2IH3B

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2006-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ih3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ih3B01
4NO0B 4LQFH 5J11C 1UXSA 3BH9B 1EHXA 4FFZL 1NCAL 2VXUH 5I30L 1BQLH 2CO6B 4AQ1B 4N0UE 4G9FA 3OKMA 4ZUWB 3L95A 3PDDA 3RVUC 5B8CC 3QZWG 3PHOA 1TTGA 1Y6MR 4H8WH 1A6AB 4XPTL 3RUGF 3EOBA 2EEDA 1NBQA 1FIEA 1MCOH 3MUGA 43C9A 3MCKA 1WAAE 1X6NA 1G7PA 4XXCC 1NJ9A 1JGDB 3QH3B 4GKZA 4F58H 2VH5L 2C3WA 3GM0A 1GHFH 2OR7A 4KKBD 3SDDD 1FYTA 3V7AE 1BEYL 5L8JB 1D6VH 1WSST 2B5IB 4KI5E 3D0VB 5E1AB 3GBMH 3VWKC 3MUJA 4M7LT 4M9PA 4XHQA 4GMTH 1YEEH 2BSTA 3FT2B 35C8L 4GAYB 5JPNA 3CMOH 2GHWB 3BO8B 2RGSA 5DD6B 5HHME 3PWPA 5BCAA 1BD2E 3E8UL 1KG0A 4MSWB 3ULUD 1QP1A 5H94A 4OIIL 1CFSB 1FGNL 1EO8L 1C7TA 5EFIA 2I5YL 2DQIL 1B90A 5C3TA 2B7DT 3EO0A 3MRCB 4GG6F 2XQYG 4ACPA 3ARBD 5JXED 1FVDA 1WZMA 3QO1B 4JCMA 4OF3A 2GJ6A 3LD8C 3TJEL 5D71L 2WBJD 3QUZD 5EOCJ 4KK8C 3RI5F 3S37H 5ENWA 1BLNA 4HJ0D 5F7DA 3IU3B 2FGWH 2XKNB 4IEFB 1L6XA 2CLRB 1JGLH 4LSPH 2W0LA 3LKSB 4OZIE 1GPOH 4FQCH 4PD4K 4NCC1 2F19L 1WFTA 3AMLA 4G6AD 1AKJA 4I5BB 1MPAH 5DEGA 3N9GL 1AI1H 4NQDE 4UB0H 4WU5A 2X4NB 1G6VK 3GMPB 1ZTXH 1RURH 2R0LH 2AXGA 3NZ8B 2Q8AL 3KGRA 3QZWA 2HFEA 1OTSC 2R69H 4MJ5B 3O3UN 3R0NA 4HQQL 4HFUH 5HGAA 4HBCH 1A47A 3O6LL 1NKOA 4PV8B 4ODHH 5DEFB 4KI5C 5EBLB 2YD2A 5DQ9A 4K71C 4N0RA 1CI5A 4PREA 1MFNA 4CVZB 1OM3L 2Z31A 3BDBA 1N7MH 1D5MB 3CSYB 2CK0H 1B3JA 3Q1SH 5E6ZA 4P99A 3SDAA 4WFHE 5IMKA 1Q8MA 1WTLA 1MFDH 4O02H 5LGJB 3BSZL 5EOCL 4K7PX 1S7UA 3MFFA 3C6LB 5DTFB 1VB9A 4FMKA 1DBBH 5FO9B 5D7LA 4HWBL 3RBSA 3WFBH 3HE6C 4TVPH 5IROC 4HS6A 4G3YH 4UOW1 1KPVB 5JOPD 5DUML 4X99B 4XZUA 4YHLH 3BHBA 1EO5A 1A7QL 3TA3C 4LEOB 3HNSL 3LSOA 2VL5A 3QQ3B 4YWGL 1KN2L 3DSFH 5TFSL 3MO1B 4ZO7A 1NGQH 4KRPB 3M17A 4QO1A 2HT2C 4KKCD 4MD0B 3FRPA 4ZPTA 2PYED 2IGFH 3NCCB 4HKJA 1JWUA 4YBQD 4PJIF 1PKQA 1ZGLA 4LNRB 1NEZB 5E6IC 3C2AH 4S2SA 2EKSB 4WO4A 5CINH 4UILL 1EHAA 2FX7H 3TZVB 5B3JE 1NFDE 1T1ZA 4S1QH 5F7MC 2HFTA 1SVZA 2W65A 2VXTL 4QOKD 4OLUL 4MB4A 4BSJA 3DVGB 5D6DC 1H3WM 1WWBX 2PNDA 3P30H 2NY4B 1E27B 3EOTH 1TPXC 4IIQA 2VZUA 1KJ2A 2AAVA 1AQDA 4WNQA 3MRNB 3ZE1E 4MD5A 1EZVY 4XP5L 2EH7H 3OKKB 1U3YA 2AXHA 1JGUL 3HFML 3OKDB 2MQ0A 1HZHL 4Z95L 3FQXA 1XT5A 2NLJB 3OF6A 1XGUA 3LY6A 3UJIL 4KQ3L 5F72S 2DQHL 4LPVA 2R1WA 2X4RA 1T22B 5TE7L 2V5YA 1MLBB 3DUSA 2ADFL 2WINB 3ILQD 3UPAA 3O3EB 3QT2A 2VDNL 3VDCA 3FO0L 2JK5A 2FX9H 1OY3B 5I8EB 1K5NA 3T2NH 4TSAH 1YJDH 3WXVL 2MHAB 2J8UF 4LP4A 5C9KA 1U95B 3AM8A 3QUYA 3CVHB 2I9TA 4C59B 4HS8H 2FR4B 4FFVC 3OR6B 5AG9A 2VNCA 1PX3A 3LN4A 4Y4HC 1INEH 1ULVA 3BPCA 4WFFD 5E2VL 1P4IH 4I18A 3I75A 2L7JA 1PKOA 3L9RB 2OR9L 1NAML 3O2VH 4IBLT 1YY9D 1FFNB 4XB7A 5SWZA 1RK1B 3O2WH 3IDYB 3QIBA 4RWYH 1T83A 4X6BB 1I1YA 1VKXB 3HC3H 3D39B 1ONQA 4JQIL 1WZKA 3OX8A 3RNQB 3Q48A 4YNYA 3MV01 5D70L 4FZ8H 4ODTL 3BWAA 1BF8A 1WBXA 3EIFA 3SCMA 3TN0B 3TIDA 2XOTA 1MFBH 3QDGE 3SKNA 1UT9A 5MENE 1AE6H 5E9DD 1J8HA 4DZBB 5IJKC 5EOTB 1F4XL 3GIVB 1S7VA 1HKLL 1U8IA 5T1MA 4D9QE 4YIQA 4M00A 3MLTB 4QY8B 5C0JB 3OKEB 4RA0C 3UTSE 4OCNC 4RBPK 3ARGA 1UXSB 1G7QA 4J8RA 4NUGH 1EERB 3NGBC 4HWZB 3ZE2F 5DUPH 2F74B 2VLKD 3N85L 3RTQD 3OKMB 1EUUA 1ZKAA 1XEDA 1A3RL 5IFAL 5AWNH 4MQSB 4NJ9H 3WNPA 3LB6C 1JGEB 43C9B 2R0ZL 3MCKB 1OCWL 4P2OC 3BZDA 4E9LA 2E6QA 3FQRA 3MLZL 5CBAA 4NRYB 3AY4A 2BSRA 1CTOA 1KXQE 1S7TA 2ITDB 3VFUA 3KWWA 2W9EH 4NC1E 4RA3A 3CC5A 4YC2C 3BEWA 3KYKL 1NUGA 3MBXL 3VU2A 2H26A 1D5BB 2BY1A 5MEPB 3ARVA 4LVNB 1AD9A 3VXUA 3DX9A 4YDKH 1NC4D 3WKMH 3N1MC 1EGJL 4V1DA 1QEWA 2P8LB 3OJ2C 3U6RB 2PXYC 3JUYA 2BY2A 1C5BH 5JMRA 2IPTL 5EO1B 5KS9F 3PWUA 2XQYK 2JE8A 4Q9QH 1FVDB 2V2TB 5INDA 3MRGA 4NQVA 1BJ8A 4BKLB 3AU1A 2ZZUT 5DFVD 1ES0A 4MXWH 1PJ9A 2KH2B 2EE2A 3MRMA 3K3QA 1BBJB 2E6PA 3M45A 3GMLA 2AK1H 4W4OC 1XR9A 2R2HA 3IDMA 1YEDA 1JPSH 3OAYH 4KTDH 1MH5B 4NIKB 5C0BE 3MXWH 2IAND 4HIHA 2EECA 3GMNB 5BQ7A 3ARFD 5GGRA 2Y72A 3QZWB 2BRRH 2HFEB 4CW1B 1LE5B 1U93A 5HGAB 1P2CA 1FG9C 4RGNE 1BJMA 3MNWA 3W9EA 3KDMB 4YHPB 4N1HB 5DQ9B 4DVBA 5JTWA 1YMMD 3MACH 2QV2A 1XGPB 2XPGB 1EAPA 1FLTX 1FZMA 1NFIA 3RWDA 2QEJA 4FQ2H 3GHEH 3WJLA 3V79C 4IRSB 3WIHA 1NGPH 2EC8A 3BYTA 3L7FA 3V8CA 5FYLE 5IVXA 4NGHH 3S35H 5IHLB 1CXFA 3RZCA 4WUUB 2ERJC 1S7UB 3C5ZD 4P23A 1SBSH 2D0FA 5C2BL 3D9AH 4I0PC 1X5FA 3O2DA 3C5JA 3D25B 3QCUL 2DTSA 4NDMB 1QLFA 1C7SA 4MD4A 5I75B 4L8CA 2ESVD 5DD0L 4CMHB 1C1EH 2DM2A 1A3LL 1BM3L 4FQQB 4OFVA 3BGMB 4KUCD 4U3HA 4Y2DD 3L3DB 1RJZA 5CCKH 3GBNH 5ID1B 1OTUC 3EYOA 3KPSE 3GMOA 3W0WE 1NGWA 4NQEA 5D96B 1LHZA 3P77B 4OI7A 1MRCH 4MS8C 4XX1G 1H8NA 1K3IA 5FKPB 2O93L 2FJFA 2P49B 5CJQH 3MV7E 1JWUB 2DD8H 4LKXA 1HN1A 4EN3D 1QFWM 4LHQB 2HRPL 4XBPB 5EZIH 4FTVB 3VXQB 3LKPA 2WLYA 1OQOA 1BQSA 2E8ZA 1YZZA 1U2CA 4RGNC 2NTFA 4XGZB 3C60D 3THMH 1KTDA 4Z7OE 4JDZA 3P9MB 1L9MA 5L6YL 4CN4A 3BI9X 4HUMB 4M93C 3HMXA 4LCYA 1YNLH 3GSVA 2O5XH 2F9BT 2YKLH 4YPJA 3WJJA 1DQQB 1N64L 5E5UB 2JB6A 4OZIF 4P0DA 3GJFA 3U1SL 5CJ5A 3JWOH 3MQIA 2F53E 3V5HA 2IH3A 2Y06H 1G9NC 1MQKH 1IAOB 4WNQB 2MQ3A 3LQAL 3SE4C 3MMEB 