4O9HL

Structure of interleukin-6 in complex with a camelid fab fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
211
structure length
211
Chain Sequence
b'QTVVTQEPSLSVSPGGTVTLTCGLSSGSVTASNYPGWFQQTPGQAPRALIYSTNDRHSGVPSRFSGSISGNKAALTITGAQPEDEADYYCALDIGDITEFGGGTHLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-6
publication title Combining residues of naturally-occurring Camelid somatic affinity variants yields ultra-potent human therapeutic IL-6 antibodies
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2014-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hL01
3G6JF 4LASL 4OJFH 5J13C 4LHUA 4OGZA 4MQSB 2P5ED 3HFMH 5CBAA 4LIQH 4BKLB 2XRAH 4KUCF 2HLFD 5FHAL 2VDNL 4Z7UF 4MNGE 4S10A 4B7LA 4GAYA 5KS9F 1EUUA 4N8VA 3U7WL 2I26N 3HMXL 1AQKL 3RTQD 2HG5A 3LHPH 2R0WL 4D9QD 3ECBA 3CH1B 1BEYL 2NZ9C 3BKJH 1XGPA 3BZ4A 2CRIA 2A6IB 4YDKL 4NQVA 4AEFA 5F7MC 5T1KB 4CVWA 1YMMB 4J3WA 4M03A 5C0RH 3VFWA 1OF2A 5DLMH 3BH8A 1OB1A 4K94L 2X09A 5ESAB 1MHEB 2P5WD 5A2LH 3UTSD 3RIFK 4NQDA 4P9HC 5L8LB 3V5KB 2WM0A 3CFCH 4LGSB 4XBGB 2MCG1 5FYKL 1HHJA 4UT9L 4KXZI 3ULUC 2IBZY 3O4OC 5IHUL 1JPGB 1NL0H 5CEYA 1NGXB 3VFMB 2BFVH 1EIBA 2EIZA 2VLRE 3HUJB 3WFHA 2DQEH 3GNML 4ZUVB 1IBGH 2EDRA 3RVWD 1U8LA 3OXRA 1CFQA 2YRZA 2LU4A 4N0YL 3EO0B 1FFQA 3GI8L 4YXHL 4OCRH 3VXRD 2O93L 4OGAC 4F7TB 3OAUH 1F90L 3RPIB 3OKKA 3MLVL 1JPTH 2F53E 3CDGA 2M1KA 4PJXF 4QRUA 5HGGS 1Q9WB 4NUGL 3GMPB 1U3HC 3JV4B 5CP3A 3LKRB 4LSRH 1FQ9C 3T0DA 2AXGA 2ESVA 1MVFA 1KSRA 2ZUUA 1LHZA 3CCHA 1HDMA 4WGVB 5IVZA 1ACYL 1LO3H 1X6LA 1T83A 4X99B 1D5BA 1CYGA 4GW1B 5CLWA 3JV6B 4K3DL 1FAIH 3INUL 3FTGA 5BOZG 3T09A 4RGND 3MV9A 1TIUA 1JGLH 3NCFB 5ADPL 5IFAL 1MPAL 4XCEB 3WKNA 3MNZA 4I5BB 4R9HA 5A16A 5TE6L 4JFEE 1RFDL 4PJ7E 1EFXB 4WUKL 1QEWA 5DHVB 2ICCA 1FVEB 3MRPB 1RZIA 5JTWA 1BVKA 1MEXL 2XNAA 3KWWA 3HC3L 4OAWB 4JPKH 5I2IB 5IB3A 1DANU 2RJMA 1MCDA 3QEQE 1EZVY 1UKTA 3GSVA 5AWNL 1DSFH 3TT1H 2EKSA 1LWRA 1FFPA 3TH2T 3BZFB 2DD8H 4RIRB 4NZTL 2VZOA 4H5SB 5ISZE 3FQWB 1U3JA 3MRJB 5GGTA 3MGAA 4Y2DB 3QWRD 4NO3B 5D6DC 4F2MA 4NZJA 2VDQL 1ED3B 3BRFA 1INDH 5CSGA 1T0NB 1F2QA 3UCRA 1G9MH 4JRXD 5ESQA 5L7XL 4ZFZB 1BWWA 4PTTA 3ARQA 5I1IH 1NCWL 1YPZF 3T3PF 3SDDD 1R5VB 5J12C 5D6CA 5T3XH 1WBYA 3KNBB 5JOEA 5FO7B 3ARBA 4TN9A 1U0QA 4DFHA 4DGIH 2HFEA 4R7DB 3OAYK 3WDIA 3ZKND 2JJSA 3TT3L 2NTFB 5F7LB 4KRLB 4NQED 2PW1A 3HC0A 2MKWA 5IBUB 1ZGLM 4LVNB 2PUQT 2VR4A 1RJYB 3G6JE 3UJJH 5IMLA 2NX5E 1JNNH 4NRZA 1BREA 5BS0D 7FABH 1SJHB 5IQ7L 5JNYB 4CADA 3MRNB 5KS9E 4G5ZH 5JXEC 3MODH 2X2YA 3ARZA 5SWQA 3GIZL 1YYLL 4JFFD 2Y06L 1CFVL 1X7QA 2WAHA 4K7FB 1S9WA 3P4OB 4MB4A 4JM2C 4F7CB 5AEAA 3MUJA 5A2JH 4YHIA 4U6HB 4PP1D 32C2A 1OGTA 3HZMA 5D71L 1S7UA 4NC2B 4X5WB 3RL2B 3IVKB 4RDQF 4HBCL 3BYTA 3GSQB 3MRHB 3X3FH 2Z8SA 2DIAA 2G5BA 1W72H 4JHZA 1BQHG 1J11A 4PJAA 3FB5B 1M71A 3IXTB 1UH3A 5E8PA 3P11H 3TZVD 1CFTB 3K4DA 4LMQE 4JFOA 1BLNB 4OF3A 2AJYH 3NFSL 1QBMH 4QY8A 2V5SA 3U7AA 5D7JB 5HYFA 3DLQR 4Y4HB 4QXTA 1UA6L 1WSST 2OSLA 4V2CB 2J2ZA 4JHWL 4XMLH 3T8XA 4KTEL 2XQYK 4DN4H 3IDNA 2D03H 3MA9L 5FB8A 1X5KA 1CQYA 3MUGA 4XTRD 1OVZA 4Q9QL 4UILL 4JFDD 1KJ3H 5GIRA 4FQ1L 4PJXE 1KB9K 3C08H 4ZUUB 1PG7H 1NLBH 2BY1A 3AREA 3EUUA 4YGAB 4XPBH 1ETZA 4KDWA 1T1XB 4F7MA 4E41A 5EOCJ 5LGHH 2DL2A 3LQAC 3C60A 3GKZA 4M4PA 1IEAB 2VLRB 5MENE 3I9GH 1HHKA 1NDGB 1DBJH 2JCCF 3S6CA 4B50A 3BKMH 1PKQE 4G8EA 1IM9A 3RY5A 1GVIA 5GHWL 4HWEL 4NO5A 5C0DA 1UQSB 3EO1B 5DTFA 1SJEB 3DVIA 5KSBB 4ZTPL 1N2RB 5CSZA 3DVNB 5GRVL 1J8KA 3PGCA 2J3SA 1S7TB 2VITB 4NRYA 4KVNH 4PJDE 4C54A 3DUUA 5HJ3B 2MQ0A 4R2GC 3ZHDA 2YSSB 3TIDB 3JZ7A 3SDXE 4FTVA 3OB8A 4JJ5B 5AD0A 1JMZA 1QO3B 3MRGB 4WTXA 5E2TL 1KN4H 2FECL 3ZTNL 3BAEH 3JV0A 5K9OA 1IC5L 3QEUB 3U0TA 3UZVB 2DQDL 1CLCA 1P1ZB 4MD4A 3RDTD 3UXFA 4P2RD 5SWZE 5F3BA 1TCRB 1UENA 1RURH 1ITBB 1XZ0B 3T2OA 4WFHE 1ADQL 3MRFA 4PS4L 5JHDD 5GGTL 3DJ9A 4JVWA 4NWTH 4DW2L 1ONQB 3KPMA 3VXUD 3DRQB 3ZL4H 3MZTA 2VXTH 3EJJX 3VRIA 3DX9B 3Q3GB 4XCFL 3T3PE 2BDNH 3QFJA 4ODUA 1N26A 2EEDA 3IFLL 4PTUB 5E7FA 1N4XL 5EOCL 3TO2A 2YRPA 2J12B 2OJEA 4MZ2A 2FJFA 3BSZL 1NGZB 3AVEA 3D25B 4PRBA 5ISZB 3BPLC 5DJAB 4HWBH 1D9KC 4KK5D 4P23A 4HCRH 4XB7A 3RAJH 2YR3A 2I07A 1K5NB 4JM4L 2VQ1B 4OFYD 4KMLB 4LAQL 1T1YA 2CDGB 4N8VG 5E7BA 5F9OL 3RGVA 4TRPH 3PL6C 1JN6A 4GMTL 2IQAA 4FXKA 2HT4C 2YA1A 3VRLF 4MA1B 4QGTA 5ENWB 5FK9A 4OCYL 1XF5A 1A22B 5KVDL 5EIIA 5F1NB 5K59E 2VXSL 4GAJH 5HHOE 4G6AC 3WLBB 2DYPB 5DJ6A 4EI6A 1A7PH 3NGBC 4DGYL 3MRKA 4WWID 4KZDH 3HMWH 4BJLA 3VGFA 1H8OA 1VHPA 4OT1L 4XVSH 3VD4A 3KHOA 1XCTB 1T2JA 4TSAH 4AEIL 3KPTA 4FQLL 4UDTA 1UM5L 4EI5A 3KPPA 1RJZB 3HI1A 4RWHA 1ZLSH 3UJTL 4C55A 1TQBB 5JOPE 2PF6A 4JZJB 5FYLH 1CGUA 4A2LA 4P2QB 3T2PA 4OZ4A 2F5BH 4ZXBA 2XKNA 2CIIB 4J3OC 5KVGH 4OCLC 5IQ9A 5KZCD 4K71B 3FT2A 4D8PA 3FONA 2XKUA 4RMTA 3HE7B 5BXFA 2X7LB 4U1NA 3FQXA 1Z0MA 1ZXQA 4C83B 3HCVB 5CBEB 5B3JE 3PQYB 4PB0L 1H3PH 3S97C 4HH9B 4N0CC 2ZCLL 3O8XD 4EBQH 5EPMA 5KTEH 1CBVL 3G5VA 1DQQA 4UV7H 2R2HA 4L4TD 2E3VA 5LXGL 1QLRA 4YFLI 4LSUH 2BHYA 2PCPB 5A3ID 2P8MA 5CCKH 3MOAL 3KYNA 2W0KA 1KEGH 3ALXA 4LNRB 4PG9B 2BRRL 3OJMB 1A4JA 1QBLH 2AGJH 