2D3VA

Crystal structure of leukocyte ig-like receptor a5 (lilra5/lir9/ilt11)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
193
structure length
179
Chain Sequence
b'LSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSAVTLQCGSRLRFDRFILTEEKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords leukocyte immunoglobulin-like receptor subfamily A member 5
publication title Crystal structure of the human monocyte-activating receptor,
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 179
sequence length 193
ec nomenclature
pdb deposition date 2005-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d3vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2d3vA02
2NY1D 5CLWA 2FHFA 4ZFOA 2BXZA 5C0CB 4JQIL 3ULUL 4JPWH 1YEHH 2FATH 3BUYA 4FFWC 5SWQA 4ZTOL 3WO4B 1MRCH 5D7LD 2F8VA 3PP4L 4R2GB 1UVQB 2FEDC 2AJZB 5F44A 3HC4H 5C0RL 5LBSH 3AAZB 2AQ3A 3FKUS 4Z7NE 3FT4A 3DV6A 1VEMA 5DEGA 4V1DA 5A2FA 4TNWK 1KBGH 1A4KA 2XFXA 2EDFA 4OZIA 5JPNB 4UU9B 5GIRB 2ITDB 2XKUA 4NP4H 4WEUD 4QRSA 1N5AB 3RZCC 5IGXL 5K9OA 5JA8B 4NZJA 3ZDXE 2FNBA 3B6SB 4HPYL 1RULH 4KRMB 1A1OB 4PJAE 3U7WH 4XP9L 3TBSB 3WLWC 2X41A 2R56L 3WFDL 2RB8A 3MV7A 5D2NA 5C0AD 3EHBC 4PP2A 5EUKB 4CBPA 2P8LA 4PJDB 5I15L 3TFKD 1NCAL 3V4VH 4Y2DD 4YHYC 1SJVA 3ZL4H 4LSUL 1RURL 5JZ7C 3ZMRA 1ZGLB 4YHOL 1U8MA 3X11A 1FFQA 3M45A 4PS4H 2NTSP 3OKOA 1AHWC 4KTEL 1U3HB 5BO1L 5GGVY 1N6QH 3RWCA 4TULL 4H8WH 3N85L 3KPPB 1OCWH 5HHVH 4NQDB 2VLJB 2ADFH 4TSBL 1DANU 1L7TL 2FD6H 2W92A 3A6BL 1RZIA 4NDMB 1I1AD 2QKIA 1EA9C 3U6RB 3QO0A 3SPVB 2ATKB 2ZZUT 3HPLA 5HYSG 1IFHL 3QUZB 3UTQB 1CGSH 4XMPL 1S7RB 3EJYC 1TIUA 5DMKA 1NEUA 4P9MH 4WW2B 3ARED 1MHCB 1LK3L 2G60H 1NAKH 3VFUB 3QEUB 3DX8A 1RIVH 4J8RB 3FO1B 4J12A 1YMMA 5IEKA 2OL3H 4IS6B 2GJ6E 1I7TA 2EEAA 1FVDA 3WN5A 4U0QB 2OTPA 4N8VG 5GS1A 3CFKA 5J9PA 5DUBB 3U7AA 2NY4C 4C55A 1AD9B 3JWDL 4PGCA 5DMIL 4LAJH 4HT1L 1YYMH 5HGAB 3QNXB 1SM3H 2C5DC 1WBYB 4LF3A 3FO0L 4OLUH 2ENYA 3DPBA 4XP5L 5C0FB 4KROD 5DQJA 1P84K 1FHGA 3FL7A 2D7PA 3SKOB 4L5FL 3UTSB 3VWJC 5KJRL 1QLRA 3TN0C 3FB6B 1VERA 3FQNB 5GJSL 2GI7A 3UTTD 3QUXD 3ARDC 3ZLQC 3QWQB 2VDNL 4QXWA 5EU6A 5CKGA 3DUUA 4WHTA 3RVXC 3IFPA 1Q94B 1AI1H 3P2TA 2VLKE 4M1DL 4FZEH 4TVPL 1PKQE 1UWGH 1IKNC 1X6NA 4G6AC 4AEEA 1EHXA 2QADD 1ROWA 3WKML 5DJ8B 5C6WH 1A2YA 1D9KB 4OIBA 1WWAX 3F6IA 3F58H 5E6IB 4RMVA 3LQAL 4XC1L 5JXEA 2VLRE 3HUJF 1YEIH 1N8ZB 4HIXH 4ZO6A 3SDCA 3QFJD 2FX8L 4CW1A 1FC2D 1F4XH 1HKLL 1I8LA 2V5YA 3H9HB 5D1ZD 1B0GB 2F54E 4OF3A 4YGVA 4X9GA 1XT5A 2WINA 5INCB 3ARFA 2EDKA 2KKQA 3PNWB 3V8CA 3MBXH 3QDGE 4X80L 1EO5A 4HPOH 2AEPL 5E7BA 1F90H 4O51B 5B38G 3DXAA 3GBLA 1E0OB 3KPSB 4MJID 3W81A 4XXDB 3RA7L 1FG2A 4I9WE 1ONQA 4OFYD 4XX1G 3SCMD 4F7TB 4IHOA 1S7TB 2R1YA 3GHBL 4C4KT 1R0AH 5JW4R 1JFQL 3CFEB 3I3BA 4Y5XB 4L8SB 5GZOD 5IV2A 1PX3A 3T0DA 4X9IA 4ZFOB 3EKCA 3CCHB 3DETC 2MQ3A 2DQCH 3F8UB 5EIVA 3BUYB 1EHNA 5SWQB 4LHUG 4K8RD 3GM0A 3TH2T 3AM8C 1P2CA 5DD0L 1IVLA 3FQTA 5FYKL 4JLRB 3V0AC 3FT4B 3DV6B 3SDDC 5DEGB 3ABZA 4V1DB 1AR1C 5LGJB 4NZDA 5FV1L 3SGDI 4BZ2L 3TWCL 2XFXB 4Y0GA 4OZIB 3D9AL 3DYPA 4Y16C 4QRSB 3ZE1F 1WIOA 1KELH 3BKYH 4G5ZL 5ANME 2WBJD 3X12A 3VU2A 1KCVH 4P59L 1Z9SA 5EULV 4O9HL 2ADIA 1UWXK 3EYVB 4M6ML 4P4KB 4ODHH 5D1XD 3MOQA 1FZOA 5D2NB 3MV7B 5TDOB 4X7DC 4RNRA 4PP2B 3MJ9L 5I2IB 3ULVH 3FONA 1MRFH 3E0GA 3VDAA 2P8LB 3DROB 5KSAC 1IZKA 3C2AH 5IEHA 2CRIA 4MNQD 4QHNB 2AEQH 3VFMA 1U8MB 3STLA 12E8L 3BDBA 3ARRA 4PGBA 1WLHA 4QWWC 3QUYD 3OKOB 4B5EA 4TQEH 4JO3L 3OKKA 4YLQT 4X7FC 4GW4A 1NBVL 4PJBF 1FVCB 2FYYA 5L88L 1MRDH 3QCTL 2YWYA 1NCCH 1RZIB 2IFFL 2GJZA 2QKIB 1GGBL 3SGJA 3QO0B 4DK6A 2GHWB 4P2RD 2X10A 3HPLB 4R0LC 1HH9A 1QLFB 4RWHA 2K9UA 3G5ZA 2COQA 4NKQB 5DMKB 3QDAA 2G5RA 4PY8I 4XTRC 4LSTH 3NA9H 3DX8B 4XCNA 3BX7C 1RJLA 1YMMB 3ZO0A 5DDHA 3RPIB 1DBAH 5LGKA 2XY1A 1FVDB 3WN5B 2OI9C 2VZOA 3B8YA 3CFKB 4MQXC 5J9PB 5FUZH 4PGCB 5C0BB 3UBXG 4N0CD 4WUKH 2C3VA 4PJHE 1E4WL 3LKOB 4OCYL 4LF3B 4U1GB 4WVRA 1HHHA 4U1HA 2HVKB 5HI4D 4P2QE 1OP9A 5GRZA 1B88A 3HRPA 4WWID 5DQJB 3C6LC 2E9JA 4G9DB 4Z7WE 1A6WL 2CGRH 4I0PD 4MJ6A 4KKAD 1QLRB 4O2CA 3QQ9D 4OZHF 3NAAH 4P3DA 4H8WC 1KFAH 4ODBD 3QRGH 3TPUA 5EU6B 1F6LL 2DMCA 4WHTB 3G5XB 4Z8FL 4P5MA 5IMMB 3IFPB 3ZYIA 1IBGH 3WYRA 2VABA 5DQDL 4GW5A 3B9KD 4UQ2A 2XY2A 4G7YL 2JIXD 3OAYK 2EIZA 4QTIL 1A2YB 3AXLB 4K71B 1FYTE 4Y2DA 3GZKA 1K3ZA 4OLXL 1PZUB 2Q7NA 4ODTH 4TTDC 3P9LA 2HT3C 3KYKH 3SDCB 4KPHH 4CW1B 5INDA 2AJSH 2YXMA 1FORL 3I9GH 2WINB 4NO0D 2OP4H 4JRYE 5DJAA 3OWEA 3WNNA 4GLRH 2EO1A 1CGYA 4XP1H 3QI9D 1I1AA 5E24E 4FXGA 5BVPH 5E08H 3NIGF 5LXGH 1NGWA 3EGSB 2VWEC 2QL1A 3QXWA 5D5MA 1MI5D 1CI5A 2R1YB 5J0BA 5IV2B 3BKCL 3INUH 2DRUA 3TNNA 2XPGA 3CX5K 1BMGA 2OX5A 4RRPA 4OD2A 5GS2D 1TQCB 1CD0A 2BXYA 3KPRE 4MDJA 5FAAA 4JFQA 3G6DL 1P2CB 5F96L 4ZOBA 3UXFA 2H8PA 2VXQH 3EOBA 3MR9A 3UO1H 1INEL 3L9RB 1RHHA 4XCFH 3C09B 3K0WA 1ZLWH 1MAMH 3GSUA 2B1HL 3I50H 5J89A 3ARXA 2CUMA 4JHBA 4LQFH 2FDBP 2DL9A 2ADIB 5C86A 1X5ZA 1KACB 2ZOLB 3GBML 5I17A 5HDOA 1FZOB 4RNRB 3FONB 1I7UA 3PL6C 1LO2L 3QUXA 1K6QH 1I9RH 2CO6B 4XI5D 1RUML 4KI5F 4YPGA 1ZMYA 3RPKA 4PBWD 5KVDL 4AL8L 3C87A 2AI0H 