2D3VA

Crystal structure of leukocyte ig-like receptor a5 (lilra5/lir9/ilt11)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
193
structure length
179
Chain Sequence
LSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSAVTLQCGSRLRFDRFILTEEKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords leukocyte immunoglobulin-like receptor subfamily A member 5
publication title Crystal structure of the human monocyte-activating receptor,
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 179
sequence length 193
ec nomenclature
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d3vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d3vA02
2Q6WB 5DUML 5CBAB 1JL8A 1KIQB 4I0PB 2R1YA 3BP7A 1U2CA 1FHGA 2Y4SA 1X5IA 4KKCC 4X8XA 4RX4A 4CNIA 3V6FA 2AS5M 3ARBB 3JZ7A 1U91A 4AEFA 5HYFA 2AXGB 4P46C 4KRNA 1U8JA 4HK3N 5D2LF 1LO4L 1TZIA 5E9DE 1QR1B 2J6EA 1QFWL 5KG9A 3TWCL 2VQUA 2BVUA 1YEGH 2OR9H 4X8JB 1UC6A 2EE3A 3AROA 3FO1A 1T7ZA 3ILQC 4LDOB 3MRDA 5E4IA 3OJVC 4KQ4L 3I9GL 1U8IA 4BUHA 5EUKA 2V17H 1NMBH 5DVNA 3P30L 5EC1A 3W9EB 2XQYK 4KDVA 1SJHA 4HG4J 1W8NA 2D0FA 5EWIH 4OJFH 4D8PB 5D6CB 1OB1A 4Z0XA 1IKNC 2R2HA 5FK9A 4BZ1L 4R0LA 2JIXA 2JJSA 2P24B 4XNMA 1DUZA 5DSCA 4F7EA 4JE4B 4RISL 1KLUB 3SCMD 3HC0A 1QLRB 3U9PH 1QBML 5HI3D 3RWJB 4DVBA 4LLYA 3VMOA 1FPTH 2V7NB 3MOAL 4OCWH 4ZFZA 5LAXB 4FMKA 4NJ9H 2AQ2A 3KPMB 1PAMA 4ISVA 5F3BB 2J4WL 1HHKB 3GSOA 4ODSL 1JE6A 4HUVB 5D70H 5C0DB 4PFEA 1NFDB 4O51B 4FP8L 3VG9B 5FAAA 3BHBA 4GBXD 4N0FB 4AEIL 1G7MB 4G9FB 4RFOL 3ARGA 2AJXH 2DQGL 1X6NA 1MQKL 2F54E 5EU6D 1HK6A 2OTPA 1VB9A 1D9KD 4NWUH 4HUUB 4QXTB 5EDXA 4ZPVA 3LH2H 3RGVD 1IC7H 5MEND 2D03H 3X3FH 1J11A 1DQLL 1XGRA 3VFOB 1BWMA 1WBXB 4PJDF 3RDTB 4B53A 4JRXB 4GRWF 5D2NE 1RFDH 2EEBA 2X4UA 2BC4A 1JGUH 4FFWD 4R0LC 5EUOE 3M07A 3RZCB 4PJEA 3RU8H 2WUCH 2LABA 3IF1B 5GZOD 2PTTA 5E6YA 3FFCB 3QUYA 3EYVB 3KYNA 4GRMB 4WHYG 3QJHB 2A73B 1IGYA 4GXVL 1DBBL 4JRYD 5EUOA 2H32A 1KGCD 1BIIA 4G9DB 2NXZD 3U7WH 4NUGH 1AGCB 5IB5A 3GK8H 3ARGC 3RUGB 4P2YA 1MRDL 4M4PA 3C6LA 3SDYL 3P4NB 5DUBA 1CL7L 2EDYA 2AJYH 3WNNA 1DQMH 3ARBD 4YHZH 5SWZB 2CMRH 1S7VA 5F3HB 2IEPA 5ACMA 5I1JL 1S7RB 4DEPB 4HPYL 5DJ2B 3FZUD 1AE6H 3QDGB 4M03A 3QXDB 1AGFB 1KFAL 3NABL 1MEXL 5DQJB 4Y2DD 4U49A 1DQQA 4H1LB 2R9HC 4UINL 4CJ1A 2RFXA 2G9HA 5FM5M 2UWEA 4GKNA 5F7KC 4OIIL 5IK3B 4YDJB 5GRXG 3PHQB 2VZTA 1JHTA 3V79C 3LHPH 5IVXA 1ZGLM 3BDYL 2AV7B 3WUZA 3G6AA 3UZVB 4X9HA 5DD1H 4MJIE 1AO7B 4ZOBA 3L9RA 5GGRY 3PXHA 3QCVL 1J10A 4RQQA 1URLA 3WE6A 4Z7QE 3WJJC 2R0WL 5F7LB 4LU5H 4C83A 5BV7B 4LFHD 4B7LA 1BOYA 1NGWB 4P3CL 3S88H 1WUNT 4MJIA 5F97E 5GS1C 4S1SL 3O4OC 4XVUD 4G9FD 3W0WA 3QFJA 1A7QH 3FQWB 4FG6C 2UYLB 5TGBA 3MRLB 3MLVL 4YNYA 2RGSA 1FL6A 3CUPB 4NQEB 4OM0L 2W65B 5DJZA 2DDQH 1ITBB 3MJGX 2MCPH 4YXLH 2IG2L 1UXWA 4GKSA 3DGCR 1OGAA 3K0WA 2FJGB 1NBZA 1I1FB 5HGBB 4XT1C 4LL9A 2P8MA 5I2IB 3QAZB 4R4BB 3D25A 2IPTL 3OF6D 5CGMA 2KL6A 4MA7L 2EIZB 1QFUH 2CLZB 2DQHL 2ZCKH 4OUUB 3SY0B 1PZ5B 1SBSH 2D7QA 3RWDA 1I7TB 3MOBL 4K23H 4KKAC 5TDOB 3S35H 3RI5F 1JHLH 1UZ6E 1IZKA 5CZKA 1PZUB 1J1XL 4X6CB 1XGPA 3FO0L 3OJDA 4U1SA 1BZ9B 3F7QA 4YHKL 3S3PA 5BZWB 4LCUB 3ZHLA 2R1WB 1J0ZA 3JSSA 3OKNB 4GUPA 4L8DB 4P3WA 2XT1B 2E8YA 3MJ7B 4L4VE 4ZXBD 4LLQB 1JGEB 4JO4H 5DK2B 4PB0H 5ESVB 1IEAB 1A7PL 4KK5D 2VLJA 3Q1SH 2W92A 4PRIE 3LKQA 2QQQA 2ATPB 3OAYH 4TVSa 4MD4B 1YMHA 4OAWA 2MCG1 4LSSH 3QIWD 1B2WL 2XACC 2ADJB 3GMMB 2CH8A 5J3HD 4J6RH 1TCRB 3ABZA 5D5MF 2LTQC 4PRIA 1JV5A 3WFCH 2XN9B 4W70A 4JFXB 2OQJA 4PP1C 3OB0H 1MRCH 4NYLB 3IFOA 4RMWA 3KLSA 1F3RB 1NCBL 2ZOKB 2H41A 3QFDA 5T3XE 1ZGLB 1M71B 3OAZH 2NW3A 5I1IH 1AO7D 4W81A 3HI6L 4MNHB 1OF2B 1CTOA 1EA9C 2N7BA 1ZHNB 3SBWA 5AG8A 2I9TB 1FVDB 1FZOB 1ZHKB 3GM0A 1KN4H 1L7TH 2R15A 1H15A 1IQDB 5EIIA 4EIGB 1OARH 1F11A 3L3IB 2HMIC 5I76A 3CH1A 3F65A 5D1QA 4LRNH 5HDOA 1V3MA 3F7YA 4ODUB 5I16A 1MWAH 4YGAB 3LS4H 3BUTA 3FO9B 5KN5A 3BN9D 2NY7H 1KYOK 3RFZC 1N59B 1FNGA 4ELMB 5KSAB 4RA0C 1T1ZA 3QSKB 4J1UA 1BD2E 5GRVL 2HJLA 3GMNA 4L8SB 2EEDA 4XRCB 5FHBL 4JPVL 5KVFL 5IFHL 3HR5B 1NBYA 1WCBB 5HGDB 1MCSA 5IV2B 4M5ZH 1DBKH 4HKBA 3KXFB 4HULB 4XC3H 4LLMA 1G9NC 3MUHL 1C5BL 1FG2A 3DYPA 3P77B 5TQ2L 5HYJD 1NLBH 1FVCB 4MQ7A 1QVOB 1ZTXH 3MFFA 5KTEL 1ORSA 3LEXB 1DDHB 3L6FA 4JVWA 1A1MB 4Y4KA 4UU9A 4Z7VE 2B1HH 2IAMA 3SBWC 1CZ8H 1MSPA 3U0TA 3WXWL 1OWRM 3BXNB 5GSRB 3C2SA 3AAZA 5B39G 5C0CD 1RMFL 2NMSA 3VFVA 4WHTB 5D1QC 3UYRH 4QXUH 3H6JA 1UKSA 2OTUA 1I1RA 4JR9L 3B9DA 3LKPB 2Y5EA 1QFPA 4L3ED 4KVCL 2P48B 3S34H 4M1DL 3FN0H 3T2PA 2O26U 2Q7NA 3ULVL 1DE4B 1YUHA 1N5YH 2EDEA 1MCPH 1GHFL 5J8OA 3O4LB 1X7QA 3BWUC 3REWB 3FT4B 3ZE1E 4H88L 2NCMA 4YDIH 5E8PA 4NZRH 4U1IB 2VC2L 2HA1A 4F8TA 1EPFA 3KR3H 3ARYA 3IDGA 3O2WH 1HQRB 4Y4KC 4DGIH 1P5VA 2IAMC 2DWDB 1WV7T 2D9QB 4JDVA 5B8CB 1A9BB 1WBYA 3CDGA 3L5WA 4ZOEA 3EJZD 1Q94A 3U79A 3WIHA 1ZT1B 2FDBP 1NGXA 3MRPA 2ITCB 3S9DB 2BOCA 2A77L 3M17A 3WHXA 1C8PA 3SKOA 4P3DA 1OOAA 2I24N 3D2UD 2UY6A 4I13B 4S2SA 1NGZB 1A8JH 4QKXB 3BRGC 2VITB 1S5IL 4JFHD 4U2ZA 4JRWA 5I71C 5DJCA 4P2RD 2GSIB 3MLTA 4FQHB 4MVBD 2A6KB 3BZDA 3NFNA 1LDPL 3ZKMD 5MERB 4GJTB 1HDMA 3TFKC 3ULUF 