5DJYA

Fc heterodimer design 20.8 y349s/t366v/k370y/k409v + e357d/s364q/y407a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVSTLPPSREEMTKNQVSLVCLVYGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyA01
4FXGA 4B7LA 4TULH 1XF2A 2BSSA 3DX6A 2IPKB 4GMTL 3ZDXE 2R4SH 2F5BH 2WBJC 1IC5L 5C08B 1AHWA 1MHEA 3V2AR 5E5MB 2RQ8A 1YJDC 1ZLVH 3KAAA 4P57B 1B4JL 3O0RL 5E00A 2OXGA 4M5YH 5HGBB 4PP1D 1N5AA 3VWKC 4OIBA 3BZFA 3WJLA 4OCWH 1YECH 4NWUL 4MJIA 1N2RB 1NDMA 5IEHA 3VE0A 3VRLE 1YPZF 1T4KA 1JWSA 1QPPA 2P1YA 3CFEB 4OD1H 4JPWL 4MB4A 1IJ9A 3X12A 2GSIB 4HG4J 3STLB 4RAHA 4X5WB 1CYGA 3MV9D 1I1AB 4KKLD 4KHTL 1KB5L 1WAAA 5MERB 1XCTB 3GK8H 4X83A 4ERSL 3VI4F 3QJHB 2E9JA 1CXEA 5I30H 3RNKA 1CDIA 2LU3A 4MJID 3PDDA 1XGTB 3BDYL 2V2WB 4QGYA 3AGVA 5FXCH 4AM0B 2VMFA 3HNTL 4DTGL 1EA9C 3O8XA 4NPYB 1CGWA 2X4NA 4K07A 1OGAB 5IEKA 3ULVE 5I1DA 2CLZA 3UTQA 2E8ZA 1IKFL 1GH7A 2OTWB 1ES0A 1T03L 3B5HA 3MUGA 4DGYH 1BQSA 3QUXD 4OCYL 1B0RA 1Q1JH 4ODXA 1FYTB 2OL3A 2BNQA 4K94L 4TNWK 5ADPL 3FN3A 4LKXA 1RZJH 3IU4L 4JHWL 3BJLA 1INQA 1FE8H 2OI9B 4HUKB 5ENWB 3PWUA 5I1CH 3ESVF 1KG0B 3KGRA 4GH7B 3RA7H 5JORB 1QFWL 1LEIB 3UZEA 2X4SB 2J8HA 5HDBF 3QXDB 5IQ9B 1I9JL 1DBMH 3C5ZC 4X5LA 1OM3H 2BNQD 2AP2A 3IDGA 1CLOL 1D6VL 5J1SC 3SGDH 4HUVB 4Y1AE 5BMFL 1ZE3C 2Z35B 5FKAA 1JTTA 3BZEA 1TTGA 2QHRL 1EFXD 5KW9L 3QQ3B 2R39A 2IH1A 2LU4A 1QHPA 3HS0B 1U3HA 3IJHB 3UEZA 3ARGD 4L8BA 2W9EL 3G6DL 3RVVD 3WXVL 1F2XK 4LLDB 5GRJH 3ARZA 5D7JA 3QEHA 4JFDA 5IMOB 3DYOA 3LB6D 1NCAH 4LVHB 1HEZA 3BSZH 5JIKA 1U3HD 1YEJH 4KJYA 5FM5M 4F7CA 1SJXA 1IAIM 1MJ8L 3GM8A 1S9XA 4IIQB 3HRPA 3EOBB 4Y5XA 2YD7A 4Z7VB 3QCVH 3GO1H 3KJ4B 4TVPL 4PY7A 1WZMA 1RIUH 2GY5A 3O6FC 4JFDD 3S96B 2ZG1A 3NABL 1TTFA 4MQXD 5LCVH 1KCVL 2AXHA 1DFBL 2W0FA 1VFBB 1KACB 1FQ9C 4GRWE 2R2EB 1PLGL 5DK3A 3U1SL 2ZKHH 4L9LC 3NGBC 3SE4A 4Q97A 3CK0H 4CMHB 3SDXB 2ID5A 2QQLL 1G7HA 2IMMA 3K2UL 1HYSD 4J1UB 2VLRB 3TZVB 2OR9L 3DRQA 1MAMH 1OD7A 2HFGH 1G7LA 3WIFA 5FA3A 1CFQB 3QH3A 4PRBA 2AJXL 3L6FB 2DQIL 3MJ7A 5L2JA 3LKQB 1FGVH 1BHGA 4DGIL 4H1LH 1ERNA 4OT1L 4M7ZC 4PJDE 1RK0A 1IC1A 1QSFB 1YDPB 2BXYA 3MGOB 3GIZL 1NMAL 5EBMA 5C0FA 4GG6A 1DEEB 4QRTB 1L9NA 1MY7A 1A6AA 5GGRB 4UUJA 5A43C 4PP1C 5EO1B 5L0QC 2PKDA 5BCAA 1DN2A 2JCCA 2QSTA 2ZUVA 4OF3A 3DURA 5GRVK 3F5WB 3GMRA 4LLQB 5KSUA 5BXFB 2FJHB 5F9WB 5E7FA 3MRGB 1MVUB 1T2XA 2RB8A 1FFPB 5HVGB 3DSFH 4KKLC 4XVJL 1Q72H 4P23B 4X0KA 5CEYA 2VLKD 3REVB 2WUBL 5D2NE 3PXJA 4G8EA 1WSST 3ZYJA 4BZ2H 1M7DA 3WJLC 2JK5A 1CIDA 5JOPD 5E03A 4C56B 2DIJA 5A16B 3PQYB 1IFHL 1KPRB 3QNXB 3OKEB 5CJOL 4J6RH 4M7KH 2YC1A 4R3SB 4LLWB 1N59B 1WT5C 2W1NA 4LSVH 4L1DA 3GJFK 4FQ1H 3K74B 2EDWA 3JWOH 5BQ7A 5D7LE 4X6CA 4UQ3B 4MJ6B 1KJ2L 1AGCB 3N1QC 3QUXC 3BUTA 1UGNA 4RGND 3QFDA 1OAKH 3MXWH 1K2DA 5EH1A 5FYKH 2VRAA 3RVTD 5SWZA 3MYJB 2VQ1B 1S7QB 2BSRB 4XH2B 5L88L 4KKAD 4FXKB 4R7DA 1FO0H 1CLYH 3SDAA 1CICD 2WLYA 2BVEA 4LSQH 1UWEH 3TT1L 4Y19D 3CC5A 5CJ5A 5KZCB 5EPMB 5SWZD 5DK0B 4GAYA 4WWKD 3GJFH 4U1IB 3UDWA 3FQWB 4G9FA 4K8RH 3O4LA 1T3FB 1U8NA 3CFCH 3EZJB 1UM4H 2GJ6B 3RUGB 1U8IB 5H2BA 3VFMB 3BH8A 2CK0H 1QZ1A 2EDNA 5DD3L 5DJZB 4O51A 4XBGA 5C0RL 3ARGC 3VFNA 3SGJA 4MQSB 4LGSB 3RVVC 1IGFH 2DJUA 1IM9D 4G9FD 4OLZL 4N0YH 3GGWB 3DXAD 1NCCH 4L9DA 2MKLC 2V2XA 3LB6C 1Y6NR 1AFVH 4HCRH 5J4MA 1B6UA 5EZIH 4UNVA 1U3HC 2X7LB 1HSBA 4WFGE 1OT1A 1N64L 1A47A 1MNUL 3QFJD 3ZTNL 1YJDH 3D0LB 2AK1H 1PSKL 4PGEB 4RZCB 3MQIA 3SGKA 5C0AB 2VLME 4FQCH 1P4IL 2BVQA 5HYIA 3GBNL 4ODSL 4X80L 4MQXC 4XPTH 4V1DA 3GMPA 1KTKE 5J8OA 5JOEA 5B22A 4WNQB 3GSOB 3S7GA 5D70L 3QG7L 2VWEE 1UCBL 1UKQA 3SQOL 3HHRB 3CUPA 2DWEA 2VSCA 5EIIB 4WVRA 2C4FT 3WKML 1HYSC 4C55A 1EEZB 2P7TA 5KSBB 3GKZA 5GISH 1HH9A 3H9SB 5CZVH 4V1DD 1YN7B 4MHHG 3MXVH 3M1BB 1A0QL 1J88A 4JZNB 4UNTA 4I0PA 4MJ4A 4NQUA 3KXFB 1L7TL 2VC2L 2N4IA 1GOHA 3HC4H 4NQDA 2ATKB 1TCMA 2B2XH 2E7BA 6FABL 4Z7VE 3Q5OA 5INCB 2VLJB 5CGYD 4F8QA 1EGJL 4M6OL 5E0QA 3VXNA 1MIML 4OUUA 5IHUL 3DX9A 2P42B 4QXTA 4ZUVA 4HV8A 4I0PD 5DRXB 5I1GL 1LDSA 3FB6B 2PO6B 3Q3GA 2YA1A 4OCRL 1W72B 4KDTA 4PRDB 5JA8B 4G8GB 3D9AL 2VLRE 4D8PA 4RA3A 5BZWA 2YN3A 5T5NG 1VFOA 2HRLA 3PIQA 2ADJA 4V2BA 1DSFH 4DN3L 3S88L 2ARJA 4QHLB 3RY5A 3ULVL 2EDBA 2Y25A 4PJ8D 3UPCA 4CL7A 4PJ7A 2BFVH 1QLEH 4F7EA 4PFEA 2V7HB 1IT9H 1QSFE 3W39A 1PBYA 5GGTA 2ZUYA 2EKSB 3MGTB 3KLSA 3RTQB 4JFEE 4NFBA 1NFDA 5IBUB 3O4OC 4F8TA 1QFOA 3MRCA 2XTJE 1S5HB 1U8HA 2IQ9L 3DGGB 1H15A 3MUJA 4LCCA 1K5NA 4RGNC 4WI4A 3RVTC 1NAMH 4GAFB 2XG4A 3GUTB 1D5MB 4DZBB 3P0YL 2VXUH 4OI7A 5B39A 2XWJA 4HH9A 3VJ6B 2VR5A 5DSCA 5C07E 1FHGA 1LE9A 2CJUH 1SJHA 4KKAC 4M7LL 1YMMD 5HHNB 5BS0B 3IETA 5DR5H 1WFOA 2C5DC 5DXWA 1CICC 1FH5L 2VL5B 1P69B 5HDQL 5I76A 2AJUH 1EO8H 1NBZB 4MMXC 5FYLH 4YHPA 2DLFL 4X7EC 1QACA 1IILE 1SMAA 4I3RL 5I73C 2Z93A 3QRGL 3HZVA 1TZIB 3UPRB 4OV6F 1JNHB 4GAJH 4FFVD 3WFBL 3SKMA 4D3CH 4WWKC 4L4VE 5I19H 4RFOH 3F7VA 3OKNB 4ZO7A 2EYTB 4LEXH 4B0MM 4DW2H 1G7QA 1F6AB 1A8JH 3KVQA 1A7OH 2EICA 1MJUL 2QBWA 3EFDL 4Z18A 2JB5L 4QXUL 5IK3B 1XGUA 2YPLE 3OKKB 3LQZA 5L6YL 1T2QH 3WXWH 4Q9QL 1PX3A 5F7KC 3ORJA 4Y5YB 4XNMA 1KB5B 