4JRXB 3PG2A 4G8IA 4L9LC 1PSKL 4H0IA 4PJ7A 3GGWB 4KHTH 4ENEC 1OQXA 5IVZB 25C8H 3UZVB 2YWZA 1J0ZA 4HD9A 2DB8A 4PJEE 3PHQA 5DJ6B 1EJ6A 3CDFA 4LVEA 4LAQH 4X5XA 4H25B 2J12B 4N0YL 5EIIB 2C1OA 2FNBA 3BEVA 4JGMA 5DJ2B 4R4NC 3NPZB 3KXFA 3SPVB 2BHYA 5EPMB 2ENSA 5I6XB 1K4CA 4NZUL 1FC2D 2EO1A 1QRKA 5HVHC 2A77L 3PQYD 5B3NA 2GEEA 3IFOA 5DC4B 3RDTB 1F6FB 4N5UA 1RUAH 5JIPA 5I71C 4XMLH 1T6VN 1TVDA 3IJSB 2QKIA 4YHOL 1P84K 4EUPG 4X6CB 1NH6A 2DLFL 3QULA 2QQNH 4XCEA 2GQHA 1N0XH 3MX0A 3TT1L 3S36X 1BIIA 5T5NG 2H2SD 2P47B 4Y5YC 2NX5A 1AGFB 4GRLB 1ADQA 1FYTD 2H3NA 5IBTL 3QI9C 5BRZA 3TVMA 3TNNB 1MJ8H 4IHOA 4I18B 4AJ0A 1JK8A 4H1LG 4B7LA 2HT3C 1KEGH 2AEQH 1NCDH 2YD8A 3WLWD 1FRGL 1YEGH 5LWYH 1HYRC 3TCLA 2NXZD 4IOIB 5C0RH 3CFCL 3PWPD 3P4LA 3SY0B 3Q3GB 2B1HH 3BGAA 3OX8B 4RMUA 3V0WL 2VLRB 2B1AL 1KJ2L 4XVUC 5I76B 1AY1H 5J3HD 4YDIL 3MRQA 3BWAB 1J1OL 3SCMB 3F62A 4OUOA 5ALBH 1JUFA 4G5ZL 2X4SB 2EYTB 1NFDF 2GJ6D 1MJUL 1RZJH 4WY7H 5C0CE 1U8IB 2BFVH 1J88A 1IGML 4OFPA 3BH8A 2BDNH 2WP3O 5T1MB 3N1PC 3DXAA 4YIQB 4C56D 5DQJB 3U0WL 5M95B 1IILE 1U41A 5FF6A 4R2GD 2D9CA 4OF0A 4FABH 5DI8B 3T4AB 3ARGB 1NMCC 3GMRA 5DRXA 1PD6A 4FQXA 1AKJD 5EULV 4B41A 3FTGA 3IFNH 5CD5C 1YUHA 5CBEA 4BUHA 4OLZL 5DRWA 4LLMB 3BKYL 2NY1D 5JA9A 4M6MH 3ZE1F 2BSSA 4LCIH 5I16B 4QRPE 3CCHA 3RHWK 3GB7B 5I1LA 3LQZA 2J8OA 1YEHL 3F58H 3ILPB 5ISZE 1IKNA 3GJEB 2Y6SD 3MR9B 3JUZA 5L2KB 5CBAB 3RX7A 1NQBA 2C3GA 3KWWB 1MFEH 2BHZA 2Z31D 2DYPB 3K4DA 1J18A 1O7VA 3OV6A 4QTHB 3GK8L 2HVJB 3W5MA 3FHQA 2NY3C 5F7KC 1A14L 1AD9B 3CFEB 1NGXB 3MLSL 2DN7A 5D1ZA 1LEIA 3SO3C 3WFDL 1IAIL 1NGZA 5K59E 4NQUA 5ITFB 2EEAA 3MRIA 4QRRE 5D7LD 3C9NA 5F3HA 4YE4L 2IBGA 3ARWA 4XC3H 1HINH 2GY5A 5EH1A 1S5HB 1F11A 1IT9L 2E9IA 1OB1B 3MFGB 2VDML 1ZA6B 3MYJA 4MNQA 4OJFH 4FFWC 3FQTB 3AU1B 1KLGA 4PG9A 1ES0B 2OM5A 3V0VA 4TQEL 2F58H 1Q0YL 3T08A 5D1XB 1F3JA 1LEKB 1P1ZB 1CE1H 1T6WA 4HXBH 2R2HB 3QEHA 4Y5VA 2FIRT 1YEDB 5HI5D 1FDLH 4WI2A 3TP4A 2APFA 4YJZL 2G5BB 2JJSA 3SDXA 3WIIH 2IAMB 2D31A 3O6FC 4YBLC 4XXDA 3O4LB 2D9QB 4HEME 4WO4D 1CFBA 2ARWA 4WWKD 1MY5A 3Q6GH 4PB0L 3ZKNC 5F1IB 1AR1C 3SE9L 1P2CB 2BY0A 3GRWH 5E7FA 3OBAA 2E6JA 3MRPB 2OMBA 5FUZH 3I2CH 2Y5TA 3KPRE 4NQXA 3WO3B 4ZPVB 1XZ0A 2A9MH 4JJ5A 4X7DC 3GJFK 1PQZA 1MNUL 1W0VB 5JW4Q 2Y7QA 1U8PB 3QQ4B 3RX8A 1YDPA 3KS0J 2R1XB 1NL0L 4PUBL 2P1YA 2HTKD 2NW3A 4P4KA 4Y4FB 5IVXB 1Z0MA 2O5ZH 5I1IH 5E8DH 1CYGA 1L4IA 4DKAA 2H32B 4P23B 5D7KE 3C5JB 4NRXB 1QLFB 2ENYA 3LKRB 4KUZH 4L8CB 3H9SB 3I6KA 4K8RL 1N5YL 3CUPB 15C8H 4XH2A 4K2UL 4MNGA 4JB9L 3FQWA 3MV9B 5T33L 4QHMA 3HAEG 3KPNA 3O6KL 5LBSH 4Z18A 4QXUL 7FABH 3MV8B 3LKNB 3EYOB 4TUOA 4S1DC 1XIWA 2DIBA 1WBZA 3IDGA 2L0DA 4GRMB 5DLMH 3B9EA 3MRJB 1SYSA 4BUGA 1JPTL 5GGVL 1OSPL 3QUYD 1WT5A 4WHCA 3H42L 3RFZC 1NBYA 3K74B 1P53A 5LAXB 2P8MB 4JFDE 1HCVA 1IEAB 3L1OH 2FEEI 2CUHA 4UTAH 1KTDB 1LEGB 4P3CL 2XZQH 1RZKH 1IM3B 4ZTOH 4LEXL 4NT6A 1KF9B 5K33A 1P4BH 4OV6F 1QSFE 1NBVH 2I26N 1INQB 2WSKA 3GSVB 4IRJB 5EZOH 3MODH 1A1OB 1JI2A 2XN9A 1LNUB 5KSUA 2BNQE 1J1XL 5F9JA 5F3BB 1F97A 3LPGA 1BFTA 4UDUA 3RUGA 3V5HB 2VXSL 3FFCD 1RPQA 2IH3B 3BPNC 4ORZC 2Q20A 3MBEC 5FA4B 4XPGH 3CXDH 3BISA 2QQKL 4JREC 3O2DL 1J8HD 1HIML 3JV4A 3WE6B 5KSBE 1Q9WA 4PJ5A 3ARBB 3HC4H 1KBGH 4OFKA 3V4PH 4GMSL 1A3QA 3D3VE 3PHQB 4JLRB 5D7JC 4M6NH 1I9JH 4JPKH 3Q6FA 3NFSH 4ZO9A 5JHDA 2EDWA 3BEVB 3WFHA 4CVWA 1G1YA 5HDQH 2PR4H 5HYJA 3LS4H 1BMGA 1OGTA 2BVPA 3UTTB 4XPBH 4APQA 3KJ6H 5KG9A 1AIFA 1LD9B 1PBYA 3BESR 3BKMH 3DTXA 5T1DL 2LVCA 4S1RH 1SYVB 3I6LE 2XT1B 1YC7A 2DMKA 1N4XL 4J7RA 4Y8DC 5JW4N 2HMID 3MJ7B 3JWDL 2IBZX 2N56A 4GG6A 1QG3A 3EJYD 1I75A 4LIQE 2CDEB 1H5BA 3L3OA 4P9HL 5DMYA 3NA9L 2H8PA 2Y25A 5H37H 3P11H 3U9PH 3HMXL 5F88A 1QSVA 1YY8B 3QWRA 4M5YL 1KTLA 4JFQA 5J1AB 1IAII 1MAJA 3D87B 4HKBA 4Q9BA 3QA3A 1WTGT 2XTLA 4WW2C 5E94B 5TQ2H 3AAZA 2CRYA 3VXUD 1Q72H 4DUXA 1T04A 1V05A 5FOJA 2DIJA 4HDIB 4R0LB 4V1DD 4A2MA 1T1YA 4RNRB 2Q76A 4U1GC 2EIDA 4NN5B 2YHGA 1BQHA 3MRQB 4LBEA 5JXAH 3AVEA 5ID0A 4PJBE 1KV3A 1BP3B 4K8RD 1JUFB 3I02A 4G7VH 3FOLA 3VWJA 1GJIA 2YA2A 4MAYC 2F15A 1YEJL 3MLPA 4Z7OF 4GW4A 3VXRB 5KVFH 1GGIH 2G9HA 4DEPB 3PL6A 3BPLC 3DIFB 5T1LD 3QAZB 1ROWA 5FF6B 1CTNA 5JNYA 5LXGH 1RZ8B 4X6DB 4OLYL 3VI3E 3MNZA 4WTZA 1DVFD 4AMKL 1HI6B 3FTGB 4X80H 3EYVA 1RJLA 5CBEB 1K8IA 3OJDA 1QRND 5DRWB 4PJDE 3B43A 1KENL 1ZVSA 2XKSA 3QFJD 3TIEA 1P6FA 2BSSB 3S88H 1BX2A 1RZ7L 2VDOL 3V52L 6FABL 4EUPB 5IHZA 4PP1C 4PJEF 1KT2B 3I3DA 1QFOA 3ARDB 1SJEB 1ADQL 3OSKA 2VDPH 2QR0A 3M1BB 4N1CA 3BQUA 4OCRL 3VRJA 4GOSA 5SV4A 3T0EB 3TFKC 4U3XA 4HH9B 3S9DB 4H1LB 3FRUB 2WQ8A 1CS6A 3MROB 3U46A 1I1AB 2YRLA 2R2CA 2UUDK 3P4NA 4PJIA 3TEUA 4ZFGH 4WENB 3WFCL 1Z9SA 4K9EH 4ZS6D 3RZCD 5D1ZB 4GAJH 1KPUA 4Z77A 3QUMA 3HA0A 3SE8H 3AREA 5D7IB 2VOTA 1AGDA 4WCYH 3R8BB 4G7YL 2QQQA 2CIKA 3QRGH 5AZ2L 4CMMA 3C9NB 3QIUD 4OLXH 3EFFB 5F3HB 2DM4A 4XBEH 4WDIB 4PS4L 3RY6C 4PJAF 4JPWL 2EXWC 3TLRA 5IP4A 4XCNA 3WDIA 3EO1B 4RSVA 1P4LB 1CLOH 1NBZB 3DGGA 3DRTA 3TF7C 1KLGB 4J1UB 1OD7A 2R56L 3KHOA 4UINH 5HHXL 4BSWB 2VIRB 1KCUL 5KOMC 3PXHA 3A67L 5FYLH 1G7IA 4HF5H 2XICA 