1E4XL 2VDRL 3PWVB 1YEHL 2OMNA 5EFIA 1KJ2B 2IALA 3B3IB 3MODL 4LHJB 5KSAD 3O41A 3LKSB 4ODBD 1TCMA 2DTML 1FO0H 4LBEB 1QFWI 3MR9B 4OBSA 3RVUD 2NZ9C 4CADA 2ZPKL 3T4YB 2XTJE 4JY5L 3PV6A 4GQPH 5E9DB 1NEZA 3QI9D 1MFCH 2D7PA 4HPOH 1WTGT 4XCFH 3X11A 3CFIC 3G5VB 3SDCB 2FO1A 4ZNEE 2V17L 1U8QB 3U36A 4Z7UE 5F9OH 2ICWJ 5IM7A 2R0LL 4LNRA 1HKFA 3QISA 5GZND 5EWIL 4AG4H 5E5MB 4ZUWB 3JWOH 4RAUB 3OKEB 3S3JA 5KSUB 3LQAL 4PB9H 3ZT7A 1AGDB 3RNKB 1KJ3H 2BVPB 2HJFB 4NN6C 4Y4HB 3U9PL 2IBZY 1YEFH 2ICWA 4TVPE 3HB3C 3QUZA 2DRUA 3BO8A 1MLBB 1P4LB 1S7SB 3CSGA 4LHQB 4U1HA 1A6WH 1NGYA 3GJFB 3BSZH 5D70L 4HF5H 3W9DA 2YN3A 3P0VL 5DS8B 1KCSL 5BQ7A 1U3ZA 1MHHA 4KJQC 3EOYG 3AS1A 4X4XB 3FB7A 1G7JA 4OGYH 5C86A 2ZCHH 4Y88A 1T80A 1AHWA 2DMBA 2F54B 4LLVA 2FX8L 2GW5A 3SKNA 4ETQA 3J8F7 4HS6A 3EJJX 5I1DB 4QHUA 1F2XK 4H25B 2OSLB 2D03L 3KPPA 5I66A 2YWYA 4OI8A 2GFBB 4GAFB 4JKMA 2BXZA 4RIRB 3K4AA 4UB0L 5D2NB 3HNVH 4HG4K 5EZJA 1EJ6A 2GITB 2B4CC 2B8OT 5C0RL 1YEKL 1CD9B 1X44A 4WWID 3ROLB 3U9UB 3RU8L 1TETL 1GGIL 3KPQB 2Y07H 3IRPX 4ZO8A 1V8HA 4RMSA 3QUZC 5CWSA 1FCCA 2OTWB 4X6DE 3RWHB 4EUPB 2OP4H 3HMXH 2Y6SC 4GW1B 1MFEH 1OT1A 3JV5A 3GSNB 4OIAA 4Y5XA 4M61A 1IAOA 5JOPE 3ZKXC 5IIEA 1ERNA 5J1AB 1F2QA 4Y2OA 2EIDA 5CJQL 4ZOCA 2YD1A 4Z6AT 5F9WB 4XPTH 4NUGL 3GK8L 3U6RB 1QSEE 1RHFA 1QSZA 1SY6L 2J8UF 1GOHA 2FATH 1DQML 5C92A 1LEGB 3PWNB 1PSKL 1CXIA 3MBXL 4MWFA 5D7JB 4MDJB 3D3VA 4MQSB 1ZS8A 5EBWB 4ODWB 4LFHG 5D1ZA 1AE6L 2DIAA 3FQUA 2ADFL 4Z78B 4JCMA 4D9RD 4PJ5E 4MQXC 5I1AB 1A22B 3WFDH 1NGQH 2PW1B 2NY2D 1JNNL 3K81A 3MLSL 3EO0A 2R4RH 4P4KC 3BMVA 1A7BA 3FQXA 2ED9A 4PJ5A 2OJEA 4IDJH 4Y5XC 4L3CB 5T1LB 4KMQA 3DJ9A 4KKBD 2ORBH 3L7FB 1CICC 4MD0B 2Y36H 2ZG1A 2ERJB 4H0HB 4WFFD 3PP3K 4Y4HD 3G08B 2QSVA 2G75B 5C0AD 2DQIL 2B0SL 4LSPH 4XNYH 4Y4FB 3S96A 3TVMB 1N2RB 3IFPB 5H35B 4GMTH 2B5IB 4DAGH 5ILTH 5DZOA 4CMHC 1MUJB 1VERA 5K9KA 2D3VA 1KB5H 2HT2C 4NNXB 4MHHG 1A14L 3DO7B 4JHAH 3S88L 1KCKA 1BVZA 2EEAA 2E3VA 4LMQE 5D1ZC 1JWSB 4HHAB 3FQNB 2QADD 1XIWB 1RULL 3NIFE 4ODXB 4PRAB 2ITDA 2V7HA 1CD1A 3QZWG 3Q3GA 1KUMA 1PD6A 4MB4A 3CDYA 5F21B 1IAMA 2EC9T 3GMOA 1A6TA 3RWIB 5I30L 1Q72H 5LCVH 2HVKA 1C08A 3PNWB 4FS0A 3HRPA 4MXVE 3C2AH 3RVWC 3ARED 3HI1A 2ADGB 2MPAL 1G0YR 4RGOH 3VFPA 3QWRD 3K2MC 5DD5L 5C0BB 2UZIL 4Z8FL 4BQ9A 2DYPD 2GTWA 3DMMA 2O5YH 3IS0X 3SDXA 2LV4A 3X13A 3GHBH 4P9HH 5DVKA 2EC9U 3MGAA 3BPCA 2X4TA 5DRWB 3DX8B 4MNQE 3V6OC 4UAOB 1HSAB 2EDWA 4FZEL 3NPZB 1WK0A 4K23L 1JPGA 2KUTA 3NGBB 2Z31B 2VXQH 1RHHB 1FLRH 3CX5J 1JHLL 4KTYA 4P48A 5DJAA 5C2BH 1V3KA 3OJ2C 3UTQA 3V8OA 4WI6A 2DJ4A 5HDBE 4M43L 3U7AA 1MH5A 4HWBH 3HTLX 4I18A 2JKXA 3F58L 3HC3L 3BQUD 3CLFL 4WRLA 1K3IA 4D9QE 4JG0H 1FIGH 4B50A 1A7RH 1F13A 1TJHH 2HG5A 1CK0H 3U46A 4NZTH 2MQ3A 3BVNA 3GMLA 1CLOH 3ALPA 5TFSH 2I60L 1FIEA 3DMMC 2DM4A 4GKZB 4HKXB 3OL2A 1MCLA 3UO1H 3L1OH 5DRZA 1HYSD 4Z0BH 4WTWA 1FNEB 4LHUB 1BHGA 1N0XL 1MRCL 3WIFB 4YO0A 3FMGL 3V0VB 4L5FL 1K85A 4PJBA 3G6JE 2BRRL 4MXWL 5I75B 2YUVA 3RHWF 4EUPH 5IT2H 1DN0B 2BVQA 4M8VA 2VDLH 2DL2A 1A1NA 4I18C 5EU3A 4LOUC 3WO4C 3O6FC 2DTSA 3IGAB 4TPRL 1L7TL 4ZSOB 5L88L 3WKNA 2R2EB 4X80H 3BIKA 2EDHA 4X6EB 1PEWA 1XIWD 3UJTH 5FKPA 2AK4E 8CGTA 2VXUL 3MMEA 2CDFB 4NQCE 2HYMA 2D7OA 2ZUQC 2NY7L 3VDBA 1RU9H 1J5OH 3FTGB 4PJ9A 3UBXI 4XPAL 1CGVA 4CDGC 2X4PB 3HS0B 1WZLA 1JF6A 3V4UL 5HY9B 4WFEE 3MXVL 4V2CB 3RWEA 5KVEL 2VDNH 4JGUA 4KTDL 4M5ZL 1CFQB 4LVHC 1H8OA 2WINA 1QO3B 3Q48A 1TQBC 1P53A 5C0BD 3OV6A 1MJ7L 1LWRA 3SKMA 1JYVA 3ARFB 3VGAC 4DZ8A 5D7KD 3DI2B 1EMTH 1E4WL 5BJTA 3IB4A 4L9LA 3KNBB 1CZ8L 2H26B 4OF3A 4QHLB 1F4XH 3VRIB 1R5IB 4JN2B 4C59B 4MX7B 2Z31D 4NRYB 2IFGA 1K5NB 1T0NB 2Z92B 2BZDA 4QGYA 3MTRA 1MHCB 2YZ1A 5D1XB 3F62A 2W60B 4QXUL 3GEWB 3SPVB 4Q6YA 4FXGA 2R29H 5E99L 4E41E 2DJUA 5CUSH 4JFFE 5CP7A 4LCCB 3MLZL 1P7HL 1HI6B 5BV7L 2YA2A 1W0VA 4HUKB 4PJ9C 4UBDD 1IGML 3FN0L 5TDNB 1FGNL 3TNMB 1SEQH 3R4DA 1Z3GH 4JFFA 3V0WL 4YDIL 4HZAA 4NUJB 4NZRL 3RPIB 3PL6A 1KF9B 4HGWB 5GJTH 3V6ZA 8FABA 4JHWH 4XP6L 1J8KA 4Q0XH 4LSDA 2YK1L 1C16A 4CAGA 1J86A 1KACB 2X1PA 5IBLD 2FO4A 4WFHE 4L9LC 5FM5O 5E5UB 1YPZF 4KVNL 4PJIF 1QPXA 2PXYD 4UUJB 1VGEH 1LNUA 5EOCH 4ZFFB 2H9GA 2WM0A 2ZCLH 4OD2A 4GSDL 3VXNB 2D9CA 4IIQA 1RVFL 2PR4L 2W59A 4PY7B 3VFGH 4JFYB 2FLBT 2VLRA 1R6VA 1NGPL 2EIEA 2YEZA 2WBJA 4F2MA 3QNXA 1T6WA 4HIHB 1GZPA 4OFPA 4WWKD 3BW9A 3BGAA 3F7PC 1UCBL 5EPMA 4ODVL 4CJ0A 3H42L 1E4XI 3SE4A 4WUUD 5DC4B 4TULH 2F5BH 3BKYL 3MRRB 4JVPA 4YAQB 5D2LE 3T2NH 4DN4H 3UJIL 2X4OB 3TCXA 1FLTX 3PL6C 3TT3L 1QRND 3BPLB 1Q0XL 3MBEA 1YN7A 1OTSC 2Z0BA 1KN2L 3X14A 2GK0B 4Y19A 2AI0H 1CDBA 3CVIH 3OGCA 5D2LA 5DTFA 4MXQC 2BNUB 4LCWE 3TCLB 3O3BB 3T0VA 4Z7WF 3BH8B 3D9AL 4XXCA 4G42B 2FYYB 1S7WA 2VSDA 5C8JA 1B4JL 35C8H 5GRJL 3F12A 3VXRE 4XCFL 4JKPL 1N5AA 3OXRA 5ANMA 4HWEL 1RURH 4LCWA 1WT5C 5BZDB 1YY8A 1DSFL 5JW3H 3GSXB 5F9OL 4Z7UB 2CUIA 4OCLC 4O58H 1AY1H 3MRMA 3BZ4B 2FZ3B 2YUWA 3VXRA 2EH8H 3T1WA 4ZQKA 1E4KC 1P1ZA 3BKJH 4YIQB 5D1XD 3UC0L 5SWSA 2DMKA 4NO0A 4WHDA 2D7TL 3TO4A 5IW6A 1JUFB 3LS5H 2XWTB 1EGJH 1QBBA 5JOFA 1BBJB 2GJZB 4APQA 3MBEC 3VXMD 5DMYA 3EUUA 3BE1L 1YEFL 4G8FA 4BH8A 3RZWA 1D6EA 2FJFA 5E2WH 