2CKBA 1WV7T 2DJSA 2QHLA 3E6HB 4AENB 3UDWC 5GS0L 5D5MA 5CSBA 4DN4H 3BVNB 2A9NL 4WU5A 5J12C 2E9WA 1S7WA 1WZLA 2CDEB 3B9DA 5JPMA 3K8KA 3RI5K 5EWIL 3JTTB 3IDXH 5K9QG 2BVPB 3KYKH 3SGJC 2IPKA 4RGOH 3D5OF 1K4DB 1I7RB 5C08A 3FQUB 3KPQB 2V7NA 1ORSB 3FRUB 3O81A 5E5MA 5FM8A 3L3KB 5BVPH 5DJXA 2FIRT 1J18A 4N5ED 3L95B 2GJ6E 1XH3B 4NNPH 5EULV 1N26A 2NXYD 5JA9A 1X4ZA 4ZFFB 4TNWF 1N2RA 4F57H 1VEMA 1S3KL 3CH1A 3MLPA 1UWXK 1KN2L 4XC1H 5FB8B 2BOCB 5F71A 3WLWD 3S3JA 1FRGH 3BGMB 1N6QL 3SGKC 3C5SB 5HYSG 4PR5B 4ZDHA 2GSIA 4KKCD 3STLA 4CW1B 1KB9J 4X5WA 3QXTA 1GL4B 1I1AA 4PBVC 5J6GB 1X5HA 5MERA 3AU1A 1XCTA 2XNAB 5J9PA 1CK0L 4LK4A 4LF3B 3AROA 3QJHA 4CBPA 2V5SA 4O9HH 1XGTA 1GGUA 2V2WA 4YDLB 3MJ8B 4OZHF 4W6WB 4AM0A 4HIHB 4JGMA 3OKDB 5L2KE 4PPTA 1YQ2A 5CGYC 4NPYA 1LDPH 2D7PA 1K85A 12E8H 3P77B 1M7XA 3C60B 1OGAA 1M6OB 4UIKH 2J8UE 4BELD 5FYJH 5HYQB 4I0PC 1QTYT 9CGTA 4NUGH 1FYTA 3T0EB 3SJVB 1ACZA 5KSBE 4MHHI 5F70A 4P5MB 2HVKA 1NGWA 3VXUB 1KG0A 3H9SE 5ANME 5JORA 5A2FA 4PGCB 5C0GA 1DLFH 4PJ8C 3C9NA 4YUEL 3O9WB 3QXDA 3TIDB 2FD6H 3MJ6A 5IQ9A 3MCKB 1OB1B 3C5JB 1FLTX 4JDZB 3X3FL 2VLJE 4G6AD 2VXSH 1FSKB 1J0HA 3K7UA 5T3XD 1YNLL 3MRJB 4NQCE 1XGYL 2Z35A 3LMJH 3TBYA 1HKLL 5CCKH 4S0TD 4MXVF 2PR4H 1QSZA 4PLNC 3QQ3A 1T7WA 2WM0A 3HS0A 4KROD 3I6GA 3T04D 3OXSB 4RSVA 4FZ8L 3P30L 4LLDA 4NQXB 4QXGH 5IMOA 3U7AA 5GGVH 1YEDB 4G6MH 4LCCC 3NZHH 2EIBA 5E2UL 3V6OE 4FFVC 1RZ8B 4HS6B 3K81A 4JFFE 1JHKH 1FORH 5EUKB 2P8PB 3SY0B 3DUUA 3MLYL 1FL5B 1D5IL 5TDPB 5IVXE 4IIQA 4PYGA 1NLBH 1OTTD 1P7QB 3EOBA 4O58H 3UYRL 4X99B 1CFTB 2GTWB 3S96A 4ZFGH 3BZDA 4U33A 4WI2A 1VFBA 2R2EA 2DS4A 2IALA 1V3LA 1BJ8A 2RHEA 4K7PH 4PJHA 3PL6B 4JM2A 2MPAL 3N50A 4HXBL 3SDXA 5HBBA 4U1KB 4J1UA 2R8SL 3PUCA 4HF5L 3TZVA 2FX9H 4PJCF 5E7BA 2I60L 3T0WA 4GG8B 1CFQA 2AV1B 3DI2B 3F6IA 1U8QB 3L6FA 2AAVA 3FQXB 1DUYB 1C5DB 4QRPE 3TCXA 1FN4B 4U7MA 5JW3L 4DEPC 4XVTH 4NFDA 3VGAB 3DV4B 1YDPA 4X98B 4JM2D 4N5EC 1DEEA 1C1EH 2VN7A 5EO1A 4OLXL 3CXHJ 2NXYC 2GYSA 5J57B 5DQ9B 1ACYH 4DUVA 3V52L 5IW1B 2XWBA 1YNTB 1I8MB 3F5WA 4LLQA 1LO3H 5BXFA 2FJHA 4ZO9A 2F15A 3WLWC 2RBLA 3MRGA 5ALBL 1MWAH 1NUFA 1UQSA 5KSVB 1FFPA 4KKCC 2DQUL 2J7LA 1J86A 1IRAY 2AJYH 2YUZA 5DHXB 1G0XA 4P23A 3REVA 4XCYB 1BJ1H 3FKUS 1ZA6A 4HQQL 5H94B 4UT7H 5IHZB 4C56A 3BP6B 3VH8B 5E56A 4YX2L 3L7FB 2BNRE 3PQYA 4OIIH 1KPRA 5GQBA 3OKEA 5T3ZL 1DQTA 4YHYB 1IC7L 4FZEL 2CPCA 1MIEH 4R3SA 3MUZ1 5ILTL 4LLWA 1RULL 1N59A 3LEVH 3G08A 4JN2B 3WUWB 4EN3B 1F2QA 2BOBB 3NIGE 1DL7H 5FCUL 4XX1E 3TNMB 1NGXB 3TO4B 3NCFB 1HWGB 1KNOB 1DVFD 4K7PY 4UQ3A 3E8UL 4K55A 4HBCL 5ID1B 1AGCA 2J8OA 4EI5B 3H42H 4MS8D 1W2KT 2ED7A 3V5DB 1NGPH 3MYJA 4WEUD 1S7QA 4U0RB 2BSRA 4OLYL 5I71B 4LSRL 1JPSL 3SEPA 4XH2A 2Z91B 2UWEB 4FXKA 1KV3A 1ZHNB 4OLUL 1A7QH 3HA0A 2X4OB 2CGRH 3HLAA 4DJMA 5DMIH 1CVSC 4M43H 5DWUH 2DICA 1UYWH 4LHUG 4GKZB 5AYUL 4JVWA 1OP9A 5CP3A 3MLWL 3HAEB 5EPMA 1G6RL 2IAMA 4QRUA 5DK0A 4G6AC 4U1IA 1CGVA 2BCKB 1T3FA 1R3KB 3V7MA 3FN0H 3ARED 3TWCH 3NZ8A 4CU6A 2H1PH 5HHVH 3RUGA 1U8IA 4HC1A 5D71H 3VFMA 2BRRH 3DUHA 3UTSE 1GPOL 4UU9B 2WZPD 5CINL 2EEAA 4KROC 3RP1A 1AXSB 3ZT7A 4L4TA 5DJZA 3PV7A 2IAMD 3GSNL 4UT6H 3DUSB 4JCMA 1I1RA 4G6JH 5DVKA 4P5TB 5CUSH 5LBSL 1GC1L 4YJZL 2ORBH 1S5IH 1U92B 1S7VA 4JO4H 4LSUH 5D6DC 2X7LA 1ZEAL 3I6KB 4I3SH 4M1GL 4L4TD 3D0LA 2IH3A 3I3DA 1H5BC 4BM7A 3LRSB 4AQ1B 1OTTC 4YXKH 2XN9D 2MQ0A 1I3RB 1NCWH 2XTLA 1YMHB 1FG2B 1W8OA 3MRHB 1HDMA 5C0AA 2HP4A 2YKLL 3V5KB 4Q9BA 5DUPL 2R1YB 4UI2A 2UY6A 4WNQA 5IIEB 1RJCA 5DFWH 1RUKH 3GSOA 4CMMB 3B2VH 2Y07H 4L29A 5EIIA 3NACL 1EEZA 2EDFA 4HZAA 1DBBH 4A2MA 5DHVB 4N90D 1WGOA 5D7IF 3MBXH 2Q8AH 4N8CH 1CDGA 1K4CB 3M1BA 4X7SL 1P5VA 2NY6D 4JZNA 4TPRL 4K71C 5KVFL 3KXFA 4TYUA 4L8CB 2EE9A 1XGPB 2EE6A 1C16A 1A6VL 3C2AH 3EGSB 4JM2C 3RWGB 1H3WM 2C4FU 3MO1B 5INCA 4FQJH 4O2CB 4K9EL 5DC0A 3U30C 1AXTL 3U83A 1F8TH 2FBJL 3S3SA 3U7WL 2EXYD 4KXZH 3BYTA 1JGLL 4GT7A 5DRXA 3GSUA 2B4CL 1PQZB 3CSBA 3FB6A 1HQ4B 3ROLB 4POZD 1W72A 4PJEB 4PRDA 4AY0A 5BO1L 4G8GA 4N8VG 4GMSH 1VHPA 4HULB 1A3LH 1KCUL 3B9VA 4PYHA 3G5ZB 1IEBB 4ETQA 4H0HB 1DLHA 1IGIL 3MLZH 3R0MA 2VXVH 5IQ7H 4QHLA 2WANA 1XR9B 4WTZG 3HPJB 1EZVX 5GRZA 3UC0L 3QA3A 3U48A 1M1SA 4NRYA 2V7HA 1RURL 4HWBA 1G9NL 4MCZB 1MF2H 2APVA 4O5LH 4JFZH 4QHKI 4URTB 3MGTA 2EKSA 5FF6B 2J88L 2AERT 3QEUB 3CMOH 4JRXD 3S34L 3UPAA 5JHDB 3NPSC 2Q7NA 4ZS7H 1DVFC 1TFHA 2ZUXA 3MV11 4NGHH 3W11D 3IDMB 1YC7A 2DMBA 4MS8C 4CN4A 4UTBL 3GUTA 1D5MA 1A6WL 1NBQA 1RZIA 2GT9B 4KAQL 2A2QT 3BX7C 5HHNA 3Q6FB 2DQCH 3FO2A 5BS0A 3LPGA 3T77B 4MGXA 3RI5F 1NBZA 1WBXB 2BXZA 2Q7YB 4QHNB 5C0CE 4Z7UB 3QDGB 4RIRB 1MPAL 1TZIA 3O45B 3UPRA 1YYLL 1JNHA 2VO5A 3CFKB 3IXAA 1ZTXL 3MOAL 2FGWL 1PEZA 4ORGB 2BNUA 5HGAB 1HILB 1NCTA 5IBTL 5E2TH 43CAB 5BS0D 3VFSB 4KI1A 3AREC 4ODHH 3QCTL 5JXAH 5IK3A 3W0WB 3OKKA 1JK8A 2XQBL 2X4TA 1NEZG 3CNKA 4Y5VB 2D7NA 3TVMD 5FA4A 4N0UE 2H32B 3BKJH 3GSRB 2IAMC 4JAMB 1FAKT 4Y5YA 2IANB 5H37G 1KB5A 3E6HA 4AENA 1M4KA 4Q6IB 2LU7A 4M62L 3BVNA 4MD4A 4NO5B 1TZGH 3HE6D 4QEGA 3B6SB 1EHLH 1RZ7L 3QUYD 2CDEA 4MNGB 2X4RB 3QZWG 4HD9A 1B4RA 1DBAL 1MCHA 