4O9HL

Structure of interleukin-6 in complex with a camelid fab fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
211
structure length
211
Chain Sequence
QTVVTQEPSLSVSPGGTVTLTCGLSSGSVTASNYPGWFQQTPGQAPRALIYSTNDRHSGVPSRFSGSISGNKAALTITGAQPEDEADYYCALDIGDITEFGGGTHLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-6
publication title Combining residues of naturally-occurring Camelid somatic affinity variants yields ultra-potent human therapeutic IL-6 antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2014-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hL01
4TSCL 5DQJB 1WBZB 3G5ZA 3H3BC 2VDPH 3WKNA 3MLTB 2ICWA 4YHYB 1T22B 1YEJH 4JY5L 3BP4A 2XT1B 4N68A 5FYKH 1FLTX 2QBWA 2BDNL 4JO2H 1SBSL 3QWOB 1LK3H 1VDGA 5TPWL 3JV4A 1ACYH 2B1HL 3G9AB 4NIKB 4X7SL 2LFGA 2AV1B 2WIIA 2QQLL 4Y4FA 4BM7A 5DURD 2XWJB 2UZYB 4KHTL 4S2SB 4AENB 2YXFA 4D9QE 3SGKC 2XTJD 3MLZL 3PWNA 4ZD3H 4JHWH 2VH5H 4TRPH 2R8SL 4J3OC 2JJSA 2FLRT 4CUCA 4ODHH 1YECH 1OAXH 4JPIA 2DQJH 5IBTL 3DRQB 1AKJA 1JBJA 2J6EA 3IXTB 4YZFF 4QF1A 4L8SA 3A6BH 2EC9U 3LEXB 5HDBF 2MHAB 4Q9CA 3DV4A 4WEBH 1NAMB 3FQXA 4XNQB 3FQWA 4XVUC 4M7LT 5FA3A 2R56L 1MAKA 5HI4D 3TO4C 3OMZA 3SCMB 5TFSL 1AR1C 1RZKL 4N0YH 5C1MB 1TJGL 5JOEA 2W65A 2AJSH 1I7RB 1UVQA 1WFOA 3QIBC 1TITA 1U3YA 2PYFB 1XF2A 3WBDA 1IZKA 4Y4KA 5IBUB 3CLFL 2CMRH 4OM1L 4HAFA 4PGCA 5DVMA 3BDYL 1WZ1H 4XP5L 4PB9L 3ZHKA 4CL7A 2NW3A 4G9FA 3VGFA 4GKZA 4G43B 3BUYA 3R0MA 4JPKH 5IB5B 2OK0H 1HH9B 4U4BA 2F15A 3GI9H 3WJLA 2W0PA 2F5AL 5FM4A 4KJQC 2R9HD 3QNXA 1D5IL 4NJ9L 2P8LA 4Y5VA 1OWRM 1MCRA 1YNTB 4KKAD 1U3JA 4ORGA 2YA1A 1F8TH 1NMAH 2NXYB 4Y5XB 1MSPA 2BVOB 3DHMA 1IEAB 3FT3A 4KKBD 5KSBF 1BJMA 1SM3L 2PO6C 1TTUA 3O45A 5JR1H 2DQGH 3MR9B 4LSRL 4LPYA 3O41A 3SBWC 2OL3B 2H3NB 5FHBH 3QQ9D 3ZYOA 5E2UL 5DJZB 5IOPA 3I6GB 4KROC 3MA9L 2OJEA 5LGHL 4I5BA 2BNQB 3UYOD 4RIRA 2YN5A 3LN9A 2E7HA 5I1DB 4L9LB 4TPRL 4NNXB 3MO1A 4EUPA 4F8QA 2CO7B 5ADPH 1D5XB 1NAMH 1FVEA 4PRNA 4FQ1H 5BXFB 2OR7A 1FORH 4UZGA 1ZANH 4RBPK 3TN0B 4H0IA 2UYLA 2DTSA 3C2AL 1DVFA 3IDJA 4J7RA 2VDML 2WBJC 12E8H 1PZ5B 5GS3A 1IGJA 5ACLA 4JFEB 5GS1C 5I2IA 3GBMH 4H5SA 1FNSL 2DM3A 2P24B 2DKMA 1T66D 1DBBH 2YD8A 5ALCH 5ESQB 3UTSB 3LS4L 5CBEA 5DZLA 4EN3D 2HFGL 3ELAT 4ODXA 1LO2H 5DS8A 1DEEB 5E2WL 4MWFB 5FEBA 4DGIL 4OQTA 1A4KB 4P2OB 4LCWE 3FKUS 4YK4C 3C2SA 3CGTA 1KTDA 1BZQK 2IQ9L 3F7QA 5C0NC 4RMRA 4J6RL 5EOQH 1U8HA 5DRXA 1Z9LA 3S36H 1YEDB 3MV11 4I1NB 5DI8A 4MAYC 2BK8A 3NCJL 4R97B 1MVUB 4QOKE 3ARDC 4ALAH 2XY2A 4CMMA 2O5ZL 3OPZH 4EDXB 4E41E 2JF1A 1PG7X 2H9GB 3LZFL 3O6LL 3WLWC 4PIRF 3GK8H 1K3IA 1EHAA 4PRPD 1URLA 1U92B 2ZP0T 3RKDC 4OD3H 3HE6D 3ILPB 5FHAL 4J4PA 5J13C 3OJVC 3TBTB 4BUGA 2IBGA 3BVNA 4OLXL 3ULVD 2P8PA 2E7LA 2QHRL 2OL3H 3S4SB 3D69A 4UBDD 3CX5K 1AY1L 3ARBD 4YH6A 4W68A 4Y0GA 1DQQA 3MNVB 5D7LA 4TUJB 4YPGB 3P4OB 4HJJL 3W11C 2BSRB 2FB4L 4H25A 4EVNB 5LGKA 1RZGA 5SWSD 3FB7B 3ULVL 4HXAL 5MI0B 2FWOA 2DQTH 1AHWB 2OS7A 3MLPA 3HPJA 5FO8A 4ZQKB 2ITDB 1EX0A 3ZLQC 1MPAL 1NSNH 4HBCH 2X89D 2LVEA 3QUXC 2WZPD 2DQUH 3ZYJA 1J7VR 3C60C 4XVTL 4XWOC 1KG0A 3QCTH 4H1LB 3KYMB 1U6AL 4XP9L 4NCC1 5D6DA 4XBGA 15C8L 2APVA 3GSWA 3MV7B 4OCWL 2I9TA 4GMSH 4PRHA 3AAZA 4LGPB 1QQDA 3ARGB 4LCYB 4APQC 3BMVA 2WIMA 5D1QC 5B21A 4HS8L 4PD4J 5CEYA 3U6RB 3RP1A 1OARH 3K2MC 3VDCA 2EDFA 4X9GA 1JP5A 3OXSB 4HWNA 2AEQH 1EHLL 4XNMB 2YPLD 2H41A 4OCLC 1VFAB 3LKOB 3A6CL 3N1FC 4M8QA 2Z0BA 4FMKA 5C08A 3IU3B 5HGBA 5EFIA 3VXUD 1IGCH 2Y7QB 5FUCC 5C0BD 5C0FA 1CBVL 4ONOA 1CWVA 1LP9F 2EDRA 3RDTC 5FUOH 2X70B 3A67H 3CNKA 4MQXC 3SDCB 1MQKL 4XMKL 1R6VA 3MBED 1ADQA 4WO4B 4CVXB 1DBJH 4C4KO 4OFYA 4P5TB 4I4WB 2AEWA 4FP8H 5JW4M 4QTIL 5JQ6L 1P1ZA 1ZEAH 4JPWH 1FG2B 1PSKL 3DETD 3MV9D 5H35B 3O8XD 1QRKA 2NTFA 1FLRL 3EYUH 4LNRB 1JRHI 4NUJB 1N64H 1YY9D 1Q94B 4XT1C 4PGBA 3JWDL 3QDGE 3MRHB 4L5FL 1HCFX 4WV1B 4RFNC 4LLUA 4LARH 1HILA 1T04B 5CILL 4X5XB 3CXHK 4KUCD 3RUGE 2QR0A 1OF2A 1QA9B 3QG6B 1V3KA 1A6AB 1QO3B 2GJ6B 1NJ9A 2ZCKH 2HG5B 4KK6D 3VXMD 3EZJB 3L5JA 1W72B 4X4YB 2VC2H 4H1LH 1YMMB 2V17L 2Q3AA 3GRWH 5FDWB 2PW1B 3VXRE 3DBXA 3LKSA 3MRKB 5DD5H 5J6HB 4KMTL 4JDTL 4U1GB 2FIKA 3PQYA 1WZKA 2G9HB 2XFXB 5FM8A 1NFDF 4L3EE 1JWUB 3O2WL 5ID0B 1SJEA 3VFNB 1NMBH 2BOCA 4X0KA 4FZEH 5GSRB 4F7CA 4N1EA 2DTML 4XI5D 1S7RA 2F53B 3JTTB 1B0RB 3N1GC 5L88L 4HK3N 1CLOH 3GBLA 3GSNB 3P9MB 5IBLD 5CP7A 5IW3A 5IFHH 2VLLA 5IHUH 1NGXA 3C5ZB 1TCRA 5BRZB 5E2VH 2H6PA 2AKRA 2EDYA 1U58B 1V5JA 3IRZA 5J56B 1FH5H 1P5UA 4WWID 5E6ID 2Y23A 2AXGA 4JB9H 1RK0B 3QRGH 4EDWH 3UTPD 3VG0H 1BM3L 4JFYB 4PYHA 3CPLB 4UTBH 1G9MC 5F1SA 3BAEL 3ARTA 3BEVA 4NDMA 1L9MA 1I1FB 1Q72L 3CK0H 4HMDA 1OQXA 1CVSC 4LPTA 4TTDD 2FR4B 3RGVA 2AQ3A 3QWQB 4O58H 4YZFE 4AEFA 5JXEC 4S1QH 1EEZA 1ND0B 5GISH 3FN3A 1AH1A 2ADJB 2AV7A 4HWBA 2ZG3A 1KCUH 3CFDA 5C0RH 4R3SA 4MQ7B 4FFZL 3ESVF 5GPRA 5I73B 1ETZA 1IM9B 4I0PC 2VDQL 5I8CB 3G6AB 4EJ1C 4NRYB 1WIUA 4X4MA 2J2ZA 2CIIB 3MV01 3AY4A 2FEEL 3S5LB 1MEXL 2QSCL 4MNQA 2E9BA 4O2EA 3KYNB 2VABB 4PRIB 4L3CB 1MF2L 3AS0A 3VFWB 1EXUA 4MA3A 3KYKL 5FXCH 4MNGE 4WW2B 1BLNB 3MRDA 5IWLA 2AXJA 4GRLA 5HHOD 5JW3H 1RUPH 3HZMA 1XH3A 4R96A 4G8GA 