2IH3B

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2006-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ih3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ih3B01
4ZUSA 5ID1B 4OFVA 5CP3A 1DSFL 5BRZE 5C6TL 1FRGL 1KPVA 3D18B 1NCNA 4PJFF 3TP4A 3WFEL 4FFWD 1T5XB 2A6JB 1K8IB 1MI5B 1XF5A 4CADB 5LXGH 3IJHB 3GB7A 4Y4FB 4X7EC 2R1WB 2CK2A 4GW4B 4M7KH 3UDWC 4PRAB 3B9VA 4I8DA 1IAKB 2CH8A 2H2SD 1NBVH 1OARL 2R1XA 3VXNA 2DQFB 2R0WH 2FO1A 3IFLH 3U9UB 1GPOH 4M6OH 1W72B 4NCC1 4TVPL 1RHFA 2R23A 2VDMH 4PIRF 1KXQE 4UT7L 5D9SA 1Q72L 2OP4L 3IFOA 1JJUA 2GW5A 1P4BH 1I1YB 5HVWA 4PJHB 3LH2L 4BFGA 2ORBL 1ZTXL 2WIIB 1J1PL 4WGVB 3EKCA 4PJGB 1KIRB 4R4FH 4WUKH 3TWCH 3S5LA 1FYTD 5DK3A 1I85A 3MROA 4PYGA 5H8DA 4G8EB 1JNLL 3DX8A 5CINL 4EN3D 3M45A 4GG6A 5D7LB 3KPMB 5B38G 3QPXH 2P8MB 4OLZH 4U1SA 3IKKA 4ETQB 3D0VB 1SJHA 2CKBA 4JLRB 4MDIB 4YPJA 3TFKC 2Q6WB 3ARBA 4QY8B 5D1QB 2J6EL 4RQQA 4Y5VA 4LIQH 2IBZX 2COQA 2VLKE 2FGZA 3U6RA 5FGSA 1GCFA 5DFVD 3FQWB 5HY9A 3V0VA 1NFDA 5IQ9B 1MLBB 1Q0YH 5CIPA 2X70B 4PUBL 4FQQA 4Y5YA 2PTVA 3PWJB 1RZFH 2R9HD 5IIEA 1PKQA 2V2WA 1IM9D 2XOTA 1R3IH 1N8ZA 1RK0B 3L3JB 3VFVB 3ZDYF 4RRPG 4W6YB 4YHOH 2QV2A 4Z18A 3ZKND 4OLUH 3CU7A 5FUOH 1LQSR 1D5IH 3IFNL 4L1DA 4FS0A 1RUKH 4PR5A 5DK2A 4HBCH 4DGYL 1F2XK 3Q3GB 1GGIH 3QUYB 1HHKB 3GUTB 4DKFH 4KROD 1K2DB 4WU7B 3HC3L 3O6MH 3HMWH 2NNAB 4PJHE 4JG1H 3SDXA 1DBKL 4PRPE 2HTLD 1H3GA 4OJFH 1RHHB 3EIFA 1CIDA 3SQOH 1JTTA 4N90D 3RTQA 1A7BA 4OLYL 3VGGA 3NCBB 1K6QL 1GIGH 4IIQC 5MEQA 4E0RB 1I1FA 3MJ7B 4HWZA 1KBGL 2NY7H 3ARPA 3I6LE 3PGDA 3S4SA 3RDTB 5CJOL 2ATPA 2MKLC 5DD0H 1OTTC 1QSFE 4F9LC 1KOAA 1P7QB 5I1KH 5KS9F 2X6MA 3PWNB 2W0KA 5FCUH 3BN3B 3VXTB 2WBJD 1WCBA 1WZKA 3VFPA 1R3HB 2JF1A 3DURA 4XXDA 5I9QB 3QA3A 1C5CL 3C8HA 3I75A 1MSPA 1X5LA 2FJGA 5J12B 4QYOA 4FQ1L 5IMLB 2VLRD 1A3LH 2VDPH 4FQPA 3MCLL 3DO7B 2I25N 2F5BH 4OM0L 4HJGB 4PJ8A 1ADQH 4P59H 3CUPB 4K7FB 3K2MC 2V2XA 3DVNA 1KSRA 1XR9B 5MEND 5MEOA 4X4ME 2EEBA 3JSSA 3EYFB 2CLRB 3U0PB 1KGCD 3MGOB 2XN9A 4ZTPL 5IVZB 3DJ9A 4Y19A 1F58H 3ROLB 1MEXH 1MRDH 4DUXA 5IQ7H 4HS3B 2D7OA 4QOKA 3THML 1QSZA 3PWPD 3TC9A 4QHLA 3WIFA 2N1KA 3OKEA 1LP9B 3U9PL 4D9RE 4K55A 2VSCA 5TQ0L 3W81A 3CPLA 3ULUE 1E27A 4PGCA 3GK8H 2MPAL 1WEJL 1YEDA 2B0SH 4OCXH 4ZFGL 4FN0A 5DJXB 1XCQB 5IW6B 1G84A 3KPSD 3NFSH 4D0BB 3FTGA 3MOAH 4OZGB 1A6AA 2H3NB 3EYQC 1S8DA 2PTTA 3ZKMC 3GSNA 4QT5A 3KYAA 2A77L 3QDMD 4NQDD 1YYMH 3O9WC 1C8PA 4OKVA 5D7IB 1K3ZA 1MRCH 1ZWIA 5C08E 3MV8B 1MJ8H 3O6FD 3SKMA 3QNZA 1BVKA 2EDDA 5I18L 4M7KL 2GITA 1ND0B 3BD4A 3J7HA 5D1XA 1IEBA 4FRWA 4ONFL 2A6IA 4KHTL 1ZHBB 1NBVL 5DVOA 1JPSL 1ZHLA 2R0WL 3IFLL 4KQ3H 2XWBA 4JB9H 1HXYA 1R5VA 3RVVC 1P4BL 4DN4H 4F8TA 3QQ4B 1LO3H 2P1YA 3S35X 4QXTB 4L5FH 4DZBA 2EIEA 5GGRA 4X4YA 1EJOL 5E8OB 2XV6B 3LN4B 3BD3A 2MCPH 1QQDB 4WY7H 1II4E 5IBTL 5FK9B 3AXLA 3QPXL 4MCYB 4NFBA 4HKBA 3SJVB 1EMTH 4MA3B 1RIHL 5IMOA 4AIZA 5E2WH 1RVFH 2IH1A 1F02I 3U46A 5E5RB 1KPUB 4MCZB 1Q0YL 3EOAA 1AQDB 1MF2L 3WNOA 4UT6H 3RY5A 5D2LE 3MLXH 5CEYB 3WKNA 4CMMA 3KJ4B 1R3IL 5K9KA 4LSSL 4YHOL 2ZUWA 1KJ2H 4ODBD 4OLUL 5FUOL 4XP9H 1D5IL 1TJGH 1N4XL 5EO1A 2YD6A 4ZNEA 5T33L 5DJDB 4HBCL 4OB5H 5B4MD 1FVCB 1HKLH 1GGIL 4G8GD 2OXHA 3HRPA 2O5YL 4ZO7A 3C9NA 1DUZB 3PF2A 1D9KC 3HMWL 4GRMA 4JG1L 4TUOB 1TVDA 3WYRA 4Y1AB 4QNPF 2WQRA 1DQDL 1U8NA 5F1SA 1V5JA 3JUZA 3GBML 2Y6SD 5D5MA 3BDYH 1YDPB 5JIKA 2PETA 4YGVA 4GLRI 43C9A 3SQOL 1CDBA 4N90E 1EO8L 1KEGH 2G5BB 3QNXA 4M93B 4WI4A 4PJBB 1DN0B 3OAZK 1GOFA 5H94A 3VI4E 3P77A 1OSPL 4JKLA 2Q3AA 5CZKA 2NY7L 5DF0A 2EDXA 1DE4B 3TBWB 3VXRA 1H15A 5DD0L 3ABZA 3P0YH 5L7XH 5DWUL 1LD9B 1LK3L 2DL9A 1XF3B 4LLDA 1MFNA 3QUXB 4TUKH 4DZ8B 3GIZL 1X4YA 3VFSB 2VDNH 3D2UD 2VLRE 1A3LL 2VDPL 1CD9B 3QQNA 4AEHL 4XCEA 4JDVB 1ADQL 4PRBA 3QXUA 4KVNL 4J2XA 5KVGH 1N3NA 3RU8L 3LQAC 5MENE 4OGXH 5C0AA 4QRQB 4C83B 5CBEA 2AEWA 4JFOB 2A6DB 4LU5L 2DTSA 4GRLD 4QHUB 3TT3L 1I1AC 4W4OA 3JWNC 5E9DB 4S10A 3P4MA 4OTXL 4KK9D 5GGTA 1S78D 1MEXL 3ILPA 1MRDL 4M7ZC 3U36B 5IQ7L 3PWPE 5DJAB 1JI1A 1TQCC 3QIWA 2AV1B 2K7PA 3RZCD 5IBUB 2C1PA 4AL8H 3RWGB 3GK8L 3PP4L 2B0SL 3M17B 4XAKD 2QBWA 4R7NB 1BX2B 3CVIH 4LHUA 3T0EC 4P4RA 5BQ7B 3MOAL 4PD4J 2FGWL 5F8RC 3PV6A 4D8PB 4JKKA 2IFGA 3C6SA 1FNEB 4U1LA 2JIXB 4NQDE 2G75A 1YYML 1DN2A 1P4IL 1MRCL 5IOPB 4XH2A 1MJ8L 1UWXK 5HXMA 4G6MH 3HR5A 3VGAC 3V7AE 5CGYC 4F7TA 1AD0B 4PJHF 1NAML 2NTFA 4YFEA 2BSRB 1OF2A 4P4KB 3U0TA 5EO0B 1F4XH 3H7LA 3U48A 3L95A 2BVQB 3AAZB 3S97C 3VXSB 4NWTH 5JIIA 5IROC 4KQ3L 2J2ZA 5EN2B 3BPCB 3QJHA 4LLYB 1Y0LA 3V6FB 4F7MB 4L4TB 5MERA 4YAQA 3IRZA 3BIKB 5E9DE 1PJ9A 1LO3L 1T2QL 3RWIA 3BKMH 5F7MC 1HDMA 5C0JB 1AH1A 4JPVL 2DQGL 4YDIH 1IAOB 3V4VL 2XY2A 2DJSA 4LPUA 2VLLA 4DTGH 3PP3K 4CN1A 1OGTA 3WS3A 1XCTA 1BEYL 4KMTH 4OZIB 1U8MA 3VFTA 1UWGH 4OUUB 5E2WL 1RVFL 4YK4B 3UTZA 2RR3A 3VXUA 2J88L 2AJXH 2LV4A 5D8JH 5CD3A 1JYXA 3TJHC 1IGYB 4HGKC 1NGYB 3O4LB 5MI0C 1KPRA 4P46A 1MCOH 4P9MH 2EDKA 4ELMA 3MLXL 5HYJA 2HVKB 3IXAA 4Y2DD 3X3FH 1ZE3C 2FH8A 3VH8A 1NGZA 3UYOD 1T6WA 1EEZA 4M8QB 1KJ2L 3QEQB 1A6ZB 5F7DA 5ITFA 2YK1L 2GFBB 1TJGL 2HMIC 