2D3VA

Crystal structure of leukocyte ig-like receptor a5 (lilra5/lir9/ilt11)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
193
structure length
179
Chain Sequence
b'LSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSAVTLQCGSRLRFDRFILTEEKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords leukocyte immunoglobulin-like receptor subfamily A member 5
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structure of the human monocyte-activating receptor,
pubmed doi rcsb
total genus 31
structure length 179
sequence length 193
ec nomenclature
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d3vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d3vA02
1H5BA 3L6FB 3MLRL 5EOCL 1OCWL 5HYJD 2VDLL 3V52L 4LDEB 3UTQA 4ZUSA 1NUDA 2D2OA 5IKCA 2HG5B 4GRLC 4TTGA 3LKPA 1KBGH 5D2NC 1AR2A 4GW4B 4K23H 5HDQL 3MRNA 4FQ2L 3QUYC 1INDH 2V7HB 3FTGB 3FCTB 3TVMB 4XAKD 3VFSB 1LEIB 2B2XH 3HCVB 5HI3C 1QQDB 5E7BA 4M5YL 3GUTA 3SGDI 1IQDA 3LRSA 3WD5L 1CE6B 5DJ8A 1WIUA 4GAYA 3RNQA 3AS2A 5HGAA 4G43A 3KPMB 3U82B 5INDB 2YHGA 1I9EA 2NY6C 1KTLA 3BD3A 2YKLL 3TZVD 2RB8A 5D2NB 3T0WA 3O6ML 4WUUB 1R0AL 4OGXH 3MNVA 5EOTA 3BX7C 4Y1AD 4IJ3B 5IOPB 1TZHA 1F13A 2H45A 5E00A 2R4RL 4EVNB 3BN3B 4UBDC 2B4CC 1MF2L 4P2RA 1NLBL 4XCEB 1T5WB 1A1MA 1OGAB 1RZIA 5IQ7H 1TENA 3ESVF 4FXGA 4YHZH 5D5ME 4PJCA 1MFNA 3PABA 2ITDB 1OAQL 3D5OF 3AY4C 3HI6L 3KXFA 4NKOA 2RJMA 2JTDA 4L4VE 4IDJL 2J8UB 1SJEA 4EUPH 4OCWL 4WDIB 1XT5A 1E4XH 1T21A 5AAMA 4F9LA 4YDLB 2A0LC 3HMXL 1O0VA 4AIXA 4F80A 4OAWB 1KJMB 2Z93B 4ONHA 1GC1H 4IMKA 4R3SB 4YC2C 1V3MA 2A6DB 1W0WA 4IRSD 5FKPB 1BFVL 2XFXA 4ZS6D 4M1GH 4KKAD 5DF0A 3V6OC 5J13B 1FZKB 2VO5A 5JDSB 5T1MB 1HH9A 2P8LB 5C0IB 5I73B 2I25N 3O4LD 4KJYA 4LVOB 3ULUD 4JRYB 1UZ6E 2YRZA 4X98B 1WIPA 3MC0A 1HHIB 3D3VE 5FM8A 5DSCB 5FA4A 1PEZA 1MPAH 1AGDA 1KJ2B 5D7JA 4Z0BL 3SE3A 2ZCHL 1UA6L 1EJOL 2VLLA 2ESVA 2V2XA 2GEEA 4Q9QH 3LD8C 1WFNA 2OR9H 4ZUTA 5KW9H 1RY7B 2V5SA 3ZSSA 5BMFH 3CUPA 1T5WA 3C6LC 2H32A 3MGAA 4I1NB 4J6RH 1JUFB 1UXWA 4OCRL 3JZ7A 4UQ2A 1D5XA 4DTGH 3WHE1 2FBOJ 3CK0L 5FYJU 1G7PA 4N1EA 4PJ9B 4PYGA 3KR3L 1ZLUH 4Q9RL 3KVQA 3AXLB 1WV7T 4LNRA 1CFVH 1QSFA 2NY5C 3DXAA 3TO4D 3VFWA 1M05B 1AJ7H 4LHUG 5EBLB 4EUPG 1CGSH 3FFDB 5I1AB 3QUXD 4L4VA 3X3GL 2L7UA 5F1SA 3V0AC 1CE6A 2AKRA 3F65A 5CEYB 3TN0B 1FNGB 4GUPA 5GGRY 4G5ZL 2VXSH 4UOW1 2XWBA 4FTVD 5IVNA 1QSZA 4OUUA 1YC8A 4POZD 1A4KB 5J4MA 1Q0YL 2X4QA 3OKLB 2BY3A 4M7LT 1I7TA 2GK2A 5IOPA 5KVGH 3V79C 2JB5H 4HW6A 4DOHB 1JNHA 3HC4L 3TIDA 5AG8A 1IAKA 1HYSC 1A3QA 4AEIL 1FVDB 1F3RB 5DTFB 1LEGB 3LQAC 5EU3B 2V17H 2FZ3A 1FFOA 3MODH 4F9PA 5EZLB 5D93B 4LMQI 5JXAH 1TVBB 2NY4B 3G6JB 8CGTA 3VFGH 4KHTL 2HJFB 2ADIA 4OFKA 3F6IA 4JFOA 1RHFA 3KYNA 4QHMB 2RHEA 2CLVB 1C7TA 2PXYB 4UTAH 1G7IA 1L6XA 2IH1A 5D1XC 2CLRA 4ZTPH 6FABL 1T66D 2NX5E 5D5MF 1RZJC 2WQRA 4LLQA 4OLYL 5EO0A 4UUJA 1ZLSH 2GJJA 1T3FB 1AI1H 4MQ7A 1FZOB 2C1OB 3OL2A 4FHBD 5EOCJ 4FQQB 5A3IC 5E00B 4R96B 4HBQA 5IJKA 4FZEH 4LSUL 3MGOA 4J12A 3LEVH 3BWUC 1QSFD 4OLZL 1QRKA 3M17B 1A1OB 4JKMA 3IJSB 5DRZB 2NZ9C 4AG4H 4IEFB 4NQDB 1IM3A 2OLDA 3SE8H 2LABA 4OFYA 4UDTB 1R3KB 5HGBA 1K4CB 1OARH 1H3GA 4AK1A 5GRJL 1I9RH 3L5XL 5DQ9A 3X13B 2GAZA 3SKMA 2PR4H 3AREA 1OAXH 5FYLD 1W0YT 3WHXA 4KV5E 3RVXD 4PV9A 2ORBL 2ICWA 3WS6C 1KACB 2F58H 3C6LA 1K5NA 2NY5H 2VISB 1TZIA 1ZS8B 3TBTB 1EEYB 1HINL 3NFSH 3ARGB 2IJ0C 1PBYA 1BIHA 5K9KA 3G6DL 4WENB 1D9KD 2XXCB 3V5KB 5SX5H 3ZLQC 2VR4A 2F58L 4YNYB 3U4BH 3LEYH 2XWTA 4HHAA 1ZT1B 3EJYC 4HWBA 1I9RL 3DURB 3MBEC 4HZAA 1WGOA 3PF2A 1R24B 2FYYB 1MQ8A 1DBAL 5GXBB 5EZIH 4ALAH 3LOWA 4Z95H 3OG6B 5JOEA 2LVCA 1L9NA 4KVNH 3V5HB 1D6VL 3RTQC 3P77A 5EBWB 1JJUA 1YEGL 3KNBB 3QEQD 4RMRA 5DVKA 5FA3A 1AKJD 4CGTA 5HYJB 3FO0L 2YSSA 5DJCA 5D2LE 3TBVB 4QNPE 1K2DB 2A9ML 2GJZA 3GSNA 1X4XA 5GRUL 1M7XA 4JVPA 2GUOA 4NKQB 4LNVA 5DRNA 5I19H 5BJTB 1QHOA 3RVUC 4HKZB 3WL9A 1INQA 3F7VA 3TNMB 3C60A 1JF1A 2OM5A 1NDMB 1MRCH 4O2EB 1M7IA 3SO3C 1F4AA 4C56E 2XWBB 3QJFB 2GCYB 2V5YA 1BLNB 3TCLB 2ZOKA 3MODL 3RWIA 3K4DA 1F58H 5DXWA 5GJSH 4XP1H 4DFIA 3L7EA 3CMOH 1GGCL 4ELMA 4JY5L 3UTTD 1XMWA 4X5XA 4V1DD 2R0ZL 3TT3L 4EIGB 2EC9U 4P4KD 2NY3B 1V7MH 5D1XA 2ZP0T 5BQ7B 3F6LA 4HWEL 1T22A 1IAKB 4PJBE 1Q1JL 3IXTB 4FMFA 3PE9A 4NQEE 2I60H 2AXFA 2Q8BH 3VXUA 1UWEL 3VRIB 1L6ZA 1CFTB 4P9HH 4YLQT 5MEOB 2HA1A 4J3SA 3V4PH 1XF4A 32C2B 4MDJA 5DD5H 1P5VA 4OZGE 3C5SA 1AIFB 2F53D 4Q6IC 4NNYB 1A02N 5DHVB 1IGYA 2GKIA 1JPSH 2GUOB 2CMRL 2IANA 5DRNB 2XQYG 2CRMA 3ARFA 5E8OA 3X3GH 4PRIB 1FDLL 1NQBA 3LKSB 5DC4B 4O2FA 3HAEB 3GMLB 4X6FA 4XPAL 2P7TA 2YBRA 4D0BA 3DROA 4F37F 1ZT7A 4JFYB 2CH8A 3JV6B 5IVXF 3J7HA 4MB4A 3IDXL 2OZ4H 5LVEA 1G1YA 3FHQA 3GSOA 4AQ1B 2OL3H 1U3HB 3U2SA 4X4YA 4KKCC 3CSBA 4PP2A 4R96A 2E7LA 2R2HB 2N4IA 4FRWA 4HMDA 4OCYL 1J0YA 1DANT 1T1XA 4I18C 3ZE2F 2HTKD 1QSVA 3Q6FA 3WLBB 3DNKA 3MBEA 1AR1C 5C0EA 2ZUSA 2FX9H 4QWWC 2JJVA 1WTGT 3AB0B 3BI9X 5TF0A 1RUPL 4F37K 4MQSB 4JO4L 3E0GA 2GJZB 4OGYL 4P2RE 4DAGH 3HMWH 3RZWA 1I75A 1GGUA 1U8IA 3MRJB 2B8OT 2Q76B 1ITCA 5DHXB 1VKXB 4DUVA 1J88A 3WIIH 2DKSA 4HIEA 3QI9A 1P6AB 5C0GA 3MTRA 3KXFD 2VERN 3VCLA 4MNGA 2R29H 3MCKB 