5E99H 2UY7A 1ZLVH 3UDWA 1V8HA 4AEHH 4ONGH 1G9NH 3SO5A 3K4AA 3RVVD 1EJOH 4R8WL 4CN1A 4HBQA 2BNUB 3ZKXC 1KGCD 4OLVH 4YHNA 1F3RB 5C8JB 5I66B 1AXTL 1NC2A 2GY7B 3JBG7 2X05A 1YMHA 4X9HA 4BQBA 2R39A 2YPLD 3O3AB 4MJ6A 3QIWA 4MCYB 1EFXB 5L7XH 1X5KA 5DJAA 5IB4A 5C71A 4LMQE 5BZDB 4NQXB 2HT4D 3U36B 4M9OA 1KFAH 2X5PA 1GC1L 3NH7L 4JJ5B 2Q8BH 4R90L 1BOGA 5CEXA 5B4MC 3SOBH 2RFXB 3ZO0A 4LQFL 4Z8FH 1JPGB 3BRDA 3VH8A 5FYJH 3G6AA 4M48L 2VXUL 3FB6B 4P4KB 1QBLH 4PRHA 2FWOA 3FT4B 2J8UA 1AP2B 1UWEH 5B38G 5HVFB 1HILB 4H8WL 1QTYT 3IAPA 3FB5A 1KCVH 3DJ9A 3CSGA 3TPUB 3ULVE 2R8SL 1MCOL 5E9DB 3I6KB 2IPUG 2B8OT 1CLCA 3HE7A 1T2JA 5TPWH 4HULB 3P40A 1P69B 5F93C 3DX6A 4JZJA 4F58L 2B39A 4M4PA 2DI8A 4G8GA 3WDJA 1D6VL 4ZAKA 4F7PB 4PY7A 4OBSA 3FQNA 1ND0A 3GBML 4NO2B 4LCCC 4JDVB 1S7SB 1IBGL 4TUOB 4GMTL 1YEEL 1QD0A 1IARB 3T0AA 4DAGL 5IFJA 1QR1B 4GW5A 1WBZB 3CMOL 4AIXA 4R3SA 1Q9KB 1YPZB 1AGBB 3GMQA 3RTQB 1JBJA 5AAMA 3AMKA 3B6SA 5K59F 5FV1L 4PTTB 1U8JA 4ONOA 3LS5H 5CJOH 1TETH 1FPTH 3Q0HA 3RI5K 1NBYB 2P24A 4N8CH 4OZFG 3WHXA 2NX5D 4NZRH 5GIRA 2EIEA 5BRZD 2B5IC 2V17H 3H3PL 2FB4L 3V0AC 3V4VH 3S37L 3L3GA 1EDQA 1FE8H 2FGWL 1HQRB 3QNZB 4LSPL 1MIEL 2ED7A 1GPOL 1NANH 4R97C 4P46B 1T3FA 4X4YA 5DJYB 2IALA 1MPAL 3CIQA 1AI1L 1XF3A 1G9MH 1ACZA 4UB0L 4QNPE 4Q0XL 3ULVC 3S97C 4WU7B 1ZTXL 3TBYB 1RURL 2R0LL 3JV4B 2ARJQ 4HKZB 2R69L 3MREB 3EDKA 4HBCL 3DYPA 4RFOH 3WS6A 4ODHL 1G1CA 3T1FB 1ETZB 1B2WH 1UM4H 5AZEH 2YD4A 1FCCA 4MMZC 3HAEB 5HYJB 3FB7A 5IEHB 4P5MA 5I18H 4TUKH 2BVPB 4FQXD 2BCKB 5IQ7H 3A0OA 2CK0L 3VCLA 3HG1A 1WGOA 3Q1SL 2OL3B 5GISH 2P7TA 1A7RH 2HWZH 3BZFB 5FK9A 1MFDL 4O02L 3WN5B 4F8TA 3O3BB 1MRFH 4PLJD 4IDJH 5B8CA 4OAWB 1E6OH 3GSNH 2WIMA 1QNZH 5JORB 1NCWH 3CX5J 3SE3A 4QXWA 3IYLW 2CDGB 3V7AG 1H5BB 5EBWB 4XNXH 4AIZA 4G3YL 3EJZD 2W92A 3OKYA 1T7WA 2X44D 5C2UB 4TTDC 4YHLL 4OZFA 1X4XA 2C3VA 1FZJA 4H26A 5A40E 3B4NA 3DURA 3DSFL 5CUSH 2X9YA 1A5FH 1YEKH 2OP4H 4X6FB 3ZKMD 1NGQL 3TNMB 2EDBA 5EDXA 4TUJA 3VWKA 1M6OB 4HKBB 4RGOH 4S1SH 3VFSB 1HH6B 4U1HB 1CICB 5DURD 3VFOA 3U79A 3FONB 3RGHA 2IGFL 3FAWA 2NCMA 4U31A 5E2TH 3PGFH 2JTDA 3L3JA 3RY5A 4QXGH 5MEOB 1TJHH 4XMPH 5ID0B 1DFBH 4O51A 1FL5B 1SM3H 5K9KA 3C2AL 3E6FA 4F37F 4P5KA 1KCKA 2GJJA 5C0EA 1DBJH 1NMAL 1R3KA 4MNQD 2FL5A 3BN9D 4GW1A 4Y2DB 2RBLA 1CE6B 4JO3H 5C0AE 1VADB 2NMSA 2A0LC 2X7LA 5TH2A 4N0UA 3P30L 2DQJH 4YK4B 2NNAB 3EOTL 2WW8A 1RJLB 3E1F1 3OJDB 4DGYH 1AQKH 1OT1A 1ZVSB 4U1MA 4FMFA 5T3ZE 4HEPG 1WAAA 1KXTB 2ADJB 3C8HA 4N0CC 5KSBF 5C7XH 2EH7L 2VQUA 3C60B 1MREH 1X5HA 4EVNB 5F7LB 3V95A 2QR0B 2AKRA 5E4EB 1ZEAH 1R3LA 4QCIA 4DZ8A 2NY4C 5DDHA 2QSQA 1BD2A 4MA7L 1K2DB 3EUUA 4JO1H 3RWJB 1RZGB 5A43C 2H9GB 3P0GB 3C6SA 2Z91A 4JN2A 3VD3A 3L3HA 1KJMA 1F02I 2EDTA 3AREB 5GSVA 2CO7B 1AGDB 3FHAA 2CIKB 5IFHH 3ZT5A 1CFNA 1A4KB 4RMRA 3HE6A 1NGYA 4LU5H 4YDVA 3RWGB 5IROA 2RIKA 4HS8L 1U3HD 4JPIB 5I17A 4XCNB 2WUBH 4PGBA 3TA3A 4OCMC 4LAJH 3VJ6A 1TIUA 2A83A 1P4IL 4EXKA 3GKZA 4LASH 1IKFL 4OZIA 4Y4KB 1MCNA 2NY6D 1XIWD 5C0GA 4WFED 4F57H 4RWYL 3HC3L 3VGGA 1OP5K 2D4DA 3RVWD 3R0MA 3H0TA 4WI8A 5ESQB 4NQDA 3P73A 3OJVC 5A2IH 3PQYB 4BZ1H 4FZ8L 3SN6N 1XGQA 5E6IA 4PJFF 4AL8H 1MFBL 4TVPD 1AE6L 4PRIB 3VXPA 3IXTA 4M1DL 4FP8L 1EH9A 2C26A 3HZVA 4L9DA 1NCCH 3OB8A 1FZKB 1MHPH 2YC1B 3IDYC 1T0NA 1DR9A 2EXYC 1UB5B 5BXFB 3LAFA 1J7VR 2NXZB 2XN9D 5DYOA 2NY2D 1LDSA 5KSVA 4NUGL 1WFUA 4U6VH 3VFVA 3QUML 4PJDF 4IS6A 1RAMA 3DUUA 4KU1A 1YNTA 4LLVA 2ID5A 5EWIH 4NJ9L 4Z5RA 4PJ5D 1R5IB 1JNHB 3PGDB 5IK3A 4GXUM 4E41D 2FH6A 3QWOA 1DE4B 2VN4A 4ETQA 4WFGD 1SHMA 3IFPB 4N8VG 3QFDB 4JFHD 1EEYA 2EICA 4G8GB 1KLFA 5HI3D 5GGQL 4C56B 3FQNB 1ND0B 2CIIA 4R2GB 1S9WB 4APQD 5IV2A 2GIYA 5FYKH 1RHFA 1INDH 2ARJA 5K9QI 2NXYB 4HMDA 5KN5A 4R3SB 3GMQB 1DQDH 3S98A 2VB5A 4OIBA 4YDKL 4LSRH 1K85A 2NY1B 1MRDL 4BK4A 1T66C 1RZFH 3INUH 3NAAL 1HNGA 3KG5A 1C5BL 2G60H 4WTWA 2P42B 3SKOA 1NFDA 1JV5A 2BY3A 3KPQA 4HFWA 3WHXB 1A6UH 3VGHA 2QADB 4U49A 5CKAA 2C3XA 2VDRH 3KYAA 4CNIB 4Y4HA 1D5ZA 3WUZA 1WCBA 3QWRD 3LKQB 1H15B 1KPRB 1GRWA 1N2RB 5IM7A 3V6OC 5DVOA 2AK1L 5I1KH 1LP9B 1I1FA 2ZUWA 5EO9B 4X9BA 5DSCA 5FM4A 2IALB 2IH1A 2GK0A 1JP5A 1JPSL 2ED9A 5TE6H 1MCBA 4DVRH 2X4PA 4UAOC 4WUUE 3MXWL 3UPCA 4JVUA 1HHHA 2XZZA 1WITA 2OK0L 3BJLA 2R4RH 3F7VB 5HHQB 3HKFA 3VWJD 5B38B 2BRRL 4I3RH 5IJKA 1XMWA 5IIEB 3BFOA 4GUPA 1N59A 3B5TA 1CXHA 5CP7A 3PL6D 5BV7B 1KB5H 3MACL 4U1NA 5A3IC 1IQDA 4N8VA 1WFNA 3FB7B 4TSCH 3C8KA 5E5MB 1FLRL 4FQ2L 3GHEL 2YZ8A 1J9CT 4XPAH 4R7DB 5CHNB 1KLUA 1NGPL 3MA9H 3LCYA 5DS8A 4QHLB 1HXYB 2R9HD 3D1MC 3EJJX 5EU5B 1CDIA 2PTTB 2ZKHH 4NGHL 2XA8H 3S35L 4FTVE 4AM0A 5EU4A 2D0GA 3I84A 3ULVF 3VXMB 2DMBA 2QHRH 2FYYB 4D9RE 5EUKA 1G9EA 1S9XB 4P2OA 4O9HH 5H2BB 4OZFB 4HJJH 5BS0B 1PEZA 4JFFE 1DEDA 2VERN 5I73B 1BAFH 1F4YH 2HA1A 4IRSC 4WUKH 5CCKL 2ZG3A 4CN6A 1H8OA 3CJJA 1NCAH 2ATPB 5I30H 1JYNA 2DQCH 3O45B 2MFNA 1YN6A 5C9JA 2BVOA 2GFBB 5CJQL 1UWXK 4XPTH 2R2BA 2OTWB 4PTUA 5F1NB 2DD8L 4NM4H 3NCJL 1CIDA 3MRRB 3QDGA 3V6ZA 1UZ6E 4JRXE 5EZIL 5MENA 1KTKE 3RIFK 4FQLH 1U58A 1DQLH 4P5KB 4M7JH 1R3KB 1WVZA 3T04D 3THML 4MWFB 1Q0XH 