2IH3B

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2006-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ih3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ih3B01
3FQWB 3LEYL 3QCUH 4OLWH 1MQ8A 3RWHA 2ENYA 5DQDH 2APWA 1VFMA 3VRJA 4NO0A 1YEGH 2CUIA 4UMGA 1ZHNA 5FF6B 1JI2A 1U3HC 4EZMA 1DCLA 3KLAB 3DXAA 4H5SB 4W6YB 1HYRC 3KYNA 3V6FB 2VITB 3NA9H 4RIRB 1E6OH 1CFVH 1QRNB 2X44D 4XPHH 3PV6A 3HZMA 3NFNA 4YXLL 5GGUA 3CLEL 1FNEB 1X4XA 2JE8A 1SBSL 2MHAA 1BOGA 1X5ZA 4KTDH 1WCBA 1H3WM 1GRWA 2HRPH 2AV7A 5EU6A 5DVMA 1FFOB 5EOQH 1DBBH 2CLVB 1UM6L 1IILE 3GKWL 2R29L 3LN5A 1R24A 4LNRA 2R0LH 4M8QA 4RX4A 4YFLF 4HW6A 5H35A 1QRND 1HWHB 3FO1B 1FLTX 1OARL 1JZ3A 3CMGA 3B9DA 2DN7A 2C7UA 1EEZA 2A9MH 1FORL 4HUKB 4MLIA 4XBEH 3MZGB 3LKPB 1ACYH 1NGYB 4GW1A 1CTNA 5GJTL 5BMFL 2A6JA 4N0CD 2AABL 4OZHE 1Z9MA 4E0RA 5IK3B 3KPSB 2HJFB 4NQCE 1NGZA 1A1NB 2BXZA 5SV3A 5KSUB 4IMLB 5I1AB 5GZND 1JNNH 1NL0L 2YBRB 4RQQB 2HH0L 3ALXA 3CFEB 5K9JL 3WNLA 2P45B 2HTLC 3PWPE 5CBAB 2ZOKA 1ZAGA 1UM5L 3HE7C 1DBMH 4B41A 4Z0BH 2HTKC 1RAMA 2Y6SD 2F53B 1KTDA 4NQDB 3KPSD 2NQCA 5HYSA 1K3ZA 3ABZA 4XP1H 3H9YA 3OKDA 1FBIL 1VEPA 1KCSH 5AEAA 5IB4A 1TCRA 1NH6A 2DQIH 4TPRH 1EJOH 3BQUB 4I48B 3V0AC 2NXZB 3RTQB 3GSWA 3HC3L 4PV9A 4JY6A 1JZ7A 3WSQH 2F53D 2UZYB 4NQDD 1FH5H 2Z35B 2A6KB 2OX5A 4KUCF 3S96B 3ET9F 4UB0L 4XCFL 1EBPA 3ROLB 3MRKA 5DJAB 1HNFA 3F6LA 3DI3B 3GSQB 3NIGF 4F37F 5FA3B 1IGCH 5ACLA 3BQUD 1INEH 3RWEA 2NXZD 1UJ3B 3RTQD 5DD5H 2NYYC 5F7EL 4FFYL 5FUOL 5C1MB 3KHOA 2XN9A 5HVGB 4HH9B 4PGDA 5T3XD 2HJLB 1PX4A 5MEQA 1N0XH 3ARFA 3TGXA 1VFBB 1Y6KR 2Y6SC 4PJHE 5IB1A 4PJGB 4YBQD 3MUHL 5LXGL 2V2TB 4N8CH 3L5IA 4ONFH 2VDMH 2X1QA 3MRCA 3O4OB 4Z0XB 5T1DH 1CS6A 5C8JA 2PTTA 2WINB 4GW5A 2QLVB 4Y1AB 4PJ5A 4KJPD 4RRPA 5CBEA 3KG5A 1DN0A 2B20A 1MEXL 1CXEA 2VIRA 2AJ3A 5BRZE 3QFDB 1OWRM 5IGXL 1G7QA 1N2RB 3VW3L 3V6ZB 1Q38A 2WANA 3K4ZA 3IDJB 3FQNA 4OT1H 2R8SL 1UKSA 3W0WA 5IQ9A 2EYTB 3IJSA 1UWXH 2OXGA 3AS0A 4GQPH 1G6RA 1QVOA 3JZ7A 5F7HA 2CDGB 3QDJA 4Y1AD 3PHSA 2W60A 3ARGB 5FO8A 1F6LL 1VESA 3GJFB 5BS0A 3RVWD 4GG6A 4ENED 5ITBH 5EO9A 3EYUH 5FOBA 2XNAA 2XTJE 1HIMH 1VEOA 2ARJA 4IDLA 4K55A 4JO3H 1U3HA 2EH8H 3LMJH 5HPMA 2YPLB 4L4TA 4LPYA 4RAUB 5GRYA 4YHZH 4W70A 5L8JB 2HN7A 4CADA 4IEFB 2P5WA 3D85B 3MUJA 1RK0B 2MWCA 2OL3A 4HT1H 3ARGD 2FD6L 4JFDB 2DLTA 3PWNB 2PTUA 2EE9A 3T2OA 1NFKA 5HYJB 4KJPC 3FCTA 1S3KH 4KKLD 4HF5L 5HHME 2QQNL 1G7MA 2PR4L 4DFHA 3IFPA 2VDRH 4GAJL 5DRWA 5T3ZH 1RZJC 2EZ0D 3MNVB 5JMOC 5HY9B 3LZFH 4NZRL 1SMAA 2YPLD 1QFOA 3MUGB 3CVIL 4R4BA 1X4YA 1VADB 1UXSB 3I75B 2D7QA 1RIHL 2EIEA 5GGVY 5EBMB 3D85D 4KI5E 1EVTC 1K8DB 3D25B 3VFUA 4JFDD 1BJ1H 2MMXA 12E8L 5J57B 4LDLB 5F7KC 5TDNB 4JAMA 5HYJD 3L3JB 1KPRB 3VG0H 1DQDL 5ID1A 2O61B 3B43A 4ENEC 1QTYT 4XTRC 4GQ9L 1AY1H 1YYLH 3BRFA 2BSSA 4G6MH 2BSED 2Q7YB 1QACA 3P9MB 1RHHB 3V7MA 4XMKL 5J6GB 1UM4H 4Y2DB 3T3MF 3WKNA 1TCMA 3QG6B 5AWNL 5I8OL 3HE7A 5HHXH 3F5WA 5DMIH 3QXAA 4BZYA 4NJAH 4NOBA 3VFMA 3FQWA 3GMPB 3QJFB 2YMXH 1MWAB 4RGNE 1E4WL 5TE4L 2FBOJ 2XA8H 1EGJH 1P84J 2BVQA 2XZZA 4MCYB 1ZVYA 2V7HA 4H5SA 5FCUH 1WEJL 3TBWA 4TYUA 4OD2B 2FDBP 1Y6MR 3ES6A 3E8UL 4MQXC 3MOAH 3OKEB 2GW5A 4Y2DD 3O4LB 3T2PA 1FNEA 4XVSH 1U8QA 1B90A 2ITCA 4PJ9C 5JLZA 1DEEA 1V3LA 4HIEA 3WIHH 1YMHB 1FO0H 4S1SH 3U46B 3ZYJA 4YHOL 4DVBB 2EDTA 3OF6A 1UJTA 2WSKA 1FFOA 1MSPA 4LU5L 5GRUH 2BRRH 4WJ5A 4BQ8A 3OKOB 1JHKH 1U95B 4PGEA 1CDJA 4U1MB 3IS0X 1CFNA 2CIIA 3O4LD 1KPVA 4PRIE 4MJIA 1JPST 4BFIA 5GS1B 1I4FA 3CPLA 1FVCA 3W39A 1D5BA 3U7WL 1FJ1B 1TJHL 1AP2B 1RV6X 1JPTL 2AXGB 4P23B 1P4IL 1A6WL 1HZHL 2XI9A 2HJFA 1CDGA 1WBZA 2JB5H 2OLDA 5KSUA 2YPVH 4IMLA 4F15B 5CJ5A 15C8L 1JN6B 4RQQA 3S36H 4ZS6D 4R7DA 2W0FB 4HFWA 4DN3L 4EDWL 2AQ1A 3IDNA 2HT2C 2HWZH 3MFFA 3OG4B 4P23D 1G7IB 1FYTE 2IBZX 3V6OA 2VOTA 3QIBB 2CKBB 4WW1B 3MGOB 4Z5RB 2PW1B 5I8EB 3P4MA 4Y4KB 3CXDL 4LCWE 5I1GL 3N9GL 5DRZA 1MJ7H 5EWIH 3RQ3A 4K3EH 2XRAH 5HDBE 5D4QA 1RQ5A 2VDKH 2JJTC 3BZFB 4PJDF 4I48A 1QLRB 1U8JB 4QTIL 1LO4L 4KKNA 5EU3A 3BPLC 1CTOA 3KYKL 3QIBD 3LKRB 4XNMA 3WLWD 3BE1H 2YS4A 3IDMB 1Y0LB 2J4WH 4Y4KD 1HEZB 3DIFB 3F8UB 1LO3H 1OGAE 2C26A 5EORH 3GK8L 4XNQB 5DJAA 4NNYA 5F9DC 1S9WB 3HNTH 2G9HA 4ALAH 3F7VA 4OGAD 5C6TH 2ZOLB 3CUPA 3KPRE 3BSZL 4S0TD 3FB5A 3OKKB 1I1YB 3F6IA 1WUNT 2XV6B 5GS1C 3T4YA 5FUZH 3HG1B 1RUKH 4JGUA 4LHUG 2HJLA 3P9WB 1B0GB 5ALCL 4P23C 4YR6A 1F90H 2P24A 1J5OL 3QUYC 4M9PA 1KJ3H 3UZEA 2YZ1A 4LVOC 5DMGD 4F15C 1BFOB 2P8MB 1CXKA 3EGSB 2HMIC 3AXLA 4CVZA 4DN4H 1EMTH 4RISL 5ALBH 1UZ6E 1UA6L 1QLEL 1YNKH 4IRSC 1U91B 3HG1D 2CGRL 2PYEA 2UWEB 4UBDC 3X13B 3LB6C 1ZLWK 5SWSA 1N2RA 5FYLE 1JFQL 4XCCH 3JBG7 4F7EB 4DZ8B 4OQTH 5D72L 2EIZB 3CJJA 1LK3H 4RA3A 4Y4KC 1QKZH 4MA8L 3C2AL 3MRDA 2CRMA 5E99H 2VE6B 1FL5B 4I5BB 3MBEB 2M26A 1G7PA 3TIDA 1Z9LA 4OB5H 1T7WA 3SE3C 3VE0B 3LQAL 1CXIA 4XNYL 1UZ8A 1AFVH 1SJEB 5F1NB 2DQTL 3VFRA 4JVWA 2DBJA 5GGRB 3VFTA 1A64A 3HTLX 5F71A 1UXWB 1JGDB 2FGZA 3GBLA 3N1FC 4K2UH 3SO3B 3OHXB 5DMGC 3RX7A 2ZUQB 3D85A 1RK0A 2ENSA 1YYML 3MBED 1YQ2A 3PWNA 4PJ9A 1R0AH 5BV7H 2ICWB 2RIKA 2FX8H 4H8WH 2AEPH 