1MNUL 3FFDA 2HMID 3HC3H 1LK2B 3L5WB 3UBXI 4JHWH 4D9RD 1MCBA 3CXHJ 3CX5J 4MHHI 3UJTL 3WFDL 3ZT5A 3RIAK 5E1AB 5KAQF 1YPZE 5ID0A 5GGVL 1HYSD 4YDJB 1B9ZA 1KENL 4QO1A 4ELKB 3PWNA 5ICYA 5EZOH 1J1OH 2X9XA 1VFBB 4WNQA 3KPSA 4M61A 2DM7A 4Y4FA 4FXGB 3ES6B 4LFHD 4NC1E 3P73B 3MRCA 4P23C 2A77H 5J3HD 1DBBH 2X4TB 3TA3C 5E2TL 4A2LA 4LEXL 3MBED 4XMPH 1YYLL 2CDEB 4NN6C 2DIAA 2D0FA 1QP1A 4Y88A 1BWWA 4RIRA 2W91A 5ELIA 1JV5A 3MRHA 4QTHB 1C16B 3CX5K 5LJYH 1FDLH 2IQAA 4LRIC 2B1AL 1U91B 4JPWL 1VPOL 2VLJE 4RMQA 1W8OA 3WV0A 2D9QB 4M5YH 1I8KB 4P2QE 2NY4C 5EORH 1A9EA 5D7SH 1JHTB 1N4XL 2VLMD 4K3JL 1WBXA 3V4PL 1OW0C 1KPRB 3NFNB 1EMTH 1ADQL 4X4ZA 3DYPA 1IFHH 5EUOB 1NAMA 1H15A 3IDGA 2ESVB 4DKFL 5DZNA 3F7PC 2Y36L 5D7JB 3T2QA 3VXSE 4P5TD 4HWEH 4N5UA 5TH2A 2DN7A 2R0WL 4M6NL 1WITA 3RWDB 2BOCB 2VXQH 4PJGF 4HC1L 4YBQC 2FJFB 1JL8A 2V6HA 1SEBA 4LMQE 3E8UH 1X5ZA 4OQTH 4NO2A 3CFBA 3C9NA 3MACL 5C09E 3K2UH 4E5XB 5ACMA 2H9GB 3FQWB 4M43L 3L3GA 4AIOA 4JPKL 4O2FB 5HJ3B 1S7QA 1YPZA 5MHSD 1TVHB 5ETUA 3HMXA 4PUBH 1F6FB 5E6IA 4EI6B 5F8QC 3UBXG 3FFCE 4R7NB 4XPHL 5IB3B 3ZTJH 3WKML 5F9OH 4PJDA 2R23A 4HMCA 2CRIA 3BOVA 3V5DA 3D0LB 4K94H 3HG1B 4Y16A 3PWNB 3MRKB 4P57A 3R1GL 1MVFA 3QIBA 3BFOA 5C0DA 4L9DA 5T3ZH 2Y25A 1I85C 1NBZA 5AYUH 3L95A 2ARJB 5J56B 3LKOA 5MP6L 5DJ2B 2NX5D 3LIZH 3L5IA 1Z5LB 4LHJB 4XHJC 3SOBH 5J57B 4HXBH 2WBJA 1IAOA 1WF5A 1E6JL 1JFQL 3PWPA 5C0GB 3MUGA 4H5SA 5ESQB 3LMJL 1PLGL 1FO0L 1D9KB 1RUAH 3P4LA 4IOFC 1FVCB 1HINH 3S34H 2V5MA 1BF2A 2DJSA 3HUJE 5DD3H 5DQJA 4AEFA 3QIUC 3B8YA 3W11C 1INQB 4JG1L 5J06A 1U93A 4YPJA 3U4EA 4WI6A 5FAAA 3QNXA 2BSRB 3B9EA 2DJ4A 4RAVB 3JSSA 3O2DL 5EOQH 3NFNA 4MAUH 4PJXB 1YYLH 3I2CH 3VXSA 4OCNC 2FHBA 2HLAB 3ARYA 3KPLB 5IBLC 2NY2D 1PZ5A 4ZXBC 2DLTA 4RRPA 3WLWD 3NZHH 4P2OC 4UNTA 2Q6WB 1BJ1H 2X4NA 1RJZA 4WJ5B 2VOTA 3IAPA 1FIGL 2X10A 4NN5B 5C0JA 3HS0B 1WCBB 3L3IB 5DEFB 4B50A 2HP4A 4GAJH 2C9AA 1RK0B 3DVGB 5MENE 4FTVE 1XR8A 2H6PA 2ICWI 4K7PL 4WWKD 3HAEG 2YPLE 1VGEL 5GRVL 1YECL 5HGHA 3TGXA 3HC3L 2EE9A 4D3CH 2GHWB 1AFVL 4LCWD 5EU4A 3FCTA 3TVMA 1IC1A 5JUEL 2DQGL 4LKCB 5JXAL 4PD4J 4EN3B 4CMHB 5IW6A 1ZWIA 4ZXBB 2V17L 4GG6A 4GLRH 4GXUM 2YC1A 4GRWF 1VFOA 4RCAA 4LU5H 3I50H 4DAGL 5EOTB 3GBNH 4YXLH 3MRGB 1Y18B 5FCSH 1OTSC 2QBWA 4KJYB 3CSYA 3RKDD 1BM3H 2YRPA 1MSPA 5E08L 1ZLWK 1RPQA 1BZ7A 3FKUS 4ZO9A 4KZEL 3DLQR 4JPVH 2W9LA 1AKJA 2HT3D 4WW1B 3E2HB 4JGJA 4J3XA 1ZLVK 1TLKA 4MJ2A 5B4MC 4CBPA 4K3EH 4FG6D 4N0UE 4QRQB 1GPOL 1BQHB 5FGBC 3O6FA 3O45B 2NYYD 4LOUD 4PRHE 1KPVB 2VZUA 2W0PA 4YHPA 1IL1B 2AK1H 4KJPC 5FUCE 4HLZG 1SY6H 2PTTB 1C1EL 1FL3B 4JR9L 2X09A 2EEDA 5L6YH 1RMFL 4HCRA 1G7LA 1U8OB 5EU4B 3BZDA 1WWBX 4F58H 3G08B 1JPSL 5INCA 1G7JB 4LRNH 4MB3A 4N5ED 4G3YH 3VFUB 1XZ0A 3BPOB 1TMCB 2AGJL 4YHOL 1V7NH 4L4VD 1C5DA 3EFDL 5J3HC 1N2RB 1OW0A 3Q3GA 4LAQL 1CGWA 1FYTB 1IQWL 3DV6B 4MD5A 3IVKB 1I9JH 3SJVE 3CSYB 3PHQB 5C0DB 1GGTA 1BJ8A 1OGAE 2X4NB 3HFMH 1F3JB 2IPTL 3K1KC 1C7SA 3VMPA 4X6DE 3RDTC 3D85A 4JFFA 4DZ8A 2EDNA 2HFGH 1FNFA 3WNLA 2NXZC 2NNAA 2E5EA 5E4EC 4OJFL 1BZ9A 4XBGA 2RGSA 4JY5H 4XP6H 3RIFF 3DSFH 2WMPA 2DF3A 3WFHB 3P9LB 4MLIA 1Q0XH 5JR1H 3T0VA 1S5IH 4NFCA 5IBTH 2ID5A 3QEHA 2G2RA 2J88H 1HN1A 3DX9B 4NZUL 3VFNB 1QFHA 3W9EB 3MRPB 3KLAA 4HF5H 3BUYA 5F88A 1EVUA 1RIHH 1VFMA 4U6HA 2VDRL 1HH9B 2P8LA 5C0IA 4RNRA 3BKCL 3AUVA 1T0MA 3FB5A 4XWGH 3JV5A 1OM3L 1RHHA 4BFIA 4NP4L 1X4ZA 3ZKXB 2BVQA 1JYWA 3QJHB 3K3QA 4DKEH 1KELH 2OSLB 5AZEL 1I8LC 1IGJA 3UJJL 5M95B 4PRAB 5I8OH 4FQIH 3NZ8A 3EO9H 1DL7L 1MAJA 4PTUB 2NY0B 5BVJB 3S98A 4LGRB 4P2QD 3FHAA 3Q1SH 3FZUD 1U8PA 1I8MA 4Y1AB 5T1LB 3GMOB 4DVBB 1KB5B 4OZ4B 5ADPL 3TZVB 5TE6L 1WZKA 3NN8B 1ZLUK 1P4LB 3QWOA 2R56L 3B9KA 4NN6B 2R4SL 4PJ5A 4WRLA 5E8EA 3JVGC 3LH2L 1YMME 5BO1H 3QB7C 1ZVSB 1UWGH 3MA9L 5HDOA 3WHXB 4L8CB 3MYJB 3ULSB 2K1MA 2VLRD 3B2UD 1TQBB 2VDML 1YEJL 5ACLA 1JNNL 1WT5A 4ODXA 4U3HA 3QUKB 4JCMA 1Z0MA 1KG0B 1YEFH 3ZDYF 2ORBH 2X1PA 1A3LL 1C5DB 1CK0H 4R2GD 4UTBL 5EC1A 4KK8D 5EA0H 3RZCB 2UZIL 5GHWL 3THML 2CR6A 4KRMB 3BAEL 3RBSA 5FO8B 2I07B 1IT9L 4U1LB 4EBQH 5T3XE 3JTTA 4I3SH 1OSPH 1QBLL 3DUUB 5ACZA 2JELL 1YMHA 3KXFE 3LKPB 1V5JA 2JLLA 4ENED 4EBQL 4PB9L 2G60H 1JN6A 4P3CL 1NC2D 3VXPA 1QLEL 1WAAE 5DQ9B 4IOIA 1G6VK 1N6QH 2AEPL 3G6JA 1B6UA 3B2VH 4YJZL 1SEQH 3C9NB 5KSBE 4PV8A 1T7VA 5D7IE 1T2QH 1ZHBB 3RAJH 3KHOA 1U3HC 5B3JF 4UBDD 1DEDA 4TSCH 4OLVH 3TIEA 2CIKA 3BUYB 3C5ZA 3SDCC 3OHXB 3BO8A 2YUXA 4UUJB 1RUMH 3T77A 2ED8A 5K59E 5FM5O 1P9MC 2DQHH 3LSOA 4HHAB 3LH2H 3QNXB 4PBXA 4PJDB 2FX8H 3QDHA 1YY9C 3PHOB 4AH2B 3PG2A 5GS1C 4U4BA 4MVBC 3F12A 1LE5B 4G7VH 3OKKA 1RZIB 2Y6SD 2F8OA 7CGTA 5KVGL 2PN5A 3L7FB 2AQ2A 4NOFA 2GY7B 5KSAA 3BW9B 3HI1A 2F54A 3IETB 3DO7A 4GBXC 1G9NH 4QXGH 1HOCA 4MNQD 1YEIL 2GTZA 4Q6IA 1UQSB 3C2SA 1DL7H 4PJEA 1YQVH 3QCVL 3MXVH 3KDMA 2EO9A 3TA3B 1KELL 2L0DA 2ARWA 2R9HC 2HT2D 1J9CT 3MXWH 2VWEE 1OTSD 4FQJL 3MYJA 4JQXA 4BFEA 4O02L 1Y6KR 2HFTA 5L88L 2XN9E 2CGRH 4RX4A 4ZS7H 5DGQA 1AD9A 5HDBF 3KYMA 1XF3A 5ICXB 1S7RB 3TBSB 4BZ2H 1HZHL 4O2EA 4TNVK 1LDPH 4Q9RH 2XY2A 4OD1H 3CFKB 1ACZA 3GK8H 4Z7UE 2APFA 3I85A 3ZL4H 4CN1A 5HHOE 1IKNC 1W72L 3LSOB 1KEML 3RZCA 3DSFL 