4QEGA

Crystal structure of domain i10 from titin (space group p41)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
89
structure length
89
Chain Sequence
METLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Titin
publication title Exploration of the pathological potential of isolated mSNPs in titin: the cardiomyopathy-linked mutation T2580I
rcsb
source organism Homo sapiens
total genus 19
structure length 89
sequence length 89
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qegA00
1FVEA 1P9MA 2VH5L 3PHQA 1SYSA 5MI0B 5IBTL 4DGVH 1U3ZA 4F8TA 3NIGE 2B4CC 4G8GB 4ZXBA 4BUHA 5E2TL 4MJIB 5BS0A 4NKMA 5I8KH 1XCTA 4HHAB 4ETQA 2OMNA 2WWMD 5FIEA 2HMID 1AGCB 2GHWB 3LKOB 2ZOLB 3ZYJA 4CN1A 3U4EB 1FPTL 1HHGB 1RIHH 1NFDB 4G9FD 2Z8WC 3H7LA 2Y06L 5C0AA 5DYOB 4L1HA 4P57B 3MZGB 4OQTH 3VFRA 3CZJA 5E1HB 5ILTL 3QG6B 2XNAA 3TT1H 4OZHE 4U6YB 4WU7A 5F3HB 1D5MA 3RZCD 5C07B 2FH8A 1CXFA 3O8XC 3BEVB 1KJ2A 1UCTA 1WWCA 2A6IA 5SWZB 2Z93A 3THMH 1XGRB 1AC6A 2BHYA 5FB8B 2DBLL 3SDXE 4RAVB 2Q86B 3O3EB 1MI5E 4U7MA 3EYUH 3QEHA 3FONA 3JWOC 3GSNH 3M1BA 1B4JL 4U1JB 5E6IA 5FYKH 5HHQB 3OG4B 2BC4B 3X11B 3E0GA 4XI5C 1RJYA 5L8JB 4L9LC 4P46A 4XCFH 1G7JA 1WCBA 2CMRH 5I2IB 4Q6IA 5FO9B 1I8LC 3QJHB 3KPOB 1HZHH 4HUKB 3TF7C 4YLQT 5C0BE 5DFTA 4KJQD 3R06B 1KIRB 3PQYA 1DUYA 4APQB 3P30H 4YZFF 2L7UA 1AGDA 3C09B 4G42B 1N6VA 1YYLL 2VQ1A 5D7LB 1ZT4A 3F58H 1J0HA 1I7RA 2NY1B 5HHMB 5DMIH 4OCYH 4ZSOA 2MKWA 4FHBD 4ODBD 4LF3B 4DZ8A 3ZTNL 4BYHA 2W0FA 2DMBA 1WGOA 3S5LA 1KLUB 4E5XB 5F88A 25C8L 3UBXG 1MRCH 1CTOA 3CH8A 4LPXA 4OAWB 5EOTB 1KENL 5KOMC 4IMLB 3CLEL 3VH8B 1CFQB 2IH1B 1QR4A 3PV6A 4DOHB 35C8H 5B3JF 3E6HB 3ZKNC 4XMKL 5CD3B 3NIFF 4IOSD 1N5AA 3VE0A 4JO1L 4K23L 3MQIA 4YFEA 4LHUD 2VB5A 