3CFBA 3ELAT 2BY2A 4JN1H 1ZAGA 1F8TL 5T1DH 3BSZL 5B38A 1GSMA 2YBRA 2Q8BH 1ES0B 3WS3B 3NCMA 1OP9A 4GRWE 4JKKA 5DQ9B 2HFEA 2YSSA 4POUB 4KMTL 2NXYB 3Q6GH 4HXAH 4EBQH 4JLRA 5GGSY 1F00I 1XAUA 3T09A 2NY3C 1KJVB 1HXMB 2BJMH 1Q8MA 4PJDA 1JNHB 5SX5K 5JW4N 1R3KB 5IJKA 2X4SB 5EO1A 2QQLH 3MRIB 4K7PL 2NR6C 5GGVL 5C6TH 5EO9A 1RZKH 4HIXL 4QOKE 4XPFH 3TO4C 3TNNA 1SYSA 5J13B 4WUKH 3QHZH 1U93B 4PRHD 1RJLA 5CJOH 2VXVH 2JCCF 2Y07L 1GAFH 3HE7A 4MCZA 1JWUB 1T03L 1RK0A 1SJEA 1RZ7H 2NX5A 3CMOH 3BP4A 4JG1L 3BN3B 2BVTA 1YN6B 4OZFA 5BCAA 1MFEL 3HG1E 3QEQA 4Q58C 4X6FB 1MJUL 2XZAH 5FCUL 4YBHA 4PJXF 2BSSA 4UILL 4JAMA 3L3JB 3A0OA 2B2XH 1T3FA 1CDYA 3DV6A 3I6KB 4HK0B 3QXAA 1QSEB 2P8PB 5IB1A 5D72H 2FATL 4HJGA 4EDXB 2I9LB 3IRZA 1EJOH 1WVZA 3TO2B 4GS7B 5IJKC 2P5EA 4KGJA 4DKEH 1CLCA 4F7MA 3RIFK 5GGUA 4KY1H 1JNLH 4E0RA 4R26L 4XCNB 4TNVK 2CD0A 1GC1L 3HRZA 3QCTH 3T3PE 4HC1A 5CSZA 4EI6A 1KIRA 4PTUA 3WFDL 5J11C 3B2VH 3HE7C 3VXUA 1N6QH 5JO5A 5B21A 1TVBA 3MZGB 1S9KC 2R4RL 4PY8J 4KROB 4Q9QL 2Q7YA 5ISZE 1NL0H 4X7FC 5I8OL 1AR1C 4LKXB 1VACA 5SX4I 2HJKB 2FWOB 2Y36L 5FYJD 3ECBB 4NBZB 3ZE2F 3MLPA 4HJJL 2O61A 3ULVF 4JM2D 4KTEH 4GMTL 3I6LE 4DAGL 3DTXB 4G6KL 1UM5H 1TQCB 5IG7A 5DJYA 1N4XL 1KJ2L 1IGCH 1U8NA 5TQ0H 4PJCE 2OL3H 2UZYB 3MRGB 3P9WB 4RAVA 1F5WA 1G7QA 5KS9F 4M8QA 3ZTJG 2VDOH 3HA0A 5JIKA 4XPHL 3NFSL 3MV9A 4YFLI 5F7FA 1KEGH 3DOSA 5AYUL 2CKBA 4MA1C 1NCWH 2BMKB 3VI4F 4KFZC 5DJDB 4NQXA 2J88L 4P9ML 5INDB 2X42A 5IROA 3QNYB 4JQIH 2V2WA 5EU7E 1QPPA 4IOIA 1ND0A 3AS3A 4LP5A 4PGBB 5HHOD 4YEFA 1NAMB 4KGLA 2CRMA 4NN7B 4R97C 3X3GH 4G8IB 1C7SA 1JN6B 3O0RL 1LK3H 2E9JA 2DKUA 3SDDA 4RAHA 5HYEA 3GSUB 2VLME 2E7HA 5FYJH 4MNQB 5IJVA 3NPSC 4P5KA 5E8NA 4F8QA 1DLHA 2VXQL 1OTTD 1FLRL 3CPLA 1KELL 4M48H 1CWVA 2WZPD 4RSVA 1FBIL 5DA4A 5C0IB 5EC2A 2X9XA 3KPNA 3LDBB 2VIRA 3O3AB 3W11D 3KS0H 5D7IF 4OFKA 4HCRA 43C9B 3TZVD 5H94B 3BPNB 1OAZH 1HE7A 4ODHL 2YC1A 3MNWA 5HI3C 5BW7A 5JPNA 4I9WD 1RQ5A 4YK4C 4OF8A 1UYWL 3PHSA 4D0DB 1UQSA 4TSBL 4P49A 3X12A 2UUDK 4NSKA 1BOGA 2F15A 4PTTA 3CVHH 2MTPA 4LLUB 3I75B 3MJ9H 3E6HA 4FQ2L 4UQ2A 5D5MA 4P2OD 3GI8H 1CFTB 5HHPB 1HEZB 5CD3A 3VD9A 1T4KA 3WFBL 5IHUH 2G5BB 4GBXC 4NCC2 1V3LA 4IMKA 1HH9B 4GAJH 4QTHB 1IE5A 2H2SD 2FH6A 5JW5A 1DANU 1GPOL 3FRUA 3H9SE 4E42B 4LKCA 1YEDB 1ETZA 1ZT7A 5IESH 3G6JB 1CLYH 5I18H 3U7YH 1HOCB 2HLFC 3QDJE 1AI1H 5JW4M 4U1KB 2EO1A 3V5HB 4HIEB 3GSNL 3UPRB 1IRAY 5F7UA 3C6SB 5BW7C 1ZOXA 3R8QA 5LKNA 5GZOC 2F8VA 3M1BA 3QXWA 1YEIL 4RWYH 1K4CA 3IU4L 3ULSA 1OY3B 3IFLL 4DK6A 1CGUA 2AK4B 4QTIH 3C60D 4PJHF 4NQCB 1CFNB 1J5OL 4WO4D 2YD6A 4MB5A 1S9XB 4K9EC 2OR8A 4PRNB 4U1GB 3QEHB 4IMKC 5LQBH 1IJ9A 4EVNA 2DLEA 1HILB 1QEWA 2SEBA 4GG6F 4F7TA 1LMKA 3SJVA 3A6BH 5JZ7D 4NO2A 1UB6A 5CLTA 5JMRA 3VMNA 4HFUL 4FNLL 4L29A 5F1SA 5T1KB 5GGTH 4XAKD 2BNQD 3UYPA 5IB3A 5IHBA 4JJ5A 3CC5A 5I74C 1T0MA 2QSTA 3E0GA 5DJ6B 4WNQA 4N5EC 3TA3A 5BS0B 1YYLL 4FQXC 3WUWB 4MAYD 4XCYB 1YDPA 3LEYL 5E4EB 1IEBA 1CDHA 2HWZL 1OP5K 2OLDA 1IBGL 2BHZA 3GSWB 2NQCA 5CEZE 1S8DA 2R29L 3LD8C 3VFMA 4OCSL 5GIRB 1A4KB 5C09A 1IAIH 4P5MB 1MNUL 3GHEH 5DHYB 5ICYB 4EI5B 5F1IB 1Z3GL 3DRTB 1QHOA 2MWCA 3QDHA 2IC2A 2AGJH 3CJJA 1T1YB 3DGGB 4LLWA 5BXFA 4G3YL 3SEPA 5DRXB 1UXSA 1W72A 4FOMA 2ZSWA 4NNPH 1EIBA 4I2XE 3C8DA 5BRZE 3TA3C 1Y18A 6CGTA 3HZKB 1QBLH 1WZMA 1T7XA 1VGEL 1IM3B 3UMTA 4B41A 2NLJA 3OR6B 1ZE3C 5A1AA 1EERB 1MHEA 4AK1A 2QQNL 1K4DA 1OSPH 1WBZA 2CPCA 4YC2B 1CT8A 5BRZA 4LSTH 2EYRA 3H0TB 4ONOA 1NSNH 2MOVA 2CIIB 1OVZA 3O6KH 5EO0A 3T65B 3BJLA 4O9HH 3MX0A 3N9GH 4ZMAT 1S9VA 4HS3A 3WN5B 3KDMB 3T2OA 3WFHB 3MUZ1 3MYJB 1XF3A 2HKFH 1H0DB 3IAQA 2BFVL 3P4MB 2F5BL 3G5XA 3SDAD 4G6MH 3FO2B 4RFNC 2QR0A 3T2NL 4DN4L 1YNTA 5EB9A 3QWOA 4FQIH 5E00B 2N1KA 1A6AA 3TV3H 3H9HB 3QUXB 1YNKH 2R0KL 4JO2H 4JFOA 4XP1L 2IMNA 4FTVA 4YFLF 3MRKB 1LO0H 4LK4A 4HFWB 3LRSA 5IBUB 2AK1L 3O11B 1NBQA 4QRPE 4R3SA 4XPGH 3TBYA 1S78C 4ZXBC 1RZFH 5D93C 4NZUH 4M4RA 5BVPH 4OQTL 3RL1B 1EAPA 2B20A 4ZFOB 4M7LH 4HH9B 1A3LH 4PREB 2ICCA 5FYKD 2P42B 1RURL 3FL7A 3LSOB 5BS0D 4J3SA 3N1FC 1P7KA 5CEYB 5LXGH 1DFBL 1NJ9A 1J1PH 3FOMB 3JUYA 5GISH 5T3XL 4POZD 5J3HC 1N8ZB 4XZUA 1JF1B 1JYXA 3ULUC 3T3MF 1MCKA 1Z9LA 4M6NH 3GMQB 4Y16B 1J05A 4XBGA 1YMMA 4U7KA 2N4IA 1FNFA 2EDKA 2VNCA 3BD4A 1NFDF 4PG2A 2VL5B 1T2QH 1U95B 1L9NA 3PDOA 2DBJA 4FXLA 1IL1A 2VH5H 3PE9A 3T4AB 4OD3H 3VJ6B 4OB5H 4MJ5B 4NQVA 2C7UA 1KULA 1B90A 5DFVC 3ZE0E 3B5GA 1R3IH 1OCWH 1T5WA 4F33A 2BK8A 3IDNA 3AB0B 3Q6GL 4NM8L 3EAKA 2BJML 3SGDH 3BN9C 3DRQA 3B8YA 4PP2B 3GSQA 2V5TA 1S9WA 1KG0B 4PRPA 2PTVA 2QQLL 4PLOB 1A64A 5FYKH 2X4RB 4JM4H 1OAUH 4QOKB 1NH6A 5I8EA 3FONA 4WUKL 1CFSA 4P46B 3QUMH 4XAWH 5HHVL 2LFGA 2VXVL 2VE6B 1AIFA 4PG2C 1A5FH 1RZ7L 2J8UE 4WDIB 5E56A 3O45B 4EZMA 4D0CB 5H2BA 2LAAA 3I02B 4OCXL 1D3CA 3RUGF 3TBVA 4BZ2L 3HG1B 3WD5H 5DEFB 3JV4B 3HUJE 1F02I 4OM1H 4NQDE 1C1EH 5ELIA 5FO8A 4WJ5A 2YD7A 3LPFA 1BFOA 2B2XL 1HHIA 3HC4H 1NCTA 5D7LD 1BFTA 5IB4A 5JHDD 4H0IA 3QPQD 5T3ZD 1IGFL 3O8XB 4X5WA 4M9OA 2C26A 4NQDA 1HSBA 3T0EA 1EJOL 5LGKA 3CLEL 3N1GC 4DKEL 4IRJC 3PIQA 3U4AA 5M7QA 4CNIB 4I4WA 3B4NA 4FHBD 1D5MA 4LAQH 3IETA 4XCCH 1ZANH 2ATKB 1WITA 2X4QA 4OZHB 