B 3QPXL 4LNVA 3GJEA 4PLNC 3VMNA 4NUJB 4QRPA 1ZGLA 4OZIF 2J88H 3LKQA 4GSDL 1ZSDA 2XWTB 2Q8AL 1CTOA 5C86A 2AJXH 2CDGA 3MGTA 1YQ2A 3MYJA 4R7DA 3QXDA 1NCDH 1A3LH 1MHCA 3TFKC 3K4ZA 1JV5A 2W0LA 5KVDH 4Y2DB 1FFOB 2Z4QB 3MRNB 1AP2A 1IAII 4GKZA 5I74C 1P7HL 4PP2B 1LE5B 1F3JA 1QSVA 2O5XH 3K8KA 3RTQA 3OPZL 4NZJA 4PLKD 1C12B 4Y19E 3WDHA 4JY5H 2VXSH 3PV7A 1DQTA 1EK3A 1H3WM 2HKFL 2F19L 5CEZH 2AV7B 4WUUD 1T7XA 2APXA 3GSOB 1HHHA 2N1KA 5DMIH 4F7PA 3WIFB 4RAUB 1FFQA 5D1QD 2R0KL 3RVUC 1KPVB 2YA2A 2YS4A 1N4XL 1VENA 3KPLB 3L3OA 1OTTC 1T6VN 4ZTOH 4HK0A 4L1HA 1NC4A 1XGYL 3TFKD 4ZD3H 4NQCD 5FUZH 5JHDA 4XNMB 3LKPB 1FVDB 3D69B 3GIVB 5D9SB 3DVGB 4NRZA 3D2UA 1H15A 4XP1L 3WJLA 3AM8C 1HI6A 3NTCL 1LO3H 5TDNA 3SE8L 1JVKA 3RPKA 2AV1B 3GSNH 4TYUA 4UB0H 3DV6A 4HXAH 3MROA 4HUVB 1KSRA 5L8JB 4U2YA 4K3EL 3D0LA 3QULB 3X12B 3I50L 1JZ6A 1IBGL 3OSKA 1X4ZA 1D9KC 1RU9H 3G6DH 3R4DA 1XF2B 4MA3B 3BKCL 2Q76A 3SDDB 2V7NB 5D2NA 1X5YA 5DMGC 5DVKA 4Z9KB 4XP9H 1MNUH 2Q3AA 4M7KL 5GJSH 5F21B 3UTSE 1E4XI 5FV2A 2C3HA 4JJHA 1D9KA 3ZYZA 1RZJL 1MPAH 1JHLL 12E8H 4JO2H 4ALAH 4K9EL 3QWRD 4Q7DA 4KK6C 2R0LL 2GSIA 2JELL 2EH7H 4D9QD 4KVNL 1EEZB 1AXSA 5E4IA 5L0QB 3O6FC 4KHTH 1A9BB 2B4CC 5HGAB 1F6AB 5DS8B 5DA4A 5CCKL 3WJJA 3SY0A 3QHFL 3JUYA 3FT4A 2PXYB 1U95B 3F58H 1IL1A 3LKSA 1F58H 1MCPH 5I18L 1S9WA 3H3BC 5LXGH 1HDMA 4R2GC 1YC8A 4NIKB 3PWNA 4QLRA 1XH3B 3MRDB 1KBGH 4F37F 2VWEC 1MQKH 4X0KB 3FQTA 5DD1L 3FB8A 5TDPB 3ARSA 1A14H 3BKMH 4X4YB 1P9MA 3MBEA 1IGFH 3C5SA 1U8OB 5FO9B 1B90A 3DTXB 3F7QA 4MZ3A 1HHGA 3TO2B 5F9WB 3O3DB 3RWHB 3QWRA 3OXSA 1CGYA 1I1RA 5DURB 3QB7C 5IW1B 3DVFA 4HUXB 1SEBA 4DFIA 5JHDD 1TZIB 1IZJA 4NCC1 5IEHB 4DZBB 2VQTA 5L6YH 4OD2A 2BNRB 2XZQH 1CDYA 5EUOE 4HWEL 4NKOB 3P4NA 2QR0B 4POZC 5L8LB 4WGVB 1MIMH 1NCBH 4JQIL 4TSBL 4S0SD 1KG0B 3RL1B 4C58B 3RY5A 5EZOL 1LDPL 2DWDB 3SE3A 1RZ7L 4WHTA 2PXYA 3A6CH 1ES0B 4NNYA 1GC1L 2DQTH 3B2UC 4Q6IB 3MOBL 5CUSH 5I1KH 3NOIA 4OT1H 3SQBA 4P2CG 4FQ1L 3MJ9L 4P9MH 4Z6AT 1NBYB 2YD9A 3HMWH 1LDPH 2H45A 2MJWA 1VEOA 3UYPA 2I60L 3QNZB 1KB5A 3HI6H 5E5MA 4DQOH 3CVHH 3GO1L 4U31A 5DK0A 1QZ1A 1C5DA 2OSLA 4XP6H 3KS0J 2CRYA 1PKQE 4PUBL 3QA3A 1DP0A 4LIQE 1BVZA 1S7UA 1MH5A 3WHE1 5TF1L 4OZFG 3TN0D 1DQQB 4OM1L 4GKSA 4XGZB 5ANME 1U58A 4JHWL 4ONFH 5DT1L 3STLA 4XP5L 1UXWB 4PJDF 3CDGA 5C0BA 3PHQB 4PJAF 2ORBL 4FTVD 4HKBB 4LSPH 4B5EA 2X4SB 1A5FH 3AXLB 3QCVH 2PYEE 3D18B 4NT6B 1QSEA 1Z2KA 5HDBF 5ESVB 1UZ6F 4DKEH 3QAZB 1F4AA 1HQRA 4UILL 1GOHA 4KAQH 3P4MB 5ACZB 43CAA 1EFXD 2VDLH 4LEOB 5ID0B 1E28A 3PWJB 3U0PA 3MV9A 2AEWA 1LO5B 3P0YH 4MJ2A 4U1JA 4X6CB 3QUMB 3GUTB 1CDIA 1MHHB 1I9JL 3HUJA 3ZE1F 5D6DC 2ID5A 2V2XA 1RAMA 3QNZA 4Q6YA 1RUKH 1P7QD 3MRMA 3CVIH 5D7KE 2CDFA 3ISWA 3IKCB 2VDLL 5E1HB 3L5JA 2LAGB 5J12C 2R23B 5ICZB 1JIBA 4TVPH 1I7RB 5TFSL 3BP6B 4O2EA 3ILQC 2IADA 5HYSA 2CR6A 3C9NB 4OAWB 4DGYH 2UUDH 1MNUL 3W9DB 1U8IA 4X6DA 3FQXA 4LNRB 1GZPA 3QO1A 4UOJA 1RZ8A 2PXYD 4F7TB 3OTTA 5L88H 2EXYD 4ZYKB 3N85H 5H37G 5HHNB 1A14L 3BKML 4HJGA 3L3DB 4WO4A 2X4SA 2BVPB 4JHWH 1CFSB 2GT9B 2V5YA 2FWOA 1A9EA 4PP1D 1S7QB 4ZFFB 1A4JA 3MR9A 4I8DA 5LKNA 