4UIMA 5HYJA 5KAQF 4G8EB 5EN2A 3TFKD 1MJ8H 3JVGA 5F96H 4XT1C 1N4XH 4PJGF 4PRIB 3EOAB 2CJUH 2AXFB 3LIZL 3G5VA 5HY9A 1TETL 4P3CL 4WFHD 1IBGL 4QYOA 3T0AA 3MUGA 3GB7B 5KG9A 5IEKB 5K59F 1VADA 2ZG2A 1UXSA 4QNPF 2D2OA 3KS0H 4ZD3H 1C7TA 5EBMA 3HLAB 5F89B 3D25A 3V5KB 3SDDB 4KZEH 3P0GB 4LVEA 5FDYA 4XAWH 3IKCA 3THMH 4YZFF 2OXHA 4NQXB 2GSGB 4X7TA 3BKJL 1KPRA 1WFOA 5DJDB 4PRID 3UYPA 3ZTNH 3GO1H 4NZUH 3WDJA 1CLZH 1YNLH 2VAJA 4IRJB 4KHXL 4PB0L 3UYRH 4GS7C 4IM8A 3P30L 4GSDH 5I8CB 1GGBH 1MPAL 1RHHA 4EN3B 4K7PH 5DS8A 4MNGE 3SDDD 5J6GA 8CGTA 4KGLA 3SGDI 6FABH 4BZ1L 4S11A 3PGFL 4MXWL 1P5VA 1A14L 4OBRA 1HH9A 4K7PY 4UV4H 4NWUL 4IRJD 1ZSDA 2VNCA 4KRMB 3R0MA 1ND0B 4YDVB 4Z95L 2VDQH 4EN3D 3A6CH 1SVZA 3QQ3A 2JJTA 3FQRB 4UU9B 4F9PC 3OKEA 1HYSD 1KLGB 1WGOA 3GSXB 3KPTA 4JY4B 1DBKL 1YEEH 5IFJB 1MCOL 4L1HA 2Y7QB 2FZ3B 3RPIB 4ETQB 3O45A 3U46A 4U0RC 1WAAF 4DVBA 4D2NA 2G75B 2WIIB 1IGML 5GSRB 4JHWL 4X4YB 3KPRB 3N85H 4XP9L 5AZ2H 4ZTOH 4BSWB 3DO7B 1PG7X 3FT4B 1N6VA 2JK5B 2GT9B 5GXBB 1T2XA 4K8RD 4H1LB 2FEEL 3UTSB 3G6DL 1TJGL 3SDDC 3MX0A 4DKFL 5GS1A 1WC7B 5B3JF 3QPXL 4X99B 5I73B 3D0LA 1OM3H 5JZ7C 1FJ1A 2HVKB 1AP2A 1MCLA 4FP8H 4P23A 2DBLL 5EU6E 2ESVA 3KPRD 3QUYA 4H0GA 3DVNB 3QHZL 4FZEH 3U4BH 3FRPA 2HFTA 1YN6B 1I8LC 4M7KH 4FXGA 4IRJC 4ZAKC 4JM2C 3PIQB 1MIEL 2QJDA 3MNZA 1RFDH 3BD5A 4EN3C 3P4OB 3UTSD 4EEEA 1XAUA 5KAQG 5A3ID 4PJEB 2WM0A 1HYSC 4IRSA 5JPMB 4PYHA 4NO3A 3IU4H 3I6GA 1T2QH 1BBDH 3CU7A 1G7IA 3FN3A 4NDMB 1JV5A 1J1OH 2BC4B 3B83A 1IAII 3LEXB 3IYLW 4YHNB 1HINH 2FECL 3L3KA 4YPGB 3HRPA 1K5NA 3BZFA 2ADGB 5HHQB 4JFZL 1TVBA 1U8MB 2E9BA 3SE3A 3DURA 1AR1D 4XBPA 1QSEB 4W6WB 3U1SH 2D4DA 1MFAH 4HLZG 5IESH 5F7MC 3IDMA 3RZWA 2MCPH 5KS9B 1BOYA 3DIFA 2VLKA 4OD3L 4PG9A 4RCAA 3MREB 5ILTL 3LN9A 1CYGA 1OLZA 1KOAA 1CQKA 4U6YA 4UINH 3L3HA 3MRJA 1MAMH 5D70L 4NJ9L 4P59L 3PDDA 2FSEB 1AGBB 5D1XB 2PN5A 5J13C 5KVEL 1QSED 1JPFA 2V5MA 5T3XH 3TA3C 5I73C 1IE5A 2LAGB 2APFA 4AG4L 4BH7B 1KJ2B 1KTRL 2DQFB 2D0GA 2OR7A 3RL2B 4HEPG 4JPIB 4XB7A 1BFOA 2CRIA 2VZTA 3TO2B 3E2HB 3L5XL 4LEXL 3Q0HA 4N0FA 2OP4H 3P0VL 4LMQE 4QHLB 5D1XD 4MX7A 4LPTA 2AXJA 2FL5A 1TQCC 1Q0XH 3RI5K 2ZG3A 1RZJH 1P7QA 1U91A 4LVHB 3C8HA 2QQQA 2XN9E 4A6YA 1QG3A 4KC3B 2GTZB 4F7EA 1W8NA 3HNSL 1ZANH 4IHOB 1GGIH 3QI9C 1B0RA 1AGCB 4Y19A 5T5NF 2ZUVA 4ZUTB 1FL5A 4I5BA 1D7FA 4PGCB 5CEZD 4G42B 1CGYA 1UACL 4PJ8C 4U7MA 4P4KB 2XFXA 1J0IA 1CIUA 5IMLA 3VE0A 5DHVA 1D6VH 3BISA 2XQBL 4LSPH 5FECB 4JANB 5JW4N 3L7EB 2EE6A 4XPTL 3MR9A 1JGDA 2Z93A 4HLZH 3TH4T 3WIFB 1NCDH 2EXYD 3OHXA 4F9PA 4N8VB 1E27A 5DZNA 1E4XH 4QCIA 1KTLB 3GJFH 1OCWL 3BW9B 4P4KD 5ITFA 4J1UB 3EYVA 4UT9L 1T2JA 2F74B 2YRZA 5BS0E 3S4SG 4GG6E 4TRPH 1ZHLB 4MD5B 3AMKA 2IG2L 2ZCKL 3BUTA 3CSYB 2CIKA 2V7NB 1I1FB 4GMSH 5E94B 1KB9K 2GK2A 2E7LC 1OGTB 5KVGH 4J23A 4KK5C 2AW2A 2DTML 5I19L 1WZMA 4P2CG 3V5KA 3SDDA 2P5WE 3E2HC 3VU2A 3U6RB 2UWEF 3NAAH 3UC0L 1DBAH 4KVCL 4YGAB 3QIUB 3IDXL 1CGXA 2WWMD 3W9EB 3WV0A 1SYSA 1KEML 4LVHC 1QO3A 3T2NL 3N0PB 3ZKQD 1NLDH 3MOBH 4S0SD 1AXIB 3GSNB 3RWIA 1I8LA 4X9BA 4IRJA 4ZAKA 3TYGH 4JM2A 5E7FA 1W72B 5I8CA 4QXGH 5L9DH 2BFVL 4EN3A 2Y5EA 5GGQH 5IR1B 4LOUC 2V5TA 3T0VA 3I3DA 1TQBB 3MMEA 1WWWX 4NFDA 3CH1B 3QIUD 4PBWD 3RVUC 2MPAH 4LQFL 3D9AH 2IPTH 3TNMB 3EO1B 1A0QH 1N5AB 4UQ2B 2DICA 5FM8A 1OAKH 1ND0A 3CCHB 1NCBL 1E4XI 1IZJA 4UDUB 1L7IH 1ZGLA 4YHKL 3N1QC 3QUMA 2J12B 3NIDE 4URTB 4JY4A 1FZKB 4EXPX 1MWAH 4QXTA 4C4KO 3I6LD 4FNLL 1PX3A 4H25A 1MJJB 3NA4A 2GAZA 3C5JA 3RU8H 1DQLH 5IBTL 4TTGA 3TM6A 4X4YA 2G2RB 1ZT7B 4EBQH 5CGYC 5T5NG 1U6AL 2VWEC 2R2HA 4H0IA 4ZO6A 4ZOEA 3PDOB 3CX5J 5ANME 4JRXB 4P48A 4XP5L 4EI6B 5B38A 2IMMA 4M03A 1F4XH 3TA3A 2LVEA 4E9LA 3RHWF 2HVKA 3REVB 1R5VB 5FM4A 5D6CB 4OZIB 1Z5LA 5MERA 3MJGX 1JUFB 4KV5F 1PG7W 1YN6A 4KUZH 4KMQA 1X5LA 3WE6A 3PIQA 1BM3L 1INDL 2KBGA 2QEJA 2OTPA 3GHEH 3MO1B 1MCPL 3BDYL 3NMEA 4JRXD 1TQBC 3VFNB 3BRGC 1BEYH 4MJIE 5JPMA 4LLQA 1C16B 3DX6A 1CICB 3IFNL 2N56A 4I3RH 3ARZA 4ELME 4L3EA 3DNKA 2ZSVA 3U30B 3FQTB 1WFNA 5I6XC 1FNAA 5DYOA 2YUXA 3QI9A 1E28B 3DYOA 2R1YB 3H3KA 4JHBA 3M45A 1IGYB 3U0TB 3VRIA 1KENH 2EEDA 5IV2B 4PJ8A 2AEWA 2UVFA 4ZSOB 3RVTD 2R2BA 4FQHB 1WBYB 2I27N 4LLAA 1CICD 1CG9B 1KTKE 3ARWA 4JB9H 2CKBH 4M93C 4MCZA 1OD7A 3V6OE 4F3FA 1CXHA 5KS9A 1BQHA 3BZ4B 2BNRB 3BN9C 3C5ZA 3TYFB 3UO1L 3RL1B 4X6BB 5FA4B 3V5DB 2I60L 4N9GB 4V1DB 3CDGB 3ULUC 1T20A 4ZFGH 5IB2A 5D93C 4HJJL 4YAQA 5J4MA 3A67H 4GXVH 3QWRD 4PRHE 1F4YL 3ALWA 2EO1A 3IXTB 4BA8A 4F80A 3FFDA 3D18B 4IS6B 1KJ2A 4C56E 2BNRD 2QTEA 5DFWH 2E7LA 3RL2A 1DBJH 4PJEF 5GGTH 3C8KA 4V1DD 1CFTA 1G9NC 5J89A 1MELA 4WUKL 3S6CA 1ODAA 3CFDA 3L3DB 4WV1C 4NQVB 5B22A 4O58L 3U4EB 1Q9WA 4L9LC 5IM7B 1FIGL 3UBXA 4X9HA 4PJXB 1CICC 1QBLH 5CWSA 5AYUH 2A1WH 3GSUB 2D03L 4X80L 4AEEA 1P4LA 5TQ2H 3U30C 2DF3A 2RHEA 5ADOL 4HIHB 4M7LT 5C6WH 4IHOA 3JV4B 4NKIH 5JPNB 1AGCA 1ZT1B 4KJQD 3RAJH 3I84A 1OT2A 2D7PA 1DR9A 1I3GL 2ATPB 4MMZC 4PGCA 4WWID 2QKIA 3M8OL 4G7VL 3O8XB 1LP9B 1F00I 3OKLB 4QRTA 3TH3T 1Z3GL 4NO5A 3HNVL 4DJMA 5FECA 3QCUL 3DX9A 1QPXA 3LCYA 4OLWL 2CUHA 5D7LE 5DQDL 1A9EB 1QSFB 4PP2B 