2FSEB 4ONFH 2BHYA 3RVXD 1I3GH 1HHGB 2VDMH 4OUOA 3QXTA 5F88B 3HNSL 4ONHB 3I6GA 4XCEB 4Y16D 5ISZB 4NKOB 1IC5H 2AJZB 5GGSB 1U8MA 1Y0LB 1BJ1H 2R0ZH 1G6RA 2PYEA 1VFUA 3MGOA 2AV1B 4M93C 3UTSD 4M7ZC 3VH8A 4Z0XB 2XZCH 5TPWL 4L8BB 3UZEA 3HE6A 2CKNA 5DSCB 1UM5L 1TTFA 1TZGL 4RMTA 2X2YA 1IGCL 4LLYB 5HVWA 4ZFZB 4PJCB 1FYTE 2IFFH 3DBXA 4MVBC 4OFVA 3B9VA 4EN3A 5T3ZH 2EYTA 1WAAF 4FQJL 4U6XB 1FH5L 1MRFH 3RGHA 1RPQA 3OR7B 1JHKH 2XQYG 2APVA 4YHPA 3B43A 1CYGA 3ARGB 3JV0A 1RUML 2C3XA 3LOWA 2QSCH 3CZFA 1KPRA 5C07E 5AZEL 1A4JB 2RAMA 3LB6C 2DQJH 3PQYD 4WI4A 3F5WB 1OL0A 3CNKA 1CU4L 4P46D 4PGEB 4L4JA 4R4FL 4GRLA 2IGFL 1YC8A 3OJMB 3KPRA 3QI9C 1NCCH 1H3UA 5CJ8A 4X6CF 4ELKB 5KVGL 4ENEC 3HE6C 1U3HA 3ILQD 2ENYA 2XZQL 5MI0C 1CR9L 3MREB 5CGYC 3DUSA 4ZTOH 1A3RL 4Z7NE 4O5LH 1UA6L 5IMKB 3KYNB 3MV7A 5E6IA 5I1CH 5K9JH 1EDQA 3F7RA 3AXLB 5GZNC 2GAZA 4QF1A 1S7UB 2W0FB 3VXTA 3VE0B 3VD7A 5IKCA 5HYSA 1MFDH 4KZDH 4WGVB 4UT9L 2NY4D 5J6HA 4R2GB 4ZS6C 3GRWL 5L8LB 1ZA6B 4RX4D 3RWGB 3S3SA 3IDYB 1Y6NR 1S7VB 3MJ9L 4H8WL 4K8RC 5IVNA 3RI5K 2VKXA 3GI8L 5FV1L 5KZCD 1J8HA 5GS1B 5JTWA 4GRLC 4LARL 1C5CH 1I3RA 3O4OB 4PGDA 1JIBA 1U3HC 1N6VA 3EYUL 4ZUUB 4OZIE 1QKZL 1UM4L 4HBCL 1A7OH 2G9HB 4RRPG 1CLYL 1BQHB 1FL3A 3ME0A 1T21A 2ID5A 4PS4L 1T22A 1S5HB 2A9ML 2JIXD 5F9DC 1DP0A 2EKSB 3G6AB 3PWLA 4ELMF 4RQQB 3OZ9L 3TT1L 1MIEL 1DLFL 1T7VA 2WBKA 3QDME 4V1DA 3WE6B 3V6OE 1T2XA 1KLGB 4KUCD 1JCKA 1T04A 3QA3B 2XPGA 2X4NA 3RY6A 5JR1L 1HNGA 3DXAA 5E8OB 5GGQH 4XXDB 3ZT5A 4D2NA 3S8WA 1RZJH 4WI2A 1BM3L 4K3DL 4LPTA 3ARGD 5LQBL 4G43B 1I8LC 3L3HA 5FKAB 4QEGA 3A6BL 2VMFA 4NRXA 3IDMB 4XNUL 2J6EH 3U30B 3ARDB 4Y7MA 1FL6B 4BQ8A 3CFEA 5HGGS 2BVOB 4AIZB 1BLNA 1T2JA 2B39A 3QIUA 4JFDE 4W6YB 2GT9A 1XF4B 2KBGA 3IXAA 4X6BB 2WIMA 1UXWB 4KJPC 1OGAB 2UV3A 4WW2B 1AD9A 4KI5D 3EO1B 4XWOD 4JFPA 5KSVB 3M45A 2Y7QB 2KZWA 3PWJB 1CDGA 2NY2C 3MLXL 4NO5B 4KMLB 5ACLA 3QUYD 2JJTA 2E27L 1LE9A 2LTQB 3ZHKA 1NANH 5ECJE 1UGNA 4MZ3A 5ICZA 4EKXA 4N1HB 1P7QA 3RWDB 4OLVL 2DI8A 32C2B 1EAJA 4KKBC 3GHEL 1XGPB 2CUMA 3NAAL 2R8SH 2QKIA 1RV6X 1I7UB 5CP3A 3TH3T 4I1NB 2GY7B 3QEGL 4GLRH 3MUY1 25C8H 3LQZB 5E8EA 1OAXH 4OIBA 4OT1L 2BSRA 4WU5B 5DYOA 4BFBD 1YPZA 4PJIA 5EU5A 1EHLL 1I1CA 2YZ8A 4PJ8A 3QIUC 3RIAF 1WTLA 3LN4A 3MRHA 4PYGA 3VA6A 1JNJA 2P5WA 1YMHB 5DA0B 5HGHA 4WU7A 4FQ1H 1DL7L 1NAML 2FNBA 2VLKE 3IAPA 4MJ6A 1OSPL 3IFNL 1ZSDA 1JV5B 3JWDL 3NIDF 3L7EA 5EBLA 4Z5RB 4LSTL 1G7LB 4N8VB 3AREC 3IFOB 2J8HA 5HI4D 3VRLE 3KJ4C 3CU1A 5GPRA 5FDWA 5IQ9B 3LKRA 2VLKA 4O00A 3UEZA 2HTKC 4JANB 4NQTA 2OZ4L 4HKJA 3U4EA 1JK8A 3RVVC 3RL2A 4UV7L 3TN0A 2H32H 3PABB 3ROOA 5FO9B 1AQKL 4Z7WE 4AMKH 2FL5B 1H15B 5EIIB 4FQIL 4UDTB 2BX5A 1J87A 4MJID 4FQLL 3TV3L 5C7XH 5ALCH 1GZQB 4PJ8C 1YNKL 5I16B 4JO2L 4RCAA 2BXYA 2MFNA 3D85A 1OLZA 1YECL 3KJ6L 2GI7A 1FNHA 2AXHA 4Z7WA 3WSQL 3W0WD 3DHMA 3PP3H 1U8KA 3QFJD 3RWFB 1FNGB 3EFFB 4OGZA 5ERWA 4OLZH 4UIMB 3BQUC 4DQOL 5JHLH 1EEUA 1YNLH 2HJLB 5L9DH 2DQUL 5DD0L 5BVPL 1NBYB 4G7VL 1YQVL 5IEKB 1S7QB 1QSFE 3GJEA 4P2QE 4M7LL 4HH8A 5KOMC 1OGAD 5MEQA 4QXGL 5FOJA 3VGGA 3ARQA 1SHMA 4MQ7B 1LD9B 3CFJA 3M8OH 3MFFB 5IMOA 4J3WA 2P8LA 2VN4A 2Z4QA 4A2MA 5IF0A 2F5AH 3NVQA 4TTDC 4G8GE 1FL5B 2Z91B 4LLAA 3FB5A 1HYRC 3TN0C 1Q1JH 3UTPE 2IAMB 2VWEC 4ZUVB 1GYAA 2A74B 2FGWL 4FFZL 3WNKA 3UJJH 5AWNH 1OAKL 4P23C 4YHIA 3AAZB 4N90E 2CDGA 2YD5A 4BFIB 2CLRA 4NKDA 4EOWH 1N26A 1QR4A 3VXOA 3BGMB 1C12B 2V2XA 5TE4L 4OD3L 5KOVC 1QP1A 4OB5L 4AQOA 4LVEA 4J8RA 1KIPB 2C4XA 2AABL 3ARPA 4UOW0 2YPLA 3BH9A 3HHRB 4JFEE 4AQ1B 1OCWL 2VLJD 2HMID 3N1MC 5I71B 1U6AH 5AZ2H 2FEEI 3RY5A 4WV1C 2FX7H 4WY7L 5BVJB 2GSGA 3D5OF 4JFEA 3UTTE 2YUXA 5FXCH 3A6CH 5DJ8B 2AJ3B 4DVRL 1X4YA 4PRID 1FE8L 3MA9H 2R23A 3KWWA 3R06A 4LLDB 4PJXE 1WC7A 1OAUL 2JCCA 1WBYB 3G6DL 5IFAH 5CILH 3L5WB 5CBEB 5CMAA 4X99A 1Q94B 4P5TA 3NACH 4XP9L 1FZJA 1NDGB 4YPGB 2X40A 4H26A 4UV4L 2YUZA 3PGDA 2D7MA 1FCGA 5B3NA 4QRRE 1V7NL 2YHGA 4S1QH 3WHE1 4MD5B 4FZ8L 3WD5L 2ESVE 4S2SB 4ZUTA 3EOTH 3LRGA 3H7LA 3HUJB 1VFBA 3KPSA 4LVOB 5D1QD 1XZ0A 5DJCB 2AXFA 2YRZA 3UBXA 1C5DB 1EBPA 1HDMB 2ESVA 5DC9B 4ZO6A 5LGJB 1GOGA 4UBDC 1X6LA 3D18A 1T7WA 3MA7A 3D69A 1CG9B 3DX6A 4HJ0D 5F7HA 3T1FB 5JNYB 1PLGH 2XWJB 1ZXQA 4LAQL 3DIFA 4NCDA 4P5TC 1AXIB 2BOBA 3KPOB 2L7UA 4C56E 4M7LT 3BKMH 3D39E 3SE8H 3ULVE 4ALAH 4M62H 2BSTA 2F8OA 1XCQB 4Y4KD 1LP9E 1A9EA 2FR4B 2W0PA 2IAMD 2R4SL 3BEWB 4U0RB 1MFBH 2VB5A 4Q74A 5TF1L 4BKLA 2VZVA 3N06B 4L4TA 1R24A 2ZOLB 2Z35B 4D94A 4HBQA 1CFBA 1KCUH 2R0ZL 1R5VA 3W39B 4P2CG 1A2YA 1IQWH 1XGQB 4YXKL 1LGVA 1PQZA 2BHUA 4XNXH 1U2HA 3PHOA 2A0LD 3RY4A 5HPOA 5F7WC 3VI4E 3EGSA 3TP4A 4DKFL 1BAFH 4CKVX 5KS9A 4F7CB 3EYSH 3C5SA 5GS0D 4MJ2A 2ICWB 3IDIA 4I5BA 4M1CC 1Z5LB 3QUZB 4N0UE 3STLA 3IXTB 2L4OA 2IFFL 4I3GA 2PO6A 4OV5A 1NCAL 2P7TA 3VFRB 3W9DB 1N64L 3KPLA 1QQDA 4WI3A 3CFDB 3VRJB 3ZKXB 1RUQH 1DBMH 3FQTA 1MF2L 2DQEL 3DROA 2DBLL 5L2JA 2GYSA 4ZFOL 1JGVH 1QLFA 4KAQH 1UWGL 5C07B 1EUTA 5ITBH 1UZ8A 4QHUB 2NZ9D 5IEHB 3KPPB 4DZBB 4OF6A 4XVTH 5IW1A 5ADPH 5KW9L 4K3JH 4I0CC 4K7PX 3S4SB 3MUGA 5EZJB 5C71A 2VL4A 5DDHB 5B22A 1RZKC 3A67H 3DVNA 2F53E 5CCKH 3DUUA 1BPVA 5J06A 1L6ZA 2X1OA 4OKVB 