4BH7B 3MGOA 4EOWH 4OKDA 3QXUA 5E8DL 4WEMB 1JJUA 1BQLL 1TJHL 3EAKA 4IRSD 4L5FH 1X5GA 1IC7H 1CS6A 2EDEA 3J7HA 3ZYJA 3H9SA 4L9LB 4X6CA 2FEDD 5ESQA 3CSYB 2VXQH 5IT2H 3VXTA 4P3DA 2FZ3B 3KAAA 3D39E 4J1UA 5DF0A 1H9VA 1D5XB 3LS4L 1EDQA 2X4UA 3GSUA 4PJ9C 4MHHI 1NKOA 4MVBD 4HT1L 4CVZB 3ZDXF 3BH9A 2R23A 1QACA 4QCIA 2B39A 1NCWH 2P8MA 3BGMB 3QFJB 1UM5L 3DRQA 3BDBA 3CFJB 3VXRD 4OCXL 4LVNC 1FL3B 1U8OA 5FO9A 2VR4A 2LVCA 3SGKC 3D6GA 4S1SL 4XC3H 3A6BH 2I5YL 4JHZA 4PY8I 3CU1A 4FABL 2NYYC 4Y4HC 4CMMA 4M6AA 1IM9D 4HZAA 5FGBA 3P0VH 1FNHA 4Q9QL 4ZYKA 3TBVB 1DBML 4ZUUA 4HJ0C 4ZPTB 4FXGB 3IGAB 3JSSA 4G5ZL 3N1GC 2DI8A 3CVHB 3MV8D 3QWOB 3Q2CA 1MCSA 3QQ4B 1PYWA 1TCRB 1KV3A 2Y9RT 5AYUH 2BVTA 3VG0L 1NAKL 1NBZA 4JRXA 3U9UA 1UA6L 2DD8L 1PX3A 3BMVA 1NCUA 2NY6C 4WFGE 3LKNA 5DGRA 1CLOL 2GY5A 4YDLC 1AI1H 5C09D 3W5NA 1DFBL 1XIWA 5CIPH 3PHOB 5E00B 3SKJH 5C0BE 2NY4D 1QQDB 3O6LH 4WO4D 2NY2D 5ALBL 1IRAY 4UTAH 1JF6A 2HH0L 5AZEL 5EORL 3VXSA 5ADOL 1MWAH 3RI5F 3FFCD 5I30H 3DYMA 3WFDL 4DVRH 5L8KB 4UQ3A 4XCYB 5E9DE 5I6XC 4OZ4B 4P2OC 3QIBC 2ZSWA 1C16A 4LP5A 5HDOA 3DRQB 4K3JL 3DX7A 2B0SH 4OUOA 4XCCH 5EULV 3KPRD 5HI5D 3EFDH 2YC1B 2C5DC 3HPJA 3VFOB 4MAYC 3FAXA 1MFEH 5DUML 4Y1AD 4LBEB 1VFAB 4BQBA 4CMMB 1MHPL 4XVUC 4NNPH 3QG6A 2C3XA 3RAJH 3CUPB 3NA4A 2GTWB 1WBZB 3MNVA 3HI1A 1KJ2L 2R1WA 2BERA 4MAYA 3ARWA 1OD9A 3NACH 3STLB 1T7WA 2FJGB 4HIXH 4M7JL 3DUUB 4W4OC 2HJLB 1JYVA 3TPKA 3U4BH 2PF6A 4GLRI 5T3ZH 3KJ6H 1IEBB 4YHLH 4YPJA 3M1BB 1AIFA 3KPRE 5FOBB 1GOGA 4PV9A 3MUGB 4MGXA 2VLRD 4PJCE 4Z0XB 1EXUA 4J4PC 5C6WH 1OQOA 1QQDA 4OTXH 1BWWA 2V5MA 1JK8B 5GGRA 4S1DD 4GUPA 3RP1A 1AY1H 1IGCL 5EFIB 3AVEA 3FQRB 3C08H 4F33B 2LV4A 1JNNH 3EO0A 1CLYH 4UNTA 3C09B 4PJ7F 3VD9A 5JW5A 3LQAC 1FNEA 2OL3L 3MJ8B 1A7RH 1K8DA 3VXQA 1HCFX 3WJLC 5DGQA 3AM8A 2PW1A 1QSFE 3MLRH 3VWKA 3UTOA 2R1YA 1RHHA 4GMSH 4WI6A 1U92A 2DICA 5MI0B 4NSKA 3LHPH 3I6GA 4UDTB 2AKRB 4JZJA 4Y16D 3IFLL 1A7BA 1CGWA 5F9DC 1YEEL 1DFBH 3HI1B 1H5BB 3HAEA 4Y5VB 4LSSL 9CGTA 3OX8B 2IBBA 2VDPH 5C92A 4NQEA 2BSRA 5GRUL 3PNWA 4Y0GA 3O11B 3I3BA 3VI4E 2XQYG 5DEGA 2DQGL 1L0YA 2MNUA 3OV6A 4JFQB 3U9PL 4NBXB 5C70A 4H1LA 2N7BA 2GSGA 1RJCA 3DX8B 3MRIA 4FXLA 1M7DA 3D5OF 4YBHA 3Q6FA 4QHMA 2Q3ZA 4XVUD 2ZCLL 2D3VA 1ZA3A 1CD8A 2Q7YA 4FQXA 2Z4QA 4EUPH 3HLAA 3O2VH 4MAYD 4XCCL 4XXCC 3MRGB 5E5RB 1GL4B 2ED7A 4WTWA 3UROR 5LWYH 4NC0B 3LQAH 4XPAL 3AAZA 5J06A 4L8SB 4HKJB 1HILB 1WJ3A 3GJFH 3F5WB 4DTGH 4TSAL 1I3GH 3GRWL 3AROA 2F74B 4LCWD 4MA1B 4P3DB 3WE6A 3UTQB 5HGGS 5AZ2L 1D5BA 3KLHD 2EKJA 3GBLA 3CIQA 3PG2A 1JPGA 4S2SB 4XCNB 3IDIB 4IRJB 1N5AA 4ODSL 5FKAA 2FLRT 3C8DA 3QCUH 5T3ZE 3RVVD 1MCWM 5EB9A 3I6GB 4UDTA 1A1MB 5IFJB 3LKQB 3LKPA 3BPLB 2ZUUA 5KVGL 1T20B 4BK5A 1YMMD 3HE6D 3NH7H 3MJ7A 4PGDA 3RUGF 1DQDL 5I76B 5T1LD 3TJEL 2BSED 3RY6C 3MRNA 4HUVA 1GVIA 1Q9LB 4P5MB 4R2GB 4PGJA 1JWSA 3CVHA 4HXBH 3TH4T 4OCSH 1NGWA 1UXSA 3ORJA 4PRHA 1YEGL 4X6EA 3CFKB 3BIKA 1AHWA 1T83A 1ACYL 1DSFH 4I48B 3BEWA 3QFJE 1LEGA 2W0FA 2FX8H 3QEGL 3VDAA 3TM6A 5C07A 4LCYB 3O3EA 2NY5C 2PR4H 3S6CA 5DDHB 5E00A 1S9XA 2UZXB 2VLRE 2AJVL 2DBLL 3KR3H 3VH8G 1I1AD 