2AJXH 3LD8B 4XCYA 2F54E 3WNOA 4KK9D 1WCQA 2X1WL 4YEFA 1YNLL 3WS3A 32C2A 3UTSA 5EA0L 2O5XL 4CRPA 1ZLSH 3QP3A 4Z7NE 3E8UH 1J8KA 1UVQA 2UZXB 4NCC2 3OXSA 2JIXA 2I5YH 3JWOL 5LG1A 5DFTA 1P6AB 1MQKL 4KRNA 3MNVA 4QYOA 4X6CE 5IB2A 3S34H 3SHSA 4KHTL 1NC2D 25C8L 3QIWD 3TJEH 5HGBA 5D71H 3SGJC 2E7LC 3SGEH 1C5DB 3QEUA 5DJXA 5I9QB 1FAKT 2ZCLH 4LAQL 5KVGH 3JTSA 3BZEA 2AKRB 3LMJL 3WIFA 2P44B 3MXVL 5IJVA 3UC0H 1WICA 4GAFB 2F19H 5HHMB 1HDMA 3TBTB 4OQTH 4YZFE 2JELL 1B6UA 3HLAA 5T3XL 3CLFH 1FP5A 2X09A 4KFZC 3ECBB 4JN2B 5JZ7C 2VLRE 3F7QA 5CIPA 5TGBA 4PJ9A 2ICWB 3V5KA 1RUAL 4YPGB 2GAZA 1F5WA 4XMLL 4I0KA 2UZIH 5D5ME 3TJHC 4AZ8A 3V4UH 4Y16C 3PWVA 3IVKA 2QQNL 1IEHA 3TPKA 3HE7D 4Z9KB 5HHOD 4NBYB 5H35B 3O81A 4LGRB 4U7KA 1TJGL 4BH7B 5F6IB 4PGBB 3VJ6B 4CDHA 2D0HA 3ISWA 4ZAKD 1AJ7H 1OM3H 5C0DB 1MJ8L 5F7FA 1JWMB 1KEGL 2DQEH 2AEQL 3MGTB 4KY1L 4XP9L 1NCDL 2WWMD 5IESH 2VLMD 5FYKU 5D8JL 1FFOA 1H3PL 3FB8B 5C0RL 4NFDA 3RDTC 5ICXA 3BSZH 5C0BA 4NQDB 4JM2D 1CGVA 5KZCD 2J6EH 4OGAC 4X8JB 3DETC 1AY1L 4KPHH 5TDNA 1DZBA 5E4IA 5FO7A 5DUMH 2ADIB 2OSLB 1A6WH 1QQDB 4RX4A 4XNMA 3HNSH 1XF2B 2CLVB 4NO5A 3IXTB 4QRUB 2X89D 1GGCL 3ZYOA 4XRCB 1VFAA 3VE0B 3OHXB 1RHHB 1RZJL 5L2KE 1X5LA 2BFVL 4GG8A 5DD1H 2MTPA 3STLB 1S5IL 3NCYP 3PNWA 2BDNL 1T0NB 4M7KH 3D85B 4R4FL 4NM8L 5LCVH 4MB5A 1UKTA 4FABL 3RWHA 4LGSB 2XWJA 2OCFD 2G2RA 5CSGA 1FH5L 4IS6B 5KSAB 4WEMB 3SE4A 1DEEA 1F3DH 1CGSL 3DUUB 3FO2B 1YNTB 4M6ML 4L9LA 3ALWA 4LQ1A 3S4SA 3MRHB 4Z5RB 1E4JA 4HIEA 1VA9A 4E5XB 4Y7MA 1M7XA 3E6HA 5HD8D 4BFIB 2B4CC 4URTB 4X98B 3QWOB 2ZSWA 3PWJB 4OLUH 2VAAB 1M05A 2EDLA 3GI8H 3Q5OA 3MA7A 4OKVB 4JRYE 2DIAA 4UBDC 5CP3H 2NW2A 1SJXA 1C08A 3KPSA 3W0WA 4EI6A 5T1LB 4XNYH 1OAXL 3UCRA 4F8QA 1TCRB 5IWLC 3QCTL 4EIGB 2XTJD 4ELKA 5AD0A 3HG1D 1GZQA 1DVFB 1IGJA 5HSFA 4XCCL 1IE5A 3BXNB 5K9JL 2F8OA 5DRNA 4XNZC 1CFVL 5DRZB 1NEUA 3W9DA 4NZDA 3O4LE 1I7TA 3K81A 3SKOB 1KIPA 4Z95H 3VMOA 1HINL 1VERA 3KPQB 4HFWB 4HK3N 4Y5YA 4M6OL 4NYLA 2ATKB 1JMZA 1IGCH 4JJHA 5FM5M 2FEDD 4CBPA 1D5ZB 3FCTB 5K9OA 3QI9A 5CZXD 4KQ3H 1WCBB 3D69B 4OJFL 5TE7H 3VWKD 3ZLQC 4ZUSA 1MHCB 2F58L 5IM7B 3DGCR 2VDNH 1VACA 2F53A 3HHRB 2X2YA 3I6GA 3KPOB 1C12A 3QEGH 1CE1L 1ZMYA 4J3UA 5ESVA 1FDLL 1D9KD 1QLEH 4N5ED 3WIIL 4GXUN 4C55A 2D7OA 4QRSB 2LU4A 4ODUA 1F2QA 3H9SE 4PJEA 4FQJL 1UJ3C 2IADA 5E2VH 2F8VA 2OZ4H 3KPPA 2NY7H 1NAMH 3GRWL 2GKIA 2BVTA 3MV9E 4NUJA 1HEZA 4OFIA 5KVEH 3BP7A 4LNVA 3TYGL 4WHTA 1RIVH 1IQDB 5C6WH 4N8VB 3MV8E 5E00A 5D1XC 4QRTA 1G7HB 2A9ML 3BP4A 4JKPL 4JQIH 2QSVA 1SJHB 3T8XA 4LPXA 3PP3K 1LO5A 3RIAF 5A16B 5D70H 5JUEH 2CKNA 3NGBB 4HK0A 4ODTH 2IAMC 1Q94A 5D1QC 1FNGA 2O5ZL 2MCG1 4NNYB 1W72B 4D3CH 3DVNA 4X7SL 3BDYL 1F4XH 2J2ZA 2XWBB 1HKLH 1EFQA 3JV5A 4KUZL 1J0IA 2CJUH 5EUKB 2YPLB 2YD5A 4OTXL 3X13A 1MJ7L 4OM0L 5ELIA 5C6PB 3OB0K 5IMLA 1UH2A 1CR9H 5LBSL 2BNRD 1EXUA 1OF2B 4UT7L 1QPXA 2AI0L 4CVUA 4S0SD 3ZKSD 4YC2B 4Z78B 1BD2D 4J6RH 3TO2B 3N85H 3MGOB 3BUTA 2IBBA 4Y4FC 1YN6B 1UGNA 4B5EA 5JIHA 5J57B 1JGVL 1HCFX 4JQVC 1A1MA 1IRAY 5IFAH 3ULUE 1I7ZB 5DLML 5T3ZH 4WRLA 1P7QA 4EEEA 1CVRA 1G7JA 2OQJB 3V6ZB 1R6VA 2PXYB 1WC7B 5B21A 1CU4L 2PO6C 3HE6D 3S3PA 1U58B 3QEQB 1TJIH 5C0CA 4O2EA 5C0FA 1T7VA 3L1OL 3PABA 4YGVB 1JPST 4OGYH 5AEAA 4KGJA 1KJVA 1U92B 4U1IA 3G08A 2XZQL 1T5WB 4ZTOL 4DUWA 3NN8B 1QPPA 1YECH 1NBVL 2P5WD 1JIBA 4GRWB 5IQ9A 3IDXH 5JIKA 4N0FB 3UTTE 3ARZA 2YN5A 5EZOL 3QQ9D 3MODL 1EGJH 1I3VA 2CKBA 1XF5A 4JDTL 1B0WA 5HHVL 3G5YB 3MYZA 2XZAL 3TYFA 1ZT1A 4X4ME 1DN0A 5JPMB 4QRPA 1MWAB 3TBWA 2MCPH 1KYOK 3O6FA 1H0DA 4XPGL 3CXDL 4HGWB 2YMXH 4OF7A 4ALAH 5IB2B 1BFOB 4RISH 2FSEB 1J05A 4GKSA 4KVNH 2HYMA 4N8PA 5ISZA 4KKBC 1KBGL 2DJSA 3V4PL 5EO0B 4M6NL 1RUML 4JPKL 4F33A 4LSVH 4A6YB 3BZEB 3G6DH 2WM0A 3NFSL 4IRJC 5L8KB 5HVGB 5HDQL 2PR4L 3LS4L 4WFHD 1TDQA 1ZLVK 5IHBA 2CUIA 3C08L 3CFJB 3BW9A 3KJ6L 2F8XC 3ULUC 5CLTA 5ESAB 1S7WB 3GM8A 4S1RL 2CDFA 4PJXE 4ISVB 3HPJB 4KKNA 2HJFA 4QRRA 2V7NB 1IGTB 2ERJB 3B9VA 4BH8B 3CVIL 4MAUL 4I0PB 2B20A 3ARBC 2VITA 5JXEC 1N6QL 3SGKC 3BE1L 1CXIA 2IQ9L 1EPFA 5JOPE 2LU7A 4KKAC 3QUZC 4P3WA 3VXRE 3P11L 4HJ0C 3ZSTA 1DQTA 1MHHA 4ZFOB 2K7PA 4JFED 4L3CA 3OXRB 1J11A 1JHTB 3GSOA 4PG2C 3FO9A 3FOMA 3GSRA 4G6AC 2PYEE 2PCPA 3UTZA 4MA3A 1Q72L 5C0BB 5EBMA 1GGYA 1ZLWK 5DD3H 5C2BH 4UV4H 1JMXA 4WJ5A 3HCVA 4HT1H 1UZ6F 2C1PA 3CDYA 5JXAL 5D2LB 5FO7B 1A3LH 1BM3H 3EOAA 4QXTB 4XNMB 2BVUA 4G7VL 4P9MH 5IMMA 3RL1B 5FCSH 4JFPA 1NLBH 3KPRA 4G43B 2DF3A 4X4XA 2FO4A 5KVFL 1GGIL 4M93B 4D8PB 1FBIL 3ZDXE 3DI2B 1FSKC 5IOPA 3T0EE 4U33A 5LXGL 3S5LG 4Z7NF 2IF7A 5MEQB 4R0LC 4RBPH 5DURB 4PYHA 5J6GA 4N1EA 3QG6A 1LMKA 2QBWA 4X80L 1MVUB 3V9FA 5KJRH 1RIHH 2PW2A 4I9WD 4WHYG 5D7IE 1DEEB 5DXWA 4LFHG 4U6XB 4X6CF 3KYNA 3S88L 4P2RD 4DQOL 3CPLB 2ZOLA 4M8QB 2GITA 3QUKA 4LCUA 2M1KA 5CGTA 4I2XE 2YRPA 5D7JA 1AFVL 2VDPL 4R96A 5EU6B 1LO3H 1N64H 2NW2B 3LEXA 4NO3A 4EI6B 4WI5A 1BZ7A 1FAIH 2Q3ZA 5T1KA 3LRSA 1QYGH 5AD0B 3BIKB 3MV7B 4YBQC 1BVLA 1E4XH 5I2IA 3UO1H 4OGZA 1P5UA 4ZFGL 5HVHB 5A2KH 3X3GH 1QACA 4K9EL 4GAJL 5DRNB 4BELD 2X4UB 4AEIL 4YHKL 1UZ8B 3LOWA 3SE8L 2AP2A 4CL7A 4PJHB 