3VRLE 2FHFA 1SYVB 1ZLSH 4YAQA 3IDJB 4FNLH 3VFTA 5J13B 1MPAL 1WZMA 3NCMA 1BF8A 1FGVL 1CI5A 2XA8L 3GSUB 4I4WB 5T1KB 4Z9KB 4HG4J 5D1QB 2Z4QB 1ZEAH 3U0TA 4XNZC 4G9FE 4PD4K 4MWFA 3VXRD 4KK5D 4NPYB 4RISH 2BOCA 4M6OH 4KKLC 4NC1C 3B6SB 1KCLA 4X8XA 3EYFA 5AWNL 2VERN 4HV8A 6FABL 5I1JL 5FO8B 1GAFH 1XF2A 4TULL 5D96C 5F9WC 2ARJA 3C87A 1TVDA 3D39A 4JY4A 5IWLC 2BZDA 5JORA 4HC1A 3V52H 4GBXC 4ORGA 4G43A 3WXWH 3FB6B 2ID5A 5KSAB 3S3PA 3CX2A 4WUUB 4P3CL 5D7IB 2C26A 2AV1A 5IVZB 5GSRA 2AXHA 5LBSH 3VDCA 5DMGC 1H3VA 3SCMD 5I1IL 4TUOB 3V7AE 1RZJH 1JN6A 4EQ2A 3Q6GH 4R90H 3NA9H 1N2RA 4ODXB 1XGQB 2JLLA 1K8DA 5TF0A 2YEZB 2OTUB 3S97C 3FQWA 4M8QB 5E2WL 2H32A 2KBGA 4A6YL 4RA0C 5I6XC 4PJEA 3QDJB 3C6LC 3JWDL 1VENA 5CMAA 1CIDA 2CK0H 5TQ0H 1ZAGA 4H5SA 1AGFA 5MHSE 2XTJC 5AYQA 3UTQA 1RZ8B 3D3VD 1CLZH 1JGDB 3A0OA 5IB4A 1T1XB 4OFYA 1EUTA 2BNQD 2YD4A 5JHDD 2XXCB 3HKFA 2QTEA 5DRNA 4ZFGH 3NFNA 1KIQA 1D6VH 5IIEB 4RMQA 1G7PA 4P9HH 4DGYL 4JHBA 3G5VA 5GGTL 4PGDB 4MNGE 4K71C 1G6VK 5CEXB 1S8DA 3HZKA 2P7TA 1P7HL 3SPVA 1AGBA 4KJWC 2XYCA 4RGOH 3RU8H 4ZO7A 4FTVA 4XNUL 3VCLA 3ZSSA 4OV5B 4QHNA 2VDPH 5GGSA 3T0EB 5BJTA 1J12A 1ORQA 4XPAH 1TVBB 5IW6A 4K9EC 3AB0C 3QI9D 4LOUD 4Y5YB 4RGNB 5EBWB 1I8MB 4HIIB 1KB9K 4S10A 1KYOK 3L3JB 3QCUL 5TQ2L 5E94B 4ZUVB 4X5LA 1F02I 1T66D 2EEBA 3DMMB 3VXRE 4DN3H 2AJZA 3TA3D 2BY0A 2DLEA 4M61A 1D5ZB 4OM1H 3IDNB 2XN9A 1W0WB 4P5TC 1FO0L 4WNQA 1S5IH 3O4LD 4WO4B 1CICB 4YDKL 3NZ8A 3WDIA 2ADIB 3C5ZA 3DUHA 4JFQA 5EA0L 4JO4L 4YUEH 2NXYD 4O51B 7CGTA 5T3XH 3LKSB 1A7OL 3EOAA 1XGPA 1MHCB 4YHZH 1RUQL 3P9LA 4V1DA 3PGFH 3DNKA 3HB3C 4MA1C 3FT4A 3R1GL 2NX5A 1N64L 2E8YA 3IETA 1DUZB 4CU7A 2A6DB 3FFDA 1JVKA 5JZ7C 5KS9A 4OF5A 3MBED 1MCOH 1I7UB 4H0IA 5C08D 2F8XC 3IU4H 4NC1E 5FUOH 5ADPH 