2JCCE 3ARGD 3UO1H 1MAML 2HMIC 5C07D 2QADB 4GKZA 1JZ3A 3BPOC 3MFFB 2RFXA 5E2VH 5GRXG 2VWEC 4APQD 4W4OC 4YDVB 4NNPL 2D7OA 3DSFH 1CE6B 3WE6B 1WAAE 3M1BA 3MLRL 1K8IA 4PRDB 3CK0L 3BGFB 4JY6B 3CXHK 1KYOK 1M05B 1TTFA 4Y16A 2Y72A 3QUZD 5J1TC 5CWSB 4LQFL 3IS0X 4YHZL 5M95B 2CK0H 4X7DC 1PKQB 5ALCH 3VW3H 1L7IH 4OGYL 5MEPB 3RWGA 5CZKA 4TQEL 4OJFL 2ZNXA 1PZ5B 3HFML 4LIQL 4AZ8A 2XRAL 5IB4B 3RWJA 5F72S 2YUWA 3V79C 3VFOB 2ADIB 4NCC1 4L29B 3L3HA 3ULUH 4O5LH 3S5LA 3QBTB 1KIPB 3LHPL 4O00A 2JJUA 3BKJL 3U9PL 3D3VA 3NFPA 5C0BD 1JGUH 1RZ7H 2ED7A 3SDXB 2CKBH 4JO4H 2V2TB 5DLML 3HNSL 3B5TA 3ARYA 1GGTA 4LCUA 5ITFA 4RFNB 1MQKL 5DC9B 5F1IB 1CFBA 2A6JB 3CFCL 4P48A 5I71B 1BQHB 3V6OA 5DRNA 5E8DH 2FX8H 1NCDH 3ZKMD 5DI8A 1NL0L 3KYOA 2BFVL 3VWJD 2EZ0C 5FM5O 3B9KB 5DSCB 5IHZA 1UVQA 3GJEA 2DQEL 3CPLA 2HVJB 3RVTD 2P8PB 4ODXB 1IBGL 2Y07H 3AU1A 4BFIB 5JIPA 3VA6A 1KPVB 4YIQB 5FYKU 3VRLE 5J56B 4OCRL 3OJDB 2BJMH 1Z9LA 2X1WL 3OAUL 4NJ9H 5DK0B 1A1OB 1H3WM 3NCEB 3TVMC 3S8WA 1HYRC 3WDJA 1FNLA 1XH3A 4H1LH 4LSRL 3V0AC 3K7UA 3FT4B 3RZCA 3BRDA 3P4MA 2WINA 4YDIH 1LO3L 3BVNA 3GSWA 2XTJB 5LG1A 6CGTA 4DFIA 5I8CA 4Y8DC 4AL8H 1FAIL 2V2XA 5GRYA 5IROA 3UTPE 1IAMA 3BJLA 4D0DB 5E4IA 3EJYD 2EE2A 2Q7YA 5HHOB 1AR2A 4JPIB 2BCKB 2DKSA 4XCNA 4BSWA 4PGBB 2QHLA 4R4FH 1KB5B 3U9UA 4WW2A 3KAAA 4KTYA 2DJUA 3FB6A 4ACPA 2XZAL 1UB5B 1YECH 1M6OA 3KXFD 2D7PA 4KVCL 4JPKL 2VRAA 3PWLB 2VDKL 4XMPH 5HGHB 3RWCB 2VXQH 1MWAH 1IRAY 3TT1L 4XWGH 5FDWA 2DD8L 3H7LA 5D7SH 4HQQH 3ARUA 3V6FB 4F7PA 3MBEC 1HYSC 5KSVA 3MRMB 3T3ME 2UZYB 4HMEA 1RIUH 5GPRA 3TP4A 4AENB 5C2UB 1LQSR 1INDL 2QR0B 4GXUN 4HS3A 1G9ML 3SE9L 3VXSB 5IJVB 3H3BC 2IMNA 4U1GB 1DVFA 4ZYKA 4JQIH 3AS2A 5I1IL 1F4YH 4PRPE 5I6XC 4HDIB 1MCEA 2AK4B 2NXYC 5T3XL 2C4FU 2GTWB 5GGRB 1RUPH 4Q7DA 4K3JL 4KY1H 4J4PA 1UXSA 3ALPA 4PYGA 4MA7H 4HWBA 1AXSA 5DURD 5LQBH 4HCRA 1I9IH 3BXNB 4U1IA 3KPQA 15C8H 3L3DA 1MFCH 4Q6IA 1AO7D 2J8UB 2COQA 5HGDA 4XP6H 4XT1C 3LB6C 3MUHL 3RUGA 3WHE0 1HKLL 3MRCB 1W8NA 4HS8H 5KSAC 3F7RA 3ARDA 5BRZE 3L3JA 1R24A 4LHJB 3WS3B 4MJ2A 5CBAB 2R15A 4EOWH 5L2KA 1U8JB 4K23H 1FDLH 3UJJL 4HUMB 4GAYB 4BZYA 5CD3A 1JNNL 1MY7A 3S96A 7FABL 4DJMA 4LCCC 4G5ZL 1MCIA 1XGPB 3C9NA 3L5XH 3VFPA 3TO4B 5FGSA 1V7NH 5E2UH 5GZOC 4G8FB 3VFWB 1B2WH 2P47B 1OF2B 1MHHA 1AKJB 4KUZH 1GH7A 1CE1L 2BSRB 2RB8A 1KCKA 1PEZA 3HPJB 5LJYH 4HFWA 3FQUA 3X3FL 4KJQD 3QEGL 5GS1C 2E6JA 3OF6D 3UBXA 1HHJB 4ZNCD 4WV1B 3V0VB 5DO2D 5EZJA 4BQ6A 3P11L 2Q3AA 4WHCA 1KN2H 2VLKD 3L3OB 2AJYL 1CFQB 5ICZA 4KKBC 2Q8BH 3LQAH 1QBML 4PJ5D 4XMLL 4K2UH 4JFZH 4HUVA 2DWEB 4DN4L 1T7YA 3FKUS 2D03L 3O0RH 5H94A 2VR9A 1NAMB 5FUCE 4NQTA 3AM8A 3I6GB 1Z9SA 1KJ3L 1AGFB 3G5YB 5MERB 1T3FB 2ESVB 4DKEH 3C08L 2ICWB 1PG7L 1NLBL 4XPBL 1EGJA 1HDMB 3CCHB 4M8QA 1RVFH 2OJZH 3U4EB 2DI7A 3ARWA 2J6EH 4WO4C 5LGHL 4NBYB 2IH1A 4XHQA 1JNHB 1U8PA 4LVOC 2X4RA 4YHYC 4Z95H 2NZ9D 4ZFOB 3TJEH 1AGDA 3I9GL 1DBJL 1XIWB 2W9EH 4EDXB 3STLA 2FRGP 4KJYA 4OBRA 2PW2A 3BKML 3IU3A 1DEDA 3IFPB 4RMUA 4ZO6A 3NIGF 4WI3A 2C3XA 4MB5A 2CLZA 3CNKA 4I0PB 4NPYA 1G7PB 5C0AD 5D5MA 4PJ8A 4WFGD 2QQLH 3QDHA 2DF3A 3DVGB 4Y5XB 3DX8B 3QXDA 1P84J 5AUMA 4M6NH 4NJAH 4TUJB 1I1AB 3KWWB 1BOYA 1K8DA 4KVNL 2I24N 5H37G 1MI5E 4Z7OF 2ADGA 3BGAA 3GSVB 3IFOB 2EKSB 4M5YH 3OR6A 3GMOB 4ZSOA 3OKOA 2V5MA 1X5LA 2NY7H 2H8PB 1G0XA 2C1PB 4PJHB 3BAEL 4KXZH 4OGAD 3ELAT 3FHQA 2J5LC 3DGGB 5IVXE 4M1CC 4BELD 2WUCH 5GISH 1U3HD 4X4XA 3CIQA 3RHWK 1XGQA 1AD0A 4K3HA 1LEIA 1RURL 1QRNB 2EYSA 2BVYA 5DUMH 3BPNC 4FG6C 2CKBA 2X9WA 5GSVA 4ONFH 1CXEA 3QIUC 4NWTL 3UTZA 1ZVSA 1B6UA 3ZL4L 4BH8B 1A4KB 3FO2B 2VXTL 4HC1H 2HFEB 2BDNL 2BMKA 2VN4A 1U8KB 3D18A 4MAYB 3L5WA 4U2YA 4NDMA 2DL9A 4R0LA 1T7ZA 4DAGH 2X4PA 3WIFB 5IR1B 4YQXH 2YD8A 5EO0B 4F8TA 3E2HB 4HWBL 4HF5H 2ZUSA 4RMWA 4Y19D 4HCRL 3CFJB 3RAJL 4D0BB 1BF8A 3OR7A 1ZHKB 2CO7B 3X12A 5F7DA 1N5AA 4YK4C 4FN0A 3IDUA 3N1GC 5IEHA 1P7HL 4TRPL 4CVXA 4CADB 5F88B 1C12A 2OMBA 4X6CB 4U05A 2VUOA 3HZYA 4RAVB 1IAIM 3T4AB 3OTTA 4M7ZB 3MLYH 1HEZA 5DVNA 4KJWC 2YN5A 1X7QB 4OLWH 2BRQA 3FL7A 4YHIB 4U6XA 4KK8C 4PRHB 1EA9C 1HZHH 1OAUH 1A7PL 3MV8D 1C5DB 1L7TH 3HZMB 2IPKB 4EUPA 4Q9CA 4LQ1A 2HFFA 1NCTA 1FNAA 5F71A 1UKSA 5BO1L 4KRPC 5C09A 3HMWL 4KZDL 1Z2KA 4XVSL 4TSAL 5DJZB 2XY2A 3FQTA 3TBWB 1W0WB 4NHUA 5FOBA 5FYLL 1RK0A 1PBYA 4P2OC 4G7VH 3ULVH 2VC2H 2F5BL 5FM8A 3EYVB 1NC4D 2OSLB 1VPOH 5FO9A 4OZHA 5HPMA 3IDNB 2PYEA 2B7DT 5JIIA 5D1XA 3TBSB 4MNQE 1MWAA 3TYGH 5DD6A 5GIRB 5EC1B 3GZKA 5HDOA 1UCTA 4N0UA 3ZT5A 1MFBL 4QOKD 3X17A 2YD1A 1H3PL 4KKNA 1A1MB 3F7VB 4J3XA 4ZFGH 2IH3B 2HWZH 2MKLC 4EBQL 4QGYA 1MLBA 2X10A 5KTEL 1HHHA 4GBXA 4UV7L 4Z0BH 3VJ6A 1JP5A 2AVGA 5I19H 5JXED 3A6CL 3SY0A 5I18H 4P46B 3RNKB 1R6VA 4OCMC 2P24A 1J8HE 1EGJL 2W91A 3UPRA 5CCKL 3PABA 1IM9B 3O4LA 1KEGL 1FYHB 4JM2D 4NO5B 5C0DB 1QBLL 1OLZA 2AGJL 1MJUH 4M9PA 1TENA 2A9NH 3UO1L 4XNZC 4QRSB 3NIGE 4X6FB 1RHHA 4R4BB 5DEZA 1FYTE 5E8EA 3GB7A 4OZIF 1CXHA 2YD5A 5E2VL 4EQ2A 1XGUB 4JVUA 3FFCE 3DUUB 3C8KB 1FSKB 1P9MC 4LEXH 3T77A 3DRTA 3OBAA 1WF5A 4M48H 2NY4B 3QG6A 1FVDA 4Z7OE 5FF6A 1XEDA 2KBGA 5LVEA 3TA3C 5I1LA 3CFDA 1RZFH 5K9OB 4UNTA 2ZOKA 2Q3ZA 1NC2B 4IMKC 4KKLC 2PTVA 