5ELIA 3DYMA 3SE8H 5JUEH 3STZB 1IAIM 3GGWB 2HJKA 3PWVA 3VXTA 3NA9L 1E6OL 1GC1H 1CFVL 1TTGA 3O8XD 4XPHL 2MNUA 4O51B 5E8PA 2MQ0A 5GSVA 4W4OA 4W6XB 3PHQB 4KTDL 1ZHLA 5ANMB 1Z0MA 1A7RH 4X5XB 2YA1A 4GKOA 2HRPL 2GJZB 4EJ1C 1MHHB 1IC1A 1XR8B 1QSFD 5EUOA 5EOQL 1P2CA 3C09C 5A2IH 1DBBL 5C09A 1ZHKA 4OD1H 3B3IA 4RAVB 5GGRY 1A1MA 3VXMB 3OB8A 4JO2H 4QRPA 4KJQC 4JDVA 4F7CA 3Q5OA 4Q2ZB 3RIAK 4LAJH 2A9ML 4P2QE 4XBEL 5HHVH 1ACYL 1B6DA 1T1WB 4H1LG 5D1ZB 4OCMC 3KPMB 4Y5VB 4OZFB 3GIVB 4HGKC 4S10A 4KKBD 2D31B 3BPNB 2VZ1A 1FSKC 5GS0C 4XWOD 1R3HB 1Q1JH 3VXMD 1ORSA 5ENWB 5IFAL 2ATKB 1UYWH 1JNNL 4MMXC 4JZJC 4UNUA 3BP5A 2IADB 4L4VA 2RFXB 3VFOB 5D1ZD 3UTTA 2VZUA 4NKMB 1DBML 4UQ2A 4Z0BL 2PYFB 5DURB 5DEGA 1CDYA 4WTWA 3CCHA 4QGYA 1WK0A 5CP3H 1IEAB 4XP1L 3IF1B 4QHUB 3HZVB 1EHXA 4PJFA 1F13A 1INQB 4WGVB 1KCSL 4JRYB 1DLHB 2DQIL 5IKCA 1MLBB 1VA9A 2E9WA 2AKRB 3NCYP 3TT1H 4TPRL 1EJOL 1MJJA 2AJSH 3WNPA 1HSAA 4P2RA 1HOCB 1MY7A 1IAKB 2E7HA 1WICA 4RWHA 5DURD 3WSQL 4L8BB 4Y8AA 5KVFH 1YUHB 1ZT7A 1C08A 2YHGA 1A7QH 1FH5L 3RX8A 4K8RH 4F33A 1XZ0B 2IC2A 3OXSB 5C0FA 1J7VR 3I3EA 1ZTXH 4JRYD 3C6SA 4BKLB 1KC5H 1F6FB 1IGCL 2GJJA 1INEL 2JJSC 4BQ9A 4POUB 1QLFA 5F1IA 1UH4A 5DD5L 1NCWH 1WBXA 3N06B 4IRZH 1TFHA 3IVKB 3TNNA 5D6CA 4WVRA 3QDGA 1MCJA 1OQOA 3HE6B 4YDIH 2BCKA 1FC2D 1N0XL 3SGEI 2X5PA 1AGDB 3BPNC 4H1LH 4LQ1A 3PABA 5DQJA 1VDGA 3HPLB 5TJWK 1QR4A 1DQML 1FRGH 5I0DA 3MO1A 4KKCD 3I02B 1QEWA 4N8CL 4ONFL 4RBPH 2VDML 1S5IH 4WV1A 1I3UA 3H0TA 5FDWA 4HWUA 2P8LB 5ADPH 5I66B 4L9LA 1CICA 2GIYA 5TGBB 4AM0B 3S9DB 3HE6D 5H8DA 1G0DA 3O3EA 3H9ZA 5DEZA 3CFKA 5AD0B 5JOFA 2P43B 1NCNA 3QXDB 2YK1H 4Z77B 1BZ7B 4OT1L 5FKPB 5I0ZA 3FONB 5D7LB 3BEWA 4ZSOA 3ZHKA 3F58H 4ODHL 4IOIA 2EIBA 1F4HA 2D7OA 2F54B 3B6SB 5MHSE 4UUJB 4PTTB 1KELH 3IFOA 4R96A 1EZVX 5I1JH 5ITBL 4G6KH 2NY1C 3BZ4A 3EYUL 4OF0A 1XGQB 4Z8FH 1XF2A 1CBVH 3RL1A 1HIML 1UWEH 3LKQA 3H6JA 1QFWM 4X6BA 3VJ6B 4JO3L 4L8DA 5FA4A 2EH8L 4N9GA 3LMJL 3DGGA 1A2YA 3MLYH 4PJCA 5D7LD 4NC0B 4YHZL 4N9OB 4OAWA 4KZDH 4WI8A 5IVXE 3AS3A 4P57B 4J8RB 3BI9X 1ZA6B 3QP3A 3TBSA 2DLGA 1OOAA 1CU4H 1YY9D 2F54D 4HT1L 4OZIF 4YBLB 2BP3A 1LEGB 5T1LA 1RUMH 4N8VG 1B88A 5JNYB 5A1AA 5DQ9B 3AREB 2OI9C 1S3KL 5D8JH 3RNQA 1A3QA 3WUWB 2VDRL 5T3ZL 1KNOB 3RKPA 5CSZB 3RKDD 2W65A 2VLKE 3LZFL 4OLUH 2FRGP 3MJ9A 4WTXA 1BJMA 4BK5A 4D0CB 3TO4C 1HI6A 2V2WA 1S7QB 3PL6B 4F7PA 4NQVA 5J7CC 1X5YA 1NMCB 2VL5A 3IDUA 3ORJA 3DRQB 2UVEA 5IM7A 5C08A 3WFEH 2EDQA 2BHZA 3ARED 3IB4A 1XH3B 2VR9A 5E9DA 3VG0L 3Q5TA 4OF3A 5LAXA 2QR0B 1AY1L 1YYLL 1JHLH 4HIHA 4JG1H 3UAJD 4LAQL 4XI5C 4G6ML 4HUUB 3ZE2E 2D0HA 5CIPA 3LQMA 5CJXA 5CEZH 1BIHA 4JZJA 3PL6D 5D2LB 2ATPA 5HVFB 1XGPA 3VI3E 4U1JB 4LSUH 4FA8A 1U41A 5E08H 1UM4L 5EO0B 3MROB 5KW9H 4KJYB 1CF8H 5DMIL 5DRXB 4YGVA 4NJAL 2NZIA 3Q3GB 5FEBA 3OAUH 2C3XA 2YMXL 1PAMA 1QSFA 2XA8L 4JGJA 1EGJL 4N0UE 4PP2A 4M1GH 4N1EA 1NJ9A 2ZNXA 4B5EA 3GGWA 5FCUL 5DFVD 5EBWB 4Y19E 4ZO7A 3MOAL 4O51A 4X5WB 2GJ6B 3ROOB 1EFQA 2EXWD 3K8MA 3TH2T 4YBLC 1CZ8H 4XVSL 5D2NB 3PHQA 3M07A 3BP4A 3QDHA 3TBVA 2D7NA 4X5XA 4E41B 3WIHL 1IGJB 1FO0L 4S1SL 4OV5B 2FR4A 5FYJD 5GRUL 3B5TA 3T65A 4K94H 2BRRL 5B4MC 2CUMA 3UAJC 5DD0H 3VXMA 3T0EB 1JHKL 1Q8MA 4LLYB 4NCDA 3F65A 1GGTA 1JTOA 1A7OL 2JJSA 4PJXF 4XCYB 3ZKMD 5C0RH 2GJ6D 3B9KB 1NMCC 5IW3A 1ZHBB 5GGSB 4E41D 4MNQA 3OKYA 2DI7A 4MSWB 3ZDZE 1B3JA 4WEMB 4P5TC 1M7IB 1X44A 4ZO9A 4D9RD 4X8XA 3TLRA 5SWQB 2BRQA 2JB5L 3T0ED 1ZMYA 2YPVL 5ENWA 1LP9F 3WDIA 2D3VA 2ATKA 4NUGH 3GMQA 1C5DA 3S36L 2Q7NA 3B9KD 3CGTA 3NIDF 3EOTH 1FL3B 3FL7A 1I1AB 2RFXA 4PRDB 4RMVA 2EXWC 3GSNH 3MV7A 2LU7A 2R2EB 3MLVH 2HWZL 1W72H 4L3CA 4OF7A 1IJ9A 3X17A 3BVNA 4JPKH 4GMTH 1IEAA 3PP3H 3L3OA 5HGBB 1MIML 3IF1A 2VDPH 3MLSH 3HZVA 4JREB 3KVQA 4H0HB 1S8DA 5DJYA 1ZVHA 2BY0A 5EWIL 4K3EL 4YHMH 2XRAL 4YDLC 2WBJC 1L6XA 4U6VH 5HGHB 2ARJQ 2VDKL 1I1AD 1P6FA 4QRSB 2B4CH 2BNUA 2YOCA 1KCVH 4MD4B 4JVPA 3VRLF 5T5FH 5FGBC 4F7TB 2WUBH 1KN4H 1FE8H 2XIDA 3WLBB 4L8BA 3U9PH 3BE1L 3TJEH 1XF3B 3WNOA 3P2TA 1NSNH 3R1GH 5EG6C 3BYTA 1LO3L 2XG4A 5EORL 3T0EC 5IUSA 2Q6WB 3FAXA 1LO5B 1LO0H 3HNTL 4CGTA 2LAAA 1LE5B 4ALAL 5E8NB 5C6TL 3KPOB 3BH8B 4PG2C 3IU3B 3L6FB 1KJVB 3IVKA 3D87B 5EOTA 4J2XA 3O9WC 3FN0H 4JPVH 1BBJA 5FUZL 1RUKL 3OAZK 5A16A 4XCEA 4OFYA 3K8KA 5A2JH 1AGDA 1F90L 1KJ3L 2WQRA 3TO4A 3I02A 3X12A 2VMFA 1G7LB 1ZE3C 4X98B 4DN4L 3MLTB 1EMTL 1F97A 4IOFD 43CAA 5ALBL 1AO7B 3HCVA 4ZYKA 2OTWA 5FYKU 1I1AC 1YNKL 2EYRB 4AM0A 1MUJA 2H2SC 5IHZB 3RA7H 4OCNC 5IMMA 2P49B 4TVPE 5AD0A 4XPFH 4XCCL 3FT2B 4Z77A 3QWOA 1BJ1J 1BZ7A 4HWZB 1X6NA 4OQTL 3FONA 4LLMB 1LK3L 4P2YA 4JREC 1BVZA 3VH8A 1QKZL 4CJ1A 4RFNC 2X9WA 3DPBA 3GRWH 1AO7D 5E99L 1ADQH 4L4JA 5I1DB 2F54A 5D7KE 4D0BB 4XHQA 5IVZB 3AM8C 5GRZA 4PTTA 4F2MB 4OB5L 1RUPH 5D7SH 2PW2A 4L3EE 5HJ3A 5E8EA 5GIRB 2C4FU 4HHAB 3UZVB 1AFVL 3JWDH 1YQVH 1XGQA 2JELH 2EEBA 3G5XB 2Q1EA 1HHIB 4P2OC 1EFXB 4B53A 5C3TA 1KYOK 1UQSA 1U58B 2J88H 4K2UL 1AXSB 1Q0YH 4P57A 4J8RA 3QNXB 4JKLA 3TN0C 4LLDB 3EDKA 4OM1H 2KUTA 4GBXB 4E5XA 3TESA 1R0AL 1LEGA 5BV7L 4WNQB 1N5YL 4Z7QF 2FX8L 4H8WL 5I1IH 1MJ8L 1FAIH 