2F5AL 2XXMB 4ZOCA 3CX2A 2X4TB 1XF3B 1KT2A 4XNMA 5D5MF 1ZANL 2R56L 4YHYB 1FRGL 1FG2A 3CDCA 5J11B 4XCFH 4IRJA 2I07A 2FYYA 1F4XH 4LF3B 4HLZG 4MJIB 5TQ2H 1ZHLA 1EZVX 2Z8RA 1F6AA 5DS8A 25C8L 4U3XA 2EEBA 4QOKA 5L9DH 5E7BA 1A1MA 3O6FA 3JWOH 4D0CB 5E2TH 4FN0A 4UAOB 4C57C 5K9OA 4TTDC 4JG1L 2R29H 2F54D 2EDTA 3DUSA 1S9WB 1B2WL 4JFEB 4YLQT 3F62A 3E6FB 5C7XL 3PWNB 3I6LE 2R9HD 1TPXB 3JWOL 1CXFA 3SDDA 4K7PY 3TA3A 2YD2A 3T3PE 1EMTL 2AXFB 5SX4H 4ZS6C 4K8RL 3KYNA 4MA8H 1PG7W 1FZMB 2XZAH 4P4KB 4WI4A 5JDSB 1GGBH 4FQHA 4Y2DC 1FVCB 4DN3H 4K2UH 4F9LA 1R3KB 4IJ3C 1FRGH 2YBRB 4OV5B 5J3HC 1MREL 5JUEL 5KVEH 5IQ9B 1I8LC 4ONFL 5DT1H 4ZPVA 4Y2DA 5DVNA 4UIKH 1IAIH 4Z7VB 1P1ZA 2Y1VA 5EUOB 2M26A 4BQCA 2BVQA 3WLBB 3T8XB 4KKCC 5SX5K 5F71A 4K3DH 5EUKA 2VL5A 1NMAH 2X9YA 2W0KA 5DO2C 2Q86A 2H3NB 2KZWA 5FAAA 3AREA 4LSTL 5CS7A 1CDGA 1XGPA 4QOKB 3MJ8A 1QOKA 3DMMA 4FQ1H 5MEND 4YXLL 1N59B 1A6PA 5IBLC 3RIFK 1R5WB 4UBDC 4JFEA 2EXWC 2P4AB 1JGEA 4AG4H 3BP5B 2VDML 4FQJH 3TBTA 5FYJE 1HK6A 2OYPA 1AO7A 1F4XL 5L2JA 3C87A 3ESUF 1E6JL 2PO6A 2AXFA 4M00A 1Q72L 2D31B 2AXGB 1D6VL 4N0YH 1A7QL 1VACB 1E4WH 5KTEL 1PEZA 5T1KB 5FYKE 1T2QH 1W72B 3BUYA 3O45B 4M62H 4U6XB 4YAQA 1L7TL 5SX4I 4U1IB 4YO0A 5GZNC 4CUCA 1IGTB 3IRPX 1DQQA 1KGCD 1T66D 3GZKA 1QYGH 4YDJA 3RGVB 1EX0A 1H0DB 4O58L 1Z5LA 4E42A 3UXFA 4QTIL 5I1CL 3KYOB 4LKXB 1D5MA 5DJ6B 3VWJA 3LB6D 1VEMA 5EIVA 3AS1A 4HMCA 4FNLL 3M17A 4G9DB 5AUMB 2PKDA 1NLBL 1WWBX 3MODH 3KNBB 1AGBA 3D18A 4L4TD 4NT6A 4J3WA 5T5FL 5DD1H 4P46C 3K2MC 3DSNA 1DBBL 4NQSB 3BO8B 4APQC 1IKNC 1QNZH 3U48A 4JO1L 3C8HA 3T1FA 3K1KC 2OTUB 2CGRL 3QDMB 3GNML 4UT7H 3CZFB 1FLRL 5CWSB 1A6VL 4FQLL 3U83A 1SBSH 3JZ7A 4HLZH 1MEXL 1MWAA 1A1NB 3V5HA 5LCVL 4EI5D 3U1SL 3L9RA 5C6TH 3OAYH 1LEKB 1PZ5A 1CIDA 2JELH 3I6LD 1Q9LA 4TSAH 5I8CA 3ZHKA 3ARUA 1RZGB 2C1PA 4JO2L 1MPAL 1BFTA 5GS1B 1WT5A 4PJ7B 1TQBC 1AFVH 4PTUB 3PJSA 4MJID 4HUKB 3RGVA 5C07E 3VFVA 3O4OC 4JFHE 1K4CA 3IJHA 4UT9L 5A16B 5TH2A 3O3DA 4EIZC 1MRCH 5C0GA 4BKLA 1VA9A 1HXYA 5DJ2B 1CICA 3E0GA 1OP5K 1D5MB 1T5XA 5DJ6A 3U79A 5B8CB 1Q94B 4HJGB 2BXYA 4PRID 3HG1D 1JGVL 1J9CT 3BD5A 1WWCA 4Y5XA 2GT9A 3RGVC 1JWUA 2G5RA 3MV9B 4JFZL 5EC2B 2Y5EA 4LASH 3IU3A 3VH8A 1F00I 1G7HA 3KJ6L 4GS7B 2F58H 3BP4B 4UUJA 4Y4KA 1RD6A 3L3JB 5I75C 1XF4A 4O9HL 4PGCA 2YPLB 1FYTD 3MRMB 4LEXL 3FOLA 3VXMA 4RX4D 8FABB 4L9LA 4X4XA 1HH9B 5IP4A 1JZ4A 2J5LB 1Q0XL 3QJHA 1F02I 5MENE 3PWVB 3NA9H 2UVFA 5C6PB 1QR1B 4GG8B 3WUWA 5BOPA 5DRZB 4PJFA 3X3FL 4IOFC 3F7VB 2X4UB 1B4JL 1U8IB 1MFCH 3TJHD 2DTML 4HX1B 4Z7NE 2B0SL 1ORQB 3UBXB 3BZFA 3BMWA 5F3BB 5KN5B 4FQ2H 4CU8A 4ZUWB 4JFDA 4DUXA 3EBAA 3QIWA 3L3DA 4WEBL 4WO4B 4ENEC 5BV7L 3BE1L 4ODUA 3UZVB 3CCHA 4BFIA 5KS9E 4KRPC 1TVHA 4MB4A 5C0CB 5EU4A 4G8FA 1JGDA 3EYOA 5DJAA 1TTGA 4AIOA 2AEQH 2LTQC 3K74B 1FG9C 2VC2H 4R0LA 2N4IA 4UTBL 4IM8A 2AK1L 5EOTB 2VDKH 1CBVL 4LLUB 3KS0H 1V05A 1Q9KB 1RZIB 1ADQL 5DD3H 3T0EC 1OAYL 4WFED 4IOFD 1XF4B 5B8CC 3V5KB 2YPLA 3LVEA 5HGHB 1T2XA 3SGDI 3GIZH 1P4IH 5GRVL 4JG0H 1CICD 3LQZA 3P4OB 4AENA 2OP4H 3TWCH 4B0MM 2PCPB 1N59A 3T0EA 3WFHB 2ADJA 3VMPA 3RVUD 4LEOA 3RGVD 