2VXQL 4PJXB 1LMKA 2OTPA 5DQDH 2BVPA 1DQLL 4BQ8A 2DM3A 3CLEH 1MVFA 3VFOB 3P9LB 5GGSB 3FMGH 2XV6B 3U0WH 2HVJA 1I7RA 3DHJA 3UROR 3FQUA 4R0LC 3FRUA 4NNXB 4ZOEA 2HFTA 1KELH 4QHUB 4LDLB 3DROA 3L95A 1XH3A 1FP5A 1F4YH 4S1SL 5HGHB 2A6IB 5F8RC 1YA5A 3KYNB 3FTGB 1V3JA 4XB7A 1MCNA 4PJ9B 5E08L 3O3BB 4Z0XB 3OZ9H 5FB8A 3HNSH 3OR6B 3C5SA 5J06A 3U2SA 4YFDB 1I3UA 5J6GA 3HUJB 1OSPL 2NY4B 4XGZB 2XNAA 4LF3A 2NY6C 5LXGL 1QSEB 3QO1B 2E6PA 2VDKH 5K9OB 2ESVB 2BK8A 2A1WH 2VLLA 3HG1E 3B9AA 4HIHA 2P45B 4O00A 3ARDB 3OKDA 3GNMH 3Q1SL 2V5YA 3O41B 2QLVB 4JJ5A 4ZFOB 1CWVA 5T1KD 1ZHKB 3C60A 3LKSA 1RVFL 1M6OA 4MB3A 2VZSA 4HWUA 5IFJB 1AP2B 3OAUL 1D5ZA 4R26H 2A38A 3MV8B 2EXYC 5BVJB 3ECBB 1KGCE 3LIZH 3GI9L 1SQ2N 4AK1A 2VZOA 3T3ME 5F8QC 2YUXA 4POZC 4TQEH 1IQDB 3T0EA 2FDBP 2LV4A 4TTDD 3SJVA 4UINL 5IGXL 1F4WL 4HGWB 4S11A 3BEWB 1Z2KA 1JPTH 4P5MA 3VXUA 2C9AA 4FQLL 3PWJA 3BKMH 2V5TA 1QRND 1X7QA 5CLTA 5EG6C 1X5ZA 4NKIH 4QTHA 4WY7H 5T3XH 3O9WA 1HIML 2OCFD 4U2YA 1AGBB 3OR7B 3B2UD 1UXSB 3MCKA 1OB1A 4NWTH 1NGQL 1RMFL 2R69L 2J6EL 2JIXB 3C5JA 4LSTL 1A3QA 4JDZA 5FUZH 4ZD3L 4KV5E 2YSSB 1FFOB 2PYEB 3KPRE 4U1MB 3VXUD 1AQDB 5E99L 3MRJA 3W11C 3LKPB 1I9RL 4XCFH 1BZ7A 2DN7A 3EYUL 4YHIB 5HI4D 2NCMA 3QDAA 4GG6F 2RGSA 4TVPD 1QFUH 3OXSA 1RHFA 2ERJB 3QQ4A 5IB3B 4TULL 3VD3A 4RX4D 1X5AA 2YD1A 4NQXA 2R4SL 4R2GB 2F5BL 2NLJB 3W81A 2O61B 5JMRA 3GM0A 5T1DH 3KLAB 1RZ8A 2B39A 1X5JA 5ISZE 1Q9OB 4M5YL 5EUKA 4ONHB 4JRYD 2P8PA 3SY0A 1E4JA 3L7EB 4OCWL 1BP3B 5TDPA 4PJIA 4FHBD 2Z4QB 5CSZB 4Z8FH 5JHDE 1P7QA 2HLFD 1QYGH 4X6EB 2FWOB 4OD1L 3FO0L 1CFTA 1LNUB 2ZP0T 3TVMC 3V5HA 5EDXA 4YBLB 4LAJH 4PY8I 1BFVH 1XGQA 3RNQB 1RK1B 3GK8L 2A6JA 1F4HA 4PLOB 5I30L 3HE6C 2W65B 3PL6A 4RNRB 3DV6B 3FFCB 3GSWB 1LILA 3QUYC 4U1KA 3HZKB 4XZUA 4TNVK 1BIIB 2ITDA 4I77L 3NIDE 4GG8A 3LKNA 3K1KC 1TPXB 2EIZB 1YPZB 1U8QA 4K3DH 4NDMB 1ZKAA 2AJZB 2XT1B 3BAEH 1DUYA 1C5DA 4JZJA 3H2WA 1FN4A 3PE9A 3CSPA 3WO4B 1KJ2A 3DV4A 1MCEA 1OCWH 4DGYL 1Q1JL 2FH6A 4YE4H 4Q2ZB 2D31B 1RZJL 5DJ2B 1FE8L 3L5IA 1CF8L 4L1HA 5I1CL 2BMKA 5IW1A 1YNTA 1I8MA 1CE6A 3RA7L 2JJUA 2R2BB 4M93C 5CJBA 2DBJA 2ITCB 3ALWA 5KSVA 3VD5A 4UOW1 4WHYH 3H6JA 1DBML 2VQTA 5C0BE 1G6RB 4ZYKB 3FONA 4K94C 5DEGB 2HA1A 1OM3L 5I9QB 1OARH 4KWUA 1CFVL 5F1IA 1HXYB 1BM3H 5H94A 4XPFH 5IHZA 2VISA 3BP6A 5KANI 4WI9A 4FG6D 4F9LC 5CGMA 1MCCA 1GIGH 1ZVHA 4LPCA 4EN3A 2CDGA 3ZE1E 2BOBA 3ARFD 1F13A 3GSNB 5JUEH 4I9WE 3TNMA 4H5SB 1NGXA 3TO4A 3FB8B 2V9RA 5ID1A 2XKUA 4EI5A 4PGZA 1HOCB 5GRJL 1EXUB 1P7HL 3V5DA 2LQRA 1GGBH 4JDTL 3D3VE 4TTDC 1JWUB 4I18B 4Y4FB 1G7JB 1GZQA 1NCAL 5FUCC 1BVLB 2HLAA 3P4MB 4NZTL 2UWEA 3BSZL 1YEJL 1ZHNA 3SPVB 3VWJB 1FNFA 2X4OA 3QULB 4NYLA 3TO4D 5EIVA 3OF6A 3VGHA 2B5IB 4GKZA 4LSSH 1JPGA 3GO1L 5I75C 1E6OH 3B2UC 1RIUL 5F72S 3RIAK 1C5CH 4UDTB 3MJ9H 1LE5B 4MQTB 5LCVL 3IDNB 4RAVB 5I16B 2BCKA 3EDKA 3STZB 1R3KA 2ZKHL 3X14B 2CO7B 3CK0L 3MNVB 3MV8E 5HI4C 3OF6D 4HLJA 4XWGH 5LGHH 4KPHH 1HZHH 1AXSA 1GGYA 3MX0A 5HI3D 1MAML 2HFGL 4U1LA 1OY3B 5AYQA 1T7XA 2HG5B 2EXWD 5D9SB 4ELMB 4GKNA 4GBXB 4Y4HB 1FGVL 2OR7A 2YD9A 3V8OA 5DJ6A 3P4OB 5TH2B 3HFMH 3H3KA 1EGJA 3FQNB 2AK4A 2P48B 3QWOB 3LRSA 3SE8H 4XCNB 2DM7A 1OP5K 2WBKA 2HLFC 1I3RA 1YMHA 1FG2A 5I1KL 5EUOE 4AZ8A 2VDQH 3B4NA 3DSFL 2EIEA 1UXWB 2R1YA 4U4BA 1Q72L 4WW1B 1MFCH 3P3YA 5IIEA 5DFTA 4CMMA 4BZ2L 1SHMA 2L7UA 2ARJQ 2AK4D 5L8JB 3W2DH 5IMMA 5ABDE 1RZKL 3VW3L 1R3JB 1FPTH 4M7KL 5DA4A 3P2TA 5DHVA 1NCDH 2FO1A 2A6KB 4I3GA 5F97E 1T2JA 1NQBA 1K4CA 2JE8A 4LSVL 4FQ1L 3VXQB 3JWOL 5GRVL 3ZTJG 3UYOD 3EGSA 1TQBB 3ULVD 4GLRI 2NX5E 1AD9B 2EKJA 1OAKL 3MXWL 3MO1A 5FYKL 4PP2B 4OFVA 3VA2C 5IR1B 5JDSA 4ODTH 4FFYH 3ZE2F 4JB9H 3SE3A 5TF0A 1U58A 4MCYB 3JZ7A 3HI1A 1FO0L 1CLYL 4ZG1A 5ALCH 4JZJC 3WS3A 4LSQL 5DHYB 4JY5H 4MAYB 1UWEL 2R56H 2O26U 3WBDA 1PQZA 5E2VH 4PTTB 1X3DA 4PJEA 3RZCB 3HPLB 4Z95H 4W6XB 3G5ZA 1N6VA 1IEBA 1PKQE 3SDCD 3KNBA 4K8RL 1T1YB 3WJJA 4OFDA 5EU6B 1AE6H 1XR9A 4OI8A 3VMNA 3CFCL 3LZFH 3HPJA 4FG6C 4HIEB 3MRQB 5MHSD 5CEXB 4LDEB 3QEGH 1UM6L 2CK0L 1T0NA 4QRRB 4U1JA 1DBKH 3D2UB 3FZUD 1DCLA 1K8DB 3ARFC 1VERA 3AB0B 2CQVA 3QEUA 4U6YA 3MV7E 1J05B 3K46A 4OFKA 1IGFL 5DJYB 3IDMA 1OPGH 1FDLH 1BX2B 3H9HB 4IOIB 4N0YL 1NCCL 1WIOA 1CU4H 1JHLH 3K0WA 5SWQB 4HCRL 5JZ7D 3NMEA 3OPZH 1WTLA 1U8MA 4FTVB 5EZIL 3Q6FA 4G80B 4PS4H 1CE1H 2KPNA 3QPXH 4PV9B 3MRPA 1YJDL 1WQVT 1WBXA 2AK1L 3P4NB 3TO4C 2Q7YA 4X6DF 4WCYH 4QHNA 5GS0D 2OX5A 4Z7UA 3QDGA 3O45A 4X4XB 5IKCB 1BZ9B 1J8HA 4FQCL 1CZ8H 4G8IB 4GMTH 3UYPA 1EEUA 4XPTL 1WCBB 1IC5H 4ORGA 2FLRT 5KAQF 5HGAA 1HILA 4TRPH 4GS7B 1IAIL 5F6HI 1BIHA 43CAA 4NKOB 3VFSA 3QEQE 4QHMB 5H37H 1WFNA 1KBGH 2JJTA 3W0WA 3RKPA 1HH6B 5B39G 2P24A 4Y5VA 3TLRA 4ONGH 5HI3C 3BOVA 4HS3B 5GISL 1J8HD 3FQTB 3GSRA 2G5BB 1JHTB 1HCFX 5LGKA 2IANA 2X5PA 4ELKB 2EXWC 2X42A 8FABA 1AIFA 3MXVL 5E8OA 5IB2B 5HHMB 4NO5A 1A6ZB 3NIFF 2C7UB 3WV0A 3HC4L 4MNGA 2X4RA 2B2XL 3C09C 4PJXA 3TA3D 1SMOA 2A74B 3QUZB 5GJSH 1R3LB 3VFOA 4DTGH 5GGSA 4OCXH 4KTDL 1ZA3B 3T2OA 1G9EA 1NC2A 4EIZC 5CHNB 4P46B 1DZBA 4M03A 1ETZA 4JFYB 4NNXA 3EYVB 2FBOJ 5D8JH 5DDHB 5E4EC 3QWRA 2YD3A 