3VFMB 3STLB 1YC7A 4U1LA 2X6MA 3IAQA 1CVSC 4PGBB 3HZVA 2BVQA 4YEFA 5BZWA 3D39E 5I1DA 4OLEA 3CSPA 3O6KL 4NQCD 3OKKB 5I6XC 4X8JA 2EE9A 5SWSD 5J6GB 4Y5YA 4GW4B 3BISA 2FYYB 2ARJA 5AYQA 2HVJA 3QFJA 1T1XA 2GJZB 4MAYD 1DEDA 1UG9A 3D6GA 5D1ZA 3UJJH 1HH9B 4OLWH 5BW7A 3IKKA 4HF5L 4UV7H 2P1YA 3G5ZB 4BFEA 3QHTC 4XB8A 2WWKT 5J06A 4YXHH 1T1ZA 2CRMA 4MJIA 4XCNB 3U0WL 1ZVSA 1RJLB 3CVIH 4RDQG 4U6VL 3SCMA 4OFYA 2YD9A 4ETQA 4WI5A 2X4OA 4PJCE 3ZTNH 1PEZA 4DKDC 3GMQA 1XH3A 2NY1B 4IDLA 3QDHA 3HHRB 5LQBH 4XWOD 5EOQL 2C3VB 5EWIL 4Y4KD 1BD2D 4EQ3A 3FZUD 4YZFF 2IGFH 5MEOB 4GS7C 1HHHB 3ULVC 1CFSA 4HMCA 1WFUA 4L1DA 1JGVH 4XGZA 1WZ1H 1R5IA 4WV1A 4OB5L 3TPKA 1M6OB 4MJ6B 2O5YL 4O2CB 5GRJH 3A6CL 4GAJL 1V3JA 3VWKD 2JB5L 3MLVL 2BFVH 4P3DB 3TPUB 4XCCH 4RGOL 2ESVD 4I3SH 3QJHA 4QXUH 4P5MB 5FUCE 3L1OH 3IS0X 3RJDA 4AM0A 5D1XA 2VABB 4PJIA 4GW5B 4UQ2B 3LPGA 4KUZL 1A7RL 2YPKA 2I24N 5KS9F 1QHPA 4WUUD 2EIZB 1JGEA 2YUWA 3EYOB 5C08D 3NFSH 1RPQA 4MNQA 5SWZD 1ADQA 5HVGB 4YO0A 1WBXA 4HQQL 4LCWE 3P9LB 5GRUH 4OUUB 5MP6L 3K80A 5E99L 1KIRA 4Y8AA 2PXYC 1QD0A 2VXVL 4KU1A 4F3FB 1DBJL 3MODH 1MCWW 5HHQB 5DJAB 4R9HA 4V2BA 3RIAK 4RGMC 1MCPH 4M1GL 1I1AB 4FXGB 2I9TA 4WTZG 3V0WL 1NGWB 1V05A 4KTDH 4L4TD 3SE4A 4J23A 1FAIL 3IT8D 5D5MB 3PWJA 1FP5A 3QZWB 1K2DB 2W38A 4BUHA 4QNPE 3Q48A 5D7IB 1CDHA 3RUGF 3ALXA 3HFML 3VJ6B 1A4JA 4P3CH 4PJFF 4PUBH 3TCLA 3RFZC 3TNNB 2XPGB 2W0LA 3KYMA 3PP3H 5GJTH 2A6DA 3ZE2E 4OD2B 5F1NA 2APWA 1KOAA 1EHLH 4CUCA 4JY5L 1F45A 4MDJB 3CXHK 5DTFA 5ITFA 2VZVA 2W9DL 2H8PB 2CR6A 3EOBB 3MR9B 4NN5C 3IYLW 1RHHB 3C9NA 1N4XL 3HA0A 1MCWM 1KJ2A 3BP6A 2BHYA 3DYOA 1ACZA 5AYUH 4LVNB 4E5XA 3GSUB 3F5WA 4KROB 1KXTB 1CDIA 2BZDA 4O5LL 4DQOH 3K2UL 5DD3L 4N1EA 5D96B 2IANE 3QUXB 1I7UB 2E27H 3BJLA 1KENH 2Y72A 4YPGB 1BQHB 5EA0L 3OB0K 3IFOA 4BFGA 3TVMC 1H8SA 3B9KA 3S5LA 4U1LB 4DKAA 2H1PL 2QADB 3QUZC 3RI5F 3HZVB 4KC3B 2BVQB 5T1LD 2OR8A 5I1DB 2JIXA 5F7UA 4NWTL 3VXRA 1X6LA 2HT2C 4WW2C 4X8JB 4Y5YB 2ZUSA 4I3RL 2ARJB 2DLGA 1NGXA 2HVJB 1OAQL 5C0GA 4LKXA 1RUKL 1T1XB 1AGBA 5CUSH 2YD6A 2BSTB 1NFDF 2R2BA 4M6AA 4OUOA 5IG7A 2K1MA 1YEJL 4OCXH 4MA7H 5CWSA 4PV9A 4HJJH 5JXAH 4CJ0A 4HC1L 1SEQH 5FYJH 5GGTL 3QI9A 1IAMA 1OAXH 4EIZC 1T1ZB 1F00I 4MJIB 4G6FB 4TVSa 2NY7H 1S5HB 4PTUA 2X40A 1MCQA 3GBNH 4ETQB 1JCKA 4CDHA 2X4OB 3IRPX 4LNVA 1P5UA 5CIPB 3CFDA 3GMQB 3E8UH 4H5SA 1KXQE 5F89A 4X6FA 1XH3B 4NQEA 2YKLL 3IETB 6CGTA 3WFEH 2HKFL 3OJVC 3O0RH 3B83A 4CDGC 4EZMA 1U95B 1CFSB 5I73C 4XGZB 1R5IB 1FJ1A 1D5XA 5EB9A 2EDRA 5IJVA 4UOW0 4DGVH 2OLDA 4DOHE 1WICA 4I5BA 5ESAA 2DQDH 5IW3A 5E6IC 1U3YA 4GSDL 2R4RL 4BZ1H 3JWNC 3SO3C 2DLIA 1P4LA 3VXSA 3EFFA 4OM1H 2XYCA 3PXJA 1DBKH 4GAYB 4KAQL 4AM0B 2YC1A 5CJBA 3QIBD 2VWEE 2YPKB 4Y4HD 1KV3A 4WEMB 1PDKA 1JGEB 5FGSA 3GK8L 5KG9A 1R6VA 5IHBA 3JV6B 5F1IA 4N90D 3VXMA 5IHUL 4YO0B 2JF1A 4Z7QF 1WBXB 3ILQC 4LP5A 3UC0H 1KIRB 4Z7VF 2X1PA 1ZLUH 1FNSL 2YEZA 3W9DA 5D7JC 4F9PA 1OGAB 1RZKH 1H9VA 3FMGL 5KN5A 4NQCA 5EBLA 5HSFA 2GTWB 3O2VH 4K3EH 4CMMA 3BKJH 2VZUA 5SWSA 4L8SC 2AABH 4UT9L 5AZ2H 4C56E 3T0EE 1BPVA 4M8QA 1HYSD 3U46A 4WIQA 3OL2A 3DMMA 2FX9H 1R3IL 1S5IL 3H9SE 1EV2E 2D03H 4TSAH 4MAYA 5C71A 5I1KH 1HINL 2I9TB 4NFCA 4EXKA 2QBWA 2OJZL 4TUKL 2EEBA 4MXWH 5FDYA 4HWEL 1YPZF 4R4NC 4HJGA 5EO1A 3L6FA 3VFPA 2CD0A 2YHGA 4OM0H 1YQ2A 1A4JB 3TCLB 3DUSA 1YECL 3N1MC 3BMWA 3TYGH 4ODSH 2Z91A 3LRHA 5DR5L 4KI5D 2DWDA 3ET9F 3VW3H 3V5KA 1PZ5A 2XG5A 3PGFH 5DTFB 5ITFB 5D2NC 3CX5J 2NY2C 4AEIL 3RWEA 1BF8A 3C9NB 7CGTA 1KJ2B 2XA8L 4E5XB 4ODVH 1HXMA 2YPVH 3MRQB 4X9FA 7FABL 1G9MH 3OKMB 4JO2L 5EBWA 1AFVH 4ZTPL 5DJDA 5HVWA 3HUJA 1QG3A 3DI3B 5JORB 4HUUA 4DK3A 1H3TA 3JXAA 1SJXA 1T1YA 5TH2A 1A7OL 4FZ8L 5KSBF 4GUPA 2ESVA 2MSPA 1MCOL 3BQUA 4K23H 3BT2L 3P4OB 3IFOB 4N0FA 1QRND 3CC5A 4KZDH 4M5ZH 3B9KB 3GSWA 1JZ3A 3EYQC 3I6LD 5DJZA 4QRRD 4AEFA 4WUUA 4FXKA 3VXRB 3V5HB 2Y6SC 5C08A 1G7LA 2EH8H 1KCSH 5SWZA 4UINH 1JTOA 4NQXB 4HSQA 1RIHL 1MJUL 5JQ6L 4J3UA 4XZUA 2WUCH 1NGXB 4D9LL 4C57C 5C0GB 4PLKC 3GRWH 2R2BB 3H0TA 5IG7B 3BIKB 3WN5C 4EOWL 5GS1C 32C2B 3ARTA 5ENWA 5DO2C 2AJYL 5CWSB 5DD1H 3GFUA 1WFOA 4PV9B 2DF3A 5FHAL 2XQBL 3CPLA 3CAFA 1SBSL 4U1GC 3QI9B 3I3DA 1UFUA 4QT5B 2XIDA 4Q9QL 4PTUB 1TPXB 3MROA 4L4TA 2OJEA 3OKDA 1RVFL 3QEGL 3P77A 2P8MA 3GGWB 5DA0B 3VI3E 3CFDB 3O6FB 5CEZE 5DZNA 3SKJL 1PBYA 5F89B 1Z2KA 4NQEB 4JGUA 4GG6F 2ATPA 3HAEA 4NJAH 1ZA6A 3HI6L 2Z93A 3RWFA 2ID5A 3ZKMC 4RFEA 2OTWB 4DGIH 1J18A 1N0XL 1JWMA 1RJCA 4FOMA 2NX5E 1D5XB 4U1SB 2RCSL 4N0UE 5IJVB 4S0SD 2MPAL 4IM8A 3TJHD 3BGFC 4K71C 4MD5A 3DRQA 2VDOL 4I5BB 5ESAB 3S97C 2V17H 4HFWB 4EN3B 3RY4A 3ARZA 3DX9A 3HNVH 5IUSA 1P4LB 5JXEC 3VXSB 5C0CE 3MLPA 3EFFB 3G04A 3O8XD 5B39A 3SDCC 3Q6FA 1KB5B 1IL1B 3W0WD 1G9NH 3CJJA 1S9VA 4J2XA 1I8LC 5L2JA 4IRSD 2YC1B 4XXCA 3LIZL 4FQHA 2VNCA 1QPPA 5BMFH 3W9EB 3ARFC 2YN3A 5FOJA 2EXWD 5D70L 1AXTH 5DRXA 5FV2A 5KG9B 1QHOA 2WIIA 3O2WL 5I1JH 1QSVA 4G3YL 3VXMB 2A9NL 5A2KH 3LQMA 5E2WL 2DQUL 5C92A 3MXWH 4TPRL 1A7QL 5T1LA 1O7VA 1QYGL 2YEZB 5KN5B 2M8XA 4NQCB 1MCKA 4P2CG 5TDNA 4CMMB 5HVFB 1U41A 4MNGA 2ZUYA 5SWSB 3LV3B 1UKTA 1WT5A 3L3HB 4M8QB 2R69L 3U46B 3DMMB 5ADPH 1UH3A 1H3XA 3F7RA 4U7SA 2Y06H 