5D7IA 4O5LL 1RZ8B 1K8IB 3K80A 5FB8A 3HNTH 3KYMA 3S37L 4P4KB 1YJDH 2PO6C 2R1XB 1N3NB 3B8SA 4D0BA 5C0EA 1PYWA 2F53A 1QNZH 4M61B 4Y5XB 1JWMA 5IIEB 1CGWA 5GS0H 1FORL 4BSWB 3VXSE 1CICB 3EDJA 4GW5A 3NH7H 4YQXH 3QIBA 1IGJB 3HB3D 4HZLA 4X0KA 3EW3B 1NMAL 2FBJH 1T20B 3THMH 2RB8A 3BZEA 4ZS7H 1P84K 4OCYL 3TIDB 3D3VB 5K9QI 3G5ZB 4KJQD 4Y5VA 1IFHH 1B0RB 3TIEA 3MRFA 2RR3A 1VSCA 3JTSB 1JZ3A 3RKPA 3ARSA 2DQFB 3MV8B 2RCSH 5C08E 3WIHH 3R0MA 2OMBA 1AR2A 3EYFA 2VZ3A 3KYOB 2C5DC 4S1RL 4X98A 2IH1A 1K6QL 5MEPB 4Q6IA 2ZKHH 2YMXH 3HAEA 4XPBL 5IMLA 1H3PL 3P9MA 4R96B 1OD9A 1ZKAA 4RGNC 1MCOH 4M6OH 4ORZC 3E2HB 3QIBC 4GG6E 1R3LB 1HKLL 5FF6B 4KJYA 3WLWC 1AKJA 3QUZD 4KHXL 3ILPB 4PJHA 3VFTA 2Y6SD 6FABL 4Z76B 3K2UH 3VFUB 5K9KB 3G5YA 5GS3A 4F3FB 4GG6A 1KC5L 3Q0HA 4Y5VC 4CVXB 4TVPD 3RHWK 1JRHH 4NM4H 1LK2A 4L3AA 4R7NB 4HIJB 1HHJB 3QG6A 4Y1AA 1CD1B 2ZUTA 3QNZA 1XGTA 3LQAC 3B9AA 3O3EA 4HIIA 1A6TB 1LO2H 4M1GL 1GIGH 4Q6IC 2HN7A 3MLUL 2VDPL 3GZKA 4JFDB 3HI1B 2BERA 1KJMA 1VADA 4FABH 5HDQH 3DLQR 1F3DJ 4YHNA 1CE6B 3RTQB 2NY1D 4GQ9L 4B0MM 43CAA 3H8NA 5SX5H 1XH3B 1HINL 3X13B 5EU6E 4JKLA 3BPCB 2B4CH 1SY6A 3RWCA 1QUNA 3CFCH 3P2TA 5EZOL 4ZTPL 2XIDA 3PP4L 3ESUF 5J89A 1IM9A 3L3DB 1NCUA 5MENE 2LVEA 1QOKA 5DJAB 3RJQB 2R8SL 3E8UL 5J6GA 4PRDA 3V5KB 5C0JB 3R1GL 4HMCA 4YBLC 4HDIB 4JM2C 3ZMRA 3IVKA 3O6FB 1WFNA 1P6FA 4MNGA 1OAXL 2HT2D 4TVPH 1Q9WB 3L3OA 3U2SA 3FCTB 3D3VD 5F7DA 2JELH 3Q2CA 5D1ZD 4XHJC 4JRYE 5I8CB 1ZLSL 3WIIL 2XRAL 5T1MB 1KGCE 3MV8D 3FKUS 4IJ3C 2IANA 1QLEL 1NAKH 1BVLA 2AEQL 4H0GA 4NKIL 5IVZB 1NFKA 2NY5H 4IHOB 1J0YA 2W07A 5DRZB 5IQ7H 1E27A 4LCIH 2V2TA 3RVWD 4PJ5D 4YO0B 4LVHB 5DMIL 5FOBB 1CGSH 2BNRA 2A9NL 2CR6A 2Q6WA 4I0PA 1JF5A 5L2KB 1JZ7A 2Y1VA 2BVQB 2AJUH 1BF8A 1VFAB 4LRIA 3U83A 3EOAB 2AXGA 4ZDHA 5B3JF 3ARWA 3HFMH 5CKGA 4BYHA 4RMRA 4YE4H 3BIKB 1JTPA 1OTTC 5C7XL 4X8JA 4M00A 1UEYA 2XI9A 3W11C 1D5BA 1FNLA 2FLRT 2X9YA 3AS2A 5T5NG 3W9EA 3TZVC 3IJSA 4KDTC 4BZYA 4D3CL 1D5XB 3T3ME 2IQ9L 5JHLL 1E6OH 2QTEA 4D8PA 5D6CA 3QCUH 1NUNB 4Z7UF 2YOCA 1Q9KB 3T8XB 4QHMB 5I1HL 3PGFH 2P24A 4P2QB 2VABB 3EHBD 4H20H 4HS8H 1PW3A 4RZCB 2MMXA 1VPOH 1QLRA 1TTGA 1GGCL 1XF1A 2APWA 3RWJA 1F90H 4NO3B 2V7NA 4OLXL 3SE9L 3DMMD 4G9FE 4DZ8B 3NCEB 3KPMA 5KSBE 5J56B 4G8GB 1YYMH 4L9LB 1Q1JL 4LRIC 4HUVA 2L0DA 4MYWB 4OZ4B 3UJJL 1CIDA 1NFDA 4NOFA 4RRPA 4O51A 3K8MA 3PDDA 1EEYB 1R5WB 4N0FA 4NWTH 1G7MA 5F96H 1BX2B 4PUBL 5GSVA 4LEOB 3AVEA 1I9IL 3CFKB 1NCDH 4HUUA 5ADOH 4LOUD 2V5MA 3O6FD 2G2RB 1DBAH 3UROR 4TQEH 3TESA 4BSVB 1DVFB 1WBXA 1FFRA 1IILE 3RDTA 4JRXA 3D0VB 1U6AL 3RZCA 1IGIH 2FX7L 2DKMA 5LVEA 3PL6B 1AFVH 3IF1A 5DK0B 3C60C 5DWUH 4WO4C 4ZFGH 3FFCA 1C16B 4GMSL 3UTTB 3A6CL 3EYVA 3LCYA 4GRMA 4AH2B 3QJHA 2A73A 2FO4B 3FT2B 1I1YB 1H5BC 1UACH 3MA9L 3O2DL 3RX8A 1R0AH 2JE8A 5JZ7C 2GJ6A 4G9DA 1EEQA 2C3GA 4YX2H 3T77B 2H9GB 2W9LA 2UUDH 4OD2B 1A02N 4CN6A 3OPZH 2OS7A 1AGCA 4UI2A 5I0ZA 1OPGL 2VXSL 3RUGA 4DGVL 2GCYB 2IPKA 3QDGE 3P4NA 4KXZH 3QNXB 3BIAX 1OW0A 3B5HA 3WDIA 5SWZA 4QRRB 5F3HA 3BW9B 3QT2A 1ROWA 5FDYA 4AL8H 3TYFB 2DD8L 5DJ2A 1AGBB 3RDTC 4U6YB 2IADB 4F9LC 5C1MB 3QDGA 3QXDA 1AGFA 4OTXL 4JCLA 4H1LA 4NGHL 1KENH 4X7SH 4PJ9D 3MBEB 1YN7B 5JMOC 1AO7E 3BWAA 4R8WL 4Y19B 1KPVB 2YPVH 5IK3A 3KVQA 3PHQA 1FAIH 5HHNA 3CCHA 3QQ9C 2AV7A 4NJAL 5C0FB 1AO7A 1EV2E 4ZD3H 3NZHH 1L4IA 2Y5TB 4C56B 3D39B 4XWGH 4M62L 5GRVK 1OW0C 1LP9B 2NY3B 5T5FL 1G9NL 1YY8B 4WCYH 4LSVH 1MFBL 5JXAL 1NGWA 1CVRA 4KI1A 4IRZH 2WNGA 1KCUL 1CXEA 2AKRA 4U7MA 4QT5A 1IQWL 3WDHA 1RUPL 3VWKB 1WAAE 2YR3A 4Q9RH 1VA9A 5IW6B 4R90H 1UWEH 3VG0H 3FQWA 2UYLA 1I7ZB 2Q76B 5JOFB 3MRLA 4WEBL 4O4YH 3NIFF 5BO1H 1DUYB 3EYSL 3CUPA 4NQEA 3EO9H 1BECA 3F7VA 4PJ7B 5DZNA 4LCYA 2FJFB 2WMPA 4TSAL 1KXVC 1WAAA 1QZ1A 1HIMH 4N0UB 4DW2L 3SGEH 1NMCC 3ES6A 5I1GH 4JFFD 3QG7L 2FJGA 1X5HA 3SDAC 4LSQH 4JO3H 1I1FA 4KRPC 5HGBA 3PL6D 5DHVB 5C0CE 4R4BA 3BMWA 3FJTA 5F6HJ 4TYUA 2HFEB 2YSSB 1OTSD 1AP2B 1D5IH 4X6CE 1BQSA 2EIZA 2M26A 1Z6JT 4JLRB 1MCEA 2CLZA 4XVJH 3UDWC 1JGVL 2PYFA 4ZO7A 5GRZA 2C3WA 5FYLD 1PZ5A 5BV7C 1UWXK 4MXQD 3HI5H 3AMLA 2X10A 2QQKH 4X6CA 1H8SA 4I8DA 2EECA 3WFZA 4JFZH 3SOBL 1XR9B 4HWUA 2VLRD 5BZWA 1B88A 5ADPL 4LCUA 2WBJD 1VDGA 2R1WA 3OKNA 1NEZG 3MJ7A 5L7XL 5CCKL 1E28B 4LLQA 1RJLB 5J11B 1IEAA 3C08L 3FN9A 5E24E 4YDKH 3WHE0 1RK0B 4POZC 2VISA 2ATPA 2XN9E 1FFOB 5B39B 4MD4A 4Y5YC 1QNZL 1BZ7A 12E8L 4XBEH 4RDQG 5I1EL 3MBED 5E95B 3VXSB 2ADJA 3GMMA 1TCRA 3I50L 1QTYT 4Y19D 3DV6B 2XN9A 1I85A 3KGRA 4JFXA 4PYHA 3THML 2FBJL 4IBLT 4NYLA 3QXAB 4ZS7L 5IB1B 3VA2C 4N8CL 2ZOKA 4PJGA 1ZGLA 2P5EB 2CJUH 2WSKA 4O2CA 5B4MC 3C5JB 1ZA3B 5HYQB 4P2RE 1NLDH 1OF2A 4J23A 5FYLH 3G6JF 1ZHNA 4E0RB 2I9TA 1FVDA 1HZHL 1FZOA 5AUMB 1L7IH 1ZHKA 4LCWD 3QBTB 3JWNC 2MJWA 2DLGA 5JXEA 1LEIB 1IQDA 3HLAA 1KIRB 3DVIA 5DT1H 2XKUA 5C08B 3VWJB 2HH0L 3L3IA 1TXKA 5JO5B 1TVBB 3VXRD 4XMLH 3EDKA 2NR6D 4XB8A 4X5XB 5SWSD 4NO0D 5EZIL 3LZFH 1KLFA 3FO9A 2NNAB 3TO4D 2Y72A 4ELMA 4Q2ZB 2BY0A 4APQD 1LHZA 4M6OL 2XV6B 4FA8A 4XRCA 2XA8H 3Q5OA 4LIQH 2O61B 4JPKL 1WCBA 1I85C 1FFNB 5HGDA 5IV2A 3B6SA 3K74B 5E08H 3KXFA 1T5XA 3K2UL 1FVCA 3CGTA 1SMAA 3NPSB 1U8NB 3IT8D 3LEXA 3GIZH 4KK9C 