4O9HL

Structure of interleukin-6 in complex with a camelid fab fragment
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
211
structure length
211
Chain Sequence
QTVVTQEPSLSVSPGGTVTLTCGLSSGSVTASNYPGWFQQTPGQAPRALIYSTNDRHSGVPSRFSGSISGNKAALTITGAQPEDEADYYCALDIGDITEFGGGTHLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Interleukin-6
publication title Combining residues of naturally-occurring Camelid somatic affinity variants yields ultra-potent human therapeutic IL-6 antibodies
rcsb
source organism Homo sapiens
total genus 37
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2014-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4o9hL01
3L3KB 1JYVA 2BDNL 4I4WB 4ZFFB 3CSBA 3AMKA 3G6AA 5HVFB 5TDPB 4ZFZB 2FWOA 2EC9U 3LRSB 3CFBB 4K3EL 4WWKA 1AXSB 2PYFA 1TZHA 5TDNB 1SJVA 3QG6B 3EJYD 1RAMA 3TM6A 4P9HC 5FGCE 3O6LL 3C6LB 1F4XH 5EU6D 4RRPA 3QQNA 3SDXA 2H1PH 1XIWC 4N0CD 5D2LE 4N1CA 1PG7X 3JV4A 1GH7A 2IH3A 3UTSD 3VXMB 3IXTA 2FJHB 4M9OA 3QIUA 4NZDA 3UP1A 3WIFB 1G7HA 4XWGH 4G8EA 1J0YA 3WFDH 4Q74A 4L5FH 2ZSWA 2D7QA 2WP3O 3MMEB 1T1XA 1F4WH 3RX7A 4MJIE 3GB7B 3CVIL 3FRUB 3BAEL 1QR1A 2HFGL 1Q38A 2DD8L 2NY1B 1FIEA 4Z76B 4PJEE 3DVGB 4GT7A 5LXGH 3IETB 3OR6A 4X0KB 4XAKE 2Q3ZA 5T5FH 4XVJH 3DUSA 4DKEL 1ZHLB 1V7MH 2JB6A 4GAYB 3GUTB 3KPMA 2I25N 4QYOA 4RAHA 2YPKB 3AREA 3MRDA 4Y4KD 4HDIA 1D5MB 2QQQA 3K8MA 3F58L 5FV1L 3FT3B 3IDGB 5IFJA 4N0UA 1F97A 5IFAH 4OZHE 1F3DH 1MJ8L 3UJTL 3T0EB 4MA7L 4P5TA 1Q0YL 1WTGT 1N5AA 4FOMA 1UWXH 1T2QL 2I60H 2VISB 4FXKB 2BVOA 2EDJA 4HAFA 4KTDH 1RJLB 4D0DA 3SE4A 1P53A 3KG5A 1KTRL 5I15H 4OF5A 3GGWB 4Z7UB 3UJJL 2VLJA 1B3JA 1QFPA 1GAFL 4XVSH 3S4SA 2F8XC 2BVUA 5IR1A 2AKRB 1KJMA 4ZS6C 3ZYOA 4CADB 1Q9OA 1S7WA 4NHUB 2IBZY 4GXUM 4WHTB 4TOYH 1OT1A 4NM8H 2DDQH 3UTTA 4TSBL 2Y36H 3BX7C 1E4XL 3ARUA 3IVKB 4JO1L 4PG2A 1QSEE 4EI5D 4PJAA 1A6WL 4AM0A 2BMKB 3TVMD 5HDQL 3TYFB 2F5AL 2J4WL 2YXMA 2H32B 2DIJA 3U9PH 1MFDL 2G5RA 3ZDYF 2NY3C 3LV3B 4GLRI 1TTGA 3GSVA 1NC4D 4GRWH 4TUKL 1FO0L 2R2BB 3BFOA 4URTB 4P9MH 4NP4H 1ZANH 4R4NC 5CEZL 4MJID 3PWJA 2IQ9H 4NC0B 4NN7C 1W0WB 4OV5B 1X7QA 1NBZA 1YDPA 3A67H 3TWCH 2VXUL 3BKCH 2P5EB 3PDDA 3ARVA 4XAKD 1A02N 1Z3GL 4YK4B 3CX5K 2DQUH 4XNMB 2NR6D 3GKWL 3HNTL 2FZ3B 4GH7B 4L9LB 1S9VB 4LL9A 2CLVA 4P2QA 2BK8A 2VDML 1CZ8L 1GGYA 4D9QE 1G84A 4PJBA 1C12B 2XN9E 1XGTA 2WIIA 4LIQL 1T1YB 3WNNA 4P46C 3CLEH 3I50H 4DJMA 4EXPX 1I9IL 4U1MA 3BH8B 2P42B 5GZOC 3WIHA 4KVCH 5DQDL 3BQUC 1OTSD 4M48H 4LSRH 1I1YA 3ZE0E 35C8H 1IEAB 1ITBB 2Z91A 4M9PA 2PETA 4MS8C 4OM1H 4HS3B 1LEKA 2W0FA 3UJIL 2VL5A 1XGUA 2OTWA 2BNRA 3CSPA 5IV2B 4ODWB 2VLRA 5E03A 2AV1A 2R0KL 4ZG1A 4JJ5A 1E6JH 4F3FA 5AZEH 3QXWA 4G9FB 4KXZI 1U8JB 3D87B 4L8DA 4WNQB 5I74B 4IIQA 3KPRA 3M8OH 4LCCC 4JR9H 3HB3D 5AWNH 2E6JA 1QSED 4QHMA 1VHPA 3CZJA 3U36A 1JPTH 1AKJA 3KYOB 3GSNA 1NCAH 2ZG1A 4HXBH 5E1AA 3UTPE 4N9GA 5AG8A 4HT1H 5E8EA 3ARBB 5D1XC 2A6IB 3ROOA 3ZO0A 2BVYA 4XZUA 3A0OA 4OQTH 1HDMB 4C56B 4XNQB 5D1ZD 4OFVA 3SDXF 3BWAA 4P57B 1JNNL 1TNNA 5F3HB 3C2AL 2MQ3A 4U1KA 3SDCA 1JN6A 1IFHH 3PIQA 4KMTH 3G6AB 2J12B 4QT5A 2E7HA 1ZT4A 1EBPA 2FWOB 1QFWL 3DRQA 1YPZE 2ZPKH 4P23D 4WWKB 3TA3D 4M5YL 2PYFB 4OGAD 1TZHB 3QI9C 4K55A 5FA4A 3RJQB 1PKQE 5E7BA 4D9QD 4NN5C 1FYTA 3RAJH 4I9WE 4D3CH 3SDXB 4G7VH 2XN9D 4OLUL 3JV4B 3VXRE 5C0IA 3SKNA 2IH3B 5FYJH 3OG6B 3QUXD 4ZFGH 3IXTB 4IRZL 5BV7L 3BZEA 3MCKA 3QIUB 4ZFOL 4F57L 1G7HB 3FN0H 4EI6A 1G7LA 3QPQD 4G8EB 5EU5A 4N5ED 1R3KA 5ALCL 4NWUH 2ZSWB 1UB6A 1T1XB 2NY5C 3DSNA 1QR1B 5FYLL 1AD9A 4M43L 2ZUXA 4KVNL 4DN3H 4Z6AT 4WFGE 3OR6B 1CDGA 1FGNH 4GQ9H 4EUPA 3JV0A 3VFGH 4Y5YC 3DUSB 2JB6B 5MERA 1OAXH 4P9HL 1UZ6E 1NL0L 2F54E 1YECL 3KPMB 1K85A 1D7FA 4XC1H 4PJIF 4QYOB 3MLWH 3MRDB 3AREB 5LGHH 4HDIB 4NZJA 3WFCH 2YD2A 3WMSA 4N0UB 5IFJB 2P7TA 3UTPD 3VWJA 3PDGA 2HVKA 1MWAA 4P5TB 1N5AB 3E3QC 1WISA 2BVOB 4YUEH 4PJAF 4D0DB 4H0IA 4OLYH 2VLJB 3PQYD 3WXWL 3C8HA 4CMHB 5I66A 3CXDH 3S4SB 1HSAA 4QY8A 2WZPD 3SKMA 3X11A 5IR1B 1J0JA 1HN1A 3GMNA 4Y2DC 1KJMB 3B83A 3ZHDA 4UAOC 1Q9OB 3WLBA 1S7WB 3FMGH 4I3GA 4GXVL 4KDTC 4EIZC 3KHOA 1LK3H 2EE2A 1T80A 4NFDA 2EYRB 3UTTB 4HWEH 4YHLL 1N64H 5B39G 1DSFH 4I9WD 2B2XL 5F1KC 4PJAB 1N6QH 4AM0B 5IF0A 2VERN 1DBBH 1DLHA 1G7JA 3VXRD 3BI9X 3RGVC 1BFVH 2PUQT 5GPRA 2H32H 3C60C 3BKML 3REVA 1YUHA 3QIWA 5LG1A 3ROLA 3VMPA 3GSVB 1LD9A 4RX4D 5EIIA 1KJ2L 1B0WA 3ULVF 4UQ3A 5HBBA 1ZA6A 3TJEL 3SCMA 4KQ4L 1DL7L 4KK9C 5F96H 4DOHE 3EZ8A 1KCSH 2XTJB 4KJQC 3EOTL 1HSBA 2VLKE 3PWJB 5CBEA 1DJSA 1YEKH 1X7QB 1NBZB 1YDPB 5D1QC 3G5XB 2ZNWA 1MELA 2X89A 4GSDH 3V4UL 1FSKB 2EIDA 3WS6A 2CLVB 4K2UL 4P2QB 2F54D 5GIRA 2PTTA 3VXPA 3T2NL 5KTEH 1HINL 3UBXG 2BOCA 2QQNH 4U4BA 2D3VA 4PJBB 4OZIA 1IQWL 1XGTB 2WIIB 1KN2H 2OLDA 4APQA 4XPAL 3MJGX 1F58H 4U1MB 2QJDA 5FHAL 2WLZA 2EC9T 1FL3A 4PY7A 1I1YB 2B0SL 1NMBH 1NAKH 2Z91B 3MV8E 1LEKB 1PFCA 2HFTA 4JQXC 4OLXH 4F7MA 2VL5B 1XGUB 2OTWB 7FABH 5EUOA 3TBWA 2BNRB 4ALAH 4ZSOE 5F89A 4NZRL 3OAZK 5CGTA 2AV1B 3RIFF 4JJ5B 1FH5L 4F3FB 4FQXD 4XXCA 2V9QA 4UUJB 5C0CE 4IIQB 4PJ9D 2D0GA 2P8LA 4L1HA 3KPRB 4O51A 3D48R 4LLQA 2EXWD 3BMVA 3OAYK 3MV01 4Y88A 4QHMB 5L8KB 2RJMA 4FFVD 3U36B 1BQUA 