5I0ZA 4PJGA 5HGHA 4X6FA 3SKOB 3KYNA 3ARRA 3FTGA 4U05A 5JHLH 1G84A 4PJ9A 3F8UB 4UOW0 2CXGA 4K94H 1DSFL 4M61B 2VZVA 5EO0A 4ELME 5JDJA 3OR6A 3OGCB 5FO8B 1NC2D 2CLRB 2BFVL 1QLEL 4NKMB 3HR6A 1JZ8A 4WO4B 3LN4B 3VG0H 5KSAA 1IT9L 3HUJA 3DO7B 4OZIF 4YO0A 1XZ0B 2BHYA 5SWSE 1QSEA 3QO1A 4OZFB 5K9OA 2ESVA 4LPVA 1BD2E 3BQUD 5LGJA 3ULVC 3ARDA 1CLOH 3VFGH 1IE5A 3EAKA 1NAML 4I4WB 2VXUL 1F00I 1MQ8A 5KOVC 3MA9H 1ZHKA 3U4BH 4PJFF 1BBDH 3MFGB 5KSAD 2CJUL 4TSAH 4O02H 5IFJA 1AP2A 5DR5L 3AY4A 3CMGA 3WFHA 3MUY1 4I1NB 4RGMB 2X40A 4A6YH 3ECBA 5BVJA 2AJ3B 2AJUL 1EO8L 5J6HB 5FYLL 5I1LB 3HE7D 4KJWD 1T89C 4MXWL 3PHOA 1E28B 2P5WE 5ID0B 4Z7QE 4NBZB 4GAJL 3LY6A 1U36A 4D3CL 4Y16D 5I19L 3BEWA 4RFOL 1U95B 2EDLA 3SDCC 1FGNH 4LEXL 4DW2L 4GUPB 1KCLA 1N5YH 2G60H 4PJHF 5F9AC 3WNOA 2NY5H 1SBBA 1ITCA 3NN8B 4TSCH 3TV3H 5CEZE 1BREA 1UJTA 5SV3A 1QD0A 5ESQA 1T2QL 3OR7A 3WXWL 2A9MH 1MJ8H 3FZUC 2JIXA 1H8OA 4FQIH 4HMCA 4M5ZH 2PYEA 4PGDA 1VEPA 3PHSA 1PFCA 1AQDA 1A4KB 5DD1H 1GGTA 1MHHB 4DN4L 1D5BB 4YC2C 4YHIA 5B8CC 5H35B 3Q6GL 5JZ7C 2CLVA 2HWZH 1JBJA 5GS1C 2V6HA 5DVOA 1YQVH 4TNVF 5ICZB 1Z9SA 2AXFB 5IB3A 3IDXL 3DVNB 3LQAL 3KYKL 2YS4A 3K2UH 5CKGA 5GS0C 2VUYA 4RGOL 1FAIH 2NLJA 3LH2H 2O61A 1VGEH 4JFPB 3BP4B 4LNRB 4CVXB 2AJXH 3DBXA 1ZLWK 5BVPL 4YK4B 3T8XA 4JQXA 1Q9OA 4Z6AT 4NNPL 3KPSB 4ONHA 4OT1H 3D39A 4QRRE 1ZHLB 4UQ2B 2F53E 3L7EA 2VLMD 3UP1A 4ZPVB 3UTTB 1G0DA 4OLVH 2Z4QA 4F57L 5CSZA 2VDOH 1UEMA 3NCEB 3FRPA 2YMXH 4XC1L 4MSWA 1T1XA 5EOCH 1LNUA 1FRGL 1ED3A 4LPWA 4M7LT 4YEFA 4ZNEA 3T2QA 4WI5A 3G6JF 3FT3B 3PGCB 3OGOE 3RNQA 1RK1A 5IM7A 1CT8B 4E42A 5F93C 3D39D 4M7JH 2W65A 5FHBH 2YUWA 4NN7C 4O9HL 4HG4K 4RNRA 4P9HC 1MCWM 3DV6A 3ZE0F 3FFCA 1ZLWH 3DMMA 3HZKA 1Y0LA 2PETA 5EORH 1BIIA 2YD5A 3OAZK 1R3IH 3TA3C 1J1OH 2Z92B 2EIZA 1LDPL 1YPZA 12E8L 2AJZA 4WFHE 4Q7DA 3TN0D 5E24E 2PYFB 3GZKA 4OTXH 5FYJL 1KEMH 5IG7B 2ADIB 4JREB 5GSRA 2E7HA 3DMMD 5T3ZD 3I3EA 1RJYA 2NY0B 2D31A 3MROB 1AQKH 4OF6A 5DJ2A 4OZHB 3EKCA 5DVNA 2IBZY 2VDLH 5DS8B 5CJQH 2R2BA 4P4KD 5H8DA 1DLFL 4NQEE 2ITCA 2XZAH 3BD4A 2OJEA 5L88H 3HRZB 2J4WH 3ILPB 2ZSWB 3MRNB 1RHHA 1WCQA 5ACMA 1G6RA 4ZYKA 1MFBH 5DEGA 3QYCA 2VDPH 3RIAF 2VXSL 1HXYA 4HWZB 4Y4KA 3B43A 2A6DB 3BQUC 2VR9A 5C8JB 2OTUA 1I1YB 5DJCB 3LMJL 3CSGA 4JFED 1OAZH 5CCKL 2FH8A 3KPPB 1D5XB 2PR4L 3VU2A 1IBGH 1H3UA 3BD5A 5ETUB 5IF0A 5KSAC 1JYNA 2XTJD 2MCG1 2V9TA 3B3IB 3GSNA 4I2XB 4XI5D 3QI9D 5J3HD 1NBVH 4H5SA 5JIPA 1N3NA 3CX5K 3FB8A 5D1XB 3HE7C 4KJWC 4Y4KD 3PP3K 2YEZB 1HOCA 4QXGL 3SDDB 4CJ1A 2WK2A 4MA8L 1MCDA 4H1LB 3X13B 5C0RH 4OZGE 4G6ML 3NZHL 1SVCP 4ZFZB 4PRIA 5DMJB 2L7JA 1JWUA 3WNLA 4Y4FA 1S9YB 2G75B 4Y16C 1BVLA 1OOAA 5JR1H 2J12B 4ZSOB 4LLYB 2DL9A 5M94B 1JHKL 4C83A 1FORL 3QULA 3AY4C 1MHPH 1NLBL 2H9GA 1W0VA 1CDHA 4K3GA 4L4VD 5ELIA 5FV1L 4O58L 1VPOH 4XXCA 4ZFGL 4J8RB 5BRZE 4UDTA 4GW5B 4OKVB 4PRID 1P4LA 1KYOK 2Y72A 3IDNA 1PSKH 2CUMA 5JQHC 2YPLD 4RAVA 5I16A 1FG9C 5GZND 3PP3H 3X14A 1L6XA 2XFXB 4K7PL 3MNVA 4IMKA 3DTXA 3PABB 4M4RA 2FX9L 4F58H 4OD2B 3F7RA 1JRHH 1NFKA 1TITA 2FSEB 5D9SA 4FABH 1MI5B 1FNGB 1CXIA 4GBXA 1HXMB 3Q5YA 5E94B 1T1WB 3P4LA 5FO7B 2ZCHH 4XVTL 5LWYH 4XXDA 5J11B 3ZYOA 3VFPB 3P4OA 2R1WA 5TH2A 1C1EL 2AI0H 5HVFB 2Q1EA 3D25B 4LLMB 3IXTA 1KFAL 3F58H 1NAKH 4XCNA 3K2MC 3I9GH 1FO0B 3VFRB 4PRPB 3OX8B 4X8XA 1LO3L 4FQHB 4PJCB 2N7AA 3IVKB 3EIFA 1MWAL 3MOBH 3TJHD 1MIMH 3BT2H 2VWEC 3V6FB 2ZUQB 2AJYL 4OCNC 5KS9F 5E2WH 4JQXC 4Z7WB 4WW1A 4DKFH 4G8FB 3T65A 2DYPB 4KUZH 3E3QE 4UAOB 3PP4L 1JMXA 1Q0YH 4OF0A 4PRHB 3ZDYF 1KTLB 3SO3B 3TBTA 4MLSA 4NFCA 3TJEL 3FL7A 3EOYG 2YA2A 1R3JA 3ZTJH 1PDKA 3X3GL 2JF1A 1MIEL 1HYRC 5LAXB 4G6KH 4YBLC 5HYJA 3OG6B 3CFJB 4DN3H 2XZCH 3LEVL 3TN0C 4AH2B 2FX8H 4UT9H 2YK1H 2EYRA 3GDBA 2E27H 3VXQA 3WKNA 3KPSE 5L2KD 4NRXB 4AL8H 3JBG7 4LVOB 1P7KB 1O7SA 1YY9D 3L5WB 5GGQH 3H42L 1JL8A 3FCTB 4F80A 1FVDB 1AD9A 3DMMC 3RL2B 15C8H 1H3TA 4G5ZH 4PIRF 4PP2A 2L0DA 1NGPL 4LCWE 3DRTB 3VG9C 2WBJB 5HYJD 1Z3GH 2ADFL 1LO0L 2IQAB 3VA6A 3VI3E 4P4KC 1A7QL 2P47B 2WP3O 2CGRL 1ZANH 4FQQB 5DHYA 5DMIL 4AEHH 4M43L 2ZNWA 3ZL4H 1UYWL 3VWKB 2F5AH 4NO0D 2OK0H 3VXMB 5MENB 2Y36H 1J0YA 3NCYP 5F7DB 5SV4A 4PJAF 1T1YA 5EU6A 4ZXBA 5TQ2H 3FN0L 5D7KE 4JEGB 1G1CA 2IC2A 3HR5B 3TWCL 2P4AB 3HMXH 5EC2B 3ZKND 2H1PL 5HHVL 3UCRA 5D71L 5CEXA 5SX4H 4M8VA 2BRRL 3D2UA 2XTJC 4NQCD 2HKFH 2NY7H 4XI5C 4WHTB 3QI9C 5IROA 5J3HC 1J05A 4UT6L 1JGEB 1HQRA 3BPOC 1RZGB 5JQ6H 3WIHH 4Y4KC 5DJYA 3J7HA 3KWWB 2MOVA 3H9HA 3WNKA 4IOIA 5CUSL 3ZHLA 4ZXBD 1NCUA 3Q2CA 1RIHH 2ORBL 1S5IL 5ADOH 4BZ1H 3RWHB 4JVPA 1NMCC 1NGZB 4WFEE 4JO4L 4JGUA 4FTVA 4LSUL 1DTUA 3D2UD 4G80A 4AQOA 1MFEH 2BJMH 5K93A 3RGVA 4I3SL 1KTDB 4PV9A 1A21A 4ZUUB 4YIQB 4DAGH 3P4NA 3NFPB 4H26A 2BERA 2CMRH 4YXKL 5LQBL 2P5EB 1NCWL 3DVGB 4L3CB 4JFFD 4X4XA 1OF2B 1U42A 1BZ9A 5I17B 4G8IA 5D1QA 2OLDA 5GZOD 1WCBA 3BO8B 5IBUG 3MRMB 4GRWH 1GSMA 5GZNC 3RGVD 4NKOA 1RUKL 4QHMA 4I2XE 4JJHA 3B2VL 5JW4R 2Y07L 3C5ZB 3HCVA 4JY4B 1PEWA 4I0KA 3ARTA 1DBBL 1D3CA 1JPST 5C9JB 2G5BA 3FQTA 4P9HH 5D4QA 5D1QD 4IRZH 3MBXL 4ELKA 2Q8AL 5A2LH 1FV1B 1UC6A 4N8CL 3JV5A 2OP4H 5IB2A 