1J1PL 3GMNB 3ZKMC 2I27N 3EDEA 2QEJA 4RDQG 4NHCL 1AO7B 5HY9A 4HX1A 3MOQA 4LLAA 1YNKL 5GRWA 3RVTC 3DX7B 3WXVL 3TIEB 3UTTD 3HCVB 5ALBH 3KPLA 1A4KB 1OVZA 4I18A 1PYWB 1G9ML 1LWRA 2E9JA 2F53B 4Y4FC 4NN5B 4P5KB 3DRTA 1XFPA 3P77A 3RU8L 1S9YA 3ZKNC 4NJAH 5CKAA 2RHEA 3PWLA 5JPNA 5FGSA 1UACH 1TMCB 2W9LA 4LEXH 4LNRA 1DE4B 2RR3A 4J6RH 3LRGA 2VDKL 3DV6B 2D7QA 1S7TA 2PTTA 4JFDD 4C83B 2A9MH 1ERNA 1PZUB 2A9NL 3L7EB 2BVPA 4RWHA 4X7EC 4QXTA 4IMKA 1P4LA 4L8CA 2DJUA 5IJKA 4Q9QH 3I75B 1I1FA 4RRPA 5KSAC 1DBAH 4MAUL 1I7TB 5IBUG 3VXSD 3ZKXB 1HYSD 4PJBE 1MCLA 1H3UA 4MS8D 1VPOH 4U1KA 2VZ1A 5F1NB 3VGHA 1QVOB 3OKLA 4Z5RB 1EEUA 5I1EH 4GJTB 3QUZC 3ARBA 3QDGA 3INUH 3K4DA 3CSYA 5ABDE 2FB4L 3SJVD 3IVKA 4Y1AA 3V5HB 1KPUA 5A2LH 3QFDB 3C2SA 2FBOJ 4HULB 1NGPL 1KLGB 2F15A 3PABA 1HINL 3VXNA 1HEZA 4MAYB 5I16B 1MJUH 2FJFB 3P4LA 2JIXD 3QUZA 3LPGA 4OIIH 5GS0H 5CSGA 4GAJL 4LPYA 2R2BB 5JIKA 2H32H 4PJ7A 3IB4A 4I77H 1BBDL 3ULUH 1RIUL 5SWZE 4XHJD 2GFBA 3T0XA 4GG6B 4B7LA 4ZQKA 5IMOB 4EDWH 5T33L 5I8OH 2J8HA 4LHUD 5C0GB 4KJYA 1MCIA 1EXUB 1FFRA 4IRJD 4E5XA 1KLFA 3BZEA 1DANU 2IFGA 4ZPTA 3ARDB 3HRZB 5TPWH 3ROLB 3RTQB 1JWUB 4AEEA 4P57A 4FG6C 1C12A 5JO5A 1BAFL 1TCRA 2DYPA 5GGSB 2DKUA 5JW4R 3RIAF 4I0PD 1A2YA 2X09A 2HFGH 1A0QL 4XNYL 4E41B 2XV6B 1VKXA 3HMXH 1E4JA 3WFEH 4PV8B 3RQ3A 5DVLA 3FO2A 1G7PA 1ZHNA 3LZFH 2PW1B 2X1OA 3BWAB 3RWGA 1KB9J 3O6ML 5SWZD 1FBIL 4X4XB 4NM4L 3L3HA 2G60L 4L29A 5IMMA 2P48B 3QJHB 2IALA 5C7XH 1A02N 1TZGH 5IB2B 2YN5A 1MJ8H 4YEEA 3I3DA 3G6JF 4PRDB 3ZE2E 1NL0L 3GO1H 2FJFA 4OZFH 1FVEA 1VB9A 1MFBL 3H9YA 3O11A 3K4AA 3Q6GH 5E8NA 3W39B 5C71A 3RWEA 4ODUB 1OAQH 1FHGA 2R56H 1YNLH 2VISA 2XTJE 2OR7A 3G5ZB 4ZQKB 2OXGA 2XWJA 4QHMB 1A7OL 5CZVL 3E6HA 4LIQL 2IH3B 1ORSB 1MCOH 3B5HA 1INDL 4XVTH 5DMGD 5GGSY 3WYRA 1WFOA 1PY9A 5I8EA 1J18A 2NTSP 2FJGA 4K8RD 4TPRL 4Z7WF 1D9KD 2JE8A 3SJVA 2APWA 4E41A 4O5LH 3O3AB 4O58H 4P2OB 1AR2A 1NC2D 3UZQA 1S7UB 2EDWA 3C8KA 5DVMA 4CMHC 5D5MA 1OP9A 3DROB 1A6ZB 1EGJH 2E9IA 4UIKL 5FHAL 2FECI 5AWNL 1MRFH 3CVHL 4U1SA 4NFCA 3OJDB 5IF0B 1U95A 4O2CB 4Q9RL 4F33A 3VG9C 3BPNB 3MV8B 1IKFL 1K5NB 1QKZL 3QQNA 2R8SH 4PRPD 2E7LA 2QQNL 3T2PA 3MRHB 1TJGH 4EQ2A 3O2WH 3OB0H 4AG4L 3SJVE 5CZVH 4KGLA 4HV8A 1WCQA 3RWEB 2A77H 1G6RH 3RIFF 5AZ2H 5E8EA 1YNLL 3VFMB 4JM4H 3RWJA 3TBSA 4YR6A 3T09A 4HJJL 5BRZA 1FPTL 3HRPA 2ICWA 3QUYB 1N3NA 1AHWB 5F1IB 2A6JA 5D70L 1NMAL 2GJ6D 2Z8WC 2OR9L 1IZKA 4PJHE 3WNKA 2X41A 2CDFB 4KHTL 4GBXC 5B3JF 3EIFA 4Z76A 3CK0H 4H1LB 3I3EA 3RVVC 3ARYA 5FKPA 1JPSL 4NWUL 2BMKA 2IADB 1CL7L 2BNQB 4HBCL 2LU3A 2P45B 2XWBB 4U1NA 5KAQG 4ZS7H 1ZA3B 4MJIA 1CXEA 1KJ2B 1ZHLB 2G75A 3JVGA 4JDZA 4ZFZA 3RL1A 4QGTA 2VYRE 2VITB 5TQ0H 4F7TA 4KJPD 4P46A 4MCYA 4FFVC 5EO1B 4LARH 3T4AA 4HKJA 1JYXA 4TN9A 1YUHA 1U8HA 2QADB 5HDQH 4TUJB 2OMBA 5FGCE 4FFWD 2JTDA 1EO5A 3A67L 3LN5A 1XGPB 1KPUB 1A4JB 2P24B 1ZVSB 15C8H 5CJXC 2Y5TB 5DRNA 3BN3B 3D0VA 2A6IB 3TZVD 4HXAL 1T7YA 3OKOB 3HAEG 4Z7UB 2HVKB 5F7DA 5FDWB 2EDQA 2PW2B 4OF0A 1KIRA 3RWCA 4GAJH 1MSPA 3BEVA 3NPZB 3C60B 3S37H 3WN5C 4WW2C 4JHAL 4QO1A 4P4RA 2PO6B 5BJTB 3QHZL 4HIIA 1X4YA 