1DDHA 4O02L 1A1MA 1G7QB 2PETA 3OKLA 3L5XL 2F8XC 4F57H 1RUAL 5HTSA 3UTZA 3MRCB 4A6YB 5GSRA 1P9MC 5JXEC 1NKRA 3EKCA 3QPQC 1KBGH 4WHTA 3SCMB 3ZYIA 4I3SL 1LO2L 2DLFH 4MSWB 3LVEA 1SJXA 3ZLQC 2V2WB 3O4LE 3LKPA 4IOIB 4U3XA 3I2CH 3KLHC 2AEPH 4FABL 5HDQL 2DLTA 4QHKI 3QHFH 4GAYB 5ENWB 1A0QL 3EFDH 1DE4A 4TSCL 4GBXB 3HE7D 3P40A 2NX5D 3O4LA 2W0KA 4PIRF 4PLNC 3REWA 2VYRE 4U1IA 2P46B 2ZUUA 2BVEA 3QEQD 3U82B 5DRNB 5DLMH 4KU1A 3RGVB 1AR1D 3PGCB 5MENB 4U3HA 3K8KA 3QXVA 1HQRA 1M1SA 5JQ6H 5EC2B 3KPNB 4LPUA 4PJAE 2VIRB 1NC2A 5DFWH 2YD3A 2YA0A 3NFPA 5B8CA 1A9BA 1U58B 3K1KC 5HGAB 1FN4B 1V7MH 3QEUB 4B7IA 5ACZB 1TJIH 2EXWC 2YC1B 1ZT1A 2P5ED 3FB6B 3MLYH 2ITCA 1F6AA 2FD6H 3UPCA 1WQVT 3L3KB 2CO6B 1YEEH 2YKLH 2JB5L 1CQKA 4JRYB 3P73A 4KQ3L 4U05A 1SJVA 3E6HB 4K7FA 4CVZB 5SWQB 4OCRL 4XMKL 4UQ2B 1QRKA 1S7XA 2FB4H 1XR8B 1NGZA 4G6AC 1T4KB 1SBBA 2VITA 5INCB 3NA9H 3VXUD 1IT9H 2GSIA 4FQHA 5IQ7L 4I3RL 2KQMA 5DGRA 4CDHA 5JW5B 5MERA 3AU1B 1J1OH 3WKMH 1CGSL 4IRSA 4Q7DA 1KJ2A 3B3IA 2Q8AL 5JIPA 4XMPL 3LKSA 4OZFH 1JFQH 4LBEA 2AJUL 1XF5B 4DN3L 4N0YH 4Y2DB 4FQXB 3T4YA 3HFML 4G80A 5E9DA 4YE4L 1SVCP 1HHHB 4YXHH 3SDCA 3G5VA 1MHPH 4JY6A 1K4CB 5MHSD 1AJ7L 3MV9D 3LD8B 5J4MA 3S7GA 1U8QA 2CK0L 1JTTA 4HGMA 4WFFE 5ALBL 5DO2C 5C0AE 1J18A 3QH3A 4WTZA 2NY4C 1I9RL 2VZSA 3QCUL 5E5MA 4F58L 1RZJC 2AEIT 3OKEA 3BT2H 3MNVA 1I3UA 4K2UH 4HC1H 4TUKH 4M7JH 4H20L 4L29B 4IRSC 2BVPA 1VPOL 3N0PB 4S0SD 1F90L 5TF0A 1MLBA 1P4LA 1CTNA 1UH2A 1F4YL 4WNQB 5KSBB 3NN8A 3GJFA 1ZHBB 2HLAA 3O6ML 5DS8A 1MQ8A 5E2TH 2P49B 1YDPB 1MJJA 1T1WB 2DLIA 3IU3A 4H5SB 2DM2A 4X4XA 1IEBB 4FQQB 3SDCC 4ESKA 1LEKB 1E0OB 3PWPB 5F96L 2YRPA 3STZB 4NFBA 1E6JH 2HLFD 2F54A 4IS6B 4K3EL 4GW4B 4YHYB 1AXTH 5I1DA 2JJSC 4PBVC 4H25A 2R56H 1PKQB 4CMMA 3VGFA 4TQEL 2DQTH 2P1YA 3O6LH 3OHXB 4J3UA 5FCSH 5F7NC 4OZGE 5D2NA 1VKXB 1WZ1H 5E7FA 4A6YH 1RZGB 2GITA 2CKBH 4UDUB 2CIKB 4LP4A 4PGCA 3LY6A 3ROLA 3U9UA 4PJFB 4PG9B 4LLWB 2ARWA 5BXFB 1AFVL 1IC1A 5A40E 5DWUL 2XY1A 4ZFGL 2V5YA 2A6DB 2ZSWB 4U7SA 2OTWA 3QZWB 1DEDA 3RWHA 5T33H 3OG4B 3T0WA 4GW1A 3MXWH 4JO1H 3GSNA 3QQ4B 4HD9A 1MWAB 5J1AA 3B5TA 1JPSH 1LILA 1GGBH 4Z77B 4ZXBB 4KKNA 3QRGL 3OPZL 1JGLL 5D93B 3E3QE 4JFQB 1CT8B 2Z8VC 4TRPL 3N1QC 4N5ED 1LEGA 4FQXD 2KPNA 1JPTH 4KI5C 3U1SH 5D7JA 2KDGA 2APBA 3K7UA 4XWOC 1BVKB 3N85H 3QIWB 5GHWH 4RMVA 3V4PL 1PEZA 4DTGH 4XP5H 3QUYC 2VZOA 1XF3B 2H1PH 5D2NC 4HCRH 3GIVB 5I8KL 2EIBA 3LEVH 4L8CB 3ARZA 1YNTB 4D9LH 5I1AA 1F6LL 3QWOB 3V4VL 3G04B 1RIVL 1KENL 1A6AB 1WLHA 1KOAA 4KHTH 2D31A 3TYGL 4JFOB 4LEXH 3INUH 4OZHF 3T3PF 5C0GB 3MACL 4FTVB 1ZLUK 1OTUD 3SJVD 3C6LC 5T1LA 3SGKA 1F4WH 5I0DA 4HUWB 4Z95H 1FSKB 1OAYH 4K9EH 5LJYH 2G75A 4LVNC 3OTTA 1A7NH 3CXDH 4HT1L 2JB6B 4Y4FA 1EH9A 4XBPA 3TVMA 3K1DA 4XWGL 1N2RA 3IFPA 4M7KH 5H35A 3ARRA 2FIRT 3MC0A 1MUJA 2XICA 3TA3D 3H3BC 4W68A 5I1LA 3DECA 4NNXA 3D0LB 4WCYL 5D7JC 1NJ9B 2VKWA 3DARA 2K9UA 5TE6H 2H2PD 3IKCA 3L95B 1INDH 3WFEL 4IRZL 4MLIA 1JWSA 4XZUB 1XIWA 2F19H 4PRAA 3PWPD 4PJCF 4QY8B 1ZLWK 2AERT 1UWEL 1YMMB 3DO3A 2IJ0C 5HI4C 5C09D 3NCYS 1INEL 5HYJB 2X44D 5C0BE 3RWIA 2VDQL 3VFWB 1ULVA 3QJFA 4XNZC 1CDUA 2H8PA 3EO9L 3PNWA 4NBYB 4MAUL 5D7KE 1UADC 2HRPL 5I6XC 1MY5A 4N0CD 1HIML 3BDXA 4JDZB 4UIKH 5CKAA 3SGKC 5FA4B 1I8IB 4AIXA 4GOSA 5DXWA 5I17B 5C0CB 3IDNB 3TVMC 3HZVA 4JDTL 5IP4A 1EO8L 5DRWA 2DI7A 3DX8A 3RPKA 1ONQB 5FUZH 5BOPA 5LGHH 1HSAA 5CGTA 3HI5L 4G5ZL 1WIOA 2PN5A 3GUTB 1RHHA 4L3EB 2A1WH 5IR1A 1S78D 3QP3A 4PRPB 4QRTB 3EJYC 4UTAH 5ETUB 4IRJB 5BRZD 1HXYB 4OLUL 2AJVH 1J7VR 1I8MB 1FO0B 4MMZC 5C70A 4L4VA 1IC4H 2VUOA 1ZV5A 4FFVC 4ZUSB 2R2BB 4FXKB 3ULUD 4LSRL 4E5XB 1UCTA 3TBVB 3N50A 1A6ZA 3PV7A 2DQCH 4F7PB 1T66C 1K2DB 2OK0L 1S7TB 3ETBF 4KPHH 2C3VB 3CD4A 4HKXA 4GKZA 1I7RA 5GS2D 4OQTA 4M93B 1EFXA 4M7ZB 1HHIB 4LHUA 4FTVD 4UAOC 3V7MA 3V0VA 5IB4B 2NYYC 1L0XA 4AENB 3D2UB 4X5WB 5DR5H 4ZSOE 2CJUL 1W8OA 5DFVD 4U2YA 1M7IA 5B38G 5DEGB 4WUUE 3TEUA 3PIQB 5MEOB 1UT9A 4I4WB 4P2RB 3S5LG 2Y06H 2DN7A 3IGAA 1QRNE 2X1QA 1AGEA 3GI9H 4OFYA 1XCTA 2R2EA 1X5AA 3J7HA 4X6EA 2DJSA 4XMLL 1JGDB 2X89A 2HFGH 2CDFA 4F37K 5KANI 4OV6F 4YFDB 1YMMD 3FTGA 1WEJH 5TH2A 3NCFB 5TE7L 2X4PA 1U8MB 3HS0A 1G1YA 1G9MC 1MIMH 4JZJA 2PYEB 5HY9A 3ULUH 1BD2A 3QI9B 5FUOL 1PX3A 1NFIB 2PW2A 1CFQA 3HE6B 5E08L 1QO3A 3NZ8A 1FFPB 5HVGB 4OZFG 5MI0B 5GS2H 5DQDH 1FRGH 3K4DA 2E7LA 3ARFA 2Q1EA 3FRPA 4W4NA 2EYTB 4F57L 4Z7VA 2H26A 4YHOH 2ARJB 4K94H 4QHLA 1LE5A 3VRIA 1R5IA 4JN2A 4MX7A 5CEXA 3VXME 5IMMB 4NRYA 3DETD 4WW2F 2Z92A 4PRPD 1MHCA 2DLFL 2W60A 2VAAB 1IGTB 3WXVH 4FQCH 4IRJD 4HJ0C 4ZAKA 1I4FA 3U48A 4M6MH 3DURB 1HI6A 3L5IA 2J1KA 3I2CL 3QUKB 2DQDH 5DF0A 3VXQB 5F7EL 3TNMA 4JZJC 5GRUL 2V9RA 1BBDH 2W9DH 4KK6C 5A3ID 2NY0D 3EFDL 3KPRB 4PR5B 5C0NC 3QRFM 2HKHH 3W5NA 4P57B 4LPWA 3VW3L 3WLBA 5HPMB 3BYYA 3CDFA 3H9ZA 3ARFC 1H3TA 2YD9A 2GAZB 3VXTB 4NOBA 4TOYH 4PJAB 1LVEA 4KRLB 4G7YL 2A0LC 4UUJA 3S37X 1YJDC 1CBVH 4I0KA 1V7ML 4ZFFA 2Q86A 4GAGL 4PRHE 1TJIL 4NQDD 1TLKA 3T0ED 5GS0C 4JY4B 4HQQH 7FABL 4JFYA 5FM4A 2CLVB 1SEBB 3HZMB 4HIHA 4ZAKC 1YEEL 3U4BL 2X7LB 5GJSL 1A6UL 2F74B 1TPXC 1RIUH 4MJ4A 1BFVL 2FB4L 1J8HB 3MFGB 1KB5B 4U0QB 2F58H 2GY5A 