5C0AA 5I1GL 1T1XB 3TT1L 3ZDZE 4UIKH 2NY0D 4MWFA 5CSZB 1KB9J 1QKZH 2XXMB 2DL9A 5BQ7A 5KANI 4XB8A 1QBAA 4M3KB 4UV7H 1S7UA 1YNLH 2W0LA 4WV1C 5EO9A 3W39A 1I9JL 3HLAB 3ROOB 3PWLB 5F70A 3V6FA 2LAGB 2XKUA 1G7PB 3GHEL 4YFLF 3FOMA 2J8OA 2AEIT 1VKXA 2YWYA 3O4LE 5I1KL 3RL1A 1HEZB 2GT9B 5DD6B 3S9DB 1OB1B 3HN3A 1ZGLA 5D5MA 3CZFB 3KPRD 2SEBB 1OAKL 1BJMA 4ISVB 5JIHA 1Q9LB 3MLUL 3L5HA 3PWPD 1A7RL 5EG6C 4KDTC 1JK8B 1OT2A 3OHXA 4GSDH 1CGVA 1WICA 4JFDA 3RL2B 3SY0B 1OAYL 1U3HA 5TF1L 2VDPH 1DQLH 5H94A 1LO2H 2WBWB 5EBGA 1J1PL 2FEEL 4CJ1A 3VWKD 4I18A 5CILL 5IQ7L 2P8PB 5DRWA 1ZTXH 1G6RH 5LQBH 1CI5A 1OP9A 2X70B 3L3IA 1V05A 2BHUA 2FL5B 1UZ8B 2OTWA 4Q6IB 3SDYH 3DWTA 5C1MB 4WY7H 1SBSH 3U9UB 3IFNL 3U1SL 1MIML 3NCEB 1E28A 4OF8A 1BX2A 3MRJA 1RZ8B 4W4NA 5DURB 4RFNC 1MCJA 4NM8H 3MRFA 4BQ8A 4HH8A 1NGZB 4JY4A 3U1SH 4M03A 4NHCH 1T04A 2WIIA 4FFWD 5HHNB 2XOTA 3ESUF 2C3VB 1FAIL 4AENB 4XBEH 2VITB 1YDPB 4P46D 5E1AA 1H3TA 3BPLB 1RJYB 1LO4H 3REWA 3VGAB 3IVKA 5DJZA 3P9MB 1QFWI 1CFSA 1MHCA 5CILH 3QUXC 2BVQB 2O5ZH 2XQBL 5F7WC 3W0WD 3A67L 3M17A 4KKLC 2GTZB 1KULA 2ZUUA 5DMIL 3QQ9C 5AAWA 5C70A 1NMBL 5HYSA 3BW9A 3HI1B 3IETA 3NABH 5D93C 5IMLA 3FRUA 3IFOB 1M7DA 1OAKH 2VLME 1HKLL 3DHJA 1NMCC 3W5MA 2Y5EA 4MCZB 15C8H 3RVVC 3KS0H 2ADGB 4KH2A 2R9HD 4PJDE 1DQMH 2VXUH 1SYSB 1NANH 4JRXB 5JTWA 2QSVA 4X83A 5C9JA 1I7RA 4YXKH 4M6OL 5KSBF 5IGXH 4PTTB 1HEZA 2GT9A 1FHGA 3D0VB 4NO3B 4K9EL 1XIWA 5SWZB 3TBTA 5CHNB 3MLZH 5I74C 2DQFB 1KN4H 4JCLA 5JW3H 4ZYKB 4D8PA 2PTUA 5F21B 4GS7C 4RA0C 3G5YB 3TJEL 4R6UA 4MZ3A 1KG0A 5EULV 1S9WA 4G43B 1E6JH 1JFQH 1I1AD 3QR2A 3O8XB 3Q3GB 4LKXA 5HYFA 1YEHH 2FYYA 3VXUD 3MQIA 4W81A 2YUWA 3FB7A 1L0QA 2YPVH 1U95A 4X7EC 3D0LA 4CVWA 1MHHA 2W65A 3B6SA 3MRRA 3QQ3B 5KSAC 4Z7WB 4RISL 4Z76A 5L2KE 4M62L 1JGDA 3F58L 2P5WE 3TF7C 4JE4B 1O5DT 4ZUTB 3EHBD 2QTEA 5KVEH 3RQ3A 2EDBA 4NC1C 1XF4B 1IKFH 2D7PA 5HGDB 1NMAL 4LSTH 4APQB 3QULA 3QNYA 2ADGA 3C6LB 3SDAD 1OT1A 1CDJA 1JNLL 1P4BL 3KPPA 5AEAA 2Z4QA 3R0MA 3WIHH 4Y4HB 1JPGB 3QCTH 2VL5B 1IGTB 3QIUA 1CU4H 2UUDK 4Q2ZB 1JNJA 4XWGL 1A9EB 1MCKA 4I2XB 2ENSA 4PG2A 1EGJL 1NBQA 2CKBH 5IWLC 3FMGL 4G80B 4MAYA 3OR6A 1BZQK 3QDMD 4CDGC 1C12B 4KQ4L 3L7EB 2H41A 4PJHE 4HGKC 4R26L 5H94B 1UM4L 2H8PA 2WAHA 4QXWA 5IBTL 4L3EA 2JCCA 1HHGB 4OZFH 4PJEE 5CJ8A 1UH3A 5K9OB 4R0LA 5LBSH 1OOAA 1OLZA 1JWUA 2K7QA 1YY9D 2OL3B 5GSVA 3OKLA 4G9FE 5D7IA 2ITDA 5I9QB 5EIIA 1VACB 2YN3A 2YUZA 2Q7YB 4W6YB 3GIVA 3EDDA 1P69B 4UQ3A 3BVNA 3HFML 3IFOA 2IBBA 2EIZB 2WSKA 3E6HA 3X14B 2ICES 4L4TB 5I16A 1ADQA 2XA3A 1P84K 3OWEA 1XCTA 3ARED 4OZGA 2AJVH 4YHOH 2VDQL 2OJEB 1JF5A 3VFWB 4BH7A 1WZMA 4NQTA 2NY0C 2VKWA 1ITBB 1HE7A 4JFXA 1WAAF 3BESR 4NCC1 2F53A 4LLAA 5I8CA 4YBLB 1OSPL 3ABZA 3I6KB 3H3PL 4PJAF 4C59B 4GKSA 4P4RA 4HKBB 5A2JH 4OB5L 1LE9A 3HZVA 3RWJB 3VW3L 2PW2B 3THMH 3U30B 4YX2L 2WBJD 3FT2B 5HHMB 4JEGB 4JAMA 5D7LE 1NGXA 1WQVT 1CK0L 1U95B 3WLBA 2R1YA 3LVEA 4HIIB 4MJ6B 2BFVH 3BE1H 4Y19D 3QUYB 4N0FB 3B9VA 5B21A 5FEBA 4RRPG 3V6BR 4OQTA 5F1IB 2I27N 2YD9A 5EBLA 4AM0A 2D7TL 3DVNA 4X8JB 4PV8B 4R97B 3UC0L 3LS4H 3BXNB 3WFDH 3GSXA 5BO1L 3MMEB 4ZYKA 5CGYC 1X9QA 2DQUH 4HIEB 1KGCE 4I2XA 4LPWA 4JDTL 5FDWB 5KOVC 1S9KC 1N59A 2VLRB 3P0GB 5FB8A 3KLDA 1GGIH 5HSFA 1NFIA 1OY3B 3HE7D 3I02A 1L7TL 4HEPG 4L3CA 1Q9OB 1J0KA 1WZ1H 4X4XB 3H9SD 4GG6B 4KI5C 1AFVH 5KTEH 2AV7B 3GJFK 5FO9A 4HPYL 2O5XH 5EC2A 3WO3B 3JWOH 4KTDH 5T3XH 1T03L 5DI8B 8FABB 4QRTB 1G7QA 1P7QD 3N50A 4KJWC 4LLVB 4K7PH 5J1AB 2JCCB 1D5ZB 2QV2A 5GQBA 4QRQA 2JJUA 4L1HA 5ABDE 3OXRA 2HJLB 3MNZB 4KMLB 4GAJL 4U6YB 4XCNB 4JB9L 3LZFH 4WU5B 1MREL 4PY8J 4R90H 3X13A 3VFOB 1W72B 1QSEE 1PG7H 2D31B 2IMMA 5SWSA 3RKDC 4JREC 1KIRA 4JVUA 2LU7A 4Y7MA 4XH2B 4O4YL 1X5AA 1C08B 4RIRB 4Z77B 4Y4HA 4WI4A 5E94B 5I16B 2IPKA 3VFUA 4QRRD 4PPTA 4GRMA 1ZXQA 1U8NB 2BVYA 1ZV5A 2XWTB 4OF7A 2P5WB 4JKWA 4WUUE 5K33A 1X44A 1MEXH 3P4MB 4PJBF 3TV3L 1SVZA 5BV7L 5ERWA 2F5AH 5F9WC 3EYFA 5K9KB 5IHBA 1MCIA 2E7BA 4GKZB 1AH1A 4HPOH 1S7RA 3TBSA 1QRNE 3WNMA 1PG7W 2R69L 2QHLA 1A7NH 4S2SB 2M1KA 1MH5B 3EGSB 4LLWA 4ZFZA 2H2SD 3DYMA 5JNYB 2DLFL 3TP4A 3SOBL 1SMAA 2YD1A 1FGNL 4MD5B 1TVDA 4GG8A 3EFDH 3TN0D 3KJ4B 3KNBA 4KFZC 4NKMA 3V95A 2XY1A 5IESL 1KUMA 4K7PX 5ISZD 2VTFA 5FYJL 4F58L 1OTUC 3HE6A 1N6VA 3FL7A 1MRDH 3MRHB 1JI1A 3H9HB 4NQXB 1GGCH 5I1LB 2HVJA 4TYUA 3DRTB 3RWHA 4RQQB 3WFCH 1B90A 3UROR 4PJ9D 1U41A 2WINB 4PRDB 3U0WL 3CU7A 4GRLD 3WEXA 4ODUB 1DFBL 3QQ4A 3QI9D 2CUMA 1RIUH 2XZCH 4ZOAA 5C86A 3HPLB 4P2OB 1MQKH 5E6IB 3PGDB 2BRRH 5KSAD 4HKBA 5FB8B 4QHLB 2PO6B 4KVCH 3K2UL 3ZYIA 1W0VB 3VWKA 5CP3H 5IM7A 1CT8B 3IXTA 3MA7B 1S7TA 4OTXH 1I1AC 3PGCB 3W9DB 1MJJA 1AXIB 2EDKA 4MZ2A 2J2ZA 1X5YA 1M1SA 4WJ5A 2C4FT 4YPGB 3KYOA 1ZOXA 4C83B 1A14H 4DVRL 4O58L 1VGKB 5F7YC 1QO3B 1OP3K 5D1QC 4Q9CA 1DR9A 1JGLH 4NKOB 4DKFH 4YO0A 1EERB 5CFHA 3MR9B 1F5WA 1IFHL 4JZOB 4I5BA 1MCSA 3HE6D 4KK9C 3GSRB 4YEFA 2FH8A 5C9JB 4G6JH 3B2UC 1RZGB 1TNNA 2BVPA 4HKZA 4POZC 4W68A 4OF3A 5DUML 3CDCA 3ECBB 4ZXBD 1TVHA 5EORL 3G6DH 3TN0A 1X6NA 5IG7B 2XYCA 5D7IF 4K8RD 3N9GH 1QR1B 5B3JE 4APQC 1HQ4B 4PLNC 2Q87A 1FN4A 2VH5H 4F15C 3VXQA 3SKUD 5F6IC 3O3EA 1G7HB 5GRJH 4M4PA 4LSPL 