4WHYG 4K9EC 1AKJB 3GSNB 5E1AB 1ACYL 4N9GB 4YBQC 2OI9B 2NY7L 5E8EB 4FQQA 3ROOB 1IL1A 4XZUB 4LP5A 2X1WL 1YYLL 4HLZH 3QQ4A 4JO3H 3RX5A 1FLTX 2VSCA 4MYWB 5FYKL 1E6OL 2VDPH 3FKUS 3BWAB 3PGCA 4FABL 1TETH 1WTLA 2VLKD 4TSAL 1JGUL 3QCUL 2YMXH 1JI2A 3SKJL 5D7IE 1DANU 4MGXA 4U1KB 3RKDC 3SDCB 2ZKHL 1JN6B 3PIQB 4QT5B 1ZT4B 4YWGH 2Q87A 3DRQB 5IJKA 1NAML 1DN2A 4HGWA 5FA4B 5ITBL 4KTEH 4XC3H 3BJ91 3HE6C 2PYEE 1FYTB 2YD3A 4GKOA 5CZKA 2DRUA 4OCXH 1NCCL 4J3TA 4AEIH 1FFQA 5C0IB 3SKNB 1ADQL 2CO6B 4RGNB 1RIVL 1DTUA 5T3ZE 3BZEB 3MCKB 1X5YA 2X41A 1IVLA 2W38A 4EI6B 3VFPA 1G7LB 5EU5B 1R3KB 2MKWA 3SQBA 3FQNA 1MCSA 3MV8D 4FQLH 3SY0B 2V5MA 1UB6B 4OZGE 2V2XA 4NO2A 4EIGB 1EDQA 2AI0L 1AD9B 3QCVL 4OTXL 1MRDH 4YBLC 2NX5A 1SEBA 4XNYL 3VXNA 4RDQF 3I75A 2AXFA 4EUPB 1RZFL 3OQ3B 5MERB 3U7YL 1IGCH 3T0BA 2HJFA 4G3YL 5I0ZA 2AJSL 3A6BH 5E6ID 2P7TB 5CZVL 5BS0A 1JZ7A 3VWJB 4EDWL 2GEEA 3O6FB 4ZAKB 2WWMC 1J12A 2HVKB 1MWAB 2ZOKA 5BZDA 4NRZB 3VDCA 2X4SA 3QXAA 3FRPA 4L29A 4U6XA 2N1KA 3TFKC 4NZTL 2NY5L 1K4CA 3H0TA 5CD5D 1EO8H 4XP6L 6CGTA 5I66B 5DYOA 4MAUL 5F7EL 1HSAB 4QY8B 3MUZ1 1I1AB 2AK4A 2EDWA 3SKMB 3X11B 3GMNB 4M8QA 1U8PA 1YEHH 1CLCA 1X5JA 2CDFA 5DD1H 3WLBB 3SE3A 1XMWA 2KQMA 2A6DA 3P0VH 4LCIH 1MCQA 3MYZA 5L6YH 1FV1B 4F7EA 1J18A 1EFQA 5LCVH 5GGUA 3MRJA 1OHQA 2J1KA 1WAAA 5KANI 5MI0C 5IF0B 4LSVL 1DLHB 1G7JB 5E2UH 1C7TA 1CU4L 4LSQH 15C8H 4LRNL 3REVB 1YUHB 3QIWB 3ROLB 2YUWA 1LD9B 1RUPH 1CDHA 5EIIB 1ZAGA 1D5IL 3HUJE 4Z78A 5IVZA 2R4SH 1OAUL 4UQ3B 5ACMA 3ARFA 1ZA6B 3SCMB 3QG7L 1OP9A 4QXTA 3PL6C 2XG5A 1S7XA 2D03H 3WHE1 4OZIF 1HSBB 2DLEA 5CBEB 2AJYH 5I1CH 4HX1A 4WGWB 5KAQF 3QUYC 1CFSA 2BJML 1RZGA 4RBPK 5IW3A 3VXQA 5F88A 1N26A 4WW2A 5M95B 2FO4A 4G6FD 5GIRB 2PTTB 3PWPE 3VXPB 1JJUA 1Q1JH 4S0TD 5T1LA 5EUOF 4GRLD 2BOCB 3ULVH 3RUGA 4OZIB 5CSGA 1EBAA 4APQB 2DM4A 5T1DH 2VDQL 4MNHA 4HGKC 5C0NC 5GQBA 1FL3B 4PY7B 4NWTL 3WIHH 2CMRH 5HGGS 5JIPA 2F9BT 3LCYA 1KB5A 4F7MB 3MLZL 3IFOA 1GGBL 3D18A 4S1SH 3H42L 1M4KA 2EDEA 5EUOB 3TBWB 5F89B 5I30L 3PP3K 1NLDL 3QDJA 3K2MC 1RFDH 2DJUA 1B6UA 4J2XA 1P4IL 5BXFA 5KVFL 2P8LB 1LWRA 2DBLH 4KI5C 4O51B 3VI4F 2W91A 4LLQB 4A6YA 3FQWA 1C8PA 4QOKE 1MHEA 2WNGA 1WEJL 4XCCL 3S97C 1AO7E 3U30B 3L3JA 4OI9A 5INCA 5AZ2H 4QRTA 2YR3A 3W81A 3GSNH 1U3HC 4P5MA 4FQQB 2F74B 4LHUA 3PGDA 1IL1B 3C6SA 5DLMH 4N0YL 5SWQA 3QQ4B 1MUJA 1I8MA 1NDMA 4CDGC 4TVPE 2F58H 3PGCB 4OLWL 2ED9A 3BHBA 1ONQA 1CD9B 1E4KA 2ORBH 1TIUA 1R3IL 5FIEA 3STBA 4TQEL 5HI5C 5JR1L 4LLWA 4HKXA 2C1PA 1DUYA 2OJZH 5C9JA 4HGWB 4BSJA 4FN0A 3U0TA 5KOMC 5I9QB 2VDKL 2YSSA 3SGKA 4AH2A 5BMFH 3LKOA 2PO6D 3SDDD 4P48A 3MGTA 1H3PL 4R8WH 1ZGLM 1AI1H 5C0FA 4OLVH 1EHAA 3TIDA 2BRRL 4M62H 3VFPB 3S35H 1XCTA 3MLSL 4W81A 4XTRD 3L6FA 3PGFH 3HI6H 3FQNB 4MNQE 2GITA 2V2XB 1N2RA 4NO2B 4XB8A 1A6VH 4NRXA 2NX5B 4O00A 2FHCA 1SEBB 3H3KA 2OZ4A 1NGYA 3JVGA 4K3HA 1NEZG 3VXNB 1HHJA 3I75B 2AXFB 1JYXA 5I1HL 1UJTA 4P2OD 2D0FA 5C0BD 5K59E 1HQ4A 4EUPH 2HJFB 2Z8VC 3L5JA 4QOKD 4JKWA 4OB5L 3S88L 2YK1L 3OKEA 4Z7VF 1AO7D 5BS0B 1SMOA 3NIGF 1A8JH 3LQMA 3RTQC 3MRQA 4PREA 3AU1A 3O8XD 3QRFM 1BQHG 1PYWB 2ZOKB 2O5YH 2MMXA 4X5WA 4IOFD 1XGRA 1JF6A 3Q2CA 5SWZA 1MWAH 2X4SB 3QDME 3QXAB 4L29B 4U6XB 1WAAF 2J5LC 4LCYA 2NYYD 3H8NA 4TN9A 1K4CB 3EHBD 3DHMA 4ZTPH 3H0TB 1T04A 5DYOB 1QSZA 4M6NL 5EZLA 1AGBA 4FFYL 3RIAF 4F9LA 4NHCL 2AK4B 4WW1A 3S3JA 4EXKA 5FO7A 4M8QB 1U8PB 4PRHE 2CDFB 2J6EL 5CP7A 5EORH 1A47A 2R56H 4HULB 3EDEA 2A6DB 5DT1H 3BYTA 1MCPH 3BP5A 4F7EB 2K9UA 3G04A 3MRJB 2IG2L 4KWUA 1WFUA 3DUHA 1T1WB 3ULUC 1KEMH 5GJTH 5DVKA 2GUOA 1I9RL 3UYOD 1CDBA 4TRPH 1U8HA 3JV6A 2W9DH 5M7QA 4R26L 4L4VB 4UMGA 4Z78B 5IVZB 1CIDA 5J3HC 3ARFB 3P0GB 5J13B 3TYGH 4PB9L 4MNQD 5KSAA 4PJ7A 5JQ6H 4QXTB 2W9EL 1S7XB 4FZEH 3ALWA 2A9NL 4NJAH 4OIIH 4HX1B 4NBYB 4RMRA 1CFSB 4QXGL 3VD4A 5AYQA 1V7NH 1RZGB 5F8RC 1FO0A 3VXQB 5F88B 4QGTA 4MA3A 2J2ZA 4WUKL 4WW2B 4YBHA 3U6RA 2A9MH 2HKFH 4YDLC 2FO4B 4MMXC 2NY2C 2VXVL 1OP3K 5T1LB 5E7FA 1Y18A 3MLPA 4M1GL 3RUGB 3UC0H 4LPXA 5CP3A 5JIHA 1BJMA 3HMWH 3HC0A 1UZ8A 5FYJE 5ICZA 4CKVX 1DANT 1I3UA 4ODTL 1KCLA 4Q6IA 4MNHB 3QDMD 2EO1A 2VOTA 1J0KA 5B22A 1IZKA 1OM3H 1BREA 1CG9A 1KB9K 3AAZA 3HAEA 4H26A 4NQUA 3WXVL 3OJDA 1CR9H 3MLYH 1KB5B 3IFOB 3UXFA 3D18B 4C58B 3KLHC 1CDIA 4Z7OE 5HY9A 3TIEA 4KMLB 3MODL 4PRHD 4P2CG 1YA5A 3QDJB 4JM4H 2IPUG 5IMKB 4BUHA 1MCOH 5BXFB 1UT9A 4HJJH 4WTXA 4M61A 1NGPH 4BFIA 1MCIA 4A6YB 2X4NA 3FQWB 2VDNH 5GZND 3AY4C 4QTIL 2HFEA 2A77L 3GHBL 3RNKA 3X13B 2DI8A 1MHEB 4OZFG 4KZDL 2EEAA 2CGRL 1OWWA 5GGVL 3L3JB 2CXGA 5INCB 2Q7YA 4QRTB 1REIA 3QUMH 2P1YA 4P5MB 4BJLA 4FP8L 3T0EE 4LHUB 3PGDB 5AYUH 2ZG3A 3C6SB 5FUZL 3MOBL 5SWQB 3VG9C 1MUJB 3B3IA 1I8MB 1NDMB 3VA2C 4GQPH 4M1DL 4M7LH 5BW7C 4Z7UE 3BHBB 5A3IC 1ONQB 4KY1H 4RISH 2EDTA 3AS2A 3L3HA 6FABL 2VZVA 3L3GA 5KVDL 1MPAH 4QF1A 5DVMA 5F9OL 4R2GC 2AQ3A 2VRAA 4D0BA 4LLWB 5DA0B 5J89A 4HKXB 2C1PB 1DUYB 2OMBA 1JYWA 2OM5A 3VD3A 3FOMA 5D96B 3PXHA 4G5ZH 5C9JB 1CBVL 4XP9H 1S7TA 4HPYL 2M8XA 5KVGL 1VFOA 3C6LD 1GPOH 3KYKH 5GRXG 3U0TB 2PR4L 4J6RL 5HYSG 5F3BA 4M6OL 3RVWC 1IEBA 3QJHA 4NQEA 2YSSB 5FYJD 1OCWH 4AH2B 3LKOB 3C2SA 1YEEL 3P3YA 1QFUH 3MGTB 3BISA 2VB5A 