3NIFF 4Q9CA 3FFCD 1IT9H 3UZQA 5D4QA 2Q6WA 5CKAA 3V6ZA 3QUML 4HBCL 5EO1B 2XZQH 5JDSB 2OK0L 1DJSA 3LHPL 4WNQB 3VFPB 3VFSA 1G84A 2EH7H 4CU6A 2H2PD 3KPLA 1N26A 3DUSB 1OTTC 3CVHA 2VLJE 4NQDE 2VXUL 1PG7W 1ZKAA 3BFOA 1QVOA 3RGHA 2Z91B 3FOMA 5CIPH 1WZMA 3OX8A 3KJ6H 2HJFA 1S3KH 2DWDB 2V9RA 1HHKA 4NHCL 4Z78A 2IH1A 25C8L 3CMGA 1PZ5B 3V5KB 3ZTJH 2DTML 4JG0L 4P49A 4HGMA 4P46B 5DT1H 3RWEB 4NKDA 2NW3A 4WEBH 3ISWA 5H2BB 5C6TH 1CR9H 1N5YL 1JF5A 1KXVC 2V7NA 4ENEC 3CXHJ 5EBWB 5F8RC 4PJ7E 2FB4L 3RGVB 4X7TB 5ICXA 4AIZA 5I19L 1L7IH 1QTYT 3ZDZE 4BYHA 1OPGH 1FDLL 1DQQA 4WO4B 1MJ8H 1BJMA 1T1YB 3QDME 3P30H 3PQYE 4IRJD 3CU7A 3OZ9L 4GUPB 2E7HA 3LH2H 2ZCKH 5FO7B 3UEZA 2X9YA 3BQUB 4JHZA 5BS0D 4N0FB 4K3DH 3SGJC 1EUUA 2CK0L 2EICA 3D48R 1FSKB 3TJEL 3QIBA 1JZ5A 2AJVH 4Y4HA 1F97A 1R3KA 5DJZB 4K3GA 4QGYA 5AWNH 4KK8C 4WUUB 1DQDH 5GGQH 3EOTH 5E5UB 1ADQH 3UTSE 5C08B 1G7LB 4XPGH 3G5VA 5M7QA 5HPMA 2RIKA 5SWZB 4LOUD 2ZNWA 2IPKA 4XZUB 5TPWL 1OP5K 2W60A 4MZ3A 3UYPA 3P0YH 3MREB 4HXAH 4P3WA 1BM3L 4JKWA 3H0TB 4LIQE 4JRXB 5ENWB 5EU4A 3P11H 3MLTA 2ZUXA 1FFOA 2HMID 2NY1C 2BOBB 4RFOH 1J8KA 4FFYH 1PX4A 3NPSB 3BESR 2VO5A 1RZFH 3ARPA 4HWUA 3MOBH 2KQMA 4JPKL 4D3CH 3MLYH 3Q3GA 3HMWH 3MROB 5CJ5A 4L4TB 5HHXH 2VDKL 1TDQA 2VSCA 3B2VH 5C2BH 2OJEB 3AS3A 2E5EA 4WFGD 2YR3A 4L3ED 3P77B 1MAJA 2P8MB 4LSRL 1G9MC 3WSQL 1TVHA 4KDWA 4L4VB 4OGXL 1CQKA 4UDTA 3IDJA 2F5BH 4XAWL 4Y2OA 2ATPB 1MCEA 1LDPH 1IC4H 3QPXL 1ZA6B 2Z93B 3RWFB 4M48L 5CLTA 3BO8A 3BYYA 5EIIB 3VFRA 5DUML 1WZKA 1EGJA 1OTUC 1X5XA 1VADB 4QYOA 1IRAY 2IPTL 1KJ2H 4U1KA 4ELKA 2ICWA 1DE4A 4Y2DC 4MD5B 5HYQA 3DRQB 5ISZE 1U91A 4GRMA 4OF8A 4LARH 1CK0L 5FUOL 3R0MA 3DX9B 3CGTA 1WAAE 2LAGB 3EZ8A 5I9QB 3G04B 5EZIL 5B39B 3LOWA 5C09D 3Q6FB 5AZEH 1J1XH 3VFWA 1T80A 3MRLA 4S1SL 5L2JB 3O4LA 2AQ1A 4UT6H 5GGSY 4FQHB 5KVMC 3NGBB 3MA9H 1RZJL 5IBUG 1CFVL 1XGPB 3BP5A 4DVRL 2YXFA 5T5NG 1RIUH 5DRXB 5GISL 4L8CA 3RIFK 2ADJB 2WIIB 5IFJA 3GB7A 1I1AC 2PTTA 1JL8A 2WQRA 1PFCA 1S9WA 3VD7A 3SQBA 5CJXA 1X7QB 5T1LB 2EEDA 4Z7WF 5MEND 5I8EA 1VEOA 5ACZA 4NRZA 4MNGB 3B9EA 1X5KA 1SYVA 2LAAA 2KQNA 3NCJL 3FFDA 4EBQL 4BH8A 3FQWA 4O58L 2LFGA 4S1RH 4ZYKB 4HK3J 2Q6WB 4JB9L 3V6ZB 4XVTL 4LHJB 2UUDH 4MWFB 3DYMA 3VFSB 3QHZL 1K8IA 1J87A 4MMXC 2C7UB 5HDLA 3CH1B 3KPLB 5FOBB 4OI8A 4LVNC 4C58B 1C08A 3HR5B 4ELMF 1QVOB 4YEEA 4KROC 3FOMB 4QOKD 2IQ9L 4FG6D 2DDQL 1PGRB 4RX4D 1D5MA 3OAZK 4IBLT 2C3WA 2IH1B 2MCG1 3T0BA 5DHYA 2BNRD 3TT1L 5L6YL 1G9NC 4JZOB 4LLQA 3QUXC 4UDUA 3LN4A 5KS9A 1SYSA 3P0VH 4LLMA 2CJUL 1QFWM 5IB4A 4OGAD 2V7NB 2A74A 3I2CL 1GOFA 2DQJH 5MHSD 2QADC 1MCLA 4PRHD 3QIWB 1ACYH 2JLLA 3KDMA 3MGTA 4NKMA 2C4FT 4X6CE 4PLNC 2P8PA 5KVFH 1DQQB 1UM5H 4Y5YC 1KB5H 3IAPA 1ZHLA 3BN3B 1EO7A 4K94C 5IVXE 2E9BA 4YX2L 5E2TH 4F57H 5HHOE 4IRSA 4BKLB 4M62L 5D1ZC 4KHTL 3QIBB 4Y4HB 1A3LH 5HJ3A 1R3KB 5FM5O 5IB3A 1I85A 5BW7C 3FN0H 1IC7L 1KB9K 4ISVA 1JNNH 1QEWB 3L3OA 1MSPA 3G5VB 5CINL 5HPMB 4X4XA 2QQQA 2I25N 1IAIH 2IPKB 5EU6E 1OSPL 3SCMC 2W60B 4R96A 5F9JA 1KCLA 2DLFH 3O6MH 3VFGL 2OYPA 4P0DA 3HNSH 5EU4B 5GZOC 3MLTB 3K7UA 1FFOB 4MXVE 4XC3H 1WIPA 3VRLE 4X4YB 4XAKD 1MQKL 4MQ7B 3AFLA 4V2CB 1E6OH 5HDQL 1P53A 5TE7L 1WV7T 1I3RA 4Y19B 1YEFH 4M43H 2GT9A 4FQJL 4U6TA 5D7SL 4WV1C 3RWJA 1YEKL 1TVHB 3SOBH 4KHXH 4UDTB 3IDJB 5K9QG 1P7QB 3GJFK 2DKSA 1G9EA 4GBXD 1IE5A 2Z31B 5KANG 3ROOB 2HLAA 4KQ4L 2B2XL 1X5HA 4B7IA 4F7MA 2J6EA 5T3ZL 1BQSA 3VFRB 3DXAE 4HFUH 5D1XC 3HKFA 3SE8L 4P5TB 5EC1A 2WANA 1WC7A 1A7BA 3FAXA 4PRNA 2HWZH 4ELKB 2ICWB 4PJ9D 1DE4B 5HYQB 2R0ZL 1U91B 4GRMB 5IESH 2XN9D 1I8MB 2R23A 1H5BA 1Q0YH 1KTDA 1A9BA 1H8OA 3P9MB 3S36X 3DSFL 3VFWB 3L5JA 4PJXF 1MJJB 3MRLB 3NCBB 3O4LB 1NFDA 3RY6A 4M6OH 4NZRH 2QV2A 4GKSA 1FVEA 4NO5B 1G7JA 1YC8A 2CRYA 5LVEA 3BP5B 5FM5M 4J3VA 4IRJA 2FH8A 1WEJH 2V5RA 5IFJB 1KCRL 3GB7B 2NY0D 4RMSA 5BS0A 1I9IL 4GRWE 2PTTB 4TRPH 1UACL 1FRGL 4D0BA 1S9WB 1K5NB 3ZYZA 4QRPA 3SE4C 4XPHL 3QO1A 4ODWB 3B9AA 2PR4H 2Q3ZA 4U1MA 5ACZB 5FKPA 3DBXA 4NRZB 2DOCA 1WSST 4K7PH 4RMQA 5H94B 4XP6H 4HCRL 1EVTC 1RZ7L 2LABA 2M2DA 4PJ5D 1WISA 2NY5H 5E4EB 1SYVB 5F7NC 3L3DB 2OTUA 1JHLH 2YOCA 3BPOB 3FQWB 1MIEH 4JO4H 3UPRA 4RA0C 4X7CC 3BYTA 4JZJB 3O3DA 2VH5L 2MQ0A 3PV7A 1K8IB 3FHAA 1HHIA 1DVFD 1CN4A 4NGHH 3ZE0E 4I77L 4JFFA 5HI4C 3BZ4A 1BFVL 1C08B 5KTEL 2R0KH 3HC3L 4FQPA 3KPNA 3S35H 4DUXA 1F2QA 4L3EA 5AEAA 5K93A 3VXNA 1TZIB 2D7QA 4MA3A 1GH7A 5GS0L 3GKZA 3U82B 4YXKL 3REWA 3QQ9C 4N8CH 2H26A 4LLQB 4UDUB 5GRXG 1WVZA 2R1XA 3TV3H 4KK6C 1SYSB 4LLMB 1JIBA 5IB4B 3HI5L 1BWWA 1CZ8L 3B9KC 5DJ6A 4POZC 1VGEH 4JFYA 3EO9L 5DI8A 2AJUL 1FZMB 2GUOA 2P48B 1I1YA 3MGTB 4NKMB 5GGRY 1S9YA 2P8PB 2W9EL 4JDVA 5T3XH 5GGVL 1A6ZA 2X1QA 2FZ3B 3OF6D 5EUOB 3ULUE 4YBHA 1HILA 1ZHLB 3KS0H 3E1F1 3HE6D 5C09A 4HS8L 5D7LE 3WXWH 1RUPL 5DSCA 4P2OD 4PLJD 5HJ3B 5A2LH 5ALBL 4RGNE 1DN0A 3DV4A 1Q0XH 3L3OB 3QI9C 3QNYA 2WWMD 4R8WH 4LVOB 4X4XB 1YEEL 5FYLH 2V2TB 1GYAA 3LPFA 1TPXC 1U8PA 5EZOH 2CPCA 4R96B 5CP7A 5EO0A 5HYJD 1R3LA 5MENA 1TFHA 2XACC 4FTVE 5I1HH 4NWUH 3L7FA 2F8XC 5C0AE 1UXWB 1UYWH 1EO8L 2KPNA 2J8UF 4WI4A 1F8TH 4C59B 2NY3D 4OSUH 3EZJB 2K7QA 1L9MA 1I3RB 1NAML 3LKPA 4ZO8A 2QSCL 3O45A 1AD0A 4HHAB 