3U2SA 3TWCH 5DF0A 1FG2A 5ALCL 1KGCE 3VXQB 5FOJA 1L7IL 1LP9F 3UYPA 1DEEB 5TQ0H 1JYNA 3QIBA 5DRZA 4CVUA 5F9JB 2YZ8A 3RJDA 4HIIA 3B9EA 4P3WA 3MRFB 2P49B 4X0KB 1F97A 5TFSH 1D5MA 1FFNB 3ULUL 3KPMB 4O5LL 4OUUA 3R1GH 1DE4A 4XAWH 5D2NC 3IAQA 2D3VA 1DQMH 1JGUL 1RZ7L 5I16B 3LV3A 1NMBH 4DEPB 2CKBL 3TO2B 2ZOLA 4WUUE 1GIGH 4KC3B 3SDAB 2OJEB 4ZOCA 3OSKA 5DR5H 3QAZB 5C0CE 2LAGB 4JFHD 4LBEA 1KEMH 3SE4C 4RGMB 5DJYB 4Y4FB 5IB2B 4NN6B 3MGTB 1VFAB 4L3AA 3EIFA 3SKUD 5J7CC 3MOQA 3N1FC 4TTDC 5E8DL 2FX8L 2Z8WC 1NCDL 1KPRB 2ITCB 4XRCA 1U8NA 1DUZA 2W9DH 3BP6B 4FXKB 4R2GD 1ZHNB 3VWKC 1BWMA 2Y07L 4FQQA 1G9NC 4QWWC 5FK9B 4ELMF 1G6RB 5C0FB 2HT2D 1OAKH 1AQDB 1KBGH 2BJML 4TSBH 4LSVH 2ZG2A 1CWVA 1UFUA 3AC0A 4NJ9L 1H5BC 2DIBA 2J6EA 4TNWF 5E6IB 1I7UA 4NKOA 1QP1A 3VD7A 3ZKXB 1BD2B 2RBLA 4S2SA 2APFA 1TZIA 4YDIL 5T1LD 2GAZB 1DBKH 4CW1B 1OGAE 3VXTA 4AL8L 1MHPH 1I7ZA 4L3EA 4ZXBB 4BQ8A 4JDTH 3VXME 2B39A 1WICA 1E4KA 4OZFH 5D93C 4ETQA 4MJ6B 3VRJB 3CU1A 2Z31C 1E6OH 4NM8H 3TNMA 4U1NB 3FQXB 3D2UA 5EIVA 4HV8A 5FYJH 1WBXB 4EVNA 1HILB 2WLZA 4Z8FH 1D9KD 4H0IA 4JLRA 4JB9H 1CL7I 1YECL 5JUEL 5D7LE 1CICC 3NN8A 3LKOA 4JREB 5D1QC 3C2AH 2FO4A 5EPMB 2ITDA 2MSPA 1JVKA 2R2HB 4XMPL 5GGRY 3PL6D 2VXQL 4PLKD 5F9DC 1BF2A 3PWPA 1MWAL 5C2BH 5MEQB 2DQTL 2HT4D 1W0YT 3DV6A 4W70A 4IRJC 4XWGL 5EU6D 5GGSY 5D7SL 3JTTB 4HQQL 2UZIH 1JPFA 3L1OH 4OD2B 3ZTJG 1MRDH 5D2LE 1QQDB 3X13A 3H9HB 4WWKA 1KOAA 2YD2A 4G9FE 4LCWA 4U31A 1RIUL 3GK8L 4PBXA 5EUOA 4YAQA 1D5ZB 5DT1H 1NFIA 5EORH 5JO5B 3LPFA 4HC1A 2VH5H 1JL8A 3SGJA 2HVKB 4NQCA 4WU5B 1REIA 2VLJA 4OZIE 4JQIL 1F4YL 4LRIA 3A67H 35C8H 4MCZA 1RUPL 3TBTA 4N1EA 4R4NC 4KY1L 4MA7L 4WJ5B 3HG1A 3P9WB 5LQBL 1I9IL 1UJTA 3K1KC 1MFCL 2AQ1A 4KHXH 3MGOB 2AJVH 4XP6L 1I4FB 4HS8L 4UT6H 1R3KB 4OLUH 2JELH 2VABB 4IDLA 5A2IH 4X6DA 1XCQA 2LU3A 4PJCF 1LP9E 4EOWL 2A38A 4K23L 1FDLL 1AIFB 1BJ8A 2ED9A 1OSZB 3G5ZA 5J1SC 4N0CD 3BPCB 3G5XB 5DJ8A 4ALAH 5E5MA 3T0EA 2ARJA 4OD3H 1CTOA 3WJJA 3SJVA 3D3VB 3L5XL 1ZGLP 5DK2A 5A40E 5IW1A 1V7NL 2A83A 3ZSTA 3BKCL 2ATKA 1B2WL 3ZKSD 4KUZL 5HY9B 3MRDA 4LCUB 1WWCA 5GS0L 2HMID 1Q9LB 3QNXA 3LN5B 4PJIB 5IW6B 2XN9B 1RI8A 3O3DB 4Y88A 3BYYA 1I75A 4IHOA 4M6OH 1DFBH 1VADA 3DROA 4JO2L 4O51A 5C0NC 1ZA3B 2HJFA 4MAUL 4ISVA 2VR5A 1YQ2A 3QXUA 3O3EB 4PRIE 3LQAL 1HQRA 5D1ZD 3QUMH 4LLWA 2I9LA 3LIZH 1N8ZA 2F53D 3JV5A 4ELME 4YUEH 4OZGB 4K2UL 4JFZL 2A73B 4EUPG 1N0LA 3O0RL 5BVJA 5KAQG 5C1MB 1UXWB 3R06A 4DUXA 4H8WC 3VXOA 1ZLWK 1IGCH 3PGDA 4DKEL 5T3ZE 3S36H 4A6YB 2OJZL 3BVNB 3O6LH 2W59A 2J6EL 1MFDH 1TVHB 1J1XH 4WI5A 1CD8A 4HX1B 4Z95L 3TJEL 3M17A 3WNOA 3KG5A 2W9EL 5C08E 3QUXB 3QI9D 4Z7VF 1CFSB 4MD5B 1EBPA 3O2DH 4PLJC 4N8PA 2Q86A 4JFED 1P4LB 1D6VH 1I8LA 1U42A 1KTDA 1U92A 2H32A 1JWUA 1FN4B 2QQLL 5AAMA 1BECA 4OBSA 3DUSA 4I0CC 3QEQD 4NJAL 1M6OB 4QEGA 5CKGA 5ACLA 2YWZA 2EYRA 5IV2B 4QLRA 2BOBB 2DM2A 2EZ0D 2E7LA 4M5YL 2O5YL 1UZ8B 3OWEA 5FDWB 1MJJA 3NFNB 5TE7H 25C8H 2FJGB 1H8NA 2NY7L 4PLOB 4HZLA 1TQCC 1HNFA 2AJZB 2JIXB 3DHMA 3K2MC 4ZUSA 2KL6A 3BP4A 4G43B 3RIAK 1A2YA 1A9EA 4NO0D 3TVMD 1OAQH 5GISL 2Y25A 4ETYA 3BISA 4Q0XH 4JRYA 3RPKA 1UH2A 2GK0B 1E28A 3DV4A 5DUML 4M62H 4ONFL 5DJDA 3QEHB 4Q97A 1TTGA 2HA1A 2NY2B 4N5EC 3SGKA 1FZJA 5H35B 4BQCA 1UXSB 1A7OH 1YEHH 4HC1L 4WU7A 1HCVA 1WBZA 1AXSB 1H3GA 5JQHC 2HT3C 4Q6IB 2VXVH 3RUGB 1TXKA 3VG0L 2IPTH 1FFOA 1TJHH 1MCWW 3QO0A 1S7QA 4YQXL 3L3JB 1R24B 4DVBA 3GGWA 4ONOA 5DYOA 2NX5D 1I7RA 4K7PH 4KUCD 1EO5A 2A6KA 2W65A 5C0IA 1J0JA 3SCMD 3KHQA 4PJCE 4OIBA 4CU6A 4LP4A 3GBMH 5DFWH 2Y36H 3SE3C 5I1KH 1JPSH 3GJFA 4U1HB 3Q1SH 3DMMD 3MLYL 2R23A 3TJHC 2KH2B 5FYKE 3I02B 1FNFA 4OLWL 1NGPL 1CS6A 3A0OA 3MBED 1HYSD 5INCB 2NXZC 1MHHB 1OAUL 1HZHL 3UTTE 1GHFH 5CJXA 1MLCA 5FYJD 1VACB 3LRGA 2GITB 2HTKC 4RX4A 5HYSA 1FL6A 1SJXA 3QDGA 4TOYH 1EAPB 2B4CH 3QQNA 3F12B 3WIIH 1KFAH 1T7VA 4GW4A 1ZSDB 2JB6A 4CDHA 5ICZB 4G7VL 1J9CT 5SV3A 3ULVL 2VC2L 2P44B 3K3QA 4H0GA 4ZDHB 2C7UA 5DJ0B 4MGXA 3JTSA 1VPOL 3DECA 4O58L 2QQNL 2K7QA 3H9ZA 2R4RH 5HVWA 3LB6D 3H9SA 3HHRB 3VE0B 3O41B 5KSAD 4WEBH 4DK6A 4Z9KB 4OF7A 4Y8AA 3TYGL 4BSVA 5JHDA 5GJSH 1CI5A 3BIKA 4DOHB 2YUVA 1FIEA 5E8OA 1OP3K 2A1WH 3GSOA 3QCUH 4ZFGL 2HWZL 4G8GA 2VERN 1U8PB 1T89C 2XY1A 3HI6H 5MEND 3BZEA 4Z0BL 1E6JH 5I19L 2XOTA 4S11A 1JHLH 4AEEA 3DHJA 4P3CH 3O2VH 5I18L 4HIJA 5IBTH 2H9GA 4KJYB 4XP1H 3MNWA 4EEEA 2PW2B 5GZOD 3OXSB 3BD5A 4V1DE 2CLZB 1MJUL 4UV4H 2A9NL 5D5MB 1E4XI 3OV6A 4HKZA 5MI0B 3C6LC 5DMGC 5E70A 3NCYS 1IGTA 3V5DA 2I60H 3L7EA 1Q94A 2CGRH 1LE5A 1QFWI 4IRSB 5AYQA 3N9GH 3VI4E 4LEXL 4M48L 2YPLE 4KKBD 1EX0A 1UYWH 4QCIA 4F7EA 1RZFL 1FV1A 3HR6A 4RISH 3KPRD 3TWCL 5SWZD 4M7JH 3IDXH 4X4XB 5TQ0L 3I84A 1XGQB 5TE4H 4U3HA 1LEIB 1M7IB 4U1LB 1HXYB 4YNYA 4PJFB 5TFSL 2YD6A 4J2XA 5HYJA 2WP3T 4HG4J 2R0KH 3GIVA 4MZ3A 1ZVSB 1ZTXH 3CX2A 4S0SD 1MIMH 4WO4D 4Y4HC 4D0CA 4J7RA 3R1GL 4XAWL 4FXGA 4YDLC 4XNMA 2A2QT 1AY1H 5IF0A 3D18B 4M3KB 1DP0A 4PRNB 4DGVH 3FRUA 3ME0A 1BM3H 4NDMB 1NMBL 1G9NH 3QDAA 1E4WH 1GIGL 1DQJA 1CXFA 1N59B 4IRZH 3EYUH 3PG2A 5E00B 3IF1A 4QHUB 5DR5L 1EMTH 5I75C 1T5WB 1KEML 2OCFD 1VKXB 2EDHA 4L4TA 1J0YA 5F7DB 3X12B 4XBPA 4MD0A 3PGFH 2R9HC 1HHGB 