5HYJE 1WZKA 3VXMD 4RMUA 5C0FB 3Q5YA 1CF8H 5IVNA 1L0XA 2OR8A 3TIDB 5F6HJ 1XCTB 2LVEA 4U6HA 4DW2H 1IC4H 3EDKA 3L6FB 3HRPA 2GITB 2D7NA 3D25A 1MAMH 1N2RB 4XXDA 3ARGA 3SGJC 1VPOL 4RMVA 2Z8RA 4NUGL 1OD7A 2NY1D 1VGKA 4NRXB 4ZFOA 2P5EE 1N7MH 3LD8C 5DFVC 3EYQD 3O4LA 1NGYB 1HHJB 2DQTL 5SX4H 5IWLA 3X3GH 5C0RH 5T5NG 1HQ4B 5F6IB 3NCJL 3BPOC 2EDHA 2QSQA 3NH7L 3OKEB 1T3FA 4NKIL 2R2HA 3MRQB 2VLLA 2FJFA 3AU1B 1MNUL 3RU8H 1RZKC 2AJUH 4I48A 4X5WB 3T0ED 1XGRB 5SWZB 3NN8A 1JF1A 3RDTC 1XIWA 2GSGA 3QHFH 2DLIA 4LCYB 2XQBL 3VE0A 1T04B 5DJZA 5EZLB 3SOBH 1AGBB 1H8SA 1HXMA 4WW1B 4I77H 4P2RA 5FO7B 5I0DA 5FO9A 4EZMA 1U93A 5J12C 5CP7B 1G7QA 2EEBA 3OAUH 5D7SL 3WEXB 5MP6H 2VDOL 2FBJH 3IFNH 5I1EH 3G04B 5CGYD 2Z8SA 1F4YH 5CCKH 1P9MC 5B39A 7CGTA 4OQ1A 1R3JA 2GUOB 1NDGA 1K6QL 2YD7A 5CJQH 1U8HB 3JV6B 2ZWLT 2F8OA 1MEXL 3DJ9A 2ZCKL 2YA1A 3IYLW 1J1XH 4C56E 4WY7L 3ZTNL 5KSAB 4PJ7B 3IB4A 3LN9A 2ITCA 2EDDA 3SBWC 2NY4C 1LILA 2DLHA 3OJMB 4DK6A 3RY5A 2P5ED 1KJ2A 3VWKC 1IGIH 1FO0B 3DUUA 4MA3B 3B5TA 1ZLUH 3U6RB 4Y16C 3FAWA 2DM2A 3V52H 2HWZH 1Y18B 2YD8A 2AGJH 4UV4L 3SDXE 3O41A 3HC0B 1UZ8B 3S5LA 3EYSH 5ICZB 2NNAA 4PLJC 3MZGB 4Q6IB 3QH3A 3UBXA 2DJ4A 1MQKH 5E6YA 4IRJC 3NCCB 1LDPL 3WIIH 3VXSA 4ELMA 3FFCE 1CG9B 4H26B 3AAZB 3HAEB 2JLLA 4ZS7H 1VA9A 5C3TA 3OJDB 2RR3A 1OSZA 1L7TH 4S1DD 2MJWA 1LO2H 1KB5H 4UU9B 5HY9B 4J8RA 1RURH 2P46B 3KPQA 1LQSR 4WUUA 4FMKA 2H26A 2DQDL 4M61B 4BFIB 1NQBA 5IMOB 2X4NB 1JMXA 2HFEB 3RNKB 4JZJC 3OL2A 4N0RA 4A6YH 4LLDA 2VDLL 4PFEA 5EBMA 4YFLI 2VXTH 1SM3L 4N0UE 5D2NC 4NZUH 2Q7YB 1NGZA 4JG0H 5LBSL 4MMZC 3ARBD 1OARH 2Q8AL 4WEMB 4N90E 1FNSH 5E2WH 3NAAL 4GMSH 3U0WL 4OCRL 1IAIH 1K9TA 1JPFA 3B3IB 4G42B 4C56D 1I1FA 4LNVA 1F8TL 4LSUH 4IOSD 1MJUL 4W6YB 1KIUA 4P46A 1Z5LA 3L3HB 1PKOA 3L3GB 4F58L 4QF1B 3MYJA 2VL4A 1PG7L 3W0WE 4D0BB 5FAAA 5J8OA 1BPVA 3THML 4Q0XH 1RUKH 4WWKD 3AB0B 2H2PD 3DROA 1QYGL 4X6DE 1S7TB 4AIZA 2JCCA 4JO2L 5F3BB 4PJCA 1IEBB 3DNKA 3QJHB 4NQEB 5FXCH 3F12A 4OKDA 4J3SA 3V4VL 2DTML 2BDNH 4QRQA 4LCCA 3VGGA 4ENED 1A0QL 1EHLL 1XGQA 4MQ7A 1AXTL 3QIUD 2ERJB 5TGBA 1OAQL 4U6HB 1KV3A 3ZHKA 3O6LH 1XF5A 4XVUC 1K4DA 2XTJE 3D25B 3QIBC 4YQXL 4XXDB 1G7IA 3NOIA 3ARGB 4Y4FD 5HPOA 3DETC 3IDUA 1ADQA 2IALA 5D1XA 2HYMA 5DD6A 1VGKB 5EUKA 1JUFA 5BV7B 1B4RA 3NTCL 4ZFOB 4PRIE 1N4XL 3O4LB 2OXHA 1KEGL 5DHVA 1J0HA 3NFSL 2CJUL 5I71B 1M71A 4HF5H 2E7MA 4X7TA 4P2QE 1F02I 2WBJD 4MHHG 3ARED 3CVIH 3BAEH 4N1HB 4DZBA 2HFGH 4FG6D 2EDQA 2V5TA 4PJBE 1T3FB 1U8QA 2X4QA 2R2HB 1CFVL 4UTBL 2VLLB 2FJFB 2ATPA 4U0QB 4I48B 5JDSA 4P5TD 4N90D 4DKEH 1P4LA 2NY0C 3NN8B 1JF1B 1L6ZA 1JWSA 3GK8L 1XIWB 3TBSA 5F9DC 3ZDXE 2NTFA 2VLJD 4Z18A 3VE0B 2Q7NA 3F58H 2ZJSL 5DJZB 1HXMB 5ANMA 3E1F1 4P2RB 2APBA 4JG1L 4HUNB 5FO9B 1MJ8H 1U93B 3W82A 3UJTH 4MA7H 1G7QB 1X6NA 1Q0YH 4HCRL 1T2QH 5DMGC 3KPRE 3B6SA 3UTTD 5HHXL 4XP5L 3TO4C 2V2WA 3UJJH 2ZSVA 4NDMA 4DGIL 5C7XL 1FFOA 1NKOA 3B43A 2P5WB 5GGSY 3ZE2E 2V6HA 5B39B 1BZ9A 4Y5YA 3UPRA 1R3JB 5C0JB 43C9A 1NDGB 4KKNA 1I1CA 2HFFA 1NSNL 3JWOC 3T09A 1FP5A 3DO3A 4TSBH 1E4XH 2OP4L 1LK2B 4JO1H 3L1OL 4QNPF 4ZO7A 4Y4HC 1JZ4A 4X9BA 4PJFA 3P9LA 3VRIA 1A6WH 2ITCB 1QPPA 2XTJD 3T2OA 4CUCA 3QBTB 5HDQH 2B4CC 4WTZG 2VMFA 2J4WH 4RSVA 5T3ZL 3S3SA 1MFDH 1R24A 3DI2B 1G0YR 1KJ2B 4GG6A 1A3QA 4PJXA 3DO7B 1YNKL 1KIRA 1MFCL 4TUKH 2CXKA 3DUUB 2FL5A 1FO0H 5E99L 3U2SB 1RZIA 4P2QD 3SGDH 2YKLL 2G5BA 4LVOC 5CEZH 1CXEA 4Y2DA 1FYTE 1MVUA 4LQ1A 5TJWK 3BSZL 2VXUH 3S5LB 5CP3H 1OB1A 2NNAB 5K9KA 1Z3GH 1NMAL 4O2CA 2A6JA 1G1CA 3QH3B 4UIKL 1CL7L 1URLA 1UWGL 5FGSA 5F70A 3GKWH 3UZQA 2DQJL 2OR7A 4ZUTA 3WDJA 1G0DA 3TPUA 3ZSTA 3QQ3A 3VXSB 1DQJA 2VDMH 4ELMB 1CZ8H 4QTHA 5DURB 1EAJA 2QQKH 1VKXA 1OSZB 3RGVA 3HAEH 2Z93A 2NY3B 1F6AA 1FL5A 3C60A 4LIQH 4WJ5A 5MEQA 4J8RB 4OD2A 4PS4L 1I9IH 1QFHA 3ELAT 3KPQB 1QNZL 5DQDH 1NJ9A 1UCBL 4WUUB 3KPRD 2H26B 2D7MA 3EO1B 4NN7B 3O3BA 5E4EC 3UJIH 4LLDB 4MDIA 5KS9F 4TNWK 5EBMB 4LKCA 1AKJD 3FT4A 1JE6A 2R0KH 3DYOA 4OV6F 3GSRA 4QRPA 3VDBA 1X4XA 1NGZB 4EJ1C 3RBGA 1NFDB 1JNJA 3JTSA 1YEFL 2P47B 4CVXA 1JPFB 4HFUL 1L0QA 2Z9TA 1I1FB 3K4DA 4FXGA 1WITA 1QLFA 4N5UA 5CINH 4P46B 1D5ZA 2XI9A 3CSGA 5ICXA 2ZUSA 1Z5LB 4DTGH 3W11D 5F71A 3UAJD 4XCEA 3SDCD 3MYJB 1BVLA 3JV5A 4XWOC 1UM6L 2VC2H 4X6FA 1JPSH 3LIZL 4BA8A 4HJ0C 4XHJD 1FVCA 5FFLA 3DROB 3NACL 5B3JE 2FEDC 2GJ6A 5DGRA 5GRZA 4AIZB 2JCCB 1FYTD 1JNNH 4KKLD 5TE6L 5TPWL 5J6GA 3OXRA 3C2AH 4F7TA 4PJCB 1TFHA 1GGUA 4HG4K 3F12B 2R1WA 3B9KC 1II4E 4QRQB 4LCCB 4RGND 1XGQB 4MQ7B 5DJ8A 4DAGH 1QFWH 2EZ0D 5TGBB 4WO4D 4ZO8A 4HEPG 4DGYL 4UDUA 4OCNC 1MCWW 1XF5B 2YPVL 1K4DB 1IM9A 1G7IB 1PW3A 5JXEC 1JL8A 3VFMB 4EVNA 3B5HA 5CMAA 4OLUH 2A0LC 2IALB 4U6YA 5D1XB 5DD6B 1JCKA 2BNUA 1JUFB 5EUKB 5I8KL 1BFTA 3TJHC 4JHAH 3INUL 4IRZH 4XMLL 5BV7H 2YUVA 3RWJA 5HVGB 5DHVB 3HCVA 5EU6A 1NBVL 4F57H 3ZYIA 3O3UN 5B4MD 1UM4L 4AG4L 4M7JL 4X7TB 2QL1A 5ALCH 1NEZA 1A2YA 4KPHL 2YOCA 1CVSC 2EEDA 4DZBB 3TNNA 4M43H 2UWEE 1EV2E 1IGTA 1A7RL 2ED8A 1U8QB 3ZL4L 1BF2A 2X4QB 4OZIE 3B9EA 4KVNH 4AQOA 3VWJD 4X4YA 3O6FD 4ZAKD 3RWGA 3VI3E 1U8OA 1LP9A 3QI9B 4LGSB 2ATPB 3KPTA 4JFFA 5CFHA 5JDSB 3HE6A 3I6GA 3MTRA 4NQVA 4NN5B 5ABDE 5I6XC 1P4LB 2R9HC 