2DQIL 1MCPL 2DQDH 5B38G 1R5VA 3BGFC 2GK0B 3LQZB 2Z9TA 4HCRH 1K6QL 3I9GL 5KSAB 1B0GA 3RP1A 1JGVL 1RZJH 4BA8A 1EO8H 1X7QA 4PJ7E 4P4KA 3LEVL 3RRQA 3QEGL 4H8WH 3VH8A 2FJHB 5CEXA 4OT1H 2RIKA 3T3PF 1YMHB 2G9HB 5EIIB 1UC6A 4UV4H 4PRBB 5DD3L 4LIQH 5GGRB 3QDJA 1N8ZB 3C5SB 4YHPB 1RURH 1A3RH 3DRTA 3RWHB 3RY5A 5C7XL 3S36H 2ITCB 4WFGD 2E7HA 3M07A 3TIEB 1I1FA 4IRZH 4M5ZH 5DK2A 1FGVH 3RIFK 1MIEL 5C0CB 5C07B 4YDIH 3OR6B 2CKBA 2FHFA 3B9AA 3BP4B 3PP3K 1ZA6B 4D0BB 3MLXH 1P4IH 4M93B 4XCFL 3QUML 5JW5B 5C08A 3LQAL 1Y18A 1CT8A 4U1NA 4FFYH 5E7FA 1NMCB 1VHPA 2XPGB 2F54B 4FQQA 5GS2D 4KK5C 3O9WC 5E8PA 5I1HH 1YEEL 5DGRA 4HJJH 2I9TA 5E2WL 4RWYL 1LE5A 2WBJC 4ZNCD 5BS0B 3IGAB 3VI4F 2C3GA 5DUPH 3VRJA 5L7XH 43CAA 4D9QE 1I1AA 3UTTE 4X6DB 1EH9A 3LDBC 4BH8A 1RFDL 2PYEE 2RCSH 2B0SL 1T0NB 1KTDA 3D85D 4JFFD 3BKJL 3IDXH 2LTQB 4HK0B 4QRPE 5F71A 2O93L 1MWAH 2FIKA 2DI8A 4H26A 3QA3B 3RVXC 2JB6B 5DMKA 4JJ5B 2OJEA 4BKLA 5C0RL 4MNGB 1KJ3H 3KPNA 4GO6B 1NL0L 3D3VB 2ED7A 3FB5B 1W0VA 4TNWF 1XCQA 3DUHA 3VFRA 3QO1B 5H37G 2BJMH 4OLXL 4QXUL 3WLWC 4YR6B 1FZOA 2C1OA 2EYSB 3DURA 1T6WA 1VSCA 1YUHB 2NY1B 3EJJX 3RU8H 5FO9B 5FECB 3WYRA 3MRCB 2D7QA 4RA3A 3UO1H 1A6VH 4WFFD 3SE4A 5CCKL 5IP4A 4N9OB 1D6EA 5FFLA 2G5RA 3SN6N 4JZNA 5CAYB 1UM5L 3JWDH 2WUCL 3NGBB 4U2ZA 5E9DA 2PCPA 4OV5A 1DBKL 3UTTA 5D7LD 4FFVD 3HLAA 1GC1C 4ZAKD 3AB0C 4J8RB 1G6RA 4XX1E 5FHBL 3O2VH 1IZKA 2QQKH 4DGIH 1A1NA 3PL6A 5FGSA 4ZUWB 4X9IA 3HE7A 5CD5D 1PJ9A 3CC5B 4OZGB 4ZTOL 3UZQA 3B9KD 3IFLH 3PWJA 2Z91B 4PJ5D 4Y2DB 2ICCA 3C60C 1EXUB 4HUMB 5DURD 4PRPB 1U8HB 5F7DB 1JI2A 2LE9A 1NGPH 2A73B 5E99L 3QDMB 3HMXH 5H35A 1P7QA 2COQA 3OJVC 2DWDB 1KC5L 4QRTA 1Q9LA 4XC1H 4RMTA 1J1OL 1IGMH 2ICEA 4XHQA 3FB8A 2YS4A 2LAAA 1A3RL 2Z31D 1BGXH 1BVKA 1AQDB 1NSNL 4M7LH 4N8CH 2VN4A 2XRAH 3G5VA 4PJHF 3VXRA 3I84A 2XN9B 3HHRB 3CLEL 4PJFA 5EFIA 3RJDA 4NKDA 3GMPA 3PWPE 2VQUA 2YSSB 2EEAA 1HXYA 1U8LB 4MA3A 5SWSB 2X4PA 3LDBB 2LV4A 4TSBH 3IFLL 4HKXB 1QSFB 4G9FD 2YKLH 3L3DB 3KYKL 3DVNB 4X8JA 3QXTA 3O3BB 2YD4A 2E8YA 1AD0A 2NCMA 3QA3A 5LXGH 1HDMA 3SDAA 2ADJB 3VWJC 3GRWA 5HI4D 3QJFA 4NO3A 1AO7A 4WEMB 1SHMA 1NDMA 3IS1X 1CS6A 3VMOA 3NTCH 4EI5A 3WEXB 1HNFA 4Z7UF 4AMKH 4PR5B 5DUMH 1A4KA 4X7SL 3H2WA 2PW1A 1UYWL 4U1LA 1DQDH 1U6AL 3PQYB 3SBWA 4IIQC 4OLWH 3MSPA 3B5GA 4URTB 3QFJA 2F8VA 3H42L 4NBZB 1L7IL 1TTGA 4N9GA 1RK0A 4L5FH 2YPLB 4OLZH 4N90D 5DD0L 1T83A 3L95B 3DXAD 2EC8A 1AR1D 1MAML 3MRBA 1WZLA 2AW2A 5KSVB 1TFHA 2Y07H 4NYLA 4ODWA 4TULL 2PKDA 4QHKI 1S7WA 4OTXL 2Z4QB 4IRJB 5E9DB 3QI9B 5F89B 3ARFB 5SWZA 3KJ6H 4LSRL 1ZAGA 1ZANH 1XGYL 2UV3A 2DQCH 4LQ1A 3EYFB 2RCSL 4ORGA 3IJHA 4GMTH 5BW7C 4KHXH 1MJ7H 2J6EH 3BPCA 3GO1H 3TFKD 4F7MA 1T89C 5GISH 3VXRD 4PRNB 3DARA 1ZMYA 5FA4B 1YMMA 4J23A 3T4AB 2DTML 3X17A 3QRGH 4M02A 3N85H 4QRSA 1HHGA 1WWCA 3WFEL 1LNUB 4X6CB 4ERSL 3C5JB 5HYSB 3O8XA 3KPSD 3U2SB 3O3AA 3EDFA 3QHZL 3HKFA 4ERSH 5DMYA 3FQRB 4XCFH 1FVDA 1UACL 1T1WB 1WTLA 2GYSA 4U1MA 3BDXA 3SKJL 1FRGL 3AROA 3ULUE 1JPGA 3Q5TA 5D1QB 4HUUB 1GZQA 4I3RH 3AVEA 2FH6A 1YYML 1E4KA 1ZANL 1KEGH 5IW6B 4MXQC 2IQ9H 4PRDA 1MOEA 3UEZA 2BNQE 4U1KB 4EQ2A 2CLVA 2NTFB 5A16B 5BS0D 2AJSH 1JHTA 3CVIL 5HBBA 1HH6A 3QFDB 1C8PA 4KKCD 3EO1B 1J8HB 3GI9H 4JFXB 3C87A 4L5FL 1EO8L 4N0CC 5GGQH 2H2PD 1XGTB 1MFDH 4BFIB 1DCLA 4OBSA 4ALAL 2NY6D 2CQVA 4KROD 4UB0L 5JXED 3BEVA 1XGQA 4X7DC 1PG7X 2YPKB 3QUZA 1FYTA 1L0YA 3RX5A 5F7NC 3PGCA 1V3JA 1FVEA 2WUBL 3QDAA 3GRWH 1A1OA 1DQDL 1U6AH 3KPQA 4NIKB 4ZQKB 5EFIB 4DN3L 4HIIA 3IAGC 4V2CB 1F4HA 4CU7A 1RIVL 1S3KH 1NKRA 3RWGB 4Q9QL 4NDMA 5EUKB 4AQOA 2UWEF 3DJ9A 2D7NA 3NH7L 3NTCL 25C8L 2JIXA 4JQIL 1GH7A 4I3GA 2D9CA 4XRCA 1KLFA 3MJ7A 2BSTB 1RJLA 2BCKA 2UWEE 1OB1A 1DUYB 3D48R 5A40E 2PR4L 5E2JA 4Y5YB 1AO7B 1CFQA 3HNVH 3VH8G 4TSBL 1JYNA 1AGCA 4KXZH 4AG4L 3MV11 4MYWB 4X4ME 5EWIH 5E6ID 3G6AB 4GXVL 4MA7L 5J6GB 4JGUA 4IMLB 5T1KD 1MHCB 2NXZB 4XT1C 3UZVB 1A4JA 4HS6A 5E4EB 3WIFB 4Z5RB 4GBXD 4M7LL 2IPUK 2XT1B 3FONB 1JPTH 4JKPL 1DBJL 6CGTA 3UJIH 3BE1L 2FR4A 1VFUA 3QDJD 5ACZB 5EZJB 3RUGF 5T1LA 3VRJB 2X6MA 3BZEB 3PABB 12E8H 4H88L 1TZGH 3DMMD 2FJGB 4GKNB 5KOMC 5ITBL 4R4BA 2GSIA 4GQPH 4OZFA 3MRQA 32C2A 3O6MH 4Z78B 5GS0C 4ODHL 1CGUA 5DO2C 1BOGA 3MV8B 1WUNT 4NWTH 2VXTL 1KFAL 4LSQH 4LCYB 1DSFH 4HBCH 3SCMB 4AEIH 4HUWB 5FKPA 1CTOA 5I17B 4G9FB 5KN5A 1DBKH 3HC0A 1WWWX 3O4OC 4L9LC 2F74A 4MJIA 5EB9A 1CIUA 2P7TB 2YBRB 1FO0B 3QCUH 4XNZB 1OWRM 2AEQL 1YDPA 1XGTA 2VDQH 2AJVL 1I9IH 1DQJA 3L3KB 4ZUVA 3D2UD 1FGNH 3OXRB 5DDHB 5AUMA 3L3OB 4JAMB 2ZUTA 1D5ZA 2VL4A 4WV1A 3BYYA 1KBGL 1TDQA 1FL5B 3V0WH 4HD9A 2Q1EA 3WS3B 8FABA 4BUGA 4G5ZH 5B39A 3CCHB 1FYTD 4CKVX 3BQUA 3GKWH 2ZCKL 5EUKA 2FO4A 4YDLC 3K81A 2AJXL 3S6CA 4X6BA 4HUUA 3W0WA 3EOBB 2X2YA 4KKBD 4LASL 4K9EC 1U42A 5I1LA 5E1HB 2VE6A 5KJRH 2CLZA 1CLYH 4OI9A 5C0BE 1DJSA 4U6XA 5CIPH 5FDWA 3GM8A 5I1AA 3M8OL 5EZLA 2X9YA 2AJZB 4LSSL 3T04D 1I7ZA 3DGCR 4JM4L 5IR1B 3OJMB 2J4WL 4DTGL 3EO1A 2OX5A 3UYPA 1AGCB 1D5BA 1RFDH 5E6ZA 3UAJC 4G6FD 1S5HB 5MERB 3CH8A 3SGDH 3QDGE 4PIRF 3LZFL 4NRZB 1I4FB 3L5JA 3F12B 4M9OA 4S2SA 3MROA 3TBWB 3GBMH 4CN6A 4G8GA 5E2WH 1YEEH 1BQUA 1CD8A 1K85A 1MFBH 2EDQA 4F8QA 2P46B 3VE0A 