4X6EB 32C2A 3OWEA 2DKMA 5FYKL 3NFPA 5SWQA 1IC4L 4OB5L 1G1CA 4Y89A 1ZLVH 1HKLL 1Z0NA 4DUWA 4TULH 3ULUF 5DQ9A 4JZJC 1P9MC 3KYMB 3SDCB 4JFDD 1S9XA 4CAGA 3LEXB 2ZZUT 5FOBA 3EYSH 3CNKA 5HHQA 2AJYH 5B38B 3REVB 1D6VL 2IEPA 1EAPB 4UAOB 2NW3A 3QEUB 1F4WH 5M7QA 5EZOH 1QSVA 5IUSA 1HCFX 3G5XA 5I8EA 4ALAH 5F96L 3VD9A 3IJSA 1KEGL 2GT9A 1EFXA 2VDOL 4Z5RA 2GJZB 3AGVA 2B39A 4NUGH 4OZIE 3MREB 1R0AH 3I85A 1JP5A 3BZ4B 2IMNA 2H32B 1QVOB 2A9NL 1HOCB 3VI3E 3C8KA 1SYVB 4LIQE 3GBLA 5ABDE 3O4LE 2W38A 3P0YL 5J11B 1Z6JT 3FO9A 3PHQA 3HE7D 3JXAA 3U2SB 1I1RA 1ZLWH 2CR6A 1B0RA 2OS7A 1GC1H 2KPNA 1KIQA 2UY6A 3DVGA 4PGJA 3JV5A 4PP1C 3VA2C 3LKRB 1D5BA 3MZTA 5GRJH 3EZJB 2PCPB 1VADA 4OGXL 4HLZH 4V2CB 1KXTB 2HAZA 3FN0L 1G7JA 5FA4A 1MH5B 4L9LC 4QF1B 3PXHA 4AYFA 5A3ID 1NEZG 2IQ9H 4Y16C 1XIWB 2QSCH 3MV9B 2VWEC 3PDOB 4GBXA 3LEYH 4KZDH 5B8CA 4UQ2B 2I9TA 3RWEA 3RJDA 4AL8L 5D2LF 4MJIA 2QSQA 4KKCD 2WLZA 2WINB 3K81A 4KK5D 2FIRT 2BNQD 1H3PL 4AENA 3TF7C 4KKLC 3VFRA 3DYPA 1NUFA 1OWWA 3GRWA 4ELKA 3OXRA 3QFDA 2YA2A 4FQLH 2NY3D 3EBAA 4G6ML 2B8OT 2JELH 2YD1A 1NAMB 3EW3B 2V7HB 3PABA 3VRIA 1DVFC 2MFNA 2NR6D 4Y2OA 4HMEA 5I1DB 4NN6B 4X5XA 2B4CH 4X7SH 1F4XL 3SDAA 3WXVH 4NWTL 3BO8B 5E1AA 3L1OH 3TZVB 5A16A 1U8JA 4C56B 3VI4F 3DYOA 5GS0D 1ZHNA 1AQKH 1NANI 4MJ2A 4D94A 3CD4A 5K59E 5DQJA 5I1LB 4WUUA 2F58H 1YECH 1Q0XL 4H25B 5I74B 2EE2A 5IVXA 5KZCD 3ZMRA 3MV9E 4RAHA 5JORA 1PD6A 5C92A 3SGEI 3DI2B 2Q8AH 3K8LA 1H0DA 3OR7A 4ENED 4OFYA 1EBPA 4PTUA 1AO7A 4V1DE 1HHGA 3IDXL 3RFZC 2F54D 5J06A 3QWRA 4L4VA 1U95A 3PWLB 5IFJB 3FFCB 3B2UD 2P5WD 5GJTH 5D8JL 2A9MH 4FQXB 2YPLB 1DBJL 1MCNA 1JF1B 3CFEB 4AEEA 3QIBB 3LD8C 4LSQL 5TDNA 2NMSA 3UO1H 1MCOL 3MCG1 3QO0B 4Z7OE 4P9ML 1TNMA 3BN9D 4M9PA 4LLMB 2J12B 1WC7A 3DXAA 4FABH 3E2HB 5DJCB 2K3TA 4XP1L 3KPRA 3X3FL 2R2BB 1G7QB 4UIMA 5JLZA 1TDQA 2BK8A 5FYLH 3S3PA 1T83A 2WUBH 5J9PB 4DJMA 4P2OC 1C16A 1EV2E 5C8JA 5IMMA 1Q9LB 3GSRB 4L8SB 4TULL 3QXTA 3QEHB 4JFDE 3TO2B 5EU6A 4DN3L 1R3JB 5IBLC 1MJJA 1ITBB 1AGFB 5GGSA 3O2DA 4XPHL 3EYSL 3JWOC 1XFPA 4PFEA 5I1EH 1TQBB 3QXAB 3LVEA 1MQKH 2D31B 4QHKJ 4NCC2 2BSED 5EZOL 3STZB 4LHJB 5FECA 3MRJA 3CSPA 5E95B 4OUOA 4M48H 1K8DA 4G9FE 4JDZB 5E08L 1B90A 3ARGC 1AKJA 2CDEB 2XRAH 2PW1B 2IPTL 2Y25A 3IVKB 3MRLA 2CLZA 5CZXD 1NJ9B 3AS2A 4F2MB 4GO6B 1ZT7A 1BFVH 4U1JB 1F3RB 1F3JA 1ES0A 1UXWA 4GFTB 1L0QA 1J8HA 2X5PA 5C6PB 1F6AB 4MQ7B 1X4XA 3F7VA 1GC1L 4TQEH 3LKOA 1P1ZA 2NY5H 5I1JL 4K3DL 1SQ2N 4PLNC 3L5IA 4ONHA 1BD2A 4LCCC 5FUZL 2E5EA 3CSGA 1UENA 2DM2A 4XWOC 4R96A 3X11B 1M71B 4CKVX 4Z76A 2YZ1A 3N1PC 1T3FB 5GIRB 1U92B 1E4JA 2Q1EA 3SOBH 4HXAH 4HIEA 5GRJL 5ADOL 4JFXB 2LAGB 1DEEB 3FKUS 4NQCA 1I3UA 3R0NA 4ZXBD 2E7LC 2VH5H 2GJ6A 4IM8A 2AK4A 4XWGH 1D5ZB 2VQUA 2IQ9L 3C5JB 3LDBC 4NBZB 4IOFC 5BVPH 3CFDB 4NHCH 1SJEA 5D96C 4I0PB 2RHEA 1MCIA 4LVOB 5J8OA 3E6FB 5B39G 3WE6A 3MV7A 4ZS7L 4TTDD 1ZLUH 1E4XH 2KDGA 4GW1B 3MJ9A 4HC1L 4FTVB 1NBQA 2BNQE 2YRLA 5SWZB 3B6SB 1FYHB 4S1RH 3LKNA 1IT9H 4YHIA 5EB9A 4QRPA 4DKDC 1BP3B 4FQLL 4BJLA 4WHTA 1FC2D 1ONQA 4LEXL 2JELL 1PG7X 1EVUA 3S6CA 1P2CA 4IIQA 1CE1L 3MR9A 4X7SL 5TF1L 3U4EB 2ZOKB 4JPWL 2LVCA 1AHWC 1OAXH 3L1OL 5CD5C 4KI5D 3K2UL 1I4FA 2Z31B 4Q9RH 2IGFL 2CR3A 3MUHL 1YY8B 1UGNA 5EU7E 3UROR 4OZIF 1GZPA 1NCUA 3OKNB 1RJZB 4BSVA 4QHNA 5E00B 1DUYB 5F71A 2F58L 3VI3F 1BQHB 1TTUA 4O2FA 4H1LG 1CG9A 1DBAH 3NIFE 1AE6H 1MRFL 4G43B 4ZSOE 3FL7A 1KIPA 2H2PD 1A5FH 3P30L 3L3IA 3UMTA 5IEHA 4JRYD 2Q8AL 3BKYL 3KPOB 2YD8A 1JI2A 4MA8H 1U8LB 4FNLH 4LCIH 2NCMA 4KJWC 3ECBB 4KK6C 2P48B 4HWEH 1O5DT 2C3GA 1KN2L 5GS3A 2P5WE 4I2XE 4EI5C 3VXMB 1T20A 5EPMB 4OIIH 4WJ5B 2YS4A 3OKOA 4UTBH 4FABL 2VLJD 3I6KB 4PJEA 3RGVA 2F74B 5D7JB 1MJUL 5D71H 4J8RB 2HLFD 1OP5K 4NJ9L 3V6ZA 4EQ2A 1HYSD 4U3CA 5E2JA 1Z5LA 1JNHA 3DRQA 5FYLL 4FQCH 1NGXB 2WUBL 1I3GH 1BF2A 4JHZA 3VFWB 1YNTB 1ETZB 2VXSH 3MLYL 4MNQA 3KLHC 3KXFD 1C5DA 2B1HL 3JV4B 4LAJH 1QFWM 4KKAC 1T5WA 3O3DB 2YEZB 1TETH 3ULVD 2VR4A 4D0CB 1FCGA 4HPYH 5ALCH 5I1EL 1UH4A 1MQKL 1FNFA 4XGZA 1Y6MR 5HDBE 1S7WA 1WJ3A 5D1QC 4UDUA 1OM3H 2W60B 5IB4A 1DLHA 5L2KB 5KW9H 3GSUB 3HG1D 1JBJA 1PDKA 1HQ4A 4ZOAA 1WBYA 1A1OB 3L3OB 2XRAL 4WI5A 4XNZC 4NRXA 4LLUA 1EHAA 3VXME 4O51A 4JR9L 4OZHA 1ORQA 4U1IB 1EFQA 2RFXB 2D7TH 4E41D 2X4SB 2HLAA 4TQEL 5F3HA 1FZKB 4LPYA 4JREB 2NY5L 3W0WA 5ISZE 3P3YA 5D6DC 2NW2B 1RAMA 5K59F 5HHNB 3B9KB 2DB8A 3O41A 2EZ0C 3OB0H 1DQMH 4QTIL 1DDHA 3V8CA 4OQTH 4P2QD 1NMCB 4NSKA 1YC7A 3FOMB 4K9EH 3IF1A 3IJYA 5BO1L 1U93A 1ZS8B 1U58B 4A6YA 4XP6H 3QG7L 5TH2B 4R8WH 5EBLB 4F80A 3QG6A 5JPNA 5DURB 5T1MB 5C0ND 4YFDB 2HVJA 2F53B 3EYUH 1T0NA 2YPKB 5HI5C 1U8IA 5CHNB 3RWDB 3VFMA 1XH3A 3V0AC 1SEBB 3MRNB 1T4KB 1JPST 2JJSC 2VZTA 4NQEB 3ESUF 3PQYE 1W8OA 3RDTC 5F7EH 4MD4B 5BVPL 3CFBA 1AGCB 3ZTNH 4GXVH 2Y06H 5I30L 2PYFB 3S8WA 4Z7OF 1VESA 2AABL 4OZ4B 1O7SA 3SHSA 2BOBA 1JGEA 3HA0A 5C0RH 4JFFA 4NQUA 5I9QC 4LVHC 4HJJH 2GY7B 5J12C 5DRNA 4S1RL 4RZCB 3GSVB 2ADIA 2XWTA 2YHGA 4IMKA 5TF0A 5H37H 3ORJA 4YHKH 1NGPH 5ANMA 3TBTB 4X6DA 4QRUB 1WBZA 1IMHC 3G6AA 4MQXD 2VIRB 2Y5TA 4DGVH 3FO2B 3ELAT 1LILA 1YYLH 4ESKA 1IGJA 2YXMA 