3GI8L 3KXFA 4P9HH 1JWSB 1NL0H 3TBSB 1YECH 5C0GA 5SWSA 2NTFB 1JRHI 4LP4A 2EXYD 1CXLA 4U7SA 1SJEA 4EDXA 1I1AD 3IDNA 5ANMB 4XAWL 3P4LA 4U49A 4MD0A 5ESVA 2R0LH 1IAKB 1XF3A 4UBDC 4PJGA 4HFWA 4TVPL 4DEPB 3GRWA 1PGRB 3RPIA 3B6SB 3MLRL 5F9WC 4D0CA 4PJFF 3OAZH 2V2WB 2WUBL 3FJTA 2XT1B 2WANA 1CD1A 2K7QA 3B8YA 4E5XA 1IT9L 2ZSVB 1Q94A 3WXWH 1FFOB 3HS0A 4BH7A 4PB0L 3DGGA 4XMPL 1BZ9B 2D7OA 4Y5YB 5AAWA 5I16A 1WFTA 5IVXA 3UPRB 4GG6F 4PJXF 1RY7B 1DN0A 3OAYH 43C9B 2HFFB 4GXVH 3QIWD 2J88L 5GS0C 3HFML 2HT2D 2XWBA 2AP2A 4I18A 2E5EA 2GKIA 1PX3A 4HWBA 4CW1A 2W0PA 4L3EA 3C8KA 1BBJA 1UENA 4U7KA 3SCMD 1T7ZA 5JZ7C 3VI4E 4PJFB 2B2XH 3P9LB 3VRIB 4DFHA 1UCTA 1CGXA 1Q9LA 4WI6A 3KJ6L 2W0LA 3M45A 1R24B 3LS4L 2PXYC 3BKMH 4UT7H 2P44B 3SJVA 4GG6B 4PJXB 3IU3A 1KIRB 5A43C 1KJ2H 2FL5B 4O02H 3TJEH 1TQBB 4KQ4H 1RZIB 5C07E 1VGEL 2G5BB 3GBML 4Y2DB 3EOTH 3T3PF 4UAOB 3L7FB 3B2UC 2W1NA 1MVUB 4Z7NF 1F6LL 1AQDA 4UQ2A 5IQ7L 1FVEA 1OB1B 3EOBA 4APQD 5K9KB 1N5YH 2C3GA 4XNZC 4O2CB 2A6JB 1W2KT 3V4UH 4ZOCA 3DX9A 5I1GL 4ZUTB 4FFWC 1UFUA 3TPUB 5SV4A 3QQ3B 4OFYD 1DQJB 4PJEA 3TH2T 2C3HA 3GZKA 4QTHB 3T2NH 1VKXB 2IWGA 2QV2A 2B4CL 3RGVB 5IB3A 2GAZA 1C16A 2Z93B 4YPJA 1FFPA 1IQWH 1F6AB 1FL5B 3C60B 5B3NA 2B39A 4WJ5B 3KPSA 2VXSL 5MEQB 4OD2B 4YXLL 2NX5E 4XPAH 3TZVC 5I73C 3MRKA 1JMZA 5IEKA 5FHAH 1NUDA 1NJ9B 3PL6A 2B0SH 3MGOA 4YHIA 3C5SA 3E8UL 4AEHL 5AUMA 3O3BB 4K7PX 3EDFA 5D1QB 3S36L 5I8EA 1TVDA 2AJZA 3QUYA 3MUGA 2GQHA 1A3RL 1OTUC 4LKCB 4XNUL 5A2LH 1KBGL 2NMSA 3LQAC 3FT4B 4KKAC 1MAKA 3PHQA 4NZRH 1JNLL 1FH5H 1NCWL 3GSRB 2X9WA 4QRPB 1P84J 4ODUA 3RWHA 4TTGA 2P4AB 3JTSB 4QEGA 3DWTA 4WHYH 4CVXB 1U91A 5EZIL 3VDAA 4FXGB 3UDWC 1QR4A 1QLFB 1MHHA 5ICXB 2ENSA 1V8HA 2FH6A 3OGCA 5TH2A 2VXQL 1ACYH 1NCBL 5CWSA 4XCEB 3WFZA 3ZSSA 2L0DA 2NY7H 1BVLB 3T0DA 4X6FB 5E70A 5GISL 4AL8H 1YYLH 5DS8A 1J05A 3OJ2C 1KJ3L 1FVCB 5FYKH 4TVSa 2FCBA 2GJ6B 4FABH 5B38B 1JNHA 2XWTA 2EKSA 4TSAH 1JGUH 5J6GB 2FGZA 1WAAE 2GTWA 3OXRB 4KJWC 1ACZA 5AAMA 5T1MA 1MCRA 2HA1A 3SKJH 3D1MC 3F8UB 4HH9A 4FS0A 2R1WB 3IAQA 2ZKHH 5GRJL 3K8KA 2BSSA 5DJXA 1CFBA 5DJ8B 1NAMH 4L4VE 5I75C 4FQJL 1U8NA 5C6TL 5ITBH 4UDUB 4LRIC 1CLYL 1AY1L 4LFHD 1IM9B 1T66C 1NCCH 4M02A 4EVNB 1U3HA 5CMAB 4U6YB 2BNUB 1DQML 1LP9F 2NX5D 3AVEA 1ADQH 3V0WL 3QDAA 3O2VL 1RIVH 3RWJB 3HCVB 3PWLA 2IAMC 1OD9A 3L5IA 3R8BB 3P40A 3ZHLA 4UI2A 2EDLA 1A2YB 2A1WL 3K4ZA 5FOJA 4RBPH 4BFGA 3FQUA 4Z0XB 2AI0H 2Q8BL 3QWRD 3T77A 3RUGE 3FCTA 3QCVH 4OTXH 3TNNB 1IGTB 4U0RC 1BIHA 4R90L 5F7YC 5BS0D 1CXKA 4PJGF 4DKDC 4X4YB 3DECA 3RWGB 1U8OB 4XNYH 1LP9B 1F11B 2QHRL 4JFFB 2DIAA 1RZFH 2NW3A 3HE6B 3I6GB 4NQVB 1KTDA 3STZA 1WBZA 1KJVA 3KXFB 3U7YH 1FE8L 2Q20A 1TPXC 5SWSB 1DBAL 5C0GB 3EJZC 4G3YH 5A40E 4X7SL 3U46A 4MQXC 2AJSH 2C1OA 5IBTH 3IKKA 4OF7A 5IVXF 5CZVH 4EDXB 3MPCA 2AK4D 2CR3A 4EDWH 1JZ3A 4MD0B 5IUSA 5ESVB 3CFCL 1XF3B 3QDJE 1MLBA 4PJGB 2P24A 4FQHA 4HFWB 1UEYA 3RPIB 5DO2C 4D0CB 1JV5A 3PP3H 4NZTH 2PNDA 2NY5H 5GRYA 1CD1B 4YBLB 4E5XB 3E2HC 1R6VA 1Q94B 1WIUA 4MAUH 3HS0B 2PKDA 5F7EH 4BFEA 1ND0A 1XR8A 1UYWL 2ARJQ 4BH7B 3FO1A 3DGGB 3IAPA 5I16B 5IVXB 2IPTL 1DN0B 1HHIA 2ZOLA 2Y06L 2GYSA 2QADC 2XWBB 4L4VD 3OKKA 4I18B 3FZUD 1MJJA 3KLDA 4CW1B 1A64A 3ARFD 4L3EB 3EDJA 3C8KB 1BBJB 4L1DA 1MCNA 2DB8A 3RTQA 4JRXA 5CSZA 3W5NA 3BKYH 1A7OL 1Q9LB 1YPZA 4LSVH 2F19L 3VGHA 3WHE0 1CU4H 5F7DA 1PKQA 4WFEE 1S8DB 4XP4L 4LRNH 1LO5A 3SJVB 4KKBC 3IU3B 4PJEF 1D5IH 4HWNA 1OAUH 3S34L 3QG7H 3WE6A 3BIKA 2PF6A 4MXQC 4OD3L 1O7SA 1HKLL 4RX4A 1AQDB 5E8DL 4UQ2B 4LMQI 2BJMH 1FVEB 4P4KC 2Y9RT 3EOBB 1E28A 1Z6JT 3BJLA 5GS0L 3LSOA 5DK0A 3DX9B 3H9HA 2C9AA 3MCLL 4OZHF 3QFJE 3N1MC 4PJEB 4N68A 4KDWA 3TBTA 4IBLT 4OFIA 4OI7A 5IB3B 4DN4L 4OM0L 2GAZB 1C16B 4UINL 2RGSA 1D9KD 1FFPB 3R0MA 2HTKD 3LRHA 3KPSB 1V3KA 1EUUA 2F54A 3QDJD 3MRKB 2VDQH 1BOYA 4O5LH 5GGRY 2FH8A 3PL6B 2X1XR 4NWTH 4PJHB 4YHIB 3C5SB 5AUMB 3WLWD 1UACH 2IFFL 4PGZA 2RCSL 3MLZH 1AJ7L 5I8EB 3GBNL 4OUUA 2AJZB 3QUYB 1GGBH 4BUGA 3EGSA 3MUGB 3H42H 5I30H 3PHQB 4NM4L 1NLDH 3RWHB 4ODUB 1P4IH 4UT9L 4LHUD 5SWZE 5KVFH 2AABH 1IQDA 4RWYL 3D39A 4J4PC 1U91B 1GZQA 5E2JA 1FDLL 1WEJH 4XCCH 1MHHB 3OGCB 1RQ5A 4TULL 5TH2B 3HN3A 4WFED 5CWSB 5TE7L 3NIFE 1PG7W 5C2BL 2C26A 4HLZG 5DS8B 1J05B 4JFXA 4JKLA 4OLWH 3WDHA 2XWTB 2EKSB 2VKWA 4IDLA 4M1CD 2EDFA 2GTWB 3LQAL 2GIYA 3L3IA 3V9FA 5T1MB 3V4PL 4G6JL 1R3IH 5IJVA 4HH9B 4TQEH 5JR1H 4I3SL 2BSSB 2ZNXA 2BVEA 1TZGL 4ZPVA 5IB4A 5HI4C 1S7SA 1U8NB 4CJ1A 2JF1A 4PJ7E 1CVRA 4Z0BL 5T5NF 2VDKH 3ZE0F 1U3HB 4NCDA 2D0HA 4RRPG 3IDJA 3QR2A 3FN3A 3VFWA 4C83A 1H3PH 4MJ6A 1YMMA 3PWLB 2FGWH 2BRRH 5B21A 5BW7A 1J8KA 3PHOA 4Y2OA 3MJ9L 1EA9C 3MLSH 3WD5L 5L88L 5JIKA 5CEZE 2CLZA 3SGEH 1KN4H 4BH8A 3N0PB 3MV9A 3FQUB 3T77B 3FCTB 3DLQR 1QG3A 4ZOAA 3JXAA 3W2DL 1AC6A 5JORA 5J56B 2DLGA 4TNVK 4JHWL 2NTSP 1OP3H 5SWZD 2NW3B 3F65A 5I1HH 1KTDB 3STZB 1WBZB 4ZSOA 1KJVB 4LMQE 2BXYA 2CLRA 4XRCA 4WENB 1YC7A 2C4XA 4OB5H 3MBED 3U46B 5C0CA 2YK1H 2C1OB 3S88H 3QDGE 1YNLL 1CTNA 2DM7A 1KT2A 5IHLB 2HT3C 4JPWL 1MLBB 2P24B 4X4MA 4FQHB 1QBLL 4DVRL 1RIUL 3T2PA 1FNGA 1FVDA 3QPXL 5E6IA 1JV5B 1A22B 3HNSL 4LSSL 5F97E 5F7FA 3T3ME 3GMRA 1YPZF 1EMTL 3HHRB 4XCNA 