1UKQA 2IANB 3RY5A 5GIRA 2EIDA 1KENH 5TE4H 4YE4L 3EKCA 3GSNH 3B8SA 4Y16D 2X09A 2Z9TA 2NY4D 3OG6B 4N8PA 3HB3C 1PGRB 3GSVB 5FGSA 3I6LD 4Q97A 4NZTH 3GMQA 1IGTB 4X6EB 3HLAA 1RSFA 3UP1A 1GSMA 3D39A 1ZT4A 4YBLB 4FQCL 4YQXL 1HHGB 4KTDH 2CR6A 2VXUL 4AT6B 3FO9B 3IJYB 2Q1EA 3B2VH 3DIFA 5KSBE 4PTTB 2BSTB 1MHCA 2DLTA 4JO4L 1WK0A 5F7DA 3L3HB 4I3SH 4LBEA 4R4FL 1QBMH 2H26B 4KHXH 5TH2A 5EU6B 5HYSA 4OF5A 1V7ML 1EBPA 1JTTA 4NO2A 4YBQC 3T1WA 4J12A 4M9PA 3KPRA 2D7NA 1MHPH 1X5IA 3BO8B 1EIBA 3D5OF 4NQCB 3IETA 1D6EB 1T0NB 4GXVH 5E5MB 1MCQA 3F12B 1ZWIB 2GJJA 2R2EA 1FZMB 4D94A 1FO0A 4Z7UF 1YQVL 2HLAA 3LIZL 3VJ6B 4ODUA 1G1YA 1JYNA 2BXYA 1LK2B 3BWAB 5FDYA 1OTUC 1M7IB 1C16B 4N5UA 1EMTL 1DJSA 4KKLD 4JFDE 1IGIH 1YN7A 4PJ9B 2ESVD 2YPVH 3GMOB 2H1PH 1MVFA 3CXDL 4Z7NE 2X1WL 3QNYA 1J11A 2Q20A 1ES0B 1JGLL 1QZ1A 3CU7A 1E4KA 4JO1L 4JG0H 5CEZE 2EDNA 3U9PH 1P4LB 1NGPH 1LDSA 2NR6D 3H3PL 3L7FB 2OTUA 3BPLB 4Y4HD 5F9AC 2X42A 2COQA 3OSKA 2IFGA 1KXVC 3HR5A 1HSAA 2VAAA 2BZDA 2OXGA 2YWZA 3PHOB 3TT1H 3TO2B 4HUXB 2G5BB 4LKCA 2NY5L 4CJ0A 1FVCA 1U8MB 4RMSA 1X5HA 4OFDA 5FK9B 2R2BA 4XCYA 1CF8L 3CX2A 4M1CC 3IKCA 3DX9B 3Q5OA 4UQ2A 1G9NC 4BUHA 2F74A 5GSVB 1JN6B 4XBPA 4DZBA 5KZCB 1A6VH 2DS4A 4IRZL 4ZUUB 1U8PA 1U9KA 4X7CC 1EFQA 1A8JH 4OLWH 3OKMA 3C8KA 4XB7A 3ZYIA 2ZG2A 4GKSA 1UACL 1JK8A 3CFIC 1FYTA 4W6YB 4PJXF 2F54D 5KSVA 5EO1A 4XNUL 2FJFB 1EJOL 3U2SB 5F70A 5EC2A 3UX9B 5EBGA 3OKKB 5FGBA 3SKNB 5HPMB 4X6CE 1N6QL 4PJIF 1G84A 5DSCA 1HEZA 2EEBA 2OMBA 3AMLA 3GJFA 3FMGH 4M6MH 1G1CA 3ISWA 1LEGA 3D3VB 2KQMA 3ARXA 2BMKB 1MCDA 3IFNH 4JFZH 1D5BA 2NX5A 4OUUA 1TJIL 4OZIB 1AR2A 1WBYA 3BRGC 3TO4D 5E00B 5F96H 1AR1D 4YFEA 3HCVB 3EDFA 4LGSB 3SY0A 4FFWD 1T2QH 5LVEA 2ICEB 2W60A 3HPLA 2FH6A 4GRMA 2CKBA 1XR9B 4P57B 4LSUL 4DVBA 4OFVA 3MJ7A 4ZS6C 2R4RL 3CDYA 3EOTL 1D6VH 3IF1B 2AGJH 4Z0BH 5BMFL 5BV7C 5DMIH 2Q8BH 3CFJB 3FFCE 3UYRL 5IT2H 3HI1B 2C1PB 3BPOC 3V6OC 3MJ9H 5I1JL 4Z7VF 1XGRB 4G8FA 4PJDB 2DWEB 1NQBA 4JDZA 4JVPA 5K59F 4JKWA 1E4XL 2YMXL 4OJFL 1VFBA 1F4WL 4KJQD 4AENA 3O4LE 1YEIH 3DROB 1YEHH 3QDHA 3QQNA 1NGZB 2ARJB 4ZSOA 3V5HB 5IV2A 1LDPL 1LP9E 1H3UA 1CN4A 32C2A 1LO0L 3DRQA 3MLSL 3VI3E 1NUDA 4GG8A 5J06A 4YUEH 2PYEB 3OJMB 5FO9B 3NCEB 4HPOH 5JUEL 5JIHA 3NFSH 4F57L 4DEPC 4WTZA 4DW2H 5DHYB 4KJYA 1FN4B 4ZFZB 1UH3A 5FB8A 4KROD 5GGQL 3FQNB 3HKFA 3INUL 3ES6A 1T1WB 1LD9B 1A6UH 4PJBF 4WI9A 1F90H 4PLJD 3ZMRA 3RNQB 2WINA 2W9EL 3P0GB 4N8VG 4QCIB 1PD6A 4L1HA 3WSQL 3GHEL 4ETQB 4ZUWB 2BY0A 4FS0A 5DDHB 2NXZB 3QUML 3SE8L 1CD9B 4PBXA 2J12B 3MNZA 4K3DL 2NMSA 2PYFA 4I2XB 5KN5B 2P48B 3GBNL 3RU8L 2WBJD 2JJSC 1U3HD 5FUZH 1YJDC 3WKML 4JN2A 3D87B 1J12A 3CFCH 1HHKA 3UTTA 3TH2T 4L8SC 5DEGB 3EGSB 1I4FB 1QRNE 1T0MA 1OHQA 1NFDE 1KIQB 1JPFA 5FO7A 3PDDA 4CDHA 5C6TL 4RGMB 5HHME 1FV1A 4I77L 5C0ND 1YNTA 3GSRA 1U8IA 1X7QB 1XFPA 5TQ2L 1CGUA 1YEFL 4K9EH 5H94A 3RI5K 2BVOA 3F6LA 5TDPB 4KV5F 4G6AC 4JFHE 4ZNCD 5EOCL 4MAYD 5IMOA 2C5DC 2EE9A 5AAMA 3BHBA 1DFBL 3LRSB 2A73B 4G9FE 3QG7H 5C0CB 1AFVL 3D6GA 2FATH 4Y4KC 4HEME 3I6GA 4Q9QL 4YHNB 2AJXL 2AJ3A 5EU4B 3SPVB 1PKQB 2WV3A 4E41D 3VXOA 5EA0L 3CZFB 5IESH 2CRMA 2PR4H 3BQUB 5JPMA 4P4KB 4LHUA 3WJLC 1KN4L 2FJHA 1U91B 5I1KH 3VXNA 4Y5VC 1AO7B 2ZNWA 3DMMB 1T80A 4QRRD 1A1OB 4C56B 3C09C 1BQUA 1FJ1B 3KPSA 1ZS8A 4YIQA 4F37F 4ZUSA 3QEQE 3UTSA 4JJ5A 5CHNB 4BKLA 4GW1B 1OTTD 1JV5A 5D1ZA 4LLAA 3U4EB 1KPRB 4ZTPL 3CMOH 1A21A 2X7LB 1BHGA 1A4KA 3PNWB 3D48R 3KXFB 4LASL 4U1IB 4NKDA 1A9EA 3VFUB 5I19H 4OIIL 1VFOA 4Z9KB 3WNNA 1YEDA 1G6RA 3QUXD 1KEMH 3GUTA 1DBMH 1RJLB 4XWOD 3C60D 3HMXH 4IJ3C 4GQ9L 2O61B 1INEH 1WIPA 1YN6B 1D5ZB 4FQ2L 4Z5RB 4EDXA 4XBEH 2H9GA 1YNKH 5ISZA 5FAAA 3TBVA 4APQD 3GMRA 5IIEB 2VLRA 4NN6C 1G7JB 4KQ4L 5D1QD 3RL1B 4JANB 3L5WA 1MFCH 1FG9C 4GBXB 3ZTNH 3GKZA 3TBTA 1NCDL 1KTKE 2UZXB 2W0LA 5MEOB 3IDIA 4M6OL 3WFDL 5EWIL 4HKXB 3STZA 2X4TA 4FQXA 3UDWA 3S4SA 2BX5A 2DDQL 2G5RA 3T0EA 4LEXH 2FX9L 5EO0B 5LAXB 4YPGA 4P2YA 5JHLH 4MX7B 2XZAL 3QEHA 4YXKH 4CMHC 3DYPA 4XPTH 2R69H 4FG6D 2VXVL 4LLWA 4MQXD 4WHTA 1U0QA 4NKMB 5TF1L 2M1KA 1KPVA 2EYTA 3GFUA 4JHBA 5FA4A 4TSCH 2P47B 4Y1AB 4X9HA 4KPHL 3QJFB 4XCCH 1RJYB 2F5BL 4MDJA 5F3HB 5KVGL 4JY5H 2DYPD 2MPAL 4HWEL 4NQDE 1LGVA 2BDNH 1SBSH 3QDJA 4J4PC 1NCCL 3C08H 3DHJA 3FT4B 3W2DH 4ODVL 2B1HH 2E7LC 4X7SH 2QQLH 3L5HA 4CRPA 2NPLX 4PBVC 4Z7UE 1AC0A 4HC1L 4KHTH 4XRCB 5MENE 3MLZH 4FFYL 3QDGD 3VCLA 2R8SH 1S7XB 4FQJL 1JZ6A 2D9QB 3L3OA 1NBZA 4NZUH 3CVHA 4BH7A 3OXSA 1VEMA 1RFDH 3EYFB 1MIEL 5F71A 4IRJA 3MCG1 1WAAA 3BGMA 2R56H 4D0DA 2NY2B 2P5WE 5LJYH 4K3HA 1RZKH 1TJGH 3VXRD 5D2NB 1II4E 1TETL 1X4XA 2Y7QA 4PGJA 4RWYL 4U7MA 4AL8L 4L3ED 1FFOB 2I07B 2X70A 4MA8L 1ZHKB 4KRPC 4NQTA 1BFVL 4NQVB 1AGBB 3WIHL 3DSFL 3QHFL 4F9PA 4P5TA 4I4WA 1XGUA 4OM1H 4WI3A 2GUOB 5E24E 2VN4A 3MCKB 3HZKB 5C9JB 1JYWA 5H35A 1HOCB 3BDYH 4BH8A 1HI6B 3IS1X 3QXDB 4PB9H 3P30L 3VA2C 5MERA 3PXJA 2YXMA 3ZE2F 2V9TA 1TLKA 1BGXL 1KT2A 1A9BB 4UIMB 4S11A 1T7VA 2F5AH 2P4AB 4LEOB 2D7PA 3EYVB 4NJ9H 1GOHA 1D5IH 3MGTB 4GW5B 5HVFB 5KJRL 4EN3B 3FO1A 3U7YL 5ANMB 1NCWL 1I85A 1BQSA 4U1HA 3QG6A 3BE1L 4LCCA 1CL7I 2FYYA 2HTKC 1W72A 4PJIE 4X4YA 1OTSD 1SM3H 5JXED 2XZQL 