2H8PA 4WGWB 2KH2B 3HFML 2J8UF 1NGPH 3WO4C 2NW2A 4ALAL 1N4XH 4XVSH 1U58B 2OX5A 2V2TB 1BVKB 1S7SA 3NCFB 4DK6A 3FT3B 4OF7A 3DI3B 2EZ0D 3FO9A 4CN6A 4LSQH 1QFWH 4X7TA 1UG9A 3PV6B 2F19H 3MV8E 1JF5A 3KPSE 2P44B 3VFWB 1JZ5A 4EN3C 5GRXG 4JZOB 1VKXB 4NBYB 1KXQE 4R3SB 4WFFD 4M61A 1FN4B 1C5CL 3AB0B 2OJEB 1NANI 4Q74A 3T4AB 3LKRA 4GKNB 4ZFOL 1DUZA 3RWGB 1KYOK 4NP4H 4M7ZB 2CLRB 3FONA 5D72H 1ETZA 5ISZD 4F57H 1OPGH 4B50A 5I66A 3AS3A 3FHQA 5SWQB 4WTXA 1NBZB 2IQAB 4YNYA 5FUCC 3MUJA 2CKBA 1YEIH 1QBMH 5H8DA 3TVMB 1B0GB 5C0RH 5HYJB 1KIRB 3T08A 3QCTH 3BEVB 1Q0YL 5HGDB 4F7EA 4GKOA 5E2VH 3VXUD 3MLPA 1U6AL 3DUSB 5GPRA 1MWAB 5LGJB 2XNAB 1C08A 1F42A 1A47A 1FGNL 3P73B 5DQ9A 1G9NL 4Y1AE 2NW2B 4HWUA 5DMIL 4XAWH 4H1LH 1Z5LB 2D2OA 5MEPB 3ZDZF 1RZGA 1QBLL 1NLDH 3KXFA 1PG7X 1UA6H 2DD8H 3LSOA 4LSRH 1J5OH 4BFBD 1CT8A 1FVCA 4JO3L 4M8VA 2XFXB 4J8RB 4C56D 4TRPH 4BZ2L 4YE4L 3THML 4JFFB 4I9WD 4P2QA 4U0RB 4YGAB 2Y6SC 1NCAH 4R97B 3GJFA 5HHVL 1B0RB 5KVFH 5B8CA 2FH6A 1TTUA 5D6CA 3IDNB 4XNQB 4RQQB 2NY7H 3U9PH 4L8SC 4PJCA 1RJLB 2AABL 5ANMA 2YRPA 3KYKH 4K7PL 2B1HL 5GGTL 4R2GD 5IVZA 2AEIT 3ARRA 4Z7WA 4QT5A 2BHYA 5DUPL 2XA8H 5DR5H 4G9FA 1B0GA 2XPGA 1S3KL 4J1UB 3DV4B 4XH2A 3A0OA 1T0NA 3GSUB 4Y4KC 2J12B 5MENB 4YZFE 1TVBB 4QTHA 3NN8A 1WGOA 3OG4B 4L3ED 3Q3GA 5HHVH 5T1DH 1D5ZA 2E8YA 3VFTB 5KVFL 1Q9OB 4N0CC 3UTZA 1A7RL 4JDTH 3PDOB 4WNQB 1QSFA 1QUNA 1BJ1J 3OKKA 1N3NB 2DM2A 2WP3O 4K3JH 4GO6B 4R8WL 2R0WL 1MLBA 3KPNB 2DLFH 4YC2C 5KN5A 2EE2A 1K3ZA 1Q1JL 4LLVB 4DKFH 4Z7VE 5C0DA 4OFPA 5D72L 1G7IA 4ODHL 4XAWL 2DRUA 1ZT7B 4ZAKC 2KDGA 2IMNA 3EYVB 1XGTB 2BX5A 1JGDB 3IU3B 4G8FB 3VH8B 4WHDA 3QXVA 1FZJA 4UUJB 1EJOL 2C3VB 1UKSA 1H5BA 5C0AE 2WLZA 1H8NA 2CUIA 2DS4A 3AU1A 3LKNB 4JR9L 4QRRA 3FOLB 5J89A 3Q0HA 4NQEB 5TDNB 4M7JH 2AABH 2DM7A 5CHNB 3QDAA 5EU3A 1BF2A 1DBKH 2BNRD 1SVCP 1YUHB 4UV7L 3WV0A 1F6LL 5D7JB 3OMZA 2Q7NA 5A2FA 3ULVF 1JRHI 3D0LB 1YZZA 3TV3L 1MF2H 5DRZA 3B9KC 3X12A 1DCLA 1CG9B 1DL7H 2WUCH 3HMXA 3QHZH 1OAUH 2EC9T 3MLTA 1G7JB 1OSZA 3SKUD 1GGYA 4ZDHA 2MPAL 1HWGB 4GXUN 4JRWA 4MA1C 4OZIB 3MJ6A 3WFHA 3SKMA 3B9EA 4M5ZL 4LSRL 3P2TA 1BD2E 1AKJD 4JFPB 4GRLD 5HY9B 1K4DA 4JLRA 4P2QD 3HA0A 1VADA 3NFPB 2IAND 5F7EH 4ZO7A 5H94B 4C55A 1S9VA 2NY1D 2R2HB 5BVJB 3OAUL 3IDXH 2X89A 4OCNC 3BYTA 1YEFH 2CR3A 4J23A 1U3YA 1XGRB 3TLRA 4AYFA 3LS4H 2EXYC 2W1NA 3ILQD 1BIIB 1DEDA 4DEPB 2F53A 4KJQC 3SO3C 2WIIA 1HKLL 5FUOH 1EA9C 5IFJA 3QIUD 3GI9L 5BS0A 2I9LA 3C5JA 3LKSB 4IRZL 1QNZL 3CH1A 3IJHB 4OFYA 1OGAE 4L5FL 3RA7H 1FAIH 5IBTH 3QQ9D 4KI1A 3ES6A 3F65A 3TO4B 5EU3B 4F57L 2W91A 5HPMB 1WWAX 5KZCD 4X0KA 1FV1A 5IM7A 4A2MA 1NLBH 3V7AE 1DVFD 5BW7C 1D6EA 1NUGA 3MBEB 3P11L 1NDMB 1GGCH 5LGHL 4KU1A 1RUAH 5EFIA 5EU6B 3X14A 1OP5H 3D3VB 4EUPB 5JXEA 4O5LL 4OCLC 32C2B 2ZOLA 3QEHB 1NGYA 1UEMA 4DQOL 4LHQB 4MQSB 4PLOB 5JIIA 4HS3A 3QEQE 2OJZL 3ARXA 3L1OH 4C56B 5KSVA 2V17L 7CGTA 2GITB 4XT1C 4X8JA 1ITBB 4QXGL 3F6IA 4H26B 4HS8H 4JZJB 5LGJA 4E41D 4HS6B 4V2BA 5ERWA 4M6OH 2EDYA 3FRUA 4KK9D 2OR8A 2YSSA 3P4NB 4Z77B 1AD9B 2F9BT 3GHBL 3MACH 1JGUL 2WBWB 1I9JH 1A6WH 1WWWX 1G6RA 5FO8A 3BXNB 2ICWJ 