3DYOA 4WEUD 4JFDA 3QRGL 4WV1C 3B2UD 4OLXL 3UBXA 1KIPB 3ARDC 3SDCD 3JTTA 3WNMA 4L29B 4DGIH 3IS1X 4NYLB 1F6AB 1QSFA 1WIPA 5DHVA 4P57A 1VFBA 1CLOL 4K3EL 3MOQA 4P2CG 4OFYA 1A1NA 1N3NB 2AJZA 1I1AC 2BNQA 2HJLA 2VQTA 4R6UA 5FOBA 5FYLL 4HF5L 3L5WB 3S5LA 5E99L 4AEHL 1R3IL 4YHOH 5ESVB 1R5VA 3KNBB 4ONGL 5DVLA 1DUYA 1G9NL 5EZLB 3QDGD 5MEND 2DLFH 4NC0B 1EJOL 2D3VA 4KDTC 1IC7H 4GKOA 1NMBL 5KSBA 3TT1H 4OLVL 1QVOA 1U8LB 5E9DE 2BVQA 4NZTL 1JRHL 3D3VA 2HN7B 2HLFD 2V5SA 3U0TB 3G5VA 4MAYA 1U3HB 5HGDB 3KPPB 1J87A 2RAMA 2V2WA 3X11B 5L7XL 5HHNA 2GTZB 3WUWG 4F15B 5KAQG 5E00B 4CGTA 3DNKA 1KFAL 5CFHA 5IW6B 2Q8BL 1PW3A 1GCFA 1CBVH 4C58B 4Q97A 4L4VD 3V0WH 3SOBL 1NMCB 2B1AH 1KJ2H 4HV8B 3W11D 1AC6A 1K8DA 1YPZE 2JIXD 3LDBB 4Z8FL 4KZDH 1U8KB 3GKWH 3QJFA 3W5NA 5KBNC 4C83A 5GRZA 1VDGA 1X5IA 1U2HA 1C5CH 4MQ7B 4G5ZH 1U3ZA 1UWEL 3GSXA 3O9WD 4OI8A 1DDHB 2GSGA 1KCVL 1MJUH 3DSNA 3I3EA 5IHUL 2H1PL 4RRPG 2LV4A 2V7HA 5MERB 1IGMH 1M7DA 5TPWL 2FZ3B 5F97E 3U0WH 5FUOL 1KB5A 1UKSA 5HGHB 1EXUB 4OD2B 1IQWH 5HYIA 4E42A 3AB0C 4POZC 2ZUQB 1CDGA 4CKVX 2I60H 3BKYH 4HKXB 4ONFH 1ZLUH 2X70B 4PJ9D 5BMFH 1M7IA 4GH7B 4PJBA 3F7YB 5E8EA 4KV5E 3OG6B 1TETL 4F7CB 4Z7WB 4N8CL 2YR3A 3PABB 4JM4H 1EBAA 1FZOB 2V17L 3G08B 4HZLA 4NJAL 1S9YB 5E2WH 4TPRH 3RAJH 4U0RC 2EYSB 4K07A 4M7ZB 3V4VL 5CWSB 4LDOB 1FE8L 5CJXA 3BUYB 3L5HA 4AK1A 5DJZB 1JTTA 4PGJA 3A6CH 5D7SH 3RTQC 2CKBB 1XF5B 4PJDA 4IDLA 4QHNA 5IKCB 3QXDB 5IVXF 3TYFB 1NUFA 1G9ML 4YE4H 2IANE 2YA1A 4BJLA 4HK3J 4I48A 3NBNA 1KJ3H 1H0DB 4YBLB 3REWA 2YBRA 4X9FA 3BP5A 4RX4D 4RGND 2VDMH 3C2SA 3RGVB 1MY7A 2VLJD 5F1KC 1TQBB 4AG4H 2IFFH 3G5XA 5ISZB 2IBZY 1U8OA 4RRPA 3UTQB 2DKMA 3VFWB 4LF3B 4UDTB 1Q0YH 2GW5A 2Z4QA 3O3DA 2UVFA 1RD6A 2R2EB 2IQAA 1YA5A 4TUKL 2J4WL 4P46C 3MJ9A 4FQHA 1OPGH 5FYLD 5C1MB 4W6YB 1U42A 5E1HB 1JZ7A 4R4BB 1UXWB 2HWZL 5JA8B 1MRFL 4IDJL 1BVZA 1E6OL 3WLBB 2Z93A 4PIRF 1NCWL 2V9RA 4I1NB 4QWWD 3ET9F 4ZOAA 5IEKA 2VITB 1HXMA 3RU8L 4OZHB 1T21B 3IKCB 1DN2A 4X6EA 1FNAA 4XNXL 4XMKL 3MLXH 5DFVC 3X14B 5EN2A 1EMTH 5SX5K 1MCLA 2KDGA 3VXSB 4RCAA 1ZV5A 5IF0B 4R4ND 3U30C 1MNUH 5DK3A 4NO0A 4ZFZB 5FEBA 2OP4L 4M8VA 3BH9A 4KH2A 4H20L 5FGCB 4RGOL 4S1SL 3GSOB 5J9PB 1NL0H 1MQ8A 3FOMB 2C3HA 3RJQB 3WN5C 5FYJD 4ZUWA 4MA3B 5L9DL 4C57C 2VZVA 3QXVA 3ULUF 4LSQH 4F37K 3WMSA 3ARFC 1O7SA 1JTOA 4DGVL 4QXGL 1RJCA 1QFUL 1TJHL 3WEXA 1EHLL 4XMPL 1DFBL 1MCWM 3EOAB 4UOJA 1JGDA 3KPMB 3QH3A 1SM3L 3BRGC 5C09B 5T33H 3O6KH 2XXCB 1DBJL 3MUY1 3D2UB 4RAUB 3TBVB 3SQOH 2VISB 5E1AA 4MDJB 1F90H 2VLLB 3U48A 1MLCB 3IRPX 5F7YC 3FT2A 4GAYA 1PVHA 4L3AA 4LVOC 4DKFL 3BO8A 4JO3L 3ZTJH 1B9ZA 5DD6A 1A4JB 1X5GA 4MSWA 3MLVH 1VHPA 2VZ3A 2X4TB 5DJCB 3K2MC 5ICYA 2RB8A 2DQJL 1JPTH 2MKLC 2J6EA 4DGYL 2PW2B 4KJWD 3H42H 1FNHA 4FXLA 3MBEB 4LLAA 1AQKL 3MRCA 4J3TA 3KYNB 3VA2C 5GXBB 3QCVH 4LLWB 4RZCB 1A9EA 3QO1A 2IPKB 5C7XL 1UKQA 2DBJA 3IDJB 4LEXH 5KANI 1I9RH 1J86A 4Y2DC 1MREL 2F5BL 1Z2KA 3IU3A 2XKNA 4PRPB 4OCWH 2J3SA 2CLRA 3QNYB 1ZEAL 3LKSA 3WIHH 4FXGB 1KC5L 3LN5A 4OSUH 1BVLB 2VXSH 1DBML 5F44A 5I2IB 3EGSB 1DBAH 3PQYE 2NR6C 4HUUB 2QQKH 3GDBA 4M61A 3GMPA 2W1NA 1NFKA 5GRWA 4L8SC 1FN4A 4UNUA 5HPOA 4NKQB 3W39B 1SEQH 1ZK9A 1U8MA 4DKDC 3C60C 4PRIE 2FH8A 5CJ8A 3TGXA 1WBYB 4OUUB 4PV8A 4LU5L 5DEFA 5CZVL 2YEZB 5EBLA 3S37X 2P5ED 2V5RA 5E4EC 4Y1AB 2WUBL 4P2QD 5JO5B 5DHVB 1I7UB 4CVZA 1YNKH 3QNXB 4R9HA 3ULSA 3AS1A 3RKDD 4Y2OA 3RP1A 4LASL 2AJUH 4UUJB 3ZKQD 3TBSB 4WW2B 4X6DF 4F57L 5JQ6H 2HJLB 4P5TD 4RFNB 5LGJA 3S5LB 1E6JL 3HRZA 1P7QD 2HFGH 5DTFA 4U1GB 1CDYA 1R5WA 5FO9A 3DX8A 4U6TA 4P9HH 2AV1B 5L0QC 5HDBF 1KPVA 5J1TC 4JQXC 1OTTD 4X99A 1RK0B 4AL8L 5C0CD 4XVTL 5HHOB 5GJSH 2CMRL 4LEOA 1FORH 1I8MB 3QQ3A 4MAYB 3HMXH 4YFLF 3MO1A 5T5NF 4FFWD 1NANI 1KSRA 2Y07H 5EC2B 4JFXB 3BPLB 4Y4KC 1MHPL 3ZDXF 3RWIB 4C56E 4MD0A 4JANB 3GJFH 2BX5A 4HIIB 4NKOB 1WWWX 4JM2B 4U6VL 4LNRA 1U36A 3QJFB 4QRPD 4C83B 1KOAA 5D7IF 3GSXB 2EKSA 3H3BC 1EEQA 5J13B 3TZVA 5EWIL 1AR1D 1MVFA 2NY0D 1H3GA 4FHBD 4QHUB 3DX7B 2CRMA 1SJVA 2OZ4A 5JHLL 4F3FB 4Q2ZB 1OWWA 3DVGA 3LKOA 3WLWC 3P4OB 5FO8B 3K7UA 5TE4H 2NXZC 43CAB 5INCB 4AMKH 3P9LB 1EZVX 1E27A 4MJIB 5FYKL 1LP9E 1INDL 2EYRB 4YLQT 1KENH 3MRNA 1DQDL 1U6AL 4QRRD 3S3JA 1B88A 4LSRL 1RZ7H 4PJBB 5FM8A 2GCYB 3V52H 3OKKA 4X0KA 1HWHB 2VTFA 3INUL 5EOQH 3K0WA 3OKDA 1OSZB 5F8RC 1A6ZB 2NLJA 1A6UL 1H9VA 4M02A 2VDRL 1U8HB 1QBML 3N1GC 3R4DA 3TT3H 3WD5L 5C0AA 4R2GC 3KLHC 1MI5D 3QISA 1T22A 1XF4B 1L9NA 1WEJH 1MLBA 1M1SA 3WUWB 1RVFL 2WINA 2Z9TA 1DLFH 2N4IA 3UMTA 2XTJB 3WFCH 3O3EA 5I1KL 3BWUC 2NY1C 1FNFA 3HI5L 3OG4B 1UWGH 5AZ2H 5TE6L 4ZNCD 1U95A 2L4OA 4U1LB 4DVRL 3IDNB 2E5EA 4I48B 4LIQL 4LOUD 4J4PD 3CVHA 2R4RL 3ZKXB 3BP5B 2FR4A 2QADC 3WL9B 3OR6A 3VXME 5GPRA 5IW3A 4I3RL 4OZ4A 1FJ1A 3V5DB 2Y6SC 4XP1H 3KPRD 3L9RA 5BS0E 2PYFB 3X3FL 1FFNA 1KB5L 1KCUH 2C4FU 4TRPH 2X6MA 1Z0NA 4NFCA 4HUVB 1RK1A 3A67H 4X6BA 1VKXA 3VFRB 4TSCL 2E9BA 2AV7B 4ZOCA 1BQUA 2BOCB 1IZKA 3RNQA 4FQHB 4YXHL 4XVJH 2NZIA 1FO0B 3JZ7A 4XPAL 4R8WH 3LQAC 1YPZF 3MA9L 1LK2B 2LAGB 3BD3A 5SWSB 4PRAB 1I9EA 2DM3A 4F7TB 3TN0A 4G42B 4ODSH 2ZKHL 3RY4A 2XA8L 