3RL2B 1IAOB 1YUHA 5FDWA 4LSRH 1J8KA 3RQ3A 3MX0A 3P0YL 1G9ML 4Q58C 4ONHB 1S7SB 3T0BA 3ULUC 3MA9H 1EAPB 3PIQB 4MGXA 3N85H 3SKJH 1IMHC 3AB0C 1MH5A 1BIHA 2FHBA 2B5IC 5FGCE 3F7PC 4L8DB 4PRPB 2FHCA 2CRZA 2NW2A 3HE6B 4WWKA 3DYMA 1MCNA 3WFHB 5BRZA 1P7QD 4JJHA 1DQML 3C2AH 1W0VB 2VDMH 4IOFD 1UH4A 4M1GL 4Z7VE 5F9WB 4NNYA 4HUUB 1FNSH 2HKHL 1QSFA 5DHXB 5K59E 4U1LB 3QULA 4O51B 2HFGH 2K9UA 4Y2DA 1NDGB 2AAVA 1HH6B 2FGZA 3QI9B 5E2WH 1BX2A 1T6WA 1A1NA 4DGIH 1FNAA 1X5JA 3VD9A 1I1FA 4KDVA 1OCWL 4HZLB 3MZTA 5MHSE 2IQ9H 4KJPD 1O7SA 4FQQA 3BSZL 4J6RH 1DN0A 1W0WA 2GT9B 4K7PX 3NCJH 1QBLL 4ELMA 1NBQA 4KZDH 3RWIB 3QDMA 1ZGLM 2ERJB 2O5ZH 2GY5A 1ND0A 1RQ5A 1R3HA 4K8RL 1BWMA 3LZFH 3O6LH 5I6XB 1KLUA 4BZ2L 4UMGA 4YO0A 5FGRA 1CLZL 2Y36L 3AXLB 3G5VA 4PJBE 4P3WA 2XIDA 1ZHBB 1RD6A 5FHAH 2GJZB 3DV6B 3VGEA 4OLXH 4M02A 1T20A 1MHHB 5L0QC 3MUJA 3IVKB 3LAFA 5GJSL 5F7HA 4PJGA 4LU5L 1IGML 2V6HA 4P5KA 3CUPB 1ZVSB 1AY1H 2Z31A 5EBWB 3RWEB 3L3KA 4NOFA 1I8KB 1RULH 4EOWH 1OTUD 4R4BB 4ZFFA 4MLSA 4OZHB 1MWAL 1BAFH 5F7LB 2YPLB 1W8OA 4HF5L 3RVXC 4HJJH 1GL4B 2LV4A 3RGVC 1JYXA 2FL5B 3B6SB 3U36B 3LKNB 2XXMB 5IGXL 5HBBA 5F8RC 5C0BB 4NQSB 3FT2A 5E8PB 2PCPB 3ULVH 2WLYA 4HXAH 5J12C 1ONQB 2VUYA 1KB9J 3G08A 3EOBA 2Z91B 3MBEB 5L6YL 5KAQF 1KLGB 4Z95H 1UXWB 4LF3B 1IGYB 1MPAH 2DWDB 2Y06L 4KV5E 1S7UB 3IJYA 4KKCC 1Q9KA 1JPST 4PTTA 8CGTA 3MV9B 4XVTH 5DUBB 3VFPB 5CEZD 5DUMH 4NHCH 4YHOL 4XP9H 1WWBX 3MRNB 3W0WA 15C8H 4HUVA 3L3HA 5IWLC 4OCWH 4GRLC 1XGQB 4M1CD 3JTSB 1IAKB 4NT6A 4HS8H 2NZ9D 1G0XA 5T1KB 5JOPE 1AQDA 2JE8A 5L2JB 5L2KB 3HUJB 2AP2A 5E5MA 4BK5A 5DRWB 3F12A 2BVQA 1XIWB 1QSEE 35C8L 3A6CH 5HGHA 4HCRL 1WC7A 5DXWA 3BPNC 2KDGA 2HN7A 2VZ1A 4WUUA 5E1HB 5BVJA 5EIIA 1R3LA 1U8LA 1CBVH 3PWUB 2W9DL 2AJYL 4M1DL 5JIPA 1MQKH 1G9NL 4XMKH 3CD4A 5FYJE 2AJZA 1ORSB 1K5NB 4PJ9A 5A16A 3GMOA 4PRDB 4KMLB 3U0TA 1NEUA 1EVTC 1F6AA 1PY9A 2JJTA 4WU5B 4QTIH 5JQ6H 1GC1H 1PSKH 4GUPB 5E7FA 2QHLA 1GH7A 3GGWB 2IEPA 1BOGB 3OB0K 3O6KH 3TCLA 4EXKA 5BZWA 1P4LA 2MCG1 1ED3A 1FLRH 5F6IC 3WN5B 3HC4L 4PP2A 5ENWB 4PJ8A 4ZS6D 5E6IB 3ZT7A 4OKDA 2VL5B 3ARED 2G5BA 4P5MB 4JZOB 5C0GA 3BIBX 2XOTA 1NANI 2WUBH 5CILH 3TIDA 3RBGA 4ACPA 2NY7L 2XY1A 5DC0A 4GFTB 4TQEL 3CFEA 5D5MB 2V17H 3C5SB 3FFCD 3KPMB 5A40E 1J8HE 1KXTB 4LCIL 4Y5YA 4L4VA 4ZUUA 3D2UB 1IAMA 4IS6B 4JDTH 1M7XA 2YC1A 3Q6GH 3KYAA 3TV3L 1NUFA 3U9UA 3O2WH 3LD8B 5FYKE 4NN7B 1E4KC 5SWZB 5BV7L 4U1NB 5JOFA 4U6XA 1UQSB 3WYRA 1ZT1B 4YR6A 2DTMH 5AYUL 3OQ3B 2VLKE 1UM5L 2F8XC 2W9LA 1JHTB 4JHZA 5D7IB 2PUQT 5HPMA 5L9DL 2AK4B 5KANG 5I76A 3BH9A 4LDLB 3O4LD 3FHAA 3QEGH 4ODTH 4KUZL 5J4MA 4HG4J 1IBGL 3VWJB 5IQ9B 3HI6L 3GMPA 1FIGL 4FXGA 4UINL 1RAMA 1GGUA 5HHOB 1FYTE 3HNSL 3HC3L 3EYQD 1V05A 5H2BB 1KJ2A 4PREB 1BM3H 2RBLA 4P57A 3T1FA 4Y4FD 3BAEH 3D85D 4DCQA 3MGAA 1Q72H 4G6KL 1FFRA 4Y2OA 2V2WB 4YWGH 5C07A 3F7YA 4DUXA 2XPGB 1QFHA 5IR1A 3OF6A 3VD3A 4YAQB 3IFOB 4K71C 5E2JA 2KBGA 4U6HB 1AKJD 4PJDA 5FGBC 5SX4I 1HXYB 4GKNB 2BHYA 2DMKA 1JZ5A 2A1WL 1RIHH 3TNNA 2OM5A 2HJFB 2VZSA 4PJ7A 4R4ND 4MSWA 1RVFH 4YDJA 1NUNB 4G6AD 1NC2B 4H20H 2V2TA 1MEXH 4HQQL 2QSCH 5HHMD 5JPNB 1YJDL 1J0KA 1MF2H 3ALPA 3TYFA 2PYEA 5FO9A 2NY1B 3KYKH 4D8PB 3VGBA 1GZPA 3LKRB 4JFHD 4Y4KD 5GRUL 4ZFZA 2R1WB 4YHYC 4LSSH 1ZGLB 4YE4H 5I18L 4G9FD 3RNQA 3ZE2E 2VTFA 3NGBB 1MFBH 3NOIA 4IRSA 5DDHA 1O0VA 1SJHA 5JDSA 4BFGA 1Q9OA 5D2LB 5F7UA 4I2XA 3P4MA 4JVWA 5I16A 1L7IL 1RZFH 1WGOA 2D3VA 2ESVB 1EEUA 5CGYC 4M93C 5TDOB 2B4CC 4FQCH 4YQXH 2BVPA 1AI1L 1IAIH 4RNRB 2A77L 1VGKB 1FVDA 1FNFA 2E6PA 1JIBA 4FQHB 3UZVB 4YDLB 1OGAA 3U79A 4JO4H 2BNRB 3HAEH 3EGSA 3QA3B 4Y4HB 4JO3L 5LBSL 4NBZB 2X9YA 3QEQD 4XNZB 1F11B 3MUZ1 1VACA 2QSQA 4K3GA 5D7KE 5JO5A 2BSSB 4WW2F 3SGEH 1QR1B 4JRYA 5GS0C 4QO1A 1V8HA 3SKOB 3KLAA 3I02B 3ROLB 5DFTA 1FL3A 4FXKB 3QH3A 3LRSA 2CLZA 3BPCB 4LRNL 1I7ZB 1AXSB 3LIZH 1JE6A 1UM6L 2E3VA 4HFUH 1JHLL 2HLFD 1DVFD 4MMXC 5GRWA 2RGSA 4YHNA 2BNUB 2MWCA 3SPVA 1EMTH 4XCEB 1PKQA 1VPOL 2NCMA 1BVKA 2PXYC 5HYFA 2F54B 3BZ4B 3RVUD 3C6SB 3TA3A 2X44D 3CXDH 1BBJA 2DQFB 4XAWL 5IB4A 3VRLF 5IEKA 2XZCL 3MOAL 5BW7A 1JGLH 3LRHA 2DBLL 2Q7NA 4JO1H 1AO7A 1DN2A 3H3PH 2QQNL 1UT9A 4M48L 1QLEL 5HYQB 5C6PB 2CLVA 5BVPL 4V2BA 1S9VA 4NWUL 4ZDHB 1T1XA 2NY5H 4S0TD 3OXRB 2BNQE 4AIZA 2X7LA 2E7BA 1G7IB 3T09A 2C9AA 3QEUB 4NQEA 5FF6A 1Q0YL 4WCYL 3LQZB 1AIFB 1HCVA 4PP1C 4U1IA 4WRLA 3QIBB 3B3IB 5KAQG 1CGTA 5C7XL 4WEUD 3KYOB 2Z4QB 4IRZH 3V6FA 1S5IL 4K94H 2EC8A 4QRTB 1RJLA 1VFMA 5CMAB 5L8KB 3NIDF 2CKNA 4JFEE 1KLFA 1UACH 1HZHL 1YZZA 4JPVL 4NQDD 3UTSE 3PP4L 5IB2A 2X1OA 2YPKB 4XNUH 5DQDL 4LVHC 5D7LD 3P0VL 1EJOH 4PJAA 4Q2ZB 4H88L 5DRZB 1KPUB 1YDPB 3GSQA 5LKNA 3MPCA 3BXNB 2GSIB 1Z9SA 4OZFB 5MEND 1H3GA 2D4FA 5D1ZC 4KH2A 1MRCL 1WWAX 3NH7L 3TVMA 3QUMB 1F13A 2PO6B 1MCHA 1TJIH 1WT5A 1IEBA 1S5HB 3O81A 3PJSB 1GVIA 1ZHLB 4GAGL 4XVSL 4XH2A 4ZPTB 5J1TC 3NFPB 3WFEH 1O5DT 1BVLA 3DYOA 3LS5H 2ZKHH 5GGTA 1QLFB 4KROB 5ADOL 4LSUH 2EDBA 4HS3B 4KRPD 2R4RH 2EH7L 2ZG1A 5CIPB 5CZVH 2P5WD 1G0YR 1TVHB 5BMFH 3MNWB 3RX5A 4MZ2A 3UYRH 3TZVB 1IKFH 3NPZB 4HJGB 4H1LG 1EHNA 5C09A 3DO7A 3S96A 1PAMA 5GGUB 4R90L 5GS1B 3OKLA 4LSPL 4X6FA 2O93L 1CU4H 2WQ8A 