5F96L 1BIIA 4ONHA 1N4XL 4C83B 4G6JH 2CJUL 2OQJA 1II4E 1D6EA 4I4WB 4MJ2A 3QRGH 1EFXD 3MRHB 2ADIA 3HUJA 4ZD3L 1CD8A 1N59B 1DSFH 3ZMRA 4LMQI 4S1DD 1I3RB 2DM2A 2O5XH 2Y9RT 4GBXD 1LMKA 1ED3B 1EH9A 3FO2B 3OJ2C 4HKBB 1UENA 4XAWL 3THML 1M05B 4R4ND 4P5TA 2EDYA 1MCCA 3AS2A 3ZTNL 3IJYB 3GO1L 1AD9A 1C1EH 4NZUL 1CLZL 1YNLL 4HUUA 5DD6B 4B50A 4OLXH 3UYRL 4OF6A 2Y06H 4GSDL 4Q0XH 1GGBL 1T1ZB 4OZFG 3IDIB 1GCFA 4K7PL 4QRRA 5CD3A 3ARBB 1A47A 5EO0A 4KJYA 1JNJA 3L7FA 6FABL 1JMZA 1Q72H 1FZOB 3Q3GA 3VXUB 5C0CB 1Z2KA 3LQAC 2IH1B 4UV4L 5MI0B 4ZFFA 2Z91B 5DK0A 3JWOH 4MB5A 4XBGB 1G7JA 3HC0A 2I9LB 2YA0A 4XNZC 1ZVSA 5C9JB 1JGUH 3FOLB 3OAYH 4NQSB 4KY1H 3H9SA 2XWTB 2WBJA 1I75A 2XXCB 1UH3A 3LPWA 2KPNA 3A6CL 1I8KB 2CLZB 3BPCA 3DVFA 5GRWA 5HGDA 4GKNB 4PRNB 5TDPB 5MENA 4N1HB 3ARBD 4JZNA 5D7JC 5H37G 5FGBA 1YEEL 1KLUB 2I24N 3T1FB 3VXUD 1IGJA 5C0CD 4HWEH 4OV5A 4XH2B 1KCLA 5FKAA 3LS5H 1WZ1H 3S98A 3N85L 4LARH 5L8KB 3NIFE 4XCNA 5JDSA 2DB8A 3JUYA 3MUZ1 5J3HD 3VGFA 4ZTOL 5ID0A 3T0EA 3BHBA 1IGIH 1VGKB 2YRLA 4XXDB 1AQKH 4QEGA 5ESAB 3H9HB 1AXTH 4G8GE 1NMBH 4NNXB 4LBEA 3B2VH 3O9WA 1W8OA 1QA9B 5F70A 1OM3L 3QO1B 4MSWA 1CIDA 3ULSB 4FP8L 3SJVA 3V7AG 1M7IA 3IDYC 3KPLA 3I6KB 5IW6A 2KQMA 1MFEH 4FZEL 5D2LF 1ONQB 2VWEE 5SWQA 3U4BL 1GOGA 4M7KL 4Y0GA 5C09E 4J3WA 3VFWB 4WI5A 2ZCHH 5KN5A 4RZCB 2CO7B 2ZCLH 4QRPE 1QQDB 1RFDL 2DMBA 2DMCA 2YC1B 5AUMB 5EU7E 5C0AA 1PFCA 1IRAY 1I1AA 2OJEB 1UC6A 3AB0C 3DV6A 2CXGA 5DMKA 2XICA 3M1BB 1YN7B 4OZFH 5EDXA 3BX7C 3ZKXB 3IU4L 2H32A 2IQ9H 1T2QL 4HMDA 1S9XB 4NRYB 2IAMB 1J1OL 1HILB 1QBAA 4PRBB 4MJ6B 1A02N 4RMSA 1HDMB 1T80A 1HINL 5I74B 1FLRH 1WFTA 1U8PB 1OSPH 3RPKA 3SKOA 1T1YA 5HGHA 1AD0A 3ALPA 3AM8A 2FYYB 1BZ9B 3MLXH 2IANA 1IT9H 3EW3B 4MJ5B 3UTTE 4F7TA 5CKAA 2BJMH 4BFBD 4NYLB 3U1SL 1JF1B 1MFAL 4YK4C 3WS3A 5IESL 2IAMD 3DGCR 4P2OA 1BD2B 3P4NB 2VLJB 3UCRA 3QH3B 1JF5A 3T8XA 1OQXA 4Z7WA 3BH9B 4U1IB 4YHLH 1U42A 1T3FB 2DQHH 4PJFE 3TN0A 1LO5A 4P46B 4UINL 3KPPB 1MAML 2X4NB 4N5EC 4JQIH 4FQJH 3IJHB 5T3XL 3ILPA 2WW8A 5MEOB 1BD2D 2VLJD 3RY6C 4NO2B 4TNVK 1KCUH 1KIQA 4G6AC 3S35X 3QNZB 3ULUE 1N3NA 3ILQC 2F5BH 5E4EC 1X6LA 3D69B 1PG7H 3MV8B 4P46D 1SQ2N 1ZLUH 3WUWG 3AMLA 1EAPA 2OP4L 5GZOD 4OF5A 4UT6H 1KJMB 4P9MH 1FZJA 3G9VA 4LSQH 4AYFA 1Q0XL 4J3UA 1RZJL 1NGWA 3WNKA 3KS0J 3QCVH 4U1HB 3MJ8A 2MSPA 3EYOA 1T0PB 3FT2A 5J1AA 1NKOA 2V5SA 4LLMA 1IEHA 1OB1B 1ZANL 2X4SA 3MV8D 3JV0A 1GGIL 3TV3H 3VXQB 1OP5H 3CXHJ 2HG5B 1JHTA 4D0BA 5IVZA 3E6FA 3K46A 5T1KA 2QHRH 2UY6A 2VXUH 4JFEA 1GYAA 5FM5O 4Z6AT 1D6VL 5GQBA 1T5WA 4LSPL 4GLRH 3TWCH 3MCKB 4LKXB 4MAUH 4ZDHB 5F7DB 5ECJE 4YIQB 3VCLB 2D7TH 5IB5B 3UPCA 3HZKB 3VD9A 5CEXB 4AJ0A 4LLDA 1E4XL 5D7JA 3ARVA 3V5HA 4WNQA 4NKDB 1FL6B 3S7GA 2KQNA 3QQ9D 4LVNB 4UOJA 4ZPTB 4TRPL 4C83A 5EU4A 4B7IA 2DWEA 1H3TA 4G8GB 5HBBA 2F8OA 1K2DB 4GMSL 4NCC1 4KI1A 4NM8L 4PJCE 5KVGL 3DTXB 4WFED 4F8QA 2AXHA 3ME0A 1I3RA 2CDEB 3NAAL 1ED3A 1VEMA 1DBAL 1UVQB 2J5LC 3QDME 4MA3A 1ZS8B 3S8WA 3NN8B 3BP7A 3W2DH 1J0ZA 1FFNA 3UTPD 1LD9B 1CFQA 1M05A 4GG8A 3WKMH 1BAFH 3TBTA 2LE9A 4EOWH 2XWJA 1NBZB 1A21A 4G8GD 1NLDL 3PGCB 1F3RB 3TYGL 2IBGA 1IEBB 5IB3B 2OMBA 3CFIC 4J6RH 4QXGL 2JCCE 5L9DL 4XNUL 2X89A 5GGQL 3MLUH 2EDLA 3PWJB 1J8HB 1BQSA 4JO4H 5GPRA 2A74B 1PD6A 2MPAL 4P49A 2KDGA 2X42A 4U4BA 1O0VA 1T22B 1QNZH 2IPTL 2WBKA 3VXUA 5C0CA 1KULA 2Z91A 2ORBH 2JJVA 1A0QL 2F5AH 4OTXH 4UQ3A 1O7SA 2I9LA 5C9JA 2E5EA 3FOLA 1OAKL 5TPWH 3FMGH 3HA0A 1TTFA 4Y16C 3ARSA 5DJ6A 4R3SA 5FUCC 1L7IL 1NC4B 2GCYB 4PRNA 4L8SC 1J8HD 4F58H 3LQZB 4OZGB 1S7UB 3KJ4C 1KLUA 1MWAL 3BWAB 1CL7H 3EYFB 3T1FA 4WHTA 5E70A 5FYJH 2X4QA 3MLRH 5KSBB 2L0DA 3RU8L 1DQLL 4PJ7A 3W82A 3UTQA 3FOMA 4EBQL 2NY5C 2LVCA 3BKCH 1JI1A 3DUUB 1FNGB 1NC4D 1T5XB 4PTUB 4XXDA 1SEQH 4X4MA 4EI5C 1FCGA 1BMGA 4G80B 1U93A 1EX0A 1F4XL 2E3VA 3FB7B 1YJDH 3QO1A 4LCIH 1RU9H 4M4PA 3RY6A 2E8ZA 3I6KA 2O93L 2DD8L 1QD0A 5FV1L 5ESQB 2GITB 3CFJA 4KUZL 1V05A 3GKZA 4PLJC 1CGVA 2IF7A 2BY1A 3GHEL 4WO4C 2YC1A 3UZQA 1JPSH 3QUKB 4S2SA 1I7TA 1NGPH 4HBQA 1BEYL 1FDLH 4E42A 3VD4A 4P4RB 5TDOB 2DYPA 2FWOB 3V0VB 4IJ3B 3FRUB 5HI3D 2XT1B 3SO5A 4MNQE 4I3RL 1S9XA 2GSIB 4NRYA 2COQA 2B1HH 5GRVL 1HILA 3ZT5A 4Q9BA 2FIRT 5GGSY 3L5WB 3IRPX 3W9DB 1AGFA 2A38A 4ELKB 3MRPB 5GRJH 3FB8B 3W5NA 2G5BB 4M7JL 1KENL 1QZ1A 5T33H 1CL7I 2BNQB 3LRSA 3F62A 5D7IE 8FABA 1NFIA 3MV7E 4JB9L 4NYLA 2CKBL 3KPNA 1R3KA 1MCHA 5B8CB 1L0XA 3P4NA 3QH3A 3MNWB 4CW1B 1YMMA 4AEIH 2BVOB 4U1IA 5EZLA 3EFFA 3UJTL 1TZHB 1KT2B 1LNUB 1PYWA 2R23A 2VN4A 1T3FA 4HMCA 3F7PC 3Q48A 5E1AA 2KZ1B 4M6AA 4P3DB 5CCKH 4ZFGL 2X4NA 1P84K 2BNQD 4X8JA 1WWCA 3A67L 3QHFH 4GXVL 5IMOA 3IJHA 1WTGT 3VXOB 5B3NA 5HVHB 3GMLA 2H6PA 4M1CD 3QDMB 5IEHB 1Q94B 2Q87A 4MS8D 2GTWB 1F58H 3G5YB 1NEZA 3QNZA 4TNWK 4JZOA 5E8OA 2VDNL 3C08H 1DBJL 5BZDA 3B4NA 1J9CT 5HYQA 3MV8A 5L88H 3BKYL 1F11B 4HGWB 2D9CA 3OGCB 3QNYB 1KJMA 3ECBB 1JGVL 2RR3A 4QOKE 1MQKH 5DDHB 3TBYA 3GZKA 1YC7A 4XB8A 1A3LH 4U1HA 3QDMD 3BP6B 1QBLL 2VR5A 4LPUA 2A1WL 5AYUL 5JHDA 5TQ2L 4PJBE 3U7YH 4M9OA 2Y25A 5CSBA 1IM3B 3SE4C 1GZQB 3MRMA 4HKJB 2GQHA 2FIKA 4NKIL 2HT3C 4U1LA 3RAJL 