4L4TB 1AXTH 4EUPH 4JKMA 4N90E 2R0KH 3GNMH 1UG9A 2Z93B 3PGCB 5EOTA 3GIVA 1IEBA 3KPTA 5A1AA 1SVCP 2QHRL 4ZXBB 3LH2L 5DJDB 2FBOJ 3ZDYE 3UAJD 1DLHB 5EN2B 3MLTA 4ODXA 3NH7H 5C0JA 3OKEA 1AXSB 3V8OA 4GBXD 1B0GB 3GSUB 1BAFL 1H3UA 1F4YL 4I3SL 5CAYB 4WUKL 1U8NB 4LCCB 4M62H 4HWZA 4M48H 5HI5C 2DQCL 2F74A 4KMTH 3NFNB 5I0DA 4NM4L 2KZWA 4Y0GA 4LKCB 2R8SH 4WWKC 4XWGH 1JGEA 3CNKA 3WEXB 1JJUA 1GYAA 4FQLL 4W4NA 4C4KT 4OKDA 1DQLL 2V5TA 1T20B 4Y19D 1Z9OA 3MZTA 5L88L 4PJGB 4M7JL 3LEYL 5KVDH 3DO7B 4NRYA 4ZD3H 5I73C 2IJ0C 1Q0XL 2ITDA 2AJXL 2VDKH 2NY5C 4JFYB 1IC5L 3UZEA 1IBGH 4J3WA 3SKJH 2PW1B 4DAGH 2BNQD 1D5BA 1NCTA 5MEPA 3OAUH 5FYKD 1QZ1A 1ZLSL 4LL9A 4R97B 5I1HH 1AO7D 2HTKC 5DUBA 5ICYB 2P8LA 1S7RA 3U6RA 3FFCE 3Q5YA 2ICEB 5EO1A 3GHBL 3LV3B 4R7NB 3CZFB 5CGYD 5F6HJ 3S34L 2V2TA 1F4HA 1A9EB 4MQTB 3OL2A 2K3TA 3H3PH 3H8NA 4BKLA 2PETA 2FB4H 2A73B 3OQ3B 4JPVH 1TZIB 4X5WB 3SJVD 1CDCA 1F58L 4IOSD 1N26A 2DBLH 5HI4D 4AYFA 2ZCLL 5F89B 1SQ2N 2AEPH 1BBJA 5KVGL 2P5WB 1MIEH 3VXTB 2JKXA 3UC0L 3CFKB 4BZYA 3I6LD 3HC0B 2Z35B 2R0WL 2EC9U 3LN5B 1JF5A 1MH5A 4XNQB 4OQTL 3UBXI 5C07D 5HYQA 2UUDH 4Q0XH 3CLFL 3GMNA 3KPLA 4M61B 2MPAH 3QUYC 1CGYA 4GKNB 1FN4B 3D48R 5ACZA 5E95B 4CW1A 2UZIL 1LE5A 3V4UL 1U8MB 2VXVH 1ZSDA 1X5YA 2G75B 4PP1D 3GMMB 2ZPKH 5I9QC 4MA1C 1DL7H 3KDMA 4YHPA 2EDOA 3VW3H 1XGPA 2BHUA 1E0OB 2XPGA 4XBGB 3HUJB 1AJ7L 3ULSB 4KJPD 1YEFH 1TQCB 4IRSA 3ARRA 4I77H 2DQEL 5IESL 3T3PE 5TF0A 2C7UB 2IC2A 1CD1B 2MNUA 5FKAB 3DV4B 3HRZB 4WUUA 1F8TL 2J6EL 3T09A 3D25A 1R5WB 4NDMA 1GIGH 4KPHL 3GUTB 5DK2B 3ULVL 3DX8B 4UQ3B 4LLYB 4LVHB 4DN3H 1R0AL 1ZANH 1A6WL 5F6IC 3VI4E 4FQQA 3T3ME 3BGMA 3CDGA 5E8OA 3IRZA 3CFDA 3CXHK 1RQ5A 1B0RB 4Q6IB 2MMXA 4L8BB 2FHBA 3L3DA 1OWRM 5ID1A 2WWKT 1JZ4A 3STBA 1O5DT 5DD1L 4JFEB 2FHCA 4PY8J 3P77A 1MJJB 3ORJA 4M7KL 4XPFH 5FKPA 3EYUH 3PV6B 2YXFA 5LCVL 4NQCB 3S35X 1T7ZA 2VZSA 3NCFB 4HG4K 3CZJA 4XBPA 2FBJL 4YFDB 4FTVA 3VXQA 4Z7VB 1QRNE 2XRAL 5EUOB 3KJ4B 4W81A 5KTEH 1G6RB 1T03H 3QFJE 4XGZA 2R29H 4XHJD 1NMAH 5I19H 4XC1L 3P9MA 3SGJA 4PD4J 2E7LA 1V3KA 1J0HA 3AY4C 3QHFH 4JFFA 3GI8L 4IOFC 3LKOB 4KROD 1DQQA 4NZJA 4O2CB 4XNYL 4L3ED 3QDJD 2OL3H 4K94H 2YA0A 3C09C 3U2SB 1ZXQA 3F5WA 4LCWD 1URLA 4WGWB 3QR2A 1IAOA 4U2YA 5KSAC 1JHLH 3MMEA 4JRXA 4NQSA 3SGDH 2EIZB 3GGWA 1HK6A 3O8XD 5FGBA 4K8RC 3RA7L 5L2JA 4X0KB 3VMPA 4ZUVB 5IVZA 3G9VA 4P2RB 4JFOB 4Y16A 2W9DH 1BZ9B 3MJ6A 4HJGB 5DJ6A 4IMLA 4H25A 1KIRA 1IAKB 2F54A 2G5RA 5EIIA 3MLUH 3CU1A 3G9AB 3S7GA 1IGCL 5DJ2A 1DSFH 4ONHB 5C0AB 4NO0D 3SPVA 5EPMA 2R1YB 4MA7H 4OF5A 1DVFC 4LSUH 1IAMA 1N8ZB 1J1PH 3RDTA 4U6HA 5HVWA 3MTRA 3QEGL 2FCBA 3IJSA 2UY6A 4L1HA 4U1SB 4XNUL 4DOHB 5LJYH 4X6CA 4CJ0A 3C5SB 2VN7A 4KHXH 5ICZB 5F71A 1QLEL 4CU6A 4JZOB 1KGCE 1Z5LB 5DJ0B 2GT9A 1L7IH 1AGFA 1I8KA 4GRLA 5IW1A 4OZ4B 1FJ1B 4PRBA 2YPLE 4PB9H 3TNNA 1I4FB 4HCRA 2OZ4L 2NY7L 1TFHA 4LPYA 1IKFH 4LHUG 3RIAK 5KVEL 3VG9B 1RIVL 4IOIA 3SY0A 3RPKA 4JVWA 2OX5A 3Q3GA 1IM9B 1BVKB 4PV9A 4ZS6C 2VLRA 5I76A 3RZCC 5F9OH 3BT2L 5JUEL 2BRQA 5GS1C 2HG5B 5TDOA 4D2NA 3VD4A 5D5MA 3WHE0 1QFHA 3ULVD 4PGDB 3QIUC 3SGEI 1OW0C 2X4SA 4D3CL 3OGCB 2EYTA 4M1DH 4ZUUB 4FP8H 3QEQE 4NWTH 1HYSD 2EDYA 1IEBB 2VABA 5ETUB 4G6FD 3X12B 4AENB 2CJUL 4DW2L 3FN0H 5I1AB 2JB5H 2JJTA 2NYYD 4ODXB 5DQJA 1CR9L 4HXAH 4JAMB 5ADPH 4DK6A 3SEPA 5DI8A 3T4AA 4UT9L 3FJTA 4GRWE 1P9MA 4LDLB 5IWLA 2F5AH 3RL2B 1EA9C 3B9KB 3D0LB 3VD5A 3BVNB 4L4VB 5EIQA 4QT5B 4J6RL 1LP9F 2FJGB 4PBVC 3QUMH 4LLMA 3RVVC 1QFWH 3JWDC 4TTGA 3CGTA 4P4RB 1VGKB 1Q1JH 5GS0H 5T3ZL 1LO2L 5I16A 3LZFH 3GB7A 1S9VB 2YD9A 3CVHL 3O9WB 1WQVT 2LFGA 1L6ZA 1ZWIB 1TJIL 3ILPA 1UADC 3GJEA 3MR9A 5L2KA 5DA0B 4MHHI 5F6HI 5H8DA 4OGYL 5GGQH 4LHJB 2HT4C 4MXQD 4M5ZL 2DYPA 3JV0A 1PFCA 2DDQL 5I8KH 2Y9RT 4LHUA 4QTHA 1FVEA 1YECL 3GO1H 2AJSH 2HVJA 3IDXL 3CFEA 1Q9LA 2N1KA 2CXKA 1NGXA 5F7EL 3NCBB 5DUBB 1MRDH 3W81A 1S7RB 3C6LD 3NAAH 1CFTB 5ITFA 1HHGB 1UA6H 3NABL 4WW1B 4UAOB 2MCPL 4FG6C 1QSEB 3QDMD 4OCLC 1S5HA 2YMXL 4ALAL 3UTOA 1OB1A 5BO1H 1FL6B 4RISL 5F8QC 1ZA6A 3TO4D 4KVNL 1CXLA 1UJ3A 4BZ2H 5A2FA 1DBKH 3FQTA 3K1KC 4GXVH 4KRPD 1MCKA 1WFOA 5C08B 4O00A 4LSVL 5CEZH 3MRLA 3G6DL 4EI5D 1ZS8B 5D1XA 1XF1A 1LEKA 4GLRH 1P1ZA 2FECL 1FNEB 4BFGA 1XFPA 4JG1H 3GFUA 2FATH 5KW9H 2G5BA 4YEEA 5HYQB 5FHAH 2IAMA 2OK0H 3KPLB 3O4LA 3VD9A 1QOKA 5J4MA 3PJSA 2D7TH 3O41A 5ACZB 3TZVD 3U7YH 5D2LE 3QJHB 1WWCA 4O2FB 5F1IA 1ZHLB 1ZSDB 3FAXA 4XTRD 3EBAA 2VLJB 2C9AA 3RWFB 4PRNA 5AUMB 3MRPA 3ZDYF 3OMZA 3ZYZA 5C92A 4Y89A 4ZPVA 3IGAB 1FLRH 1W0VA 3OKLA 1U8PA 3QQ4A 2NY4D 5B39G 3WO4C 3HMWH 4NN6B 3TWCL 2J88L 1DUZB 2O5YH 2R1XA 5DMGD 4PY8I 4S0TD 4Y4FA 5GZND 3VXNB 1OP5H 3VFNA 3RNKB 2H32A 4JQVA 5DD3L 4U4BA 1MCHA 4NHCL 4UV4L 4BSVB 4NRXA 3LKRA 3H9SA 4HT1L 3AROA 3TC9A 1WAAF 2HLAA 3CUPA 1U9KA 4GQPH 2YWYA 5F9WB 3VRLE 1CT8B 2SEBB 3QDAA 4FA8A 3RWEB 3QUXD 4P9ML 3MV9A 2BXZA 2WIIB 3CDGB 3LHPH 1RUQH 4OZGB 1G0DA 5E8OB 3CFDB 4KI5F 1NLBL 4G9DA 3MV8A 5EU6E 3LKNA 5J1SC 4FQXC 4KI1A 1ZLUK 4F2MB 3G5ZB 3DRQB 4GRMA 3ESUF 2HTLD 3NCJH 4HC1A 3MRJA 4PLJC 4J2XA 1QA9B 2ZUYA 4RQQB 5T3ZD 4ELME 2P8PB 2Z8WC 5KJRL 4RAVB 