1YEKL 1DBBH 1OAXL 4KI5E 3BSZH 3DARA 4LSTH 4Q9RL 4XX1E 1JUFA 4L8CB 1NEZB 3ZLQC 1MQ8A 4FP8H 4ZPTA 1NDGB 4M4RA 4ZUVA 1T22B 2X4OB 3OAYH 4UQ3A 3S3JA 2CRIA 2Q86A 3ARBD 3O11B 1MCWW 5LGHL 4JE4B 4TSAH 2DBLH 1E6JH 1U8PA 1W0WA 2C3VB 3EO0B 3RUGB 1DQJA 2C1OB 3UTSB 3BEWA 5A40E 5J6HA 4FNLL 4LCIL 2HRPL 5E5MA 1QEWA 4HWEL 1YEGL 43CAA 4CBPA 2AJ3B 5E94A 1NGQH 4MAYB 3OB8A 1I9RH 1I1AA 4IRJB 1NLDH 1BFTA 3V8OA 1BVLA 4JM2A 4AIXA 4OIIL 1ZGLB 1MFAH 5C0FA 3P11H 2BHUA 2VLJE 1GYAA 2CRMA 5D71L 2DLGA 3TN0A 2DWDA 5DZOA 2X1WL 5CSBA 1HILB 4N1EA 1X5KA 4X83A 4MQTB 3ZSTA 4FQCL 1V8HA 5GGTH 5KJRL 1ROWA 3PHOA 5E8EB 4N0YH 1IGIH 3BAEH 2EXYD 2D7MA 1FCCA 3CSYB 4JJHA 2VXSL 2ZUTA 3EDFA 4YHPB 1WZMA 2CDGB 5D70H 1CD1B 4JRXD 5JW4N 3PGCB 5IFHH 1TETL 3U4BH 3MRRB 4GKZA 2VAAA 5ALCL 3L5JA 1Q1JH 3FO1A 2GTWB 4FOMA 5TPWH 3HLAA 3ULSA 4XB7A 4HUXB 1OM3L 3CVHH 1J18A 5FAAA 4OCMC 4LKXA 1MHHA 3K4AA 5DXWA 5IROA 3UTPD 2GY5A 4YFLI 1I3RA 1S7SB 4JFYB 3WNLA 4YO0A 3KJ4C 2F19L 1C12B 4GT7A 1S7UA 5CJQL 3QJFA 2JTDA 4PJ8D 2BHZA 4G6KL 4LK4A 1MWAH 4QCIA 2D7TL 4E41E 5DI8B 1OOAA 2BVYA 5IT2L 4ZAKC 5HGBB 3WFZA 2JB6B 5GXBB 2NY4D 3QZWG 4KWUA 1J0YA 3HUJA 3OJDA 1H3VA 3T2PA 1DQML 5FYLE 3RI5K 5IHLB 2PW2B 4OQTL 2XN9D 1HSAB 5IK3A 4K9EL 3NIFF 5C0DA 1Q9WB 4NGHL 4QOKD 1T0MA 4QHMA 1N59B 3BZDA 3QH3B 3HZMB 4NO5A 4ODTH 4XMKH 4HIXH 2A73B 1GJIA 4ZPVB 3FQNA 4PJAB 3ZKXB 5LBSH 2ZCKL 3GFUA 3GSQA 1CLYL 1J11A 1A9EB 5EU3A 4YHNB 3T0WA 4WNQB 1RJCA 4P5KA 4B53A 2ADFH 2VE6B 2IADB 3CFJB 4FXKA 4G80B 3WBDA 2P43B 3ZTNL 4GXVL 2Y06L 3V6OA 4J4PC 1FZJB 1NDMB 2CLVA 3RP1A 1IGFH 1P84J 5E8PB 2QQLH 3AVEA 2FZ3A 3QUXC 4HFUH 5C0RL 5D1ZB 1P9MA 3B5TA 3MACL 2JJVA 4HJJL 5J7CC 4LRNH 4Q6IB 2V9TA 3ARRA 4QXWA 4YHKL 3RVXD 1CWVA 4KVCL 1RJYB 4KKBD 1CXEA 4NM8H 4MD0B 4L3AA 4DGVL 4I48A 4WTZG 5DFTA 3MRQB 1LE9A 4DOHB 1GGBL 2DYPB 5HBBA 4YBQD 3KDMB 3TO4B 3DI3B 4GAYA 3KYKH 5HDBF 1CR9H 1YPZB 2G2RA 5IB1B 5KSVA 2NZ9D 1OCWL 4GAGH 5IB2B 5I8KL 2EIZA 3FJTA 4EN3B 1QSEE 3SE3C 1AY1H 4CRPA 2Y23A 3KR3H 2CD0A 3NAAL 1TTGA 4KTEL 2BY3A 2E6PA 1A7RH 2NY6B 3TPUA 2AXJA 5F1OB 3BP5A 4TSAL 2HT3D 1KB5H 2DBLL 1E6JL 1RUML 4P3CH 5C0CE 1B0GB 2BVPA 2NLJB 5BZWA 4EDXA 1YEEH 4LQFL 3MUY1 4ZDHB 1JWMA 5BOPA 4XTRC 1N0XL 1PKQE 5CLTA 1A6UH 3L6FA 1UB5B 5LGJA 2X4UB 5DMKB 2B5IB 3B8YA 1I9RL 4HKJA 3VDCA 2X4PB 3FQRB 4M9OA 1UM4H 4JQXA 4P4KC 4J1UB 1OP9A 4NO0A 1YNKH 4P5TD 1MFAL 1KCRH 2W9LA 4RWHA 5J3HD 1T1WA 2JK5A 4GKOA 3QUZA 2WLYA 4A2LA 4HIJA 1U36A 4AG4H 2BFVH 4KJYB 4KROB 4RDQG 3VDBA 5FKAA 3KLSA 3T0DA 5FDWB 1FNGA 4NC0B 5A2KH 2FH6A 2R4RL 4O4YH 4O2CA 1V3MA 2EDTA 4NFDA 2BNRA 2YSSA 1HHIA 4H1LB 3S3SA 1NBZA 2V17H 1FO0A 2YBRB 4JCLA 5D70L 5FDYA 3R8BB 1J10A 1IAIH 3BWAB 4U1GB 2PO6C 4U2YA 1OP3H 4HGWA 4JANA 5F1NA 5IFHL 3JV6B 4K7PY 2YD9A 3U4BL 3VXRD 4YK4C 4PJ5A 5EBGA 4YDVA 5IM7B 1Q1JL 1Y18A 4XMPH 1DVFA 5FA3B 4Q9BA 1QZ1A 5TPWL 5ESAA 3QO1A 4ZFOL 3CVHL 4BK5A 1I8MB 2VITB 2CUIA 3ARDB 3WV0A 2HJKA 1R24A 2WBJB 4WWID 1JHKH 2X44D 5JIHA 1XF4A 2NX5A 1NPUA 1S3KH 1IC1A 4KKNA 3LS5L 4S1DD 5D2NA 1O7VA 5FM8A 1BQLH 3MRHB 4NKMB 4KI5F 2DS4A 1RPQA 2D3VA 4AM0A 2CIKB 1ZK9A 4KAQH 2V5RA 5C0AD 5GRUH 1ZLSH 1KCSH 2D0FA 4XPFL 1L7IH 3SDCC 2M8XA 3FRUB 4L1HA 1LE5A 2DJ4A 1TLKA 4KUZH 4X7CC 4Y19E 1T1XA 4QOKE 4F7PA 4DQOH 3T4AB 4UAOC 1SY6H 3QIWD 4PREB 4D3CH 1TFHA 3DPBA 2DIBA 4AH2A 4XMKL 1BF8A 2QSVA 3RNKA 2D7PA 4LBEB 3GJFK 2KZWA 4LHUD 1BQUA 4YHZH 1Q8MA 3DIFB 3D39D 3CFKB 4EUPH 4PP2B 5C0EA 2ADFL 2VDQH 4I18B 5J11C 5ENWB 4OF3A 3QDMB 3PE9A 4KTDH 3VFOA 3QHFH 4UUJA 1IGFL 2QQLL 3WN5A 1T0PB 3O6FB 1BLNB 1OPGH 4YDJB 5AEAA 2M1KA 2OQJA 3U7YH 5K9OB 1X6NA 4L3CB 5HYSA 15C8L 2HT4D 1NFIA 3T77B 3MGTB 5DHVA 3X13B 4I1NB 3EYOA 4MGXA 1G7PA 2Z92B 2RBLA 5DJ0B 5DVNA 1I9IH 2EO1A 3BEVB 4PJ7E 4OSUL 5J6GB 3LIZH 3O2DH 3WS6A 4XZUB 4PJDA 3MRKB 5DRXA 2ED8A 2R39A 3BW9A 4GAGL 2NXYB 1LO4H 2IALB 5L6YH 1KLFA 4EXPX 1AY1L 2CO6B 5C07B 1N7MH 5C6WH 1CU4H 3KR3L 2ICEA 4FMKA 3L3DB 1IARB 1RZIA 3VXUD 5I8OL 5FO7B 3WEXA 3L3KB 3QIUA 1FV1A 1FFQA 2Q3ZA 4JO2L 5AUMB 1KB5L 4WEBH 2ITCB 4P3CL 5EU5B 5SX5H 4P46D 2ZUSA 1YEEL 4UIKH 3FOLB 1CFNA 1J0JA 1BJ1J 3FB7B 4HKZB 3SCMC 2FEDD 1RUQH 3WFDH 5HYJD 1X5IA 1YN6A 1RULH 2NY0B 2XA3A 6FABH 2VQ1B 4X9FA 4D0DB 4NN6C 1YZZA 1GGCH 1L6XA 1UM4L 3LRGA 5HI3C 5JA9A 4ZNEE 2AXFB 4F3FB 3S36L 1KCRL 2W65B 2M2DA 5DJZA 1KG0B 3C2SA 3PG2A 4OIBA 4PRHB 4QRRE 1YMME 3KNBB 4HF5H 1J05A 4MB3A 3BH8A 2JB5H 3BOVA 5D5ME 2CPCA 5I74C 4DW2L 3L9RB 4O4YL 4C4KT 4BFIB 1PYWA 5E6IA 2VZ3A 3HAEG 4U49A 1EFXD 4P3DA 3K0WA 5C07E 1HQRB 4JPIB 3RAJH 2BDNH 4PLJC 1X7QA 1T7XA 4V2BA 1IL1A 3OJVC 4O58H 3VXRE 1A1MA 1XGQA 2MTPA 4OBRA 3MJ9H 4XMPL 4YPGB 2ZSVA 4ZFOB 2HG5A 3CVHB 2CJUL 4FQXC 5EBWB 4DAGL 4LDOB 5AYQA 4YBHA 1CFTB 1NGWB 1SM3H 3DTXB 3HNTL 3KPNB 1CT8A 3QIBC 1AHWA 1GOHA 1ZGLP 4G6AC 1AXTL 1JHKL 4ZOEA 2BCKA 3E2HC 5CZVH 3UX9B 4N9GB 1S3KL 5JQHC 1A7NL 5CWSA 3IAQA 2YUVA 4QHKI 4G9DB 3G04B 4NCDA 1BQLL 3PJSB 1PQZB 4Q9QH 4MA1B 3PV7A 4S1SL 5EBMA 2H45A 4KAQL 4ODSH 1LDSA 4XXCA 5C0AE 5GRUL 1ZLSL 1KCSL 5ALBL 1T5XA 1MFEH 2A6JA 3RVUC 1K8IA 1MI5A 4CADA 1L7IL 1QLRB 2ADGA 5I66B 4Y4FA 4LCYB 4ISVB 1WIPA 5DMGD 2R1WA 