4CU8A 4M6NH 4FFYH 1WVZA 1ND0B 4NHCH 2PW2A 1XR8B 5CJXC 3FO1B 2O5ZL 2VZUA 3S4SG 2J6EH 4HCRA 5GGSA 4K94C 1HHIB 5JHDA 2ZOLB 1AGFA 1G7PA 3H9SA 3OKKB 3OB0K 3HPJA 1MJJB 3RP1A 3NPSC 3QQ9D 3ORJA 2IG2H 3RTQB 4JRXB 5T33L 5CSZB 1YPZB 5F7DB 1PKQB 1PLGL 4D2NA 1I9RH 4ZUWA 2PYEA 1LO5B 1P6FA 3RDTA 5F1OB 3ARRA 2J5LB 4R26H 2GT9A 3WS3A 2BY3A 5CEZD 4PB9H 3WE6B 3BIKB 3MQIA 5BOZG 2NLJA 2W9EH 5HD8C 3NGBC 2A9NH 3TNMA 1UZ6F 3ARQA 1FJ1A 1QHPA 4QXGH 2Y72A 3LMJL 4ORZC 1S5IL 3LSOB 5DK0B 3H9HB 4ONHA 4UNTA 3CX2A 1MF2L 3P4NA 2NXYC 1P69B 4GMTL 4LSPL 4U7MA 3BPNC 3TBTB 5JOPE 3W5MA 2VXVH 3SE8L 4M1GH 5K9QG 3O6KL 2D7PA 4JM2C 2E27L 4ODTH 3HG1A 1G9MC 3QAZC 3O4LE 2IBGA 3FQTA 5JDJA 4IJ3C 4G8IA 3KWWA 4XGZA 3WXVH 3HR5A 3TN0C 3SBWA 2Y6SC 1FZMA 3VXOA 3MRFA 4HC1L 1S78D 2LAGB 5FYLE 4OUUB 2OMNA 3EGSB 1TXKA 1FAIH 3MODH 5K93A 5ITFA 2AV7A 1HZHL 3K2UL 1QSFA 1HYSD 4H0HB 2Y1VA 3ZE1E 4PLKD 4YDLB 4QHKI 3TBYA 5ETUA 2NY2B 3GFUA 4OF3A 1IQDB 4YC2C 3D39B 4QTIH 4HGMA 2A77H 3F7QA 3GHBH 1GZQB 3MREA 5ID1A 4GAJL 4XMKL 4HQQH 4KZDH 2CGRH 2GFBA 3NCFB 2H2SC 5GGVH 2WIMA 1DFBL 4P2RE 2CRYA 4IRJA 1CGSL 3V5DA 5I1KL 1AR1D 1IGML 3BGMA 4FP8H 4I5BA 4IMKC 5FUZH 3MOBH 2UVFA 5TE4L 2X10A 4YHPA 4M1DH 2XA8L 4JFXB 2YEZA 2D4FA 1U3YA 4GAGL 1U8LA 4IDJL 2PW1A 3L3IB 6FABH 1KIPA 2P5WE 4WDIA 5IVOA 5T3XE 5KVDH 5IJVB 5JA9A 1AGCA 2VYRE 1AXIB 5F9OH 3BRDA 1JYNA 2MSPA 3QO1A 4NO5A 3ME0A 1PDKA 4ZPVB 3ILPA 5IB4B 4JZJA 4F37K 1S7SB 1CBVH 1J87A 5JOPD 2FIKA 3T0XA 5KVGH 3VD5A 2DICA 5D2NA 5D5MB 4DQOL 2PR4H 4J6RH 3LB6D 5C71A 4M6OH 1LE9A 3ARGD 4ONGL 3E6HA 1P2CA 1YEEH 3IDJB 4JREC 1WK0A 3D6GA 4FZ8L 4C83B 3PWPA 3VG9B 3O4LD 1WCQA 2IFGA 1YMMB 4MJ6B 5CAYB 5CJ8A 5D8JL 2JJTC 5EC1A 3PHOB 4OT1L 1JTTA 1BZ7A 5GS1C 4OF6A 5DJDA 2CLZB 2X9XA 4BH8B 1QSVA 5FYLD 3MV9B 3C5JA 1Z9MA 3BRGC 2MOVA 1VPOH 4R2GB 3WUZA 4NUGH 3ZKMC 3B8SA 4MZ2A 5JORB 2NXZC 1ZA3A 2Y5EA 3BP7A 2DQTH 5CBAA 2HG5A 2COQA 4MDJA 3WV0A 4JVPA 4ZSOB 2MWCA 4EUPG 1XIWD 3NCJH 3VXSE 4ELME 2CLRB 3IDYC 1F42A 4XRCB 4YX2L 3NH7H 5C0CB 3RZCC 4NKIH 1YN7A 3P4MA 1KT2B 4P2RD 1MNUH 4FQCL 3RZWA 2X6MA 1CD0A 2LU3A 1QKZL 2DWDA 2YHGA 1J0ZA 5D7IF 2AEQL 5GRVL 3I9GL 1E4WL 1FNGB 1FVDB 3CLFL 1V3JA 3QIBA 1AO7A 4QRRA 5E6IB 4G43A 1UGNA 1IKFL 1UXWA 4ZXBC 1QP1A 5KSBA 2XQBH 4OZ4B 5IP4A 3GMRB 3LD8B 4XCNB 4RA3A 2P5WD 5T3XD 2PW2B 4BELD 4WI9A 4AZ8A 4RGOL 5GGSB 1W72L 5IBUB 3SE9L 1NFDE 4Z95L 2DQCL 3F5WA 5D7SH 5JHDB 1AGFB 3H3PL 5E9DE 2VDOH 4NKDA 3BPOB 3H9SB 4NGHH 5E24E 3HPJB 3VCLA 3WJJC 1EFXA 4YH6A 4MSWA 4OZGF 3DXAA 5FGBC 2H8PA 1BECA 1K6QH 2PYEB 4ZUWB 5GGTH 3RDTB 1MAJA 2YUXA 1JK8A 1MEXH 1NKRA 1WWBX 2ZCKH 4ONOA 5FM5O 5A16A 2YA0A 3LY6A 2GT9B 3BVNA 3WS3B 4WY7H 5HHOA 3ZTNH 3D85A 5EU3A 3MCG1 2NLJB 5HGBA 2JCCE 4K07A 4ZS6D 4PP1C 1HNGA 1IMHC 4PJCE 1T0NA 3TNMB 4S0SD 2XZAL 1FJ1B 1XF4A 2EE9A 1JFQL 3WKML 4KHTL 1IM3A 3TO4A 4LQFL 4ONHB 3LKSA 4GLRH 4C55A 1Q8MA 3P4NB 3VXSD 1NEUA 3K80A 5DURD 3QEUA 2VQTA 3HTLX 4QXWA 4UV4H 4OI8A 2NY3D 4KTYA 5IT2L 4EOWL 1SYSA 2HN7A 4HIEA 1IEHA 2X7LA 3HG1B 1TQCC 4HIHA 4MLSA 5JLZA 4XPGL 5EC2A 5LQBL 4R7DA 4Y4HA 3FQTB 1ZLVK 4R4ND 5KAQG 4WUUD 4NFBA 1BF8A 4G8IB 3GSOA 3KWWB 4XGZB 1LDPH 3L5WA 2VQUA 2BCKA 3HR5B 4MWFA 5HVWA 2NY4B 1FZMB 3VXOB 1A21A 1Q0XL 2I07A 3MRFB 4Y5VC 4CN6A 5F7KC 5GRVK 8CGTA 3VXTA 3VWKB 5ITFB 2AV7B 4ESKA 5EZJA 1I1RA 5IHBA 1QSFB 1NUFA 1T22A 3KR3L 4Y16B 3TBYB 2MPAL 5ETUB 2DQDH 3CDCA 1P1ZA 4JKKA 5ID1B 3MREB 4HV8A 5E00A 4JRWA 3N50A 3IRZA 2VDLH 3RVVC 3CNKA 3HUJF 4H8WC 4P46D 4YR6B 1SM3H 3MRLA 5GZOD 1TVBA 1G9ML 5ANME 3BQUD 1T6WA 4IRJB 3V5DB 5LBSH 1A7QL 1FYHB 4G6AC 4I5BB 3BGMB 1JPGA 2Q8AH 1KXTB 4MS8D 3NAAH 3U0WH 1V05A 4OCRH 4YHPB 3GIZL 1QFWM 1F8TH 2YEZB 2VQ1A 1MJUH 2HLFC 3WFEL 4JVUA 1U8LB 1F5WA 2PW1B 1U42A 5JMOC 1KIPB 5EN2A 4WDIB 4F58H 1AGCB 4KK6C 1CI5A 1PG7H 3QYCA 3AC0A 3QO1B 4NO5B 3THMH 3U4AA 3M07A 3ILPB 4JZJB 3PE9A 4NN6C 1QYGH 2FIKB 4BZ2L 3MXVL 1TCMA 4I4WA 5D2NB 4JO2H 5FA3A 3X12A 2R0ZL 1LE9B 5JNYA 4W4NA 3E6HB 3OZ9L 1L9NA 1QBML 2MNUA 5D1XD 3QEQA 3V4VH 2DTMH 4UILL 5BRZE 1A0QH 3E3QE 3PWPB 1EHLH 4UTAL 1AXTH 1S9WA 1D3CA 1Q72L 1OAQH 2XG4A 5EC1B 1BZ7B 3WYRA 5DJDB 3HMXL 3C5JB 4YQXH 2BZDA 1XH3A 3NBNA 4LFHG 4HPOL 3NTCH 2CIIA 1PY4A 3HKFA 4GAFB 1N4XH 1KEGH 3QI9D 1ZA3B 3BP7B 3FB7A 3NFSH 2A74A 2CJUH 5DWUL 5CBAB 2HG5B 1G6RL 1X5ZA 3C6LC 4NKQB 1YQ2A 2YBRA 3QUZA 5L2JA 1WCBA 1KOAA 4DUXA 4W4OC 4LU5L 3T3PE 1YN7B 1CFVH 3P4MB 4UTBH 4YLQT 4Z7NE 4HXAH 5IG7A 3TESA 3UTZA 3O2DL 2DWDB 2BY2A 4U2YA 3QIBB 3QNZA 4QRRB 1AO7B 5JXEA 3GK8H 4G43B 5F7WC 1UXWB 5KSBB 1P5VA 3DYPA 3PDOA 4NQTA 4FQ2L 2ZJSH 1JRHL 5IM7A 4LVHC 4JG1H 2OX5A 4HCRH 3F5WB 4NBZB 2AEPL 1S5HA 3PXJA 4NKDB 5HHXH 4HEME 4XP5H 1A4JA 3VCLB 3Q1SH 2Y5TA 4CGTA 3I6KA 2EICA 3NCYP 4DGIH 5C7XH 3V79C 3LN5A 4A2MA 1VEOA 1MCCA 1I9EA 3AS0A 1BD2A 1A6AA 4YHKL 1EFXB 4MSWB 1DVFC 5BRZD 3DIFA 1FNFA 3DXAB 2NY0B 2H8PB 5DD5L 1NSNH 4Y5XC 1JK8B 2G60L 3DSFL 2SEBA 3CVHL 5A16B 2OP4H 3BVNB 3P2TA 5HHOB 3L1OH 3K1KC 5LXGL 1YYML 3C09C 3D85B 2DQGL 2Y7QA 5EU3B 5HYJA 5HGBB 4LPUA 4LF3A 4Y2DD 4FNLL 1ZV5A 1T0NB 3MOAL 1BOGA 1VEMA 5T3ZH 1XF4B 1OAZH 2BP3A 1IC1A 1BVKA 2VR4A 3B9DA 3V7AE 4LPTA 3TO4B 1IM3B 1YNKH 1WWCA 4KJPC 1MFCH 5JW4R 1RZJH 3LKSB 