3ZKNC 4Y4FB 4KPHH 1M7DB 2IAMD 4NO0D 3QT2A 4UNVA 4KK6C 5DZLA 4F9PC 5L9DL 1BBDH 4LQFL 4M7JL 1QO3A 4MXWL 5HHXH 5IBLD 5IEHA 2NY2C 1BVLB 5B4MD 5I18L 1QSEB 4PJEF 3LKRA 1GSMA 1NCBL 4GAGH 1NGWA 3MOBL 3VXTB 1LEGA 3QIWC 3KDMB 3DMMA 2HKFH 3QIUD 4U6XB 3QIUB 1EHAA 1JWSB 2DLEA 5C7XH 1CFQB 4LVNC 1IAII 4CADA 4BQ9A 1BQHG 1EHLL 3S97C 1EUTA 4QHLA 1N5YH 2J5LC 2ZNXA 5FYKD 2FDBP 4JLRB 1F4WH 1YNKL 2EIEA 3IDGB 5C07E 3T4YB 2DS4A 4ELKA 4CJ0A 4Y4KC 1XGPB 4OD2B 3PDOA 4WHYH 4LSPH 2YEZB 3NACL 3ARPA 4NUGL 1HKLH 1E4WH 3BGAA 5ID1A 1UVQA 4ZFFA 1ORSB 4DWHA 3REVA 5HYJA 4PLOB 3NABL 1BVZA 1OVZA 4HKXA 2VWEC 1ND0B 4KDTA 2DI7A 5IROA 2IADB 5F7MC 2RFXA 4XCCL 2N7BA 3KLAB 2XA8L 4JM2C 3IXAB 5T5FL 4GH7B 1KPUA 4RGMB 4NQCB 3DRQA 2XA8H 3TBYB 1OP3H 2YD8A 4PJHA 4HX1B 3U79A 1ZGLB 2QLVB 3VA2C 1TCMA 4X4XA 2W60B 4LSVL 4OLUH 4D9LH 3I6KA 4HH9A 1JHLH 2ZPKH 5J6HB 3MLRH 4M7ZC 4V1DA 5DDHA 4NJ9H 2XPGA 1GCFA 1M6OA 1DUZA 4NUGH 3NACH 4C83A 5BZDA 1GHFL 5D6DC 2OTWB 1T22B 4LLDB 3H9SA 3QG6A 5KS9B 1TITA 4P4KC 1LO3L 5ANME 3HR5A 3HRZB 4DZBA 3ARFC 5KVFL 4KQ4H 1HIMH 3NAAL 3ZTNH 4GW5A 1IILE 2ZCLL 4H8WC 4MMZC 1G6RL 4FQLL 1FFQA 3RDTD 4QF1B 1SJEB 2VDPL 3HNTH 3ARQA 5LAXA 3MRLA 4FXKA 5C2BH 3QNZB 1XFPA 1OP5H 4UT7H 4Y19A 3CZFA 3VG0H 5ALBL 4CU6A 1FIEA 2VLKA 1GAFL 1DLFL 3DETD 1S7QB 3CGTA 4R4FH 2XICA 4KU1A 4OFDA 3MJGX 1KB9K 3BIKB 3MLWH 2FGWH 5D2NA 3MZTA 5SWZD 5HHXL 1NCAH 3STLB 1CZ8L 5FUCC 4XXDB 2MHAA 4QNPF 3ALWA 4TRPL 4FP8H 2FJFA 4PRPD 3C09C 2JJTA 3ZDZF 3GBML 2UYLB 1KCKA 5HVFB 3CUPB 3NA9L 3QUZD 3OAYH 4WDIA 4Z7VE 1HSAA 1D5MB 4QYOA 5BV7H 1CGTA 1S7SB 3FT3B 4KI5E 1IGYB 2E9JA 2JJWA 4NNYA 1B4RA 1T1YB 3NPZB 3OKNB 3PWVB 4PYHA 5D7LA 3TO4C 4CW1B 3P4MA 2E6PA 5LAXB 3BD4A 4YK4C 4Z7WF 2A74A 1CLOL 2DB8A 4BELD 2HJFA 4WFED 1A21A 4PJCF 4HIXL 5FYJE 3BD5A 1NBYB 3OXSB 1HCVA 4PRPA 2VR5A 3UPRB 4I13B 4IMLA 1OPGH 1DVFC 2DLGA 1AGEA 1H3PH 2QSTA 2FNBA 3SDXB 4JFYA 4WHCA 1MLCA 3OX8B 4O02H 5CGYD 5L88H 1MI5D 4LHUA 4JB9H 3QUZB 5EH1A 4EUPA 2F54E 5DHYB 1CCZA 1HWHB 2OCFD 4JFQA 1PY4A 5FK9A 1JNHB 3F7YA 4KDVA 2EDYA 4PJ8B 2XN9A 3RGVC 1OF2B 4PG2C 4XPTH 4R8WH 1YEIH 4NC2B 1U8JB 4ZUUA 3RWEB 1N64H 1J8HD 4AYFA 3QI9C 3PQYE 4Z7QF 4D9RE 1I9IL 1QVOB 4RWHA 4S1RH 3MLWL 1QEWA 4YO0B 5CP7B 1B0WA 5I1DA 2F9BT 1KLUB 3PL6C 4NQCA 1TPXB 3O6FD 1KIPA 4JFDE 4GRLA 2HT2C 4Y2DA 1RUML 3BWAB 1X4YA 3IFNH 1CXIA 4Y5VB 2WZPD 1SBSL 2FRGP 1I8IA 3OKDA 4KRPD 1QPPA 1S7XA 4HT1H 1EFXB 1N2RA 3VD9A 1VEOA 1HHKB 3L3HB 5IM7B 3G6AA 4MA8L 4ELMF 4R4ND 5C3LD 5AYQA 5H2BA 4YH6A 5DVMA 4L8SA 4XB7A 3T1FB 2MQ0A 3QH3A 3OB0K 3MLVH 1BBJA 2EE2A 5IMKA 2V2WB 4KUZH 1V3LA 1N7ML 1VACA 1Q94B 5DHVH 5TDOA 3QDME 5L0QB 5GSVB 5I8EB 2LTQC 5TDPA 4AY0A 2NZ9D 1F8TL 1RAMA 2GTWB 1QBLH 1BFSA 4U6TA 4MA7H 4MNHA 2ZZUT 1IGIL 1TZIB 1ZS8A 4XVJH 2AP2A 1RZFL 3B5HA 4GBXB 2JJTC 5I1KH 4OCXH 2XZAH 1EEZA 3MREA 4MS8D 3HNVL 2P4AB 4TVPL 1CF8H 3ARDB 1R3IL 4UT6L 1AY1L 1BD2E 1A3LH 4ONFH 1GGYA 2GJ6D 3A6CH 4XCCH 1JNNH 3HB3D 1QR1A 1YEJH 1QLRA 4PFEA 4HWZB 3QSKB 3MUZ1 3VWKB 3NH7H 1NBYA 1Q72L 3CVHL 2BMKB 4K71B 4LLMA 4PRNA 1H3XA 2P5EB 2X41A 2IBZX 4XHJD 1UWGL 4P0DA 4EDXA 2IFFH 1FFRA 5C09D 4N1CA 2N56A 1RZKL 2PF6A 1RVFL 1W72H 5D6DA 4P46A 3BJ91 4P2RB 1FNAA 2VRAA 4M6ML 4I8DA 4G7YL 2APTA 4XI5C 3KHQA 4PS4H 3RUGA 3VXUB 4MNQB 5J9PB 3IDJB 4U1JB 3V9FA 4HWUA 3GI9L 4RBPK 2KZ1B 2V9QA 4YHKL 4WUKH 5KS9F 5JHDD 3CVIH 2HLFC 3ET9F 1CDHA 1FJ1B 2Z8RA 4LPUA 5IHUH 1KJVB 2AJZA 3DX7A 1ZEAL 3QDJE 3W2DL 4GMSL 2XFXB 3UTPD 2PXYD 4JM2B 5C3TA 1EEZB 3MREB 5JOPD 4GXUN 5IJKC 3X12B 4L8DB 1YQVL 5BOZG 4XP4L 3MRPA 2Z92B 5F88B 1DEEA 5IMOA 4QRSB 4XC3L 2A6KA 5DI8A 1DLHB 4NOBA 2ZUQB 4NZUH 1NCBH 3SKJH 3RX7A 4M62H 4X9GA 2Y06L 5SV3A 1B88A 1SJHA 2J6EA 4CNIB 2VAAB 2FEEI 1YUHA 3MCG1 5TFSL 3JTTB 1I3VA 2IAMA 1TQBC 2EZ0C 1A1MB 1OGAA 2I07A 4JRWA 2GQHA 3WBDA 2B1HL 2XI9A 4YXHL 2V9TA 1K2DA 3LPGA 4GKOA 2R2BA 4I0PD 4X7TB 2YOCA 2H26B 3PV6A 1QG3A 1IGCL 3GJEA 3OZ9H 3RY6C 1C08A 4RAHA 5GSRA 4U7MA 1VB9A 4OLVL 5TQ0H 3DTXB 5D2LA 1N6UA 1RZ7L 2EDOA 3GO1L 4H26B 5I30L 4OAWA 3BKML 3T0DA 2BZDA 4HK0A 3PGFL 2EECA 4NO0A 1DN2A 1T7YA 4LSRH 1IC5L 1NCNA 1J1XL 1N6QL 2C3WA 1EUUA 4ZXBA 3RTQA 4YQXL 5FXCH 4E42B 3AAZA 3DXAE 3MCLH 2OJZL 3SPVB 5E56A 3ZE2E 3PJSB 4DEPC 1CTNA 4LGPB 1P7HL 3ME0A 1KJ2A 5DD0H 2P8MB 4U1HA 1PDKA 3QZWG 2AK1L 1IC4H 4YDJA 3QH3B 2AXFB 4NKIH 3FB7B 3QXAA 4IRJD 2AQ3A 5E03A 2O5ZL 3RGVA 5J8OA 1T1WA 2D3VA 1MHEB 4FQXA 3T0EE 3CPLA 4K3EL 5F1OB 5C0JB 3LV3B 4LEOA 4TTDD 4AEEA 1PZUB 1IAIH 1UYWH 3QWRA 5HYEA 5CD3B 2NW2A 2EDWA 2AJUH 5LGHH 1U8LA 5GRVK 5GGVY 4JPVL 3D3VD 4KZEH 4OIIH 3MLYH 3QDGD 4DQOL 3AU1A 3U6RA 4ETYA 3L1OH 5MEPA 3MRQB 2GI7A 5CZKA 1KTRL 1TQCC 2BX5A 5I75B 2BCKB 3I50L 3ZYOA 1QFWL 3TESA 3BGFB 5HVHB 1T2XA 3MO1B 1MVUA 2PXYA 3U0PB 3LN4A 4KGJA 4S1SL 3RDTA 3T77B 1UM6H 1DP0A 2AI0L 1P7QB 4XP5L 4C54A 5CJQH 4Z5RA 3WIFA 5DVNA 3G5ZB 3WMSA 2X4UA 3NFPA 3RJQB 2CO6B 5I8KH 3KPQB 4L8SC 4YPGA 5I1IL 1TCRA 1F02I 1FH5H 4M6AA 1T1ZA 4X5LA 1CLZH 1XGUB 2BXYA 3UJIL 5DHYA 5JW4Q 5I15L 1Q38A 4U0QB 4N9GB 5CSZA 5DRZA 3V4UL 4IOIB 4QHNA 3QRFM 3BH9A 5CWSA 4JVWA 4A6YL 5IBUG 1A2YB 1A7RH 1MWAB 4LVOC 3MLUH 1AGBB 3GB7B 1MCEA 2E6JA 1HOCB 3DSNA 5E2UL 2VDRH 3JVGA 4HGWB 4ORZC 