1ORQA 3P73B 1A7PH 4NSKB 4CUCA 1BQLH 1MI5E 4JN2B 4PLNC 1FG9C 1XFPA 1XR9B 1BWWA 4OM0H 1F3JA 3S5LA 6CGTA 5B8CC 1D5MA 3MZTA 4O2EA 3MCKA 4KQ3H 3VCLA 4Y16A 3ARDC 2PF6A 4HPOH 1W0WB 3SE8L 5JUEL 5CS7A 4G7YH 2B0SH 1DVFB 4L8SA 1NAKH 5F9WB 1QSZA 1AQDA 4YO0B 3V0WH 3FO9A 3MYJA 2DDQH 1GC1L 3E6HB 4CDGC 4NKDA 1FFRA 2V2XA 2L7JA 1ETZB 4HKZB 1A1OA 5EOCH 5HVHC 1RUAH 1KIRB 1A7RL 3P4LA 4HG4K 2DQCH 4DGVL 1K2DA 5SV4A 1IAOA 3HS0A 1Y6NR 3K74B 3QFJB 3F7RA 4EIGB 1DVFD 1S7WA 4AT6A 3LV3A 4OD1L 4EI5A 4ZMAT 3VG9B 3KGRA 4JO2L 4KK9D 2CDEA 4UOW0 5TH2A 2X4RB 1PKQE 5C0ND 3QEQB 5IJVB 4Y89A 4MQ7B 1NDMB 2H41A 5HHVL 5F88B 4I2XB 2ITDA 4Q6IB 4OCRL 3MA7B 5FK9B 5IB3A 2Z8VC 3QFJD 5CZVH 4WO4A 1Q1JL 3QDAA 5C0GA 3HUJE 2V6HA 4DGYH 2JKXA 4V2BA 2HLFD 3PWJA 1J8HA 1UYWL 4ZUUB 2AQ2A 1YZZA 3X14A 1F2XK 3QEQD 4M43H 1HHHB 1I8MB 2OK0H 5C0JB 2XKSA 1T22A 3T4AB 4Z7UA 4WU5A 1OF2A 1HQRA 1R5WB 3BXNB 4D0DB 5C0BB 4ODVH 5D7IB 2HLAB 3SQOH 2VZ3A 1DANT 3D5OF 4G3YH 4NPYB 4GJTB 1RK1B 3S3PA 1DVFC 1MF2H 3EOBA 3QIWC 5F9WC 3CIQA 4QRRE 4K9EC 1FVEB 4OZGA 3NCJH 1S7UA 2Z92B 3TT1L 1A6TB 1MCKA 2H2PD 3QXTA 4QLRA 4BSVB 5C07A 2EECA 3D3VA 4QHNB 5D1QB 5MEPB 2Q86B 2AJSL 1S7VA 2AK4A 1L7TH 4Z78B 4KRPB 3GSVA 2FGWL 5C0BD 5KVFL 2AQ3A 3F7QA 4O2CA 4ODWB 4K8RL 3KXFA 1FNGA 3H9SE 4NCC2 4X6CA 3PGDB 2IQAB 3SGKC 3MLWH 2B5IB 1ZTXL 3VG9C 1KC5L 4Z7OF 1CDIA 1MLCA 5MENE 3HAEA 1OAYH 4XZUB 5IBUB 2P8PB 1ERNA 4XP4H 4M48L 3FB7A 3OPZH 5D1QD 4OCSH 4IRZL 2R15A 3ZDYF 4KRPD 1S9KC 4NC1C 4Q6IC 4QY8B 4OGXH 1YECH 2UYLB 1V7MH 4OSUH 1NAMB 4YDIL 5ESQA 3FTGA 2GITA 4LSSH 4HEME 1NC2A 1JWMB 1ZV5A 4Z7VA 1FRGL 4DKDC 4APQB 1S5IL 3A6OA 5CEYB 4FMKA 1RZIB 2C9AA 4U0QB 5ADPL 3RVVD 2GK0B 1BFVH 2BSTA 2H2PC 5CMAB 4HUXA 2Z4QB 1CLOL 4HBCH 5BXFA 1NGXB 5D71H 5T1MA 3SJVE 3LKOA 1HXMB 2W9EH 3OKMA 4OBSA 3K4DA 2IALB 3SE4A 5HHOA 3MTRA 2YK1L 3WDHA 2R9HC 3FB8A 2G5BA 4GFTB 5E2VH 4APQD 1MNUH 4YWGH 5C0AE 3F58L 5D5MB 1U8OB 4WEBH 1D9KB 1E0OB 4NBZB 5KSBF 2NY6B 3U0PB 2ICEA 4XHJD 4M6NH 4OCYH 3DMMC 4JGMA 5B8CA 4HK0B 5IMKB 1KELL 1ZWIB 1MVUA 3MNWA 5I1JL 3TVMB 4JKPH 3UPAA 3JV6A 4G6KL 4CMMA 5DJ2A 4Z8FL 3B9VA 1CBVL 3ARDA 2FJHB 1UWEL 3STBA 4JN1L 5I30H 3PWLA 4JFFE 2P5EA 3MLYL 1C7SA 3ULVD 5CZKA 5ETUB 1XIWB 3OSKA 1PQZA 4GRMB 1D9KD 4PUBH 2NY6D 1OVZA 1CU4L 4XAKE 2PUQT 5EH1A 4HWNA 4KQ4H 1T0NB 2NX5B 3RVVC 2N7BA 1RUML 2BK8A 1Q94A 1R5IB 1XT5A 3TVMD 5D8JL 5INCB 2GTWA 5C86A 3G5YA 2XQYK 4OGYH 5EO1A 4K3DH 4Z7WE 1QFHA 4TUOB 4JDZA 4PJAE 2YEZB 4WCYH 1IQDB 1XIWD 5HXMA 3QNYA 5FM5M 1CT8A 3G6JE 2G60H 3ECBA 3DECA 5IIEB 1TZIA 3ELAT 5DDHA 2NX5D 5CZXD 3WFEL 3BP6A 2ICWJ 4YPJA 1NBQA 3BUYB 4LSTH 4QRUB 1JHLL 3C6LC 4JG1L 2YSSA 1NUFA 1SYVA 4YHPA 5BVPH 1ITCA 5CEZL 2NTFA 3AY4C 5DA0B 4ERSH 1FN4B 3SGJC 3RRQA 1OTUD 5EZJB 3MRIB 3NCCB 4BSJA 4LSUL 1N26A 1CD1B 5E08L 3PQYB 5JXED 4LPXA 5KW9L 1CF8L 4QWWC 3OAUL 1T4KB 4K71B 3TVMC 3BIKB 4O4YL 4M1GL 1A6VH 1GPOH 1DVFA 3GHBH 4Q74A 3LPFA 3QIWA 7FABH 4ZFOB 4JJ5B 1XIWC 1JNHB 4U1GB 4ZUSB 5E00B 3CVHB 2W0KA 3PQYD 5DUPH 4LEOB 4N68A 1YNTB 5E8DH 2I25N 4PY8I 4I3SH 2Q3ZA 4PPTA 1OSZB 4JFEE 2PXYB 3NZHH 4LLUB 4OIIL 3IGAA 5AG8A 3MRGB 4NN5B 1TMCB 5B21A 1RZKH 4K94L 3L1OH 4NHCH 3SGKA 5LKNA 3DARA 1QHPA 4C55A 5DD0L 2JCCF 2VLRA 1ZA3A 5C0RL 1EZVY 1OTUC 1JK8A 3SKUD 1T7VA 3FQXB 3CX2A 3QEQA 1VB9A 5IJVA 2ZUWA 4MQ7A 1NDMA 5F88A 4Q6IA 5JXEC 2NY5H 2PXYD 4AZ8A 3T77A 4QGTA 3DROB 3GMNA 2CRYA 4G8FA 2VABB 4UAOB 3HRZB 2HRLA 3OKNB 4Q9QH 5L2KB 1SVCP 5EULV 2NY4C 3V52H 3OQ3B 4U7SA 4NUGL 3L3IB 5JXAH 4FFZH 3ARXA 3EOTL 1AKJB 1HHHA 3FB6B 4U3CA 5C0JA 1T21B 3GSNL 1AH1A 2WZPD 5I9QB 4NN6C 4NRZB 1CGSH 3CD4A 3MLVL 3OMZA 1C12A 3SKMA 1W72L 2HFFB 5C0BA 4MAYC 3UEZA 2AK1H 5L2KD 2D7MA 3IXAA 1K3IA 4GMTL 4JPKL 4X0KB 4ZO8A 3TP4A 1RD6A 2VDPL 3MLSL 4NFCA 5CHNB 5IQ7H 1RK1A 3MBXH 1EA9C 2AJVH 1G84A 1FVEA 3OXRB 4YHML 1OP3K 4N1CA 2QSQA 4LIQH 4U1GC 1OLLA 32C2A 4U6VL 1A6TA 1LEIA 1AKJD 4BSVA 3HFMH 4BQCA 4BH8B 3DMMA 4JFFB 1X5GA 4QHNA 3EDDA 4G9FA 1KCVL 2Q86A 4FHBD 4PRPB 3S3JA 5T5FL 5JR1H 4Z78A 1MCBA 2WUBL 1KCKA 2PXYC 5F3HA 5E03A 2R1XA 3TEUA 3U9PL 2X7LA 2D0FA 3FT3B 1GXEA 2C1PB 2P48B 4NHUB 3TJEL 4FZ8H 5LGJB 1NSNL 1FZMB 3R1GL 4PYGA 4I18B 2OR8A 2H9GA 3PGDA 2Q76A 2IQAA 5M7QA 2UUDK 3IDGB 3B9AA 1BVLB 1S7RA 1LO0L 5I1HH 4PJAB 4JFFD 1WFUA 1OW0A 4MVBD 4R0LC 4PRPD 3VXRA 5JOPD 1R3JB 5DO2D 5DC9B 3NCBB 4DQOH 3FN0L 4JPVL 4XAKD 3FJTA 4WENB 3WUZA 3SDXE 3GIZH 4K3HA 3GM8A 2HT4D 4R97C 4HUVA 1J87A 3IAPA 2NY2B 2LABA 5MP6H 2J8UA 4LNVA 1IKFH 3MA9H 4GUPB 5FGCE 4HUWB 1RZIA 1HQ4B 3O2DH 4WHYH 5CMAA 5D7IF 5ICYA 2JB6B 2AJUH 4XPGH 5I75C 4P5MA 4N0YH 3RA7L 2X4PB 2IALA 3C6LA 3GMOB 4XPFL 4HDIA 4UTBH 4K23L 2NY2D 2VL4A 1UB6B 5ISZE 3GBMH 4HWBH 3AY4A 3SGJA 4JKKA 1I3VA 2P7TB 5DJ0A 1HH6B 1BLNA 4HZAA 3GRWL 5D5MA 1U8OA 4CVUA 2VQTA 2XZQH 3M17A 1ADQL 1T7ZA 3LRHA 4DKEH 3U0PA 3U2SB 2AJZB 1AHWC 5FXCH 1QR1B 1RUPL 5D7SL 2VLLA 4MVBC 1F3DH 3TVMA 4DUWA 9CGTA 3VFVB 3JWDL 1YQVL 2JELL 4YJZL 7CGTA 2NW3A 1BECA 1CFSB 3UPRA 4I18C 1BWMA 2J88L 4GRMA 1SHMA 1ZGLP 5FYKE 5F7UA 5BO1H 3P77A 3RIFF 4OM1L 4WFFE 4I9WE 3T2QA 2AERT 2NX5A 5LBSH 2OCFD 3LD8B 1NFDA 5I2IB 4PJIE 5I1IL 5DRNB 