1A6ZA 5EOTA 3A6BH 2WIIB 5A2JH 2C7UA 1UZ8B 2DTSA 3N85H 1E4KA 4L8SC 4IMKC 2BY1A 5LKNA 4U3CA 4QRPD 4OLWH 4P2QE 4FQJL 2A74A 4NIKB 3QUZA 1LP9F 2Y06H 5EU7E 3BMWA 1F8TL 1R3LA 3UTPD 1LK3H 1XR8B 1ZA3A 4GW1A 1ZT7A 2VN4A 2XOTA 3OG4B 2W60B 4C58B 5CHNA 4OIAA 4XNXH 3ABZA 5D7IB 3EYVA 5MI0C 3CZFB 3TJHC 3JWNC 4MQ7B 4EOWH 3H8NA 3RWEB 3TO2B 3LVEA 3KYMB 4GMSL 1HHGB 1A3LL 3ARBB 4K9EC 3SKOA 4DFIA 1BFSA 1CLZH 2VZ3A 5D2LF 1OW0C 2EC9T 3O6FB 4XNQA 4JRWA 1DUZA 1NH6A 1MI5E 2K7QA 3QUMH 4XC3H 2XIDA 3OGCA 5FO8A 1BWWA 1SY6H 3C6SA 3PWPB 4YFLF 4H20H 3VMPA 4NKMA 4WO4A 1R5WB 2BZDA 2XWTB 4L9LB 1HSAB 3NGBB 3G5XB 2J6EA 1MF2L 3DO7A 4JFZL 1QP1A 2BNRD 4U7KA 1XZ0A 4YZFF 1EH9A 3CMOL 4OZFA 7FABH 5F7WC 5EC1A 4ZS7L 2X9WA 1A6PA 1OQOA 3GSVA 3WNPA 1PG7H 2DQHH 3DX8B 1YY9C 3L3HB 4AYFA 5GJTH 3BGAA 5DI8B 3RJQB 2I9LB 4I4WA 4YLQT 2VL4A 3AS2A 5MP6H 3QIBD 4NJAL 1MH5A 5I1EH 2V17H 2B1AL 4M7ZB 2DQCL 3U0PB 2GTZB 4Z7WE 1ZAGA 4PJBB 2CRZA 4C4KO 5J6HA 3VFTA 3VXRE 1FZOB 2EIDA 4PRHE 5L0QB 1E28A 2FJFB 4FXGB 5ID0A 3SGEI 4NN5C 2MFNA 5IMKB 1FC1A 1FFQA 3B9KA 4XCCH 2HFFB 4NCC2 1U95A 3ARSA 4GUPA 1MHEB 5E2TL 2DQFA 4JPIB 3ZKMD 3MV9B 4ODHL 4QHKJ 3ZKNC 5JXAL 3NN8A 4HIIA 3ESUF 1N5AB 4OGAD 4B50A 5DT1H 5DK2A 4MJIB 1NDMB 3BKJL 1JWSB 1L6ZA 3B9KD 1MCFA 4TUOA 5IJVA 1F4XH 4P2RA 1TDQA 2R0WH 1A4KA 3W5NA 5HHPB 2Z8VC 1MHHA 1S7UB 4RQQB 1F3JB 1TZGL 2DQJH 4ZXBC 1D5BA 1EHLL 1X5XA 4WEBH 3RNKB 5ICZA 2AXFA 4UOJA 5JMOC 2MPAH 5DQDL 4KI5E 3QUXB 5MENE 4YBQD 3DVNA 3CLEL 5FKPB 1S8DB 1MSPA 3FMGL 4P2RD 3RWDB 3U0WL 1X6LA 1WITA 4JFPA 4CVXA 4HHAB 3K1DA 1KELL 1ZSDB 5IEKB 4NJ9H 5GZOC 5I1DB 1EVUA 3LEYH 1U8KA 1PVHA 4IJ3C 1F4YL 4KJPD 1QBLH 2WINA 1ZHLA 3W82A 1ES0B 3RGVC 1HHHB 3UTTA 1TETH 4JKKA 3ZHKA 4MNQE 4OAWA 1FCGA 4WTXA 1B0RB 5HHOE 4XAWH 4ODXB 1QNZH 2BNQB 1JN6B 1ZS8B 3HNSL 1INQB 2LVCA 5D1QC 4U6TA 3FT3A 4QNPE 2X6MA 3FO1B 1CT8A 4HKJB 1EFXB 2VDKL 3N1GC 2A1WL 4HAGA 1T7VA 5F7NC 4PV8B 3ARGB 2Y5TB 4E41E 3LCYA 4JZOA 3GNML 1UB5B 1PKOA 3CFDA 5CIPH 3EBAA 1E4WH 3GSXA 4YX2H 1WWBX 4R26L 4KK8D 3DJ9A 1IGJB 4K7FB 3LIZL 3INUH 3JVGA 5IG7A 2Y23A 1FFNA 1U3HB 4KMTH 3BPNC 4K3EH 5FCUH 1E4KC 2EDTA 5KTEH 4JHAL 4TQEL 2CUHA 1EJ6A 2HT2D 3TEUA 2C1OA 4OZHA 2P8LB 2COQA 3AMLA 3QEHB 1AKJD 4JFDB 2E7LA 3OHXB 1DANT 3MRRA 1Q9LA 4EBQH 3BKML 5IFHH 3N1PC 1WISA 4JM4H 4NKIL 3MRNA 4WY7L 2ZSWA 1HEZB 3ZDXF 1D7FA 1B9ZA 1I9IH 1E27A 3QDJE 4NWTL 4EJ1C 2NTSP 5IOPB 1S9XB 1F5WA 1J1PH 4HIXH 1GHFH 4DK3A 1QFPA 3EW3B 4JFOA 5FUZL 2PW2B 2YWZA 4UV7H 4NC0B 1D9KA 4H0IA 4HWZA 5C8JA 2HT4D 1I1YA 5GHWH 2XI9A 4XCFL 2VXTH 3KPPA 1T21A 2D2OA 3VRLF 3BISA 3QIBC 1SEBB 5ETUA 1JI1A 4EZMA 1QFUL 4NKQB 3T3PE 8CGTA 1FLRH 3VGEA 2BY0A 1G7HB 3QT2A 1D9KD 1F58H 3BESR 5TGBB 3T0BA 3SDDA 3DRQB 1BQHB 4H1LA 3VGBA 3WIFB 3X13A 5FA3B 2HTLD 1J10A 2VERN 4NM4H 4ZFZA 5T1DL 3F7YB 1XT5A 1S9YA 1XFPA 2G75A 3PWPE 1WLHA 1A02N 5C0CD 3GRWH 4ZSOA 4LLYA 4GRLD 1M05B 5DJ8B 1P1ZA 4LU5H 3VH8G 3I50H 1LK2B 4GG6B 3ZKMC 1U3JA 1F3RB 2R1XB 2X4UB 4Z8FL 4UUJB 3ULVF 2VLKB 2B20A 1QYGL 1BVZA 1MWAB 4RMUA 4OGAC 5DEFA 3MREB 4RFEB 3PWVA 1IVLA 3WUWG 4GW5A 4OKVA 3DARA 3B9KC 4LQ1A 4LSDA 3TESA 4IS6A 2XZQH 3E1F1 4Q0XH 4G6FD 1HNFA 3C8DA 1PZ5B 2XFXA 4LIQE 3PV6A 4KK5D 4XVUD 4PJBE 1LO5B 2R0KH 4HGKC 3S35H 5AEAA 3SO5A 3O4OB 1A5FH 3C2SA 5GGRY 4K3DL 4YBQC 4YDIL 4RGNB 4YR6B 2FSEA 4LQFH 3BAEL 1FNGA 2FJGB 5FO7A 4ZUTB 1IAOA 3HAEG 2PW1B 3VFPA 1OCWL 4YXHH 4OF5A 1CICB 4W68A 3U4EA 4KJPC 3LKRB 3QIWA 3D25A 4YE4L 4X6CB 4QRQB 4Y19B 2QADD 4LLMA 5I73B 4MJIE 1G1YA 3ZDZE 3O3AB 4FN0A 1SJEB 2XY1A 1BF2A 1FO0A 3QFDB 4PRPA 3VFRA 1K2DB 3OX8A 5SWZB 4QOKA 4PJCA 4PY8J 4WWKB 1TVHA 3KR3H 5IVZB 5TFSH 1KCKA 1KPUB 1WIPA 2FBJH 2BRQA 3HG1A 4R7DB 1A7RH 1RIVH 1WAAE 5FYKD 2EE2A 3GJFA 3QIWD 2AJVH 1OARL 2DYPA 2DI7A 4ZTPH 1BM3L 1KTLA 1FZMA 4XPFL 3V95A 5BO1H 3D48R 4QOKD 1IM9B 1QFWM 4G9FB 3CFJA 2WNGA 1GIGL 1XEDA 3FHAA 3HG1D 1U8NB 3BDXA 3TNNB 2A77H 4AH2A 3DXAB 2BY2A 1FVEA 2VUOA 4KK8C 5J12B 5JUEL 3ES6A 4QGTA 1SEQH 1R24B 1P7KA 4GRWF 3FCTA 3QFJB 1FVDA 4O51B 3VFNB 2BNQE 1GGBL 2HT2C 1MRDH 2Q87A 3RY6A 5FUOH 1KGCD 1OAQH 1TVBA 4HCRA 3TBVB 2WBJA 4I13B 4LMQI 3JSSA 2IQAA 2V2XB 4FQQA 1XMWA 1XF3A 4PTUB 3I02B 3SCMD 4YBHA 3VWKA 4LSSL 3MSPA 1JZ5A 1E6OL 1Q9KB 3EJZD 3VXMA 1C5CL 5GRUH 4PJDF 5ICXB 3QBTB 3MJ9L 3MODH 3U7YH 3BP5B 4P3DA 1MPAH 5F7DA 1WK0A 3OKMA 5TE7H 2HT4C 1Z0NA 4YGVB 5EC2A 4V1DB 3PDOB 5F1OB 5DYOB 4GXVH 3LDBC 2AGJH 2XPGB 2WUCH 3KPRD 5M7QA 4YDKH 1F45A 4XWGL 5LGHL 4KPHL 1NJ9B 2DWDB 4WHTA 3VXMD 3LD8C 1JGEA 3CUPB 3BGFC 1RJLB 4JO1H 2FHBA 1RZGA 1D9KC 2XQBH 3F12B 1Y18A 1QOKA 4JFDE 4ODUA 4YAQB 2HTLC 1KC5H 4ZO6A 4LFHG 1KLUA 3RWHA 4FNLH 1X4XA 1E0OB 1NGZA 3IYLW 1RUQH 3HFML 2QQQA 2EDDA 4GRLC 3WEXB 2X70B 4I0PB 1KTDA 3BXNB 4ZUUA 2ICWI 3SE8L 5TQ0H 2FL5A 5ISZD 4X7FC 2P5EA 3RVXD 5CWSB 5I1JH 1OF2A 4HWEH 3V0WH 4KMLB 5I17A 5MEPA 2B0SL 3ILQD 1PZUB 3C6LD 5F7LB 2VDQL 2BHUA 4OUUB 4L8DB 2OQJB 5HPOA 4Q9CA 5IHBA 3NAAH 1JZ3A 4PJ8B 1WUNT 5IB1A 3MRMA 2BVYA 1MFCL 3MRLB 7CGTA 1E6JH 2PNDA 3WFDH 1ZT1A 2GW5A 2AXJA 4KK5C 1A6TB 1RUAH 3C5ZA 3Q3GB 4XVUC 3W2DL 5I8CA 1S78D 2H2PD 3R8QA 1UCTA 4GRMA 3RDTB 4WENB 4D8PB 