5EIQA 3OAUH 4NQUA 1LEIA 2GSIB 3IU4H 2J88L 4XCYA 2V7HA 1XGRA 1CD0A 4NFDA 3W82A 3MLSH 3MV7D 5ENWA 3TPUB 3FAWA 2IH1B 2LU4A 3EKCA 4MNQE 5FHBH 1A8JH 4JG1H 5HJ3A 4OZIF 3K8MA 1AC6A 5MERA 2VJXA 5ESVA 3NOIA 3OKMA 5E5MA 2GK0A 2APWA 3EDJA 2UY6A 4OSUL 4XPFL 4IHOA 2OSLA 3SE4C 3KYAA 3B9KC 1FO0H 1HHKA 5CCKH 4O2CB 4U49A 3VD4A 3LIZL 5I6XC 1KEMH 3ULUF 5GIRB 1MCOH 3D2UB 5E9DE 2WUBH 3RU8L 2BOBA 4OM0L 4OZHF 5E6YA 1J05A 2NY6B 4WIQA 3GHBH 2Z31C 4OLXH 2FO4B 4U6VH 5I8EA 5F72S 1Y0LA 3TWCH 1JVKA 3QAZB 4ZS7L 1QLFA 1IC7L 1V3KA 3ARGA 1KJ3L 4NBYB 1DQQA 4XTRD 4M1DL 2VLRA 5T33H 2H3NB 2X1XR 3SKNA 3IDMA 2FSEA 3BKJH 4NZRH 4HV8A 4TSAH 2A83B 1G9NL 1OGTB 5E5MB 5EU6B 3QIBB 4EOWL 1JP5A 5IFHH 1F90H 2ZKHL 3CU1A 1XGPA 2IAMC 4XCNA 2ERJB 4KZDH 5C09B 1J5OH 5I6XB 3IFPA 5FYLE 4LPVA 4BSWB 4JHAH 4BH8B 3DUUA 4WHDA 2VXQL 3ARSA 3CH1B 5CJOH 4BK4A 5JW4R 3B9KB 4PJ5B 1E6OL 4U1IB 1KXQE 2IC2A 4WCYL 4OZ4A 3RY6A 5IB4A 3T0BA 1JZ2A 1RUKH 1MI5B 5JQ6L 1P4IL 3UPAA 1MCWM 5F6HJ 4TSCL 4OGZA 1WLHA 5ALCL 5DD6A 1UB6A 3GJFH 1MJ7L 2J6EL 2VLJA 3CXHK 1MIEH 3DX6A 3GJFB 4NN7B 3BT2H 1YECH 4BQCA 1S7VB 5EUOE 4K8RH 3VFRB 4M7KL 3ZTJG 1VGEH 3KJ6L 5TGBA 5GS1A 5D7SL 3WSQL 3H8NA 1RHHB 1EBAA 1CR9H 3U0TA 1WCQA 4F7CB 2OZ4A 2BY1A 2M8XA 2X4UB 5MEQB 1AQKL 1UZ6F 4WW2F 2Y07L 4UV4L 3RKPA 3P30L 2DMCA 3T2NL 5BZWA 3VU2A 4HQQL 3MRGA 5DJXB 4PJXA 3U9PL 1KGCD 1WEJH 2C26A 4I3SL 4Y16B 5TE4H 4NQSB 1JGVH 1RZJL 1CFNA 4J7RA 4GFTB 2VLJD 4RMSA 5BRZE 4ZFOL 4MVBD 3UZEA 4C4KO 3N0PB 4S1QH 5C71A 2FR4B 1I3GL 5EA0L 1S9XB 2ZSWB 3BRDA 2DMKA 4Z76B 1RZ8A 2HTLD 1XR9B 1WBYB 1BQHA 1QFWM 4UILL 3MUGB 5E94A 1WIOA 4UDUA 1BQLH 4JM2A 1PX4A 3JV4B 5I1JL 3VRLE 3FO2B 4PJFF 2DTSA 4ODXB 3WNNA 1D5IH 3G5YA 4HXBL 4H0IA 5ILTL 3SCMA 1A64A 4HFUH 1P84J 3EW3B 3O4LB 1TTFA 3HAEA 5C8JB 1O7VA 4YIQB 4NQDE 2DDQL 3O8XC 2UY7A 3U7YH 2YPLD 2PO6A 4MLSA 3TNNB 1T0PB 3SJVB 2HLAA 1T3FA 3ZZ1A 5L9DH 35C8L 4U05A 5K59F 1HSBB 2GSGA 1A6UH 4GQ9H 4J2XA 2NLJA 3X3FH 4KPHL 3KPSB 1JTPA 1KCLA 1RUPH 4MSWB 3EO9L 2CXGA 1KCVH 4U33A 3B6SB 4FQIL 3RWGA 4PJGE 3Q6FB 4UOW0 2YXMA 1E27A 2EIDA 1NSNH 4N8CL 4JZJA 5DT1L 4NQVB 4G6AC 5T1KA 1XR8B 4OIAA 1K4CA 1DBMH 1KLGB 1KC5H 3QQNA 1AXTL 1J87A 3L3DA 4D0DA 4OZHE 1RIHL 4P23B 3PWUB 1G6RB 3DX7B 2OL3L 3SQOH 1U91A 4HC1A 2XZCL 3CLFH 5HI5C 3L9RB 1IBGL 1XZ0B 4NQCD 1IQDB 1KYOJ 3LRSB 3UBXA 5CZXC 4POYA 1NCCH 3O6KH 5K9JL 5HYQA 1CLYL 3P0YL 4XNUL 4XP6L 3VDAA 4KKAC 1NAMH 2VLKB 4NHUA 1AP2B 1MRDL 3BPCB 5CGMA 4QRUB 5D72H 1A6ZB 5GRXG 1LK3L 1P5UA 1NPUA 5F3BB 1BFOA 3K0WA 2ZCKH 3VXNB 5E8DH 1D7FA 1XF1A 2DWEB 3DVIA 4ZOEA 2HFEB 2UZXB 1LP9B 3FONA 4Z7WA 1WFOA 4UZGA 3QWRD 4TNWK 5EU7C 1KIUA 4P49A 4KGLA 4DZ8B 1PSKH 1IQWH 3ULVD 1BPVA 4P9HL 2XV6B 1PQZB 4HS8L 1E4JA 3RTQD 2BERA 5CD3A 5KS9E 4NYLB 3SGKA 2E8ZA 2BC4B 3U83A 3W39B 3OMZA 1ZGLP 1T89A 2AEQH 5D2LB 1A9BA 2X4SA 3QHFH 2BJML 3DX6B 1SEBB 2XG5A 4Q2ZA 2VE6B 4Y2DC 2F5AL 5C0AD 2X4RA 5DK2B 4L4TA 3EOAB 4Y1AE 3NCYP 4WO4C 4KROB 4OM1H 1C1EH 4JR9H 1RSFA 4NQED 5GJSL 4RX4D 5TE7L 3GSVB 4LVEA 4ODHH 4LFHG 5D7LB 4CW1A 4PR5A 2GIYA 4LEXH 2SEBA 1DVFA 4LLYA 3AAZB 2OR8A 3LEXB 1IEBB 4EDWL 2BNUB 4G8EB 3CFEA 4R7DA 5EC1B 4PJ8A 1HHHA 4G8FB 1GZPB 3RHWK 3HNSH 4XP9H 1MRFL 3ALXA 4PLJC 4PRAA 4POUB 5I74B 4XTRC 5E5RB 4YHML 3P3YA 5T3XL 1T03H 2IBGA 1QSEA 4JKKA 4UOJA 4ONGL 3K80A 2X1OA 1D6VH 4GQ9L 4FFYL 1TTUA 5F1IA 2CDFA 4G8GD 1F6LL 4QKXB 1T21B 4HS3A 2CK0L 5CEZH 4GW1A 2R2EA 4JZJC 5JHDA 2IANB 3BRFA 3F7VB 2MPAL 5KVDH 4D3CL 5GPRA 3ARDC 1NGZA 3H7LA 3DRQB 1KXVC 1S78D 4M5ZL 1U8KB 1K8IA 4OV6F 3QUXA 5JHDE 1UT9A 4J4PC 3VXMA 3E1F1 3I6LE 2FX9L 4Y19E 4YR6A 2CIKB 5H2BB 1RURL 2BDNH 2BMKA 1UJ3C 1WJ3A 2HFFB 5T1MA 3C8KB 3VGAC 4N0UA 2PYED 3BHBB 3QWQB 1Z9LA 1KCUH 2AXJA 3WNPA 4UILH 4RFOH 1F97A 1HNGA 4PP1C 5HY9B 4RFEB 3CSPA 1XGQB 5B8CA 3WNOA 4CVZB 4HUNB 1IEAA 4LLDA 5IW3A 1EHXA 2F15A 3QUYA 2YEZA 4HCRL 4JZJB 1QFPA 4MAUL 4XPAH 1NCWH 3DO7B 1WEJL 1JPFA 1QZ1A 5IJVB 2BSTA 4X6DA 1IAMA 4PY7B 4JG0L 2OMNA 2DIJA 4PTTA 2KH2B 4UU9A 1UXSA 3O3UN 4ETQB 3C60B 2OR7A 1ZLSL 4PJGA 5IK3B 1QR4A 5DFWH 4JO1H 4DCQA 1T2JA 2X89A 2AEWA 2YXFA 4GRMB 1CD1B 4M7KH 4LDLB 4K8RL 4ZFOA 4CAGA 4HS8H 3MZGB 3SDCD 4WI3A 2I26N 3TPKA 2BNRD 4HWNA 5GZOC 3RUGE 1IEHA 4LF3A 1RUKL 4OLEA 2FIRT 5FF6B 3BKYL 4Q58C 3V6ZA 4N0RA 1LEKA 4PRHA 4NKDB 2R0KH 1JN6B 4OFIA 4TVSa 5DJ6B 3WFEH 3LS5H 2Q7YA 4M48L 4AL8L 5F6IB 2VABA 2EYRB 3BP6B 4HIJA 3ZE1F 5DWUL 2WINA 4P9ML 1G0YR 3U48A 4FXKB 1Q0YH 3CSGA 1JMZA 1NBVL 2ADIB 4Q6YA 3S8WA 3JBG7 2N1KA 3OKEA 1UH4A 5J11B 4QY8B 5DWUH 3MACH 1CU4L 3S35X 3VWJA 3U0TB 4F7CA 2BRQA 4WTWA 3V8OA 5D96B 3U0WH 3JV6A 4JRYE 4M48H 3LS5L 5JZ7C 3RPIA 1KCVL 4HC1H 3PQYD 3IKCB 5L2KD 3SDXA 3LB6C 1AJ7L 3OV6A 3D39A 3ARRA 1HHHB 1YNTA 4G8FA 1QBMH 4KC3B 4N0UB 3MGOB 5EZIL 3Q6GH 5IFAH 1G9MH 3O9WB 1FG9C 3C6LD 1ZVYA 5IW1A 1LD9B 2B39A 2DDQH 3JUYA 2Y23A 3OAZK 2YD6A 1CICD 3S5LA 1U9KA 2FJGA 1NUGA 3CH1A 3EZJB 1U8JA 2P24B 3C5ZC 3FOLA 4IS6B 3FT3A 3SDCA 1ONQA 3VH8B 1AGFB 4X0KB 4RQQA 5FYJD 1ZE3C 4JO1L 1BQLL 5MEPB 3TZVC 3U7AA 2DL2A 3RVWC 3T3PE 2UZYB 4Z7VA 2VNCA 2F74B 3FO2A 2BNQA 4OUOA 3DOSA 5BRZD 4GAYB 1OARL 2AVGA 4ACPA 5TGBB 5GS1B 3O3EB 3BGMB 2C1PA 3O2DA 3BHBA 1CE1L 1NEZG 2FEDD 2ED9A 