3RWJB 5D71L 3WNKA 2C26A 2J8HA 4LCIL 3E6HB 3SDYH 1U8LB 4FFZH 2FR4B 2HLAB 1FH5L 3MYJA 5FM8A 4RX4A 4HS6B 4F33A 1A21A 2UWEE 1I3VA 2BNRA 3MRPA 2AXJA 2DMKA 4RWYL 3CSYA 5A2JH 1YYLL 2H45A 5F7EL 4LEXH 4PRNB 3W82A 4XI5C 5BZDB 2EECA 3FQXA 5HGHA 5D2LA 1MFCL 1LP9A 3GSVA 3SDAD 1MWAL 2H3NA 3QCUL 3BI9X 4MA8H 2R23B 3V9FA 3TH3T 1Z5LA 1KTDB 3W2DL 1A9BB 3V4UL 1U6AL 2XXMB 4DN4H 1SEBA 4PRHA 1ZTXH 4KRLB 4F9PC 2XRAL 3HE7D 4LLYA 5TDPA 3Q6GH 1B0WA 1FVEB 1G7JB 3BSZL 3TO2A 4IRJB 4KZEL 1EAPA 3DMMC 4QY8A 2F19L 4YQXL 5BS0B 4ONFH 1X4YA 4MAYC 5EO9A 5K9QI 4KK9C 2Y5TB 5FHBH 4D0BB 5E2VL 4QRPB 4U6YA 3MNZA 3R1GL 3QO1B 3U7YL 4ONGL 4AENA 4R26L 4U1MB 4TTGA 2I27N 1I7RB 3DBXB 3LZFL 5JO5A 1IGYB 4MB3A 1X5AA 3UTTE 4GG6A 1JI1A 1TZGL 1F4YL 1FL6A 1AO7D 3W11C 1MF2L 5DS8A 4TVPE 4ZD3L 3S36L 3HG1B 4UTBH 4UILL 5I1EH 3MJ9A 4FMKA 2ZSWA 1EMTH 4Y4FA 3C5JA 2AK1L 4HULB 5D1QD 4ZFZA 1HHIB 3QBTB 1RK1A 4KH2A 1HQ4A 4LLWA 4JFFB 1JRHL 2WK2A 2ZSVA 3BZ4B 3OR7A 3BVNA 4OQ1A 1JMZA 4LGSB 1A1MA 3MV8A 4ZS7H 1V7NH 3QFJE 4L3EB 3MRCA 3VXNB 5BXFB 2HTKD 3MLUH 4TUOA 4MA3B 1HWHB 1QBML 4JPIB 3L5HA 4MVBD 4YHZH 2AK4B 1GVIA 2V2XA 4F15B 1IGFH 3REWB 3S3SA 4FQ2L 4YDIL 3EYSH 4GBXA 4WTXA 2H26B 1SBBA 3D2UB 3LEXA 3R0NA 2YPLA 2R1XB 3QHFL 4PJGB 3BQUC 1TJIH 4QHUA 4LU5L 1MFEL 3W5MA 1BBDL 4MJIE 5KW9L 1FSKC 5DJ6B 1CBVH 4MB5A 2VQUA 4C54A 3C6SA 4JFYB 3O4OB 1RQ5A 3V6FA 5DI8B 4Q2ZA 5B3NA 2GUOB 1I1YB 1S9YB 1ES0A 4JDVB 3TT3L 1AC0A 1RJZA 4ZQKA 2A73B 4GMTL 1HILB 3K2MC 2CLRA 3QXAA 3EJYD 2V5SA 3S9DB 5KVEL 2NY5C 1A6VL 1U8JA 4BSJA 3WFCH 3FB8A 5DSCB 1ZANL 5FYKE 4XP4L 1H15A 3BEVA 4LFHD 4KMTL 5ID0A 1DN0B 3DV4B 2DQHL 2HKHH 5ALCL 5F6HJ 2ZCHL 3S8WA 4EIGB 2NY4D 5FM4A 2R0LL 5J13B 2IEPA 5CP7B 1KB9J 1V7ML 1R3LB 3WEXA 5MENB 4PJIE 4H88H 1EEQA 2B4CC 1J0YA 3VG0L 3SKMA 4I13B 2QSVA 4EUPB 4PJ5A 5I1GH 3S3PA 5E8OB 8FABB 1BEYH 5T1KB 4MAUL 4LCCA 3A67L 4OD3L 4MNQE 1KJ3L 2CLVA 2Q86A 1ZT1A 1GAFL 1QFUH 5IMKA 1Q72L 4NQTA 3VGEA 3GMRA 4CKVX 3LKPB 3LS4L 1DLFL 3O45B 1AD0B 1JPST 4X5WA 5DXWA 3RVXD 3S6CA 3O2DA 5F9WC 5HI5D 5IR1A 2Q7YA 1AXSA 3MJGX 2NTFA 3RP1A 1NQBA 5ETUA 1GGCL 1G1YA 5I9QC 2R29H 3TP4A 4Z7UF 3MYJB 3KLHD 1PLGH 5D6DA 3ULVF 4F33B 1NCDL 1DZBA 4P2RE 2BNRB 4XXCC 5IK3A 3MRPB 4H25A 3NGBC 2Y07H 5ICZA 1T5WA 3FQRA 4F58L 2DB8A 3FQXB 1MCSA 2ZPKL 5D2LB 4MNHA 1LP9B 3GSVB 4YUEL 2H3NB 2FHBA 4M00A 1NDGB 3IU4H 1IQWH 3THMH 1JYXA 1FIGL 2D7TL 1Z5LB 1NLBH 3LEYH 4MHHI 5BQ7A 2GCYA 2FX7H 1I3GL 1NKRA 4LGRB 1SEBB 3TA3A 3CLFH 4F9LA 3S37X 4GFTB 5T5NF 4HLJA 2DD8H 1TJHL 5TDPB 1MOEA 3S4SA 1R24A 1J7VR 2BDNL 3TO2B 4XPTL 3FAWA 3OF6A 1WT5C 1GIGH 4JREB 2VR5A 3RU8H 1EAPB 4NPYA 4QY8B 3HE6A 5IFHH 2RR3A 4U1JA 3JTTA 5EO9B 1OSZB 4XHQA 2XWTA 4LDEB 3WJLA 5KSUA 4U6YB 5ID1A 1S7WA 3MNZB 2X4QA 4X5LA 2MMXA 1EFQA 2D4FA 4AENB 2M1KA 5B3JF 4TSCL 2J3SA 3MFFA 5AG9A 3LCYA 1XR8A 5IBLD 5ACMA 3OSKA 4LCUA 1JGDA 3SDDD 5HYJA 3H7LA 2BY2A 4HMDA 3LPWA 1AR1D 5IM7A 1KIQA 3E6FB 4OTXH 2DKMA 2YD7A 2ZSWB 4G8EA 4Y4FB 3C5JB 4RRPG 3JTSA 3ZSSA 4GAGL 4ZFZB 3IFLL 4JKPH 2X1OA 4ZAKB 1RK1B 3GI8L 1HQ4B 4LLWB 1U3JA 2WMPA 1BZ9A 3OR7B 2X4TA 4BQBA 1A1MB 2YD4A 4JM4L 4NZTH 3MV8B 5C0EA 3HMXA 3OPZH 3CFBA 2HRPL 2IJ0C 3MRCB 2HFGL 4TUOB 1XFPA 4U31A 2YD5A 4XBGB 1WJ3A 3JVGA 4PTTA 2V2XB 4GBXB 2J6EH 2PUQT 4G6MH 5IIEA 4HK3N 3WIHL 3LEXB 3CX2A 4QWWD 2YPLB 2CQVA 2NMSA 4PJDF 4ORZC 4QHUB 1A7PH 5JW3H 1FPTH 3X3FL 1ZS8A 2IQAA 3KGRA 4YHLH 1J11A 4FP8H 3QIBC 4Z77B 1X9QA 4Y4HC 4BQCA 3C6SB 4YGAB 3V6FB 2X44D 4A6YL 4K7PY 4WTWA 4NM8L 4Q2ZB 1E27B 4ODXB 1MI5E 5EZLB 1ES0B 1LO0H 4BH7A 1RJZB 4ZQKB 4U7KA 1EFXD 1CS6A 1N3NA 4JPWL 4WTZA 5BV7C 2FATL 5IVZA 4ZPTA 3AMLA 2CLRB 3QXAB 2YK1H 1MRCL 5CZKA 3V0VB 3ARYA 3HE7A 1U8JB 3RAJH 4XTRD 3HC4L 5IHZA 3FB8B 4JQIH 1CIUA 3KYAA 3BEVB 5ID0B 3MBEB 1KBGL 3PP4H 2OMBA 2KL6A 3CMOH 2VR4A 1A3RH 1NC4D 2NY0B 4NO3A 3MRRA 5C0RH 4WW2F 2PTVA 4YXLL 4MQXD 1FE8H 5ABDE 3D1MC 1Z9OA 4HXBH 2HP4A 1AXIB 4OFKA 1J0HA 2P5ED 3WEXB 3FHQA 3Q2CA 4LLDA 2F53E 3CU1A 1NUDA 1A5FH 5L2KE 1IAOB 4RISH 4BJLA 3W5NA 4PJ5B 4AK1A 1AO7A 1CXEA 4LCCB 4KI5C 1CE6A 1SHMA 2CLVB 2Q86B 1ZT1B 1KIUA 5I15H 1NCAH 1LEIA 5IMKB 5FF6A 3N9GL 1I3UA 2DLTA 3GMRB 3WFHA 3ZTJG 2GIYA 2H32A 3HRZB 4X98A 1QA9A 3ORJA 4H8WL 4MJ2A 5D1QA 2FO1A 3HPJB 1OCWL 4YHPA 5IR1B 4GXUM 2Q7YB 3G5YB 3UJIL 4ESKA 1AXSB 4J3OC 2ADFL 2NTFB 4KTEH 2NR6C 2O61A 5ETUB 1MJ7H 1VFMA 4TULH 3D0LA 2W59A 1UKQA 4JY4A 1ZHNA 4O4YL 2HG5A 3FRPA 4NT6A 5IK3B 3A6BH 1OWRM 4H25B 3BRFA 4P9ML 5ICZB 4GAFB 1T5WB 3FQRB 1IFHH 4G9FD 1NAKL 4MNHB 2JB6A 5DD6A 1RUQH 1HQRA 2OL3L 4LLVA 1IM9A 1C5DA 5BQ7B 2GCYB 2DTSA 5CJXC 3TA3B 2IBZX 2P24A 1EUTA 5I8CA 1EH9A 1R24B 1RUAL 3Q1SL 1ETZA 1SM3L 1AY1L 5E4EC 4PP1D 4NPYB 1BD2E 3QEHA 5IT2L 5DMIH 3EDKA 2ZG1A 3MACH 3ROLA 3JTTB 1CFNA 4HT1H 1JK8A 2X2YA 2VITA 2BSED 2XWTB 3BPOC 3V7MA 4CVZA 3SJVE 5KSUB 3MRBB 5ID1B 3FO0H 1S7WB 2X4QB 2O5ZH 3HUJE 4YHML 3WCYA 3VXTA 1EX0A 4BK5A 4JFED 4L5FH 4WFHD 3MFFB 1UCTA 5KJRH 2Q20A 3U1SL 2ESVE 4OLVL 1AI1L 4LCUB 1JGDB 5HYJB 3AB0B 2PNDA 5IM7B 3QH3A 1KIQB 4EUPH 3S37L 3P0GB 1WCQA 4OZGA 4LGPB 5LGHL 1BJ1J 5JW5B 4G8EB 3JTSB 5C2UB 5I8OL 1HHJA 1NL0L 1GJIA 4M9OA 1YUHA 1ZGLM 3WKMH 2NY6B 5D7KD 1U8NA 3C8DA 1YEIL 1F58H 4HIXL 