1FAIL 2NY3C 2PKDA 4G6JL 1JYXA 2CLRB 1GIGH 3QRGL 4HXBH 4U31A 2R39A 1EO8H 4CMHC 4LHUB 5FV2A 2AV1B 1MCQA 2HKFH 4ODSH 3GSRB 1A6PA 1MCRA 1DSFL 2O5XL 4NQEB 4W81A 3PNWA 5JXEA 1UEMA 2ZSWB 3CX5K 1VHPA 3WL9B 4P3WA 4DAGH 1S9VA 1UKTA 5DZOA 3BUYA 2VXTH 1C1EL 3MJ9L 4ZNEA 1YEKH 3ULVF 1OP9A 2J8HA 43C9A 3TPUB 4ZPVA 4OLXL 4O02H 5D5MF 5D96C 5KSVB 2H26B 4LHUD 4PGBB 2L7UA 2Y06L 4Q0XL 1NBVH 4D8PA 4M5ZH 3AC0A 4FQCH 5HVWA 4GRLB 3NZ8A 4NQED 3EHBC 1N8ZA 1CD1A 2V9TA 1L6ZA 4Z7NE 3QG7L 1L9NA 1IC7H 5J11B 4O2FB 1IQWH 5IG7B 2BOCB 1Q72L 2A6DA 1S78C 5INDB 4LDOB 4MAYA 4ZFZA 5DFTA 4OUUA 2YUWA 5JHDE 1EGJA 4M7LH 3JWOL 2BVTA 1JGUL 4KY1L 2QV2A 4Q9RH 1RJZA 3RWJA 4UV7H 5HD8D 1JNHA 4GRLD 5ESVB 5I1CH 5E00A 1CGTA 1P69B 3O6FC 4MA1B 5L0QB 4U1SB 1P53A 4HSQA 4MD0B 5BV7C 1Q9KA 4KTYA 3LD8C 1A4JB 2PXYA 5C0DB 3WIHA 2YD8A 4H8WC 5CD5D 4HWEL 1FO0A 4LLUA 5E2TH 1A8JH 2OM5A 4CN1A 3QAZB 3QQ4B 3C9NB 3LS5L 1RZGB 1A9BA 4K9EH 2DQJH 2R4RL 4QT5B 5FUCE 4JFXB 3VXSE 3QO0A 1IGIL 2W0LA 2YZ8A 1ZGLM 2R56H 3UTOA 1AQKL 3SKNB 1D5ZB 1AXTL 2Y4SA 4R0LA 4OI7A 1N6QH 1NMBL 4PJDB 5JO5A 4PR5B 4U3XA 2H3NA 2ADJA 3B2VL 3EZ8A 5JORB 5DK2B 1S7SB 5FGCB 4IIQB 5IBUG 3DROA 2ZP0T 4MQSB 4IBLT 4WW2B 4DOHE 3HRZA 1J0KA 2FJGB 3CC5B 3QPQC 5E6IA 1MFEL 1Q9LA 1ZLVH 4NKQB 4ODXB 2HKHH 4HS6B 3L3GB 2ZCHL 3JTSB 4KPHH 2ZCLL 4EVNB 5EFIA 3BDXA 4LCYB 1FP5A 3OJDB 1U8LB 2BOBB 3ZKND 3QEHB 3DVGB 2PO6C 4CN6A 4XXCC 4GRWE 3WLWC 3CSPA 1V5JA 4IDJH 3EJYD 5GJTH 2HFFA 1TZGH 5CD5C 2AABH 4JCLA 3KDMB 4FQ1H 3T04D 3IFLH 2NY7H 4WUUE 3NVQA 4MNHA 4S1QH 2AEQH 1FLRL 5I17B 4HJ0D 2C1OB 1OSPL 3SCMB 1FG2B 1XGTA 3L5HA 2VDLH 1AHWA 4BH8A 4U1NB 1S9YA 1WQVT 3ZE1F 5F9JB 3MLXL 3T0WA 3PJSA 1IT9L 3JUZA 2A83A 5IF0A 1RIUH 3PE9A 4LSVH 4RNRB 1U36A 4NHUA 3VD7A 5C7XH 4Z76B 3VFPB 1I85C 1FZMA 4I18A 5BVJB 3UJIH 5GHWH 4YHLL 1D5XA 4PD4J 1F2QA 3MRQB 2DQHL 3SCMD 1FBIH 2NLJA 4XVUD 2HFEB 2W91A 3QR2A 3TCXA 4DCQA 3IAGC 1T1XA 3LAFA 5C07E 1H0DA 1M1SA 4XX1E 4JQIL 5DGQA 3D3VE 4FQJL 2XXMB 5HDLA 3ZKNC 4YUEH 4N0CC 5FYKD 3UXFA 2AK4E 5DI8A 4G5ZH 4XMPH 3LN4A 4IIQC 4HXAH 5HYFA 4ZXBB 1AIFB 3I9GH 1KCUL 3BPOB 1JZ6A 5I16B 2X1WL 3KXFE 4X6CE 4EUPB 3WN5B 5GZNC 1M7DB 1PG7L 2EYSA 4HJ0C 4ZUWA 1AGEB 4UT6L 2OMNA 1QFPA 4YHIA 2CH8A 4P9ML 4LSQL 2Z9TA 1NAMH 2VH5H 3AVEA 4GAGH 3QCVL 3INUH 3R06B 4ZXBD 3NPSB 3AU1B 3DSNA 4G43A 1UB6A 5KZCB 5SWZA 4OQTA 5HHNA 4RFEA 4OKVA 4ORGA 4Y4FB 1ZLSH 4Y5YB 2NNAA 2VISA 1EAJA 2P7TA 3TV3L 3CZFA 3SCMC 4XC1H 4XVUC 3U2SA 4H88H 2SEBB 3U9UB 2QHRL 1NLBH 2VXUL 3CFCH 1W0VA 3G04B 4MGXA 3TWCL 5KZCD 3F7YA 3FFCA 4MAUL 5HHOE 3ULVH 2EO9A 3O41B 2D7TL 4Y4FD 2XZAH 3REWA 1HXYB 4PJAF 1QYGH 1N7ML 1PEWA 1FV1A 1DFBH 3O6FA 2YKLH 3BQUC 2R69H 3G6JF 4FTVE 2NXZC 3RTQC 3VXSB 2GUOA 4OCLC 1KG0A 4P0DA 2A77H 5DRNA 3NTCH 3S88H 4OF8A 1KIPB 3QEUB 2CLRA 3OR6B 4LPWA 1Z6JT 5DJZB 4ZXBC 5HDQH 2X70A 2EDNA 4YBQC 4YE4H 4LHUA 2JIXA 2X09A 3ARTA 1ZOXA 3WN5C 1IM9B 2DWDB 1T03H 4NZTH 4KK6D 1HHJA 4NZDA 1BX2A 4LHJB 4PRAA 1UJ3C 5IFHH 1KUMA 3W2DL 5E5RB 4GXUM 3VWJB 3WKML 1BAFL 1SJHA 1CLYH 4EOWL 2BHUA 2FJFB 1U92B 4K7FA 2QQNH 3TPUA 3NPSC 4OZHB 1FVDB 2H26A 3S35H 1GZPA 4J6RL 3O4OC 1Z0NA 4NQCB 1IM9D 4Y5YC 3RNKA 1A6AB 3R8QA 3RGVB 1XCTA 2A0LD 1U8NA 3MLUL 3R4DA 5HTSA 2PO6A 4WUUB 3LSOB 4XXCA 3DX8B 4J3VA 3O3BB 1XGRA 4HCRH 4JO4L 12E8H 3PWPB 3RVWC 5J9PB 3VWJD 2OR9H 3KWWB 5DEFB 1QNZL 5DJ8A 3BJ91 2ORBL 4Y5XB 4BFGA 3IAQA 4OTXL 3VXNB 1KBGH 1QBMH 3ZL4H 5E6YA 5CP7A 3EDJA 2DJ4A 4R7NB 3FMGL 4JG0H 2UZXB 4TUJB 5E56A 5TPWL 4YHYB 4NQCD 4DTGH 2YD3A 4HKXB 2DIAA 3RGVD 3ARGC 2XYCA 4WUUD 3MV9E 1YEDB 3S3SA 3CFBB 4F58L 5EZIH 2A6IB 1AE6H 3PWPD 1MRCL 4MD0A 4YXKH 1A4JA 1RMFH 2XY1A 5CJQH 4KKLC 1MOEA 5FYJL 3MLRL 1I85A 2EZ0C 1IZKA 1JVKA 4XRCB 5FF6A 1EV2E 3KLAA 3HN3A 4U7KA 3V6FA 2VITA 4JFXA 4RIRA 4AL8H 3S4SB 1QRNA 3CVHH 3BKCL 5HGAB 3RDTB 3OB0K 2FO4B 4O5LH 1SEQL 2MKLC 3SKNA 1B4JH 2W38A 4PJDA 1FNHA 2OYPA 1I7RB 5DK2A 1S7SA 1YJDL 4LCIL 1RU9L 2ICCA 1YPZE 3HI6H 4FABH 3CU1A 2CLVA 1UWGH 5EBLB 5IWLC 3L9RB 4PB9H 5DSCB 3B8YA 4AEHH 3FO1A 4PJHB 3RDTD 4EVNA 1PEZA 3LKPA 2ZJSH 1JPSL 1NGYA 3FN9A 3OJDA 3QUZB 1NGPL 3QEHA 3DVGA 1FDLL 4ZS7H 1NBYB 3U48A 1SMOA 3DHMA 1R3LB 1TENA 4NC1E 5IK3A 3KPSA 4CU6A 3WNMA 1A1NA 2WIMA 2B1HL 3DX7B 3MRFB 5BRZB 5I1AA 2YBRA 3CFEA 5SX5H 4YHYC 4L29B 5CBAA 1J05B 5EB9A 3SCMA 1FG2A 3ZYOA 3QUZD 1LE9B 4Y2DC 2C3VB 4LCCB 1EO7A 4LGRB 5T33L 4U1NA 5J6HB 3ZYZA 1JZ4A 2F53A 4NQDA 5TE7H 2EDBA 3MACH 2IPUK 3MGTB 2F19H 5HGGS 1ZXQA 5BRZD 5EZOH 4BQBA 4JRWA 5DR5H 4AEIL 1EUUA 3TIEB 4CBPA 2XTJB 5LCVH 4UIKH 2F8VA 3SPVB 3BQUA 2FLBT 3O3DB 5GS2D 1FNFA 1P1ZB 3A0OA 1F8TH 3RTQA 3EIFA 5KOVC 3TPKA 3OGOE 1RHFA 4RDQF 3QHFL 4WW2F 4KRNA 3Q6GH 4G9FE 4QTIH 5E4IA 2VC2H 1GGYA 2Z35A 2A6KA 2YPKB 4ZXBA 4V2CB 3S96A 3WFHB 1AR2A 2RCSH 3ROLA 1F58L 3D39E 5I16A 5HHMB 2XTJD 3GSQA 3GMRB 3C08L 4FQLH 5IW1B 5FA3A 4GAYB 3WN5A 3C60B 4TSAH 1LDSA 1M7DA 1S7TB 4ZS6C 3TT3H 5L88L 1KPUB 1UJ3A 3GK8H 1GAFH 4KTEH 5F7YC 3QEGH 3QUZC 4D3CH 4DVRH 3E0GA 1GVIA 1MQKL 4HH9A 5C0IB 3VXRE 4MWFB 1VFBA 1B2WH 5C6PB 1A3LL 1N64H 3MRBB 4PJGA 4NNPH 5HHMD 2V2TA 3U7YL 4YLQT 3TCLB 2P1YA 4UILH 3V8CA 4Z0XA 3C60D 