1BP3B 2QSCL 4AT6A 4LNRA 3MNWA 1V7ML 3V0AC 4JFED 2Q8BH 3AAZB 1A47A 1BFOB 4MQ7A 4OLUH 5D4QA 2QBWA 3ARBA 3BW9A 3LS5H 3QISA 1BZ9B 5KW9H 1T5XA 2H9GB 3QIBB 3KLDA 3WFEL 5KSBE 1CQYA 2DQJH 4GG6F 3F6IA 1G7IA 1N8ZB 2JE8A 5J6GA 2EECA 1A7QH 3DRTB 4HUMB 3D6GA 5MERA 2YUVA 1ZVYA 3RBGA 4X5XA 4KFZC 2BNQE 4NO0D 3I75B 5JHDE 4WDIB 4P9MH 3W2DH 1YEDA 4P5MA 2GSGA 4M6NH 4ENEC 3LH2L 2A2QT 4OF6A 1A7RH 2BOBA 4BSJA 4X0KB 2HKHL 3NIDF 1F6FB 2X7LB 1YC8A 3QDAA 2HTLC 4U1NB 5GISH 4F7PB 1G7HA 2K1MA 3GRWA 4JFZL 1AP2B 1JF5A 1HIMH 3SEPA 1S7VB 3UJTL 5HDQH 1Z2KA 1KSRA 3QDGD 4OCSL 3BKJL 2NYYD 1L9NA 3CSGA 5IGXL 5F89A 4G6ML 4FXKB 1HSAB 2VITA 1K2DA 2HTKD 1K4CB 3K81A 2WNGA 2IGFL 3DBXA 2I9TB 1JZ4A 2XKNA 3RKDC 4EI5B 2HVJB 3IAQA 5F7EH 4IBLT 4DUXA 1NUFA 4NN7B 5J6HB 4RAHA 1BM3L 1LO5B 5IKCA 2F8VA 3MRJB 2GFBB 5DK3A 4YHYB 4PGZA 1HYRC 3HS0B 2LV4A 2V2WB 3T65B 5I30L 2XZZA 5JW5B 3DURA 1JHLH 4XP9L 1QRND 4RNRB 2ERJB 3QJFA 3HR5B 3QULB 4RBPK 1WIUA 3KWWA 4HKXB 1QFUH 3U4BH 4CN4A 3UTOA 4PLJC 5IW1A 1I8IA 2ICWI 3GMQB 2CRYA 3N9GL 2OX5A 5FM4A 3MJ7B 3OTTA 3S34H 1BBDH 1ZK9A 5L2JB 2PCPA 3RKDD 1ZTXH 5CILL 1A1MB 2R29L 1FE8H 1ZA6B 3BAEL 3IRPX 4HLJA 3BPLC 2ZUVA 1PX4A 5A2FA 4MA8H 5T1MA 5BZWA 5ABDE 4DQOH 4JR9H 5LWYH 3D0VA 4UT9H 4YGVB 4HZLA 2P5WB 1T0NB 4X4MA 1K6QH 5J1SC 32C2A 4LK4A 4MAYA 2BSRA 4TRPH 5ALBL 43C9A 5DQJA 4TVPH 3MLXL 1AH1A 4X4YA 2X4RA 4D9LH 4JFEE 1E27A 2DQIH 3HE7B 4L4TA 2JJUA 3QQ4A 1NKRA 3KJ6H 2AJ3A 1VKXB 2AXGB 3VXMD 3QXUA 5E9DB 4U6VH 1S7UB 4OZIE 3FQRA 2AP2A 2FX7L 4N5UA 2W1NA 5JIPA 3KS0J 3BXNA 1RFDH 5DUMH 4Y19E 1FVCB 2PR4L 3OX8A 3IXAB 5DK0B 4J3WA 5IHUH 4YWGL 4IJ3C 4LGSB 1MCWW 4RMSA 4MNHA 5KG9B 1A64A 5CAYB 3QIUC 4NN6B 1NAMA 2HFGL 1TENA 4MB3A 3RNQB 3MRQB 2ESVD 4UOJA 1R3LB 1NJ9A 1YNLH 2VIRB 4R0LA 