4KUZL 5HGDB 1SVCP 1TQBC 4K23H 4GW4A 4PRAA 4DQOL 4GBXD 3UTQA 2ZSWB 1SY6L 1IAKA 2IG2H 5T3ZH 1LEGB 1J0HA 2DQFA 4YQXL 1VEOA 1OD9A 4MJID 3U9UA 3VXOB 1W72A 5KSAC 4BA8A 3A6OA 2EIDA 1MFCH 1CGSH 2IPUK 2X1XR 3AU1B 4FMFA 3BVNA 1I1YA 3TH2T 1F13A 4PJHA 2WIIA 3LRSB 4KTDL 3V95A 3QHFL 4G7YH 4WHYG 4KRNA 4L4JA 1KIRA 4GW5B 1FBIL 2R8SL 4G8EA 2DQHL 1CICC 4Y4KB 3WD5L 1WISA 2IF7A 5D7LA 1HEZB 3KPMA 3R8QA 2P8MA 3QZWB 4AIOA 3SDAD 2ZNWA 3QUMA 4LLWB 3D0VA 1UYWH 3AMKA 4MDIA 4KRMB 2Q6WA 1EJ6A 4IDLA 5L9DH 5CP7A 2NYYD 3X14B 3MRPA 1I9IL 4NN5C 3FQWA 3NACL 2DI7A 1MLBA 5IQ9A 5F9JB 5GS0L 4I5BB 4OFDA 1CFSB 2Z4QA 3GM0A 4JDTH 1R3KB 1RK0A 3KGRA 3VFVA 1RIVH 1RU9L 5GGVY 2R2HA 3K7UA 4I0PC 1CZ8H 5HI4D 4Z7VB 4LVOC 25C8L 4F7CA 4OFYD 1LO4L 1AO7D 2VO5A 5L6YL 5IESH 1N7ML 1CU4L 3Q3GA 3QWRD 5CBAB 5I76A 3ZYIA 3QUYA 1UM6L 4HH8A 1HHKA 3GUTA 1QFHA 1UCTA 4WU7A 5D6DA 4NKDB 4X4MA 2EEDA 2NNAA 4WEBL 3KPQB 1YQVL 5K9JH 1YJDL 1RZ7L 1Y6KR 4OLXH 4OCYL 1RHHA 1HINH 3RWFA 4UIKL 1CFQB 2HFFB 1NL0H 5L0QB 3P0VL 4HUWB 1IKNC 3DXAD 3QDGB 1RUQL 3WFDL 3EYVA 3KPRD 2VDRH 3VFUB 1U91A 5ESQB 4LSVH 4X5WA 1X5JA 6FABL 1ULVA 4TRPL 4E0RA 5IGXH 4JY6B 3QWOB 3UAJD 3WFBH 3MJ7A 5HD8C 1GGCL 1SEQL 2JKXA 4HCRL 4IRSA 3WJJA 5IWLC 4NBYB 3WHXB 5IF0B 1FGNH 3REWB 1X5YA 4WVRA 4NJAH 2AJUL 1Q9OB 3BE1H 3KYOA 2Z31C 5F6IB 4BYHA 3H3PH 1UZ8A 2OXGA 3DETC 4YWGH 4XB8A 1LO5B 3PWNA 3FT2B 5EU6D 1EGJL 3BGAA 2PXYC 4IMLB 4YJZL 5C08A 4HHAB 4HF5L 3ROOB 1R3HA 4OZFG 2JB5L 3TBVA 2RIKA 4JFPA 4HIIA 5GZNC 3DO7A 4FHBD 5SV4A 4JGJA 4Z7VE 4XHJC 4HJGA 4R0LC 5ACLA 3E6HB 4NQVB 1JVKA 4BQ6A 2BDNL 3STLB 3CUPA 1AKJD 4MXVE 4AQOA 5JHDD 4ODHH 4O58L 2AEIT 1XR9A 3H7BB 5FKPB 1JWUA 2UWEE 2CLRA 3U0PA 4PJIB 2R29H 3MGOA 1QOKA 2BSTB 4OGAD 3IDJB 1J8HD 4PS4H 4JRWA 5IVZA 4JHAL 1NMAH 4HS3A 1J1XH 2I5YL 2EDLA 4PJ7F 1BD2D 4KFZC 2BVOA 2NY1B 4HMDA 1RZ8B 4Y4HC 2FJFB 3MUGB 1XCQA 4I77H 4WW2B 1NCBH 5IW6A 3TFKD 4D0BA 4YHML 4OZGA 4Q9QL 4XT1C 2H3NA 5DJ8A 3NH7H 4IS6B 4KRPD 4OZFH 4ODSL 3RHWK 4U1KB 2O26U 2AJVH 3UBXA 1T80A 5D7IA 4NQCD 2PR4H 3RWCA 3MV8A 5MEPB 1MHEB 2GJ6D 4BZ1H 5T5FL 1RMFH 4JO4H 1ZANL 3EO9H 2AK4D 4PV9B 4RX4A 2Y7QB 5HHVL 3AB0B 1ND0A 7CGTA 4LPXA 3OKMB 3K8MA 3LN5B 5DA0B 1ZHBA 2YD2A 4NP4H 3MV7D 4WO4A 4MJIE 4MLIA 4U1NB 3NCFB 3MRDB 2YPVH 4RGND 3LQAH 4EUPB 3UTTE 1MFCL 4HW6A 1CGSL 1FLRH 3F65A 2KL6A 3H9ZA 5TQ2L 4MXWL 4MMZC 4QRPD 3ZDZE 4QXTA 3D1MC 3OAZH 2DM4A 3BHBB 3VRJB 1OTUD 4XC3L 5E8OA 3LN4A 5E7BA 5C3TA 1QQDA 1KCVH 3B9KC 1Q94B 4N5ED 5FK9A 4N8VB 4MCYA 3SJVA 5D5MF 1NMCC 2A6KA 1QYGL 5ICYB 1UYWL 5DVKA 2DM7A 2J6EA 3VE0A 5L9DL 3D69B 3TPKA 2GI7A 4F37F 1GAFH 2DIJA 4MCZA 1F4AA 2HJFB 1AQDA 4ODUA 4WUUE 5CMAB 1YN7B 4LDEB 2DD8H 4OF5A 5KZCB 5T3ZD 5IB5B 5KAQF 1TVBB 4KK8D 3S4SG 3H9SB 2AQ1A 1AO7E 3CZFB 3MRMB 2AEPH 4L4VE 1FVCA 4HK3J 5EZJB 2F54B 4U05A 2XNAB 3M1BB 4MB5A 5FGCB 1XT5A 3DX9B 1MCRA 1DANU 1XR8A 1BECA 4TUOA 4W4NA 4Y1AA 5K9JL 1ED3A 1KYOK 3PIQB 2CXKA 1HINL 4XCNA 2BRRH 1NL0L 4PG9B 3RGVD 3GIVB 2VDRL 4TSCH 3HHRB 4Z0XA 4LSVL 5C0BB 1DN0A 5TFSH 4GG8B 5FUCE 4AEIH 2APFA 1AR1C 3WFBL 1UXSB 1WT5C 2GCYB 5T3XL 1DE4A 1XEDA 4MNHB 5LCVL 1F11B 3TBWA 1SBBA 1KTDB 3EJZD 4HULB 4RAVB 1V7MH 4MNQD 3H9YA 1LD9A 1T1YB 4U1MB 1CL7I 4YWGL 1EHXA 1VFUA 1OTSD 3NA4A 1UWXH 4OD1H 4M62L 3GMNB 3WIIL 1XF3A 1M7XA 3V52L 3QUXA 5ESVB 4EKXA 1IC7H 1L7TH 5EORL 5F93C 1HIMH 1KTKE 3MA9H 4DZ8A 1S7RB 1F2QA 4X0KB 2YRPA 3BQUC 2QADD 1V3LA 4BQ9A 3MLWL 4JDVA 1WGOA 1RK1B 3P2TA 4R2GD 4NZRL 1RUPL 4WFFE 1MLCA 4ODXB 4ODHL 4GMTL 1AGBA 4F7EA 4C83A 3RX7A 2R29L 1SHMA 3VCLB 2A6DA 2OR9L 4X6BA 2R0LL 2VZUA 2DAVA 2UYLB 1J8HE 2A38A 5E9DA 3EOYG 1JZ6A 4PGEB 2VR9A 4KI1A 1J1XL 1U0QA 4J3WA 5FYKU 1VHPA 5DJAA 2OK0H 3W0WD 5BVJB 3PP3H 5C0BE 2AV1A 3WNKA 5BMFL 4KJQC 3RX8A 4UOW0 3KS0H 3MRCA 4R7NA 5EUKB 1BX2A 4I77L 1NCBL 5BQ7A 1BZ7B 4GQ9H 5KG9B 3F8UB 5CILH 4XNYH 5ID0B 4D8PA 2A1WL 2FB4H 1ZA3B 1I7TB 2JIXA 3MFFB 2AJVL 3W9DA 1WZ1H 5SX4H 2PR4L 5KSUB 1FVEB 3HAEB 2FEEI 2VXQH 4LCWE 1HI6A 2UV3A 1RMFL 2AK4E 4JO4L 1NC4B 1AD0A 1AI1H 1QBLH 1YEIL 3BP7A 4LDLB 3OR6B 3C6LD 1JK8B 5EOCH 2BSRA 2P8PB 2W9DL 2Y07H 4HWBH 5EO0A 2GIYA 3BH9B 5ACZB 3O3BA 5EIQA 3QHZH 2BVQA 4NP4L 3VXSA 4DWHA 4NQSB 5EN2A 1JPTL 3LKSB 4JFFD 4NWUL 3V6FA 4F7MA 4L4TA 3RY4A 1CCZA 3BIKA 4QRPE 5F7YC 2E7BA 4GH7B 3QDJB 4Q6YA 5C0JA 3AM8A 1PGRB 4K8RD 1VGKB 3E1F1 1IAOA 1KCVL 1OVZA 3IS0X 2GUOB 4OLVL 3R06B 4LRIC 4OZIA 4OUUA 4F58H 3LS4H 1T21B 4H8WC 1IEHA 1QR1B 3QQ9D 4RBPH 4Z7VF 1IGYA 3O45B 1NGYA 3O4LA 4XVJH 4ZFFB 4KHXH 1A1NB 4XP5H 3O9WB 4Z95H 2DI8A 5JR1H 4MXVF 1FO0H 3OKKB 1PZ5B 2A74B 5EULV 6CGTA 1R5WA 3K74B 3F5WA 3ZKXC 2UWEF 2DD8L 4O2EA 2HVKA 1TVHB 4HBQA 4HUNB 1P5UA 5T3ZE 4JY4A 4M8QA 5INCB 4JRYB 2GFBA 1BZ9A 3NTCL 4X6EA 3DUUB 4ZODA 4NZDA 1MY7A 3DHJA 4NYLB 3UYPA 3HZKB 2VXTH 1I1AD 3LEXA 4XRCB 5FV2A 4EOWH 4HJ0D 2OTPA 3NMEA 2H2SC 4JM2D 1FL5B 1QBMH 5KVEH 2CRYA 3REVA 1EAPA 2OL3L 3QEUA 4PJEE 5A43C 3L5WB 4H20H 3TN0D 5GGUB 5TFSL 2L7UA 3LQZB 4AEIL 5HHXH 1XGYL 5DLMH 1M1SA 1OSZB 2GJZA 1K5NB 3MREA 3BZ4A 5EO9B 3IDIB 1QVOA 5I75B 4NHUB 4WWKA 1N64H 3WL9B 3DGGB 1HOCA 4GSDH 3MRIB 2VABA 5TDOB 3S36X 1JF6A 1V7ML 3ZL4H 