1RIHL 3B8YA 2ADGB 1ORSA 2YUZA 4PJHE 5F9AC 2P8MA 5LAXA 1IEAA 3EJZC 3L3KB 5I1JL 1LEGA 3RIFF 5BV7H 1IM3A 4UU9B 2E7MA 4JFFB 4J3SA 1GC1C 1INQA 2HFFB 1BJ1J 5F7NC 3ROOB 3DMMD 5EA0H 1EIBA 3T65B 1RULH 1LO3L 4IRJA 3U4EB 5FDWA 2H2PD 1A1OA 3D39D 3EYQC 4PJ8D 2BZDA 1FAIL 1LNUA 5IBLC 5F3BA 3TM6A 1QYGL 3F5WB 2JLLA 1E4XL 3UO1L 4NNXB 1NDMB 3TN0D 5FA4A 3X3GL 4NQSB 1E28B 2AK4B 3WE6A 5L2JB 4HUWB 5CILH 5FDYA 5LVEA 3ARBA 3D18A 4Y16B 5JXEA 3SGKA 4HIXH 4OZFH 1G7LA 4JLRA 4IMLB 4HZAA 3BN9C 1KIRB 2F54B 3LMJH 4DGIL 3MXVH 4FXKB 3UTPD 1A0QL 1S9KC 4G6JH 2HJKA 5DHYB 3UTTA 3HZMB 4QRQB 2JELH 1LD9A 3UEZA 2IEPA 3SKMB 4Y5VC 5IB1B 5T3XH 4WFEE 4XVSL 1SYVA 3T3PF 3VRIA 4G9FD 3WXWH 1OAUL 1YQVH 4U6HB 4ZYKB 5ERWA 3IJHB 4X4MA 1ZHKB 4OM1H 1N6VA 3MJ7A 1T66D 2FO1A 1CFQB 2ZOKB 2VAJA 1ZHBB 2CDEA 1IC7L 5JW3L 1TJGH 2GT9B 4TVPE 4LLUB 3UX9B 1I8KB 3VI4F 3T3MF 5IW1B 3BKJH 1UQSB 4PRBB 2O61B 4K55A 2YOCA 5ANMB 4H0GA 4YR6B 2KQMA 1YY8A 5A2LH 1BWMA 5J1AA 1W2KT 4KY1H 4PP2B 4NNPH 4XP9H 4YQXH 5D8JH 3HTLX 4X9IA 5E94A 2LTQB 5DMJB 4UTBL 1H3PH 1VEOA 2M26A 3I9GH 4R0LA 4HDIA 4PJXA 1CBVL 3VG0L 4PV9B 4Z76B 4P5TB 4RNRA 3MRKA 4OBRA 1U8QB 4P59H 1NCUA 4KZDL 2X4OB 1FVCB 3GKWL 5TDOB 1BF2A 5D5MB 3GSNB 1C5CL 1TVHB 1JI1A 1IFHH 4Q9RH 2RCSH 1GGCH 1U3HC 4FFYH 2VABB 5B3JF 4Z7WE 2QL1A 4RIRA 3VXRA 4E41E 2FECI 2LABA 2RHEA 1S5IH 4WFGE 4MLSA 3DIFA 4F15C 2ICCA 2FRGP 3G6JB 2GTWB 5A3ID 4R4FH 4NM8H 3P4MB 1UB6B 1XIWC 1RZ8A 2N7BA 4BFBD 4X6DA 4KK6C 1IQWL 2VC2L 2PYEA 3RVWC 3LDBC 1HI6A 2CUMA 3T0WA 3LRHA 1MCDA 1FH5H 3HRPA 2I60L 4NKIH 4ONFL 1CGSH 1UWXH 1GSMA 5BMFL 5J0BA 3LIZH 4XT1C 4XNZB 4EUPA 3HR6A 1T7YA 5IMOA 4I13B 1JWSB 1PLGH 1KT2A 3ARDA 4KDWA 1SJEA 2DKUA 5CD3B 2NY0B 3V6FB 2DM7A 3M1BA 4HCRL 2JCCB 1FV1B 4JM4L 6CGTA 1OAXH 5E2WL 3T0EA 2Y23A 3QCTH 4HH9A 4TPRL 3RAJL 1MOEA 4H1LA 4LHUB 1TXKA 1FVEB 3FRUA 5LKNA 1P84J 2ZUQC 3MROA 3O11B 3SDAD 2NY2C 2QSCL 3CX2A 1I1AA 4XCCH 3A6CL 5D7SL 3T0BA 1Q9LB 3ES6B 3F8UB 5K9JH 3H7BB 1CFVH 3CH1B 5D7IA 1AGEA 3OZ9H 3MJ8B 1C8PA 1F45A 1T5XB 4KDTA 3EFFA 5FB8B 1KJ3L 4WDIA 2W07A 3WNLA 4M6OH 1A2YB 2MJWA 4GFTB 2AXJA 4OZHE 3EO1A 4I2XA 1P4LA 1UJ3B 4AG4L 2IFFL 1NDGB 1NBZA 2O26U 4JRYB 5HI3C 4CU8A 4J1UA 4M7ZC 2BMKB 1MSPA 4HHAB 4JRWA 3VXSE 1MEXL 4BSWA 3MRLB 2VIRA 4APQC 3S3SA 3QG7L 4POYA 2DWEB 4OV5B 1CLYH 5FGCE 3UROR 1QFPA 5DK0B 1OPGL 1YN7B 4P2YA 2DJ4A 4FTVD 2XKUA 1HSBB 2BNUA 5D1QB 3RVTD 3PJSB 1S3KL 3O41B 5I66A 5C8JA 5DVMA 4FQJH 1R3JA 3RGVC 1T1XB 2W0KA 4D9RD 1TQBC 4PJCB 4J3OC 5AG8A 3TESA 1AD0B 1F4WH 4AT6B 3O3AA 1OOAA 3R1GH 1JYVA 4MCYA 4Z7UB 5C09E 3IF1A 1EFXA 2LE9A 1Y18B 4PRNB 1MCFA 5D2NB 3TYGH 1CDJA 2Z8RA 2X1QA 4OF6A 5BZDA 3MLXL 1HH9B 1PGRB 3U36A 1EMTL 3QPQD 1E4XI 4JKPH 1ORQB 1J0JA 3O6MH 2RFXA 3OKLB 4GRWF 1VENA 2FX8L 2QSTA 1JPGA 5JR1H 3EYFA 3FB6A 3HS0B 1OGAB 3FT4A 3VGAB 5JZ7D 1AP2A 3VFNB 4QTIH 4D0DB 3FFDB 3G04B 1YJDC 4X7FC 1HILA 4LSQL 4X7SH 2CK2A 3BDYH 2I07B 2MKWA 4G8EB 4HWBA 4HX1B 3TJHD 3TPUA 3VWJC 3OAZK 5E9DA 3J7HA 2HRLA 2HLAB 2PO6B 3E2HB 4OTXH 2XI9A 1MJ7H 3MOAH 4OM0H 2UVEA 3OF6D 4PGEB 2ZJSH 3PL6C 1PDKA 4OB5L 4F7PA 3SQOL 4G9DB 4UT7H 2AI0H 1F90L 4NO2A 4PRPE 4JDVA 1S7SA 4GBXB 2HH0H 5CGMA 2V2XB 1RU9H 5E2JA 4FRWA 1QR1A 1Q9KA 1YPZA 1PZ5B 1JGVH 1DP0A 1IAIM 1AGBA 3RTQA 2R9HC 4KRMB 3MLVL 5DC0A 4OGAD 3DETD 4PTTA 1MFAH 3IXAB 1CU4H 5GGTH 2VO5A 4MNHB 1QHOA 1IZJA 1L7TH 4PLKD 4YHZL 5GGVY 4G6MH 3C87A 1ORSB 2BXYA 4KTEH 3E0GA 4GRLD 3QCVL 4MQXD 4Y19B 1VEMA 3SDDB 1I9RL 2DS4A 2W9LA 2OR8A 4Y1AE 5EZJB 5ECJE 4NSKA 3CAFA 3BMVA 5SWZD 3MLWL 1HQRA 3QIBD 3QNZA 4OCWL 5FECB 5FDWB 1V3JA 3AS3A 2CRIA 5DWUH 3WIHL 4JDTH 4P46A 5DJYA 5HHVH 3U4AA 5F7HA 1IVLA 3UYRH 5FUCE 5B39B 4OSUL 2XZAH 2DTMH 4NKDB 3GBLA 4DTGH 1DBAL 3SCMD 3WDHA 1W72H 1PZUB 2XYCA 4KJYB 4RDQG 2OJZH 2BOBA 4WU7A 4CAGA 3TBYA 2HP4A 5JQHC 1MAMH 4HKZA 2Y36H 5D2LF 3MREA 1LO0L 1UJTA 1SEQL 3D18B 3L7EA 1U0QA 5HHOE 1G7LB 4JGJA 2OTUB 5FHBL 3EZ8A 1RUMH 1RFDH 3L3IA 3T1FA 2VZ1A 1ETZA 2WBJB 3AS2A 1A64A 3QUZB 4KK9C 1JNNH 2CSPA 1T4KB 1A7OH 4H5SB 3HAEA 5IEHA 5SWQB 1I8LC 1IGIL 4UQ2B 1YNKL 2HJKB 4K3DL 3ARGD 3C08H 1A6TB 2BCKA 4ODWB 3AC0A 3QXWA 5EU3B 2AJUL 2VLME 2OL3A 3VRIB 4Z7QE 5JQ6L 3BZFA 3WN5A 3O3BA 4HC1L 5C07B 1JF1B 5ERWB 4OAWA 2IANA 3CVIH 3ESVF 5JORA 4MAUH 2HFGL 4NN7B 2Q6WB 1S7QB 1N6QH 1MFCL 2CDGA 2H45A 3BE1H 3RWCA 1I7RA 2IQ9H 5EBWA 4MA8H 1FHGA 3QIWC 4P3DB 3VRLF 4MJ2A 3HPLA 5GJSL 5L2KD 1FORL 5C0IA 1JCKA 4GRWH 4X6FA 3TNMA 4HWEL 2Y07L 1M6OA 3VFSA 4NWUH 1HH6A 3KYOB 5EC1B 4U1HA 2EO9A 1CICA 1DCLA 5FUCC 1FSKB 3FONA 3HZKA 4RFNC 4XPHL 4MJIE 2XFXA 4F9PA 2XY2A 4PJXB 3PP3H 3ULUL 3MRKB 2ZCKH 5IVNA 1MWAH 3OTTA 3B9DA 5MEOA 1OP3H 5ITBH 3LVEA 4UNTA 1FL5A 3NIDE 1NAKH 4LK4A 4PJHF 3HE7C 1G0YR 1KNOB 4JZJC 3OPZH 4KVCL 1WISA 4TYUA 4UV7H 4RIRB 4Y2DA 1FBIH 3UJTH 3OB0H 3SKUD 1CE6A 3BMWA 2VKWA 2WWMC 5D1XD 3IFLH 3OR7A 1VADA 5TE4L 3FT3B 2PYEB 2XTJE 2NNAA 4JM2C 3ZTNL 2X10A 5CIPH 3RPIB 2VMFA 5DD5H 4KKLD 5KS9E 5J13C 1B6DA 1D6EB 1KIUA 1IGYB 4DQOH 2X42A 2ADJA 1Z6JT 2VXQH 3N1FC 4JY4B 3WYRA 5IMOB 2DLEA 5EOQL 3DHMA 4WV1B 5DMIH 2VQ1B 3C60A 2YRZA 5IR1B 4EVNA 2IMNA 1MHEA 3GZKA 1RSFA 1AFVH 1K9TA 