3QUZD 4PJ5A 4UTBL 5IEKA 4Z95H 3VXTA 1TQCB 5LGHL 3QDGE 3T0XA 1FNFA 3QUXD 4MSWA 3DUSB 1GGCL 4PJBE 1A4JB 3ZL4L 1OW0C 1RUPH 1CD9B 3O3AB 4HGMA 4GMTL 4JPIB 4QRPB 4LPCA 5TE4L 4M6AA 4XTRC 1A6TA 1RHFA 1MUJB 2AEWA 2YPVL 4F9LC 5TFSL 5AZ2H 1AQKL 5ADOL 1MCQA 4N8PA 4M1GH 1I7ZB 4K3JL 2G60L 4MLSA 1QRNE 1FZJA 4YDJB 3V95A 3FO1A 4ZNEA 4PR5B 2O5ZH 2VZUA 2DLFL 5INDB 4HH8A 4Y1AB 4OTXH 2AKRB 4Y16B 1P6FA 4G9DA 5FO7B 2PN5A 4QRUB 2B4CH 4IOFD 2SEBA 4XP4L 3VWKB 1F2XK 1T83C 1IT9L 1S7WB 5ELIA 4HUUB 1PZ5A 2X4NB 2XY1A 1XMWA 1HHJB 4JM2F 2ICWJ 1PD6A 4QHUA 3VG9C 5I8OL 1V05A 2C1OA 4R96B 2DQTL 3CJJA 2D0HA 3MRNB 1UT9A 4Z78A 5F1NB 1IC7H 1U58B 3AROA 5CZVH 3BPCA 3BZEB 2D4DA 2IAMD 4PJIA 1OM3L 5IVXB 3TIDB 4GOSA 3MLRH 4WUKL 4LSTH 4TSCL 2EIEA 1FDLL 2X89D 4C58B 1JL8A 3QEQB 3WHE0 3JV6B 1ZGLP 1A5FH 4PJXA 5HVWA 4Z77A 1QYGL 4ZD3H 4XP6H 2ARJQ 3A6BH 3L3GB 5FHBH 2WBWB 4IDJL 5F7KC 3VXME 3BPOC 4XP1H 4G6FB 3FZUC 4XNYH 4LRNL 1CYGA 1MHPH 3BP6B 3GMRB 5DRXA 4RFOL 3BH8B 1MCPH 3RRQA 1IL1B 5DHVH 4PRID 2DQFB 3WS3A 1EEZA 3JWOH 2F58L 4MLIA 3QIWA 3IJHB 1XIWA 4NNYB 4GW1A 1JHTB 1MLBA 5JHLH 5IF0A 5M7QA 5FYLD 2VDML 5ECJE 1ZHKB 3K46A 4LDEB 4O5LL 5D2NB 2DQDH 4QOKB 3SGJC 4G8GA 4N1CA 4Y5XB 4MJIA 2IPTH 1OVZA 4KQ3L 4WHYH 3HE6B 4HHAA 5DT1L 3RL2B 5EU4B 2D3VA 4LSUL 4YHOL 1LO2L 1AGCA 2ED7A 3LKOA 5FHAL 4U6HB 2ZOLA 3U4EA 1P4IH 4FQCL 1HHGA 1NFDA 2V17H 4QXTB 5FGRA 5IT2H 5DYOA 4S1RH 1ZLUH 4C56D 3HI6L 1S9KC 4MD5A 4P57A 2LE9A 2XI9A 4H0GA 1EJ6A 3QG6A 4I48B 4U6YA 1WT5A 5F3HA 5C0NC 3MV7E 4O2EB 1OARH 4TPRL 3BEVA 4R7NB 5E5MB 1HINL 3SDAC 3BIBX 2AEPL 5SWZA 4GXVL 2VXUH 5F44A 1HEZB 1KC5H 1ZHBB 4OLZL 5FB8A 1ZA3B 4RAVA 4Z7NF 2Q86A 3O3EA 5KVEH 4J6RL 3K2UL 2DJSA 4W70A 3VD9A 3OKOB 5E2VL 4U1JA 5HHQA 2A9NL 2BC4A 3QUML 3QXTA 3Q6FB 