1C12B 4QRPE 4P57A 2W9DL 5DJCA 1L0QA 1KJVB 3HKFA 3HZYB 5DVMA 1X5AA 1NDMA 2IEPA 3DXAB 5ANMA 4MLIA 1OAKL 5E5RB 1KBGL 3KJ6H 2CR6A 4P5TD 1LMKA 4TSBL 4LSVL 2CUMA 3SEPA 4UOJA 3IDYC 4PJAF 2GYSA 1XF3A 2Y9RT 4M1CD 4LLQA 3ABZA 1S9VB 4PREB 1QRKA 1GCFA 2OZ4H 2OXGA 5JOPD 3FQTB 4AQ1B 1WTLA 3V4PH 1A0QH 2XQBH 1T4KA 4FG6D 1DBKL 5FOBB 1RK0B 3PHQA 1MHPL 5MP6H 2SEBA 3IU4H 4KROD 4YDJB 1PY4A 1I3VA 1U2CA 4GG8B 3K46A 2ERJB 3UTQA 4WEMB 4EN3B 5D7KE 1HE7A 3MBXH 4G80B 1E6OL 4NM8L 4Y1AB 2X44D 3U46B 2IMMA 5FYJL 4GRLA 3GHEH 4Z8FL 2VAAA 4W6YB 5CIPA 5CP7A 2BNRB 1BIIA 3WN5A 1FC1A 2WWKO 2YBRB 1VFBA 1XGRA 3QA3A 3C2AL 3H7BA 1FJ1B 4MXVF 4FNLH 5DVLA 4M7LH 3MV9E 2EDXA 2NY1B 1A9BA 3LCYA 5JLZB 1RQ5A 2AI0H 4KJWD 2UZIL 1QSFA 3PWUB 3GSNH 1RZ8A 5IK3A 1MRDL 4IOFC 1NGYA 2BY3A 2E9BA 4FQXB 2QL1A 4KK8D 2WSKA 3IJHB 3C5ZB 1S8DA 3JWNC 2GW5A 2YA0A 5DT1L 4P0DA 5E8EB 4N90E 2BVQB 4MJ5B 5EUKB 5EORL 2X1XR 5I73B 2VH5L 1AJ7H 3WJLC 4MA1C 1F11A 1AD9A 3RY6C 3CSYA 1ORSA 4NNXA 5ETUA 3M45A 1G7LA 3A67L 35C8L 1RIVH 4NRXA 3QG6B 1GZPB 5IEKA 2YN3A 4P2OD 5FF6B 4QNPE 1CFNB 4DCQA 1YEDB 5BOPA 1IQDA 2D4DA 4PY7B 3GRWH 1RULH 2ATPA 1MCSA 4KHXL 1Q1JH 3U2SB 2A74A 2AJVL 4XGZA 1PX4A 2EH7H 4P4KA 3IJYB 3QUYD 2MPAH 3F7YA 4U0RB 4UT6L 4WVRA 5GSRB 4OLUL 2JELL 3QUKA 4Y5VA 1FZKA 3W2DL 1YQVH 4JAMA 4Y5YB 2CD0A 5IB1B 3EDJA 4O2EB 4IMLB 4OUUB 1C08A 3BESR 4LSTH 2FX7H 4OD3L 1JI1A 2YS4A 1T2XA 4Y0GA 4DK3A 4GRMA 2QV2A 5C9JA 5EC2A 1S5HB 5GJTH 4NN5B 1AGEB 2ZOLB 1BZ9B 1WFNA 5JOFA 2QLVB 4D9LH 2OL3A 2X70A 4G7YH 1DBAH 1YN7A 2ZUWA 3PF2A 3KXFA 1DLHA 5I8EA 3C09C 2VISB 1LD9B 5BV7H 4CMMA 2EXYC 1MCFA 2D0HA 2ZSWB 4M6OL 4HUWA 1DFBL 3SKOA 4X8JB 4GRWF 3DO7B 3L3KA 3LD8C 4GKOA 4YHKH 2ICWI 4NQEE 1U3YA 5JORB 2DI8A 4PJBA 3VFVB 2QADC 1X5IA 3QUML 2IAMC 3LIZL 1P4BH 1U9KA 5CGMA 1J05A 3LMJH 4YUEL 3A6OA 4KKLD 1GL4B 3AB0B 5EZLA 3CFKA 4PJGA 3D0LA 3P4NB 1U8OA 4JFXB 4LGPB 1JTOA 5HDQH 4X7FC 2PXYA 1R5WB 5IOPA 1AXIB 4H25B 1IGCL 5DRWB 1LO5B 4JFFE 1S3KH 2UUDK 3QH3A 4S2SB 5GGVL 1I8KB 3EOAB 3O6LL 3STZB 3UTPD 1K4DA 1MFDL 2VLLA 5CS7A 1J1XL 5I30L 3VDBA 1QSEA 5SWSB 4CBPA 5FKPB 1T66C 1U6AH 4QRPB 2YA2A 4XVUC 3QB7C 3LQMA 1Z9MA 4CNIA 3T0XA 4UDUB 1RZJC 3VH8A 5AAWA 4PFEA 5F8RC 1KLUB 1P7KB 1D6EA 2P5EB 3RQ3A 1D6VL 1OWRM 3TNMB 3IJSA 4N9OB 2Z91A 1ZVHA 1QR4A 3O9WC 2GJ6A 4K94C 4X98A 3RTQB 4JKLA 4ZNEA 4E41E 4YBLC 1SMOA 3GMRB 5CJOH 2PNDA 4O2FB 3S35H 1HIMH 2DLHA 5IMKA 1GOFA 3MLTA 3G6DL 4K8RC 1JUFB 5ALBL 1I8MB 3TPUA 3VWKD 5J1AB 4HKJA 5TE7L 25C8L 3HE6C 1LE9A 4QWWD 1BFTA 1IAKA 1UJ3B 1JPFB 3D85A 1ZGLB 5DEFB 2P5WB 3RWHA 3UTSB 5LKNA 4N8CH 3SDCA 1L4IA 2Q76A 4TVPL 5LGJB 5D9SB 4I18C 5K9KB 3GMQA 3OF6A 3MV7A 1WCBA 5DS8A 3UAJC 2C3VB 1AP2B 5E24E 1OAQL 3QIWC 4J3VA 3KPSA 3BKYH 5B8CC 3IRPX 2IANA 1CXLA 4YHNA 3O6FD 4PRPD 1S7XB 4MDJA 2VLKA 5JDJA 1PQZA 1LEGB 3AMKA 3QQ4A 4FTVE 4XVTH 1N6VA 3VXRB 4LIQE 1YEHL 2A0LC 1BHGA 3T1FA 1HH6A 3D5OF 2VXVL 5BRZD 2XWJA 1CGXA 3SKNB 5EU5B 1BZ7B 4L9LC 5C0GB 4QF1A 2IPTL 1TJHL 4KI5F 4X6DB 1T0PB 2H2SC 4F9PC 2NCMA 4K7PL 3ARFA 1XF2B 2XA8H 1BBJA 3V2AR 1OAXH 3G5ZB 1CICD 2FSEA 3GBML 5D1QD 5E5MB 4ZS7H 1TZHA 2Y36L 5I1KL 1JPSL 4RGNB 3WNPA 1II4E 2ARJB 5I17B 3Q1SL 3QFJE 5DJ2B 3K0WA 5J6GA 1GC1C 4PV8B 2HJLA 4IRJD 3W5NA 2AV7B 1JMXA 2XXMB 3Q5TA 2ATKB 3FOMB 4QRRE 2EE6A 1CL7H 4I48B 4ZUWA 3N85H 2ICEA 3QFDA 3C5JB 4HZAA 4MXWH 1GPOH 3NCBB 1KUMA 2GFBB 2R0ZH 2XV6B 4E0RA 4P46D 5BW7C 4CDGC 2B4CL 2Z93A 4LPYA 3WIIL 1FVCA 1KFAL 3DROB 2ADJB 3ILQD 4Z5RB 1IGMH 5MEOA 4M7LT 1DUYB 3O2WH 2HJFB 2R69H 2XICA 2F74B 3EFFA 2Y5TA 4PR5A 1HQRB 4WNQB 3S4SB 3MQIA 1N8ZB 2MWCA 4MA3B 3FO9A 1S7RA 5MHSE 2R4RL 1S7VA 4JRXB 4YHMH 1IE5A 4G8IB 5SX5K 4WEBL 5F1KC 2KQMA 4ZODA 3ZHLA 2DICA 3SDDB 1OAZL 4AYFA 2A1WL 2OQJA 1AHWC 4XB8A 1J1PH 3HI6L 5HI3C 4M1DH 4PD4K 5FECA 4HD9A 2CPCA 1QHOA 1E6JL 1FAKT 1JHLL 3S34L 1RHFA 1CU4H 3O2VL 4P3CL 5TH2B 5A43C 5IBTL 4XP1L 4NQEB 1Y18A 4WDIA 5GZNC 4WW2F 1J0KA 1NMCB 5SX5H 1O5DT 1MFNA 4UV4L 4Y19A 1U92B 3MFGB 3LEXA 2H3NA 3H42H 1OM3H 2D4FA 3LN4A 4C57C 5D70H 4OD1H 5FFLA 4Z0XA 2GSIA 5BS0B 3S98A 3ULSB 2I60L 1MI5D 1WVZA 5F7KC 4H26B 2C26A 2CSPA 4LAJH 1JGEA 2CGRL 5SX4H 3WL9A 1FNEA 4JFFB 5HD8C 3N9GL 5C0ND 3T4YB 3BH9A 4P9MH 1MJJB 2IF7A 3LKNB 1RD6A 3VFTA 1UYWL 4R7NA 4U1KB 2IWGA 4U4BA 1CVRA 1IGFH 4RISL 2R1YB 1S7SB 5T3XE 2ADFH 4G3YH 4M7JL 4NOFA 2CK2A 1FO0B 1YNLH 3IDXL 1CK0H 3S3JA 1J0IA 4Y4KA 5TE4L 3TZVB 1NCCL 1P2CB 3QZWA 5FUZH 3D9AH 2AJUH 2XQYG 1Q9OB 2R0KL 4N5UA 5HVHB 3MLZH 4BM7A 3BEVB 1NC4A 5DVKA 4WU7B 1WBZB 5F3HB 2JF1A 3RUGF 1AY1L 1T04B 4KMTH 4DGVL 2UZXB 1BM3L 4HGWB 4IIQB 1G9NL 1VDGA 5E4EB 1E4WL 4PLJD 4JFDB 3LKQA 4IRZL 3EYUL 4LKCA 5E1HB 3QO0B 1EMTL 2EDFA 3GGWB 1T83C 1MCOH 3H3PH 4OB5L 2W65B 4KFZC 4KI5E 1YUHA 4WI7A 4AIZA 2Z9TA 1KJ2A 2XWBB 4XP4H 1HQ4A 1WGOA 2CQVA 2V9RA 1P6AB 3DARA 4L8SB 4ZD3H 3TV3H 2WBJD 3W0WD 4BKLA 1IFHH 2VDMH 3KJ6L 3I6KB 5EU7E 2ZCKH 1RY7B 3D39D 4LKXB 1U8MA 3QWOB 3CJJA 3KLAB 1DQLH 2RGSA 3OKYA 1KELH 2E9WA 3T08A 1SMAA 4X4ME 1KXTB 3RVVC 2A6IA 3V6OE 4NKIL 5T1KA 1YMMA 2OZ4L 5F7HA 3V4PL 3OKDB 1A0QL 1EH9A 2XQBL 1MHEA 1TPXB 4WI9A 2EDEA 3V5KA 5GS2H 1SVZA 1NFDE 5MP6L 3PWJB 4XBGA 3IU4L 4N5ED 1F5WA 1S9XB 5HGBB 3JTSB 1BMGA 