2CO7B 2P47B 4ORZC 3KXFB 3U2SA 4OD1L 4EN3C 4RRPA 1FL3A 4JVWA 5I2IB 3OG6B 3IFPA 3FQXB 1FDLL 1IC7L 1L7TL 1FFRA 4OF8A 4DKAA 2NY6C 4OAWA 1WCQA 3L5HA 3DX7A 3LKRA 3ZDZF 3MCKB 5L2JB 3S35H 3RWHB 4NNYB 1ADQA 2FATH 3OTTA 5DFVC 1BIIA 3HG1B 1CL7L 4BK4A 4TSBH 2GTZB 1J9CT 3PL6A 3NZ8B 2PCPA 2CIIB 2R9HC 3WLWD 1PY4A 1D9KB 4HK0B 4GAJH 5C70A 4OZHE 1U8QB 3MNVA 3ZKNC 1MH5A 3JWOH 4QF1A 4ZS6D 2IAMB 4QXGH 1ZV5A 1XIWA 3MV9A 3W0WE 3E0GA 4UQ2A 4KROC 3R1GH 3EFFA 4IOIB 3OGOE 4V1DA 2AKRB 2HTLC 4GQ9L 5E2UH 3N9GH 5CILL 4LCUA 4XNYL 4NM4H 4OZFB 3VFGL 2FB4L 2J5LB 2QKIB 5HJ3B 1INDH 4U6HB 1JZ8A 3MOQA 5EIIB 4Z9KB 1IAMA 5KSBE 2DLFH 1I8IA 5IHZB 4U1GC 2JE8A 4MD5B 2X9XA 1NAMA 1QBLL 2V7HA 4OFIA 5HPOA 3LPGA 1T89A 3FRPG 1JYNA 5I1DA 2Y07L 4XBEL 4HWBL 4WV1C 2D2OA 1IQDB 1U42A 3GSWA 5FB8A 2HMID 3QHZL 1ZA6B 1ZEAL 3GB7B 4K3JL 5CEZD 3ARDC 3TZVA 1GZQB 1JE6A 1XGRB 4JFFE 4C56A 4F9PA 2WBJC 1CXFA 3I3EA 5I71B 2WWMC 3T09A 5T1LA 2FEEL 3N1MC 3VG9C 3ARFA 3UYRH 5I1LA 2R1XB 3DVIA 5ANME 3VXNB 4GAFB 4H25A 3P4NB 5IEKA 5JPMB 4M7ZB 1VFBA 1PBYA 5HYQB 5EFIA 1F6LL 3D9AL 3IFOB 2QR0B 4B50A 4D9LL 4KMLB 2JCCB 2P5EB 4G9FA 4XVTH 3T0EB 5FM4A 4F58L 3LS4L 3PWLA 2EDOA 5IFJA 2Q8BH 1IGMH 3FFCA 1HH9B 3V5HA 5C09B 4FQXA 2YPLA 3MROB 3QNYB 1CD8A 3DUHA 3QUKB 1JF1A 4KHXL 4XP5L 1JZ2A 3QIBA 4Z95L 4F8QA 3LZFL 3QO0A 1QBAA 3H8NA 3VGAB 4LLMA 4M6MH 4JEGB 1SJHB 5DJCA 1A47A 1KTLB 5HTSA 2R2BA 1UKSA 4JN2B 2ICES 1KJ2A 3RVWC 1CDIA 4WI2A 2YWZA 1T7ZA 4AMKH 1B0WA 3O6FC 2PYEE 1Q9LA 3GSRA 3HE6B 12E8H 2V2WB 4L8SA 1N8ZB 3NOIA 4WFED 2E6QA 5CJBA 3TO2A 3QEHA 1JGDA 3O2WH 4TVSa 4NO0D 1QBML 5KVEL 2OL3B 2D31A 3QUZD 3IU3A 4FQHB 3STZA 3PWVB 4G42A 2DQUL 1REIA 2P49B 4NRZA 3O81A 3QCVH 4HEME 5DLML 5HHXL 4JDZA 3SDXB 1Z9MA 4PLKC 2BX5A 2ATKB 3WNNA 2EH8H 4IRZH 3IVKA 3MPCA 2DMCA 3QPQD 2BNRD 1NJ9A 1H3WM 1MCCA 4F2MA 4U1JA 3ZL4L 1JWSB 4JFHE 2FD6L 1F6AA 3B8SA 4MQ7A 1E28A 1I1FB 3MNZB 2OTUB 3ARVA 4JRXB 1L6ZA 4KGJA 3T4YB 3VJ6B 3U30C 1W72H 1EPFA 4PJ5D 4RFOH 3MX0A 1DVFD 2AJSH 5DJYA 4FFVD 5F97E 3X11A 3MRGB 1M71A 3GSXB 3H42H 3P4LA 3RBGA 5BV7L 5I1IH 1U92A 2NY2D 2C5DC 2NX5D 3QA3B 3RIAF 1CTOA 1QFOA 4CW1B 2XTLA 4JFXA 3ILQD 3MJGX 1DEEA 35C8L 3NIDE 4Q58C 1ZOXA 1LGVA 5T1KB 2AVGA 4NKIL 4R7DB 1D5ZA 3VD5A 3C5JA 4X98A 2MWCA 3BYTA 5CJ5A 2V2XB 2APWA 5B4MC 2QJDA 4HUVB 1RIUL 3HUJE 1FJ1A 3N1FC 5T5NF 1RZJC 4LP4A 5IR1B 3O0RL 5IW1B 1HYRC 3BRGC 4P23D 4U3XA 2XN9B 4RISH 4GW1A 3MLRH 4APQA 5SWZA 4PRIB 2VB5A 1CDYA 2Y6SC 4NM4L 4QHLB 4I2XA 3FO0H 4UZGA 1INDL 5KANG 4QTHB 2QQKH 4JFEB 3HR6A 1UADC 1IKNA 2D7QA 2DLFL 2IANB 3MLUL 5D6CA 2Z8VC 2GAZA 5DD3H 2AK1H 2MKWA 1DTUA 3GSNB 4QT5B 4LGPB 2BZDA 3JVGC 5E2TH 3WLBB 1KFAL 5IWLA 3U4EA 1A9BA 1OD7A 4PJEF 5CEZE 2X9WA 1NMBL 3SKMB 3QNZB 2Z31A 1M05A 5AG9A 1VENA 2GITB 3GJEB 1IEBB 5MHSE 4PLOB 5KANI 2LTQC 1DUYA 1ZHLB 1BQHA 4Y16B 2Q87A 4G43A 1R5VB 1IKFH 3T2OA 3UJJL 3QYCA 3KPOA 1U8LA 2GJJA 1QRNE 4XVTL 3SBWA 3ECBA 4PRIE 4KK9C 1ZSDA 1IGML 2Q8BL 4C54A 4DZBB 1JYVA 3MLZH 1FAIH 4X4YB 3VXMA 5IB3B 5EPMA 3RZCC 4XAWL 4WJ5A 3NGBB 1A6VL 3EZ8A 5IMOB 3WSQH 4M6ML 1MCPH 3I6KA 3QIUD 1CF8H 5D7JA 4J8RA 2IH1B 3Q5YA 5GSRB 1RD6A 4OZHF 4XNUH 2V9QA 4PD4K 3U46B 3WFHB 1A7OH 4LVNB 4ZD3H 4U31A 3W82A 4AMKL 3VMNA 1NGXA 3KJ6L 3R4DA 4PJCB 4G6JH 1HCVA 5JZ7D 3VFWA 1YNTA 3M8OL 3WXWL 1ETZA 2Z91A 1H5BB 4Y4KC 4U6YA 4NO3B 3JV4A 1A4JA 1F4HA 1NCDH 3VW3H 2YEZA 3VWKD 3C5SA 5EO1B 4P5TB 4JAMB 2VWEE 4IOFD 5CJXC 1DSFH 3C9NB 5C6TH 4MB4A 2E9WA 3RA7H 1J1OH 5L2KA 5KSBF 3GSUA 3DROB 3QCVL 1U8NB 1A1OA 3L3OA 1BBDH 2EH8L 5E6ID 3P4OA 2BNRE 3G5ZA 4Z8FH 2ICWI 5KOVC 4Z7WB 1OW0C 1P6AB 1OARH 3ESVF 4U1IA 2RFXA 1Z9SA 2X4SA 4HS6A 2NXZD 1FZKA 4ONOA 1Q72H 2OP4H 3U1SL 2AJSL 2NW2A 5DHYB 5I15H 4FQIH 1BZQK 3LH2H 2ORBH 1ZTXH 3FOMA 5BV7B 4Y8AA 3H42L 1FQ9C 4HQQH 2IWGA 1ZS8A 1U58A 5L0QC 4P2OB 2NX5E 3IETB 5EBLA 3DX6B 5T1MA 4Y2DC 5D2NE 2H41A 1TPXC 1XZ0B 4NT6B 5CHNA 3RWDA 3WFCL 2ERJB 1K85A 1G7IB 4XC1H 4XCEB 1T4KA 2X9YA 4PRBB 1BM3H 2YD5A 4ZFZA 3D5OF 1N3NB 1AGCA 1IAIM 1N6UA 1TCRB 3ALWA 5A1AA 3T65A 2PYFA 3JZ7A 1MI5D 4KDTC 4Y4FD 3CH1A 2FL5B 5MP6L 5F1IB 3KHOA 4RISL 4HC1A 2QLVB 4MDJB 3ILPB 1VFAB 3QEGL 3SE8L 5GRZA 4RZCA 1KJ3H 2ZCLL 2C1PB 3IFNH 5ACMA 3D25A 1AJ7L 5EUOB 3TBTA 2DWEB 1X44A 4QRUA 4BSWB 4U33A 2VIRA 3ZHLA 3ZTJG 2EKSB 3FO2A 1CK0H 5DD3L 3HC3H 3D39B 3H0TB 2DQJH 4GKNB 4JQIL 1NCTA 4LCCB 4U1LB 5E2TL 4DFHA 2ZCHL 2FYYB 4YZFE 5DC4B 4UV7H 1OGAB 5DEGB 2VXVH 3HE7C 4LGSB 3RRQA 2XYCA 3SGDH 1QNZH 4I0KA 1CLOH 5DDHB 2YMXH 1NEZA 5D7LD 1YA5A 4GMSL 3B4NA 4Q0XL 1NDGA 1OF2B 3U0TB 4U6TA 1KBGH 1T22A 2X4OA 2G9HA 2GYSA 3AROA 4HAGA 3I6LD 4WW2C 4NKOB 3FN9A 1LNUA 1QSFD 5D96B 1CXKA 2C3VA 5MERB 4JFQB 2W9EH 3EO0A 3VG0H 2C1OA 3UTSA 5JXEA 4YUEH 3U82B 1URLA 5JUEH 3LPWA 4PJDE 2R2EA 1C5CH 3KLDA 5A3IC 3AB0C 2AJ3A 4FQ1H 1HE7A 4YX2H 4MAYA 3LPFA 4IRJA 4HSQA 1YUHB 2CSPA 1ZGLA 3WO4B 2XG4A 1YEJH 3WS3B 3BPOC 1XGTB 4RGOH 3QUYD 3VFTB 1EHNA 4C58B 1I8KB 4O00A 3FHAA 4KKCC 3UTZB 2RQ8A 4EZMA 3O3EB 3VXUB 4KK5C 3NIDF 2FWOA 4XNUL 1HILA 2WUCL 1KB9K 4U1HB 3ET9F 1KPRB 1OGAE 1A7OL 3K1DA 2JJWA 4ZTPH 4ZD3L 4LPWA 3BISA 2ZPKL 5FYJH 3THMH 5E8EA 3HUJF 5HYJB 