5HHOD 5K59E 3MACH 2X9XA 5I2IA 1AO7B 3QJHA 3KPOA 5T33L 4MXWL 2MJWA 4I18C 1D9KD 4B0MM 4XBEH 3W11C 3R06A 1KIRA 4APQA 4ERSH 3CFCH 3DRQB 1MJ7L 2V9TA 5D7LA 5CJXA 4HK0B 2Y25A 4YHPB 2QHLA 4O58H 2RAMA 5DHVB 1B0GB 1P53A 2OLDA 4UT7H 3MFFB 2HJLB 1M1SA 2PKDA 5E7FA 3WIIL 1KLUA 1U8IB 4TVSa 3RZWA 1U9KA 1G0DA 5I1DB 2IBGA 5LQBH 4RFNB 1R3HB 1LVEA 4IIQC 4OAWA 5EOTA 4IMLA 4PLOB 3X3GL 4JRYB 1EHLL 1CD8A 4J3OC 3QCVL 1CFQA 4JG0H 3VH8A 2IH1A 4OT1L 1FAIH 1EGJH 4JN1H 1F42A 1MCDA 2F54B 1I9RH 3E6HA 4JAMB 4PLNC 5CD3A 2IFFH 4JFHE 1DVFC 1LE9B 5I18L 2NY4B 3U7AA 1YEEL 5FYLE 5M95B 4X5WB 2PXYB 1SYVA 1DBAL 1PDKA 1REIA 5HBBA 3IDJA 4FMKA 3SKOB 3ZYZA 1MAML 3K1KC 4MQXC 4KKBC 3MRMB 3GSUA 4I4WA 4NO5B 1NGWB 4EOWL 2KQNA 4QF1B 5T1KA 5D1QA 2VXSH 1NC4B 5AEAA 1G7QB 5ISZE 3RX8A 3O6FC 5T3ZD 2Z4QA 3V8CA 4ZAKC 4OCWL 4OF3A 4PJDF 3M8OL 3U46B 1F3DH 4LSQL 1HKFA 2E7CA 3T2NH 3HC3H 1OAZH 4NPYA 1MCRA 4C56E 2YPKB 1MIEH 3MLZL 5EO0B 4DTGL 3S5LG 3B6SA 3WDJA 2C4FT 4A2LA 3ARXA 2GY7B 5B39B 5I71B 4HK3N 5HI3C 4J4PC 1KTDB 5FO8A 3VU2A 3VWJC 5JQ6L 3ARGD 3V0WH 3MLPA 4LCIH 3IGAB 3ARTA 4Z7OF 5INCB 1NCWH 1YJDL 2GJ6D 3D2UB 3A67H 3VD5A 3FB6A 1RJCA 3PABB 2BFVH 5KSAA 5FM5M 3IVKA 4WUUA 4NSKB 2VRAA 5D7IA 4RX4D 2ZUUA 5IVZA 5HHOE 3B9EA 4FQLL 4MS8C 2IMNA 4TUOA 1JWMB 1N4XH 4TSBH 5F9WB 4K9EH 5CD5D 4LRIC 3QXDB 2EDRA 1NMBL 4ODXA 1XGQA 2YEZA 2OTUA 3L5HA 4JG1H 4G6JL 3T0VA 4M8QA 4LSSH 2E7BA 3QDJA 3ZE2F 2VDRH 1FFOB 5C9JB 2UWEF 4M7ZB 4HF5H 1ZHLB 1EBPA 3MROA 3T8XB 1RZ8A 4XZUB 1FIGH 3FQXB 4XMPH 1JGDA 1VESA 3GO1H 3FN0L 1T1XA 3GFUA 4OFPA 5FKAB 2RIKA 4Z7WB 4WWKC 3RWCB 1JCKA 4HDIB 5IIEA 5I6XB 5TE7H 3C6LB 3U36B 3O45B 3T0DA 3I50L 4PGDA 3LD8C 2NY3D 3KLAB 5CEXA 2XTJB 2Z0BA 4CVWA 1TZHB 3UJIL 2VXTL 4OV5A 1CXHA 4KVNL 3T0EA 4KY1L 4LCCB 2Z92B 