1JHKL 5E99H 4YHZL 1DP0A 2VWEC 3CDYA 1HEZA 2YKLH 4HG4J 3QEUB 3RGVD 3C60D 2I60L 3T0WA 3BSZH 4L4TA 1SYSB 2HN7B 2XRAL 4HIEB 2DIBA 5C6WH 2X7LB 4HIHB 1MFNA 4UIKH 5JLZB 1CL7H 5EC2B 1UWGH 4R7DB 4Y4HB 2DQJH 1ZLWK 4KK9D 3GSOB 4KJQD 3L5WB 5GGRA 5ID0A 2W9LA 4NQSA 1WIOA 5KSVA 5D1QD 3TP4A 2PXYA 5MEPA 4PS4H 1CXHA 2VN4A 3GSQA 5EZJB 1CGYA 4H88L 4QRPD 2C3WA 4HMDA 4JFFE 3W9EA 1RHHA 1VFMA 3OKLA 5E5MA 3WNMA 3KXFE 5DI8A 4FHBD 2KZWA 3LN4A 3SKUD 1Y6NR 5SWSE 4Q7DA 4HV8B 5E00B 3FONA 4KROC 4I0PC 1EJ6A 4KUZL 1U6AL 1PSKL 2IBZX 3MRLB 1TVBB 1JPGB 3LPFA 4U05A 5DFTA 2IQ9L 1ITCA 1H3WM 1YEFH 1IKNC 4LHUG 3NIDF 4HFUH 2NQCA 5TQ0L 1R3LB 1CD8A 1RMFL 3TZVA 3CXHJ 5EN2B 1HCVA 4U6TA 2DN7A 5IROC 3AM8C 1UM6H 4KKCC 4P5KA 3UYPA 4RCAA 3LIZH 5D7JC 5E4EB 3G9AB 1BJ1J 1D5BA 1EJOL 1OGTA 4L3EE 5L0QC 4YDKL 3VA6A 4H8WL 5FA3B 4IS6B 5TPWH 5TE6H 3ABZA 1IM9D 4KVCL 4YBQD 3X12B 5JNYB 4XH2A 2ADFL 3QEQB 4WI5A 3UZVB 2WUCH 3KGRA 4EN3C 3RL1A 4M4PA 2R29L 1JVKA 4Z7OF 1S9WB 3SJVE 3UDWA 1GIGL 2WWKT 1UJ3C 3ZDZE 4HHAA 4DGYH 2EDRA 4KK5C 4WEUD 4Q58C 1UKQA 2YPVH 1YEJL 1OAYL 5I1DA 3CD4A 3RKDD 1IAII 1XH3B 2FX9L 2OZ4L 1T20A 5I8KH 2CIIB 3V5HA 3FFCA 4RMTA 3RX8A 5TF0A 4MQTB 2OTPA 3INUH 4XMLH 2FDBP 4JFFD 3MJ9A 3FB7B 1NBVH 2A74B 3ARXA 5HJ3A 3HE6D 4Y4FA 1UM4H 3IDIA 1DCLA 1PEZA 4AG4H 4M7JH 3KXFD 1S7UA 5SWSD 3NA9L 3MGAA 4KPHH 4HT1L 2YBRB 4X7DC 3QUZB 5L2JB 1YEIL 5D72L 1WCBB 4OGYL 2DAVA 1A7RH 2YZ8A 3ZL4H 3KPSE 3ES6A 4Z7UF 2XY2A 4X8JB 3FO0L 2WBJA 5IG7B 1MCLA 4LRIA 3WL9A 4PPTA 3UTZB 3DX6A 5D71L 2ZUQC 3GI8H 5CD3A 1KXQE 3PWVB 3QNZB 5HHQA 4NCC1 4PJHE 3VFRA 4DKFL 5HHMB 4CL7A 1LO4L 1IFHL 5F9JA 3PDOB 4ODVL 5DC9B 5IM7B 1U3JA 3P9WB 2DTSA 1AC0A 4B0MM 1CXFA 4TVPH 1S5HB 3MLRH 4M7LT 1A4JB 2P8MA 4L3ED 2WUBH 2Y5TB 3I6KB 3I6LE 4U1IA 3W0WA 3LN5B 4MVBC 3SDAC 2WWMD 1BD2B 2WV3A 1A6AB 2XWJA 2EYRA 4PB0H 3T1FA 5I6XB 1Z9LA 3QULA 1U41A 3DIFB 4JPIA 3EYUL 4X6DA 3MSPA 4XHQA 3HPLA 3S8WA 5JW4N 3GM8A 3TFKD 3SJVD 2J88H 1NUGA 2SEBB 4V1DA 3SE4C 4DN3L 5DUBA 1EXUA 4MD4B 2Y7QB 2AQ1A 1CDJA 5HYJB 3N06B 4W6XB 4LF3B 4FTVA 3FHQA 5FKPA 3KJ6H 2E3VA 3CDFA 1BOGB 3BE1L 3V6BR 4JY5L 2QSTA 1BVKB 3LS4H 4KI5E 1FNHA 5F9WB 1UVQA 3FHAA 5HPMA 3OSKA 5FDWA 3SO3B 3IJHA 3U9UB 1HEZB 1VGEH 3GBMH 1H0DA 4WRLA 3G5XA 25C8L 4PRIA 1CYGA 1T7YA 1M7XA 2ZCLL 3K3QA 2VE6A 1F45A 4LGRB 2JB5L 4K7PL 1ORSA 1L9MA 3KPSD 4L4TB 1KELL 1X4ZA 2HRPL 5IQ7H 4YUEL 4P59L 1YY8A 3X14A 1IC7L 4ZUVA 2BSTA 5I1GH 1F90H 3NCEB 2B5IC 3PL6D 4NNXA 4TNVF 2R1YA 4GBXA 5GGRB 4PUBL 5ID0B 4NQSB 4X6BA 5GHWL 2B4CH 2C7UA 3HAEG 3F6LA 1X5XA 4ZO6A 5KSVB 3QUYD 2PXYB 1CQYA 3LPWA 5MEPB 1XZ0B 1U58A 2VXSH 4YXLH 3GSQB 2NCMA 1N64L 5E8NA 5AEAA 1T7XA 2APXA 3W9EB 1RHHB 5FEBA 3OKLB 8FABA 4HC1A 2A2QT 5E5MB 5CEYA 3ULVC 2AXHA 5DI8B 3E8UH 4LLUA 3LN4B 4AEHH 1OLLA 2K7PA 3FONB 3S36H 1W0VA 3NMEA 4UUJA 1IRAY 4P4KA 5JA8B 4XNZB 1A3RH 3DARA 4XNUH 2HJLA 1KBGH 1KCVL 5C0ND 1JNLH 1NCWH 5D7LA 1B0GA 1Q9WA 2X4TA 5CZXC 4CU7A 1JIBA 3WUWA 1KENL 3QHZH 1NCUA 3ZTJH 3BUYA 1K2DA 4XI5C 5EZIH 4KRPC 3RJDA 3HE7C 4G6KL 3LDBC 4K7FA 3TZVB 5I73B 3QZWB 1W0YT 2F53A 4JFHE 3KLAA 2VXQH 3MA7B 1NCBH 2RAMA 4MNGA 4KI5D 3NFNA 4P5KB 5GISH 2BOBA 1QOKA 1KJ3H 3DTXA 1D5BB 2EYSA 1OGTB 1F58L 4JRXE 1MCWM 3RL2A 4XH2B 1CDUA 1U3HD 3Q5TA 1ZTXL 1A9BA 3FB5A 5GRJH 2O5XL 3U4BL 3RL1B 4OLXL 3B9AA 3V6ZA 5E6ZA 4J4PA 1MCDA 3I85A 4FQJH 2R2EA 3CMGA 4HHAB 5C6TH 1EH9A 1CLYH 1PY9A 1AY1H 2Q3AA 2H6PA 2GSIA 5I1DB 5HI5D 2JJSC 1A6ZA 4MXVE 1ERNA 4C4KT 4WO4A 1DQMH 1T20B 3V0WH 4Y8DC 3V5HB 3FFCB 5HVHC 3O2VH 3SY0A 2APWA 5ADPL 5HJ3B 4Y4FB 3IDIB 5CHNA 1S7UB 3ULUE 2A1WH 1VDGA 4HS8L 1KG0A 1BHGA 5D9SA 4WV1C 5DF0A 3ES6B 3O3DA 2QHRH 2RIKA 5I75B 2WBJB 2OJEA 3WL9B 4JGUA 3KS0J 3DX6B 1MJ7L 1GRWA 4HKZA 5CD3B 1A7PL 4D9RE 1FE8H 3IRPX 5HHQB 3VFRB 1CICC 1DBAH 1MLCA 3O6FA 4ZAKA 4X7SH 3PJSA 4NRZA 3T2QA 5F9JB 3K46A 3U48A 4JFHD 3OX8A 4X6DF 2V7HA 4Z7QE 2IAMB 4MXWL 5EOCJ 3CC5A 1BQLL 1ULVA 5BO1L 4OJFL 1RVFL 2B8OT 4Y8AA 1I1AA 4JB9H 2P8MB 3HI1A 3D39E 4PD4J 4U0RB 3I2CL 4U1IB 5T3XL 3VGFA 4AT6A 3RTQD 3W0WB 2BVPA 4JRXD 3KPLA 3UZEA 1Y0LA 1UYWH 2XWJB 1W72A 3T1FB 3QULB 1FV1A 4BSVB 4JPIB 4X6DB 2IPTH 3HPLB 2WQRA 5CKGA 4AY0A 3BZDA 4HUVA 1TPXB 2Y06H 5C8JA 4PJ8C 5DJ0A 3QRGL 4V1DB 2HKHL 2VH5L 3AS3A 5J9PB 3K7UA 4JFQB 5DUBB 1EXUB 4F37F 3QWOA 4FTVB 3OPZL 1A7OH 5FKPB 2IF7A 1UH4A 4ETQA 2F19H 1BX2A 1J0IA 4AEEA 5I1JL 4XP4H 4JVWA 3LRGA 5IKCA 4PJBF 1UVQB 5HPMB 4F9PC 1RJYA 3E2HB 5FDWB 3L5HA 5A2KH 3IJHB 3ET9F 1H3UA 1TJHL 3S34H 4WFGD 1H0DB 3ULUD 4PRIB 4KV5E 5CJXA 1JGVL 5D5ME 4OD3H 2VE6B 5E2VL 1HKLH 3QWQB 3ZDXF 5E8DH 1ORSB 2O26U 5I19L 4NKMA 1YY8B 3X14B 5DMIL 3S5LG 1NGQL 4ZUVB 5GS0H 5J3HD 2BSTB 5FCUL 1YMME 3L95A 4NNXB 3MCLH 4JQIH 2UWEA 2R1YB 4D9RD 4GBXB 3U4EA 4HMEA 4PRDA 4Z7WA 5INDA 4X6BB 4IEFB 2WBKA 3I3DA 3MV9E 2C7UB 4KGJA 2NY6C 4DN4H 4OM0H 3PNWB 4UINH 3DX8A 1U58B 2H9GA 2JK5B 1CTOA 1S7QA 4OFYA 4NO3B 4BYHA 3MFFA 5E8NB 5IFHL 4EBQL 4KZEH 5FYKU 5J11C 8FABB 2NY2D 3ZE2F 4NQXA 5CEYB 5I2IA 2G9HA 4LLUB 3D39D 4LDLB 2IFFH 2RCSH 1QHOA 1AJ7H 1W0VB 3GBNH 4XNXL 1CXIA 4P4KB 1CDCA 1RUPL 2HP4A 2HJLB 3O9WC 3CFDA 4TPRL 4NM4H 4UT9H 5D7LB 1B0GB 1Q9WB 2X4TB 4X4ME 3RA7L 2X09A 4ZTOL 1BZQK 4NKOA 3WUWB 3BUYB 1YN6A 