4OJFH 1F4WH 3I75B 3ECBA 4FQXC 3UDWC 4QXTB 4EQ3A 3WLBB 5CZKA 5DD3H 5T1MB 3T0EC 2Y4SA 5C08D 4L8CB 4HV8B 3VXPB 4BSVB 1I8IA 3F7VA 2NY0B 1G0DA 3QAZC 4F7MB 2HTKD 2D0GA 1LDPH 4YK4B 3T8XA 3MLSH 4OCRL 4PG9B 3O3EB 4OZIF 4FQPA 5IB3A 4P46A 5JUEH 5IW6A 1FNLA 4F57H 4QRUA 4M3KB 4OFYD 4MAYB 1G7MB 3ARDB 3VRIB 4IIQB 4MD0A 4OLZL 3FO2B 3ULUD 5GGQH 1S8DA 2VLME 1NDMB 4CADA 5A2LH 4OZFH 3HZVA 3MV7E 1FZOA 2W9EH 3NTCL 3R06B 1FL5A 3WSQH 3GHEH 3S9DB 3CDGB 1I1AA 4ZO7A 3QUMH 3QUYD 3W5MA 5ICXA 4NQVA 4OF8A 4F33B 4K3DH 4MZ3A 5J13B 1EHXA 4J1UB 4ZMAT 4Z7QF 4X7EC 1ADQL 1LEKA 4Y7MA 1OAKL 3FB5A 3GM0A 3VFRB 3RU8H 3ZO0A 1ZGLP 3MCKA 5DJDA 1HOCA 3QQ4B 3QXDA 1AD9B 3GZKA 3WKMH 3ZKQD 3ULUL 1TVBB 5CIPH 3DOSA 4QRRB 3V0AC 1FP5A 1KELL 5JW4Q 4XNYH 1KB9K 1WTLA 1A9BA 1ZA3B 4U1JB 2GAZB 3UPRB 4PRBA 3MA7B 3FRUB 1I3GL 3R4DA 4IRJC 3CU1A 5C6TH 3MGTA 3U82B 5ESAA 4YXLL 4I77H 4YHPB 4M7JH 1H3PL 4MXVF 3KVQA 5TQ2H 1YEFH 2P8MA 3B9KD 4F8TA 3WDHA 2E9WA 2WM0A 4LLYB 4HX1B 5HD8C 5KTEH 1MHEA 4KVNL 5DR5H 3I3BA 3I9GH 1DFBH 3U4AA 1JZ2A 1H3WM 5E9DA 4PPTA 2OBGA 5T3ZE 3RKPA 4F9PC 3QUXB 3PWPA 2HFEB 1AFVH 4OCSL 4ONHA 5DA4A 1S7SA 2RQ8A 4F7EB 2AJXH 4P3DA 1PQZA 5D1XA 2IPKB 5EOTA 1RZ7L 2VITB 3PL6A 5IFAL 5EA0H 5ITBL 1CDJA 1FL6B 4APQB 2GJ6E 3IXAB 4KK9C 1KN4H 1VADA 5D1QB 1MCBA 4QXUL 4PR5B 4QRQB 3CH1A 3WXWL 4TUKH 1YMME 3AROA 4NC2B 2YHGA 5CP3A 1T03L 4UI2A 4XTRC 1I85C 3HRZA 1E6OH 2IC2A 2YEZB 4LCCC 5ESVA 2JIXD 3RGVD 1CFNB 5F9JB 1A2YA 3BKYL 5IF0A 1RZ8B 1K9TA 2F53E 2AVGA 2YD5A 3RDTB 4P2RA 5HSFA 3PABB 5DHVH 1C5DA 1FPTH 4OIAA 3OKOA 4O02L 1RZJC 1EUUA 5CCKH 5BRZE 1PG7L 2ZCHL 1SVZA 4AH2B 4MNQD 5IM7A 3X13A 1K4DA 4KK5D 2DJSA 3RWIA 2DYPB 4WWKC 3LV3B 3AU1B 1Q1JL 3RVWC 1CE6A 2EKSB 4NCDA 3RVVD 1J1XL 1CFTB 4RFNB 2RR3A 4F7PA 3AXLA 3IU4L 1GGBL 2Y6SD 4KGLA 5EO9B 4RRPG 3M8OL 3IGAB 3MJ8B 4ZUTA 4XP1H 4NBXB 2AERT 4M7KL 1NCDH 2A6KA 4UQ3B 2KKQA 4Y2DC 4M6OH 4OGYL 5EWIH 3WFDH 4KC3B 1H15B 2IALA 3NN8A 2ADFH 1JRHL 4J8RB 4BJLA 3ARZA 5DQ9A 5JOPD 3VD4A 1D5MA 5EBWA 3CVIL 3EFFB 3S37L 3I2CL 3RWEA 2FX9H 3QQ3B 3A0OA 1JGDB 2XZAH 3G6JA 1QSED 2VXVH 3F58H 1F4HA 4XAKD 4PJFA 1EAJA 2B0SL 5IG7B 3IRPX 2Q76B 3ZE0E 1HKLL 4OFPA 5TF1H 5H37H 3H9ZA 1NL0L 2OJZH 1X9QA 3MRRA 3MXVL 3D0VB 2HH0L 1ZLVK 4Z78A 4YHIA 4XPHL 4RSVA 4PRIE 3FAXA 2F5BH 5KVGH 2C3VB 2X4SA 5BO1L 5FYJD 3X17A 1KUMA 3KPRD 4LAJH 4QTHB 1HN1A 2V2XB 1H3XA 3SO5A 1NCCH 4CBPA 2ZUSA 2IANE 2IH3B 1H0DB 3VFPA 2E8YA 4HBQA 1EPFA 3LN4B 1HHIB 4ERSL 2Z31C 4FFYH 1XGQA 3DGGB 1OP9A 3JTSA 3IAQA 4FQJH 3BN3B 2EZ0C 1KJVB 3O3AA 5L2KA 1FAKT 5L2JA 3HUJA 1RY7B 1FRGL 3BKML 3DO3A 3VRLE 5HI5D 4LP4A 5DRWA 1XIWA 3EW3B 1HDMB 1FO0L 1AC6A 3WEXB 3MROB 5D71L 4OFKA 1TETH 1J0YA 1DL7H 4I0PB 4AL8H 3QZWA 3BZDA 4WJ5A 3EOAB 5EU6E 4MA8H 3C6LA 1BFVH 3BH8A 3GSXB 2XKSA 2Q86A 3KPQB 6FABL 3UYPA 4U7KA 3GSOB 2ADIA 3QHFH 1ZHNA 4ELKA 3EFDL 1OAYL 2VLKD 2WBWB 2I5YL 1A14L 4XB8A 3OR7B 2IADB 2C1OA 4NQCE 3TP4A 4M6AA 4DKEL 5E1AA 3GGWA 1BOGA 1CGWA 3E3QC 3L3DA 4G6FB 5I9QB 5HVHC 3R8BB 1KIRA 1Z9MA 3EZ8A 3LQMA 2BOBB 3P30H 5DJ6B 4AM0A 5JW4R 3O3BA 5ENWA 5BOPA 4NZRL 3NIDE 1BGXH 4UDUA 1RZIB 5DO2C 5T1LA 4R0LA 3JV5A 4JZOA 4N9GA 3EJZD 3RWGB 5INCB 1FYTD 4OCYL 2Q8AH 3TNMA 3U7YH 2C3WA 3BE1H 3DGCR 5HY9B 2YD1A 3FAWA 3DLQR 5JA9A 5CJBA 2XZQH 3C5SA 1T7ZA 5LXGH 5D4QA 2R23B 5I74C 5CSZA 3D2UA 3KR3L 4IS6A 1FNEB 1U8OB 3HG1B 2AK1L 2FDBP 2NLJB 1N8ZB 3P0YH 2JJTC 1G9MH 2Z8WC 4YHZL 1F6FB 4QHKI 1QBBA 1H5BA 4LVOC 2UY6A 2YN3A 1MWAB 2VJXA 4R26L 1JHTA 4PJ8C 1XF4B 1MQ8A 2MFNA 3VI4E 1QHOA 4OV5B 4WI2A 2AI0H 3MRQB 1OP5K 1DQMH 4G42B 3NZ8B 4QRPB 3T4YA 3VWJA 4ZFGL 2HA1A 4M1GH 3BP6B 5J11C 4QHMA 3WL9B 3U7AA 5BQ7A 2IH1B 2HKHH 3LSOA 3KNBA 3SDXA 5DJXB 1MCEA 5H2BA 2R0LL 4Y5YC 3SQOL 4OF7A 2CKBL 4ZNEA 4XPBL 4ZFOA 1Z0NA 4LSQH 5LG1A 1BIIB 4LPXA 1OCWH 2BY3A 3VFOB 2FBJL 3BSZH 2XPGA 3D3VE 2EKJA 5E8OB 3P9LB 5I71C 3TPUB 5HYJA 3WNMA 5J9PB 4U6HA 4OZIE 3LDBC 1HXYA 3B9VA 4FHBD 1FFNA 4O2CA 1CD1B 2JTDA 5D9SB 1XGYL 2QLVB 4LFHD 4Z7WF 3ARFC 3P73B 5T3XL 2Y36H 1FZKA 3SCMD 2ZCLL 3MMEB 1HQ4A 5I1EL 3U46B 4B53A 3QCUH 2B4CL 3REWB 3ULVF 5AEAA 3I3EA 1E4XI 5GJSH 4LU5H 1U8JA 1IGMH 1RUML 2DL9A 4PJDE 1EO7A 3G04A 1QP1A 4HUNB 4Z7QE 3LKRA 2KZ1B 4CNIA 3UJTL 2R1WA 4Y19A 2J8OA 1MWAH 3HC0B 3MRBA 1ZGLA 2E7CA 2P42B 3QJHA 3ZHLA 1N2RB 2V9RA 4DK3A 3V2AR 1U93B 1TFHA 3OAUL 2ZUQC 5IGXH 5L8JB 1MCOH 5F93C 5GS0L 4DGYH 1TTFA 2EXYC 5D2LA 3ZYZA 4Z77B 4MXVE 5L6YH 2PYEE 1SEBA 4P23B 1ITCA 4LRIA 2Y06H 1HKFA 4RGOH 2K7QA 1YEKL 3E8UH 1JNJA 4ODWB 1VGKA 3V6BR 1B9ZA 2ITCA 4E0RA 1CXEA 4JRXA 2BY2A 4KFZC 3S88L 1Q9LA 1BD2B 4UV4L 4YHOH 2VSDA 4QHLB 4U6TA 3UTZA 3WFCL 1X5LA 4WGWB 4JLRA 2OTWB 1YY8A 1M05B 2EE3A 2YA2A 5FM5O 2EDKA 5BV7B 1E28B 1KC5L 1S7QB 2BSSA 4I2XE 2C4FT 1ZLSL 1A3QA 4E42A 3SKOA 2DQDL 3BPOB 4IRSC 2GSGA 4LHUD 4M5YL 4OZHF 2NXZC 3ROLA 5JIIA 4I13B 3PF2A 1PYWB 1YPZB 3KPNA 5F1NB 1CGSL 35C8H 1MFEL 2VDNL 4RMWA 4RFEA 4LHJB 3TN0D 4WI8A 1JI1A 4TTGA 1FZJB 4QHKJ 4JFED 4XHQA 3C9NA 3KPSD 2W9DH 5DK0B 2AJYH 4M1DH 3UTSD 1G9NH 1NMCC 4JY6B 2QQKL 5CKGA 4S0SD 1RMFL 2DQFA 1GZQB 4WDIB 4C57C 5JXAL 4P2OD 3VXSA 4RGNC 1EEYB 3QIUA 3AC0A 1TENA 3DX8A 5JHDA 2J4WL 2YRPA 1NLBH 4DEPB 3THML 3G5ZB 2L7UA 