1BZ9B 4IMKA 4OZIF 1BREA 4PPTA 5HXMA 2AEWA 1E4KA 1MFBL 4KXZI 4DW2L 1I1RA 2VDML 1CLZL 4XC1H 3EYUL 1WTLA 4PTTB 2Z35B 2Q76B 1KLGA 2YUXA 1DQJA 2JELH 5JLZA 5IIEB 3QDJE 1C12B 4JJHA 1F90L 4ZODA 1MEXL 4ZUWA 3T1FA 4CMHC 1HSAB 1ZS8B 4IRSC 1FFNA 3WD5H 4XRCA 5L8LB 3ZE1E 1MH5A 1I85C 2D4DA 2J1KA 5KOVC 1R0AL 3HS0A 3U9PH 3S5LG 5TFSH 1S7XA 3BH8B 4I2XB 1N3NB 4LVOC 3GHBH 4OCSL 2Q1EA 5IVZB 4ZPTB 1CGTA 1HXYA 2FJFA 1QFOA 4ZSOB 3GSQA 4LPVA 3HE7B 3J8F7 2XTJE 1AKJD 1FNEA 4HV8A 2AXGA 5IHZB 3VXUD 4FXLA 2GTZA 1D3CA 5F6IB 1A9EA 4L3AA 4NO3B 3LRSB 1T2JA 3MRRB 5F7HA 2Q8AL 1XIWA 1RI8A 5IOPB 4ZS6C 2FHCA 3L3IA 5IB1B 4PJBE 3TWCH 3D9AH 4ODHL 3K4AA 4LLDB 3HCVB 1JHKL 3OHXA 5CCKH 4G5ZH 3ULVL 3GI9L 1ZLWK 4P59H 1URLA 4M6MH 1XGTB 1RFDL 1U8KA 4DN3L 1AO7B 3GIZH 2AEQL 2C4XA 3MJ9H 1CE6B 5CFHA 2GK0B 4XBEL 4RCAA 5SX4I 5I66B 2QQKH 3UZVB 5FF6B 1LEIB 3WFHB 1GGUA 2BK8A 3MV9D 2H32B 4G80A 4OLYL 4OGYH 3BZEA 4X98B 1QA9B 1QSED 5EOCH 3C8KA 1SY6L 12E8H 4YHPB 3RL1A 1B9ZA 4NKIH 4E9LA 1MRDL 4F2MA 2O61B 1H5BC 5CEZL 1T7WA 3D0LB 4DCQA 3OXRA 4YDVA 4JY4B 1ZHNB 5E4IA 3RY6C 5L88H 3QCTH 2VOTA 4HGWB 4NT6B 2OXGA 4ZOCA 5CJQL 4DFHA 3PABA 4IRJC 3REVB 4PRPA 2PXYD 3SGEH 5T33H 2JB6B 2R8SH 4NC0B 2IBGA 1DUZB 3C60A 4LLVB 2XT1B 4JY6B 1IM9B 1C5DB 4OZHE 3VFOA 5KZCD 5DK2A 4JEGB 2P24B 3L95B 5FUZL 5ADOH 2A9MH 3NVQA 4KVCL 3V7AG 3O9WD 2AXFA 1ETZB 4LOUC 1EFXA 2WBKA 4R2GD 5I18H 1V3MA 2J8UA 5A16B 2G2RA 2EDOA 3ROLB 1AGDA 2EC9U 1S78C 1ZOXA 1JK8B 1E4WH 4OCYH 1ZA3A 2VUOA 5K33A 3LKNA 2HMIC 2EDXA 3A0OA 4OT1H 5EN2A 4EI5D 3CH8A 4JFHD 4X99A 1CTNA 1NC4A 3WUZA 2HRLA 4GT7A 3VXTB 4GKOA 2QR0A 3QNZB 3NAAL 1A6WH 4HIEA 4C83A 3PHOA 4PYHA 2HN7A 2X89D 2P5EA 4R97B 4HWBA 3NIGE 1ZSDA 4OZGB 4DTGH 2VC2H 1OVZA 4GG8B 5DQDH 1NMBL 3O81A 1YUHB 1U3HD 4ODTL 3MRNA 4N90E 1U8NB 1M1SA 2DIAA 2ZWLT 1HOCB 4KPHL 1F11A 2AJSL 3MFGB 3O4OC 3RY5A 3P4NA 1DR9A 3QXTA 1MCBA 2FLRT 2BJML 2KZWA 1KLGB 2JCCB 1DQJB 2VIRB 3DX6A 5JLZB 3QUZD 2B0SH 4GQ9L 1A6AB 2R4SH 5BVPL 1FORH 3OJMB 3T1FB 5LXGL 2EDNA 2Q8BL 1WWCA 3D18A 1C16A 2A1WH 2HAZA 4H0IA 1P1ZB 4K3JL 1DQLH 4R4BB 1FFNB 3WUWA 2FECL 4XRCB 5DGRA 5FGCB 1MH5B 3H8NA 1KTKE 2Y9RT 5FXCH 2X4RA 3HNTL 5E94B 3UJTH 4R7NA 3INUL 4OGZA 2BNQA 5E2UL 1S7XB 1HNFA 3ZZ1A 4JG1H 1UB6B 4WU7A 1KSRA 3B4NA 4OCRH 5J13C 1HXYB 2FJFB 4KI5E 4U6XA 5E8PB 5D72L 1ZLSL 3GSQB 4O2EA 2AXGB 4EXPX 3WKNA 1HIML 1XF2A 3T2NL 2VXQL 2GTZB 3UO1L 1DQML 3PP3K 4JPVH 5T5FL 3WXVH 4XCFL 1A9EB 4LPWA 3ULSA 3G6DH 1J5OH 1QBLL 1JWSA 2NW2A 1XIWB 3I50L 1F3DH 1CDBA 2CXKA 1SVCP 3RVWD 4LQFL 3L3IB 2DBLL 4M7LL 3LDBC 5JPMB 4MSWA 1KEMH 3OKYA 4OJFL 4NRYA 3MZTA 3OHXB 1YEGH 3KJ4B 3O11A 4EI6A 1A02N 3OJ2C 4U33A 3PWPB 1JPTH 4LIQL 1I75A 2LU7A 4FG6C 4JFXA 4AH2B 1QRNE 1D9KD 2XICA 1FGVL 2CIKA 1XF4A 3HAEG 2YUVA 2QJDA 4P23B 4G80B 3I6LE 4YBQD 5KVDH 4QRRE 4HEPG 3BZEB 1MLCA 3C8KB 2DM7A 2V5TA 3KPQA 2UZXB 1P6AB 1X5LA 2F5AL 4OGAC 5D8JH 3HMXH 3FRUA 4F2MB 3EFDH 2D7MA 3TH4T 1KC5H 4DCQB 3OXRB 1WF5A 1OWWA 4YDVB 4YZFE 3UJJL 1BFTA 3T0WA 3D25A 5E0QA 1CDCA 2DBJA 3MOAL 5B39G 3ILQD 4BA8A 2XKSA 1JGLL 4NN7B 1NUGA 4JREC 4PRPB 3NA4A 4YXHL 3PXHA 4HF5H 5C9JA 5J12B 1XEDA 3C60B 5DQ9A 3VFOB 1LDSA 5DK2B 3ZTNL 2PTUA 4NZUL 1FC1A 4ZFOL 2GJ6D 1RSFA 2CMRH 5JUEH 2AXFB 3VD9A 1EFXB 1MCNA 5C0DA 4BELD 2IGFL 1BFOA 5KS9E 2J8UB 4X6DB 4LDOB 4R4ND 3PDOA 2G2RB 1AGDB 3VI4F 3F7YA 3MUY1 1AKJA 5EWIH 5EU3A 3VD3A 3VGAB 3VXUA 1ZA3B 3MMEA 4GW1A 4Y4FC 3MGOA 5D5MF 3T2PA 5EN2B 3EBAA 4X99B 1NC4B 3MUHL 1N6VA 1J86A 4RFNB 2QR0B 3NCEB 5D7IF 2BHUA 5B4MD 4P4KD 4XCCL 4HIEB 2EC8A 4I3SL 1H0DA 2O5YH 3MV7D 3UDWA 4QXUL 2W9LA 1J8HD 4LSQL 3PHOB 1DSFL 2DLHA 3GSOA 2HN7B 3L1OL 4GAJH 1GOGA 4Z7UA 3S34H 3OAYH 3W0WE 3QG6A 4MLIA 4XMKH 1UZ8A 2BP3A 4GBXC 4KRPB 4KUZH 1A7RH 2FIRT 4OKVA 2H32H 3QQ3A 2YSSB 4PJFE 4G6JH 4W81A 3MV9A 3C5ZB 3GIVB 1E4XH 2E9WA 1QSEA 4HQQH 1DUYA 5A2IH 5MP6H 2J5LB 2Y23A 5E99H 3MODL 1JYNA 3H42L 3DURA 1H3VA 1CFTA 3BGMA 3EYQD 5DRWA 3DTXA 1ZLUK 4AZ8A 3PV6A 1SQ2N 1DQTA 3L3GA 3R8BB 5BRZA 5JHDB 4G6KH 4O2FA 5FA4A 3D18B 3FFCE 1C16B 4KTDL 3SDXA 2Z8SA 4L9LA 5K9JL 3MZGB 3PHQA 3V0WH 2X4RB 3OBAA 1M05B 2J8OA 1CTOA 4MCZB 4R7NB 2NY0C 2BNQB 4MLSA 4G7VL 4CADB 3G6JB 2E9IA 5DO2D 1W0VB 3HFMH 3AU1A 3OXSA 5A40E 5SV4A 1HYRC 5C0BD 1YNLH 1EHLL 4HUMB 4U6XB 4PJEA 5JW4M 1WTGT 3GUTB 2CKBA 3MLWH 1JN6A 4G8GB 4M7KL 1XF2B 1MIML 3O9WA 2XNAA 3ZKXB 4UB0H 1IEHA 2AJZA 1HK6A 4JY5H 3N0PB 3AAZA 3ULSB 5AYUL 1YN7A 4LCCC 2W9DH 1JWSB 1U2HA 1A47A 4LPTA 1T03L 1OAUL 4XNMA 4TOYL 1S8DA 4UU9A 3ARGA 4MSWB 4EI5A 1NFDE 3U36A 3O11B 2BY1A 3JSSA 3TBSA 2E27L 1IGTB 4M9PA 1WZLA 15C8L 2DJ4A 5DC0A 4JDZA 1TQBB 3K2UH 4JFXB 5DD3H 2X89A 4PJDA 5D6DC 2LU4A 4F7CA 2F74A 1XF4B 5EA0H 4JHWH 5DEFA 3T4AA 5IMLB 4BK4A 4QLRA 1P5VA 1MLCB 4JN2B 3G9AB 4F80A 3SDCD 2H1PH 2OBGA 3KPQB 1U3HA 1AGCA 2A6KA 4WFFD 1HCFX 1K3IA 3T77A 3FRUB 5HDBF 2CK2A 5CUSL 1Q9OB 3RWHA 1IC5H 4K7FA 3IB4A 2QEJA 3TA3C 4F9LC 2UVFA 2I07A 3D25B 1BFSA 4HZLA 4PRIB 4HJJL 5JXAL 1RUKH 4WJ5B 3G9VA 5FYJL 3GHEL 5C07A 1OAXL 3HE6C 1S7RA 2A77L 2RQ8A 4LPYA 5C9JB 3BH9B 5I30L 2BNUA 4HC1H 4XMLH 1AGFA 5DQ9B 4PLJC 4LPXA 1T2QL 1CVRA 4OI9A 1W0YT 4JGJA 3K8LA 2DQEH 5GRVK 2WWMC 3V5DA 1U9KA 4S11A 1HI6A 3E3QC 1OAZL 