5TDPB 3AXLB 5IB5B 1HHIB 2A2QT 4QOKB 2GSIB 3T1WA 3NFPB 1WUNT 2YPKB 4LPTA 3TT3L 3GSQB 4K3HA 1ZOXA 1WEJL 1E4KC 3QDJB 1VFOA 1K2DA 3RWJA 1RZGA 2H9GA 3A6BH 1DLFL 5GRUL 4LCWB 3WFEH 4HIJB 4JO4H 2EE9A 4AEIH 4YHKH 1NLDL 5E70A 5SWSE 4P23D 3PWLB 1AGEB 4TVSa 1P7HL 2UYLB 1UWGL 2GUOA 3O8XB 4L4TE 1A4KA 3RWGA 4NOFA 4FQ1H 4NKMB 2AJVH 4S11A 3RJDA 4JQXA 4JPIA 3EO9H 1E4WH 5IGXH 5FXCH 1FGVL 3MV9D 4NC2B 4I2XB 3ARSA 1XCTB 4OCSL 4OD3H 1UCBH 5FA3B 1FFPB 1VFUA 4K3EH 4XP1L 3VFGL 1GVIA 5J6HB 8FABA 3MV8D 3MRDA 2C4XA 4LARH 4OIAA 3SDYH 2PTVA 3STZB 4Y5XC 4OLWH 3JWNC 4NQED 4Y4KA 4TRPL 1G7MB 3SBWC 5LGHH 2XTJC 3F6LA 1D3CA 2DQFA 3BPOB 5ESQA 1RJYA 4X7CC 1CN4A 1R3IH 3JWOC 3PQYA 4ZTPH 4XVJL 2R23B 5GRXG 2QHLA 3RBGA 3SE3C 1NMBH 2FJHB 4ODSL 3ROLB 1KIQA 5I0ZA 4MZ2A 4NZTH 3W82A 1JRHH 1R3JB 4PRIA 4BA8A 2PTUA 2R0KL 3GNML 4HS3B 5JW5A 5HJ3B 2ZWLT 4Z7WF 3VXOA 2FEDC 2XACC 3IF1B 3QXUA 2WBWB 4PJGE 5CZXC 5HY9B 4F7EB 3TH4T 1FZKA 1OAQH 2YC1A 2A6KB 1X7QB 1U3JA 3PF2A 1RMFH 4IRJD 2BNRE 3F65A 4F7MB 1MCCA 2ED8A 2EDNA 1UB5A 4JR9L 5BXFA 4PPTA 4M62L 4BK5A 2N7AA 3AB0B 3EYFB 4YDJB 1HOCB 4KMTL 5CSZB 1D9KC 4N5EC 1ZLWH 1OP9A 4YO0B 1PX4A 4PBWD 4JY5H 5IHUH 2H1PH 3MRBB 1R5IA 1JNHA 3PGDA 3IDIA 4XWGL 1X5JA 4AQOA 4ZXBC 5IB3B 3BD5A 1DE4A 4J3VA 4CJ1A 4KKAD 4G6FB 5FUOH 3KLSA 3IFPA 5ACMA 3QFDA 5KVDL 3MRFA 4ZD3L 3KXFD 4B50A 4C56A 3FRPG 2E7BA 2VDKL 1S9WA 4U0RB 4RFEB 3UTTD 2D7QA 4K7FB 2P5WE 1TNMA 3SKJL 4JHAH 5BVJB 3OAUL 2A9NL 4XB8A 1KCRH 2VLKB 3LPFA 5I1HL 4Z0BH 1OAYL 5GHWH 4ORGA 2Z92B 4D0CA 2J1KA 4C4KO 4EQ3A 2A6IB 3PIQA 1KULA 5BZWB 1J10A 4OZHF 1RZJC 4CNIA 3TVMD 4ZNEE 4NJAH 5GGSB 2XG4A 3LKQA 4GS7C 1H15A 1QR4A 4JPVL 1KPRA 2FGZA 4NSKB 3HUJE 2DBLL 1M71B 2QQLH 2AEPL 3UXFA 1N2RA 5MI0B 5E5RB 3MOBH 1LP9A 4U1JB 4Q9CA 4Y88A 5I8OH 2E3VA 5EO9A 1NC4B 5IVOA 1PG7H 4I4WB 1SEBA 5ADOH 3UJJH 1AHWB 2HVKB 4KC3B 2BOBB 4ZO8A 2X1PA 3F7VA 3OKOB 2MPAL 5GGUB 5HHQA 3FMGH 5B38A 1CXEA 3FO1A 3QDMB 5IIEA 5D9SB 3L7EB 2VXVL 4CVXB 3TO4B 3VXRD 2BSED 4PGCB 2ZPKL 1DL7L 3L3IB 4PGZA 2JF1A 2R4SL 4NPYB 3DXAD 4ZSOB 3VW3L 5GJTH 5EORL 3AUVA 2J4WH 3KR3H 5E5MA 3U30B 4JFEE 4POUB 1YEFL 4EI5B 1CZ8H 5F21B 4DKEH 1N6UA 3QQ9C 3H9HB 4R7DA 4I77L 5CHNA 3MPCA 2X4QA 4QHLA 4NQCE 1XGTB 1ZT7B 1Y0LB 1HXYA 5MHSD 5EU5A 2PTTA 2ITCA 2IANB 4Z7VE 3ZDZE 3ARFB 2C4FT 5EUOE 5I8CA 5AYUH 1GIGL 3RU8H 4WWKA 3RWCB 3VXMA 1I7RB 1G84A 2FYYA 1IJ9A 3ARDD 3P9WB 4XMKH 4XXCA 1S9XA 2LVEA 4DN3L 1CG9A 5H2BA 3V7MA 1ZANL 3HPLB 5BS0A 3X17A 2ZUXA 1I9IL 3QO0A 5C0IB 1NAMB 1OARH 1TZGH 1YMMB 5FCUH 1TQCC 5JLZB 1TLKA 3T0ED 1V3MA 1FQ9C 1UEYA 4H20H 2Q7YB 3I85A 5E08H 4OFDA 1ZT4B 2ATPA 2IFGA 3T77A 4BQ9A 1F00I 3O45A 3HR5B 4LVOB 4ZDHB 1I1AD 4C54A 4YHML 2CKBH 4XPFL 3HZKB 3EYUL 3M8OL 1TZHA 4DN4L 1XGYH 5L9DH 2GFBA 2XFXB 5D1ZD 1HHKA 2OTWA 5F1NA 3N50A 2XNAB 4G80A 4U6YB 2ZSVB 3MRRA 5DVKA 4X83A 5EG6C 4DGVH 1QFUH 1BIHA 3C5ZB 5CMAA 5DR5H 4HLZG 1RV6X 1AC0A 5GS2H 4I9WE 1EHLH 3BP6B 2AEIT 5JOFB 4LVHC 5KTEL 1U91B 2ESVB 1T03L 4K3JH 1T2XA 4P2RE 2R29L 1EX0A 3N0PB 4D0BB 3UPRB 1DQMH 2WWKO 5I19L 3K8LA 4Q6IC 3QUXB 4MWFA 1JPFB 3VDAA 3IJYB 4MXVE 1ACYL 2DWDB 4MX7B 3QHFL 1JF6A 4YHYB 2YZ1A 4DKFH 3OR7B 1OL0A 4DCQB 3T0XA 3BOVA 3JV6B 1UH3A 3DROA 3L6FB 4WW2F 2OL3L 4K94L 4FNLH 4EN3B 1TTUA 4L8DA 3FN9A 3KJ4C 4YFLI 2WLZA 3HI1B 4DOHE 1JHLL 1T1WB 1PEWA 1D5XB 2EE6A 4L8SB 4A2LA 3Q2CA 2UWEB 5T5FH 1T0MB 1I3RB 1EFXD 1C5DA 2W9DL 2F5BH 1MHEB 4XAKD 4JZNB 3MLUL 2IG2L 1A21A 1DTUA 3DVIA 2OMNA 3DMMB 1Q9OB 1KC5H 1QUNA 1DSFL 2ILLA 3PDOB 4IRZH 4N9GB 4P49A 3TBTA 4PJ8B 1GXEA 1DBMH 4X8XA 5J8OA 1I85C 4POZD 4LSUL 3JVGC 4Z7QF 5TF1L 3VFTB 4P4KD 3ECBA 5JDSB 1J1PL 3FFCA 2ICWA 1UYWL 2L7UA 4JM2F 2W59A 3BD4A 4YPGA 5I1CH 2GUOB 2HAZA 4KHXL 5CZVH 5H35A 5GSRB 5L0QB 1VGEH 1MELA 2EC9T 2VL4A 4BH7A 1L7IL 2EZ0D 1RZKC 5DGQA 1F4AA 4PB9L 5C0DA 1MAKA 4LGPB 4ODVL 8FABB 2EDJA 1WK0A 3MRDB 1KEML 1JWMA 4BFEA 3MGTA 3ZTJG 1D5IL 4U1KB 4M1CC 1R24A 3FB8A 3HNVH 2DQFB 1RJYB 1E6JH 4L4VE 3FZUD 4G9FB 4TOYH 3VD7A 3L95B 4V2BA 4X8JA 5F9OL 3PHOB 1DANU 5ALCL 4KJQD 3EOBB 4HUNB 3VGFA 4KAQH 1VEPA 3MUGB 4QGTA 2QLVB 4PJBF 1KIQB 2ADIA 3B2UC 2OSLA 3NIDF 4XVTH 1QQDA 2CMRH 4LSTL 3SDCC 4LRNL 1G7PB 4HMEA 1NJ9B 2CLVA 1XF2A 4GKZB 5JW5B 4QRUA 4NWTL 1J5OL 2DI9A 4XRCA 3VXOB 4M03A 3VE0A 3OHXA 1FYTB 1RHHA 3TCXA 3ABZA 3VG9C 3FN0L 3STLA 2JB5L 5EIVA 5SX5H 3D85A 1S78D 5D6DA 1VESA 2BSTB 4HXAL 4L5FH 5BOPA 5ADPL 3DOSA 4JE4B 5JPNB 3VI3F 4P46D 3PWPB 2F5AL 1KG0B 1UM5H 3V6OE 5KAQF 5H94B 3V2AR 3JSSA 3ARPA 1QFWL 5EFIB 5J06A 5KSAA 3FO2A 1G0XA 1Q1JL 3EO0B 5GS0L 3MRHA 2IPUK 4WI6A 1QSEE 3LZFL 3IDIB 4E5XA 2HLFC 2AGJH 2D03L 1IGFL 4BFIA 3HZYA 2GJ6B 3KAAA 4X98A 5JHLH 3PWJA 4ESKA 2VAAA 5DHVH 5JHDD 1I3GH 4OKVA 1UENA 5ENWB 3MRFB 1BLNB 5HYJD 5F7DB 5C08E 5T1LA 3B9AA 4X5LA 1TCRA 4GQ9L 3B9KC 4QEGA 5DQDH 5I8KL 3NIFE 1BPVA 3GO1L 2AJSL 5GZOD 2BC4A 3W11C 1DVFA 1AKJB 4FZEL 2VSDA 5DEGB 3BXNA 1U6AH 2DRUA 4ZO6A 4WU5B 1QRNA 4JHBA 3ZL4H 1P7KA 4ORGB 4D0CB 5DRZA 4K7PH 4BQCA 2AXGB 2KBGA 3QFJA 3PIQB 3QXAA 3O9WC 2NZ9D 4UT6H 1UA6L 4WHYH 3CDCA 4XP4L 4XP6H 1GAFL 4JG0H 5BO1L 2VLJE 2ATKA 4CU7A 1QBMH 2EKJA 3FCTA 4LPWA 4BZ2L