4C83A 4NBYB 1ZA6A 2HRPH 5C0CE 2ICWB 4FN0A 3BP4B 4WEMB 3FO0L 3AM8C 1R0AL 2XTLA 2EYSA 2J3SA 1MCWM 3OXRA 1PKQE 1FGVH 1MCFA 5SWQA 1G7IA 1CE1H 1QR4A 3JV4B 3QEUA 3ULSA 3E6HA 5CJOL 4CN1A 3LQZA 2WIIB 1ZVYA 2NY7H 4OM0H 4TQEH 5I75C 3PWNB 4F37K 1QOKA 1AO7E 3KYOA 3N9GL 4OKVB 4LCIH 5CMAA 3TA3C 4C56E 2WAHA 1G6RL 2DBJA 3V4VL 1OGTA 3KHQA 4JPIB 3TV3H 1AKJB 5BW7C 4NPYA 3ZKXC 2A9MH 2OP4H 3T0ED 4QF1B 5BV7H 2VB5A 4L8SB 1GRWA 2UVEA 3T3PF 3UC0L 3DV4B 5AYUH 3FQXB 3IKKA 1UM5H 3VMNA 1KPUA 2R2HB 2QJDA 5L9DH 5FA3B 5EUOA 3UJIL 3KXFE 4NSKA 4XNXH 2EDJA 1KCRL 3RZCC 2C4FU 2W65B 4KUZH 3B4NA 2ORBL 4K7PY 1IBGH 1UVQB 3HI6H 5DMGC 1FIGH 3TH3T 5ICZB 4UINH 1XF2B 2BXZA 5B39A 1ORQB 4X4XA 3EO9L 3I3DA 3QDJD 1QFWH 2VNCA 4PGCB 1QLFA 5AG9A 1MNUL 4HS3A 4RRPA 1WFUA 2VLMD 1F4YL 4NHUA 4P2QA 2ZUUA 2NW3B 4PY7B 1LNUA 3MNWA 5D5MF 4GKZB 4G6KH 3ARQA 2HYMA 2D31A 1MREL 3R1GL 3NZHH 4Q0XH 3TZVA 2DB8A 3ARGD 1VENA 4YHML 1NAKL 3L95A 1R24A 4HJGA 4LAQH 3QNXB 5HGDA 2P8LB 4Y5VB 2R0ZL 4POYA 2YD6A 4ORGB 2M8XA 2JB5L 5DT1H 3C09B 1YNLL 1A47A 3H6JA 5D96C 2VZ3A 1JNLL 2R0WL 3TVMC 3VMOA 3FT3B 3H3KA 4IRJD 2CPCA 1JGVL 3KPPA 3O45B 4YEEA 1WT5C 1UWEH 3I50L 5D7IF 1QFPA 1OQOA 2W91A 4BSVA 3O41B 1UB6A 5HD8D 4Y1AE 4HQQH 5IOPB 2CXGA 1KCKA 5EZLA 4I5BB 2LU3A 2J6EH 4RIRB 3CVHL 4UU9B 5EU7E 2G75A 4P5TD 3MO1B 4EUPB 2D7MA 4IJ3B 3VRIA 4IIQA 4Q9RL 4ZO8A 3FO2A 1FVEB 3VH8A 4PRNB 1NH6A 2AXFA 3LRGA 5I18H 5T3ZD 43CAA 1RU9L 3R06A 2UYLB 4X6DA 3IDJB 3BWUC 4HD9A 1CLYL 1IGJB 4KK9D 1XCTA 4GJTB 5I2IB 4NO3A 3IB4A 5I1CL 4WTWA 1JNHA 5CBEB 4MJIB 4MMZC 2PTTA 2EDWA 1KJ3L 4H0HB 4ODXB 2GJ6D 5DS8B 1QACA 1JGUH 2YA0A 3PE9A 2V7NA 2A77H 4POZD 1AD9A 1KTDB 1TVBA 4KMQA 3VWKA 4LL9A 7FABH 1YMMD 4OBSA 4OB5L 5DRXB 4P46C 5D2NE 5FECA 1ZA3A 4CMHB 3UPRA 5LBSH 5DI8B 3RVTD 4GW4A 2XXCB 2FD6L 4X83A 1FFPA 4CMMB 4ZXBA 2NY2C 4HZAA 1X5XA 2P1YA 4OD1L 1JZ7A 4UTAL 4LOUD 5LCVL 4M7ZC 1NCUA 4HX1A 1I1AC 4WWKD 5DRNB 3RVWD 4XGZB 3K46A 2EE6A 3C5ZD 4K2UL 4L4TA 4LRNH 1UM6H 5BRZD 3BVNB 2P8PB 1JHLH 3QUZA 5CGTA 5E8EA 2CD0A 3BI9X 1R3KA 2EICA 2N7BA 4HJ0C 1TJHL 4RX4A 3D69B 5DJ0A 5F72S 4XCNA 2IPKA 1VPOH 3BJLA 5E4EC 2CDFB 1RZJL 3VRJA 4YHLL 1DQQB 5ANME 3BKCL 4OCNC 5D7LB 4ENEC 4Y2DD 4MA1C 4I0CC 4GG6A 3HMWH 4J3XA 4EUPH 4O9HH 2XZCH 2CDEB 4H25B 2ZUTA 2DBLH 1RZGB 4P2CG 2OLDA 2QQNH 4M48H 1QLEH 1PY4A 2HRLA 1BF8A 2FWOB 5FO8B 4WNQA 3OKEA 5BVPH 4NWUH 4FZ8L 2CDGA 2E27L 2JCCA 1ZTXL 3GO1L 3T3MF 1TZHA 3EJYD 1IM9D 1Q0YH 5F7WC 4WCYH 1KG0B 4PRPE 1CICA 4OQTH 2OR9L 4KTEL 5D1XC 3GSWB 1PKOA 3PL6C 2I9TB 5C7XH 4CN6A 2W38A 4PRHB 4TSAH 3ULVE 3AAZB 1S5IH 4X9FA 4PRID 1LO4H 4QT5B 3OJ2C 2ZWLT 3LV3A 3AU1A 5CEYB 1LE5B 4LMQI 2VWEE 4JPVH 1IC7L 3PP4H 1S9WA 3QT2A 2Z31D 2Y9RT 1C1EH 3X3FL 1CFTA 3CDFA 5DQDH 4XXCA 3HE7A 3P0VH 1GHFL 4KRLB 4H88H 3U0PB 2VL4A 3CFBA 2GI7A 4M8QB 3RWDA 2EZ0D 3BJ91 5C08B 4A6YH 2O5YL 5HGBB 5EFIB 3HN3A 3NH7H 2VLJA 5DEFB 5IVZA 5C0FB 1A6WL 4J8RA 3WIHA 3LPFA 5EC1A 4ONFH 1UWXK 3RIFF 4XHJC 4GAGH 4XVSH 3CC5A 4G80A 1JGDA 5JMOC 3KAAA 5MP6L 1P1ZB 5E94A 3K2UL 5DC4B 2EH7H 4AIXA 2NTFB 1MFAH 3W0WD 3AB0B 2A2QT 1AGDA 1CL7L 1S7WA 2B5IB 3PWLA 5FYJU 4PGBB 1I9IL 5EU6D 5I66A 1PFCA 2C3VA 2XKUA 3ZT6A 1DDHB 4AEIL 2AEPL 1SVCP 1HILB 5C92A 5M95B 3TH4T 3W5NA 1OSPL 2W92A 2V2XA 2QR0B 1OF2B 2CRIA 1NJ9B 4NQCD 4OZHE 2D7TH 4R90H 4LSPH 1H0DA 2YPLE 1T3FB 2RCSL 2F19H 5ICYA 3NA9L 3DX7A 4DZ8A 3IFLL 4EEEA 1P7HL 1IM3A 2XN9A 3DBXB 2P49B 2A83A 4ORZC 3QSKB 4PJHB 5C0BE 3PQYB 2C26A 4GLRI 3OGCA 1ITBB 1SJEB 4MCYA 4NNPL 3MOBL 4D0BA 4X0KB 4PJ9D 5LQBL 4O4YL 1A3RL 4MJ6A 3SGJC 1S7RB 5HYIA 1JWMA 5AD0B 3MV9E 1QYGL 4MB3A 4UOW0 2N7AA 3WEXA 3MROA 4ZAKB 3VXTB 1TCRB 5FYKU 2LU4A 4GH7B 1R3IH 4KAQL 2H6PB 2AKRB 3AFLA 4I0PA 5LWYL 4PJ8D 1K6QL 1F2XK 4EI5C 3EO1A 3IDYC 2AXGB 1S7TA 3KPQA 1OP5H 3QNZB 3VD7A 1A02N 2JJVA 5FOBA 1CLCA 4WHYH 5L0QB 1CR9L 2IADA 5L2KE 3HUJE 3BEVB 1KBGL 3F5WA 2IQAA 3ULUH 1F3JB 3FB6B 1I9JL 1U8KA 2OSLA 5DK3A 1KELH 1MCKA 4L4VD 1NGQL 4N9OB 5IW1B 3FCTA 1IVLA 1I3GH 2R0KL 1XIWC 3SJVA 3RWGA 1EEZB 3MLRL 2Q7YB 2AV7B 2FLBT 2GY7B 2OR8A 3CFDB 5AUMA 4R3SB 3MODL 4CU7A 3ALXA 1ETZB 1I3RA 5J12B 2FGWL 4JFPA 4KVNH 5IMMB 4CVUA 5CINL 3C6LC 3CLEL 1G9EA 3F7RA 3K74B 5D93C 4JFXA 1FNEA 3HG1A 4O2EB 4MNQB 1N8ZA 5EZIL 1S78C 2KPNA 4PB0L 3GIZL 4UNTA 1EXUB 4MA3B 2VXSH 4GRLB 3HNTL 4MCZA 5SV3A 5IFAH 4N0RA 3HZMB 4R96B 4G8GB 1XF4A 4JHAL 2HTLC 1KGCE 4FFVD 4R0LC 4I18A 3DNKA 4QXUH 4U2YA 5D5ME 3WXWH 3WDJA 5C07D 2X4OA 4RMQA 4NOBA 5F7FA 5I1GL 4CU8A 4G42A 3NZ8A 4U0QB 1J0HA 1U2HA 2VXQL 2D4DA 5IVXA 2H2PC 2NY6B 3BKYH 3HLAB 3BPNB 3FRPA 5SWZE 3D39B 1ZT4B 3SGDI 3HAEG 4FQLL 3MUHL 1KJ2L 4XPGL 1GGIL 3DIFB 1QTYT 1LE9A 5AAWA 4HKZB 5GGSA 1DR9A 1MHCB 4K7PL 5D7IE 1QBAA 2AK4E 3VFOA 5J8OA 5F7DB 2OZ4A 4Z18A 2YZ1A 3RA7L 4LBEB 5HVWA 1H5BC 1BJ1H 5TH2B 3P9LA 2ZCHH 3MRMA 2MCPL 5J9PA 4DK6A 1CTOA 4AYFA 4DAGL 4WI5A 5F6IB 2PYED 4QXWA 3KPRB 1NFIA 3F6IA 5HHOE 2PNDA 4HWBH 1BPVA 2ZOLA 3IETB 1J1XH 3V8OA 2SEBA 1T21A 2A6IA 4N90D 3IU4H 1GGBH 1FO0B 4HCRA 3M8OH 3HRPA 5T5NF 2WW8A 1ZSDB 3SDYL 4ODUB 3Q1SL 4WI4A 1CYGA 3U46A 3T0XA 4I9WD 4M7KH 5TF0A 3U4BL 4ZUVA 1EK3A 4OGYH 4PRAA 4WVRA 2NXZD 1AGCB 1U8QB 3B83A 3MQIA 5F9DC 1JRHH 3WS3A 1CCZA 