4G6JL 1YQ2A 2NY3C 3GM8A 3GMLA 3IXAB 3Q1SH 2J1KA 1QA9A 3CSYA 5TQ0H 3T08A 4YHPA 2YA0A 3ULUD 2DQEH 1EEZB 2NR6C 1CD1A 3PGCA 4IRSD 2ZUQB 1NCDL 5DZNA 4E5XB 1U8KB 4XNXH 3MRRA 5SWQB 2GTWA 4K3HA 4HUXA 3DYMA 5I0ZA 3RA7L 5TE4H 2A77H 3GMOA 1J1OL 3BXNB 5GS0C 3WDJA 5C08D 1HZHH 1G6VK 5L8LB 1S7SA 2CQVA 1PG7H 5HHQB 1DFBH 1BBDL 2XY1A 5I18H 4WI7A 1C12A 5E56A 4EI5B 4ONFH 3O8XA 4KHTH 4Z8FL 2FCBA 4NQTA 2WMPA 4HUKB 4UILH 1EFXB 1JPSH 1UVQB 2VZ1A 4RA0C 1UEYA 2VISB 1YMHB 5DI8A 4L8DA 4MS8D 3CXHJ 5H2BB 4OD3H 2JB6A 5JW3L 3IXTB 1IE5A 4P49A 3T04D 3HC0B 5CGMA 3B2UC 2I24N 4FQIL 5I15L 1CGWA 1YJDC 4LRIA 4BZ2L 2PW2A 1HSAA 3CMOH 3QXDA 2EDWA 2HN7A 3C5ZA 3QWQB 4LMQE 1Q9WA 4HQQL 4G3YL 5GGRY 2P45B 4X8JB 2PUQT 3QH3A 3BN9C 3HZMA 1EJOH 2VL5A 3IDMA 4ZO6A 3DVGB 3RPKA 1VGEH 5IBTH 2A73A 1QSEA 2EDFA 1K4DA 4PJAA 1RIHH 4XC1L 1BM3L 1D5BB 4YHNA 1A9EA 3S96B 4WNQA 2VE6A 3CFJA 4WEMB 4L8BB 4WDIB 2C9AA 1MI5E 5C0CA 1FZJA 1NDMA 5IMKB 1D7FA 4ZYKB 3MV8D 5FM5O 5E8PA 1MF2H 4KXZI 3UC0H 3V4UH 2EE9A 3KWWB 5F1KC 5FA4B 3W2DL 2HFEA 4RX4D 1FIGL 3PGFL 5D1ZA 4CU8A 5C71A 4XNZB 4LSSH 3FT4B 4R4BB 4Q6IA 3O2VH 1X5GA 5B8CB 3RWEB 3BD5A 4Y5XB 1KJ3L 3RWJB 4WO4D 1U2HA 2OTWB 1JFQH 1N4XH 5CAYB 4M6AA 1A3RL 3F7QA 5T33H 1EH9A 4TVPD 3C60A 2V6HA 5C3LD 2O5YH 3MRQA 1CK0L 2DQJL 2FLRT 2AJZB 3VFRB 5KTEL 2DYPA 3DV4A 5CZXC 3KDMA 3OQ3B 3TO4A 2VR5A 4UV7L 2OZ4H 4NIKB 1CI5A 4K94L 1DQDH 2VXVL 3QFDB 4PJGE 5IB1A 3GBMH 2CGRH 1QNZL 5IB2A 1DJSA 1RY7B 1CGVA 1EO8H 1CLOL 3PABB 2YMXL 5D7LE 4EN3A 4OM1H 1OSPH 1E0OB 1BWWA 2DQTH 3SJVD 2HJLB 3ES6B 2H32H 4YE4L 3NA9H 1U8JB 4HS8L 1WFOA 2FO4A 2NPLX 4J3TA 5DWUH 1B0GA 2WZPD 1LK3H 5J13B 2W9EL 3VG0L 1VKXA 4YUEL 4ZDHA 5JUEL 5DQJB 1X5XA 4X6CB 4ZXBC 4I3SL 4LVHB 3GIZH 3MTRA 5JORB 2R69L 2C7UB 4R97B 5C9KA 1UB5A 2X4UA 4YX2L 5AAWA 1CLCA 1X5AA 5DMKA 4R9HA 5T1DL 3P9MB 4HZAA 4XPGL 2DTML 4J1UA 4AEHH 3SQBA 1H0DB 5I73C 1IM3A 1YEJL 4RGOL 2PTUA 4KVNH 4KZEH 3RU8H 4TTDC 1F3DJ 4KJYA 2ZUVA 4HV8B 1MNUL 3I6GB 4IBLT 2VC2L 3GMPB 4LU5H 3OKLB 4Y1AD 5C7XL 3TT3H 5FDWA 1MREH 4AK1A 3EFDL 5TDNB 4OTXH 3VXQB 7FABH 2ED9A 5FYJL 3DXAB 1R3LB 2UZIL 3Q1SL 4BH7B 3KPRB 4H1LA 4O9HL 3GJFH 1UEMA 2VYRE 2W07A 2DQEL 5FO8B 2YBRA 3PP4H 4HIHB 4UIMB 3BWAA 1S9WB 3NCEB 2DQCH 3JV6A 3OX8B 4XNXL 3DV6A 3NCYS 2FGWH 3SKOA 1C16B 5C8JB 4M1CD 5FA3A 1IC5H 4KI5C 5TE4L 1I8MA 2R4SL 2VITA 2A0LD 1XGPB 5EU6B 1P4IH 3ARDA 1MJJB 3QUXD 2BSSB 4X6CE 5E7FA 1HZHL 2WBJA 1VSCA 1PG7L 1TENA 1DFBL 2EDQA 1NAMH 4YZFF 3MRJB 3T2QA 4UILL 3MRHA 1CVSC 4FQJH 2H2PC 4NKMA 4HG4J 1HHHB 4LSDA 2RAMA 5DT1L 3RNQB 1HN1A 3ZO0A 4RMUA 4OD3L 5JHDB 1OWRM 3MRLB 4ZG1A 1KNOA 1I7RB 3FRUA 4OQTA 4HAFA 4E42B 5E9DD 4PJ7A 2W0PA 3CMOL 3QDHA 1XGUB 2ICWB 1T2QH 2B2XL 1OAUL 4JPVH 3T4AA 3F7VB 2DQGH 5IW3A 1LP9E 3I9GL 4PREA 3V4VH 2W92A 3DECA 1JGVL 2VJXA 3TIEB 2FHBA 2HLFC 1BD2B 4ONHB 1VGEL 4YXLL 2QHRL 3OXSB 1HYSC 4J12A 4PJDF 5B21A 5BZDA 3D85B 1BEYH 4LNVA 4RIRB 1MUJA 5HDOA 4OZGE 1U6AH 5I75C 4OD2B 2LQRA 3CFKA 5FXCH 2J88H 5ICZB 3T1WA 4PP2A 4RMQA 4LSUH 5C9JB 2JIXD 5DGRA 4I18A 2EEAA 5IHUH 4PRDA 5D7IE 3QDMA 1M7DB 3MV8E 4NQCB 4XTRD 3UC0L 3V4UL 1PX3A 4JM4L 4M5ZL 5GSVB 1BLNA 2GJ6B 4YDJA 1CXIA 1EA9C 3WDHA 3ULVC 1CQKA 5K9OA 4L3CA 3JWDC 1KENH 2H6PA 2HT2D 2LABA 5JMRA 5CSZB 3WIHL 1DL7L 3O2VL 2P44B 4FG6C 3T77A 1G9EA 1G6RL 1KXVC 3MGTA 4WU5B 3X13A 4YXHH 2YK1H 1G7HA 1JFQL 3WE6B 1IEAA 4LHQB 4WHDA 2Z92A 5FYKH 1IC4H 4TVPE 3F6IA 4ZAKB 2V2TB 4L4TD 5DJ0A 3CCHB 4RGNB 4X6FB 1C08B 2Y36H 3GBNH 1DQQB 1N6VA 5J6GA 4QRRA 2OZ4L 1YMMA 1UJ3B 1HXMB 1G1YA 2IAMC 3MBEB 1D6VH 3MJ8B 1ORSA 3MRKA 2APVA 3VRLE 5HVFB 2CGRL 4UBDC 4K8RL 5F96H 3LKQB 2VN4A 2GHWB 5E6ZA 3ZYZA 2VDOH 5C07A 3SJVE 4OM1L 3MR9B 2DQTL 3B3IB 1I8LA 2QTEA 3BZFB 1B6UA 2A9NH 3CAFA 1B88A 1AP2A 3NA9L 5FO7A 3EDJA 5INDA 5AUMA 4JQVC 3O4LD 2J5LC 2IPUG 4U4BA 4GLRH 1GZPB 2BC4A 2BVUA 5C0NC 5JW4Q 3FOLA 3TLRA 2R1YB 3FB7A 1FE8L 1VFMA 3P9LB 3TV3H 1R6VA 3NABH 1MIEH 2CRZA 1OAZL 2VQ1A 1KT2B 3L3IB 3QAZB 2C4FT 2AXFA 3PNWA 1MCKA 3FONB 4MYWB 4ZO9A 2B1AH 4KZEL 5I71C 1A22B 3CDYA 1QUNA 5BW7C 4C59B 1QACA 5AZ2L 3HPLB 3FN0H 4LOUD 2DI9A 4PRHA 4Y1AE 2APBA 3LQMA 1MREL 3KNBA 4Z7UB 1RV6X 7FABL 4XCYB 3L9RA 4BFIA 4JGUA 1N2RB 4QLRA 3MMEB 4MQXC 3RGVB 2VKXA 2J3SA 1H8OA 4PJBE 1NCWH 2JJTA 1ZHKA 2Z35B 4H0IA 4JPKL 1HQRA 4JPIA 3UCRA 1Z5LB 4WWKD 3MODH 2DQCL 1H3PH 4YPGA 4ZFOA 1IC5L 3CVHA 5EBWA 1I85C 2A83B 1DBML 3HPJB 4MNQB 4BUGA 1NGWA 1LK2B 1C5DB 3KPNA 1JF5A 1T5WB 5IHBA 5EA0H 5GRYA 3HB3D 5IV2B 2HFTA 2L7JA 4JKWA 4XGZB 3OZ9L 3ARBC 5JNYB 2LU4A 4UDUB 3RKDD 3OBAA 1FZOB 1DLHB 4G9DA 4PJGF 3G04A 1MWAA 2QADB 3PJSA 4FQJL 4MNGB 4YR6B 5ETUB 4B0MM 1BREA 3TT1L 1PQZA 4BH8B 4G8IB 4R2GB 1HQ4B 4P2RB 3PL6D 1JV5B 8CGTA 1J88A 3TBSA 3HE6C 2ARJB 3N06B 2W0FB 4FXGB 1QLRA 3L3HB 5I66A 3I3BA 3JTTB 4LCYA 4Z7UE 4ISVA 1Q0XH 4PY7B 3VGDA 1XIWD 5J57B 5HYSG 3MV9D 4BQBA 2ZSWA 1CDJA 1HKFA 3VXPB 1LEGA 3PDGA 5D7KE 3O41B 1DDHB 4QRSB 4V1DD 2PO6B 4NDMB 3IDXH 3RY6A 1OLLA 4X7FC 1U6AL 5LWYL 4A6YB 4Q9CA 5DEFB 3AU1A 1DBJH 4LSUL 1I7UA 2V5TA 4UB0L 2EXYC 5IHUL 2OSLB 3LRSA 3PWUB 4LSQH 4RMRA 5GJSH 3IT8D 5F7FA 3UPCA 1XH3B 4R3SB 3RPIB 4GW5A 2YD4A 