4M6AA 1NGXA 2HT3D 3RDTB 3VFMA 3E1F1 3VGHA 3HUJA 4P2RB 1MRFH 4LLMB 4MNQD 4ZUVA 3QT2A 3MBXL 3IETB 3S88H 1U95A 4XI5C 2FEDC 2F58H 4BSVB 1G7JB 3O45B 1CD1B 3EO0A 3GHEL 5AG8A 5JHDB 3BE1H 1EO8H 2YPKB 3GFUA 2G75A 3B9AA 3ARBC 3VXUB 3WYRA 2PYFA 4TNWK 1NCBH 3QDME 3DGCR 2JJSC 4LCYA 1Q9WA 3BEWB 3GMPA 4M7LL 1J8HD 3LKRA 4M61A 5FYJU 4POZC 2E9JA 3F62A 3TJHD 2M26A 5D5MF 2AI0L 3MLPA 3VH8G 3BFOA 2UVFA 4PG2A 4I1NB 1N7MH 2NXZD 4X99A 4B0MM 1UH4A 1FYTD 1MVUB 1FZOB 2GJZB 3H3KA 2JB5L 5B21A 3FFCD 1U91B 3GKWH 3MREA 1AJ7L 1SY6H 4JFYB 5CSBA 4YH6A 1TZGH 4XCEA 4YJZL 3AUVA 4LVEA 1LE5B 2MMXA 4H20H 4X83A 1RIVL 3ZT6A 4F57H 1R3JB 1NBYA 1EFXA 5DHVA 3MRPA 5B22A 4QCIB 4NZDA 1ORQA 3OQ3B 4F7EB 3GRWL 1RULL 5EU4B 4OAWA 5I2IA 2EDOA 2GK2A 3WFZA 1Q1JL 2BVEA 1KLGB 2EH7L 1WIUA 2MPAL 6FABH 3GDBA 1YEIH 1YQVL 5DFVC 3J7HA 4EZMA 4RIRA 1FG9C 4GG6E 1YC7A 2F54D 3T0AA 3HPLB 3WIHH 4RBPK 4QTHB 4JQVA 5DXWA 1CT8A 3FQWA 1NKRA 3GIVB 1R3LB 3MRJA 4Y2DA 1XF1A 4NO3A 1ZLUH 4LSTL 5KZCB 2FX7L 1ED3A 4XNMB 5A2FA 1T0NA 2LV4A 4Q2ZB 4WUUD 4ZFZA 5GJTL 1JHKH 3BIBX 5HDBF 3N0PB 3OGOE 3GHBH 1DQJB 5C0CD 3VCLB 4D9LL 5JIHA 3AREC 1IJ9A 3IF1B 2EDQA 3WSQL 1DBAL 4MXQC 5L2KE 3C6LD 3SQOH 5DMGD 4R7DA 3O8XB 3N1PC 3DSNA 3C60C 4G6FD 1TMCB 4L4TB 4XBPB 1EEYA 5BV7L 1S9KC 3EDFA 2NTFA 5EU6A 3OPZH 4L4VD 3BDBA 4AK1A 2X4TA 4MNHB 5DJCB 5L0QB 2O61B 5CUSH 2I5YH 1E4XH 4YHKL 1NDMB 3REVB 2D2OA 3LRHA 3ARGB 1WZ1H 1Y6MR 5KAQF 1FFRA 5C07B 1P4BL 5L9DL 1RZKC 3LMJL 5TJWK 5INDB 3D87B 2G5RA 5JNYA 1SJHA 1RZJH 2Y4SA 3MRNA 3JUYA 5FYLE 4NN7C 4I13B 1BEYH 4RAHA 1QFWH 3FJTA 4NQXA 4APQB 5HDQL 3G9AB 4QHNB 5L6YH 1JZ4A 1TETH 4AMKL 4K3EH 3RWFB 1I9RH 3HZKA 3P4OA 1S3KL 1YDPB 1OGAD 4CVZA 4M5ZH 3CSBA 2WIIB 4F80A 4JR9H 3IVKA 4X5WA 4XNYH 3RL2A 2O5XH 1B0RB 3VXMD 3QUZB 4OZHF 3MRHA 4XNXL 1U6AL 3IAPA 3DX6B 4EXKA 2HFTA 4UI2A 4K8RH 3FB5A 1KACB 1WUNT 2IBBA 3BRGC 1W72B 3IXTA 3IB4A 5FEBA 2QSCH 3PWVB 3JWOC 1CFTA 3V95A 4FZ8L 3SPVB 4N0YH 4M9OA 1IAOB 3ESUF 4YXHH 4KZEH 1I85A 5D7JA 1I1RA 5D7LD 5CP7B 3QR2A 1BIIB 2ID5A 1CVSC 2UY6A 4PJ5E 2VMFA 5CJOL 3BWUC 1HIML 2JJTA 2R9HD 4QYOB 5C0BB 1NQBA 4R90H 3NIFF 4X4YB 4LFHD 1A9BB 1KPUB 2W60B 1BQLL 3BP7A 3WEXB 4N8CL 1HSBB 4G9FD 1T1XA 4P23C 1Q0YL 1T20A 4K3DH 4P2CG 3INUH 4ONGH 1S8DB 1EZVX 1IEAA 2VLRA 3RGVC 4XC1H 5IFJA 1NDGA 3B8YA 3BKYL 5DK3A 3VWJB 4YGVB 1YEJL 4LPTA 4CRPA 1H15B 3CSYB 1ORSB 4NNXB 3SN6N 4LPXA 3SQBA 1UQSA 1G7LB 1SJEA 1S7WB 3MMEB 4OUOA 2NR6C 4KDTA 3CLFH 4XVTL 1J12A 1F4AA 1A1NA 5D1ZA 4ZSOE 5J6HB 5KSBA 3KPLB 1N2RA 1U8IB 2F53A 2A77H 2NW2B 3DVNA 4S1DD 3GM8A 5DA0B 1K4CB 2BNQD 1GC1H 1S7TA 1BBDH 1GGCH 2ATPB 2VITA 5E9DD 5DUBB 2Y7QB 1OD9A 5DEGA 4LSDA 2ZKHL 5HJ3A 4Z7WB 3ULUE 3F7YB 2YSSA 4EI5C 4Y5VB 1FZKB 4UQ3B 4JJ5A 1QO3A 3MRGA 2GCYB 3TIEA 1F4HA 2XA8L 4WTWA 4ZXBC 1OAXL 3QEUA 3T65B 5GS2D 4ZS7L 4ODHH 5HDLA 4MCYB 4X9FA 3K8KA 3QI9A 4HKBB 1TCRA 4RNRA 2VZUA 1IL1B 2O26U 4JKPH 5EC2B 1KLFA 1XZ0A 1CGVA 1YNKL 5KBNC 1F13A 1EVUA 4IOFD 4NSKB 1GOHA 1CL7L 3O6MH 2IPUK 1RV6X 5DD0H 1ONQA 3N85L 4EIGB 5HDBE 3DRQA 5CAYB 3DETC 1FPTH 1F3JA 4JQXA 3TPKA 4PD4J 3KXFB 1DLHB 4MXWL 5D7IB 1CD9B 2R0ZL 4PTUA 5CILL 3U82B 4PIRF 4M4RA 1KNOB 4GAFB 3QNYA 4GG6B 3SKOB 1G9MC 1NGZA 1IGML 3O2WL 4PRID 5ISZA 4DQOH 2R56H 2R69L 5FA4A 3FRPA 3CMOH 4ZOEA 1UM6H 5ERWB 4PGDB 4PJBB 1K5NA 2VQ1A 2CDGA 1X4YA 3D0VA 1J05B 2K1MA 5F7YC 4LEOA 3RZWA 4KJPC 3T0VA 4YHML 5C09E 3EJZC 3WMSA 1KJMB 5T3ZD 1HOCB 4IRSD 5IOPB 3OG4B 2Q8AH 4R97C 4BUHA 3WBDA 1BFVH 3WLBA 2DYPA 2HKFH 4Y16C 1J1PL 1YNTB 3JVGA 2VLLB 1KT2B 1D5XB 4M1DL 1MCJA 5DURB 5C08D 4IM8A 1AO7B 1XCTA 3ZDXF 5DHXB 1P5UA 4OZHE 3V5HB 1RJZA 2PYEE 1SY6A 1AFVH 4N1HB 4TPRH 3E6HB 1OM3L 4KI5C 3W9DB 4P2QA 1IQWL 2Y6SC 5D70L 4OD1L 3SCMA 3RJQB 5HBBA 4N0UE 2VO5A 4NT6B 4KDVA 2YZ1A 3BMVA 3HS0B 3HE7A 2DIJA 3GMMB 2E6QA 2X4OB 3DMMA 1W2KT 2X7LA 2OTPA 1DLFH 4E5XA 1V05A 4Q9QH 2BSED 4P9ML 4C83A 2YPVH 3HCVA 3NOIA 3O4LE 5CBEA 3NIFE 5GRVK 5LAXA 5C86A 4HH9A 4JKKA 4KMQA 3ZMRA 3WIHA 1IGFL 1NAMH 2G9HB 1G1YA 3V6OC 3C2SA 5CP3H 2ADFL 4G3YL 1I1YB 5FO8B 1YNLL 3W81A 1A21A 1CK0L 2GUOB 2PCPA 1EHLH 1KC5H 5IP4A 5H2BB 4LNRA 4MDJB 3V6BR 2VLKB 4DZBB 5FUZL 3EW3B 3D9AL 1N3NA 2AJUL 3MLZL 4PJ5B 5JPMB 1T66D 3MFFA 3JWDC 1MCLA 4KMTL 4OSUH 1I7TB 3UMTA 4YDVA 1FNSH 4LSSH 2JKXA 4X6DF 1CE6A 4AIXA 3RZCC 3WE6A 4L1HA 4OFVA 5J13B 4PRDA 4JY6A 9CGTA 1XMWA 1M05A 1J5OH 1MCOL 2FH6A 1A6VH 2DJSA 3H3PL 1BFSA 3O9WD 1T22A 3ZTNH 5CWSA 4KRMB 4MJID 3BI9X 5IROC 3C8HA 4LCCA 2FSEB 2APTA 1PKQA 2WV3A 4XP4L 4ZS6C 5MEPA 1IGIH 5C70A 5FYKD 1CDYA 3E3QE 4ZD3L 3TV3L 4K8RD 3EO9H 1PZ5A 1IFHL 4XPTH 2HAZA 2VDML 3QJHB 3HE6D 5C0AB 3UTTD 5J11C 1OQOA 2ADIA 2CUHA 4PS4H 5GGTH 5GRJH 3U4AA 5J4MA 4WW2C 2LTQC 4OF0A 4K3GA 3ULVF 2ZCKL 2NY5L 5ITBH 5I1AA 4X6EB 1KIPA 1X3DA 1DQLL 4MYWB 3VXPB 1KELL 2HJKA 5TQ2H 4QXWA 3O4OB 3AROA 1T0MA 4L1DA 3QIWD 4XX1E 1N4XH 3SDXA 1SM3H 1SBBA 2V2TA 1OWWA 1LNUB 1FVCB 5MEOB 4YR6B 3W9EB 3NA9H 1J88A 5F1IA 3G04B 2A6JA 3EFFB 1E0OB 1TTUA 1BQHA 4LAQH 5SWZA 5EFIB 4LLAA 2C3WA 4D9RE 1ACZA 3ZE0F 2RCSL 3KYKH 1WEJL 1U3HB 3IXAB 1A3RH 3B9KA 3PWNA 2HVJA 4QHLB 2P8PA 4ODXA 1TJGH 2PTTB 3VDCA 1DVFC 3S88L 4ONHB 4BFIA 4J6RL 2F58L 4OCYH 1KPVA 4FFVC 1MNUH 