1YN7B 3SKMA 3CVIH 3S37H 3I2CH 1CDGA 3UAJD 1VGEL 2APTA 3S3SA 4OT1L 3QNYB 3WUWG 4F58L 5ACMA 3H2WA 1N2RA 2B0SH 4RISL 3QFDA 2DL2A 2OTUB 1NL0H 5HDOA 2B8OT 3MXVH 3HR5B 1HSAB 3BT2L 1Q8MA 2BRQA 2Y25A 3BZFA 2VAAB 3LY6A 1MRFL 1P84K 2CK0H 4C55A 2UWEA 5BO1H 4LKCB 1FVCB 5I1IL 1N59A 2DIAA 4P23A 1DBKH 1KTLA 4LSTL 4V1DA 2R2BB 4QWWC 3NMEA 2ICES 1JWSA 3IKCB 5D8JL 1BD2A 4UQ2B 4QHLA 2F74B 4H26A 1K8DA 4XBPB 4DZBB 2BFVL 2XWBA 2MQ0A 4ERSH 1U8PB 1T0PB 2IBZY 3OKMB 1DBAL 5A2FA 3C8KB 5HI3C 4GKSB 4MYWB 1KACB 3MRPB 5D2LE 3ABZA 4HK0A 2ESVE 5ITFB 5EO1B 5KSVB 1JFQL 2CLRA 3BQUD 4MB5A 3TA3D 2N56A 2DM2A 5EC2B 3D0LB 4P4KD 1FRGH 4K71B 4D0CB 1KYOK 3PGDB 1YPZA 1MJUL 5C0JA 2WUCL 4RMVA 1VHPA 4TYUA 5DSCB 3EYSL 1HEZB 1AO7D 1FFQA 1FO0H 3DMMD 2YD4A 3GJFB 1LEGB 5D71H 2BP3A 2BNRE 4LRIC 2B7DT 3IAPA 1TNMA 1KB5A 2NX5B 5DK0A 2JELL 5BZDA 4NRXA 1TZGL 5CEXB 3U30C 1WBYB 1YA5A 4BA8A 3J8F7 4YDLC 2DLIA 3SY0B 3U1SL 1KV3A 6FABH 4HT1L 4S1RH 3HPLB 2W60B 3T3ME 3EFDH 2CKBB 4GRMB 4OLUH 4YDKL 4KI5C 4NQED 4DVBB 1A7BA 3MJ7B 2R4SL 5DMGD 5I8EA 1MIML 4DKEH 1QKZL 4O5LH 1IQDA 3SN6N 4BQ6A 2YK1L 4IBLT 1I1YA 4NZRH 1NC4A 4I3GA 4M03A 5I30L 3NCBB 5CD5C 4M6NL 4AG4L 4DFHA 1HQRA 1RUKL 4G8FB 4JDZB 4OCYH 3T77A 2F54E 2O5XL 2YS4A 1FHGA 4NQXA 2I60L 3FONA 3SO3C 1VFBB 1BFTA 4G8IA 3LVEA 4JZJB 5EBLA 2ZSVA 4GBXD 4M93B 4OKVA 2VR5A 1MAML 2Y5TA 3MV8B 4ZSOB 5EU3A 5IV2B 4PJ5A 4HWZA 32C2B 1OM3L 1OP3H 2WMPA 3WO4C 4YHZH 3QIUC 4GG8B 2DMBA 3E0GA 3O6FA 5J3HD 5SWSA 3PP3K 4OZFG 1WJ3A 5HGAA 3TBWB 4KJYB 2R2HA 5FB8B 1AD0A 2Z8VC 1UEMA 3ES6B 5F88A 5KS9A 1Q9WB 3TLRA 4MXWL 2HT3D 2IFFL 4H8WC 4WY7H 1ZK9A 4J3UA 2WINB 3GJFH 4W6WB 5D7JC 4OIBA 4Y1AD 2B1AH 1HXMA 4ZFGH 1TZIB 4AMKL 3MNZB 5ICZA 1GPOL 1ORQA 4HGMA 2UUDH 4JY4A 2J8UA 5C09D 1B0GA 8FABB 4I3RL 2R0LH 1VEOA 3SQOH 2CKBH 5GGTL 2IAMA 2QEJA 4JN2B 2DN7A 2PXYB 4PY7A 3ZKMC 2GCYA 4AY0A 1WLHA 1HHKB 3P3YA 3UTTB 2CIKA 1AQKL 2FBJH 5E6ZA 1TQBC 3JZ7A 1T0MB 3UBXI 3S98A 3AGVA 1JPFB 5FO7B 1QSVA 1FV1B 4NC1C 5CZXD 3GSRB 3VFMA 3V0VB 1U8IB 3SE9L 4P46D 5H94B 2EIZA 1HE7A 4URTB 3VXUA 4KU1A 4GS7C 1CT8A 5IMOB 1XGYH 4QYOA 1VESA 3QFJB 5EZJA 1F45A 2NY2D 5T3XH 3BHBB 1X5YA 1YC8A 5T5FL 1KIPA 2ZCLH 3ZDYF 1HIML 3ZKND 5I1EH 2B4CH 1GGCH 1J87A 1JMXA 3EHBD 2AJ3B 4W81A 3O8XA 4OV6F 1RUMH 1IRAY 1UCTA 3VXOB 4UU9A 3ZHDA 1IFHL 4F3FA 1O7VA 3TWCL 4LPCA 3UJTH 1MOEA 3E1F1 3TZVC 4D3CL 4LHUB 5JPMB 2FJHB 2JK5A 4FTVA 4RFOL 1IAII 3VXNB 1Y18A 2DD8H 5J6GA 3OAUH 4LVHB 4OGXL 2CJUL 1IC4L 5GS0H 3KPSB 3VXMA 1ZS8B 4YIQB 7CGTA 4ZUSB 1S3KL 1JPTL 4U0RC 4JJ5B 4BKLB 4MJIA 3KPLA 1JV5B 5D1ZB 4N1HB 1QLRA 3SDDA 3U48A 5CLWA 5D70L 4Z7NF 1KJMA 1OW0C 5KSAA 1YEKH 4QEGA 2NY0C 5JNYA 1SYVA 4LP5A 4MHHI 4PJEA 4NKDB 4TNVF 1A9EB 5KVDL 3S88H 1K8IB 1P69B 2GKIA 3WFCH 1E27A 5E9DD 1MI5A 1G6RB 3GUTB 4ZO6A 1BQHG 3K0WA 2FX8L 1DQJA 2JJWA 3ZSSA 4IIQC 1QFOA 2FRGP 1KC5H 4PYGA 4QGYA 5ALBH 5GRVL 2A74A 3GMMA 5ABDE 5ISZB 1ZLSH 3TBVB 2CGRL 2P7TA 2VDPL 3HFML 4U7SA 5C0DA 3GMRB 2DQDH 2VLRB 5DRNA 3ZL4L 3CDCA 5IJVA 3L5WB 4XGZA 1BECA 3TM6A 1CGSH 1MFEH 5JMRA 1LK3L 2VDNH 4QRRE 3IDIB 4X6BA 3STZB 2X4TB 4FQXB 5AZ2H 3CAFA 1H3VA 3UZEA 3WIIL 1BF2A 3MRJA 1XR8A 3T0EB 2CDFA 3UBXA 3VWKC 5T5NG 3VGAC 5H37G 3QAZB 3QI9D 3QEHB 5JXAH 1YECL 1UWXH 4LLWB 2CDEA 3JWOH 4X6CF 4WHTB 3MOQA 4ZXBC 4KQ3H 4NRZA 2J4WH 1KPVB 2EYTB 4XHJD 5FA4B 5BS0A 2VZTA 3THMH 4ISVA 4TOYH 4LPWA 2F9BT 4MDJB 2VZVA 3HNVL 4DFIA 3FOLA 1R0AH 1S7VA 1CQKA 4BSWA 2Q6WA 3O6MH 3QDJB 4YGVA 3MRFA 4GAJL 3NABH 2CR3A 2AJSL 3QUZC 1Y6KR 1GIGH 2JB6A 1UA6H 2Z8SA 3NACH 4OZGA 2D7QA 5E99L 3FB8A 25C8L 4OUOA 3VCLB 3N9GH 2CMRL 4RAUB 1G6RH 3QISA 3V4VH 4QT5A 3L3OB 3PGFH 5JLZA 3HTLX 1LE5A 4R2GC 1NBZB 1XZ0A 3CVHB 3LMJL 5DMYA 5FYLD 3E6FA 4CJ1A 4C54A 4JR9L 5FUCE 2A6DA 5DA0B 4BH7B 3UC0H 1WFTA 3U0PA 4IRJB 2W1NA 4KZEL 3P11H 3BGMB 3UJIH 4D0DB 1UGNA 1NGYA 4MD5A 3L3IA 2W59A 5KVEH 4JQVA 4JZNA 3BP5A 5DEFA 1KCRH 2ORBH 4OZ4B 4BFEA 1JHKH 3ZSTA 3VI3F 1CICC 1W8NA 3S8WA 5FYLL 3EO9H 5HHPB 1XGUB 1SY6A 3WUZA 2HFFA 3EDKA 1BFOA 1Q0XH 4BH8B 3OKYA 2XG5A 3GHBL 5MERB 4BQBA 1KTRL 1MREH 2APXA 3R1GH 3N1PC 1KT2B 4XXCC 3HE7C 5ADPL 2NYYD 1DDHA 1NAKH 5KVMC 1C7TA 3RY4A 3IJSA 4XZUA 5T1KD 2R0ZH 1Z3GL 3FO1B 5DJ8A 3T4AA 1XF1A 4U1HB 1A4JB 2JB5H 4LCCB 4X98B 3X12A 3ETBF 1UJ3B 4UAOC 2VKWA 5L2KD 2JJUA 12E8L 1GOFA 2R0WH 2FYYB 2R29L 1T3FA 3B9DA 1A7RL 2G2RB 3DTXA 1XIWD 1JGVH 1QFUL 4PS4L 3M17A 3I50H 5ALCL 5EG6C 1YUHB 4YJZL 1A7OH 3LEYH 1HHJA 4BYHA 4PJHA 4KK8D 2XA8L 3MLXH 2X4UA 3RAJH 1T1ZA 3C6LD 2Y07L 3QXAB 5K9QG 4XC3L 5EOQL 1MH5B 3CVHH 2XNAA 5T1DH 1A1MB 5GZOD 4AEHL 5AD0A 1SEQL 2NW2B 4WWKB 4Q9RH 4XVJH 4ZAKA 3VXTA 3OPZL 3Q0HA 3DI2B 1V7NH 1RU9H 5TGBA 3GK8L 2PN5A 4L29B 2R1YA 2HTLD 4NNYB 4PJCA 4KVCL 5I1CH 4OD3L 3QNZA 5DEZA 1QSFB 2VO5A 2DM7A 3BRDA 2HJKA 3QULB 2E5EA 1ODAA 1JF5A 4Y2DB 4BQCA 1KJ3H 4UOJA 1CDUA 1C7SA 4EZMA 1RUAL 1BX2B 1KGCD 1A1NB 2H2PD 4WFEE 1F3JA 3G9VA 1EUTA 4E5XA 3FB6A 4FQQB 4OB5H 5T3ZH 4U1SA 4WIQA 3D2UD 5IW1A 1DN0B 1W0WB 5ACZA 4DOHB 5IFJB 2FD6H 4ELMB 2J5LC 3QDMB 2B2XL 1LQSR 3D18B 4YC2B 5SWZD 4F15C 2Q7YA 1MFNA 3V4UL 1R3HB 4O2FB 3V5DB 3EDEA 4OD1H 1KLUB 4UTAH 5LCVH 3CFKA 3GMLA 4YO0B 3QXTA 5F6HI 2AK4D 4ESKA 5IMMA 