3FB5B 2NQCA 1JPTH 1QG3A 1G1CA 5E8DH 4YIQB 1I4FA 4G8EB 3VI3F 5HGBB 1BQHA 2EIZB 3L3GB 4G3YL 4G6KH 5IMOA 3AFLA 5FHAH 5F89B 2GQHA 3S34L 4LPTA 3I9GL 3H9SD 3MRRA 1KJ3L 4ODWA 1JMXA 4CADA 3MRLA 4KRMB 3D48R 4LQFH 5ITFB 3D9AL 1BD2B 5E5MB 1U3HA 2FX7L 4H0GA 32C2A 4WW1A 3BIAX 4UDUA 5E6IB 5A2IH 2BC4A 4HKXA 4IHOA 5FYKL 1FQ9C 3V5KA 2FSEB 3OKMA 1KLGA 3FO2B 4ELMB 5F9OH 3W0WD 4KRLB 4TVPL 1CZ8H 4ZPVB 2F53D 3P9LA 3E3QE 2GKIA 3KPRA 3CZJA 1IFHH 2IALB 2DDQH 1ONQA 1KUMA 3GMNA 3PDOA 4WNQA 2MCG1 3CFIC 1RIUH 3FRUB 3VFGL 4XP6L 4O51B 1JPST 1SBBA 3IFOB 4XRCA 5MP6H 4HZLA 4F80A 4OD1L 1PKQA 1DDHB 2AJYH 4YHIA 3AREB 3DPBA 1OAXL 4ZOAA 2QHRL 4DWHA 2E5EA 5E7FA 1KCKA 3H9ZA 3QZWA 1G6RB 2ZJSL 4XBEH 3G6JA 2GUOB 5HD8C 2LVEA 4KVNH 1N6QH 2HT2D 4WVRA 1X5LA 2VDQL 4HS8L 4I18B 1Z9MA 5GZOD 5ID0A 1UXSB 4HWBL 2DQTL 5I1HH 4OZHE 3O2WL 3CC5A 2UY7A 1C1EH 2HFEA 2IFFH 1A5FL 2DWEA 3HMXL 5E6ZA 3STBA 2VLKD 2OJZH 4XCFL 1NDGB 4LKCA 2PETA 1EFXA 3Q6GL 3MRQA 4MSWA 4NFBA 2ICES 1EV2E 2X6MA 3G6DL 4PB0H 3SDDC 3OXRA 1N2RA 4Z7QF 5I1AB 4HCRH 1CQKA 3TA3C 4KKBC 2WUBL 5CBEB 1RUAL 4GQPH 1LNUB 4YHMH 5TDOB 3MRKB 1OTUC 1FG2B 2BY3A 1MHCB 3VD4A 2HVJB 3B6SA 1IGIL 1FVEB 2B4CH 4XCEA 3BFOA 3QO1B 3QO0B 1OF2A 4U6YB 1F3JB 4V1DE 3BSZH 4HEPG 1QLRB 4HAFA 4U1SB 1OLZA 3OQ3B 2K7QA 3QUKA 5KAQF 3VWJB 5F6HI 1HSBB 3OKEB 4DVBA 1XR8A 3HMWL 1INDH 1CFSA 5FUZL 4AEHL 1KTLB 5E8PB 4XMLH 1EHXA 1YN7A 4ZTOL 5DLML 2GTZB 2CKBH 2EYTB 2XN9E 4EEEA 2ITCA 1XCTB 3IDYC 2AJUL 4NOBA 3DXAD 2VDRL 4G6JL 4PJEB 5KVGH 4HKZB 1O5DT 2Z8VC 2WWKO 2EYSB 1QFOA 1JTOA 3O3AA 3G5VB 4OI7A 4K94L 4V1DA 3HE6B 1H15B 1U8PA 1J1PH 1EFXB 4NO2B 5GS0L 2AGJL 1PQZA 1U8MA 3MNWA 3IYLW 3QYCA 1QPPA 3VJ6B 1WZ1H 1LK3L 4P23D 5D1QA 2HT3D 5GJTH 1CXKA 2BSSA 2PO6C 3GI8H 1UZ8B 2ZCKL 1YECH 3MQIA 5CBEA 2O61A 3GIZL 1D6EB 4U1HA 2KL6A 3C60C 1OTTD 2WBJD 4LGPB 1E4XL 3VXUA 4JQVC 1NBVH 1FFPA 4PG9B 4OIBA 5D1QC 1DBJH 2ENSA 5EPMB 1A0QH 4YDVB 2CRIA 2V7NA 5D2NB 3ALWA 3RU8H 2X89D 4MCYB 1BAFH 1M1SA 2CH8A 1G9MH 4ELKB 3DJ9A 3ARFC 2EXWD 1BMGA 1EFQA 4LDOB 1CFBA 2JIXA 3QUZD 4OZHB 1KIQA 2VSDA 2ICEA 2KZ1B 4QKXB 1EO8L 2IMMA 1N0XH 1H3TA 5BV7H 4JKMA 3T2QA 4WJ5B 4JDVB 4Z78B 2BHZA 5B38B 2NY5L 3WO3B 1WEJL 4F7CA 3MSPA 1QA9A 5E6ID 4QF1A 3UTSD 3SY0B 1IGJB 2F8XC 3OF6D 2NY0B 4LMQI 3V4UL 5E4EC 1I8MB 2V5RA 3L3IB 5EA0H 1JZ2A 1QBBA 2DQHH 3RNQA 2H8PB 3MNWB 4G9FE 2HWZH 2X5PA 4XNUH 3MRRB 2ADFL 2FB4H 4BZ1L 2BSSB 3OKDA 4OLVL 3FT3A 4JJ5B 4PJ8A 3MRBB 5I9QC 2VLKE 1YQVL 4LKXA 3NFNB 3EYFA 1PD6A 3PIQB 3LS5H 4RGNB 4ZFGL 2I24N 4ESKA 3BQUD 3QUXB 2SEBB 4N9GB 1WFNA 1JZ8A 1AXTH 2R15A 1VFAA 5JLZB 3QI9D 1ZVSA 2V9RA 3QG6B 3OXSB 4PJ8C 5GGVY 1JGVH 5CKGA 4QWWC 2OP4L 3TWCL 4GRMB 5GGVH 1LP9E 4YHLL 4Z7UA 1LQSR 5FDWA 1CICC 4K55A 5I8KL 4BFEA 3ARFB 4O02L 4PJHB 5SWQA 3CZFA 1HQ4A 2EO1A 4Y5XC 4O2CA 1MCFA 1N7MH 4O4YH 1HWHB 4WHCA 4UQ2B 3FB6B 1LK2B 4HPOH 4JN1H 3SCMA 2HWZL 1FC1A 5EC1B 1LEKA 1YECL 3GKWL 2R4SL 4TSCL 5HHPB 3WEXA 5JHDE 3MLYH 4X80L 3RUGB 2GK2A 3UTTE 2AEQL 3L3IA 5I1DA 4KGJA 4KI5C 1RK1A 2X70A 3MRCA 5IR1B 5IESL 4PIRF 4ISVA 3RNQB 1HHKA 5EWIL 4RFOH 5ETUB 3VFWA 1CDBA 4K94H 2AXHA 2ICWB 4PJAB 1DZBA 