3BE1L 1EO8L 3I6LE 3OJDA 1RU9H 4L3CB 5FAAA 4J4PC 3ZT7A 1NCBL 5DK0A 5LBSH 4C59B 2FGWH 1A1OA 3N50A 2C5DC 4L3EE 4MS8C 5FCSH 1HSAB 3ARSA 1Y0LB 2L0DA 4MA8L 3FT4A 3EZ8A 4V1DD 1QSZA 1UM4H 3ARDC 5EBGA 1P7QD 3PE9A 4H1LB 3ZDXE 1HNGA 1N7ML 5D96C 5B38B 1F8TL 4Y19B 1T6WA 4J23A 3FFDB 4JRWA 4NFCA 5E99H 5B4MC 4D0DA 1BJMA 3GKWL 4JGMA 1T5XB 4Q9BA 3MNVB 3PDDA 2EO9A 1SY6L 5B3NA 1HWHB 4FMKA 1TZGL 2C4FT 3PWPE 5HHOA 2YPLD 4JPIA 4H20L 2BCKA 4PGBA 4F57L 4JDVB 1KB5A 4P5TA 4GSDL 4QRQB 1W0VB 3MV8B 1IC4H 3I2CH 1UB5A 5A2KH 1R0AH 3PWLA 4PV9B 5HGHA 3Q2CA 3RWCA 2DQGH 5EUOE 4DN3H 4ZUTA 1WT5A 6FABL 3LY6A 2N4IA 2P43B 1YEIL 3L95B 3WKML 4NQCE 2VLJE 3V6FA 4O02H 1JWSB 3MRMA 1NUFA 5J12B 3WIHL 1MAMH 3DYPA 4AENA 1NANI 2BOCB 1NC4B 5HI3D 2M2DA 1R5IB 2QR0A 3VXSA 5IJVA 3WHE1 1JHKL 3AM8C 5DWUH 5DC0A 3GHBL 4LHUD 5E94A 5JXAH 5GZND 3S7GA 4HDIA 4GW5B 2GTWA 5GGRA 1RZKH 4Y7MA 1DN2A 4QOKB 1Q9KB 1UEMA 3BN9C 5IT2H 3EYQC 3SQOL 2I9TB 4I2XB 3BXNA 3TN0D 2ORBH 2J8UA 1U93B 4LQFH 4AIZB 3MRCA 4JKMA 3OPZL 1T6VN 3SJVE 1M4KA 4TQEH 1QNZH 3WUZA 5CUSL 3EAKA 2I5YL 1E4XL 2B5IC 3WS3A 1PVHA 4JM2B 1U8JA 2WP3O 1WZ1L 4PJ8C 5MI0C 4NQDD 1CIDA 4XP9H 1E4JA 5J3HC 5CMAB 1RZJL 1U8MB 2OTUB 3ISWA 4PP2B 1QFWL 3JWOH 3U9PH 2EDBA 3ULVE 3TO4A 5L6YL 2NTSP 1DBBL 1WAAA 1TETL 1ZMYA 4U1JA 4K3EL 3WO4C 4G8FA 1I9RL 2IG2H 2V2WB 2AXFA 1QBBA 1EEQA 2H6PB 3HNSH 1AKJA 4M5ZL 4ZOBA 2BSRA 4JR9L 4XNYL 1MQKH 1M7XA 2O5XL 2GY7B 3HPJA 3REWB 2UYLB 3ARTA 3FRPG 2NY6D 4PJEE 2FD6H 1I8IB 4WV1A 4K8RL 1ZE3C 3QUYA 3V0VA 5D7KD 2VWEE 2QSCL 2MOVA 4G9DB 3DWTA 3ZE0E 1CXKA 2M8XA 4Z78B 1U95B 3L3OA 4GUPB 2MQ3A 4TYUA 4Q74A 2BP3A 4KZEL 3TEUA 3KS0H 2I25N 2G75B 3C5SA 3RIFF 2PYFB 5IM7B 1WV7T 2DWEA 1JRHI 3V9FA 4LCYB 2UWEB 3MRBB 3MV9D 1NAMA 3A6BH 4R0LC 4R90L 4IOSD 1G6RH 1QFHA 3I6GA 3B9DA 4M61B 4GRWH 3G5YA 1AGFA 5MERA 2F8XC 1T3FA 2ICWA 3CAFA 1FH5H 3ARRA 3KPNB 3M8OH 2WQRA 4JN1H 2BVPB 3U4EA 3DX7B 3JBG7 1DQTA 3GSXB 1PAMA 1JNHA 4ZO9A 4ONGL 4N90D 5DGQA 4G6JL 2BXZA 4XC1L 4OFIA 4ZFOA 1A7QH 1XIWA 2GHWB 4EDXA 3FT3A 3FN9A 3MREB 3IFPA 4R2GB 4ODVH 1JF1B 3BUYB 4I0PA 1G7PA 1QKZH 3CLFL 4LRNH 1NBYB 4JVPA 3TCLB 3DVGA 2A77L 4Y5XA 3DX8A 2HKHL 2XPGB 3FQNA 5C92A 1ORQB 2XZAH 2P4AB 4TUJA 4CL7A 1I1AA 1GC1L 1BBDL 1GGCL 4KVCH 2YXMA 2VDKH 1G84A 3IFOA 2XA3A 5CKAA 5HHQA 3GMOA 1G6VK 4XI5D 2FEDD 5T1LB 1FZMB 4JRYE 2H8PA 2C1PA 4PJHA 5H37H 3ARBD 1CT8B 4XNUH 4M7KL 1OY3B 4N9GB 4YFLF 2EDKA 3DGGA 4ODHL 2EDWA 3WD5H 3JSSA 5HHNB 4JZNB 1LK2B 3MRIA 3SE9H 5D1XC 1QTYT 2IJ0C 4JKPL 4WI4A 4XH2A 1QRNA 2W38A 3O6ML 5HHME 1FLTX 3BPLB 5DD0L 5C0EB 1D9KB 1WQVT 3SE4A 4BH8A 1A4KA 2C1OB 1FPTL 3FO2A 4K3JH 2V7HA 5FA3A 2D7TH 2RQ8A 3FO0H 4GBXC 2AEWA 2R1WA 4KK9C 1U8KA 5F70A 4MAYA 3Q6FB 3PL6B 1EEYB 1K3ZA 3DYOA 1IT9H 5EU6B 1HKLH 4S0TD 3WIFA 2X4TB 5IR1A 5CEXB 1KIQB 4DQOL 5EO0A 2R56L 4UAOC 5DJXA 1NUNB 3CMOL 1UM6L 3CFJA 4OM1H 4D0BA 5E2WH 4HMDA 1ZHKA 3NGBB 4FQIH 3VU2A 4G42B 4C4KO 2KQNA 1URLA 4Z7UE 5F88A 4X6CA 1YMHA 4L9DA 2VIRB 4NQXB 1QOKA 4RAVA 5JW5A 3T4AA 1G7MB 3O6FA 2WANA 4WGWB 3CX5J 5T5FH 2Q8AL 4BUGA 5DFVD 3QDGE 5HSFA 1CDIA 5E56A 3HZKB 1BFVL 3VG9C 2HKFL 3DVFA 2YUXA 2FHCA 5HGAB 4PRHA 4CVZB 4ERSH 1OAYH 1C5DA 1CE1H 2IPKA 4NOBA 3L7FB 1OTSC 5BVPH 4M93C 2CDEB 3U0PB 1ZS8A 3QEGH 4L8DB 5FYJE 5C9KA 5DJZA 5EO1A 1BVZA 4L5FL 1NBZB 4U0RC 2BSTA 5H8DA 3TBWA 1W0WA 5TGBA 3QIBC 2VZTA 3H9SE 3Q0HA 1AFVL 4GLRI 4MNGB 4U7SA 4TPRL 1ZT1B 2YOCA 3ARED 3BN3B 4PY8I 1PD6A 4WHYH 4MXQD 3VFNB 4E41D 4MQ7B 3EYVA 4KU1A 5HI5D 3L3IB 5GS0C 3C60D 3GM0A 4HJGB 4G8GE 3E3QC 5TDOB 2X4QB 1DLFL 3TBSA 1C1EH 5HHXH 2C3GA 5EC1A 1MJ8H 2YPVL 2Q7NA 4POYA 2NY3D 3BP7B 4LK4A 3SKJH 3F5WA 1PZUB 4FFZL 1A1MA 3F7VA 3JWDH 4J3UA 2IH3A 2FL5B 1T20B 3BPOB 4X9GA 1OOAA 1NAML 4LDEB 2R2EB 3MOBH 4U1MB 5IFJB 4P46A 3CXDL 3RNKA 3WNLA 1T1WB 1EHLL 1DZBA 1KC5L 3IGAB 3GMNA 4POUB 1J7VR 4LF3B 1IM3A 4FTVD 5DHYA 4QRSA 1FL5B 3RBGA 4OGXH 5D1ZB 1A1NB 4X6FA 2CXGA 4R4BA 2F53B 3U6RB 3AB0C 4Q6YA 1CD0A 3V7MA 4F8QA 1LDSA 4OSUL 1XGUA 1FNSL 4X6BB 4LSSL 2CRZA 3C8KA 4WFEE 5DEGB 1AE6L 1B9ZA 1MCNA 3MRRA 3WHXA 1JGDA 2PO6D 4S1QH 5M94B 2P7TB 2OMNA 1J5OL 3F7PC 1A6VL 3D48R 4PGCB 3TIEB 1MSPA 1NC2A 2CLRA 1E4KC 3QFJD 4LLDB 3VXQA 4I3GA 2AW2A 1IGIL 3KPRE 3CDFA 3UZEA 1DEEA 3QI9B 4Q9RH 2AERT 1JBJA 4RNRB 3EO9L 5F9JA 4QRRD 3P40A 4XPTL 4JFEB 4PJ7B 4X0KA 5GRJL 3BO8B 3CFEB 2Z8VC 1DR9A 1FFNA 1YY9D 4P23D 3QWQB 3V7AE 4CMHC 1EHNA 5ITBL 1EK3A 1YPZE 3ZLQC 1F3JB 2GT9B 4NBZB 3QEQB 4X7TB 3NPSC 5TQ2L 1P84K 3RGVD 3BUTA 4GQPH 4I3RH 3FCTB 5I16A 4JY5H 1SM3L 2CO6B 1U58B 3SDAA 3QNYB 4PJBF 3NA9L 3MLSH 1CGYA 5ANME 4OFPA 5FA4B 3PDOB 3KPOB 4WWKC 5DJYA 4Y4FA 4PJGF 5IB2A 5IVXA 3MGTA 3BP5B 1VFAA 5MHSD 3MUY1 3FB7B 3D0VB 1KPRA 2ITCA 4HXAH 4ELKB 1P6FA 4LEOB 1Z0NA 3KYKL 4NO0B 3TVMB 5CJ5A 5DMYA 1A3RL 3BP6A 3SGJC 1TJGL 1ZHNA 4EI5D 3P9MB 4LRIC 2Z92B 3MX0A 1G6RA 5C0FA 1QUNA 4JPVH 1MNUL 1AQDA 5I76A 1TNNA 5EOQH 3EOBB 1RU9L 2VE6B 2LE9A 2GJJA 2W07A 1TJIH 5JHLL 5LBSL 2FGWL 3PP4H 5DD1L 2WWKT 3ARXA 4HGKC 5BO1H 43C9B 5E6IA 1BGXH 3BX7C 1RUMH 1BD2A 2ZPKH 3MROB 4X7CC 2CDFB 1UM4L 2AEIT 3HLAB 4YWGH 4NIKB 3G6JB 2GAZA 3F58H 4CW1A 2NX5B 4CU7A 5IFHH 5K9QG 1EFQA 3DETD 4ZPVB 3SCMB 2BHUA 4Z7UB 2ZUQC 