4RWYH 1K2DB 2BVTA 4JM2A 3KLHD 3UBXI 5DC0A 1FDLH 3ZKNC 2F74A 4K7FB 1A1OA 1K8DA 4TULH 2F53B 3KLAB 3FOLA 4QKXB 2CDEA 5TE7H 4MNGB 3NFNB 1GC1C 3TN0A 3LKPA 1E4JA 5JHDE 5IQ9A 2BOBB 3H9SE 3DTXB 2EYSB 3ZT6A 1XAUA 4K23L 4ELKA 3DHJA 4JN2A 3U30C 3RL2B 4H1LG 3LQAH 1P7QA 4ORGA 4OSUL 4U2ZA 1TJGL 3IFPA 1J1OL 3V4PH 2XZCL 3OB0H 1A9BB 3FB5B 1H9VA 5C07A 5EB9A 1A6UL 3V6ZB 3C5ZC 1YMMD 5A3ID 2R2EB 2GW5A 1B4JL 2APFA 4Z0BH 4J12A 3MV9D 3OTTA 2H6PB 2GSIB 4GKZA 4KK8C 4R2GD 3MLTA 1A6ZB 3GMLA 4IMKA 4R4FL 4AMKL 4WO4B 1VSCA 3HR6A 2EIZA 2EH7L 4GW5A 4FQ1L 5EDXA 5HHPA 1TMCB 3HNVH 4AIOA 3HMXA 1OSPL 3MJ9H 5CHNB 5L88H 3RVWD 5EU7C 5C0CD 1KG0B 5D9SB 1QLEL 1WFNA 4YXKL 5HDBE 4YHOL 1K8IA 3CH1A 3W2DH 3O3DB 1P84K 3HG1E 4JRYA 5EOQL 5GS2D 3QXUA 4JHWH 3VRLE 1IILE 1G6RA 3RY6C 1FZOA 2OJEB 4WTWA 4I0CC 1WBYA 3QWRA 4HKZB 4WCYL 1LO3L 1JHTA 4MQSB 3WDIA 2IQAA 1MLCB 1RZ8A 4PTTA 5E95B 1PYWA 3PJSB 2E7LC 1H8NA 4EQ3A 4LLVA 5DFVD 3OF6A 1YNLH 5B3JF 3OX8B 1DUZA 2V7HB 3QB7C 5FM8A 3Q6GL 3RWEB 2P43B 2JJTA 3O2DA 1QSFE 3S9DB 3CC5B 4JPWH 4ZOBA 5GS1A 4G7YL 1QBLH 4DVRH 5JHDD 1RIUH 2MFNA 1R0AL 3H9SD 3QPXH 4NIKB 1HH6A 1RV6X 3HNSH 3HI1B 4LSSH 2YD5A 2DMBA 2Z31C 2BY0A 4AT6B 1EMTH 1WF5A 2BVPB 2PTUA 3KPLB 4QWWC 5JHLL 1Y0LB 1W72B 2AVGA 1AD0A 2O5ZH 2EH8L 1CIUA 1KTKE 4CVWA 1JPST 2PYED 3RDTD 2AS5M 2NZ9C 4HUVB 5JIIA 5C8JB 5EG6C 1CDYA 1MFBL 5DJ0B 3RPKA 4PRNA 1T1WA 1LDSA 2X4RA 1KXVC 3RZCA 1ZGLP 2R2CA 4DCQA 3RWDB 4NFCA 3BT2H 3QWOB 5T33H 5T3ZD 3KVQA 2DMCA 4ZODA 4YEFA 4ETQB 3SO5A 1BX2B 4L4VA 2IGFL 1DZBA 1PLGH 4HZAA 1PVHA 3CVHA 5IKCB 4MJ5A 2UWEF 4LPWA 1G9EA 4ZXBA 1B88A 1RJYB 4GJTB 4Z7WF 4NJ9L 3VI3F 1BFSA 1BMGA 5H94A 3MX0A 5D2NE 2O5YL 3R0NA 2V2TA 4J3XA 1MCHA 5EU4A 1WLHA 4NKMB 2VIRA 1U92A 3D9AL 3HG1D 3MO1A 3LMJH 1S5IH 4E42A 3NPSB 5J13C 5L8JB 3L95B 5FM5M 2UWEB 1MF2H 4BK4A 3U4EB 4PRDB 4GMTH 4LSPH 4K8RC 2NY4D 4Z7WB 5INDB 3VFTA 4JDZA 1RULL 3SE8H 5FGBA 3O6KH 3BD3A 3KDMA 3DX8B 2E27H 4OD1L 1ZE3C 3VWKD 2H9GB 4V2BA 1UA6L 1S7QB 1QSFD 3MFFB 1TTFA 2CO7B 4Y16D 4JFOB 3NGBB 1D9KA 4NQXB 4YXHL 1NBQA 5I2IB 2G9HB 1R5VA 5I8OL 4HC1H 4E41E 4NRYA 1AR2A 5IMKA 4X6EA 1JTPA 4PLJD 3TLRA 2W9DL 1MRCL 1WZ1L 1K3IA 1P6AB 3CFDB 1HZHH 3K2UH 1Y6MR 4IRJD 3MJ7A 3X13A 3WJLC 3EYVA 2NXYB 5IESL 3BPNB 1C5CL 1GGIL 4NKOB 4YJZL 3TPKA 1QRKA 1YN6B 4QRRE 3FN9A 1RZ7L 4JM2B 4L3CA 3RVXC 4GAJH 4XMKH 5KSBE 4YHYC 1I3GL 3QAZB 1A1OB 1K8DB 3FOLB 1DFBH 1EHNA 5L7XL 2CDEB 4IJ3B 1CGSH 3MFGB 5I1KH 1IGMH 3TN0B 1T03L 4ZD3L 3LKPB 5IQ9B 1OQXA 5TE4H 4M6AA 1NPUA 2QEJA 2P49B 2XA8H 1T1ZA 4JQVC 4PR5A 4GAGH 4ELKB 5D93C 4JN2B 5B38G 4NOBA 4IDJH 1P7QB 3CZFA 4ORGB 3IFPB 1U8MA 1OM3L 3GM0A 5D6CB 3DXAE 5C07B 3LEVL 3PWPD 3DYMA 4YO0A 4YC2B 4YHML 3OKOA 3V7AG 1F6FB 1WQVT 3CDGA 4K9EL 1SBSL 4WFHE 2FO1A 3V5KA 1FBIL 5HHOE 4H0GA 4OIBA 4DQOH 1A14H 1E4KC 4MLIA 4GKZB 2ICEA 4ONGH 3HC3L 3MLTB 1NGPL 3GMLB 3QFJA 1XR9A 4ISVA 4FZ8H 2EIZB 5C09E 1GC1L 2R8SH 4G9DA 3D0LB 4NQCA 2VZ1A 4GW5B 3EOYG 5D8JH 5HHPB 3CFKA 1SJXA 1V3MA 1YY9C 5AG9A 4OT1H 5D70L 2LABA 1ZHNA 3HZYA 1J1PL 5IBLC 3LH2L 3U79A 1JP5A 4P2YA 2D31A 1MCJA 2VNCA 1TITA 1K8IB 1EZVY 3BZFA 3BXNB 3CH1B 2ESVE 5A1AA 3JWDC 4JRYB 5TFSL 1QQDA 1G6RB 3PWUB 1FZOB 2P45B 1WBYB 2Z4QA 4XVUD 3QIBD 4QRRD 4Y19A 1MFEL 2YWYA 3DETD 1JHTB 2IQAB 2WSKA 4YX2H 1RZ8B 4JREB 4PTTB 2HT4C 3OXSA 4LLVB 5H35A 1ZLVH 1HOCA 1RUML 2RHEA 1DUZB 4FQCH 4TVPD 3GRWL 3S37X 2GK2A 3VGAC 1GPOL 5GS1B 2X40A 3ILQC 3MBEA 4U1SA 1QKZH 3T0AA 1MY7A 1E4WH 3I9GH 3CLFH 3EO9L 1B0RA 1HH6B 1IKFH 5MHSE 3NABL 4BSWB 3GMPB 1CF8L 2NXZB 3WEXA 5DUML 1EFXD 1AD0B 4RGOH 3DXAD 2NY0D 1W72H 3SE9H 1CGTA 3CFIC 4M93C 4HWBL 1NC2A 1T0MA 3IDYB 3H3PH 2RQ8A 4YZFE 4K3DL 4PRNB 3VU2A 2X4RB 5HHOD 1A1MA 3RZCB 3Q6FA 4W4OA 4DCQB 2G2RA 3D85D 1I3RA 4ETYA 4WU7A 4F9LC 4OCYL 4F7CA 4WW2F 2IMNA 4PRBA 4LHJB 4N8CL 3VGEA 5JW4Q 2IADA 1HHGA 2UY6A 5DMGD 2X9YA 1T7VA 3CVHB 3RUGF 4MJ5B 3TO4D 4ONFL 4ZXBB 1TDQA 1R3HA 1DLFL 5H94B 3NIDE 1QPXA 3I02A 2AJUL 1BBDL 2V2TB 3V95A 4XCFL 2XZAH 5EU4B 3QEQE 2ESVD 2VIRB 2I24N 3WKMH 1U92B 3MO1B 4KHTH 3MLXL 4F8TA 1HWHB 4LQFH 3HLAA 4CVZA 3PP4L 4E42B 4Y4HD 3HC4L 5KSAC 2YD9A 2HH0L 3L5XL 3OHXA 5BVJA 5H37G 4JDZB 1DVFA 3VFTB 2MHAA 3Q48A 3MA9H 2ED7A 3KDMB 1VADA 4LCWE 3K0WA 4PBWD 5IT2H 4Y5XA 4EOWH 4GUPA 3GNML 3WNLA 4XPGH 5LQBH 1R5IA 1ZSDA 2B7DT 3QDGA 3U7AA 1D9KB 4UU9A 1ORQA 4FQIL 4PRAA 1R5VB 1Q0XH 1INQA 5MHSD 2B1HL 4NRYB 3RQ3A 4X6EB 1ZLSL 2D7TL 3SN6N 1C5BL 4AYFA 3QDHA 4Q6IC 4LPYA 2OCFD 4YNYA 5IMOA 1KIQA 4J3VA 3KR3H 3MJ7B 3EYVB 1J7VR 1ZHKA 2P8PA 2MPAH 4RFOH 3QXDA 1T21A 4QGYA 4K8RL 2GTZA 5DFWH 5EO0A 4L3CB 5HHME 3DV6A 2DM3A 1TQCB 1PZUB 3WSQL 1I7UA 1N59A 1G9MH 5FECA 4G42A 5GGVY 1A7QH 3QEGL 1CCZA 1T5XA 2QHLA 4JO4L 3GIZH 1IBGL 1T1ZB 4PR5B 3WFEH 4ZNEA 5IB5A 1DBML 3LEYH 2ICWJ 3CZFB 1BD2E 5SX5K 5ISZA 1U8MB 1I8IA 3QEQD 2DQFA 1A5FL 1D6VL 4JY6B 4M5ZL 4YO0B 5J1TC 3OKOB 1MI5B 4HIJA 1V5JA 2FD6L 3CDGB 2DS4A 4RA0C 3BUTA 4I0PA 2I26N 4LKXB 2VZSA 3FO9A 3V5KB 2ATKA 4BZ2H 5E2TL 3MLVL 2R4RL 3MXVH 2ICEB 2R0ZH 3NCYS 1YNTA 3OZ9H 3R4DA 1QBMH 1QACA 4UNUA 3VD9A 3QFJB 3MJ6A 4XWOD 1IKNA 1XR9B 4ISVB 4UILH 1CLZL 4HJ0D 4YDIH 1T83C 4UTAH 4G9DB 2A6KA 2IANA 3ESUF 4NQCB 3C87A 3AB0C 1Q72H 4JDVA 