3QUYA 2DWEB 4XB7A 5C3TA 4D94A 4J4PA 4PJ9B 5E24E 3MRBA 4TNWK 4OLYH 4QWWD 5E1AB 3OAYK 1YJDL 4GW1B 5IESH 4Y5XB 3EYQD 1HKFA 3MLYL 2QKIA 4ENED 3NA9L 2OZ4A 4Z18A 1NAMH 3P77B 4OI9A 3KHQA 3RBGA 1NFIA 3NZ8B 3Q5OA 4OZFB 4XGZA 5C1MB 4OF3A 1RHFA 3U4EA 3V7AG 1QO3B 2FATL 2X40A 3B9KA 4U49A 3IU4L 2UUDK 4OZGB 1E27A 3VG0H 3VWKC 4X83A 1CBVH 5I8KH 3GFUA 4R0LC 1HQ4B 1HOCB 4FP8H 1HSBA 4L4TB 2HAZA 5I17B 4QXTB 4NO0A 4KQ4L 2IAMC 4G6FD 4X7FC 4U1LA 1F8TH 2AJ3B 4NN7C 5B4MC 5KTEH 4JY6B 1A7QH 5EZIH 3S96A 1FL5B 3LMJL 1QLEH 1MJJB 1YMHA 1ZKAA 3LOWA 3LS5L 4F8QA 4ZFGH 2A74A 4DKAA 4X4ME 3S37X 3VFRA 4P59H 4J7RA 4JGJA 3GMOB 3GMMA 1KEGL 4V1DB 4BSJA 4AMKL 3JV4A 1JN6B 3IT8D 4RMQA 2XA3A 1FNGA 1ITCA 4PJBA 1AC6A 3BYYA 2BVOA 1I1YB 5I2IA 1HCVA 3MFGB 4H5SB 4S1QL 4O2FB 5EBWB 4G9FD 5T1MA 1Q0XH 4QHKJ 3E2HC 5CAYB 4FNLH 5I16A 3OB0K 1GXEA 4NWTL 5GZND 5FKAB 5JA8B 4UOW1 4QYOA 3EYVA 1T1ZB 3FO9B 3TYGL 2YD7A 2YPKB 4HFUH 2W9DL 2P5WD 4Q0XL 4ZO9A 4XWGL 4X5WB 1S7WA 4XNXL 3SO3B 3O2DL 4CW1B 4CDGC 1P6FA 5D7IF 4WHYH 1R3HB 1W0VB 1JNHB 1MFDH 1NH6A 3X11A 1V7NH 4P23C 4JPVL 3FQNB 3LN4A 3KWWA 2IH1A 2CDEA 3EGSA 3DETD 5HYQB 2VIRB 3MV9D 3NCBB 1JWSB 4JE4B 3V0VA 2DIAA 3OZ9L 3B3IB 5IBLD 4ODVL 1CFNA 1MLBB 4DZ8B 1DBJL 3KPNA 4YK4B 5J6GB 2ZSVB 5CILL 3HPLA 5HYEA 3MLSH 1MJJA 1YMHB 2P5ED 1CTNA 1NC4D 4MQTB 4F7CB 3IXTA 3D85B 5IHUL 4HWBH 2FHFA 2Z31D 4M1CC 1K4DB 4JLRB 1XCQA 2AJZB 5TE6H 3PGFH 1AGFB 2C1OA 3D3VD 4P2RB 4Y16A 5IMKB 5J11C 1JZ3A 1WFTA 1C08B 2I26N 3P73A 4HBQA 3T0VA 4HUNB 4K94C 3CFCH 5MHSE 4RZCA 2AXJA 4MJ5B 3V5DB 1WIPA 3S8WA 3GBNH 5E94A 1I1CA 2Z8SA 4JB9H 3ZKND 5CJOH 1SQ2N 3LV3A 3G04A 2VR9A 4P0DA 4NDMB 4LFHD 2CDGB 3MGTB 4D9RE 1DBBH 4G80B 1U3HC 2XWJB 5ID1A 5J3HD 1OSZB 2AEPL 4J3OC 2BVEA 2VN7A 1UH2A 3LN9A 3W9EB 3PP4L 3L1OL 1OCWH 5F1NA 4AL8L 3VXRE 1QVOA 2GW5A 2VAAB 3FZUD 4FFYL 1HIML 4PJCB 5HVGB 5MHSD 1FZMA 3MA9H 3UJIL 3X14B 2WZPD 4UBDD 4L8BA 4HMDA 4NRXA 3ZO0A 4HF5H 4Y1AB 3O8XD 3NIFE 2DIJA 4N0UE 2IAMD 3ABZA 2ARWA 5DZOA 1A21A 1T0NB 4ZNEA 4KRNA 1T1WA 1S5HA 5F9WC 3BGAA 2OBGA 5KANI 5I73C 5F9AC 1A8JH 4QNPE 3U0TA 2KQNA 5DFVC 4WI5A 4ZTPL 4X99A 3RA7L 5FHBH 1OLLA 3ALPA 2HT4C 3FQWB 4IMLB 1U93B 5TQ2L 4K2UL 4WDIA 4PYHA 5IV2B 2F54B 3GBMH 4PGEB 2IBZY 3HB3C 4MD4B 2XZAL 4Z77A 4WUKL 2B7DT 4IDJH 3IJYB 2ZZUT 5F7UA 5INDA 1N64H 4P9HL 1QP1A 2VLJB 4YXLH 1NDMA 4LCWB 5HYJD 5H37H 4PR5B 4ERSH 5C0EB 3DSFH 1XGTA 1FZKA 4C54A 3AREC 3L5HA 3GMLB 4B41A 2J7LA 4PJ5D 1WIOA 1QEWB 4PJIE 1J8KA 1MVUB 2EKSA 3DMMC 1OOAA 1A7NL 5L6YL 1UM4H 5GRJH 4YPGA 3P0GB 2EDHA 4M7ZC 4R4ND 1IC5L 3DUHA 1JYNA 3I6KB 1W2KT 4XPBH 4ODBD 5CP3A 4TVPE 4Q2ZA 4WW2F 2D7MA 4YHZL 4PRNA 3GJFK 3MLWH 5F9OL 2ITDA 3G9AB 4JKWA 4TTGA 3V0AC 4NC2B 5HGAA 4RFEB 5JW3L 1TNNA 3FRPG 4ONHA 4E42B 2CLVA 4TOYH 2VDPL 4JR9H 2UYLA 2DLGA 1MY7A 4GAGL 1CF8H 3FQRA 1I4FB 4G8EA 2ZUQB 2BFVH 3HNVH 3CMOL 4ORZC 5D96C 4MNQD 1G9EA 1JN6A 1AGBB 1U2CA 3E6HB 4NWTH 3ZYOA 4POUB 4ODHH 4OFDA 4R6UA 1RFDL 1YNTA 3U0WL 2JKXA 3VWJC 1F4HA 4JY4A 1D5IH 4KJWD 4JCMA 3PDDA 2HFEB 1T1YB 3BAEH 5B21A 5BS0B 5EIQA 1SJHB 1L0QA 2JJVA 3HB3D 4JDTL 4U7MA 1DQJA 2FX9H 1VFMA 1DLFL 4D9RD 