3WFEL 4Z76A 3FO2A 5C0DB 5I0ZA 1BFOB 5TQ2L 2DQGL 3KLSA 4LAQL 4PGDA 5HGAA 2YKLH 1VFOA 3AB0C 1BGXL 4E41E 1VFBA 1WBYA 3F7YB 4Z0BL 1AKJB 1GPOH 2HKFH 2IAMD 5MEPB 3VXUB 4Z7QE 5EORL 5C0FA 4DGVL 2EDHA 4M6NH 4Z7VE 3MGOB 5J6HA 1KIPB 2WWKO 3BXNB 4BZ1L 3DECA 5TGBA 3QCVH 3K46A 3ARWA 4OM1L 3VH8A 1BOYA 1H0DB 2AXHA 3CUPA 1LO3L 5HYSB 2VZTA 3GSOB 4NO2A 5C09E 4Z7UB 4GSDH 4PJAA 3JVGC 3M8OH 1UZ8B 4W4OA 1I8KB 1B0RA 3IAGC 1YPZE 4OKVB 3LMJH 3TGXA 3QQ3B 1D9KA 2VDPH 3GK8H 4ZOEA 5IQ7H 1E6JL 3MV9B 1CFQB 4PD4K 4XVSL 1QSEB 3DVFA 1FLRL 2A0LD 4U1NA 3T65B 4RAUA 3MRIA 3O2VL 5IHUH 1CLOH 1DUYB 1EHAA 4PRAA 1FG9C 1R5WA 2AABL 2AKRA 3N1QC 2ENSA 3DURB 2AV1A 4P48A 1CFTB 4B50A 3FMGH 1NJ9B 2FX9L 1ND0A 3QA3A 2CUIA 3K1KC 4GMSH 5DRWB 3V52H 4WCYL 4KK8D 2D03L 3DTXB 4TSAL 3L3GB 1KTLA 5BRZB 4UT9H 4LSSH 3RL2A 3HE7C 2P5WB 2BVUA 5GXBB 3SDXB 3B9DA 3TBYB 1LE5A 1S5IH 1YNKL 4L9LB 1J9CT 4WU5A 4HKXA 4XXDA 1HINH 3PHQB 3V8OA 5T1DL 3IXTA 4KMQA 4RA3A 4F7TA 5F6IC 4IOIA 3PUCA 4HWEH 5F71A 3UYRH 3W39A 4IRZL 4Y5XA 5AAWA 1YY8A 2PF6A 3OXSB 5KSBE 4QOKE 5DLMH 3VW3L 1YECH 4PJEB 3CCHA 3PGFL 2CKBB 3ARBD 2GJ6A 4LBEA 3WHE1 1JN6B 1M71A 3DNKA 5DR5H 4Z5RB 3ETBF 2AV7A 5T1MA 4MGXA 3O9WB 4S1QL 2VLLB 5ACLA 2XNAB 5I71B 3OMZA 1Z9MA 1CE1L 1H3WM 1YEDB 35C8H 4XHJC 5E9DE 3MRHB 2BRRH 1IM3A 4JLRA 1YN7B 4WRLA 4ODVL 1LILA 1LP9E 2YPVL 4DUVA 2EYRA 4AEIH 5LGJA 1G9ML 2X42A 4XNMB 1BQLH 2ILLA 3V4PL 2A83A 2F58L 1LWRA 1S8DB 2APTA 5MHSE 2J7LA 3RWIA 2XA8H 4JVWA 3ARGB 4PRHE 2I60L 4EI5B 5D1QC 1K8DA 3NPZB 7FABH 1T21A 2MJWA 3OB0H 4M3JA 3U36B 3EYVA 1HE7A 1OTUD 4P4KA 5HGDA 2AS5M 4JDZB 5TDOA 1J8HA 3FO9A 5I2IA 3U9UB 4XVUD 4HWBH 5HI3D 5C3TA 1DCLA 3DROA 2HTKC 2IFGA 1A7OH 2LTQB 4F7CB 2ZNXA 2F74B 5KBNC 4QHNA 4MVBC 3M1BA 5DEFB 1MCOH 3BT2H 1VESA 2IPUG 2VLKA 3T4AB 2CR3A 1PKQA 3RVUC 1U8OA 1JNLL 2AP2A 2EH8L 3UROR 2XI9A 1WGOA 3T2OA 1AGCB 1P4BH 2A6KB 4UINL 3WJJA 3T77B 3DRTA 4LHUB 4GG6E 3EOYG 1XCTB 3RWHB 4K7FB 1FVCA 3DWTA 2VLRA 1BWMA 1W0WA 1MHPL 1I4FA 5JMRA 2I07B 5DD1L 4HZLB 1S9KC 5KVGH 4U6HA 4XAKE 1CGVA 4WDIA 2X1WL 1QLFA 5C07B 5GRVL 5CJOH 2AJYH 4H0GA 3UX9B 3HN3A 3BGAA 1CGUA 2BNUB 2PW2B 1AGFB 4DZ8A 5DJ0B 1SBSH 3IDYB 4Q9QH 1SJEA 1YMHB 3RPIA 2C1OA 1RVFH 2PYEB 4MQSB 3V5DB 4ZFGL 1BZQK 4OCNC 1HI6B 4NJAL 2BOCA 3H3KA 2Z8WC 4Z76B 3TZVD 3FJTA 3FO2B 1KCUL 3EJJX 4PGDB 3D3VE 5C0BA 4DGIL 5T3ZE 1AE6L 1RHFA 3LKOA 1F2XK 4LMQI 1VFBB 4R97C 4Q9BA 4UOJA 5CEXB 5C0IA 2HVKA 4FABL 4X4ZA 2BMKB 2YN5A 3IJSA 4NQUA 5BVJA 5J6HB 4F7PB 4G9DA 2WV3A 1NGQL 3MRKA 3WE6A 5TGBB 3SGDH 4AG4H 2XN9E 1OD9A 3VH8B 4IMKC 3CUPB 5AUMB 1G9NL 2XV6B 5F9OH 1E4KC 4NO2B 2HA1A 1Z6JT 1NMAL 5ANMA 3MCLL 3KAAA 3G5XA 4NN6B 3SE9H 3NIFE 5HI5C 1HNGA 5IMMA 4PJAB 3RDTD 1AXTL 3I6GB 4F37F 1B0RB 2MKLC 5FCUL 3ZKQD 3KLHC 3BP7B 3BEWA 5IROA 3AXLA 2VDQL 3IS1X 1G1CA 2X70A 4NM4L 1MCHA 2NXZB 4HKJA 4OQTA 4ZFFA 4U1NB 2A9NH 4RAUB 3MRIB 5E2WH 4CN4A 3MO1B 4R6UA 4PRAB 3NH7L 4K94L 1G7MB 4TPRH 1R5WB 2AKRB 1QYGH 2AV1B 2F9BT 1ND0B 3QA3B 3ZT6A 4KUCD 1U8IA 1AQDB 3CXDL 1KTLB 3KHOA 3TM6A 3RL2B 3FB7A 5E8EA 1OAKL 1LE5B 4L29A 4WU5B 4G6FD 4HKXB 2XZQL 3EGSA 2EH7L 3GSXA 4EQ2A 3IXTB 5C9KA 1BVKA 2VE6A 3OGCA 4IOIB 1BOGA 1XIWC 3W39B 4HBCH 1OQXA 2OK0H 3LVEA 3LHPH 3DARA 3GJEA 1YY8B 3KJ6L 1S3KL 2AJXL 1WK0A 2XA3A 2VXUH 2GJ6B 4LBEB 3NOIA 4S2SA 1M71B 3EDDA 3WHXB 3KJ4C 4Z9KB 5E70A 2AV7B 2NZIA 5T1MB 4K8RL 5DRZA 5DT1L 2H9GB 3DI2B 3N1GC 4WEBL 3D0VA 3TEUA 5C6TL 25C8H 5IBLC 1IM3B 3EJZC 4PJHA 1NLDL 1T3FA 2EYRB 3L9RA 1ZHBA 3MTRA 4WI3A 2IAMA 4NNXA 5DRNA 2A83B 2FH6A 4Q0XH 3RWIB 1A6UL 1N5YH 3GKWH 1L7IL 4YBLB 1OPGL 4ACPA 4UT7L 2DL2A 1K8DB 1W2KT 1T21B 2C1PA 1RZGA 2FB4H 3P30L 5GZND 2DAVA 2ZCKL 2ZOLA 5HGDB 5I19H 1D6EA 4F8QA 2R2HA 1T0NB 1J8HB 3FO9B 2IAND 3MLZL 4HW6A 4N9OB 3OZ9H 2AJVL 1U58B 3U4EA 2CXGA 1MY5A 4KJYA 4WHDA 3M1BB 5AWNL 2VLKB 1FFRA 1DQDL 1KLUA 1PKQB 1KLFA 1U8OB 2CK0H 4XPGL 3TJEH 2EE2A 3CDCA 1OGAD 1QUNA 3NZ8A 3BUTA 3E3QE 2AEIT 3DRTB 3EO1A 4P5KA 4DWHA 2DM4A 3QISA 3C60C 5J6GA 2ED8A 3P0YL 2VLRB 1IAIM 2D7OA 3U48A 1W0WB 2VYRE 1I4FB 1F3JB 4FFYL 2F54B 3MRGA 1BM3H 4U6HB 4WDIB 4PY7B 3MOBL 3O3UN 3MLYL 4GJTB 5JR1H 4UI2A 3QDGB 1WWWX 3RWGA 1P9MA 1LMKA 4GO6B 1J0IA 1TETL 4DZ8B 3VGAC 4G8IB 2R15A 4HUXA 5LCVH 4RQQB 1SJEB 3FT3A 1A6TB 2VDKH 2C1OB 4RFNC 1LDPL 4WY7H 3AS2A 4PRDA 2BOCB 4FMFA 4LSRH 1H3PL 4OFIA 2CKBH 3T1WA 3BD4A 1U3ZA 4GXUN 1U92A 3ARBA 5MEOA 3MJ8B 4U1IA 5C0IB 1NCTA 1S7UA 3KPRA 3IJSB 3MCKB 1F02I 5DUMH 4K7PX 4KRPC 4LRIA 5BVJB 4P9HH 1BF2A 1NCBL 3MRKB 3WE6B 2IPTH 1FL5A 3DSNA 1M6OA 4PGJA 1LE9A 5IVOA 3MX0A 3TIEA 3C5ZC 3AUVA 5FUOH 5IFAL 4KK6D 5ANMB 5I76A 5J11C 3MA9L 1MVUA 2J5LC 3VD4A 4ZUUA 1BECA 1J10A 4POZD 4S1SH 1AJ7H 2PO6D 4FQXB 1GZQA 3DO3A 1CFVH 3VXRD 3EYOA 3BEWB 3S35X 1MCCA 5L7XH 2X70B 5GISH 4XPBL 4HKJB 4ZFFB 4ELME 3MV11 4OUUA 1N7ML 3GMOA 1QKZL 3BKMH 4F3FA 1IGCH 1WQVT 1UT9A 2P4AB 3S96A 5DK0B 5FYKU 1A0QL 4XPFL 3GRWA 1T89A 4OD1L 1CD1A 4PD4J 5HHQA 1U8IB 3T0ED 2DQFA 4X83A 2JJUA 4U49A 2W91A 2XKNA 3FB7B 1XGUB 1G7QA 3KWWB 5E8EB 3GSNA 1DFBL 4L29B 1P6FA 3NCJH 3ZKXC 4I4WA 3GSXB 4EBQH 3CK0H 1BVKB 1KN4H 1MAKA 2VE6B 3GJFB 3OGCB 4O58H 3QZWA 4PP1C 3RTQA 1K2DA 4NCC1 1BOGB 3QUKB 5D7IA 3O6FD 3NTCL 1CLYL 