1KCRH 5KS9B 5E99L 3VFGL 4EQ3A 3T0EC 5AG9A 3WJJC 3RI5K 4TVPE 2PR4H 1KIRA 4MJ6A 1Z5LB 3DMMB 2WBJA 4OZFB 4E5XB 3VRJA 4TULH 2W0FB 5IUSA 4RSVA 3QQ3B 5B39B 1WBXA 1HILA 4LLYB 3MBEB 4U1SA 2GTZB 5J57B 2OP4H 5I1HH 1MFBH 4J3TA 1IC4L 3I2CL 5LAXB 3EFDH 4XAKE 5T3XD 1R0AL 4NNYB 1MF2H 3ULVC 3F8UB 1V3KA 2DQGL 4DN3L 3NZHH 3I3EA 5EBMB 3A6CH 5MEQA 5FGBA 1RIHH 1VESA 1OT1A 2FIRT 2Z0BA 1U3ZA 3JTTA 1EGJH 2EDDA 4OD2A 3OMZA 5BZWB 4O02L 5I6XB 2K7PA 3WFEH 2NXYB 1QQDA 3DURB 1N3NB 3H9HA 4Y16D 1JNLH 1K85A 3H0TB 1D5ZA 4WI6A 5JO5A 3ZTJH 5I66B 4QO1A 2HVKA 4WU5A 5DWUL 2CKNA 2BY2A 4PJXB 5KSAB 3WXVH 3KS0J 5JXAL 3RWDB 1ZHBB 3CDYA 3HRZB 2DBLL 3PIQB 3PHOA 4JANB 4P3DB 3RVUC 1RZKL 1PW3A 4KI5D 2E7BA 5IT2L 4HJJH 1YN6B 2Y6SD 1MCRA 2VJXA 3EKCA 4WJ5A 1T22B 3GI9H 3ZKNC 5MENB 4JN2A 2ORBL 4LCCB 3MGOA 4XXCA 1X5HA 3PXHA 1I4FA 1R3KA 1QNZL 2VABA 4IJ3C 4JG0H 2YD9A 5F8QC 3Q5YA 1I8LC 5CHNB 5D8JH 2NY0C 3BQUC 2Q6WA 3EYSH 1AIFA 1JV5B 1OSZA 2HTLC 3BPCA 1SYSB 1GAFH 3G5XA 4XP9L 5I1AB 1UZ6F 3OAZH 4L8CB 5GS1B 4PJDB 2HJKB 3JWOL 5T1MB 1T0MB 1ND0B 1O7VA 5HPOA 5J9PB 1MREH 2E7LC 2IG2L 3VI3F 1G0YR 3KYMA 5HY9A 3FMGH 1MH5B 1Q9LA 5EN2B 2RHEA 1B0GB 3LN5A 4PJIA 3SKMB 5IW6A 1XR9B 2XN9A 4ZAKC 2VDRH 3O3DA 2GEEA 2FD6L 2YEZB 3KPRB 1BJ1H 5SWZB 4X5LA 3RVXC 4PJGE 3WXWH 3UZQA 3PWNB 3RZCD 1ZA3A 4MVBC 1FCGA 3O3EA 3G6AB 3QDMD 5DQ9B 4WO4B 4ORZC 3SGKC 4F33B 4OIAA 5IW3A 3O11B 4OZGA 2A73A 4NUJB 1YY8B 4YHYB 1EDQA 1QSEE 1VFOA 4PJ9D 1EEZB 5KSUA 3A6BL 4ZS6D 3KLHC 3GSUB 1UXWA 4XTRC 1G6RL 2CH8A 3C6SB 4F9LA 1PEWA 1PDKA 4WEUD 5JMOC 1FH5L 3OHXB 3M8OL 4JN1L 4A6YA 4EUPH 3H8NA 4HUXB 1TVHA 1L0XA 1D5IL 2PN5A 4PB9H 3LSOB 2GJ6E 4HX1A 5DGRA 5DRXB 1J0HA 1OL0A 1A7QL 5D2NE 3QUXA 4LVHC 1CFSA 1NGWB 4MD5A 4ODVL 1P4LA 1BQUA 3NAAH 1QKZL 3S3SA 3AMLA 4HIXH 5CEZH 5F44A 1FN4A 3E0GA 4LRNL 4P5TB 4F3FB 1K9TA 1QLEH 5CJXC 2HN7B 1KCVH 5JUEH 3SBWA 2YWYA 2NNAB 5IV2A 2BOBA 4ZUTB 3VGDA 1QFUH 2DQTH 3EYFA 2Z4QB 1UZ8A 5IJKA 2IANE 3NFNA 2AXHA 3BDXA 2FJGA 2CJUH 4FFVD 3BPNB 2DQIH 1T7WA 3VXMA 5EIQA 5JDSB 4ZG1A 4J4PD 4XNUL 1AXTH 2AJZA 3GUTB 4UINH 2JIXA 2FX9H 3GK8H 4KROB 1WIOA 3ZE1F 4G43A 3WD5L 1KIUA 5IWLA 4BFEA 2VOTA 3W82A 2IADB 3ARDD 1WJ3A 2GK0A 5E94B 1QVOB 2EIBA 1OTTC 3QEHA 5L2KD 4HAFA 5FCUH 12E8L 5H35A 3LQZB 3CGTA 2DQFB 1IGJA 5IB5B 2D7TL 3FO0L 4LLUA 2V5YA 5GGSB 5B4MD 1J1OH 3D69A 1EHXA 3CFBB 3P77A 1IT9L 3KJ4B 1RJCA 4GKNA 3HAEG 4JM2F 2G2RA 5D2LA 4AH2B 1UWGH 1UWEH 2JCCB 3PP3H 5IMMB 3P73B 3MJ8B 4OM1L 5E2WL 2X41A 4FQIL 4NBXB 5FYLD 2DM4A 2JLLA 4KAQH 1OCWL 1WWAX 4U1HA 3RGHA 3HR5A 5F21B 3VMOA 3MR9B 1JTTA 4HGMA 5DD5L 1SEBB 3DO3A 4U1JB 1CDCA 3I02A 5T5FL 1F3RB 4RWYH 3BKCH 2AS5M 2AXFB 4HK0B 5INCA 1FL3A 2ZZUT 3R0NA 4ERSL 1OAYL 4P2OB 5GS0H 3VI3E 1VACA 5BVPL 4ENEC 5LCVH 1G7QB 5BZDB 4X7EC 2E9IA 1INQB 3HUJF 2GITA 3IKKA 3QUYB 1FNHA 1EAPA 1OQXA 3F12A 4JO2H 3GMLA 1ZSDA 4MAUH 3QJFB 5F9WB 4MJ4A 1OARH 5I9QC 2Q87A 3BN9D 3EYQD 1IKNA 4P2YA 3RNQB 4ZDHA 5DJ0A 3C5SB 3QYCA 3QDJE 3NCYP 1CLOH 5IG7A 4B53A 3ROOB 3VE0A 2AEQH 3O41A 2KZWA 1C1EL 1FIGH 1JZ7A 1IAII 4YZFF 5HHXL 1FLRL 1MJ8L 3MACL 3TGXA 4PJ8D 3SKJL 3JWDL 4IBLT 5DDHB 1S78C 4J1UB 5D72H 3IDMB 5I74C 3GEWB 5J3HD 5AYUH 3MOBL 1NKOA 4UTBH 3FT3B 5L0QC 2L7UA 3OXSA 3ZZ1A 2D9CA 3RY4A 4RFEB 3SO3C 2VSCA 2D31A 4OGXL 2WZPD 2FO1A 3FQNB 8CGTA 4BH7B 3ULUD 4N0FA 3L5IA 2E8YA 1PJ9A 2DQCL 3NA4A 2OI9C 4IRSA 2O5YH 2OBGA 2XYCA 4S1QL 5HHQB 1XGTB 4FMFA 1ZVYA 3MXWH 2Q20A 1NJ9A 1ZK9A 4NQSB 4NZUH 4AG4H 1NUGA 1F4XH 4RZCA 1HH9B 1FRGH 3MLWH 4QRTB 5IIEB 2FR4B 3R0MA 4Q9RL 3MRIB 2D9QB 4EXPX 3ZE1E 2GI7A 1M7IA 4XH2B 4U1LA 1HXYA 1IGYB 4PJFA 4GRLC 4QHMB 1VEPA 3QG7H 3CZJA 1JRHH 3WN5C 1A6AB 3P3YA 4E42B 2V7HB 3LDBC 5FA3B 1BPVA 5HHPB 2XWTA 4PRAB 2R1WB 5C6WH 4PRNA 4AY0A 4GQ9H 4I3RL 1WK0A 4HWUA 4JY5L 43CAB 3UPCA 1WLHA 5F93C 3VG0H 3VWKB 1N59A 1PSKH 3RHWF 5E00A 3L5HA 4QHUA 3MLSL 5DJXB 1T5WA 4UBDC 2R0LH 1A02N 1VKXA 1ZWIA 1H5BB 4XMKH 2DLEA 3NCJL 4HXAL 4R96B 3ZKMC 1FNGB 2EEBA 5C09D 1HHGA 5F6HJ 1YMHB 1UADC 3U7YH 5IHBA 2XTLA 1RAMA 1KJVA 5JW5B 3BGMA 3O6FB 4PRPB 2DWDB 3OKMB 3DXAA 3EGSA 4MWFB 2E7CA 4Y2OA 4JPVL 3W0WE 1NGPH 4HLZG 5EOQL 5ADOH 1VFMA 1TJIL 3HI5H 2AV1B 1I1FB 4OI9A 4ORGB 3B6SB 3PP4L 3PJSB 1ZS8B 1F02I 3D39E 1HI6B 5ABDE 2XXCB 1BGXL 4XPAH 1EVTC 5D93B 1S9VA 3F7QA 1RUML 4PREA 2VKWA 4WHYG 3PV6B 4P4KC 5EO1B 1TVBA 2PYED 3VGGA 2ZPKL 5BRZB 5D1XD 1NBVH 2BSTB 4Y5VC 5TGBB 4YWGL 1YC8A 5IBLC 1AC0A 1C16B 1INEH 5DA4A 3F58L 4RMVA 4HIEA 1EHAA 5IFHL 3P0GB 2JK5B 4UU9B 1KCRL 2GKIA 5IMOB 4YDJA 1CICB 4NHCH 2FZ3B 4GBXD 2IFGA 5D1QB 4KK9D 4O58H 4MSWA 2QQNH 4GG8A 3EJYC 2PR4L 1M7DA 4ODWA 1H0DB 4EN3A 4IRJB 2J88H 4G80A 4Y1AA 4Z77A 3U46A 4FFWC 4TULL 3O4LD 4UMGA 2B4CC 2OP4L 5I1HL 2BNRA 3F5WB 4ODSH 3EFDL 2YBRA 4B7IA 1MF2L 2W9LA 3OKEB 1FJ1A 4IS6A 3NZHL 1RIHL 1CDJA 3HA0A 1BX2A 5JLZA 3DUHA 4HPYH 3GMNB 3PWUA 4U6YB 1IM3B 5KSBF 3TH3T 3WFEL 4OLZH 5DHYB 4FQXA 1BJ1J 2GIYA 2ZJSH 1KF9B 3WLWC 1JNLL 3GSNB 3IJHA 3C5ZA 1MCCA 1OTSD 3X14B 5EUKA 2BVQA 4MJ5A 3MC0A 2HLAB 4BK5A 2PXYC 1KTRL 4L9LA 3WXVL 2FLRT 3QIBD 2H32H 2OTWB 3MRRB 3WHXB 1JGDB 2DJ4A 1GZPA 2V7NA 1FBIH 2E7MA 3FOLB 4NO2B 5FV2A 4HJJL 1CFNA 1YEDA 2B8OT 4PY7A 3GI9L 2AAVA 2ILLA 5GS0D 