4XP1H 4Y4KA 1KENL 3I2CL 1HEZA 4HT1H 3C6LB 1JPFA 3CIQA 1JPGB 3SO3B 1G6RB 4RMSA 1PX4A 4YXHL 3VXSE 4LLWA 4KMQA 4P2RE 3TZVD 4PGDA 2WK2A 1QFPA 4L4TE 5T1LD 4Y7MA 2EC9U 3X14A 1RJLB 1PEWA 3ARFD 2C3XA 3BGMA 1PAMA 2Z9TA 4TNWK 4DN3H 2Y36L 3RJQB 3GBNL 5DUBB 3TJEH 1CFSA 4MXQC 5GGSY 1XMWA 3QI9A 4XPHH 1R3KA 1P7KB 5CKAA 3EJJX 1TJHL 4X6DB 2XKSA 2Y5TB 4KUCD 2R0KH 4K3EH 2MCG1 5TGBB 4N0UB 3UXFA 2NY4C 3ZE2E 2X7LA 4X6CF 4Z7VA 2X09A 3SO5A 5JDSA 3K1KC 4G9FD 4PLJD 5E08H 3LKPB 2BJML 4HPOL 5CBAA 4LLVB 2D9QB 3FFCD 2IPTH 3AREB 2ICCA 1IJ9A 2YPLD 4FQXD 1KB5A 4RMTA 4EIGB 2UWEA 3QFJB 3KPQA 3ZYOA 3QIBD 4M7JL 1JHLH 4PJ9B 4YHLH 4ZUVB 1CFQA 4HUWA 1Q38A 1QLFB 5HGGS 3TV3L 3QDGA 3HRZB 1F5WA 3NABL 3KPLA 1FL6A 1MIEL 5EC2B 5I1JH 4K3DH 5FUZH 1U8PB 3QEQE 1WK0A 2ITDB 3QWOA 4JY6A 5GHWH 5D72L 4DFIA 1DQJB 3WHXA 1F8TH 2EDYA 5IF0A 2HKHL 3BEWB 5E0QA 3REWA 4X4XB 2ENSA 1LP9F 4XP4L 1P84K 1Q9OA 2B1AL 3L5XH 5ADOH 3VWJB 4XBGB 3RVUD 2H1PH 2J8UB 5E94B 2ZG2A 1LO5A 5IKCA 3FT2A 4FFYH 1MCLA 5JOEA 5DRZB 4OZGF 2AERT 4IMLA 4ZQKB 4DKEL 3QXWA 4HHAA 3ROOA 3RVXC 4GRWH 4KKBC 3SE4A 5D7IF 4NC2B 4LFHD 3GJFB 1NCWL 5C0IB 2ZG1A 4BELD 2LE9A 2VZSA 4NQVA 3H2WA 4YC2C 3TA3A 3STLA 4YBQC 3Q6FB 4ZS7H 3MODL 4EQ3A 1TZHB 4HC1H 5FKPA 1KB9J 2NZ9C 3UTTA 1FSKC 4PY8I 2BSTA 3F7YB 1IGTB 4MA7L 2FX9L 1LO2L 5DZLA 3NGBC 5EA0L 3SCMB 1QPPA 4LEXH 3DMMA 3WJLA 4Z78B 5IVNA 3OAYK 2L0DA 4YLQT 3BJLA 3MLTA 4B41A 1CE1H 4JHWH 5LG1A 1RZ8A 4YDKH 3QCUL 5TF1H 4LVNC 2FJFA 2D4FA 3MUGA 4S1QH 4WW2A 4JPWH 3VRLF 4Y0GA 5BS0B 4EBQH 1I3RB 3K2UH 4YO0B 4IS6A 3VMPA 2IGFH 2OX5A 1AXSB 3OMZA 1BAFL 1H5BC 1JHTB 3QJFB 5MEPA 1MHEA 2FLBT 1HH6A 4CJ1A 1N0LA 5GGQL 4PV9A 4JJ5B 1RZKL 1S7VB 2Y7QA 1CIUA 4P5TC 2FJHB 1MRFH 1SY6A 5J3HC 3JTSB 3LN5A 1LEIA 3P30H 1H8NA 3CX2A 1A6TA 1LO0L 3BKYH 1I9JL 3S34H 4U0QB 3MRDA 1OB1B 5DD1L 1NANH 1FHGA 4APQD 1A21A 1CTNA 1OL0A 1A7PH 4P3WA 5SWZD 1T0MB 1KN2H 4EUPA 1YEHH 3SDYH 4PB9L 4I0CC 1UWEL 1A4KB 5DSCB 5DJ6A 5ITBL 5GJSL 3SGEH 3G5VA 4PJFB 3SKJL 3ARZA 3L3GA 5HGHB 1T04B 4P2YA 3BHBA 3VRJA 3GSQB 1DZBA 1MJUH 2PN5A 5HDQL 4NJ9H 3WMSA 3DOSA 4HT1L 2CUMA 1Q94A 5HD8D 4N8VA 5C2UB 5CUSH 3WUWG 2AEQL 5F9DC 5ILTH 2FIKB 1S9VB 4HEPG 5EOTA 5BV7C 2X4TA 1YY9C 5ICYA 4C56E 4JFZL 1QLEH 2O5ZH 4PJBF 2UZXB 2Z31D 3D69A 4DCQA 3DETD 3MLYH 2B1HH 2HJFA 4N1CA 5GRWA 4HK3N 3TJEL 2ERJC 1QFWI 4CNIB 3UDWA 1EVTC 4MX7B 5GZND 1P7HL 4I48B 2R0KL 4K3EL 1TVBA 4LGRB 2I27N 3OL2A 2ZKHH 4RGMB 3H9SA 2OJZH 3CZFA 5JW5A 1UKQA 5AWNL 5HHMB 1MJ7L 3MRMA 4GAYB 4W4OC 1Q9KB 1KELL 5KSAB 4NN7B 2XNAA 3M1BA 5KSVB 3FFCE 3OGCB 1EEUA 4UU9A 1MOEA 2YPLE 3DX9A 3ZSSA 4B7IA 3QIWC 4Z7QF 3VXMD 3CJJA 3PIQA 4JR9H 4F33B 2XT1B 1JHLL 4YHLL 3RI5F 3SDDB 4PG9A 1OY3B 3GIVA 5D7JD 3CLEH 1CICB 5ISZD 4ONGL 5C0BA 4GG8A 2H8PA 4QTIH 2YUXA 4Z7UF 2AXGB 4TNVF 3V0WL 4HCRA 5BZWB 5GHWL 3DO3A 3FB6B 5FYKE 1F8TL 2GCYA 4MNHA 5BO1H 4H8WH 1CDHA 3QG7H 1KTDA 3AC0A 4RAVA 3L5XL 5DO2C 1T1YA 4U1MA 2H1PL 2K1MA 1EGJA 4NN5B 4FFYL 3GMNA 2EDHA 5CCKH 5ESVA 4NRYA 3BPNB 4LCWA 3PQYD 1JGLH 2JK5B 1S7RA 3QUZB 4X0KA 4HIJB 5E8NA 5I30H 5L2KD 2EDNA 3MA7B 2AABH 5FKAB 1WITA 1RK1A 3QULB 2PF6A 4NNPH 4RAUB 5ELIA 3UBXG 1HK6A 4H26B 2P24B 3VCLA 1EO5A 2FHFA 2O5XH 3AY4C 2X05A 3U83A 1FLTX 5KS9B 3WO4C 1B4JH 3SN6N 4PGEA 4JANB 3HZYB 1JMZA 1W8NA 2C3HA 4K7PL 1EO7A 5BVJA 5IJVB 4PG2C 4JHWL 1VACB 4WENB 4YDKL 5EUKA 4S1QL 1C1EL 1YEKH 1BMGA 3K4ZA 4YEFA 1OT1A 5F72S 5KG9A 4EBQL 3MLVL 2NY2B 3W9EB 3UBXI 4F9LA 3ZE2F 2FEDC 1XF4B 1ZA3A 1I7TA 4EIZC 2FR4A 4I3RL 1WQVT 2ZOLB 1H8SA 4C4KO 1CLZH 3GHBH 2J8OA 3MBXL 3MFFA 4CJ0A 1CGYA 2PXYB 3IGAA 5KSUA 2BY0A 1FVEA 2GK0A 3HAEA 2ZUQC 4G8FB 4OFKA 3RKPA 1NC4A 1X5FA 5LGHH 1INQA 3TCXA 1EXUB 2C3WA 1JK8A 2Y9RT 2P8PA 3AS3A 5GS1B 4PBXA 5ERWB 2XTJB 4R0LB 3BH9A 3S34L 5DTFA 5LKNA 5J56B 3D3VB 4NQSA 2H9GA 5DA4A 3T0AA 4P23B 2HRPH 3FMGL 3B83A 4FTVE 5SWZE 1UA6H 1A7PL 1YEGH 4F7PB 1YEHL 3MUJA 4J3SA 3SDYL 4Z0BL 3UZQA 2IPKB 3QDJA 3CDFA 2DKUA 1K9TA 1AC6A 1VGKA 3G5YA 1OP3K 2LU7A 4POZD 4UDTB 4OI9A 5CUSL 4Y4HB 4Q97A 5ILTL 4NZJA 2VUYA 1T21A 5IG7B 3WN5B 5KJRH 5DD6A 1QLEL 2O5ZL 1DQTA 5SWSB 1A1NA 4H1LH 3O9WA 2E3VA 5KN5A 2HTKD 5K33A 3OKKA 1PZ5A 2A74A 4CVXB 3BIBX 4YIQB 3EYOB 3QUML 1G7PB 1TVHA 3SKNB 5DC0A 5JIPA 1RURH 5EC1B 3LB6C 5GISL 2EYRB 2ZKHL 3GSOA 5JXED 3QCTL 2OJZL 2EYTB 4WCYL 3DUUA 4R6UA 1FC1A 3BYYA 2DLHA 2F19H 4NYLA 4MAYD 3HZKA 5CJQH 4XRCA 4IRJD 5B8CC 4Y5XC 4G6KH 1MHCA 1KJVB 4XBPB 3V7AG 2X89A 2ICEB 5IT2H 5ADPH 3H3BC 2N7AA 3EHBD 2ESVB 3L5WA 2EDJA 3CLEL 4M61B 3UZVB 2Q20A 3MO1B 5GGUA 4MWFB 4KU1A 4ZUWB 5HPMB 1S7QA 5FYLD 1K5NA 5EO9A 3IDIA 1CE6B 4NHUA 1CFNB 4L9DA 3DGGA 4UNVA 4NGHH 4H8WL 3MRIA 5TDOA 4IJ3C 2EYSB 3DRTA 3KXFA 3GI9H 1MAJA 5CCKL 1PZUB 5KSBA 4NQXA 4GRWB 2ZCKH 2MMXA 3FQXA 4WRLA 4ETYA 4L3EB 3VWKB 1TZIB 3HI6H 1CLYH 2I60L 1JGLL 4D9QE 4XVSL 2NYYC 2X41A 5BRZB 3MCKA 5L2KE 5L2JA 4C55A 4NNYA 5J13C 1FFNA 4JY5L 2VTFA 1T2XA 3QQ3A 1QFUH 3P73B 2GTZA 5SV3A 4NNPL 3MACH 1B2WH 1D9KA 4R97C 4HK0A 5E6IB 3O8XD 4KH2A 1K4CB 5A2LH 4G6FB 3OPZL 2O5XL 5AYUH 2NTSP 2FX7H 4KVCH 5HI4C 2IAMA 2IQAA 4X7DC 1B4JL 1X7QB 2ED7A 4ODWA 3RVTC 1MCJA 1ZT1B 1GGBH 3NN8B 