3QHZH 3GJEB 4OCLC 3VJ6A 4NQED 4I18A 2V2WA 1ZT4A 4U3CA 4IJ3B 3GSRA 3GNML 4QRQA 2JTDA 4S2SB 1CXLA 2Y7QA 1F6AA 1MFDL 4PJCA 2IQ9H 3G08A 4LLUA 5DRZB 3AROA 2XZCL 5EBGA 1N2RB 3D0VB 4U3XA 3TZVA 2FJHB 3P0VL 3LKSA 1KPUB 1G7PA 1TQBC 3RVTC 3MV01 1MPAH 2YZ1A 5CILH 3QG7L 3HC0A 1T3FB 4PJHB 4AMKH 1ZHBB 2DQTL 2IAMB 4NNXB 5DRNB 4YE4L 2CJUH 4EN3D 4P2QB 3ZHLA 1ACYL 5ESVA 3BPNB 1TNMA 1LEGA 3VXSD 3I2CH 3QIUB 1CT8B 1UM5L 2C1PB 3JBG7 3VCLA 3T04D 1RZGB 4B41A 2WLYA 3CDGA 5HYFA 5HVHB 1D6EB 2R2HB 5GSVA 4ZNEE 3WHE0 4LCYB 1BQHA 3TBVA 1EJOL 3U4EB 1A3LL 2WP3O 3RDTA 4KJYB 4YX2H 3VXMD 1KLUB 2A6IA 2B8OT 1FL3B 5I74B 3DVIA 2E7CA 1OP5H 2Z4QA 1FO0L 5ITBH 4NC1C 1VACA 1FYTB 2CSPA 3NZ8B 4IDJL 1IAIL 3EO1B 4P5KB 4AJ0A 4Y1AD 1GZPA 1N64L 5EU7C 2DLFL 3QT2A 1CGXA 2J4WH 3VRJA 3DMMD 3HNSL 1UCBL 1DBBL 1OSPH 2BSTA 3VG9B 5DWUL 3STZB 4KK9D 3MRGB 1LK2A 3SKNA 3VFGH 1NBQA 1E6OL 4JRYB 1M4KA 3S4SG 3MA7A 2ORBH 3RWGB 1Y0LA 4RSVA 1YEFL 5IKCA 3IJYB 1TTGA 3U0TA 3CNKA 4HUXB 1S5HA 3D85B 2Z8VC 5DURB 2XWBA 3RZCB 5I1AA 3SOBL 3FT3B 1ZV5A 3W11D 3OTTA 4PJXE 3X3GL 4FQJH 3I3EA 5CIPA 3VGGA 4PRDB 1YEKH 3UDWC 3RKPA 4P46D 3IETA 4QEGA 1UM4H 4HFUL 4PJ8D 1U92B 3ARBB 3DO7A 3AC0A 4U1IB 4HK0A 5MI0B 2ZJSH 4KQ4H 1U95A 1S7UB 1QP1A 1M7XA 3KPRB 3B2UD 1O5DT 4HIHA 5B22A 4DKFL 4KVNH 3RGVD 3SE8H 3SN6N 1OF2B 4UNVA 5IESL 1FCGA 1FL5B 1QSFD 1LE9B 4PG2A 4JJ5A 3MLSL 4WO4D 3WIIH 9CGTA 3TIEB 3QJFA 3WV0A 1H3UA 4CU8A 4M6OL 2BVYA 5I76B 3BQUD 1IEAA 1P4IL 1MVUB 1AGEA 4GAYA 4OFPA 1WEJL 4ZUUB 5CZVH 4HWZB 3SGKA 5EU5A 2IANA 1GZQB 2NQCA 4TRPL 1OLZA 1GL4B 3QXUA 5EBMA 5DVNA 3JV6A 5JA9A 3N06B 4YK4B 4L8DA 4L9LC 1I9IH 1X5IA 2EDTA 3UBXI 1FRGH 4L1HA 3D39B 4K7PL 3GMOB 4XP6L 1OGAA 4KFZC 5CD3A 2GTWA 2NY5L 4JRXD 2B7DT 3S96B 5EUOF 1CD1B 2DQFB 1RZ7H 2XKNB 1MIEL 1G7QB 1QPXA 3GSNB 1CF8H 3WO4C 4W6YB 1T2XA 3O9WC 2WUBH 5I71C 4R2GC 4I4WB 4NGHL 3RTQB 1A1NB 3IDIA 3ZDYF 3OAZH 2HFTA 4CN1A 4QTHA 4H1LA 1C7TA 2VH5H 4L4VD 5LAXA 2Q87A 2HT4C 4P9HC 2K3TA 2P46B 5TF0A 4LKCA 1BLNB 2B4CL 2DYPD 2EZ0C 2X4UA 3A6OA 4I18B 2V2WB 1ZT4B 3OKEA 1NMCB 3GSRB 3ARGC 4HIIA 2APFA 4QRQB 5DMYA 5KTEH 1PY9A 4WFED 4EI5C 2G9HA 3LEVH 1LHZA 5E56A 2Y7QB 1F6AB 4PJCB 2X9WA 4N8CL 3G08B 4LLUB 2B1AL 3TZVB 5GS0H 3LKSB 1G7PB 1MY7A 3CFIC 2F8OA 2AW2A 3ALPA 1XGYH 3R06B 1BBJA 3HC0B 1JYWA 4NOFA 2LTQC 1G6VK 3S88H 5IBTL 3TIDB 4JFDD 3MRQA 5ESVB 1LEGB 3I85A 3OKMA 3RNKA 1J1PH 5T3XD 4EDWL 2I26N 1IKFL 5E8DL 5JORA 3VCLB 1U3HC 3IU3B 3CDGB 3SBWA 2W9EH 5JOFA 4Y89A 5GSVB 2J8UE 4OF5A 5GGVH 1GSMA 3WXWL 3TBVB 3P4OA 3RDTB 1UH2A 3HB3D 3NCMA 2A6IB 4QCIA 4FS0A 4B53A 4WW1A 1TZHA 2PO6A 1RUPH 1B4JH 1L4IA 2E8ZA 5FGBA 5FYLD 2C3XA 2Z4QB 3FRPG 4J7RA 4OQTH 3V5HA 1VACB 2X4PB 3DVNA 5TE6L 2QQLH 1GZPB 1QLEL 4NQXA 2WQ8A 4LCWB 5I1HL 3IDYC 1G7IB 3VRJB 2P5EE 1YEEH 4NWUL 1HSBA 1TJGL 4M5YH 1A14L 3BIKA 4B7LA 32C2A 1LK2B 4GXVL 3SKNB 5HYIA 5I1CH 1F4AA 3T0EA 2HJKA 1FNLA 3MA7B 4WHYH 1Y0LB 1AQKL 2VB5A 3WO3B 5IKCB 4QT5A 1HEZB 3U0TB 3T0VA 4U7MA 3OR6B 3GJFH 4Y16B 1ZLVK 2XWBB 5I1AB 3CVHL 4OCWH 2XZZA 1KJVA 4FFZL 5EPMA 1U93A 5JIIA 2QSCH 1EVUA 3GGWA 3WL9B 3O6FA 1VHPA 4XNQB 4LFHG 3RVWC 1CDUA 5E00A 4PLOB 4I3GA 5KSAB 4X6EA 1QO3A 2O5XL 3RX5A 3DO7B 3B8SA 1QFWI 3CZFA 4HK0B 1FH5H 2OTWA 4URTB 4D0DB 1GOHA 5I1IL 4PBXA 4BFBD 4W4OC 5CSGA 1C5CL 4HIHB 1CQYA 2UZIL 1I1FB 2RFXA 4U1SA 4G9FE 1OTSC 4I0CC 3U0PA 3QIWD 4RWYH 4X7SL 4MA8L 1YYLH 3QEQE 4JJ5B 2VQ1A 5F7EH 1D9KC 2YA0A 4DN4L 5F6HI 2NXZC 4HFWA 4EN3A 1UJ3A 4YBQC 3QJFB 4A6YB 5CAYB 3QCUH 3NACL 3IF1A 3Q6GL 1IEAB 1KB5A 3V4UH 1IL1A 1AGEB 5TQ0H 3B9VA 3W9EA 3CLEL 2IANB 4JQXA 5EU5B 4ONFL 2AJ3A 3BSZH 4PJGF 5FHBL 4Q7DA 5EBMB 5DVLA 1BZ7A 2EDLA 2XTLA 4YQXH 2F19H 4L8DB 4DEPB 5CEYB 1J0ZA 5BV7L 3KR3H 1OM3H 3BAEL 1NGZA 1EERB 5CD3B 2QSTA 3U7YH 3U4BL 4JFEE 4WFHE 4Y5XC 4Y1AA 4R26H 3LV3A 4P57A 3L3HA 1R3HA 2L7UA 4MS8D 1ITCA 1OGTB 1TZGH 4FQCL 5L0QB 4HMEA 3OKNA 1EMTL 3MNWB 1UZ6F 4AIOA 1C7SA 1Z3GL 3WDHA 4Y19D 5IQ9A 4KJWD 3UTPD 4UILH 3IDIB 4H26A 5JDSA 2B39A 4KGLA 4H1LB 4QTHB 4WNQA 3PDDA 5LAXB 3X17A 1T22B 4I48A 4ZS7L 4LASH 1P7QD 4LKCB 4TNVF 1UWEH 2X4UB 3OKEB 1KPVA 3LS5H 1TCMA 3LQZA 2Z31D 4QHLA 4HIIB 2G9HB 4CAGA 1IGFL 2IBZY 4CGTA 1VCAA 2A6JA 3EYSL 5B4MC 3X13A 4P4KC 1EGJL 4P5TD 4N5UA 1TJIL 4P46A 1Q9LA 1QNZH 2YD2A 4FQ2H 4PJ8A 1BBJB 4NC1E 2Y1VA 5H2BA 1CL7I 3RKDD 2IPUK 3QHFH 4ZUTA 4MXQD 5EZJA 2NR6D 5EU7E 4LU5H 2OMNA 1BBDH 1ERNA 3RNKB 1DEEA 5C6PB 4ALAH 3RGVA 4N0UA 4X7TA 3PIQA 5ESQA 1QSFA 2MHAB 5FGRA 1A64A 2YMXL 3O4LD 3RI5K 5DFWH 3WJJC 3QP3A 4WO4A 3WBDA 5JOFB 5K59F 3WFBL 3VXOA 5FO7A 1GC1H 3WFCL 3MRJA 5DD5H 4GMTH 1F4HA 4I0KA 4YAQA 2OR7A 4MDIB 4QCIB 4WW1B 1TZHB 2PO6B 3L5WA 2HKHL 3SQOH 4K9EL 5D2LF 4JHAL 1LP9F 2X4NA 2J88H 5LG1A 4KMTH 4HDIB 3DVNB 3VXPA 5ALCH 4Z7UE 2ZCHH 1Q9KA 4H88L 1HSBB 3I75A 3QWRA 4KDTA 4X4ME 3ULVE 1LD9A 2R0WH 3MREA 1V7MH 4XCYB 4OZFA 5I1GL 1T20A 4JRXA 5DJXA 4KJQC 5I8KH 5MERA 3F7PC 4C56B 5A3ID 2BOBA 3T0EB 2HJKB 3GSNH 3WIFA 3H3PH 3EUUA 3IKCA 3JV5A 2FEEI 4MAUH 3A67H 1NANI 4WENB 1QSEE 1GAFH 5H35A 1KJVB 1JRHI 3GM8A 5EPMB 1U93B 3B5HA 4L4VA 5IMOA 1GRWA 4YHIA 4FA8A 4NNPL 2DYPA 4RMTA 5E00B 3K4DA 2OS7A 4X6EB 1QO3B 1BAFL 3CZFB 5ILTL 3F7QA 2Y07L 4XNUH 5EIIA 3ILPA 