1C7SA 1FPTL 5FCSH 5C9JA 4CNIB 1NCDL 3ETBF 1KIRB 1GGCH 5TDOB 2DQEL 3C8HA 3JTSB 2OZ4H 2CKNA 2UV3A 4F7EB 1IAMA 1ZT4A 4JKWA 1UZ8A 2DLIA 1YMMB 4JN1H 1RZKC 4ENED 4UILH 1CS6A 1NAMA 4XNZC 2QADC 1FL3B 4FFYL 4ODTL 4R8WH 1IEHA 4JB9L 5DTFA 2JCCE 2X1XR 1XR8A 4KKBD 4LCCB 1BOGB 5C0BA 2YD4A 2HKHH 5ALCL 2W60A 3JWOC 2XWJB 3HI6H 5D7IA 2MQCA 4JY5L 2R56L 3CZFA 3AM8A 2IJ0C 4Z77B 3D0VB 5E2VL 3BPCB 4Q9RH 4MQ7A 3RWEA 1QA9B 3KYMA 5I76B 4N68A 1HHGA 4Z95L 1LO4H 3ARBA 3QIWC 1VEOA 1F90H 5C0EB 1MCIA 3O6FA 3VRIB 4NN6C 5IMLB 4RGNE 2IEPA 4JO3H 1AE6L 3OJDB 1CDUA 4TSBH 5C0BD 4EDWH 3BRGC 2FEEL 5IGXH 3LZFL 3GB7B 3D85A 1X6NA 4H88H 3QEGL 1R5WA 2XWTA 4HDIB 4L9LA 1DBKL 1TNMA 5FECA 1FCCA 1CN4A 1XGRB 1XGUB 3ARBD 5CZKA 4X6CE 3REWB 1JRHI 3UX9B 2EC9U 3ZLQC 3DX8A 3BKYH 1OPGL 3G6AB 1FDLL 4G3YH 5DI8A 5DMYA 2I9LA 1U8LB 2EDJA 4HW6A 5SWZE 1T83A 4NOFA 4I9WD 5DC4B 5IESH 1CU4L 4D9QE 4OZ4B 3D85D 1JHLL 4OQTH 4JLRB 4DEPB 3OPZL 1VB9A 3L3JB 3P0GB 4F37K 4P3CH 4PS4L 1CE1L 3U0PA 2GTZA 3QPXL 5F7EL 4WU5B 3SOBH 1S7WB 3D3VD 3QXAB 4OV5B 1FZOA 3SCMC 5CBEB 5JPMB 4WCYL 2R2HB 1OQXA 2NXYB 4IDLA 2FJFA 5E6ID 3EJZC 1AD0A 1CZ8L 1FL6B 5FDWA 5IMKA 4UIMA 3RY6C 2R4RH 2HFFA 4RMQA 2Z31A 1VENA 5MEOA 4G9FE 1X4YA 2DQTH 4TRPL 2V7NB 4Z7VF 3O4LE 5AD0B 4UTAL 4JPIA 5DJXB 3MV9A 1KBGL 2A0LD 4ONGL 1U8PB 4X6DB 3CH1B 4YDVB 4HK3J 2IBGA 5C7XH 1UVQB 2Z31D 3A6OA 3FO0H 5HHPA 1S7UA 2C3WA 4ODBD 4RQQA 4ZDHB 1F3JA 3BN3B 5AAWA 1MJ7H 1WT5A 3AU1B 5J9PB 4NP4H 4I0CC 2MTPA 4J7RA 2MMXA 4HUNB 5EUOA 1DEDA 2Z8WC 3QUXA 3S36X 5GJSL 5FKPA 1S8DA 4ZPTB 4OCXL 4I77H 3RWDA 4BQBA 2GHWB 3RVXC 2M26A 5F1KC 1WEJH 3UZVB 4HHAA 4N9GB 3GBMH 3ILQC 2B7DT 3C6LC 3QDMA 1ZSDA 5F6HJ 2X1WL 4V1DE 5D8JL 3V4UH 4WU7A 4QRSB 1HHHA 5JHLL 2Z9TA 1S78C 2H2PC 2UUDK 1BLNA 2K7PA 5DLMH 1JN6A 1ZS8A 5DGQA 1GAFH 5FYJD 1CBVH 1CF8H 4AMKH 2HVKB 1NGWB 5F7HA 3QDMD 2XXMB 3KPLB 5E1AB 3PHQA 3VG0L 5SX4I 5C0GB 4FOMA 3FO1A 4MXQD 2IG2H 4HKJA 3C9NB 2CD0A 1EFXA 3DSNA 3WMSA 4KROB 3S36H 1Z0MA 4NQDE 4PV8A 3ARGA 4ENEC 2Y5TA 3MBEA 1CFVH 3VFGL 3MTRA 4X6BB 1UB5A 3CXDH 3MA9L 1WIUA 3U4BL 1OT2A 1BBDL 4KKBC 3B5GA 4TSAL 4O02L 3TBYB 2NX5D 3KHOA 3MFFB 2UUDH 5F9DC 1IGJA 3FRPG 4A6YL 4GQ9L 4K7FA 4MJ2A 2FLBT 5F6IC 3TYFB 5IFAH 3I6GB 4PGBB 4X4MA 3MRFB 2XA3A 5I74C 1H5BB 3MBED 1CDBA 2P8LA 1FGNL 1WJ3A 3OHXA 1I7TB 4JDTH 1N5YL 2G60L 4OF8A 1JJUA 3IKCB 4KVCH 2NY5L 4PJ7E 4PJFB 4NZTH 2JJSC 3MR9A 4JG1H 4CU7A 4TSCL 3TV3L 3AM8C 3WN5A 1QSVA 2C3GA 3DUUB 3EFFA 2A9ML 5IOPA 4JR9H 3MLXH 2AEQH 2PW2A 1NFDE 4FQIL 3ARBC 4M5ZL 3BIAX 5DD1L 4BSJA 1DANU 5CP7B 3KPTA 4WWID 4X7CC 1MCOH 3QIUA 3MV7D 1SEBA 4HXAH 5JW5B 2IALB 4LCUA 2HWZL 2H45A 4K71B 4G7YH 1D6EB 4PJHB 1YQVL 4JM2B 1LHZA 5TGBA 4NRZB 4DUXA 1RU9H 1FAIL 1BQHA 1WBZB 3LH2L 5E6IC 2R2CA 3U30B 1VGEL 1RAMA 1Q8MA 3AS1A 4KMQA 3F7YA 1T83C 3QIUD 3IS0X 2R0LH 5IHLB 1JCKA 3BZ4A 2IFFL 3BDBA 1G9MH 3SKUD 3VCLB 4CU8A 1JNNL 3E2HC 1M05A 4D9LH 1RPQA 5DJ8A 3AFLA 1LK2A 3LQAC 3GI8H 2XRAL 4OLVL 4P9MH 3BWUC 2R1XA 2X4UA 2VDOL 2A0LC 3MNZB 2VLKA 4HGMA 2YMXL 2ZNXA 4I8DA 5LJYH 1MWAA 2J8UF 5EOCL 1ZLUK 3MREA 2W9DH 4RFEA 3QEQD 2XY2A 1X5YA 2MSPA 2XWBB 3VGDA 3DECA 2QV2A 4IDJL 4QKXB 2Z31C 1MOEA 2WWMD 5D5ME 5HDLA 5I1KH 1UQSB 1PZ5A 4M7JL 5KSBF 5FHBL 2KZ1B 3U9PH 1PD6A 1LO5A 5CMAB 3OKOB 3BPLC 5T5FH 4F3FB 4D2NA 5EORL 5I8OH 4H25A 3NPSB 4LAQL 3U0TB 1R3IL 1DVFB 2VNCA 3HAEH 1ZA6B 2CXKA 3H7LA 3WIIH 1J1OL 2IGFH 2QR0B 3UJIH 1RZKH 4YR6A 3VW3H 3I84A 5C08E 2FJGA 2E7CA 4OTXL 1QR1A 4HJ0D 5E9DA 4ZUTA 1S7SB 1EEYA 1KEML 1CIUA 2WP3T 1VA9A 2WWKT 4PB0H 3G6JB 2PW1A 1ZLUH 1WF5A 3G08B 3WHXA 5B38A 5GIRB 4U49A 4IOSD 1CICA 3T4AA 3UTZA 3LKRA 1K6QH 2MJWA 4QRQA 4Y19A 1AQKL 3O3AA 5HY9A 1SJEA 2VDLL 5J56B 2DMKA 2DLGA 5CJQL 3B83A 4WWKA 5IVZA 3FFDB 4AIXA 3FO9A 4ZAKA 1KPUA 2QKIA 2XZAL 5E9DD 2J4WL 3VFVA 5ESAA 4IEFB 3AREB 1T7YA 4MXQC 1MFBL 3HLAB 1IQWH 5B21A 2VDPL 4UBDD 5E5RB 2DLEA 3NFSH 3BIKA 1TVDA 2NZIA 2F58H 2VITB 2X1OA 4OFYD 3PG2A 4KQ3H 4NT6B 2IAMB 1CXLA 5DMKB 1MRFH 4QRUB 1OD9A 5IVXF 1ZMYA 1OAZL 4YPGA 5SWSD 1UENA 4ZAKD 1IM9A 1AY1H 1IBGL 5L8LB 1BD2D 1FIGH 3TNNA 1OGAE 3DXAA 5F7FA 3NZ8B 4BYHA 1NBVL 1UM6H 2V5MA 4NCC1 4UDUB 1R24A 4L4TB 3QFJA 1FYTE 3QXWA 2XACC 3NOIA 4RDQG 2BSTA 3MBEC 2XN9B 4OGXH 3TBVA 5JIIA 5JR1L 4R0LB 3DVIA 1T7ZA 2JB6B 4N1CA 2P5WD 2N1KA 5A2KH 3UZQA 4XCEB 4PTUA 1MHPL 1ROWA 1P53A 3I02A 1A1NB 1S7VB 5DD5H 3R1GH 4GXUM 1VPOL 3S37H 1Q9KA 1P6FA 3FT2B 2IH3B 5ICXA 3BP5A 3BE1H 3BIBX 1A9EB 1HDMB 5CEZD 35C8H 3TT3H 4U31A 4YGVA 3PDOA 1AR2A 5DYOA 3QXUA 2NY2D 1URLA 2XPGA 1IAIH 1K9TA 2NY6B 4HUWA 4A2LA 4NO2B 3WN5C 1NJ9A 1J7VR 3ULUE 2DWDA 3IKKA 4F58L 2D7TH 4L29B 3E6FA 1JRHL 1RJLA 1FNAA 4FABL 5F7MC 3F12A 1ZOXA 4YAQA 2F53A 1NUGA 4LP4A 1KTRL 2ZCHL 3NBNA 3EDFA 5LWYL 3QIUC 4U7SA 2WBWB 2XICA 2AI0L 2E7MA 4EDXB 5FOBB 3WEXA 5C71A 3IAQA 3EDEA 2DLTA 1REIA 2X70A 2AQ1A 4N0CD 2EDRA 3BXNA 4EXKA 1C16B 3F58L 1NAKL 2W07A 4HFUH 3I9GL 2X4PB 4TTGA 5GRWA 3NIGF 5CWSA 4CVUA 4WGVB 2F53D 3MOBL 3BT2L 1EUUA 5I8EB 4L8DA 2OQJA 4KTDH 4PJ8A 5E2WL 1RFDH 2WWMC 5C6PB 3MRLA 4DKFL 3GSUB 4PJHE 4KUZL 1A6TA 1H8NA 1Q0YL 3SDXE 4KC3B 4BFEA 2X4QB 3RDTA 4JRXB 3WD5H 