5KZCB 3ARDC 4ODSH 4WFFE 1M71B 4PG2A 2H6PA 1DANT 2RCSL 3KLHC 1CLZH 1IAIM 1PSKL 3CAFA 4NQVB 3OJDA 3ULVE 2YK1H 3CXDH 1I3GL 3GRWH 1KJVA 5CJ8A 1DDHA 1UWGL 3VDBA 4UNUA 5J6GA 5H35A 1IGMH 2RFXA 1FN4A 4MNGE 3SE9L 4RAVA 1R3JA 4UI2A 4JO4L 1ETZB 5AD0B 2C3WA 3SGKA 4ODTH 4GRLC 3RPIA 4PFEA 5HVFB 2E8ZA 2A83B 3GGWA 3WHXB 4KDVA 1UVQB 4OGXL 5K9QI 2O5YH 4NZUL 1IILE 1YMMB 1P5UA 1AD9A 4RWYH 1ZLSH 4BELD 1WBYA 1C5DB 5DD0L 2P7TA 3HZYB 2IEPA 4K3GA 5L2KB 4FHBD 1AQKL 4CVXA 4MLSA 4K3HA 1QR1A 4KV5F 2R0KH 2HH0H 1PQZB 1U8MB 3N50A 4GKSB 4C56E 4HW6A 4KQ4H 2EDBA 4DUWA 4YZFF 3GKWH 1OD7A 2QSQA 1UFUA 4TQEL 3PWPB 1M71A 2GJZA 4FP8L 5HHOA 4Q9CA 3U4BL 1XIWC 3FQUA 4PJFE 4KKLD 2QSCL 3E2HB 2VB5A 3B5TA 3OPZH 5FXCH 1WCBB 2B2XL 1K8IA 3L95B 5MI0C 1YN7B 2QV2A 4HKXB 4IHOB 5E0QA 4WRLA 1AGEB 2NZ9D 1NAML 4DOHB 3C5ZD 3IF1A 4IRSB 1G7QA 1T1WB 3ZDZE 1K2DA 43CAB 3SCMC 1TZIA 2DQGH 5EU7C 4KI5F 1ZS8B 4R4FL 1EHAA 1WBXA 1R24B 3FQWA 1CIUA 4QT5B 3WIIH 4G8IB 4UMGA 4I0KA 1RUML 3AMKA 2ZPKH 1FYHB 1UENA 4GMSL 4OD3H 3UDWC 5ICZA 4NKDB 2FEEI 4LAQH 1CR9L 4NQDD 5CZXD 1JV5B 4X4YA 4IJ3B 4GKZB 5IQ7L 3WNLA 5DHYB 2Y23A 1QRND 2WIMA 3CC5B 4LVHB 5KS9A 1HHGB 2BVUA 1UWEH 2NY4B 3RHWK 1CLYL 3TO2A 3WIHH 2V5SA 2EICA 3IDYB 1YYMH 1OY3B 1MI5E 1JE6A 3VWJD 3LD8C 2O93L 3QIBD 1QLFA 4MD0A 2HT2C 1MHEA 3PE9A 4XTRD 4Q97A 5JDJA 4ODTL 5BCAA 4M93C 2CLRA 3UAJD 3HZVA 4TTDD 1IVLA 2W9EL 1FZJB 2FR4B 1S9YB 1U2HA 4YHOH 4L4VD 3G5XA 1AGCB 5IB3B 2OL3A 1I1AB 4XXDB 2DQJH 4I2XA 5J12B 4DW2L 1DR9A 3H9SB 1HI6B 4PJHA 4NO3A 4LCWE 3CDGB 5C0BB 3VWKD 2X4NA 5D1ZC 1DEEA 3ULSA 4K71C 4JZJC 4OLEA 3S4SG 2EDXA 1CI5A 1LEIB 4CN4A 4CRPA 1H3XA 2W0PA 2VL4A 1HQRB 4NKDA 1DBMH 1WVZA 2EDJA 4LSUL 5EOCJ 5D1ZA 3WL9B 3QXAB 4RGMB 1RK1B 5B39A 5I73B 4AT6A 5FA4A 4LPVA 1KCSL 2VKWA 4M9OA 4Z5RA 4HWZB 5KS9B 1SJHA 1A6UL 1N0XL 1UM5H 4MWFA 2AJSH 2V2XB 1D9KB 2FO4A 1UB5A 1G6RL 3EZJB 5DFWH 3IDNA 2VXVH 43C9A 1XGRA 5FUCE 5F72S 1BZ7B 1MVFA 3ARBC 4KTYA 2I25N 5DLMH 3FFCE 3QCTL 4KPHH 4R7NB 3PHQA 3R1GL 2EO9A 2R8SL 4D9LL 1EAPB 3B4NA 2LE9A 1IGYB 3GSNB 4UQ2A 3UJTL 5EPMA 3DO7B 2XRAL 4LFHG 4YDVA 5MENA 1H5BC 4KJYB 4HBCH 4PJEE 5SV3A 3QUYD 1OPGL 1Q9OA 3SDCD 5JHLH 3ROLA 1E28B 1HHKB 2NY6B 3BT2H 1KC5H 5ETUA 5ITBH 1NMBL 3RWIA 1B88A 3GMPA 1ZHKB 3RPIB 3T2NH 1E4WL 3OKKB 3QISA 3QEHA 2FGWH 4NQSA 1NGYB 3AY4C 2HFTA 3MGAA 4A2LA 1K6QL 4PTTA 1Q72H 4S1SH 3HI6L 4XC3L 4MX7B 2DOCA 2DQEL 2GHWB 1FPTH 3UJJH 1ZHNB 4QRTB 4RA0C 5D5ME 5BO1H 4HUMB 5C0DB 1OSPL 1OP3K 2X4QA 3B9KD 3TT1L 5DMJB 4A6YA 5ESQB 2DMCA 4OUUB 4HT1H 1UJ3A 5K9KB 1RIHH 4OGAD 4NQDE 4OGYL 5DC4B 2EE9A 3L9RB 4U6VL 4KMQA 4W6XB 5ENWA 1C8PA 3CLEH 2QQNH 1CGSH 1IJ9A 3OJMB 1GZPB 1QRNE 2HLAA 1S5IL 3H9SE 3BKJH 2X9XA 5GS1A 1XGUA 2GAZA 5MERA 2W60A 3DI2B 1CD9B 4Z7UE 4LAJH 2AK4E 1IARB 5ISZA 3NPSB 1ZE3C 4CVUA 1FE8L 4KZDL 5EBLB 2NXZD 2VISB 3G5ZA 5I17A 5AWNH 3QUML 2EC9U 4NJ9L 5ESAA 3QXDB 1WAAE 1IFHL 5T5NF 1QSFD 2NNAB 2Z31C 3MGOB 5J57B 4CGTA 3DVIA 4YK4C 1U8JA 4HF5L 1KXVC 1OGTB 5K9JH 3ARFD 2XRAH 5J1AA 1LGVA 1S7XB 4HGWA 2QHLA 5GS0D 4S1DC 4WV1A 1TJIL 2F5BH 2BC4B 4XP4L 1UM6H 5H94A 2AK4D 5JXEC 4XBGA 2JCCB 3VXQB 1LK2A 1OHQA