1BFVH 1FN4B 4JFDB 4W6WB 5FYLL 3SY0A 3I75A 1ULVA 1NCUA 5E2TH 5B22A 4PD4K 5HVWA 3WUWA 1R24A 2YD5A 2J1KA 4LK4A 5FGCB 3BQUD 4MQ7B 4J3UA 1H8SA 5A43C 1QNZL 2VYRE 2PW1B 4NJAL 4OF5A 3V5DB 3FT2A 3EYOB 4A6YH 3ARTA 2UVEA 4PJCB 3V4UH 2W59A 1I85A 2FJHA 5FUZL 2HG5A 5BS0A 5DJ6A 3WNKA 4IRSC 5JMOC 2I9TB 3QUMB 1CLZL 1BX2B 3AU1B 5E2VH 2EC9T 5I1IH 3JWOL 4KTDL 3MV9D 3TBVA 3U9UA 3R4DA 4JHWL 3K8KA 1LO4L 1A6UL 3SGEI 1GOHA 5D1ZB 4ODWB 4LCCB 1Z5LA 4XH2A 3VFGL 4P23A 4LP4A 2AI0H 5I0ZA 4E5XA 4PJFE 4QRRB 2HLFD 3HZYA 1A6TA 2JB6A 2MWCA 4Y5VA 4Z7OF 3FFCA 2FIKB 1IE5A 4WTZA 4PRID 5DK0A 4FTVB 2DQUL 2HVKB 4OGYH 3QFDA 5CJOL 5IVXA 5ANMA 5IEKA 1NUNB 3ETBF 3TCLA 2I9LB 2WWKO 2WUCH 5E5UB 2C7UA 4GAFB 4X9HA 3D9AL 3PIQB 3N1PC 1BFOB 3UYRH 1MRFH 2W1NA 3HNSL 4XP9L 1GYAA 4Z7UB 4W70A 4NN7C 5FO8A 4OCYH 3MOAH 3OTTA 1CXFA 3ZMRA 5TDNA 3WJJC 3E6FA 4EDWH 2EZ0D 3FRUB 3H3KA 4MD0A 5DJYB 2OXGA 2VXSL 4KI5F 4C56D 2JKXA 3GSUB 3QXDB 2BNQD 1WCBA 1XF2A 3BYTA 1NGWB 5EOCH 3PUCA 3PDGA 4JJ5A 1CGSL 2A6DA 1G9NC 5C0RH 1KJMA 1VFAA 2Z93A 4FMKA 3OKEB 3WFBL 3FQTA 3BWAA 3GMMA 3E2HC 3GZKA 2AJYH 2VL5A 1JMXA 2W9EL 4ODVL 4LCIH 5E9DD 4RGND 2FGZA 3D0VA 4PGZA 1MWAL 2ERJC 5F44A 1J1XH 2YWZA 4OM0H 2B5IB 3VGFA 2NTSP 2E27H 3MRMA 1MCOL 3BP5B 1MFAL 2IEPA 4MDIA 1FZMB 5GS3A 2YD3A 4PGDA 4Y5XB 1HHIA 2Q8BL 2PYEB 3FQUA 4PJIB 1T80A 2VUYA 1UA6H 1AHWC 3MRRB 3QQ3A 4DUWA 4NZDA 2PETA 4P5MA 2R0LL 4HS6B 3LAFA 3VXRE 5FCUL 2AQ1A 5HTSA 3TT1H 4P5TC 4YHLH 5DJ2A 1EBPA 2VDOL 4OZGF 3VJ6B 4CVZA 1B3JA 2Z31B 1HXYB 4YBLC 1J0IA 1F58L 5CJXC 5TFSH 3NBNA 3HZKB 4E0RA 1UM4H 5FO7A 1XF5A 3MRDB 4YDIL 3S7GA 3KPPB 4IRSA 3E6HB 2VUOA 2DQFA 2KDGA 2EICA 2Q76A 3O6LL 5AZ2H 1G7LB 1U8OA 3ILQD 3SJVD 3MV7B 1E4XL 5I19L 1MCNA 1KCRL 3E3QE 3QNZA 5FGRA 3F5WA 4N0CD 2AK4A 3H7BB 4OUUB 1I1YA 4QCIA 5DT1H 4UMGA 1HQRB 2A9MH 5I15H 4WFHD 5H35B 4JREB 4XNQA 4LLMB 3DI3B 4YHZL 3CFCL 4R0LB 1ZKAA 1NMAH 1IKFL 3MFGB 5DJXA 4L3EB 5LGKA 3PP3H 4B41A 1EJ6A 2R2HA 4CN4A 3PHQA 2H8PB 4KKBC 2VLKD 5GIRA 2HN7B 4CRPA 3P40A 1UENA 3CZJA 35C8H 3HRZA 4RISH 1GJIA 1BREA 2NY3D 4WW1A 4F7PB 1FLTX 4XXDA 5EO9B 3GJEB 4Y0GA 4LBEA 3MJ9A 3BQUC 4PBWD 4D0CA 2LFGA 2CLZB 2DQHL 2VLJB 4Z9KB 2ILLA 2X89D 3VFSA 3OKNA 1UB6B 4N8VB 3MFFA 3N9GL 4XPFH 4PLKC 2XG4A 4XZUB 1FFNB 4X9FA 1X5GA 2YN5A 4H1LH 1BWMA 1Z0NA 2CRZA 2D03L 1F4XL 2LVEA 4QHMA 5ICXA 3P4NB 5HDQH 1A7OH 5FDYA 1WBXB 1MCRA 2B20A 5D1ZC 4QTIH 3ROLB 4M6OH 4PGBB 2AEPH 2AXGB 1J0ZA 1JGLL 3SE8L 4YIQA 5DO2D 1QLEH 4KKNA 4WUUA 3MV7E 2K9UA 1ZGLM 5JORB 5DD1L 4GT7A 5TE4L 3N1GC 2X70A 1BECA 5E2UH 2BY2A 1ZVHA 1BMGA 1NC4D 5HD8C 4JO2H 3S5LG 4FZ8L 3IU3A 2QL1A 1AI1L 5CJBA 5BXFB 1AQKH 2VSDA 3MV9B 4E9LA 2WLYA 5KBNC 1BD2A 4MJID 4YQXH 4JO3L 1NGXB 5TPWH 3SKOB 3WSQH 5GRYA 2EIBA 5DJDA 3RX8A 5B3NA 1NEUA 4UI2A 3GSRA 2D4FA 2CDGB 1ES0B 3C08H 5FV2A 4MA8H 3ZKMC 5FM4A 3KLHC 4QT5B 3VA6A 3I02B 4XAWH 4YEEA 5CIPB 5A2KH 3OZ9L 5EO1B 3WFCL 3NIGF 4IDLA 4P59H 1NFKA 3WXWL 1IGJB 2DQEL 2G5BA 1CDBA 3RPIB 1H5BB 4EEEA 3L3HA 3QJHA 4JDZA 1X5IA 2R4SH 3DUSB 4KI5D 1J8HA 3L1OL 4K7FA 1F90L 2ZKHH 5IQ9B 2HN7A 1EDQA 3A6BH 3MRIA 3LQMA 3SDYL 4P5MB 2WWMD 3RI5K 2AJUL 5BOPA 5IIEA 1C5BL 4MJ6A 1YEKL 3WJJA 4LVHB 4CVUA 2DLFH 4TSAL 1QRNB 5JOPE 5IB2B 5I2IA 3FOLB 4IS6A 4XP4H 3KXFB 3IS0X 5FM5M 4IM8A 4FQHA 4MCZA 3D25A 5C0CD 1IC4L 1TETL 4GG6E 5DJDB 5FHAH 4O00A 4FFZH 4TVPD 2V5TA 4L1DA 2KPNA 1IC7H 2A9NH 1OPGL 1D9KA 5ISZA 4YHKH 3SDAC 4JANA 5DQDL 2NY4D 3VGEA 2DD8L 1I1CA 5JXEA 3GHBL 4ZODA 3TYFA 4M6MH 2JF1A 2ZUXA 2E6QA 2DQTL 5K9QI 2EDFA 3BZFA 3GHEH 5DJAA 3NFPB 5CSBA 1MH5A 1DUZB 3EGSA 2QKIB 1K3ZA 4WI5A 3EYUH 2VMFA 4BQBA 1AHWA 4G8IA 4YGAB 1YNLL 5J1AA 2PNDA 3DECA 5B38B 2X4QB 4QOKD 2GJ6E 4UV7L 5JLZA 1D6EB 1YZZA 2XKNA 1HCFX 2DKUA 3OF6A 4HXAH 1FBIL 2O5XL 4HPYH 4RAUA 3GGWB 1CFTA 3CMGA 3MFFB 5CJXA 2R15A 1JIBA 3MLSL 1Q9KA 4OCXL 4CMMB 3S35H 3S88H 4YHYB 1IM9D 1ZHBA 4J1UB 4KQ3L 4BZ2L 3O3BA 3A0OA 3OAUL 5CBEB 3MCKA 3DXAB 4JDTH 2AS5M 2KQNA 2MMXA 4KRLB 3LN5A 4LCYA 1FV1B 1KJVA 3VFTB 5ALBH 3VG0L 4P3WA 4XNYL 3MV8A 4Z8FL 4IIQA 2XWJA 4DGVL 2A6IA 4IDJH 1CDCA 3SHSA 4JHZA 3LPFA 4K71C 4PJIF 4ZFZB 4HKJB 3VXMB 1ZEAH 3PGDA 3W2DH 1OSZA 1NCDL 3QCVH 4YHIB 3NCYS 4WEBH 1FH5L 4W4OC 1RK1B 3O81A 1WISA 1Z3GL 1MCWW 2OL3A 3FB8B 5LCVH 1NANI 5EUOA 4Q0XH 4NQSA 3QPXH 1B4JL 4OQ1A 4LRIA 5CLWA 2CSPA 5EN2A 4ZUSB 2UYLA 4QRPD 5F9JB 4HULB 4Y8DC 4L8BB 4OB5H 3S37H 1VGKA 1EA9C 3QG7H 3AREB 1CFBA 3VI3E 5CGTA 4H20L 4NJ9L 1FPTL 3MRBB 3A6OA 2LU3A 4HDIB 1OAZL 1A6TB 1PKQB 4PREA 1Q9WB 1J8HE 1FL6B 3JV4A 3HG1E 4DQOH 4OCSL 3VFNA 3W9EA 1IM9A 3OB8A 1BOGB 2VDNL 3ISWA 4RMWA 5DFTA 4K23L 1NCTA 3U36A 1KNOA 3PJSA 4I4WB 4Y5XA 5J12B 3F5WB 4UINH 3HZVB 1BD2D 4U7KA 4JO3H 3FO9A 1SJHB 4M61B 4NKIL 1DVFD 1CG9A 4XGZB 3HUJB 4GG6F 1JWUB 1OCWH 3UDWC 4ZDHA 4ZUVB 3D85B 4JFFB 3WXVL 2DOCA 1UCBH 1HXMA 1F3JA 1OLLA 2P42B 3QPQC 5FKAA 4HIXH 4PB0H 5DD1H 4C56A 1N7MH 5E24E 2FZ3B 2NW2B 1IM3B 3Q2CA 3BAEH 3ROOA 3I2CL 3PNWB 1X5KA 1T7ZA 2ARJA 4XNXH 4UTBH 4JANB 4QTIL 4PG9A 3UCRA 3FMGH 1I3RA 1FFPB 5MI0C 3LHPH 5F3HB 2A74B 1YN7A 4FN0A 4ZD3H 5T1DH 4PJDF 4AJ0A 1H3UA 4ISVA 1RQ5A 3QCTL 4MXQD 3WIHL 4HUVA 4F7MB 5MI0B 5DEGB 5J0BA 2AK4B 1TNMA 4XX1G 4LSTL 2RQ8A 3V4VL 3BH8B 