4ETQB 4CNIA 1DLHB 4G6KL 3T0XA 1KIRA 3IDUA 3G9VA 5TDOA 2XZCL 5HVHC 2FX8L 4JFXA 4UT9L 2YK1L 3QA3B 2E27L 3JTSA 4G43B 1NDGA 4HJ0C 4NRYB 5JLZB 4AL8L 1YMMA 4RRPA 4IRJD 5GGQL 4WFHD 2WW8A 3RDTD 1WFUA 4OUOA 4S10A 15C8L 4YH6A 4G5ZL 3CU7A 1F6FB 1FL3A 4JFHE 2H32H 2M1KA 3MA7A 5I2IB 1Z3GL 1BOGA 1QPXA 4O2FB 4YHKH 1ZANL 1RZIB 5J0BA 4AEHL 3ZL4L 4Z77A 4P2CG 2BP3A 3D0VA 3BPCA 4L3EA 2F5AL 3FO2B 3GMQB 2OK0L 1QA9A 1JGUH 5I1HL 1KXVC 1OGTB 2DKSA 3V0VA 4X4YA 3LSOB 5KVEL 4MXWH 4UBDC 2Y36L 3FN9A 5C0EA 5ITBH 3VRIA 3TVMB 2GITB 3L5HA 4C56E 2OMBA 5IMLA 2FB4H 3O2DH 3OJDA 3PQYE 2FO4A 5TQ2L 2GSGA 2XYCA 3IXAB 3HMXL 3TYGH 3GB7A 1KLFA 1O5DT 4HJGA 2P8MB 4ZAKC 2D03L 2BNUB 5DJAB 3AAZB 4NZJA 4HDIA 4L3ED 2DB8A 3HE6B 1QVOB 5ACZB 2XQYG 2HKFL 2NY7L 1QKZH 1XGRA 3QUYB 3REWA 3LRGA 1JK8B 2DTMH 5JQ6L 4ALAH 3WIHL 2X4TB 3DI3B 3G6AA 5FA4B 4AT6B 1YEKH 3K8MA 4H0GA 1U8LA 1SBSH 4JQIH 4BK4A 1RIHL 2MKWA 5ADOL 4OZ4A 2P44B 2NW2B 2DMCA 4JLRA 4PJAB 4BZ1L 1IM3B 5D96C 4O2EB 3L3JA 1CFNB 4MD4B 2LABA 3WFCH 4XP9H 1MFEL 2BJML 2CIIA 4KHXH 1L9MA 3QXAA 5DUMH 1U8OB 5EBGA 4DAGL 3QISA 4KQ4H 2FIKB 4OV5A 3Q6GH 5CBEA 3OJMB 3ARVA 2CMRL 2R2HA 4PD4K 4J3TA 1TMCB 4IRSD 3LQAH 1U3ZA 1FL6A 3L3OB 4GFTB 2Q3ZA 4M93B 2HVJB 3CH8A 4OZFG 1GGIH 4FQ2H 2F74B 5AD0A 3H7BB 5AWNH 4HIJA 5BRZD 4Y2DD 2M8XA 3DROB 3RUGE 5ICYB 1ND0B 3IFOB 4LGRB 2NY2C 3QDHA 3VD9A 1JZ7A 1U8PA 3PWNA 1H0DB 2HJKB 4P2OD 2V9QA 5B3JE 4L4TE 5F44A 4YHLH 4YHOH 4P9HL 4X6DA 4IRZL 4OM1H 4YDVA 5IW3A 2VDRL 1UVQA 2OP4L 1VCAA 2RR3A 5T1KB 3A6BL 3U2SB 4WI8A 3QNZB 3HKFA 3N85L 3O2WH 5FYKU 3GJEA 3GMMB 4ZOBA 5HTSA 1PYWA 1JZ4A 4OLWL 4N0CC 4APQA 2VLLB 4P99A 2Y06L 3V9FA 4MA3B 2CRIA 1LK3L 4ZPTA 1LEKB 5BW7C 3TPUB 4A6YB 2DI9A 3VDAA 5C0AE 5CKAA 4N9GA 4JJ5B 4XNXL 3LKSB 3IF1B 1UFUA 4UMGA 3SKNB 4FXLA 1JE6A 1D5ZB 4EOWL 2ADGB 1QRNB 1MCPH 2E3VA 4XHJD 4QRSA 4M3JA 4P3WA 4APQD 1X5GA 5C0DB 1CLZL 5I75B 2J5LC 4NQSB 2H8PB 4R96B 1UZ6E 3QUML 4XC3L 4ESKA 1C5BH 1LP9B 1SY6L 1BFOB 4H20L 3MCLH 5FIEA 4YQXH 3KPLA 5E1AA 3PWJB 3S4SB 1X7QB 5C09A 4QTHB 2W91A 7FABL 3KXFE 4IRJC 1PG7L 2DQHL 3EO9H 5F88A 5GJTL 3RDTC 2GIYA 5D2LB 4X6BA 5MP6L 5I1EL 2V17L 4O4YH 1EDQA 1CFSB 1BZ7B 3MFFA 4OJFH 5C09D 3MLTA 4DKEH 4NBXB 1QHOA 4LCWD 5BOZG 1CD1A 5D6DA 3TYFA 1FFRA 4JRYB 4K7PX 4PGBA 4X7TB 4OZIA 3MRFA 3QQ4B 2RAMA 3QNYB 4K23H 4BUGA 4G8GE 1H5BA 4XCCL 4RMWA 3TM6A 4MA8H 4WW2C 2X89D 3CDYA 3V8CA 1I7TA 2DRUA 1NANI 3IKCA 1BJMA 2N7BA 1MFDH 3TBSB 2Y4SA 4RBPK 4XNUH 4PJFA 5JW4Q 4DK6A 1JPFB 1X44A 5GS2D 3ZO0A 5JOFB 2ATPA 4PB9H 5DT1L 4PJIB 4YHZH 3NPZB 4NZRH 3EJYD 5D7KD 4ODVH 4RFNC 2KZWA 4U1GC 1IMHC 3DIFA 4PBWD 2OSLB 1F4XL 2R0WL 3D6GA 4PJ5B 3V5HB 2C3HA 5CP7A 2DQJL 2CRMA 1SJVA 2UY7A 1RZFH 1XGQB 4WEBL 5JW5A 1ADQH 3OB8A 2A6JB 5EZJB 1D6EA 5BS0E 1U2HA 5F3HA 5EOQH 3AVEA 1J5OH 1CR9H 1JUFA 4XZUB 3MC0A 1VADB 2ITDB 1ODAA 4NRZA 1CDJA 2B8OT 4RBPH 1F02I 1WBZA 3ZSSA 3LKNB 4IRSC 3LS5H 4ONFH 4XP6H 4MDIA 2VTFA 4NJ9L 2QEJA 3OKLB 3O3DB 3LEYL 4JZJB 3VCLA 2ICWB 1QBLL 1KJ2B 1TETL 4Y2DC 4JO2H 1S9WB 4XAWL 2NY1D 3MNZA 2MNUA 2FATH 1QNZL 1MFAH 4P2OC 1I8KB 1KFAH 2Q76A 2BMKB 1QRKA 3T3MF 1CE6B 1JV5B 3Q48A 2QSCH 4HLZG 4H1LG 1F97A 3IFLH 1Y6KR 1YN6B 3ARFB 5CMAA 3FONB 3OKOA 2AEIT 3BH9B 4F3FA 4MD0B 3ZKSD 3U9UB 3U0TA 1DVFA 2X05A 3PP4H 1AO7A 5F1IB 4P2YA 5DRZA 5TF1H 2VISB 2QR0A 4NC1E 1E4WL 3TJEH 2APWA 4P4RB 3X3GH 2ICEA 4ZO8A 4P2QD 4M00A 3GHEL 1S7SA 3INUL 4K3HA 3VXSA 3G6JA 4XBPB 3TH4T 4Z7OE 4KMTL 4KH2A 2CDGB 3BP7A 5GIRA 3RIFK 1OAYH 4K3EL 3LN5B 2ZCLH 3X11A 5KTEL 1DQMH 4XHJC 4H8WH 1AO7D 4APQC 1EO5A 1RUMH 4Q74A 1OSZB 1OWRM 2E6QA 3FFDA 4EBQL 5IFHL 1GZQB 1J8KA 4JM4L 1I3GH 2HLAB 3VXSD 3E3QC 2ADFH 1LO0H 5AZEH 1I9IL 1SM3L 3AREA 1K8IB 2BVOB 4NYLB 1HK6A 5E8EB 1A6UH 3MJ9A 1J1PL 4HIXL 1GHFL 2FGZA 1T0MB 4UV7L 3JV4A 3CX2A 1IKNA 3QCUH 3BFOA 1JPGB 1UG9A 1LD9B 2VITA 2ZWLT 4NT6A 5CJXC 4LBEA 5DMKA 5GHWL 3T2PA 3WS6C 2VXTL 5F89B 4LVNC 1ONQA 1Z6JT 2P43B 1INDH 5AUMA 4JPVH 1GRWA 1FNEB 1FLRL 4WGWB 1JF1B 4UDUA 1F58L 3C09B 4JCLA 4X9IA 1BVKB 4OSUH 4KRMB 1T6WA 3T0EE 2F54A 4R4ND 4U1LB 3GIVB 4NM4L 3SJVE 2VIRA 5IT2H 2XN9A 1T66D 3BI9X 4GKNB 2O93L 3VXRD 4P5KB 4PGJA 3EO0B 4WUUA 4POUB 3VXUE 4R0LA 3GRWL 5ACLA 1JYXA 2JB6A 4AIZB 2KUTA 2H3NB 2NY3D 3NIDF 2AKRA 1FVCB 3NCCB 4LU5L 1TQCB 3I50L 1S7TB 3JUZA 4FQXB 4XCEA 5DJ6B 5E4EB 5F9JB 1A1NA 1H3XA 4S1RH 4Y8AA 3IFPA 4TVPE 5CEZH 4CJ0A 1IL1B 1C7TA 2JELH 3K4AA 2AK4B 3FT2A 5INDB 1KCSH 2F54D 3EJYC 32C2B 4XP4H 5LQBH 3AMKA 3MRKB 4NM8L 5DJDA 4F33A 1A9EA 4WUUD 2XZQL 4Q0XL 1I7UB 2JLLA 3BN9D 2R0KL 4IM8A 4NO2A 3S35L 3MYZA 2ZOLA 2EH8H 1A5FL 4OCSL 5FFLA 5IMMB 3SGDI 1N6UA 4LQFL 2DOCA 3IJYB 4KRPD 5I8KH 5KJRH 5FYJU 2PN5A 3CVIH 3D1MC 4ISVB 2XZZA 4KI5D 5C3LD 3HC3H 1OAXH 2R9HD 5A3ID 4YXHL 5FOBA 4AIOA 4EDXA 1B0WA 5DURD 4QT5B 1ZGLP 3JWDH 2DKUA 3K8LA 1AJ7H 5CSGA 4PJIE 43C9B 4ODWA 1EBPA 2NY1C 3ALXA 2X4PA 4M9OA 3ZE1F 1V3MA 3R4DA 5TFSL 3KR3L 4BFIB 1FZJA 2ZUSA 5JDSB 2DQDH 1U58B 3SDCB 2ZZUT 3HI1B 4MNQD 5I8EA 5HHOD 4LP5A 1A7RL 1ZGLB 1RIVL 3CSYA 3WS3B 3WNNA 2AJVL 3ZKXC 2G5RA 1N0LA 4ZTPL 4S0SD 2X4QA 2A83B 4Z0BL 4JRXA 3VMOA 4JQVC 4HEME 3C8KB 3GHBH 3KNBB 3B9EA 