2X7LA 1G6RL 1NCDH 1VADA 5C8JA 1G0XA 2WNGA 2RFXB 3U0PB 3IU4L 5IW6A 1IQWL 1B6UA 2VQ1B 3E2HB 5IROC 5B3JE 1NLBL 2FLBT 5I6XB 4F58H 1EEYB 1JGUH 4JFDA 3CLFL 1UJ3B 4JANA 2DD8L 1NSNH 1IGMH 4DGYH 3IF1B 3SEPA 4ONHA 4EEEA 2D7TH 4QRTA 3T4YA 1TJHH 3TO4A 5F70A 3CFCL 2EDBA 1JF1A 1XGPA 3QDMA 1E28A 3PQYA 2AJ3B 1SJHA 4XPTH 1KUMA 1GGYA 2ADJA 3OAUL 5DK3A 2H6PA 4DAGH 1BZ7B 5C0JB 1HH6B 2X5PA 1IC1A 1GGIL 1FLTX 1B6DA 5SX5K 1X7QA 4XVJL 4JFHE 3KLDA 3WUWG 1JF6A 1NGZB 1L9NA 1T5XB 1ZXQA 4Y1AB 1WWBX 4TSCH 4P57B 1R3HB 4PJDE 1C5BH 4TNVK 3MRDA 1HZHL 2ITCA 3OKNB 1TQCC 3BWAB 1KPRA 2NYYD 4ZS6D 5GPRA 4ZYKA 4JKPL 2DI7A 5IQ9B 4MWFA 3NFNA 4H26B 5GGUA 5FA3A 2C7UA 1PG7X 4NZTL 3CH1A 4I48B 3OPZL 2IAMC 3IFLH 3WMSA 3C09C 5FOBA 2DICA 1D6VH 3HR5A 2WBWB 1KPVB 3LQZB 2XWJA 2ZUWA 4QHLB 5F93C 5IW1A 4O02H 4QGTA 2A6JB 2ED7A 2HRPH 3TC9A 3X13B 2WP3T 3C5SA 3CFJA 2HFFA 4JZOA 1RU9H 1Q9LB 1D5IL 5JW3L 4QHKJ 1K4DA 4PJ8B 3O41A 3N50A 2X4SB 4FP8L 3WIHH 1NPUA 2BY3A 1DBMH 4ZUTB 5EZJB 5KAQG 3X3FH 4HG4K 5I74C 1NEZA 1DEEB 3MXVL 1LO0L 2AGJL 4N0UB 3PIQB 3QIWA 5ESQB 1QSFB 1YZZA 4A6YH 5ISZA 4JM2D 2DM3A 3T3PE 1RZKC 1B2WL 1WAAA 3ZT7A 3ULUD 3RAJL 3VXOB 2A0LC 4XWGL 2PKDA 3F12A 4RGMB 3MRJB 5E2JA 2P44B 1KT2B 4KY1L 1G0DA 4BKLA 4YAQB 1IAKB 3VG9C 3T8XA 2ICWJ 3CMOL 1A3RL 4QRPD 4YHNA 5DFVC 3L5WB 1FE8L 1QEWA 3C08H 2X4NB 4RGND 3CZJA 1P9MC 4FNLL 4HXBL 4YWGH 2I5YL 3VXPB 4YXLH 3BW9B 1Q9KB 3LAFA 3I75B 1A5FL 1YJDH 1LD9B 4RISL 5IWLA 1VGKB 1S7QB 4FTVD 1S78D 4OZFB 1JNHB 1T20B 3ES6A 5DJXB 2DWEA 3HG1D 1FBIH 4FN0A 3S7GA 5H8DA 5MERB 4X4YA 4LVEA 5TE4L 4MQ7A 5E6ZA 3AVEA 4NN5B 3WIFB 1LGVA 5GRWA 3ARBC 3IKCB 1P7HL 5MI0C 4NHUB 4JFFD 4CJ1A 3NIDF 4H1LH 5H35B 4Y19A 4LRIC 1WIUA 3IDXH 4FQQA 4OFDA 3N9GH 3P40A 1PJ9A 4MJ5B 5IMOB 1MJ7L 4W6WB 3T3MF 4YHIB 2AK4D 1P7QA 4QXGL 2DYPB 3V2AR 2ICCA 3UJIH 3D2UD 3LN9A 2Z31A 3ROOA 1IQDA 2C4FU 2UY6A 2QHRL 3ILPB 3TVMB 2X7LB 1GC1C 3KPSE 3HLAA 4O4YH 5C8JB 4P5TA 2OR9H 5FO8A 4J3TA 4XVUC 4UMGA 5HI3C 1RUQL 5IW6B 3O3BA 2ZCLH 1EBPA 3TYFB 4JFDB 4YK4C 5CP3H 3BZDA 4N0YL 2HH0L 1I8MA 4JANB 4YNYA 4PJ7B 4QRUA 3P9MA 4KKBC 4ONHB 4RAHA 3BPCA 1MJJA 5HGBA 4X6CA 5B8CA 4QRTB 3JUYA 5DVMA 3T4YB 3TO4B 4NO5A 4NFDA 5DJ2A 1JF1B 1T89C 3MACL 3QDMB 1E28B 3PQYB 1RUAH 3Q1SH 5HHNA 1SJHB 4V1DE 1ZEAL 5IVXA 4E0RB 2H6PB 4YDJB 1AY1H 1EDQA 3CDFA 2O5ZL 4Y88A 5IT2H 4MJ4A 5HHOA 4OZIE 1K5NA 1INDH 4ZUVA 3RTQC 1VB9A 4ODWA 2UY7A 3K8MA 5DFTA 4YHMH 4R4FL 1GGTA 5H94A 4WWKD 1D5ZA 5D2NE 3MV7E 3QWOB 1J8HE 1XGQA 4I18C 3LKQA 1NMCC 5T1KD 3MRDB 3U1SH 2W65A 2ITCB 3L3DA 4OLVH 5I73B 4QHMA 1F4WL 4MMZC 4TVPD 1KPRB 3TZVC 3S37H 4JZJA 3NFNB 5LGHH 5GGUB 4OF6A 3BN9D 1F58L 5FA3B 3F65A 5I8OH 3UZEA 1NL0H 5CHNA 2KBGA 1KF9B 3SO3B 2XWJB 2EE3A 4JR9L 5IW1B 1VA9A 2DM2A 3V6BR 1TZIA 4HGKC 4LHQB 2JELL 4J3SA 1MFBH 4DW2H 2VDMH 1CLZH 3C5SB 1T6WA 3EYUH 1OAYH 3CFJB 5GSRA 2HFFB 5D96C 1K4DB 1NCWH 3O41B 3K8KA 3WD5L 2EYSA 5FUCC 3RDTC 5GGSA 1MEXH 1TTFA 3EYFA 1NEZB 4QXTA 3U9PL 1YMME 5TFSL 3NFPB 4J4PA 1DANT 4K55A 4KGJA 5D7JB 1FZMA 3FN3A 3ALWA 2PCPA 5ISZB 1D5BB 4QF1A 1PG7L 2FZ3A 5EUOA 5C0BE 4PB9L 3F12B 4OCSH 4YC2B 3T8XB 5GRYA 4FFVC 2WAHA 4OAWA 5FYKD 4YHNB 4FQLL 5F1SA 2EKSA 3EAKA 3KPTA 1A4KB 4YFLF 4Z95H 4LEOA 3RJQB 4X7EC 1KEGH 2V2TA 1AP2A 2Q8AH 1NC2A 4LSVL 5CCKL 5K9OB 4N68A 1UADC 4KK5D 2VDLL 3ES6B 2DWEB 1QR4A 3GIZL 1JHKH 3AS0A 1UXWA 1Y18A 2NY2B 3GI9H 4Y4FD 3ELAT 3ZKND 2EXYC 2QQKL 4ZAKD 1RFDH 4OGYL 3FTGA 4DN3H 1OLLA 5EOCL 2K7PA 4GOSA 1OARL 3X11B 4XBEH 3GMLA 3MV8D 4FQQB 4M03A 3IDUA 4OLYH 4HHAA 4NKIL 1YQVL 4WFFE 4NYLA 4PG2C 1SY6H 3IFNH 3RWCB 3E6HA 2D0GA 1U8LA 4CU7A 2R2CA 3RX8A 1UEYA 2EIBA 4QKXB 1UGNA 2YPLD 2FR4A 2CH8A 1IQDB 5CEZH 3EO0A 1KN2L 1UA6H 3VH8G 4HS6A 2VLMD 3QPQD 5DUPL 5GZNC 3HLAB 4OZGF 4CNIA 5FYJE 1CDYA 5FO8B 5T33L 2R8SL 1QZ1A 4W70A 3SGKC 3BDYL 5CJQH 2D2OA 2JE8A 5I16A 5JOPD 3O3BB 5BZDA 5FFLA 3VDBA 4UOW1 3PGCA 2IH3A 2ZUVA 2B20A 43CAA 4DEPC 3H2WA 4YNYB 5AD0A 1FGNH 2OZ4A 5ADOL 4QRUB 2A9ML 5IEKB 5JHLL 3N1FC 3BD5A 4NRXA 4N1CA 3BPCB 1I7TB 2OQJA 4WI9A 4X6CB 5HGBB 4Q6IA 5B8CB 5GS1B 5I18L 2JCCF 4JM2A 4EDXA 1PSKL 1YJDC 4OF0A 2MFNA 1LO4H 5DJ2B 4KVCH 5HHNB 1QRKA 3JWOH 3MBED 1JPFA 1MHHA 4HH8A 5IVXB 2DS4A 3IXAA 4XNYH 5L0QC 1UQSA 4LPCA 5HHOB 5D7LA 5EDXA 2Y5TA 4OT1L 4H20L 4JRWA 4ZUVB 1BP3B 4EJ1C 3BWUC 2MOVA 1F42A 2ZG2A 1I7RA 1IGYA 1D5ZB 1FNAA 1RMFH 4K2UL 5I75B 4Z0XA 1XGQB 3MLRL 3LKQB 1X5JA 4OZFH 3DUUB 1RZ8A 2FGWH 2W65B 4DTGL 1OT1A 4RIRA 4WHCA 1QSZA 4FTVA 2VC2L 4QHMB 3HG1A 4EVNA 4PB0L 5C0AA 3ZHKA 4LK4A 5I1LA 2W1NA 1J0KA 3BGFB 3O2DL 2WM0A 3T0AA 2XZAH 1NMBH 3VMOA 5CHNB 1NGPL 2HTLD 5BXFA 5E5RB 4Y8DC 1PY4A 4JPIA 2B0SL 4LRNH 4D9RD 4RAVA 2AK4A 4YGVB 2MWCA 2D7NA 2R4SL 5GSRB 3SBWC 3ARFB 1QFWL 1A7NL 2IG2L 2BJMH 4OFVA 3D2UA 2A1WL 5F8QC 1DQLL 4PJGA 1JPSL 2EYSB 4GQ9H 5GGSB 4F7EA 3DXAB 2UWEA 2Q8BH 3EYFB 3UJTL 4AQ1B 1XR9A 2KH2B 4QXTB 1FG2B 1ONQB 4K3JH 2PO6C 3TA3D 5CS7A 5FGBC 1MCRA 1MFAH 4IHOB 1A22B 4JG1L 2PCPB 3AREA 3HNTH 4OCRL 2Z9TA 3RIAF 3ESUF 1O7SA 4QF1B 2A73A 5E1AA 4Q9RH 1IZJA 5E2UH 4HG4J 3U2SA 3NZHL 4LVHB 1VENA 4HIJA 2QQNH 1DTUA 4UBDD 2BY0A 1YDPA 4JPVL 3WXVL 4BQ6A 5D72H 1ZLSH 4OAWB 1J5OL 3WFZA 3FQTB 1T83A 2VXSL 1HIMH 2EKSB 3T2NH