4IOIA 5I8CB 3C5ZD 5EU4B 3BI9X 4KUCF 2K7QA 4TUJA 4PGBB 1OCWH 2D03L 4JQVA 4OZFA 4YDLC 4QKXB 4N8CH 5I8KH 4BQCA 2F53E 2QKIA 4S2SB 1CLZL 3GHBL 3LEVH 5FHAH 5HJ3A 2VERN 1T6VN 5JTWA 1QSED 4U6HA 4XPTL 5EIIA 4UINL 4GRWE 3NAAH 3UAJC 5IHZA 4KTEH 4NQEE 1MHPH 2OLDA 2QHLA 1T83C 1ZKAA 1FFOB 4MD5A 5HHOB 4OCSH 1QKZH 4ZUUB 4MVBD 3BQUB 5EWIL 1RUMH 5C0CD 1IQDA 2VLKB 4LQFH 2XFXB 3T3PE 2ADGB 1ZA6A 2W1NA 5I1AB 1GZQA 1XGRA 3GNMH 1N0XH 4MZ2A 5D1ZD 5BW7A 2PYEA 1UA6L 3TH3T 4P0DA 4PRNB 3UTQB 1YNLH 2X4NB 2XQYG 2DL2A 5FGRA 5C0GB 2Y4SA 5KBNC 3TVMB 2DIAA 2ZUUA 4OFPA 1BVZA 4X9IA 2DBJA 3C60D 3P4NA 4R90H 5JPMA 2R0ZL 1E6OH 4G7VL 5HYQA 3MNWB 4HUMB 2QR0A 3F12B 1RZJH 2DYPD 3BVNB 1G9NL 2F5AL 3TO4D 1WVZA 4UTAH 5JOFB 2JCCA 2P5EA 5I19L 4KDWA 3SE9L 1BPVA 4OGAC 3T0EA 2R4RH 4PRPB 5FO9B 1HH9A 5C09A 3F62A 3GKZA 3QNYA 3RTQD 3GHEH 3QUKA 5DMYA 3QUMB 3RIAK 5HHOE 2NY6D 2E9BA 1F4YH 1KTLA 4I9WD 1RURL 5CP7B 4JN2A 1QSFB 3I50L 2XQBH 3OHXA 3MRPB 4KRPC 3RUGE 3HNSH 3UTSE 1KUMA 3WKMH 4X80H 2Z4QB 1AGEA 1DP0A 5F7HA 3HE6A 3LS5H 3F58H 5GGVL 2R2HB 2QQQA 3CXDH 4F7CB 1N5YH 2OL3A 1T1ZB 1V3KA 3BUYB 5GRVK 3WUWB 5JO5A 5I76B 5ADPL 4KRLB 4FQHA 3PWVA 4RGNC 2EXWC 4XPFH 5J4MA 5L88H 3HI1B 4OGYH 4CU7A 2P46B 5CGTA 5E5UB 3GMQB 4Z77A 4TN9A 4K94C 2ATKA 4Y19D 3RWFB 1UJ3C 1QHOA 2X10A 4D2NA 3MBEC 2BHYA 3PUCA 3UJIH 3G08B 3EYVB 4QWWD 2A2QT 4HH9B 4LNRA 1EEYB 2HRLA 5DS8A 1U91B 1OTUC 2HWZH 1U3HB 1KLGA 4RSVA 4X5WB 1JWSA 3T8XA 1QPXA 4M43H 3GI9L 2AXHA 5E2VL 4JRXA 2OTUA 3MNZA 4N5EC 4IRSB 3T4YA 3VJ6A 1T66D 4MJ5B 1ACZA 3IDUA 3HI6L 5I16B 3GKWH 3KYOB 1U8OA 4OF7A 4H88H 1MVUA 1UZ8B 3W11C 2XPGB 2EECA 2KH2B 3MRGA 3GSXA 3ARDD 5F7UA 1NC2A 5C08B 4UNUA 1QFUL 3W39B 5F9OH 5TJWK 1FORL 5BXFB 2WWMD 4QO1A 3TBVB 4CW1A 4OCRL 5GPRA 4JZJA 5D1XD 4JFPB 1B2WL 4HIIB 15C8H 2FDBP 4XCFH 1QG3A 3T0XA 3AFLA 5AYUL 5T1KA 2N4IA 3QAZC 2FX7L 3F6LA 4KK8C 5DK0A 4R7DA 4AJ0A 3GDBA 3X3GH 5TDPA 4HUVA 1TNNA 1JWUB 2YR3A 3WHE0 5IR1A 1OQOA 5I6XB 5IW1A 2XZZA 3BP6B 4J6RH 1UB6B 4HZLB 4OSUH 4QRTB 1QRNA 1FNSH 4P57B 1KJMA 2EH7H 1J7VR 5L8KB 4PRIA 2XKNA 4XPBH 1FYTB 3GGWB 5E8DH 4YXKL 4N8CL 3RGVC 1T03L 4XVUD 1E4KC 3UJTH 4U6XB 3LEVL 5FHAL 2BVOB 4QTHA 4JFEA 4PJAE 1S5IH 3RL1B 2DN7A 2IANA 1UKTA 1MHPL 1MCQA 2YKLL 5I8OH 5DJ8B 5B39B 4MHHG 4OCSL 1QKZL 3BP4B 4JO2H 3RVWD 4HWBA 3WLBA 3EJZC 2WANA 3UBXB 3OKDA 5LXGL 3RWCB 1OTSC 1BJ8A 4ZUTB 3GNML 3L7EB 5C2BH 4P48A 3BMVA 5D2LB 2Q7YB 4N0CD 4DVRH 1M7IB 4TOYH 1IM9B 3GJEA 2BERA 2G5RA 1YNLL 4M02A 2G60H 2JJUA 2P7TA 3BUTA 4L9LA 4PJXB 4LLQB 3TIDA 4WO4B 2QADC 3MYJB 1F97A 1J8KA 3S36H 1GPOL 4Y16A 4M6OL 4R2GC 4R90L 4LAQH 1E6OL 3FB8A 4MHHI 5J1SC 1QHPA 2VDML 2YZ8A 3SGJC 4DOHE 1RZJL 1Z9OA 4P5MB 5L8JB 1DEDA 3X12B 4UTAL 2BXYA 4PLKD 4QRRD 3H3KA 1YMMD 1YPZE 2BXZA 4WFHD 2XZAH 4U2ZA 4DW2H 4ZMAT 1GVIA 3UPRB 1TMCB 4R4FL 1IILE 4WUKL 1FYTE 5DYOB 4X9GA 3TWCL 4YHYB 4OV5B 2NXYD 5D4QA 3GHEL 1EERB 5IB3A 1BBJA 5C07D 2XWJB 3S37X 2X42A 2E8ZA 4OLZL 2A6KB 2AI0H 4OT1H 4CMHB 5KOMC 4LFHG 3VE0B 5GSRA 1F4YL 4I9WE 4DAGH 2CJUH 4LIQL 3WFHA 4GOSA 1EX0A 2XQBL 4WV1B 1DLFH 3TYFA 2MHAB 1IRAY 3HNSL 3HNTH 3WKML 4W81A 4ODUB 4X80L 1AXTH 1UJTA 3IAPA 4PJCA 1RZFL 2NY0D 3JBG7 4M7LT 5CFHA 3VG9B 1H5BA 5I0DA 1A7NH 4RNRB 4NO3A 2VLRB 3C6LC 3KPPA 3EJYC 3F58L 5HGAB 4PJXE 3SO3C 3CXDL 3RHWF 4W6XB 1M4KA 2MQCA 1D6EB 1N5YL 1RUKL 4P5TA 1A2YB 4S1SH 4JAMA 3WNPA 3CC5B 1TXKA 2I07B 4AEFA 4WI9A 4DKFL 1JNJA 2XA8H 5MENB 3O6ML 5ALBH 2BMKA 5L88L 3DROA 4GRWF 1XR8B 4OGYL 4PRHD 3BX7C 2FSEB 4IMKC 1ED3B 1VA9A 4BSJA 1OAKH 1UCBH 4OJFL 1EDQA 4XCNB 3UJIL 4K8RC 3PWPB 3T3PF 5DGQA 5F9WB 4GUPB 4Z7WA 4Z0XB 4LEOB 2HWZL 3Q5TA 4OQ1A 4F57H 1GIGL 4M43L 4YQXH 1ZT4B 2J7LA 2VKWA 3EGSB 3D0LB 3LV3B 1KF9B 3KPSB 1A3QA 2X1OA 5IJKC 4LF3B 3AREC 3GKWL 5DHYA 2N56A 2BNUB 3QQ9C 4H88L 3GMMA 3BRFA 5I1KL 3RIFK 4NPYB 4NQDB 4RFEA 3OJ2C 2UUDK 3HMXH 5FCUL 4HFWB 5LGKA 4WEUD 4PJ9C 2V7NB 4P2OA 5F9OL 1WZLA 3IETA 3DX6A 1FBIH 2R8SH 4CU6A 2DQHH 2AGJH 3N1QC 3WD5H 4X99A 4DVBA 4XCFL 1XZ0A 4NT6A 1ZMYA 2Z8WC 2F5BL 1PW3A 1G7IA 1SMOA 3VGBA 4P59L 3V5DB 1MLCB 3X3GL 2QQNH 4W70A 1TCRA 1AGBB 3VWJC 4K7PX 1KGCE 4F7EB 3NACH 5F3BB 4JN1H 4LPVA 4BM7A 5GS0H 5FHBH 4X6BB 2FL5A 3ARGA 4J6RL 5F1IA 4HJ0C 4WI3A 1FNSL 4JM2C 1F58L 2EH7L 4MDJA 1QTYT 1VFAA 1RU9H 3BRDA 4XPBL 3RUGF 3VDAA 5E8DL 1J0IA 4GKSB 3R0MA 3UJTL 5I17B 1BQHG 25C8H 3BPLB 3TN0C 5EUOA 4OCXL 3MRCB 1S5IL 2DWEA 4BSWA 3U30B 3KPSE 3MLPA 1UM6H 3NFSL 4RFNB 2EKSA 3D39A 3H0TA 4GKNA 5BJTB 4LCCA 4N0FB 3VGEA 4NO2B 9CGTA 1YQVH 2FYYA 3QDME 1YJDH 5EZLA 1RZ7H 2ZP0T 5HSFA 3W9DB 1OGAA 4OCYH 5DEGA 4CVWA 3P0VH 1HI6B 2PNDA 5C2BL 3EO1A 3BP7B 4Y4KD 5DDHA 4DVRL 2ZUYA 1M6OB 4TOYL 3EOTH 4HUUB 4TRPH 2OR7A 4IHOB 2G60L 3EOBA 3VFNB 1SEQH 4HCRH 2E7LA 3O3BB 1X3DA 4NKOA 5M94B 1FFPA 1WWBX 3IS1X 2H26B 3HCVA 3VA6A 2AJUH 4LAQL 4FZ8H 4G8GB 1QO3B 4JB9L 3TBYB 4H5SA 4JFQA 3WLWC 1EGJH 4DN4L 3FFDB 3QI9D 4FXLA 4WFHE 2XZAL 5DJ2B 4L5FL 4ZS6C 1JZ3A 1WBXB 4OCLC 3AY4A 1LHZA 2MCPL 4J23A 4WY7L 1YUHA 3FRPA 3Q48A 2ADJA 1EMTL 1XGTA 2AI0L 4OT1L 1I8KA 2BY1A 3O3EA 3T1FB 3NFNB 4PG2A 2XXCB 1GSMA 2IH3A 4U1HA 3TCLB 4DK3A 1DLFL 1KIUA 4Z7QE 4JHAH