2FEDD 2X1PA 3F6IA 3CFKB 1OVZA 3EBAA 3D0VA 3HMXH 4NT6A 4MAYC 1YEGL 1ZHNB 5CILL 5J06A 5DK2A 32C2A 3HZYB 3QUZD 2FBOJ 3B9KD 1OARL 4LLAA 5IROA 2D31B 2W92A 3AM8A 4HPOH 3PABA 4L4TE 3BZFB 4X98A 5D7JA 3RVTC 4N8VA 4NN6B 3IDXL 1QQDB 3RIAK 5IHUL 2FR4A 5DWUH 2EDBA 2Z4QB 1G6RH 5FV2A 3HZMA 4JDTL 4Y19B 5JXED 3NIFF 5HHMD 2A0LD 1OAKL 4C59B 4PJ5A 3OXSB 3TJHD 1OTTC 3P9MA 1ZLWH 5H35B 4EN3A 4LU5H 1HOCB 1H3TA 1GOHA 3RRQA 1U8KA 5I71C 1UJ3A 1I7TA 4Q9RL 2EO9A 2QSCL 3MBEB 3O2DH 4U1SB 4CAGA 4I3RL 5F7LB 3BEWA 3EYOA 4G6ML 1IJ9A 1B0RB 4HBCL 2BC4B 1EX0A 3RWCA 4WI4A 3MNVA 1HHHA 4FQ2H 1JRHH 1BD2D 5FCSH 4GW1A 3JWDL 4PJ7F 2R9HD 4MA1C 1QZ1A 2Y23A 4EQ2A 1NC2B 1T0MB 2AEPH 4H25A 4KI1A 4LVNC 2P5WA 4R0LC 3TF7C 5IGXL 1A1MB 5F7HA 3Q6FB 2G2RB 5C0JA 2W60A 2E9WA 1I3RB 5HYJD 4WU7B 4YPGA 4F7CB 4UBDD 3V6OC 3RBSA 4HF5L 4YHKH 4PRBB 4YAQA 4M03A 2HRLA 2IADB 1LK2A 2LAAA 1HHGB 5DD5H 5HSFA 5I17A 3O0RL 1KNOA 2W07A 1Z2KA 4K71C 1EO5A 1MCKA 3FAXA 2G60H 3DSFH 3MXWL 3CVHH 1R3HB 5DZNA 1YYMH 4LVHB 5C9KA 2DQGH 3I02B 2FJGA 1WIPA 2XA3A 4YIQB 4FNLH 4ACPA 4XPHL 3DO7A 3K8LA 3DURA 1EAPA 3MOAH 4WI7A 3GSUA 2DJSA 5DC4B 4L4TD 5GS0D 3U2SA 1BAFL 4LASL 1WFOA 3HLAB 3PV6B 3UYRL 4CVZB 5JZ7D 3ULUL 4BZ1L 1JHKH 4YHZH 1U0QA 4X8XA 3SDAA 5EBLA 3RFZC 4JKPL 3FB8A 3OHXB 5BVJB 1MCFA 1F3DJ 1DVFB 2MHAB 2PXYD 1VADB 5JUEL 4Y5XB 3SQOL 2XRAH 1IGFL 3T3MF 2LTQC 4GUPB 5EIQA 5C0AA 3C09B 4PJIA 1R5IB 1ZSDB 3QDGB 4FA8A 2AJVL 2Z0BA 2Q86B 2UUDK 3B2UD 1ORQB 4X9IA 4GS7C 4M3KB 4PRAB 2A38A 4RQQA 1INQB 2F8VA 3CK0L 4CVUA 1NFIA 2GCYA 4YNYB 1CK0L 1KIQB 4FFWD 3EO1A 2CD0A 4H88H 3CGTA 1ZHKB 2P8PB 4KFZC 4PV9A 3QXDB 1T21B 3IXAA 1EGJL 2IPKA 2GTZB 1INEL 5EO0B 3DV6B 1NFDA 5DHXB 3TZVD 4KUZH 1U6AH 1PSKH 5E9DA 1I7UB 4OGZA 1N59B 5FECB 1S9KC 5KVEL 3MC0A 4HKBA 1X44A 2ZG2A 2I5YL 4X99A 1IE5A 1T5XB 2V7NB 1FL6A 5TQ0H 1RMFH 3BQUA 1OTUD 3RNQA 4KKAD 1JZ2A 5IB5B 3B2VL 2A83A 1J88A 3VH8A 5ISZB 1I8IB 2DQFB 2QQKL 1L7IL 4ZQKA 4H1LA 5J1SC 4HIJB 3O11A 1WT5C 2ARJA 4KROB 4V1DE 4I0PB 1I9JL 1EJOH 1F4AA 3FO9B 2ATKB 1QTYT 2FLBT 4L4JA 1TJIL 4YDKH 4H8WH 4N9OB 2EE6A 3PF2A 4WFFE 4FTVE 1YNTB 4K3EH 2ADFH 4RNRA 1ED3B 3FFCD 4KRNA 2AEIT 3GJFK 2R29H 4JGJA 2A6KB 2IANB 5HYQA 4JDVB 5I18L 1GIGH 1QRNA 3HE7A 3VFMA 4KJWD 3ZE1F 3D0VB 4X6CE 1ZEAL 4OFDA 3WO3B 1DQLL 4NT6B 1YEJH 2CKBL 32C2B 5DK2B 1OAYH 4TTDC 3U83A 1C08A 1Z9SA 3UTOA 4ZUSA 2FX9H 4HS6A 2OZ4H 1BEYL 3U82B 3PABB 5IEHA 2VLME 5D7JB 4X98B 4N8VB 5GSVA 3UO1L 1RIHL 2VDRL 5CINL 2FR4B 4AK1A 1AGEA 5L0QB 1ZXQA 4RAVA 2AXGA 2DD8H 4DTGL 3HZMB 1GYAA 1T66D 1FPTL 1GSMA 4HUXA 4RZCA 5HHNA 3NA9H 4OKVA 4JFZL 1YEIH 5D72H 3QI9A 4OGYH 4PJ5B 5K9OA 4W68A 2VC2L 1M05A 3P9MB 3FT2A 4EN3B 1CGVA 5E08L 1JPSL 1MFAL 1U8KB 2IAMD 1RK0A 3LVEA 2OK0L 1UJ3B 1I7TB 3FO0H 3FTGA 3GI9L 3PQYE 5D71H 3KPPA 3ARZA 3BEWB 3EYOB 5EIVA 4DKFH 2JJSA 4KDVA 3RWCB 1LO4H 1IAKA 2ID5A 3MNVB 3P4OA 3C08L 2ZUTA 3W0WD 1XT5A 4ODVH 1HHHB 4DAGL 4GKSA 3RWFA 4GW1B 2I9LA 5DUPL 3GHEL 1KACB 4OBSA 3KAAA 5D7LE 1NLBL 5DJ2A 5IBUG 3WO4C 3EJZD 5D6DC 4CN1A 4H25B 1GAFH 4V1DD 4MQXD 5J57B 3IFLL 1IC5L 1NGXA 1FGVL 4JHAL 4HWZA 4WV1A 1LO0L 1RZKL 2W60B 4MHHI 2XKUA 2X44D 4YPGB 4WFFD 4FTVD 4HIXL 2HTLC 1PBYA 5EH1A 3U7WL 2F53E 4D9LL 2KKQA 4YAQB 1C1EL 1VENA 2ZUQB 3EYUH 1W8NA 4MNGE 4DEPC 5I17B 3DGCR 4U6VL 5DO2D 1PX4A 1KNOB 1CICA 1C7SA 4X7CC 5C92A 4ODXA 2F5AH 3RVUC 4HWUA 3GMOA 5BRZA 4X9GA 4PRID 2GJZA 2FJGB 5GJSL 1EHXA 1G9NC 4WEBL 3DURB 1EAPB 3GSUB 3BE1H 4ELMF 3D2UA 5GGQL 4JY5H 2VLMD 2QADD 4X7FC 4LEOA 2G75A 1A1NA 4BQCA 3MBXL 3L7FA 4MB5A 4KDTA 4GBXD 1B90A 4JJHA 4YE4L 1SBBA 3SDAB 3DMMC 5EBLB 2APTA 2R0LL 3FB8B 25C8H 4G80A 2CUHA 3ZKXC 4S1RL 2ZCLH 1RPQA 2ITDA 2JB5H 4K7PH 3HNTH 4OFKA 3BN9C 5HYEA 1KELH 2HRPH 4KKBD 4P59H 4PJ8A 5IB2A 3D3VA 3R06A 4UB0L 4LAJH 1IC7H 4WVRA 1FNEA 5BCAA 5C0AB 4PJIB 4XPBL 1TQBC 5MENA 1WZMA 4MXQD 5CIPA 4PUBH 3O6ML 5GHWH 1CLOL 4RQQB 1NFDF 4O2FA 1KPVA 4P4KD 3LKNA 1VEPA 1WV7T 5FOBA 1NFIB 2N4IA 3QFDA 5TDOA 4F9PA 2GCYB 3AMLA 2HMIC 1ZT1A 2AW2A 5D1QA 5D7LD 2E6PA 4PV9B 2N7BA 3IXAB 2JJVA 3P73A 5F7NC 2IPKB 5E8PA 4UT7L 3EFDL 4PYGA 1GJIA 3IGAA 2R23A 5E9DB 1HH9A 2F53D 3H3BC 2OQJA 3G5VA 4O02L 1KCVH 2B5IB 4I2XA 5JOEA 3Q5OA 2JCCF 4HKBB 4X99B 2ICWI 2VR5A 4PJCF 4POZC 1P7KA 3BMWA 1KENH 1FL6B 1CL7I 2AK1L 3ARDC 3BDYL 3EO0A 3BQUB 1N5YL 3RNQB 4G6KH 3NPZB 2A83B 4Y89A 4UIMA 3VH8B 4JQXA 4CRPA 1BQSA 5FUCC 2DQIL 4MCYA 3F7YA 4ZQKB 5B38A 4H1LB 4J4PD 3O11B 2ARJB 3U1SL 1NUNB 1RU9L 3OWEA 2BXZA 3KPNA 3O9WA 2E8YA 3G6DL 1OW0C 3ECBA 3PWNA 5HI3C 1U36A 4MA8L 1OT2A 1ZTXH 4HK0A 4M5YH 4RNRB 3QXVA 4XB7A 2O5XH 3S96A 3U4BH 2KDGA 2W0FB 5HYQB 4KRPB 4M7ZC 1QRNB 3HE7B 5DGQA 3BIBX 3WCYA 2VLRB 1VERA 3LDBB 4L8DB 4OLZL 3BDXA 1C08B 1ZS8A 3FFDA 3LOWA 4ZUSB 3ZLQC 4HS6B 1I75A 3S6CA 5IEHB 5HI4D 5DVLA 2UY7A 5GSVB 1S3KL 4IRSC 2J8UA 1DE4A 5ADPH 4Z0XA 1AGEB 5FYLH 3QUMA 4RAVB 2AXGB 3MNZA 1I8LC 4F2MA 4HUXB 5HHNB 4RZCB 4Z7WE 4P3WA 4OKVB 4DGVL 4U33A 1F11A 4HS8H 5K9OB 1SHMA 2YWZA 1M05B 3FT2B 3EJYC 2WM0A 4ODHL 4AL8L 3C5ZA 3S36X 5KJRL 1RK0B 1H8OA 3OJVC 4Z9KB 1HXYA 3HA0A 1GGCL 5B8CC 3FTGB 2ENYA 4N0CC 4KGLA 1MJ7H 3KPPB 1FNAA 1A7PH 4U1GC 2YUZA 3RWIA 1IAOA 5EOTA 4E0RA 1GOGA 3CXHK 3P4OB 5HVHB 4W6WB