3DI3B 5DVMA 1EEZB 2FX9H 1KTDA 2WAHA 3QQNA 4GXUN 5B3JE 3MRRA 5FA3B 1WWCA 2Y23A 3LB6D 3S36H 1MLCA 1J1OL 1OGTA 1MCJA 2UVEA 2Z8WC 4JQXA 5I9QC 1MJ8H 2GK0A 2PYED 4HUXB 1F3JA 4OLYH 3UAJD 1J0KA 5I1KH 1YEGL 4ENED 4JZOA 2BNUA 2OR9L 3HE6D 4ONGH 5D9SB 1BP3B 2C4FT 4N0YL 4XI5C 1PBYA 5FUCE 3O3BA 1OLLA 3BH8A 3VFSB 1NMBL 2O93L 2FYYA 1MAJA 5CGYD 3HKFA 2NY2B 4OLWH 3ZKQD 1VGKB 1TJGH 1ZVSB 4GG8B 4I48B 4OJFL 4Y8AA 4EN3D 5BZDA 1S9YB 4DOHB 4ZNEA 3GSXA 1C7TA 1D6VH 2XPGB 1H3XA 4Z7UA 5FYJE 1RAMA 2XQBH 5ID1B 1I9JH 3BZ4A 2E7MA 3V8CA 4YIQA 5C0AB 5CHNB 2C4FU 2EC8A 4K55A 1IZJA 1FPTL 4OCWL 4G8EB 3AUVA 4ZS6D 3IDUA 3TPUB 2NPLX 2XKNB 4NJ9L 2WIIB 5I19H 4XVSH 3LMJH 2GJZA 4K8RD 4NZDA 4JQXC 2OI9C 4GRLD 4C58B 3KPRD 2QADB 2AVGA 3NTCH 1U3HD 2DM7A 5M95B 2AJXL 2CDEB 1CLZH 1AD9B 4IOSD 1ES0A 2YD2A 3CU7A 4JEGB 3WS3A 4NWUL 2XTJC 3E6FB 1G6RH 3LH2L 1IC7L 5DQ9A 4NT6B 4U3CA 3X3FL 3MV7D 5E6ID 2IPUK 5JUEH 3C9NA 1R3HB 3GRWA 3H3PH 4TUJB 3ZE0F 2VO5A 2R69H 1RFDL 3AREB 4Z7OF 1JGUL 1R3KA 3KJ4B 5E8DH 1INQA 2JK5B 5HHOE 2X4SA 2WUCL 1OM3H 2QKIB 2G60H 1D5ZB 2DYPB 3MRIA 2HTLD 4OZGB 3IAGC 4A6YL 5IHZB 5E94B 1U93A 4QWWC 3GJFK 4U6VH 1J8HD 4I77H 1JWUA 3U7WL 1CL7I 3B9EA 1F4AA 4X6DA 5T33L 3LN4B 3MRHB 4OBRA 4CRPA 4X6FA 1AHWC 4K8RH 3NCJH 5LBSH 2AJYL 2EZ0C 1N7MH 2C1OA 4NC1E 4WU7B 4YHZL 3VFNA 2CMRL 3BQUB 2FHBA 3OKKB 4I9WE 4DJMA 1M7DB 3L3JA 2NXYC 3WNPA 3LIZH 3LN5B 3I6KA 1XF2B 4HK0A 5C6WH 3HUJF 4L9DA 2C1PB 1BGXH 2NY5C 5I15H 1QSEA 2P8PA 4KJPD 4BFGA 3JTTB 4H8WC 5DMJB 4EDXA 4NPYA 4MLSA 4X7CC 2I9LA 5DUMH 5FDWB 3TO2A 3DUHA 2EE9A 1EUUA 3N85L 2NY1C 4MA3A 1QFHA 4DTGL 4NNYA 3UPAA 3TN0B 2H1PL 4V1DD 4HCRL 4XCNA 3LEVL 4P23B 5CJXA 4D9LL 3LHPL 4NQSB 1QFWH 1T1XB 4O2EB 5MP6H 4LF3A 3DXAD 3L3GB 5DD1L 4UQ3A 3ESVF 4MB3A 1FJ1A 3I9GH 2N56A 4KQ4H 3P30H 2ED8A 2BVYA 4TUOB 4LKXA 2QJDA 2FWOA 4J2XA 4LU5L 3ECBA 4K9EL 1KCRH 4JZNB 5IB2B 1A7NL 3QIUD 2P4AB 4BZ1H 1RZIB 3DTXA 4RISH 1BF2A 4WV1B 5GRWA 1QBMH 1X5JA 2E6QA 2RIKA 4S10A 1CQYA 1A7QL 1CXHA 5IMOB 3MOAH 3MRGA 1INDL 5IF0B 2J4WH 3MCLH 3FB5B 2COQA 1WFOA 4JKWA 3U0PB 2DDQL 3BJ91 2ZUSA 5CJXC 2MCPL 5H8DA 4YXLL 1P7QD 2BMKA 3TF7C 2CDGB 4XAKE 2X41A 4X5LA 2XZZA 4AEIH 3HZYA 4RFOH 4GXUM 5DZLA 2HTKD 3DX9B 4KKLC 3QNYA 3RVVD 4KROC 1AD0B 4R4ND 3VXOB 1RK1B 2V2XB 1MPAH 1ZHLB 4UIKL 1Q0YH 1QFUL 2H3NA 5F1KC 2ZCKL 1DQLH 1SBSL 4PGBA 3BH9B 1NAMA 4MCYB 1AC6A 4G8IA 3S35L 2CRZA 4PJ8D 1UH4A 5HYIA 1KNOB 5E03A 4XGZB 3D1MC 4GFTB 4NKMB 4U31A 4N9OB 3GSUA 3NIGF 2P5WD 4X9GA 4MNQA 1IARB 3EDFA 3OBAA 3MO1B 1K8DB 4HSQA 2OZ4A 5C0IA 5F72S 4GXVH 4JO4L 3RIFF 3O3AA 4PB0L 2R23B 4UTAL 1JPST 4HMDA 1YEJH 5C3LD 3Q1SL 4NRZB 3KWWB 3R06B 1WC7B 1U8LA 1ZWIB 4Z7NF 2CUHA 4NC2B 1ZVYA 2AJVL 4YUEH 3EHBC 5H94A 4PLJC 2XG5A 4YBQC 5HJ3A 5GGRB 2LAGB 2VLKD 3SO3C 4LSSL 4NN5C 1MRDH 4D0DA 4YWGH 1CFVH 4TTDD 3SDYH 3V5DB 3RKDC 4WIQA 3DV4B 4J6RL 3TN0D 3HPLB 4LLUA 3I75A 3WFCL 3BFOA 2PXYB 5I1JH 4P23D 1CFTA 4AM0A 2DQCL 1A47A 5HHPA 4NN7C 2G5BA 3RVTC 1JVKA 5CP3H 1HH9A 2AXFB 3JWDC 4QTHA 3NABH 1MEXH 2D0GA 5I1IL 4PRBA 3D85D 3FOLB 3GMRB 1XGUB 1CGXA 1WSST 3FQRB 2RJMA 4UINH 1F6FB 1YEDA 4WWKB 3ZTJH 2VRAA 1KN4L 5DR5L 3G6JA 4OZIF 3H3KA 4OIIH 2X05A 3LDBC 5CSGA 1OARL 1HOCA 3MROB 1ORQA 4WUUB 4U1KA 4LRNL 2YD8A 3V5HA 4HIEA 3BDYH 1MWAL 3DIFB 1EFQA 3BUYA 3LS4L 5KAQF 1QRNB 4PLKD 1FC1A 3QCVH 2AAVA 1A9EB 2R0WH 3C09B 1RUKH 2WV3A 3OKOB 1K3ZA 2AK4A 4NQCA 1CFNA 1DBKL 4L4TB 3WNMA 4XC3L 1S9XA 4ZG1A 4HLZH 1FZKB 5HVHB 1NLBL 4PRNA 3QEHA 3IDJB 2XFXB 1A2YB 5HHMB 1ZTXL 1HILA 3MRQB 5DJXB 1PQZB 3BPOC 4QNPF 3PHOB 5FYKE 5BS0E 1RJYA 2FIKA 2B1HL 1HWHB 4HWNA 3MLVH 1CD8A 1W0WB 4HWZA 3OKMB 5T1KA 3VDCA 3AMKA 3UX9B 2YPLD 4OM0H 4C54A 3QO1B 4CN4A 1FRGL 3O3DB 1RJCA 4U4BA 2IG2H 4QGTA 3UYRL 3MV11 5DJ6A 4AEEA 1KPUA 3GMPB 4OV5B 2P7TB 5F93C 3WUWA 4YHOL 4XCYA 3MJ8B 5FV2A 2IPTH 3VXMB 3FQTB 3O9WA 3S34L 4BQCA 4U1MA 2DQHH 5FGCE 2V5RA 3GSWA 4HLJA 1N5YL 1MCPL 1JZ4A 1PG7X 4HAFA 4E41A 1HQ4B 3MOBH 5GIRA 5E1AB 1NDMB 1UZ8B 4L1DA 4J3XA 4P5MA 1J1XH 4P5TD 5DHYA 5ICYA 3FO0H 3HPJA 4EI5A 5F9JB 2ZNXA 4YHKH 5F1IA 5EORH 3KR3L 3DRTA 4KWUA 1OHQA 2J5LC 3O2WL 3V95A 2MQ0A 4Y89A 4DGIL 5GGVY 4K7PY 3T04D 3UXFA 2A6IA 2BCKB 5DRXA 2APFA 3FFDB 4ODTH 4BQ6A 3KPSD 3TBTA 1BWWA 2DB8A 3KYMB 4LPCA 4HEPG 4TOYL 2BY1A 3HZKA 1PYWB 2IH3B 5ICXB 1ACYH 2EYSB 1B2WH 4RGNB 3VH8G 2ESVD 1OSZB 4GW5B 3O9WC 4PRHB 3QIBB 3O3UN 3WCYA 4HQQL 2B1AH 4M1CD 4HZLB 1NBVH 4QRUA 3REVB 2CIIA 1PJ9A 2CRYA 4NDMB 1I1AA 4YR6A 3T65A 1NCBH 3AY4A 1RIUL 4Y5VB 3HI6H 3WN5A 3KDMA 1W0YT 2F58L 3WFHA 3VCLA 3VRLF 1H0DA 1RJZA 2PTUA 3S36X 2OL3B 1P2CA 5D7LE 3FO2A 3KAAA 4QRQB 5JHDE 1FO0L 4J4PA 1MFNA 1XFPA 5T3ZE 5E00A 4L4TD 3LKOA 3MZTA 3QUXA 4X98B 2IH1B 3ULVD 1MJ8L 4IIQC 2BDNH 5HHMD 3MRJA 1WZKA 4BA8A 3MRKA 1MFCL 3SHSA 1P4IH 4HPOL 4HFWA 4YDVB 2WBJC 3P9MB 3QQ3B 3LKNB 3O11A 5K9OA 1U8HB 5E2JA 5FO7A 3NOIA 5FHBH 2JTDA 3MPCA 5IFHH 4KJYB 3IYLW 4ZFOA 3SE4C 4Q9CA 4PREA 1L9MA 2PO6D 3GNMH 3LSOA 5TQ2H 3NMEA 1I1AC 2K3TA 2XG4A 3G5YB 1Q38A 4AG4L 3MQIA 3JWOL 5CEYA 3MGTA 1QA9A 1UJ3A 3FOMA 5IVOA 9CGTA 3WN5C 4PB9L 1I9JL 1KJ3L 3NA4A 1N8ZA 3UTSE 1JF1A 5HYSG 3QG6B 4W6XB 3GMQA 5DC0A 4YBLB 4J4PC 4JM2B 3IKKA 1IAIM 1XGTB 3BGFC 4XVSL 3V7AE 