5IFJB 1Q9OA 4KRPC 1I4FA 4X98A 3GIZL 4WV1B 3SJVA 3C2AH 1FNSH 3TO2A 4NT6B 3TO4B 3VFMA 1JHKL 1DN0B 1YNTB 2C4FU 2FGWL 5BVPL 5CWSB 5FK9B 3P77B 5EBWA 3C2AL 3ILPA 4UDTA 3LKOB 1UEYA 2NY1C 3L3JA 3FFCD 2D31A 1A0QL 5F96L 3IDIB 1UADC 2BC4A 5ID1B 2IG2L 4NC0B 1HHJB 1MFBL 5I8OL 3ZYJA 4CVXB 3FQNB 3TJEH 3EYSH 5I1EH 1KTDB 3GMRA 4LHUD 4XPGH 1I1FB 3GUTB 1J8KA 3B43A 4C57C 5IHUL 5ENWB 3TPUA 3TYGH 3R06A 1NEZB 1EGJA 2FD6L 5CS7A 1ZLVH 1MI5E 5AZ2L 4H1LA 5IGXL 2VXVL 1IMHC 2P5WA 4PJHB 4S11A 4AT6A 4YHIA 1NFIB 5AWNL 1G7MB 3PL6D 4HKJA 3M8OH 1GHFH 1YMMD 3TJHD 4NSKB 1YJDH 4O9HL 5HYSG 2DRUA 2GFBA 4NRYB 1CDGA 2QEJA 4LASH 2A83A 2IFFL 1JRHL 1NJ9A 2R0WH 4M6NH 4OJFH 5FCUH 1IGFH 2V9RA 5DMIH 1MY7A 1S8DA 1NUFA 3SO3B 4RZCB 3H9SE 3R8BB 3WUZA 3MNZA 1ORSA 4U6YA 3RVTC 4RGNE 3MJ6A 4X6CE 2ZNWA 4FP8L 3VXPB 2YA1A 4TRPH 4B5EA 2DBJA 1MFAH 1JBJA 1AY1H 5C0ND 4XBEL 1R3IH 4UT6H 2VDNH 5HGGS 4L9LA 4S0TD 3SDCB 1RJLB 3EZ8A 1FFNA 1NLDH 5D7JD 3FJTA 5LWYH 4JY4B 3W0WE 4FFVC 4XRCB 3TBYA 1NGYA 1EFQA 3UP1A 4LRNL 3WS6A 1KPUB 2O5YH 3KYNB 1DLFH 1AD9B 2W92A 4Z7NF 3WHE0 4KY1H 3OGCB 4GRWE 5KSUB 3C60D 2BVUA 3SO5A 3T08A 3CXDL 1EXUA 3ZYZA 1A6WL 3S37L 5EU6A 5C2BL 4WY7L 1CWVA 3QEUA 4JDZB 1OGTA 4HFWB 4X80L 5HHQA 4XMPL 1K4DA 2YPKA 3TN0C 2X40A 5ITBH 2DYPD 1GPOH 2HYMA 3T8XA 1TJGL 1Z3GH 5C9KA 5JNYA 5BZDB 2Q6WA 2IGFL 3E6FB 3VFMB 3VRLF 4Y8AA 4JFPA 1NCDH 1DQLL 2WP3O 4JKPH 3VXMD 2OK0L 4HT1L 1A6PA 3P73A 4UQ3B 5GRWA 1KENH 3BRGC 5CINH 4R4BB 1KYOK 1A6WH 4DGVH 2CDGA 2F8XC 1BFTA 3W5NA 4I5BB 4PJ9C 4Z8FH 4F15B 1LDSA 2H1PL 2OP4H 3GBNL 3MJ9L 1FZJA 1QSFE 1HSAB 1G9MC 3LKQB 2OYPA 4KJQC 4IRJA 4OLUL 5EWIL 1U8HA 3S35L 4TUKL 1U8QB 5DYOB 7FABL 3PWJB 1MUJA 3NPSB 4Y4KB 3SDAB 4E41A 4P2RD 4JFZH 3VXSD 5KN5B 4GJTB 4P99A 3HMWL 3S3PA 1U3JA 2J5LB 5CEZD 2VIRB 4PLKD 4Z7WE 5T5FH 3VDBA 2CPCA 2RAMA 5B39G 3VXQB 2HKHH 2O61A 4NRYA 1J86A 3AY4A 4NSKA 4XVTH 3BIKA 5FUZH 4P5TA 1S9XA 2IAMB 2ZSWA 1URLA 2I5YH 5CKAA 2AK4E 1FE8L 1WAAA 3DMMC 5EZJA 1MI5A 4KKLD 4IMKC 4ZPVB 1I8MB 1CXEA 3ZKXC 2UWEA 3O45A 3MR9A 3ZL4L 5KAQG 4ZUUB 3RWEA 4HG4J 2PO6C 4YUEL 1LDPL 3O2DH 5EOQL 4EN3D 3P9WB 3EJZC 5FGCE 3CDGA 2BSSA 1LGVA 1XF5B 3GSXB 3OF6D 3RI5F 5KJRL 5C07D 2KBGA 5DK0B 1I7ZB 2FD6H 4MGXA 2KKQA 3FQWA 2HAZA 4PREB 4FQJH 5F9DC 4BFGA 2D0GA 3O3DA 3QAZC 4PJCE 4LPCA 1IAIM 1HQ4A 4Y4KA 1B0RA 4E41B 2XTJE 1EPFA 3SDXE 5C0CA 3QPQD 3GSWB 3LRGA 4ZSOA 2X1WL 1PLGH 4TOYL 2MKWA 3RL2A 2HKFL 4KAQH 4M3JA 2P8MA 4U1HB 5C0AE 5MP6H 1YEKH 4ZFGL 4H25A 3NIGE 3NCCB 4TUJA 4UIMB 4PGDB 1JTTA 4HG4K 2XKNB 5BVPH 5I18H 1KB5A 1LO5A 5TDOB 2R1XB 1RZKC 5C08E 3O8XD 5CEXB 3WIHA 3ULUL 4K3HA 4X7FC 1GZQB 4ODTL 2X4OA 3MRDA 2DQEH 1S7WB 4WI7A 4E41D 3U6RB 2WLZA 3T65A 1CYGA 4D0CB 3DV4A 1WSST 1UWXK 5J1TC 4OF6A 3PWPB 3HNTL 4N1HB 2WW8A 3LPWA 1T2QL 1OD7A 2NPLX 5DVLA 2ADFH 5T1DL 4IBLT 3ULSA 5CBEA 1S7XB 5DJ8B 4NCC2 4ELME 1EZVY 4R3SA 4WEUD 4QY8A 1J18A 4BQ6A 1GRWA 4WHTB 4XNXL 4NBXB 1BLNA 2VITA 5DRXA 4LSSH 4ENEC 4C4KT 5A3ID 2W60A 5IHZB 5ISZE 2B7DT 4QEGA 4D2NA 4PB0L 4XNZC 3NPSC 4MQXC 4YAQB 1HSBA 1U8PB 1MCQA 2GSGB 3VD7A 1YEGH 5DSCA 5JO5B 3BSZH 3O0RH 3WXVH 5IMKB 5A1AA 2AJXH 4XCEA 4EDXB 2Q8AH 1QYGL 2EKSB 3RVWD 2BOBB 4GXVH 4L8SB 3T1FA 5E8PB 5AG9A 1MHHB 5IROC 3ULUC 3AFLA 2QQNL 4E0RB 3G6JE 1FORL 3BH9B 2BVOB 2IANE 4NKMB 2EO1A 3DVGA 3ARFD 2X4SB 4Q97A 1KIRB 1M71A 2Z8VC 3DYOA 4U0RC 2GJ6A 3UX9B 4M9PA 1EHNA 3ARWA 4LNRB 2X1QA 1CDYA 3QCUL 4J3TA 4ZSOE 5HHNA 4QOKA 3VXUE 5EIVA 4R97C 1FNLA 3JXAA 3GMNA 4YDVA 4ZPTA 1U8KA 1OAXL 5F93C 3VXNA 3RWCB 5EC2B 4HK3N 1RUQL 2BSRA 3U36B 3N06B 2R56H 1A6ZA 3G04A 2DQJH 3RWFB 2P5EA 3IT8D 4JM2F 1AGDB 1CBVL 2ENYA 3KGRA 1ORQB 2VN7A 1DBBL 1NDGB 1CL7I 2ZWLT 4P5TB 2A77L 1N5AA 4TVPE 2DBLH 5DUBA 1TZGL 4JRXD 4LL9A 4Y5YC 3GSNL 4FZEL 4LSUH 5A2LH 3CLEH 1S9YB 4Y16D 2C3XA 1AO7E 3JV0A 2XRAL 1IAOB 1KCUL 4XPBH 4OF0A 3UJJH 3QBTB 1U2CA 4OLYH 1JPTL 5DTFA 1S7UB 2BDNL 2H26A 3PV6B 3OKYA 2XTLA 1R5WA 3LKNB 4FQCL 2DM2A 4QTHA 4RMVA 1A6AA 4LLUB 1YYMH 2OBGA 4Z7NE 3VGGA 5FIEA 1LP9F 3HI5L 1Z9SA 3LKSA 4OZFB 1ZHKB 3ZHLA 3MOBH 1FL3A 1MJUH 5JZ7D 3SEPA 2VC2L 4HX1A 4H1LB 2FB4L 5D71H 4MXWH 1S5IL 5JR1L 2C7UB 5K93A 3D69A 4HWBH 3QYCA 3FO1B 4I77H 1UB5B 3B3IA 1DEEB 3O2VL 1BF8A 3VGBA 2BHZA 5D1QD 1OWWA 1T20B 4WW2B 3F62A 4X6EB 1H0DB 3JUZA 4MA1C 4RZCA 2R0LH 2MHAB 1F4YL 4X9BA 4FABL 2KQMA 3UTSA 4DZBB 4PJ8D 3EYUL 5GISL 2YPLA 4XMLH 2EEBA 1NC2A 2IFGA 1A6VL 3UO1L 2XKSA 4LAQH 4RGNC 3GSQA 3LRHA 2OTUA 1N3NA 2ATKB 5KANG 1PKOA 3PP4L 2W9EH 4ODVH 5CP7A 4G3YL 3PWVA 4KI1A 3WFBH 5I66B 2DD8H 4R4NC 3K4AA 1JZ5A 4UU9B 1T1YA 5JXEC 3WL9B 5L6YL 4OM1L 5D1XD 2W07A 1EEYA 4QGTA 4P3DA 5I1CH 4HUXB 4EI5B 5FHAL 4CADB 3MV9E 4ONOA 3GKWL 5CMAB 2IQ9L 3KR3H 3CK0H 1KEGL 5FF6A 3DV6A 4JFHE 3V0WL 1WK0A 3H0TB 5CZVL 5HHVL 2D0HA 1S8DB 2NXYD 2QADD 4X7SH 3WCYA 5ITFA 3CJJA 1I1RA 3HA0A 5IEHB 2P47B 1I7UA 2V7NA 1FCCA 4BK5A 5F9JA 4G6KH 4Z0BH 4OZHA 3P11H 5D2LF 4DOHE 3EOBA 5I1HL 1E27B 3FTGA 5GZNC 2DYPA 2J8UA 1DSFL 2X05A 1A5FL 4NRXA 2BVPB 5BJTA 1X5XA 3P9LA 5JQHC 1AIFA 4K94C 3KYKH 4JFHD 2DTMH 2VLKE 3WDIA 2X42A 1WBZB 9CGTA 3BUTA 2A0LD 1Y6MR 3TLRA 4KK5D 1KTKE 1CL7L 1IM9B 4X8XA 4P2QA 2DQCL 1P7KB 1AXTH 4IRZL 1XGYH 5E2VL 1UFUA 1G7HA 3NCJL