1JTOA 3G5VB 1W72H 4U05A 2ILLA 4K2UH 2PW2A 5MEQA 5AYQA 5ID1B 3S35H 1J1PH 1T20B 4J3WA 4L1DA 3VWJD 4PJGB 3VDBA 1WF5A 2X9WA 4TVPL 4P5KB 1TJHH 1A6PA 2VYRE 2EH8H 4MAUH 5I9QC 4Q6IB 5HGGS 2Z31B 5B8CA 4CDGC 1RZJH 4QXGL 4YHLH 3L3KB 3RHWF 3T08A 2AJUL 3BKCH 4ZFFB 4TVSa 2DRUA 3PWVA 3QBTB 4ZS7L 4K8RC 4XMPH 1OARL 3FT2B 4M43L 4L8BA 1NLDL 1J0IA 3EO0A 2AEQL 3L5XH 3HG1E 1R5IB 3G08B 3EOBB 2E27H 5GS2D 1ZTXH 3GO1H 5C8JA 3WNKA 1Q9KB 3BEWB 4HKZA 5B22A 4ZFOL 3A67L 4UIKL 4P4RA 5I8OH 3W0WB 2HMID 4N8VB 4HUVB 3ZDYE 4NO5B 1I75A 2XQBH 5B38G 1NC2D 4HSQA 2CUHA 3O0RL 4HH9A 4QRPE 1ZEAL 5I17A 3OWEA 2R2CA 5HVHB 4NT6B 2NY3C 1EDQA 2NY1D 2X40A 4I18C 4N5EC 4B5EA 1AQDB 4YHKL 3LOWA 1N64L 3X3FH 1WFNA 1CXIA 2Z35A 4Y19D 1GHFH 3AUVA 5HI3D 4F9LA 2BVQB 5HGHB 1WITA 5GXBB 1WC7B 1X5FA 1A7PL 1ZSDA 2HN7B 3JVGA 4OQ1A 2O5YH 2XTJC 4WUUB 2YBRA 1JYVA 5BVJB 5EIIB 4PGEA 1R3LB 1U8LB 4HMEA 1A6WH 4NKOA 3KLHC 1AGCA 1U8QA 2VIRA 3BD3A 2VC2L 5I74B 2AJZB 5A16B 3BIKA 2Q87A 3T2OA 5IKCB 3U0TB 1A64A 2BCKA 1F6AB 3NVQA 4YFLI 4KRMB 3MRLA 5IK3A 2GK2A 5C0IA 1KF9B 2ENSA 3NAAH 3TCLB 5BZWB 5HI4C 1ED3B 4LVOB 2BNRD 1CL7H 4PP2B 2EXWD 4C4KT 1SJVA 4PJ8B 3V6ZA 1I9IH 4LCWA 3BZEA 3DRTA 5K9KB 4AEIH 5C0GB 3H42L 3TIDB 2MMXA 5HHVH 5IHUL 43C9B 4JQXA 1OSPH 2C3HA 5ECJE 4R9HA 1JUFA 3QUKA 4LVEA 3E2HC 4QOKA 5J11B 2AQ1A 1TDQA 3CFEB 2RCSH 4JB9L 4EDWL 4E41A 1F2QA 4L4VB 4Y5YB 3FQTA 1P7KA 2HVKA 2OMNA 2YC1B 2HKFL 4JM2A 3IDGA 5K9JL 3U9UB 3MRPA 4NNPH 4QHNA 4LNVA 1UZ8A 3IDMA 5ITFA 5JOFB 4U6XB 5LQBH 4O4YH 1A3RH 5F6HJ 4YR6B 1A7NL 3BDXA 4LQFH 3D0LA 3DUUA 5I71B 2V5RA 4D0CA 3PGDA 1I9EA 2VZUA 3VXSD 3PP3H 3LDBB 3BH9B 4KY1H 5I76B 1BBDL 2DMCA 4KKBC 1QYGH 3ULUF 3HI5L 5JHDD 4JG1H 1BD2E 4S1QL 3O4OC 5HJ3A 4WGVB 4HKBA 5GISL 4P23C 3EJJX 1RJZA 1MY7A 1KCUL 1CDCA 1RIUL 4BFIA 3WS6A 5F89A 4XVUD 5LWYH 4M7LL 3L9RA 3ARFB 5CEXA 2VRAA 4NO0B 4NQUA 1K6QH 1G7HA 3GMPB 1HNFA 4FXGB 4HEPG 4UNUA 4IHOB 1SHMA 4ZODA 1CGYA 3SHSA 5DJYA 1KJ2B 3H9SB 5J57B 1BJ8A 1CR9H 5FM5M 3T1FB 3V6OE 3W9DA 3QIBD 4DCQB 3DVGA 1YPZE 3BW9A 4JGMA 5C07B 5DMKA 3F7YB 5IR1B 5JW3L 1RUPL 2VMFA 1OT1A 1DLHA 4PJHF 4UB0L 3ZKMD 1OSZA 5TE4L 2R0KH 2WBKA 4H8WL 1YEEL 3V4PH 3MLRH 1TXKA 2ZUQB 3SQBA 5DVKA 4QNPF 4NGHL 3NIGF 2X4RA 3CH8A 4GKOA 4HLZH 3MODH 3TNNB 2MSPA 2FGWH 4NZTL 4JZJA 3ARSA 3KHOA 3CLEH 5JORA 4PJ7B 4MSWB 4YDJB 4UT9L 5FV2A 3MV8A 2V2TB 4KTDL 3PHQA 1GJIA 4UT6L 2PO6D 5EZIH 4XP4H 2X4QA 1I1CA 3B9AA 3GIZH 5C9KA 4LLMA 2G60L 3TYFB 1TCMA 1J88A 2UV3A 1GZPB 3GJEA 3HNTH 4I3SL 3TBWA 4U6YB 1KSRA 4KHXL 3FQUB 3I6KB 3QPXL 5DLML 3ZE1E 5B3JF 1Q9WA 3MCLL 4HKJA 4P2QD 3ZZ1A 2M26A 4EI6B 2ICCA 2AJVH 3CCHA 5KOVC 3OKNA 2MQCA 2BJMH 4IRSB 2K7PA 3TZVD 5I1GH 1PJ9A 5GGSY 3OBAA 1TZIA 4GXVL 2VXQH 5JDSB 1SJHB 3VG9C 1Q9OB 3P4MB 5I16B 1RK1A 3FJTA 2MKWA 8FABA 1X5ZA 3K8LA 1T1YA 4FQLH 1IGFL 2BVPB 1EJ6A 1KJ2H 4XPGH 1GGIH 1FVDB 5CSGA 2PXYA 4K7PH 5TE6L 1NMCB 1OGAB 5KW9L 3B2UC 3RUGA 2DQIH 2YPVL 3O6FC 1B3JA 2H1PL 3RA7H 3TIEA 2NY0D 4RGNB 4NP4H 4P9HC 5IEHA 1Z6JT 2MCPH 4Z8FH 1YQ2A 3ZKSD 5IQ7L 4DAGH 3V0VA 5EN2A 1VACB 2D03H 3U9PL 5JO5B 4R8WH 1NEZG 5GHWL 1RHHB 4JRYB 1JF6A 2LE9A 1HYSC 3TBSA 1RPQA 2HWZL 3KLAB 2YOCA 3ARDD 2J88L 4L3EA 1FL3B 3QFJA 4NKIH 4CU6A 3TT1L 2R1XA 2W0FA 3QH3B 2CLZB 2H32B 2CUIA 3WLWD 3Q1SH 4HDIA 4OTXH 4Z0XA 3UPAA 3RKDD 1T4KA 1X5GA 3OHXA 4G9DA 4EUPG 5I75B 1I7UB 2FECL 2IAMC 1BVKB 4XPAL 1MCJA 4YDVA 3TFKC 1VA9A 3TA3B 1A6VL 3LN5A 4NN5B 4PGDA 3X3GL 1BBJB 1VGEH 2HAZA 5IB4B 4OT1H 5IEKB 1NANH 3ZKXB 3DUHA 4N8CL 5EUKA 5ILTH 3RPKA 4RISH 1MLCA 3W11D 2CLVB 3BT2H 2FSEB 1GGYA 1CG9A 1S9VB 1MRFH 3IJHA 3TJHC 1MCLA 1GYAA 2F58L 4ZXBD 1T1XB 5I1IH 2ATPB 3RZCB 5DUPL 4AIZB 4NZDA 1FCGA 1DANT 4WFGE 4NQEB 5FF6B 3IFNL 4JFZL 1N3NA 3MLUH 1K8IA 2GTWA 1CD8A 3DETC 3O8XC 1TQCC 5EPMB 4JFOA 2BFVH 3V6FB 1HK6A 3G5YB 1T89A 4KRNA 2PKDA 4NUGH 1YY9C 3DX6A 4PV8B 1T83A 1DBAH 1D6VL 3WMSA 4DWHA 5F3BB 3DSNA 5IB2B 4MJIE 3W39A 1IQWH 4CW1A 1JFQH 4RMUA 4PJAB 4MNHB 1HSBB 1AGEA 3GSQB 3EUUA 1M7DA 4HXBL 2WUCH 1J0ZA 4MNGA 4R2GD 2QQQA 3CSGA 4HHAB 4U2ZA 5GRYA 3TGXA 1R3JA 5D96B 3SDDC 1UWGL 3TVMB 4OLYL 3OAZH 5KSAC 3KS0H 2JELH 2XRAL 1I8MB 3OKDA 1A3LH 1TZGH 1IEBB 3MRIA 1E4WH 4XH2B 1YEHL 5A1AA 3U1SH 2C3XA 4HS6A 5IB1A 4YDKH 1BVLB 4XI5C 3RDTD 1AJ7H 1C08A 4RAHA 5KOMC 2R4SH 1NKRA 3QIWA 1MIMH 5IBLC 5D6CA 1QKZH 5EU5A 1S9YA 4HPOL 4RAVA 1G7PA 1EFXB 5KSBA 5I30H 5IHZB 3VFTA 3MRCB 4AG4H 2F8VA 4X7DC 1RUKH 5C09B 3DO7B 1F90L 4RA3A 3DUSA 5TPWH 1HWHB 3S96B 5DWUL 4WU7A 3LKQA 5D7LE 4LDEB 3OKLB 3HE7D 4X6FB 2I60H 3ECBB 2L4OA 3MLVL 1WQVT 3ARRA 5A2KH 3MRGA 4LSDA 1QVOA 1MAMH 5CWSA 1I8IB 3F7VB 2VLJD 4RAUA 3B8YA 3KGRA 1DANU 4J3TA 4RWHA 4LKXA 3T8XB 5IBTH 2V7HA 4CN4A 5IB3B 4JKKA 4P46B 5IW6B 1B2WL 2RIKA 2DI7A 4QRUB 3SDAA 1ULVA 4NYLA 3T0VA 4HAGA 2LQRA 3RTQB 4MD0B 5E4IA 4JFDA 1S8DB 3R8QA 3O3DB 5C0AB 4MXWH 5TFSH 3UTQA 4CADB 2IFFH 3HZVB 2EIEA 1FZOB 4OF3A 1FL5B 4M7ZB 4OZ4A 4WHYG 3BGFC 4PRHE 3MBXL 1I1AB 4U6VL 5ICXB 4AMKH 5F1IA 2DLFL 2B39A 3WHE0 1GPOH 3VFGL 1LEKB 1P9MC 4GAYA 5HHPA 5AZEL 3FB5B 3CLFH 4I3RH 4TSBL 3RNKB 3DURA 5DJDB 1WCQA 2IPTL 5GGTH 4XP5H 1D3CA 3OX8A 4MVBC 5E4EB 3OR6B 2WK2A 5KG9A 4X5LA 5JZ7C 5JDJA 2YR3A 3QPQC 5C08E 1AQKH 