1Q9OA 1A6WL 1KXQE 4DK3A 4HF5L 2VDKH 1EX0A 4XXCC 2D4DA 2XY2A 3S5LA 1NC4A 5JDJA 4R7DB 4JR9H 4LAJH 4OGYL 1BZQK 3T4AA 1KJMB 2CRIA 2ZCHL 3VJ6A 3WYRA 1VENA 3D87B 4KVCH 5J9PB 3WBDA 2OM5A 4IJ3B 3CVHB 2X09A 3ULVH 1DQJB 4YGVB 3VD5A 1GHFH 5HHQA 43CAB 1CGTA 1UWXH 2DICA 3BZFB 2CGRH 4H88H 2VC2H 3PQYE 3KYAA 1MELA 2F53D 2XOTA 1AC0A 3HNVL 5A16B 4PP2A 4JPIB 1UJ3C 4RGND 1VEPA 2NZIA 1KG0A 4APQC 4OGXH 1OM3L 3F8UB 5HHOB 3QIBD 1KB9K 1EBAA 3WLWD 1FNSH 3EIFA 4BH7B 2X4RA 2WANA 4QOKA 1FQ9C 2OP4L 3HMXL 1X5LA 4P46A 4ORGB 1GGTA 3L3OB 2XWBA 4U6VL 4XNQB 2A77H 4BJLA 4WDIA 1TZHA 3O45A 4NIKB 4XPTL 1N0LA 4KK8D 5JW4Q 3HG1A 3QO0B 5DEFA 4K8RL 3TZVB 3TBWB 2IANB 1CDJA 1S5IH 1IKNA 1LDPH 4YLQT 3U0WH 5I15L 1E4XH 2VDRH 2VN7A 2BNRB 3O8XA 4LGRB 3MODH 1G7HB 4P2OB 1GCFA 4OZHE 3Q6FB 5LWYH 2GUOA 2DTMH 1NGQL 1AKJD 4HUMB 5KBNC 4JGMA 2ATKA 2ZPKH 3MRBB 4JY5H 4ZDHB 4OD1H 4RFEA 4IDJL 4OZHA 2FSEA 1ZT4B 1U8PA 3RQ3A 3H9YA 5HSFA 5MP6L 4F9PA 2ORBL 1HHGA 4QHKJ 4WFGD 3FAXA 1HCFX 5F88A 2FJHA 4HV8B 5CSBA 1D5BB 4LSPL 4ONHA 4XNYL 4LQ1A 4Y1AD 1U36A 5H37H 4XCEA 1WWWX 5ISZA 4NKOA 3IJSB 5ILTL 2AJZA 5GGSA 1LP9F 1J0IA 1Y0LA 2R0LH 1KB5L 1KCRL 2D2OA 2AV1A 4JHAL 4MZ2A 4L8BA 4XHJD 5F71A 4KC3B 5EZLA 2EDTA 5C9JA 3LQAH 2EO9A 3O8XC 3C60B 3FB8A 1DR9A 4IMLB 4MDIB 4WO4B 4U1LB 2NW2B 5ESAB 4PJCA 1DQDH 3HAEH 4X7TB 1BMGA 2VSCA 1Q72L 3EOBB 4HKZB 3MCLL 5LCVL 1H5BB 3T0AA 4PJ7F 2JF1A 5EH1A 3P0VH 1KCSH 3C2AL 2VQ1B 4U6XA 4ZYKB 1IM9D 3OR7A 4KH2A 1I8KA 4RGOL 4F9PC 2BNQB 3PUCA 5AEAA 3WL9B 5GSVB 4U1JB 3EYQC 2O5YL 2FX8H 1A4JA 4HLZG 3GHBL 4P9HL 1MPAL 3ZKSD 4PJEE 3F5WA 4KI5E 1Q0YL 1L0YA 1JPFB 1R3JA 4MAYB 4PGEA 3IS1X 4UB0H 3GBNH 5C2BL 4ELKA 5C0RH 1YEKH 5J7CC 1EO7A 4TNWF 2QSQA 4HWBL 1TETH 1GGIH 3MREA 2IAND 4U1NB 3DX7B 5IMKA 3RNQB 4JG0L 1RSFA 1FIGL 3AXLA 1S7UA 2W0FA 4CW1A 5IROC 1YEJL 3VE0A 1A7RL 2GJ6B 1TJHL 5TDPB 4DFHA 4YUEL 3FT3B 5CJQH 2QHLA 2BNRD 1CK0L 3K8LA 1ZK9A 2DWEB 3RX5A 4NZTL 1KTLA 2HVJB 5TFSL 1CLOL 3F6LA 5E0QA 4I0PD 3MNZB 3HN3A 2IPKB 4YWGL 1CFVL 4QHNA 1SY6H 1ZA6A 5D96B 1YZZA 3RWGA 4RNRB 3WJJA 3VI3E 1SVZA 5EU7C 3UO1L 3L1OL 4Z0BL 3SDDC 1PSKH 3MBXH 1MVUA 1F3DH 4MHHI 5GS1A 5IFJB 1KV3A 3FHAA 2UWEE 4QRSB 5EN2B 5DMKB 2ADFH 2GK2A 4CGTA 3SKJH 5IT2L 5FIEA 4ZUUA 5IVXE 2VDLL 5E6ZA 4ETYA 3H9SA 3ZKNC 1ADQA 1MI5B 1JNNH 3MLSH 3BWAB 1B0GB 3P3YA 3VXPB 1MY7A 1BQHA 5CLWA 4WENB 4X80L 3HCVB 5HHNB 2FEDC 1S5HA 1NMCB 3CCHB 3QDJA 4CVUA 3SDAB 3UJTL 4WHCA 2EKSA 4KRPB 1ODAA 5ID0B 2DQIH 2B0SH 1RU9L 3IJYB 5A2JH 1IAKB 5SX4H 4R2GC 2WUBH 1B6DA 4N9GB 1EXUB 2ZSVB 1WF5A 2XNAB 3IDYC 1RUKL 3W0WE 4HMEA 3QFJE 1CS6A 2VDNL 1A14H 1Q9LB 1KLGA 3QA3A 2ADIA 5E8OA 1NCNA 3MCKB 4XXDA 2Q87A 1RULH 2AKRB 3C8KA 4QT5B 4G43A 3P9LA 5FKAA 2BP3A 3TBSB 2R39A 1OGAE 1EMTL 3IDMA 3ARDA 5I30H 3GFUA 1DEEB 2I27N 2BVOA 1F4XL 4LDEB 4AIZA 3RDTD 3F7VB 3QUMB 4LCYB 4JRXD 4GKOA 1XF4A 4X6BA 5EU4B 4DGYH 3ES6B 3O2DA 4TTGA 2MPAH 3RZCD 4WW2A 5DD5H 4Y5YB 3EO1A 4NFCA 2UZIH 5KSVA 5CUSL 4Z8FH 4WI5A 2Y7QA 3UBXG 3PWJA 3AFLA 2ICES 4NO5A 1A1OB 3SKUD 3FFCD 4S0TD 3PJSA 2X70B 1SEQL 5GQBA 2HFFB 2PYFB 5FGCB 1OTUC 4FZEH 1CXFA 2GJ6D 4ZPTB 3QQ9D 5E2UH 32C2A 4DKAA 1T6VN 2DM3A 5DI8B 5HD8C 4WEMB 1JZ2A 3QDAA 2VLJE 5GJTL 4M43H 1I7UA 4JHWL 4Q0XL 5EORL 3F58H 3LQZA 3HC3H 3GSRB 5SWZD 3U30C 3CLFH 1FC2D 3ARDC 3BISA 4WU5A 1X5GA 2H2PC 1B4RA 5EOCL 4ODTL 3WEXB 2ZCLL 3QDGD 2VISB 4I2XA 3VFGL 1U8OA 4WW2C 5AAWA 1PFCA 1BZ7B 2I60H 1FZMB 1ACYL 1MI5D 1MVFA 2P43B 4DCQA 3WJLA 2ZUWA 4NP4H 2B1AL 1CXKA 1HH6B 4Z5RA 1N0XH 1G7LA 4N8VA 4N0CC 3FMGH 4L5FH 1NBVL 1V5JA 4TULL 5FECA 5IQ9A 5I73C 2BRRH 4KRPD 3ZZ1A 3SQOH 4MXWH 4PJGB 5IGXH 3BD5A 2Z93A 4O2CB 2HAZA 4JANA 3BP6B 5DHXB 1AXSA 5GRYA 1YA5A 2E6PA 1EHXA 3PABA 1OWWA 2AI0L 2GQHA 5FO9A 5D7LB 4TPRH 3CVIL 2QEJA 2FL5A 5L88H 5JHDB 3HLAB 3S97C 4UDTA 1OAQH 4OFIA 1ZLUH 1GZQA 5F6IC 2BDNL 2NTFB 3OX8B 2ICEA 2VXUH 35C8L 3GSVB 1P4IL 3I3DA 3RWFA 3EFFA 4XPAH 4UIMA 1PKOA 5C3TA 4QRPA 3V4UH 3MXVH 3PWUB 5KVEH 4NQED 5JW3L 3WJLC 1DQTA 4KTDH 4PGZA 5IEKA 1S7QA 3B6SB 4O58L 1AY1L 3GBLA 4QCIB 4H1LH 2EH8L 1T5XB 3BKJL 5SV4A 5IHLB 3GNML 3T0XA 1ZGLP 1LD9A 1MJ7H 1F42A 3LS5L 3QB7C 1EGJL 3EYOB 1ZLWH 1E4WH 2I07A 2QL1A 1FL5A 2Z91A 3OKLB 3UTSB 4ZUVA 2A74A 3UTZB 5E2WL 4QLRA 1EK3A 3SO5A 1MCDA 4QYOB 3JV6B 4JN1L 2GJJA 4NKQB 2UY7A 4N1EA 1A21A 5KSBF 5T1DL 4K94C 2VDKL 2Q8BL 5FEBA 4BFIA 5B4MD 1PY4A 4DKDC 5H37G 2GTZB 5E99H 4Z7OE 5CINH 3BGMA 3CSPA 1C12A 3MLZH 4HXAL 4WI9A 4WW1A 4HX1B 3X17A 4EBQL 5BV7H 4Z18A 3GBMH 1KIPA 1IGMH 2VUYA 1FGNH 2IQAB 5ESQA 1G7PA 1Z9OA 1A6PA 4AJ0A 2W38A 2MHAB 5JLZA 3V0WH 5JPMB 4KRMB 2CGRL 1P6AB 5C6TL 1RZKL 5BVJA 4XPFL 3P11H 3PQYB 5A2LH 4XP6H 5ITFB 3HAEG 1U92B 2YK1H 4R9HA 3QHZL 1JJUA 3CIQA 5DJ8A 4PJFF 4OGXL 1F58H 2AJ3A 5CJOL 4KVNH 1GAFL 1NC2B 3DHJA 1FNSL 2XN9D 3P4LA 3P4OB 3CMOL 1DBJH 3NFPB 4LLDA 2HFTA 3C5ZA 1ZEAH 3CSYA 3GM8A 2HT4D 4JPWH 5CBEA 4NZJA 4GSDH 5DD6A 1RVFH 2PR4H 1NDGA 2A6JB 4YPGA 2XZAL 5C2UB 1X5ZA 1F6AB 2AEWA 4KK9D 1NGPH 4EJ1C 3TGXA 1Y6MR 2J8UA 2EE6A 1FP5A 3P73B 1JMXA 3VU2A 4K7FB 5AYQA 2VLLB 3MRNB 3ZYOA 1S7XB 4MD5A 1KT2A 3BP5B 5JXED 3ARXA 1KEMH 1UCBH 5D72L 3HUJA 4ODVH 3H42H 3DETC 2NY4B 1OP3K 2R1YB 3BKYH 3BP7B 1C5DA 3UJIH