4Y5YA 2J8UE 3ZTJG 4KKAD 2WINA 3LKSB 3UX9B 4Y1AA 4YNYB 4UNVA 5ICZB 4LCCC 4KI5D 1A7PL 5AAWA 4HK3N 3QFDA 5AG9A 1BQLL 4QTHB 3QIBC 5ICXB 3V6ZA 4OM0L 3MV9B 1EEYB 1UFUA 3IDJA 2I5YH 1PZ5B 4PV8B 2X4UB 3DLQR 2EYTA 4KQ3L 4RGNB 5ERWB 5K33A 2XTJC 3GSOB 2CDGA 4G7YL 2B0SL 3ARGA 2FH8A 1NAKL 3V4VH 4MA8H 4OGAC 3V0WL 3GJFA 4EXKA 2DDQL 3ZE0F 5J0BA 1JYNA 1EO5A 3SGDH 2RBLA 3RP1A 1P4BH 1WLHA 4KDTC 3S34H 4I13B 3MV9D 5EOCL 1PVHA 2VZVA 1RUAL 4EDXB 3H7BB 3OR6A 3QEUA 2YPLA 5DLMH 3X3FH 1HSBB 4RAUA 2DQCL 4RGND 3LHPH 5I1EH 1OAUH 1F6AB 3VFSB 3SKJH 4GOSA 1YPZB 4I77L 4HS3B 5C3LD 2FBJH 3FO0H 4JFDA 3C60C 1UWXK 2X6MA 2DLHA 4YEFA 1TNMA 1CR9L 1Q9OB 2GFBB 4Z7NF 2OZ4H 3W11D 2M8XA 1NFDE 3MNVA 2PNDA 2FJFA 3MCLH 1WAAA 2KZWA 4NFBA 5IWLA 2FO1A 3BDBA 3I75A 5T3ZE 3LIZH 1FVDA 5LGKA 5D9SB 1K8DA 4HGMA 5CZVL 3QULB 4NQCA 4RDQG 4ZTPL 1A6AA 3DJ9A 3PXJA 4DGYL 5JW3H 4ESKA 5TDNA 2V5YA 2AJYH 5IHBA 3L3JA 3O3BA 5IROC 5A40E 4KVNH 3QB7C 3OJVC 1NKRA 4JFQB 3ZTJH 2O61A 4M43L 2OK0L 3DUSB 1G1CA 1G6VK 3SOBH 4R9HA 1EEUA 2XOTA 1XGYH 2DQGH 2Q7YA 2J6EH 4AIZB 4JFHE 2ILLA 3VXNA 2NZ9D 3P9MA 1KIUA 1M4KA 5EC1B 2VO5A 1FYTB 4ODVL 5IOPB 3SQOL 2UZIH 4LLVB 3KNBB 4R7NA 4KHXH 4TUJA 3STLB 3U4AA 4PB0H 4XP6L 1DUYB 4HKXA 5KVMC 2VZOA 2DQDH 4G3YL 3WFZA 1RJLB 4Y2DA 5DF0A 3QG6A 4LCWB 1KB5H 5F21B 1MF2L 3MBEC 4X6DE 3RUGE 3NCJL 4QXUH 5JHLH 3QA3B 3GMPA 1GC1C 3QJFA 1MWAA 3EOYG 1U8KB 4KDWA 3SQBA 3TFKC 3VXPB 2B39A 1J10A 2I26N 2ZKHH 4L9DA 1EHLH 4MCYA 1L7TL 3L5JA 4GW4B 4MXWH 1FYTD 4X4XB 5DK3A 1IAIH 1BVKB 4OD2A 4P9HH 4GKZB 3S4SA 1NQBA 1I7UB 3SO3C 25C8H 2ZUQC 4NBXB 5HGAA 3O4LA 2FO4A 4AMKL 4LCWD 3MLWL 1OGAB 4OIBA 3K1DA 4FS0A 2R2CA 3D39B 1OAYL 4HIIB 1P6AB 1YMHA 1NUDA 2DLEA 4HJGB 5HYEA 1W0YT 3OPZL 1DBKH 4OZHF 2EKSB 4OGXL 1YECL 4RMUA 3OKOA 3VMPA 5EPMB 4OSUL 1U95A 1V7ML 5K9OB 5EBLA 3HMWH 2Q8AH 4LSSL 3DXAE 4U1MA 1MJUH 5CLTA 2CR3A 1OGAD 2IPKB 2XPGB 3D39D 1AI1H 4GO6B 3UTZB 3ZHDA 1FNSH 3X11B 3H42H 4EUPG 2AXGA 4FXKB 1U3JA 1BFVL 2R0ZH 4HBCL 1KLFA 3QBTB 5D71L 4OZ4B 1YEIH 5BRZA 2DBLH 2W9EL 4LRIC 1JN6A 2CXKA 3IETB 3QHZH 4OFKA 3OX8B 2W0FA 2XKNB 4OI9A 1EDQA 5E2VL 3LKNB 4LCCA 1MNUL 4JFOB 4OLYH 3NIGE 5DHXB 4YWGL 5J6HA 4WEBL 2MFNA 5L6YH 4L8CB 4M6NL 4WDIB 1J1PH 3QIBA 4OCYL 2DIJA 2CKBA 4WW1A 3MGOA 3MGTA 4Z5RA 2PW1A 5I8EA 4Y4KA 2I07B 2EC9U 1G9EA 2I9TB 4JKPL 1Y18B 2R1WB 2B7DT 5FYLD 2BDNL 3UJJH 5I30L 1UT9A 4K8RC 1QLRA 1U8JA 1CK0H 5EIIB 4BUHA 1DN2A 1XF4B 2Q20A 1MY5A 1NPUA 4PUBL 4F37K 5FYKH 2V9QA 4KDTA 3LKRA 1RVFH 1KFAH 1FFPB 4KQ4L 1PBYA 2QSCH 4M61B 5BZWB 1Y0LA 1TLKA 1VFOA 5E7BA 3WFHA 1HEZA 5C2BH 4PJHF 1MH5B 4M1DH 3QYCA 5DUBB 4XNQA 2HFGH 4OGYL 4K3DL 4NT6B 1S9WA 1RZFH 2DJUA 2XKUA 3C60A 4U6HB 5GGTA 2JF1A 3V9FA 3WXWH 2YD4A 4WCYL 5F93C 2ZOLA 5EOCJ 2GKIA 1CI5A 5A3IC 3NACH 3OKKA 1QHOA 1I1YA 2G60L 3LRGA 3QZWB 4UDTB 3HG1A 5C0IA 4JKWA 1B0GA 4AIXA 5KVEH 3VGBA 3RGHA 1E6JH 5B39B 5I76B 2ZPKH 3MRBA 4OLVH 3RJDA 4RSVA 1MFBH 4EUPH 2P8MA 4XNXH 3EGSA 4LSTL 2YD7A 5JQHC 4LFHD 1KGCE 3MRNB 3V79C 2NY0B 3LKSA 1F4WH 5BVPL 4ERSL 5IROA 2UWEA 2XG5A 3X13A 4MNGB 1AR1C 2VAAB 5ICXA 3GFUA 4X6DB 4KFZC 4DZ8A 3RUGB 2EIZA 5C0EB 2X4UA 5SWZE 5C70A 1A6VL 2NY0D 3A6BH 1V8HA 2OS7A 3GSOA 2VE6A 1GPOL 4YFDB 4AQOA 3MBEA 3KYOB 5KSAB 7FABL 4PJ5E 3MXWH 1NMAH 4U49A 3AS1A 4Y4HB 1OHQA 4WTZG 1SJEA 5F1NA 5DUPL 5E8DL 5TQ0H 4I3SL 2CK2A 5GGRA 3S37X 4ETYA 1QFWH 1UXWA 3NZHL 3MJ7B 2OTUB 1F6AA 3W0WE 3FFCE 3VFSA 2BVUA 3RWHB 5M94B 3L1OL 4NHCL 4KI5F 3VRJB 4NO0B 3QDJE 5F7FA 5KSAD 3U79A 3WBDA 1ZHNB 2ICWA 5CGTA 5D1XC 3I2CH 3DXAB 3KYNB 4G8EA 4Y4HD 1OCWH 2GFBA 3T3ME 4PRIA 3EOAA 3HZMB 2AXFA 3NFNB 1SBBA 5GGUB 2AJXH 2MHAB 1BOGB 2NY5L 2KH2B 3GB7A 5IEKA 1H15B 1WCBB 4L4TE 4J4PD 1LK2B 3ZHLA 5EU6B 3HLAA 5F89A 4Q9QL 1CE1H 3O0RH 2VKWA 3QULA 4NO0D 1JMXA 4D9LH 4MDIB 3V52L 4QXWA 3DXAD 3DETD 4NQXA 3LN5B 1R24B 2GSGA 4FFZL 4JR9H 5JXAL 4LNRB 4GT7A 4M8QB 4NN7B 4X7SH 5DJDA 1ITBB 5E95B 1UCBH 2C7UB 1E4JA 1MHCB 1CGSL 2O5ZH 4LRIA 4GW1B 2EH7H 2JJWA 1U3ZA 2A6JB 5EC1A 5EU6D 1FYTA 1NANI 4HD9A 3VWKB 2AK1L 4F57H 5CP3A 4E0RB 1T6VN 2EXYC 2X10A 4BZ2H 5F9AC 5IQ7L 1KXTB 3MBXL 2AJVL 4P4KC 2EDHA 4QHKI 4RX4D 4LIQL 3QA3A 3HFML 3VXPA 4X6EB 4PGZA 4KROB 4DKAA 1QFWI 2VUYA 3MYZA 2ERJB 2ZOKB 5JR1L 3CXHK 4YDVA 1YPZF 3P11H 3LPGA 3VWKD 4FG6D 3FQRA 4J4PC 4FZ8L 4UU9A 1KTDB 1MRDH 2CO6B 1KLGA 3K8LA 4K94C 3GSXA 5HYSB 5TF1H 1WV7T 2ZUYA 4WRLA 5CUSH 3OKDB 4YHKH 5IFJA 4DK6A 4HIIA 3CSBA 2Y7QA 2FZ3A 3RPIA 2WWMC 3SE9H 1TCRB 4ETQA 4HJGA 2G75A 4KROD 2WIIA 5GSRA 3KPRA 3UDWC 4KXZH 4DQOL 1DQJB 2VDOH 3O11B 4BSWA 3PV7A 2CMRH 4JY6B 2MCG1 3GIZL 3DO7A 3FT4A 2JK5A 2EC9T 2GT9A 4W4NA 4H1LA 2C3HA 1QRNE 4RFOH 3ZZ1A 3UTSA 5MP6L 2IPKA 1IKFL 1WC7A 3QIUC 3UTZA 4BELD 4X99A 4PY8J 3O2DL 4U2YA 1A3RH 3CK0H 4NN7C 5E24E 3RWEB 3DVNA 1QOKA 2AJUL 4XPGL 1UCTA 3OV6A 4N0YL 2XN9B 5J8OA 1AC0A 3V4UH 3OX8A 5IHUH 3VWKC 4PGDB 1TVDA 3FZUD 4UTBL 5MEQB 3P4OA 5HDBF 3ARFB 4FG6C 1VPOH 3GBML 4HWBL 4PJEA 5IB1B 2JTDA 2VQ1B 3PG2A 1TPXB 1L9MA 2BERA 2XZQL 4DKEL 1CFBA 4NDMA 2PTTB 2B4CC 2BC4A 3KPSE 5CBEB 2ERJC 3LEXA 2XN9D 1DTUA 4YHNA 4WI7A 4YPGA 3BFOA 3LY6A 2VIRB 4UTAH 3RY4A 3ARFD 2ADGA 