4MA1B 4HIEA 2R15A 3ZDXF 4PRBB 3RIFK 2P46B 4BZ1L 2QSTA 4DTGL 1A5FL 1UCBL 5ESAB 1F5WA 5TE7L 3JUZA 1KIUA 5EBMB 3SE9H 1A4JA 4X98A 4ZO9A 1UJ3A 4JQVC 2P8MB 4Z76A 4HWUA 4MD4A 4OSUL 1MHEB 4WFED 3T0AA 2G2RA 3C87A 3ULUE 2OQJA 4P9ML 1ZAGA 5DMJB 5T5FH 5FCUL 4EBQL 4OCXL 5E9DB 1OAUL 3GEWB 1HIMH 3PWPB 5BJTA 1LWRA 4I0PD 3UZQA 3HR6A 4ZPVA 3P4NA 5E2UH 4Z6AT 5AG8A 1IEHA 3KDMA 1XF3B 4P3DB 1PQZB 5D1XB 3QXAA 4JKPL 5LGHH 4J23A 4ZOBA 5EOTB 4H0GA 5CBAB 3PL6B 1L0QA 4TPRH 1A1MA 1IFHH 1DUYB 4G7VL 3TWCH 1I3UA 5DGRA 4D3CH 1VADB 3ALWA 1INEL 1V3MA 4RFOH 4A2LA 4G6FD 3CH1B 4YXHL 5CJQL 1OB1B 4ZYKB 1E6JL 1YNKL 3HRZB 2CJUH 5ESVB 4L29A 4PJHE 3PQYE 1ZE3C 1PLGL 1L6XA 1A2YB 1S3KH 1JPTH 3STLA 5IF0B 3H0TA 2HJLA 3LS4H 1IL1A 1MFCL 1WISA 4K8RD 4QNPE 3HB3D 3NIGE 2BERA 4JDVA 2EECA 5D70H 4WHCA 1MUJA 4P2RB 5CD3A 5KVDH 1C5DB 1P2CB 4G8EB 3OKOB 2IG2L 4UUJA 1R5WA 3RWHA 3HG1D 4K94C 3CSYA 2FX8H 5IM7B 5IFJA 2XZZA 3RX8A 2X1PA 3NFNB 2VISA 3X13B 5B4MC 1K4DB 2C7UB 3D18A 3O4LA 1CE6B 4ZAKC 4O2FA 3V5DA 1CIUA 3T0WA 1MCSA 2E7MA 2DF3A 2CGRH 3HFMH 1LP9A 4F7PB 3S34L 4XCCL 5B3JE 4YBQD 4GT7A 3ZL4H 3GB7A 2NY3D 1JGEA 2BRRL 4N5ED 4ZUTB 1YMHA 4MQSB 4NJAL 5DC9B 5ID1A 4HUWA 1KNOA 2A6KB 4B50A 3C08L 4EQ2A 2WSKA 4YEFA 4QRPD 3W2DL 1J86A 2IALB 2QHRH 3NN8B 1WIOA 4U49A 3D85A 3WIIH 1IC5L 3LKPB 4Q6IA 5DQ9B 3L3GA 1D5MB 4HIHB 3F62A 4K3EL 3EDJA 4V2CB 2IPUG 4U1MA 3MFGB 4MJ4A 3LHPL 2EYRA 3KLHD 2UVFA 3G6JB 2FB4H 4PJFB 5FKAB 4HUMB 4NZUL 4X4ME 1QHPA 3MRRB 5CP3H 1NGWB 4Z78B 4WI6A 4YHIB 1RFDL 4MNQE 2ICWJ 3EYOA 1R5IA 4QY8A 2X4SB 1R5VA 2J1KA 4PLKC 5GRJL 3HNVH 2KL6A 4FRWA 5IMKA 1QRNA 4FFWC 4GAJH 3ESUF 3TF7C 3O11A 3L7EA 3RPIA 1NFDA 3TYGL 3BEWA 4G8GE 4EI5B 3IDYB 3CSBA 1N26A 1U6AH 5HYSG 2XV6B 1ZT7A 4N8VA 1AXTL 4NO5A 5E99H 5ETUA 1UC6A 2OZ4L 25C8H 5B8CC 3TBYA 4X4ZA 4Z7OF 1N5YL 3O2DA 1QNZL 1EVUA 5IP4A 3IDUA 4R6UA 4MDIA 3LMJH 3O3AB 3D39E 1KULA 2EDQA 4E9LA 2DQCL 4JR9H 1CS6A 3WHE1 1L6ZA 1EHLH 1K2DA 3FHQA 3PGCA 3PWJB 4GSDL 4KZEH 4XAKE 1N5AA 2NY6C 3NCYP 5M94B 3DVFA 4YLQT 1CGXA 2ZNXA 3QZWB 4WJ5B 3L6FA 3EDDA 3C6LB 5I15L 3BH8B 2Q86B 3L1OL 1NEZA 2ADIB 5D93B 1ZHNB 4P23D 4ELKB 3KPRE 5FYLH 5IKCA 5I0DA 1B90A 4V1DD 2KUTA 5CS7A 5DJAA 2C1OB 4Q7DA 3ROOB 3QEQA 5E1AB 4GXUN 3L3DB 1BD2D 1KIRB 3BD5A 3N85L 3GHBH 5HHXL 3SKJL 4AM0B 4PLJC 3O3BB 3JWDH 3ZTJH 1MLBA 4R7DB 1B0WA 1L4IA 4QHUA 4K07A 4L5FH 4UDUB 5T1LB 4R0LB 5GGRA 4F9LC 5K9KA 2RAMA 3KPOA 4N9GB 4P59L 3TNMB 43C9A 1Z3GH 2X1QA 5CGMA 3JVGC 2EO1A 5I8KL 1Z5LB 1U3HC 2R29H 1A7RH 4JREC 4MS8C 1WAAF 1QFUH 4PS4H 3T04D 1JF1A 3SOBL 1BZ7B 4IOIA 4G6JL 5CSZB 2ATKA 2LVCA 1M71A 4KMTH 2FH8A 3OAYK 2YRLA 3G6DL 1A6ZB 1CIDA 2XA8H 1WSST 2GFBA 2Y07H 4XC3H 1H5BB 2N4IA 2A9NL 2ZUVA 5L88H 4AEHH 4PV9A 1HHHB 1BREA 1SEQH 1EV2E 4KZDL 2FCBA 1NBYA 5KSUA 4IMKA 4JQXC 3HS0A 4PTUB 1EA9C 1NC4D 3T4YB 3ARFA 1X6NA 4NO0A 4X9BA 1KB5L 4JCLA 4WTXA 4QHMB 5BQ7B 1LO5A 4IHOA 4KVCH 3LSOB 3KNBB 4A6YA 3RY6A 3SDXB 4K23L 3H9SA 4IM8A 1RUAH 1C12B 4ZFOB 4JM2C 3UO1L 5CKAA 4NQDA 2UZIL 2D0HA 1RULL 4EOWL 1EBAA 2XYCA 1BAFL 5HYJB 1BEYL 2NX5E 4PJ5D 4Z7UA 4WFHD 1DUZA 3PV6B 1VEPA 2B2XH 3B2UD 5C2UB 5MENA 3S37X 1MCCA 3V4UH 1OTTC 1CXFA 3O6FD 1FFNB 4O2CB 3WNPA 4FFZH 2QTEA 2ZUYA 3WS6C 2VDQH 1U3ZA 5F7EL 1UXSB 3FFDB 1FZKB 4U3XA 3MREB 1HQ4B 2EDOA 5CUSL 4Z95L 3BESR 1XGTA 1HYSD 4FXLA 4HIIA 2QADC 3K8KA 4WTZG 1X6LA 1U8JB 4LFHG 4TVPH 5DUML 4NHCL 2P5WA 5DJCB 5EORL 3G04B 3OV6A 4AEEA 4DN3L 4QXGH 4CNIB 4U6YA 2AJUH 2MOVA 3FQUA 3I6KA 4WW1A 4Y19B 4P9HL 3MRBB 4UILL 2IAMD 1ZLUH 3QJHB 5T3XE 4EI6A 3WCYA 5D7SL 3TFKD 4ZS7H 5FKPA 2BVTA 1HWGB 4M43H 3ZDXE 5IBUG 1L0XA 3MV8E 4ZSOE 5LGJA 1NLDH 4F80A 3GM8A 2BY1A 4J3SA 1M4KA 4JZJC 4ELMF 6CGTA 1C5BL 1CDIA 1SEBB 2R39A 4RZCA 1OAZL 2YUXA 3GIVA 4LIQL 3VA6A 2VXUH 1QEWA 3U30B 2ITCB 5E03A 4I48A 4E0RB 4JRXB 3TJHD 4JFQA 1Q9LB 4FG6C 4UIKH 4PJXA 3UTZB 3ZE0F 3U83A 4JLRB 2QKIA 4R4FH 1YY8B 3O0RH 2HP4A 1V7MH 1QPPA 2MTPA 4PJIA 1GC1L 3W81A 4PJGF 2DI8A 3O6KL 1QSZA 2FX7L 2AEIT 4NFDA 4WFGD 1RHHA 4E42B 1F00I 4YHKH 5GS2H 4ODBD 3AS3A 2GSGB 5TDNA 3AM8A 3KPNB 4FTVD 3O9WB 3QUYA 4KXZH 1YQVH 2H32A 3MYJB 2WUBL 1A7PH 4RFEB 1DSFL 3UTTE 5A3IC 5I1LB 3MGOA 3SO3B 3C9NB 4MA7L 1I7UA 4LHUG 3ARYA 4WFFE 4MJID 2XKNB 3SDDD 1WTGT 5KSAD 1F58L 3WO4B 3Q6GL 3VXSB 4Z7VA 3QRFM 3QIUB 4M5ZL 4U3HA 3DX8B 3VGHA 5JHDB 3QFJE 1K85A 1RUQL 1BP3B 1LHZA 2I25N 4C83B 4XX1G 2LABA 1MI5D 1ZA6B 3B9KA 2ED9A 2FSEA 3D9AL 2EYSB 3RIAF 3H42H 1CD0A 2ATPA 3RZCA 3QEGL 5D7JB 1UB5B 4ODTL 4RDQF 1G7LA 5SWQB 3ULSB 4BQ9A 4M9OA 3E6HB 1ZLWK 1CF8H 5HHNA 3UCRA 5GQBA 2Q3ZA 4W70A 2DQHL 3BRFA 3ARUA 4N0CC 3MLWL 5EPMA 1T2XA 4J4PD 1SYSA 1F97A 3G5YA 4PV8A 5DFVC 1OGTB 1EGJA 2HKFH 3KPSE 3PG2A 5K9JH 5GZNC 4PJBA 5F3BA 4NPYB 4XX1E 3TPKA 4TNVK 1TQBB 4YWGL 2LU7A 4XPFL 4PLOB 2DKUA 1A7NH 4NWTL 4EIGB 3P4LA 4MNHA 1HSBA 2JIXA 3RJDA 4PUBL 5EUOB 2DLEA 2X1XR 5HYEA 1N6QH 4NSKB 3S4SG 1BBDH 4UDTA 1OTSC 4HHAA 3HI5H 2RFXA 5DYOA 1CFQA 5BS0D 1F4XL 3X14A 4GS7B 2VDRL 5HDBE 1RIUH 4X80L 4M7LH 1I8MA 1RIHL 1ZKAA 2ID5A 3D25A 5E7BA 5B39B 3N1MC 4X4XB 2FBOJ 1RVFL 5ISZE 4H20L 4RQQA 1T89C 3C5JB 1I7TA 3K80A 5J0BA 4PGZA 1H9VA 1T83C 2VLRE 3EOTH 4NHUB 4P2QB 2IJ0C 3VI4F 2A38A 2NNAA 1LNU