3LKOA 3RPIB 3U46B 1GYAA 1BFTA 2A77L 2DJ4A 2AV7A 3QUKB 4YC2B 5FK9A 5B8CB 3MRBB 4KVNH 4E41D 4G43A 2APTA 5HYFA 3GMLA 4U1JB 1T0NB 5JLZA 1HWHB 2XQYK 5GS1B 1SEQL 5KS9A 5EU7C 2RCSH 4X9FA 1EEQA 3L3DB 1O7VA 2Q86B 4U6YB 4ZQKA 3BMVA 3S9DB 1MRDL 5CJ8A 5FUOL 1OAQL 4TUKH 1EIBA 5I2IA 5HHQB 4LASH 4O2FA 2D4FA 4NJAH 3O3UN 5HJ3B 2IF7A 2B1AH 1U8MB 1YEHH 3IDIB 3GMQA 3MRPB 1OGTA 1GZPB 4W4OA 1CGUA 1KLGB 3FT4A 5GRUL 3LSOA 2WSKA 5ECJE 3A6CH 3MODL 3U7YL 3SN6N 1KOAA 3TVMA 2GITA 4YWGH 5EZLA 5TE7L 1J8HB 3QDJD 1CFBA 5F1SA 1VGKA 2P8MA 5EU3B 4GXVL 3AAZA 4FFZH 5DJAA 1PAMA 2AGJL 1ZV5A 4U6XB 2WUCL 1RD6A 2AEWA 4YDKL 4BKLB 3HE6A 5ITFB 1QBBA 1QVOA 1UM5H 4NN7B 4D9RD 5ACZA 5EUOF 4XNYH 3QUYA 2I5YH 3UTOA 4JO1L 5LVEA 1IKNC 2P24B 1N8ZB 3HZYB 4LPYA 3TA3B 4AT6A 4PJDB 1UB6B 5E8NA 4R4NC 2X44D 1XIWD 2CRYA 1KC5L 2EC8A 4Z7NE 1T66C 8FABB 2NW2A 1AIFB 1QBML 4PJAA 5E8OB 2R23A 4FNLL 1IM3A 4O2EA 1RUQL 1CFNA 2JKXA 2UWEE 4Y2OA 2NY3C 1MCWW 1X5KA 4MB5A 1U8OA 1XF5B 4XPBH 2FIKA 3UBXI 4TOYL 5TQ0L 5EOCJ 1HHKA 1CQKA 4D0BB 1CLCA 5DVLA 4B7IA 5I1JL 1BGXH 4N1EA 4HWEL 5FAAA 3V0WL 1MLCA 2EDOA 4JGJA 3L3OA 3IFNH 5DF0A 4EVNB 5TE4H 3BW9B 3NAAL 1NC2B 2F74A 5CFHA 5KANG 3H7BA 1E6JL 1ETZB 3WFDL 3DHMA 5CLWA 1A1OA 5E5UB 5ICYA 1LQSR 3O2VH 2YRPA 4I5BB 1RUAL 1ND0A 5B3NA 5EU5B 3IFOA 1PW3A 3BN9C 4PJGB 3QUMB 2VABB 3QQ9D 4X6FB 1H0DA 1YUHB 2HJKA 5K9KB 2GQHA 1BEYH 1MJJB 3BQUB 5JW4M 4FMFA 4X4ZA 1GGCL 4L5FH 3GMOA 3EOAB 4HKZA 4KRPC 5EO0B 2GAZB 1EHXA 1BPVA 5TPWH 4F9LA 5D7LB 3S6CA 1A22B 1V05A 2OZ4L 5T1KA 1LVEA 4NQVA 3QNZA 5KSAB 4KI5C 2BY3A 1YEIH 5C6WH 3NCJH 4JN1L 2AEPH 2FX7H 2R9HC 2ICWJ 4YO0B 4UILL 5A3IC 3GMMA 1OLLA 3THMH 3HE7B 2AK4E 5LGJB 4R8WL 4NHCH 4JVUA 3P9WB 2B1HH 4MA3A 4FP8H 1LEKA 2HKHL 3RWIA 3TPUA 3U36B 4PREB 4A6YA 5L8KB 4Y16B 3GMNB 3IDJB 3HI5H 4GAGH 1AI1H 3HI6L 1HHIA 1OHQA 3IF1A 1LO2H 1JWMB 3SKNA 4Q9RL 2NR6D 3WFHB 2ADGA 1QRNA 5L7XH 3NA4A 2ZCKL 1LO4L 5C0DA 5I66B 1F90L 3PHOB 4KKNA 2MCPH 3KG5A 3R0NA 4JHAH 4NQSA 1U6AH 2H8PA 4R96A 4JO3L 4TSBL 4EDWL 2EDEA 4X7DC 1LP9A 1BFOA 5IV2B 2EE3A 3RL1B 2QQKH 4AJ0A 4H88L 2C26A 1CTOA 4HMDA 4D0CB 1IAII 3S4SA 4WDIB 1NC4A 2ZG2A 3I2CH 4DOHB 3O8XD 1TTUA 2DKMA 5ESQB 1NFIB 4F15C 3BKYL 4LRIC 4G3YL 1NKOA 2FHFA 3KS0J 4RX4A 2NXZD 2OS7A 5D2LA 2ZJSH 5IESL 4PGDB 1TCRB 4OQTL 4W6YB 4P3CL 1CFSA 3EYSH 4QY8A 5IBLD 2VZTA 1NC4D 4G7VH 2D7OA 3SOBL 4CKVX 5MHSE 5HGGS 4DZ8B 2CLVB 4HT1H 3MOQA 4JRYA 3LN9A 4X7TA 3TPKA 4PJEE 1P84J 3QNYA 1LGVA 1UJ3A 3F62A 2UVFA 2R4RL 3CX5J 1BBJB 1KJ3H 3DX7B 2DQTL 5GS2H 1CDCA 3DBXB 1BQUA 1KCRH 4OFPA 1MCBA 3T8XB 3TBSA 5I18H 3WDJA 3DYMA 3PGDA 1JPFA 3D39B 3MCG1 5JOFA 3TIEB 3NCBB 3RX8A 1HE7A 1ITBB 1M71B 4W4OC 1I4FB 4HS8H 5C7XL 2OSLA 4MSWB 1T1XB 2BX5A 4PJ5A 1CVRA 1ED3B 4MLIA 1XIWC 2DM4A 1MJ7L 3TN0B 3ME0A 1KYOJ 3S3PA 1UKTA 5IM7B 3DOSA 3CPLA 4NP4L 4E42B 5E8DH 4ELMF 5EZJA 1WWWX 5D7JD 3BEVA 5CIPB 2O5ZH 5E8PB 4G42A 1NGYB 3DMMB 1PG7W 2W0PA 1Y0LB 5F7YC 4F7PA 1VADA 4Z7UE 3QDGE 2ZUWA 3VG9B 4PJ5D 3N1MC 1WEJL 1J8HE 2V5RA 4YDIH 3GBML 3QAZB 1Q38A 1DE4B 4P4KB 3OKLA 3O3DA 3IU3B 3GSQA 5I1IH 3RIFF 2HRPH 2ICWA 3V4UL 3PF2A 4LHQB 4TN9A 5J7CC 1W0WA 5GSRB 1S9WA 5FEBA 3W0WE 5DLML 1RJYB 4RDQF 3QQ9C 4HLZH 1GAFL 1G7IA 1I8KA 1CBVL 4AMKL 2I9TB 2X09A 2EDKA 4QF1B 2IANE 4PG9A 2W38A 1JV5A 3QHFH 4JFEB 4Z7QF 2K3TA 5C9KA 2IG2L 4PLJD 4M8QA 1ZWIA 2OJEB 2H26A 4Z9KB 3ARQA 5FHAH 1CQYA 1BQHG 5I6XC 4AEIH 1QLFA 1RHHB 2XTJB 1YN6A 3ARFA 1R5IA 4R4BA 3S36L 3QI9B 3BH9A 5C0IA 1BZQK 3O6MH 4MD0A 3J8F7 4MNGE 1IEAB 2CUIA 3U9UA 5E2JA 3BPOB 4PJXE 1AHWC 4Y4KB 5KVMC 5C07B 3CXDL 4UNUA 2OTUB 5F9OH 3O3EA 3OV6A 4P4RA 3O6LH 1QFHA 1NMCB 3RX5A 4XBPA 5IF0B 3PXHA 5IFAL 3LN5A 2NR6C 1H3GA 4PJGE 3N9GH 4L4VB 1N3NB 3ULSB 3BHBB 1OSZA 3M45A 4OLEA 4PRIB 1U91B 3OAYK 4KVCL 2YPLB 3BRDA 4ZMAT 3RJDA 1DP0A 1WFTA 4GO6B 4HUXA 4JG1L 5ESVB 3ZMRA 4C83B 2HH0H 5DFVD 2IPTH 3HUJE 1K8IA 2GY7B 2BVOA 3P11H 4K3JH 5E8EA 4JR9L 1MQKH 3MLXL 2AABH 2AEQL 2H9GB 1QSEE 1T0MA 1W0VB 3O8XC 3V6BR 3CVHH 1KIPB 2ESVE 2J1KA 1M7IA 5D6CB 1LD9A 4YHNB 3RWFB 5B38G 4PRNA 4J2XA 2FRGP 1WBYB 2RJMA 4CN1A 2NXZC 1P4LB 2NY5C 1MCOL 3MRIA 4FRWA 5F89A 4HXAL 3HZMB 4EUPB 3JV6B 1U8JB 2V2TA 4G7YL 3IDYC 1FNEA 5IBLC 3NH7H 2CSPA 1JF1A 4L8SB 2DQGH 3T2NH 3DTXB 4D9QD 3OAYH 2XA8H 1MFNA 5T5NF 1RU9L 1BVKA 1T80A 2X2YA 3UAJD 5I15H 1IGYB 1T1ZB 3GIVA 3CU1A 4OB5H 3SDAD 1MUJB 3PWLB 4HPOH 1W0YT 4LPTA 2R0LL 4P5KA 3EO0A 1G9ML 5FGBA 4AIZA 4D9LL 2H3NA 2FCBA 5MI0B 5FO9A 1CDYA 1FVCA 4XXDB 1S7TA 5F9JA 4FQXA 4DOHE 3GI8L 2R1WB 4P9ML 5EO9B 5K59E 1JZ2A 5T1LB 1UWGH 1IL1A 2RIKA 2BHZA 3O4LD 3IXTB 5INDA 2W9DL 4XWOD 1GJIA 1UJ3C 32C2A 3FB7B 3MRKA 2VKXA 2PYEE 1YEEH 2B0SH 1I7UA 4FQXD 3U9PL 3CLFH 5T5FL 4KFZC 4UV4L 4HKBB 5I8OL 5L2KB 3T65B 3WO3B 1RV6X 1A14H 5D7JC 1JNLH 3TBTB 4WW2F 3WIIL 2IGFL 3I75B 3UJIL 4W81A 1P6AB 3IJYA 2J8UB 5F3BA 1T20B 2AXGB 4ISVA 3CFBB 5HYJB 4U3HA 1NPUA 4PB0L 2DQEH 1V7NH 2EYRB 4LGPB 4Y5XC 4QT5A 4KGJA 3D39E 1K6QL 3RRQA 1T89A 2O5YH 43C9A 4NO0B 4B53A 5ANMB 4AEFA 3BD3A 4NN5B 4FS0A 3OL2A 4MA1C 4BFIA 1GVIA 3SE4C 3SDCA 4ZNEE 5I1AB 5DQJB 3H9ZA 4HX1B 4DCQA 1EPFA 3CD4A 1ZGLA 4OZGF 3VDCA 1G7PA