1G7QB 1X9QA 5GS2H 5HHQA 2NR6D 1PKOA 1U8MA 3P40A 1A5FL 3W0WB 1U9KA 4AIOA 5BO1L 1QSEA 3IT8D 3IJSB 2K7PA 3UMTA 5DJCB 5LBSL 4KXZI 1RULL 5FHBH 1X5IA 5BS0B 3MREA 4GG6B 4FMFA 3KHQA 4NT6A 5EO9B 5FOBB 1RURH 2GY5A 1GIGL 2ARJB 4HXBL 1EO8L 1VFUA 2FSEA 3LVEA 1AGBA 1U3HB 5D1XA 1UZ6F 3ZSTA 5HPMB 3W0WD 4ODSL 4NWTH 1JWSB 2HN7B 4CADB 5TE6L 4FFVD 4NGHH 2P5WB 2NXYB 2OL3B 4KH2A 4WHCA 5A2FA 4BH7A 2DQFA 2QQKH 5I76A 3I50H 4CU8A 4LSRH 5BS0D 4DAGL 3FCTB 4JPIA 3CDCA 4IOSD 3ARRA 4MXQD 2BVYA 3TO2A 1G7MB 1VACB 3IFPB 5DRWB 4O02L 4QHLA 1U3HD 2NR6C 1NBVL 4R4BB 4M5ZL 1G9MC 3RVTC 2XACC 4KU1A 1T89C 4MNGA 3BZEB 2P5WD 35C8H 2NXYD 1UEYA 3VFUB 2CDFB 1IQWL 2GTZA 3QHTC 1BHGA 1FCCA 5K93A 3ZT7A 4PJGE 4K3JH 2D03H 3JWDC 4M7LL 1P9MC 4ZUTA 2BSSB 5K59E 1PW3A 4Q9RL 4G42A 4D94A 4Y1AE 4P4KA 2QSVA 5I1CL 3BAEH 2PYEE 3JXAA 4J7RA 5F7WC 4FFVC 5SWSE 1VENA 4JANA 1H5BB 3HE7B 3L7EA 3F5WB 3QXAB 1DQTA 4X9FA 2OTUA 1YEGL 5E2TL 3VFMB 3QXWA 4J4PA 3WIFA 4M8VA 4J3SA 4N8VA 1JYVA 4K9EL 2DQJL 4MXQC 1KTLA 4A2MA 3BW9A 2BVQB 5DD3H 1DQQB 4J1UA 4O00A 3SHSA 1FNLA 2F74A 2V7HB 3TBWB 2M2DA 1RPQA 2R56L 2HTLD 3ES6B 5JTWA 4JLRB 4MD5A 1N6QL 3NPZB 3UDWA 2NXYC 3CSYA 3HE7D 1HWGB 1U8QB 2ITCB 2V7NA 1I1FA 1YEHH 3KR3H 2HTKD 1H15A 5E94A 2YPLE 5JLZB 1DEEB 1LK2A 1OGTA 4HIEB 2NMSA 3U6RA 4DW2H 3WEXB 2R0LL 3WD5H 4MDIA 3QIUA 4WGWB 2HKHL 4JFDE 1HHKB 4WJ5B 4XGZB 1AJ7H 1MCIA 4KPHL 4PGEB 3W9EA 1H3GA 4X6DF 5HYJE 3GJFK 3RUGF 4MJ4A 1CFNB 2CIIB 4TQEH 3MPCA 1KPVB 3GSNA 4MJIB 1MHCA 4BFIB 1HKFA 1I4FB 3CPLB 4IDJL 1FVCB 2Q8BH 1HCFX 1W72A 3W39B 1WAAE 1TZGL 1D5BB 3VWKA 4ELMB 3SGEH 5FYJU 5DMYA 5IR1A 3QXUA 3OF6D 4FQ1L 3IFLL 3JWOC 2NY7L 4JJHA 3CH1A 1WBZB 2E6QA 3O2VH 2AEQL 4S1QL 5IFAH 3O8XC 1CLCA 2GHWB 2VDLL 3EZJB 4R7DB 3TNMA 3EO1A 1OTTD 4X6EA 1G0YR 4EIZC 4HFWB 5F8QC 1N5AA 2CR6A 2NYYD 4MJID 4A2LA 5B3JE 4U2ZA 5KJRH 3MC0A 4YX2H 1RIUL 1H5BC 3IDNB 4LSVL 2W92A 3NOIA 3MFFB 4UDUA 5C7XL 2W9LA 5CJ8A 4FRWA 3UJIL 5GHWL 3P4MB 3FHAA 1FZKA 4PS4H 5DRZB 4AH2B 5F6IB 1F3DJ 4BFEA 2G2RA 4PRHB 4YUEL 2BZDA 4MZ2A 1DQJA 4ONOA 3KLDA 3O11A 4G5ZL 5EU3B 4XMPL 5FO9B 4KKBC 3HI5H 4HXAL 3GDBA 5FOJA 2EE2A 3I9GL 1M71B 3MJ6A 2G5RA 4XWOC 3PDOA 4XNMB 1PGRB 4C56B 4JRXA 4EI6A 2X4TB 3O4LE 4BQ6A 1RZ8B 2N4IA 1REIA 4B0MM 3REVA 3O81A 4NNYB 1R5VA 4LFHG 2G9HB 4OZIA 3HMXH 5D1ZC 4PRHD 3F7VB 1JUFA 1OTTC 1NAML 4Y5VC 3LH2H 1ZLWH 3CUPB 1MCFA 2VH5L 3FB5B 4GAGL 2Z31B 3QZWG 3T4YB 3INUL 1JIBA 4YFEA 2ADFH 3DWTA 3HZYB 4C56D 3EJZD 4YR6B 5B39G 2P24B 2VQ1A 3VFNA 1ZLSL 5T1DL 1LQSR 1T89A 1DQMH 4LGPB 3GRWA 3MV11 1C16A 3WFCH 1ADQA 5CJBA 4XC1L 3AXLB 3VA6A 4CVZB 4P5KB 4H88L 5I71B 3FQTA 4HFUH 1M6OB 2ESVE 1CXLA 3S97C 2Z31D 1NLBL 5FYLH 4QF1B 5H2BB 1E28A 2R1YA 2PYEB 3CFCL 1P9MA 1SY6H 1IGYA 3U0TA 1RJYB 5SWSB 5IV2A 4CVWA 3ULVL 2N7AA 3V6OC 4KWUA 5DGRA 2XZAL 3PP4H 1QYGL 3RY5A 3QWRA 4FQHA 3NBNA 1WBYA 1DFBL 3RI5F 1CG9A 2YKLL 2R69L 4R26H 5F6IC 3MRDB 3BKMH 4ODHH 5DJCA 4Q7DA 3SDCB 3VI4E 4HC1H 4X9IA 1G7PB 3TIDB 4JPWH 2BNRA 4EQ3A 3TYFA 1EERB 2A77L 3NTCL 2PYED 3S88L 3V5DA 4XTRD 5GRVK 1UZ8B 1H3PH 4V1DA 5SWSD 1ROWA 3CDGA 5HDQL 1VCAA 5TF0A 3VFRB 2BVPB 3VFTB 4YE4L 4DK3A 3PDGA 4KKCC 3EJZC 1SJVA 3HR6A 3IXTA 4DUVA 1T03L 4NZTL 1JWSA 5IFHL 3D18A 3SDCD 4IS6A 3KYMB 4PJ9B 4PLOB 3HE6C 1YA5A 1N0LA 1CLYL 4P2QB 4UIMB 1I9EA 1LWRA 3N50A 5EN2B 2Z31C 5GGVH 5F44A 5E2UH 1NUNB 4WI4A 1VACA 3S35L 3G5VB 3L3DA 1RY7B 2YXFA 1BZQK 4QYOB 5KG9B 1U2HA 5CJOH 3U4EA 3BMVA 4MQXD 3BZEA 4PJXA 3HG1E 3MUY1 4DUXA 4FQIH 3GSUA 2CDFA 1NCUA 4HCRL 2VKXA 5I71C 4PJ9D 2OR9L 3IKCB 4P2QD 5I8KH 5F1SA 4X7TB 3QXVA 3JV4A 3P9LB 4P99A 4XPAH 5K9KB 5JPNA 1ZT1A 1KBGL 1QBML 1KEGH 4MB4A 3ZL4L 1JZ2A 5F1KC 5JW3L 4LAQH 2P42B 3O6MH 4JG0L 4U33A 1JL8A 1U3YA 4DTGL 3O8XA 1LP9A 2WAHA 2BVEA 3OKLA 2WWKT 1YY9C 2C3GA 5HHXL 4WIQA 2UWEE 5DS8B 5EZIL 2EDOA 4GG6F 1AE6L 4PBVC 3SDCC 4YXKL 1H5BA 1A9EA 1RMFL 1G1YA 5CJQL 1D5IH 1GGCH 5FHAH 4WI2A 5I1KH 3STZA 4NM4H 3RKDC 1HH9B 2EDKA 4ZFOL 3OWEA 1ZSDB 4AL8L 4ZQKB 1DQQA 3CVHL 4AEFA 4O5LL 1IFHH 4FOMA 1B4JL 3QQ3B 2DRUA 2WLZA 4JLRA 5ANMA 5HYSG 2GJZA 1MHHA 4POZD 1XR8A 3AREC 2HT2D 3U7AA 4I0KA 1C5CH 2OJZH 4KMTH 2A9NH 3OJMB 3BPLB 4WFHE 3ISWA 3HI6L 4FABL 3RBSA 1IVLA 3O45B 4RAVA 1UWGL 3JVGC 2Z8RA 3WFDH 3WEXA 2R0WH 2EDXA 4PB9L 5K9QG 4AEHL 1HHKA 4LCUB 3PL6C 5IVNA 4Q2ZA 4XGZA 4PLKD 2ZJSL 5J06A 1T1WA 5D1ZA 1A7OH 4CU7A 3KPMA 2DMKA 3MV01 4Y5VA 4OZFA 4ZS7L 3GIVA 2D31A 4WEUD 1X7QB 1TITA 1WIOA 2FLRT 3D0LB 4H26B 4ELMA 1R3HA 2O5YH 2ED8A 2XZCH 2IFFH 1G7HB 2CK0H 2ESVB 3QUYB 2EDJA 4NBYB 1I8IB 4LVOB 5DFVC 4FXGB 3DV4B 4BK4A 2HVJB 2IADA 4YFLI 3H2WA 3MNZB 3VFOA 4NKMA 2PYFA 3MLZH 4IRSB 5TE7L 4POZC 3K81A 4MYWB 4NO3B 3MACL 2F19L 3I6GB 4QHUA 5AZEH 5EZOL 1MJ7L 2ESVD 1INQA 1FGNH 3QUYD 4KV5E 4JRYA 3J7HA 1JV5B 5DR5L 5AYQA 1DLHA 5LCVL 1MLBA 1MIMH 4RRPG 2AKRA 4UIKL 2E7CA 2E6JA 3EYSH 3L3KB 2HMID 3ZKMC 4AH2A 1U8HB 1F8TL 1LVEA 1K5NB 4UI2A 5D2NC 5IVXB 4PLKC 3UYOD 1HOCA 1IAKA 4HG4J 1TVBB 4PRHA 4MDJB 1YUHA 3CMOH 3Q6GL 4IRSD 4UBDD 5MHSD 2VC2L 3RHWK 5FO9A 1YJDC 3DURB 4PBXA 3LB6D 4XBPB 4JCMA 2J4WL 1WF5A 1XZ0A 4LL9A 1M71A 4XC3H 5E5MB 3OXSA 2RCSL 4MXVE 4BKLA 5DWUH