3NH7H 2CLRB 5M7QA 4OF5A 3HAEB 4OCSH 2ZP0T 2QBWA 3IJYA 4GLRH 5GSRA 2JE8A 1GOGA 2B20A 4OI7A 3CVIH 4JG0L 4O9HH 2YKLH 5IESH 4KKAC 4Y5YA 1MUJB 2WNGA 2RIKA 5D8JL 1MRCL 4URTB 2FJHB 3QXWA 2WUBH 3EYSL 5IB1A 4O2EA 3UPAA 2F54E 1OW0A 1FO0H 1GAFL 2R2BA 4IMLA 4HSQA 1RUKH 3QPXH 2D0GA 1X5XA 1MI5B 4WHTB 5E95B 2CLVB 1MAKA 4L8BA 1S5HA 3O3AB 2ICES 1MREL 2YPLA 3LRSB 1AGEA 3U30B 1BZ9A 3IFNH 3DBXB 2BERA 1DN0A 4LPUA 2EC9U 3FMGL 3SDCC 3CUPA 1N0XH 4AJ0A 2YMXH 2F8VA 5GRWA 1A6PA 4HW6A 5IKCB 3FQRB 2VDRL 3QNZB 1KG0A 2EE3A 4D9RD 5IVXB 2VISA 1LD9A 1OP5H 4YO0B 2HH0H 2ZSWA 4KQ4H 3WXWL 4X8JA 5GGVY 3DO7A 3TNNB 3B43A 4UNUA 4L4VE 2ZG1A 3I6LD 1I3RA 5JORA 3HNVH 5F1SA 3VFVA 1A6ZB 5I76B 3QHZH 3B83A 4CU8A 3G08B 4L3ED 4HG4K 4OKDA 3GJFH 4M8VA 1CTNA 2X89A 3RL1B 3P4NA 4HIHB 4JFXA 1R5WA 2VZ3A 4NM4H 4DKAA 4ZTOL 4H25A 3VGAC 1R3HB 5DRWA 1LO5A 5KG9B 3D2UD 1I8KA 2NPLX 2DQUH 3EOAA 3STZA 5I1GH 3ARFC 3IDJA 4JY4A 5T5NG 5SWSA 5FKPA 1HWGB 4PB9L 3TN0A 5JPNB 1NUDA 4QRPA 5FHBH 4P59H 4YBQC 4YX2H 3S37L 4UDUA 3PWPD 1KIRB 4LSQH 1KLUA 2CXKA 3LZFH 4GS7C 1P7KA 2WBJB 2P5EA 3W0WB 1VGKB 4MLSA 3NAAL 4HIXL 5CEZL 3PDGA 1JZ8A 2AJ3B 4U1SB 1QLEL 1KTLB 4WWKD 1KCVL 1TQCB 1A6TB 1X6NA 3D39B 4KTDH 3RTQA 4LCWD 3I50H 1KTKE 2BX5A 1DQDH 3GMRA 4O2FA 3BWAB 3WFCH 3DNKA 4WFFE 3ZHKA 1QFUL 3UJIH 4NQCD 1MFAH 1JUFA 1ZHLB 2VLJD 1I8MA 5ICYB 5J1AA 4LSPL 4OTXL 1UJ3A 2CJUL 1ZGLA 5DEFA 2P5WA 2DQIL 3UTSA 4UTAH 4G6AD 3TBVB 5LGJA 4AM0A 1ZV5A 5D9SA 1AXTL 3WV0A 5K9KA 1X5YA 4UINL 2EIEA 2FX9L 3QPQC 5KSBE 3HG1D 5D4QA 3T2QA 2C3VA 1AP2A 4LDLB 5EO9B 3AAZB 4MNQB 1ZT7B 3V8CA 2V9QA 1GYAA 1WWWX 1S7XA 4C56E 4K7PY 5DUPH 1LEGA 2QKIB 4UOW1 3PHOB 5FCUL 2B0SH 3VXRA 4X7SH 3OX8B 4F15C 1I9EA 3T0ED 1J1OL 4JN2B 2BNQE 3SJVD 4BFBD 1J8HB 2X1PA 5E9DE 4JZOB 3SKNA 5K9JH 5EU5A 1BZ7A 3F6IA 5C0GA 4L4JA 3W2DH 1UWGL 1UWEL 1T1ZB 4JO3L 2NXZB 3ZYJA 1J18A 4Z6AT 1HINH 4PJDF 2Q6WB 1FYTB 1XF2A 5JW4Q 1U8HB 4KAQL 2QSVA 4XC3H 3ULVD 2QHRH 2XFXB 3FFCB 5I17A 3SDXF 3VGEA 5DJ2A 5I8KH 4K9EH 4PV8A 2D7NA 2AV7A 4RWYL 3FOMA 3KYMB 4W6XB 4I48A 2VTFA 4KPHH 4HWZB 2BC4B 5C8JB 3B3IB 4JG1H 1EJOH 4XNQB 1ADQA 1V3JA 5JMRA 3C5JA 5LCVL 5ID1A 3MRQA 4P99A 5JR1H 2GFBA 3IDGB 4YHOH 4FQJH 1QLFB 3TH4T 1MCBA 3MYZA 4Y4KC 1PYWB 4Z5RA 2ADJA 1DUYA 2F74A 1OARL 1LVEA 2DMKA 2F54B 3RVUD 4JDZB 1HCFX 1W8OA 3QCVH 2DLFH 4WNQA 1FE8H 4MDIB 3S4SA 3QWRA 3VGBA 3W5MA 2F15A 5TPWH 1A3LH 1CLOL 1D7FA 4MA3A 4JRXA 5KSUB 1UB6A 2AEQL 1NSNH 4G8IA 4WUUB 1FIGL 5BV7C 1T21B 4GFTB 5C0CB 5E1AB 1NLDH 1NEUA 2VUYA 3SDDA 4IOIB 2NY0D 3BQUD 2K9UA 5GGVH 2HTLD 5D72L 3C6LB 3C8DA 5I30H 5ESVB 4P2QE 4OF6A 4FP8H 5AYUL 4G6FB 4YPGB 5JA8B 2IALB 5BJTB 5K59F 3U0WH 3OAYH 5TH2A 4UTBL 2R29L 4L4VB 2X1OA 4NQEA 3B2VL 2YXFA 2VL4A 4RMSA 2OM5A 3WS6A 3N1MC 1F4WH 4JFPB 3PQYE 5I1CH 4ZAKD 5BS0A 3ULSA 1K2DB 5BQ7A 3O81A 4H26A 3EBAA 3RVXD 1JYVA 5HHVH 5GRUH 4JFFA 3G6DH 3MCKB 2NMSA 5FM4A 3T4YA 3EYFB 2CIKB 4MVBD 5ALBH 4XHJC 4JRYD 1BAFH 4JJHA 4YXLH 5CIPH 3LKNA 3NABH 4X9HA 3Q5OA 1OGAB 3MXWL 2YK1H 4U1KA 4TUOB 3VXMB 4TVPH 4NZUL 4AG4L 1U8QB 1F4XL 2R1YA 4YDLB 1S7SA 1FRGL 3MLWL 1FO0A 1C5BH 3KLHD 1WZMA 2H26A 5B3JF 3TZVA 1P2CA 4GMSH 5HHMD 2XACC 5F7NC 4HH8A 2ZUTA 5ID0B 3DIFA 4ODBD 2UY7A 4LARH 1Q9OA 3QG7L 5I75B 1EXUA 1JRHL 5KVEL 5D7LB 3BEVA 2J8UF 3ZDYF 1IGJB 4LLUB 5F3HA 3K2UH 1T04A 4UUJB 2VLME 4GQ9L 3GSRB 3KDMB 3D69B 3I3DA 2NYYC 4HGWA 4IIQA 1IARB 1IEBB 3LH2H 3P77B 3RIAF 4GKNB 2G2RB 4JFDA 1PSKL 2RR3A 5D2LB 3QSKB 1K3IA 4PG2C 1QPPA 4G9FB 4U2ZA 3S9DB 2R0LL 2C3HA 4X80H 3WNMA 2OX5A 4XMKL 3IDYB 3V4UH 5HI4C 1WAAF 4MJIE 2XWBA 4OZIB 4RX4D 3U7YL 4C56B 3HR5B 4L8SA 4BZ2H 1RJLA 3QDGD 4OLXH 4WY7H 5E08H 2HT2C 1FGVH 3I6KA 3AS1A 4FZEL 1FL3B 5ADOL 3HNTH 3HI5L 4LKXA 5DQDH 5ICXB 4BA8A 3QWOA 2X42A 3KLAA 5IHLB 2BNQB 1Y6KR 5E9DB 4LLVA 4XCYB 4XPAL 4UIKL 2XZZA 4N0RA 3H9SD 4JGJA 1NBVL 2CR3A 2PO6A 2OL3H 1LP9B 2X4SA 3OKDA 2HFGL 1F2XK 4UIMB 3GMLB 1INEL 1B6DA 4GKSB 5KANI 1OTTD 2NXYD 3ZE2F 1G7IA 3HTLX 3PWJA 2V6HA 4JQVC 2DLGA 4BSJA 1OP9A 3MO1A 3OKNB 1RK1A 5F9AC 4Y2DC 4G8GD 1S9XA 4NHCL 5HGBA 2EDJA 3D6GA 3J8F7 4PY8J 2GY5A 5IG7B 3RDTA 4OI8A 4RMQA 4P2RA 4LLMA 1LK3H 2MTPA 2IPUG 2J88L 4LMQI 4X5XB 5F7FA 4QRRA 1A7RH 3IETA 4ZMAT 2XG5A 5EOTB 4OV5B 2VZVA 1G7JA 3O45A 1CD1A 4LHUG 3ARVA 3CZFB 1G7HB 1P69B 2J8OA 2YPKA 1B4RA 1OAZH 5E6ZA 3VXUA 4ODSL 2KKQA 2XTJE 5EWIH 1AI1H 4BQBA 3RKDC 3N06B 3NZ8B 2LABA 1KENH 3BEWA 4PLKC 3BD3A 5EU3B 3S34H 1ZT4B 4FQHB 1N6QL 3LS5L 4HPYL 1MJ7L 3OGCB 4PRIB 4CUCA 1UT9A 1VENA 4LVNC 4OLZL 1TDQA 5L2JB 1KXVC 2ZJSL 4Z7VE 4X9BA 1MVUA 4ELMB 1FZOA 2DTSA 2EDTA 2D31B 2GJZA 4OFYA 4ENED 1D3CA 1U91A 4OLVH 3FO1B 4WFED 3MRLA 4JFYA 4N0FB 1ZA6B 3DPBA 2FBJH 2P8LB 4RQQB 1T7XA 4KI1A 1RSFA 1EBAA 4EIZC 4PJHF 2ZUYA 1R3JA 1FBIL 3IDIA 3CDCA 5I1DB 5HYJD 2DAVA 3FAXA 5CGYC 5GXBB 1NJ9B 5EU4A 1S5IH 3NH7L 2FYYB 4RZCB 5C08B 3RKPA 3QXAB 1KLGA 3SDYH 3QRGL 4OCSL 1VB9A 5C6TH 3CVIL 4O9HL 3VXSE 2YKLL 1NCCH 5IESL 3W11C 1R3IH 2WUBL 3HPLA 2BXYA 1DL7H 4QTHA 2WW8A 2AK4E 3S37X 1R3LA 1I85C 5D7JC 1FO0L 1S78D 4JE4B 2ARJQ 1RUKL 3C09B 3DTXB 3QPXL 4NP4H 2XWTB 2ZSVB 3VFRA 4Q2ZA 2JJTC 1IAIH 2F19H 4QTIH 3T3MF 2J8UE 3ZDYE 4XCCL 3LD8B 3IFNL 3VCLA 1SYVB 1GRWA </