2VL4A 4LSVL 3SGEI 4POZD 4X98B 5CSZB 4Y5YA 5K93A 1QG3A 2CRIA 5AG8A 5EBWA 1I8MA 4HIIA 1TNNA 1X5XA 3PNWB 1I9EA 3L3JA 5L88L 1GGYA 5E94A 4ZUVA 4P99A 2FD6H 3DMMA 3SOBH 3FMGH 1H5BC 1D5ZA 4OLYH 4R2GD 3SE8L 3V4PH 4X9FA 1GIGL 2FR4B 3IDNA 4Y4HD 4GFTB 1W0WA 2A9MH 1MREH 3SJVD 4WO4A 1CICA 2HAZA 2XV6B 1JYXA 2ADIA 1DN2A 3MRCB 1H3UA 4GS7C 3AB0B 3K80A 1TJGH 4XCNB 1B4RA 4FOMA 2EXWD 3W5MA 1WTGT 2IC2A 1NCBH 2GJ6E 4O51A 3OXSB 3F62A 3LKSA 2NZ9C 3DJ9A 4YDIL 1MHCA 1RPQA 4KROC 1RU9H 2BCKB 4NKDB 1PBYA 3N1MC 4Y4FD 1Q0YL 4P5TB 4WHCA 5JXED 1DUZA 1KXQE 2A6DA 2VLRD 3VI4E 2XRAL 4N0UB 3IRZA 4N0CD 1UJ3C 4XNQB 3VFUB 1SVZA 3C8HA 1I7UA 3TM6A 2F19L 1HXMB 3DXAB 1A6VL 1ACYL 4YXLL 3BD4A 1ZVSB 2BVPB 4X7FC 3AAZA 5ETUB 1A4KB 1BFOA 1HHKB 2VZVA 3I2CH 2H9GA 3H7BB 3QIBA 1NL0H 3WSQH 1F6AB 5GS1C 3UPCA 5DUBB 5FGCB 3UTPD 1N8ZA 4LGPB 3DRTA 3OQ3B 2YK1H 4EN3C 3C60D 3I75A 4WDIA 4JFFD 2PYEB 3OKDB 4X0KA 4NC2B 4AMKH 2X7LA 1CLOH 1OAYH 3TN0D 4U1NA 4F7PA 3GHEH 1AP2A 3ARYA 1S7VA 3B5GA 2D7TH 5JPNB 12E8L 2KL6A 3R8QA 4UNTA 1YPZF 4KMTH 2VH5H 1KFAL 5GRVK 5I1CL 3IFOA 4ZTPL 4FXKA 1HSAA 4I8DA 3GSRB 3BUYB 5JO5B 2OTPA 3BRGC 1RZKC 3GK8L 2AV7B 4IOIB 4HMDA 5EBMB 1T7YA 5D7JB 4WI6A 2I9TA 4EI5A 2HVJA 1I1FB 5KSVB 2X4UB 5J6HA 3RKPA 1FPTH 1J88A 1LO5A 2YD6A 2XZCH 3HTLX 2QADC 3MRJA 2GFBA 5ERWB 5E8NB 2Y06H 4ELME 1RSFA 3HMWL 3QB7C 4U1SB 1BECA 1DQDH 2X1XR 3T65A 2DDQL 4PGEB 1KJ2L 5C70A 3F7PC 5ILTH 1BOYA 2CKBB 5JW5A 4M8VA 4PJDB 4RNRA 2CGRL 3HR5A 3QULA 1RUML 1CK0L 1A1OB 4IRZL 5FA3B 5L2KD 4HKXA 5E8PB 3EFDL 5JA8B 4BZ1H 4P2CG 3GMQA 4N0YH 4XPBH 1MQKL 2B8OT 4AEIL 1CGVA 3MJ7A 4NDMB 1J1XH 5L2JA 5F1SA 1Z0NA 1B4JH 2R0LL 1FH5L 1A1MA 2I9LB 1KPRB 2MOVA 1G7MB 1ZA6A 5B4MD 4D3CH 5DO2C 3MZTA 5K9JL 2VLRE 4D9QD 1FCCA 5K9OB 1RHHB 1U3HB 5EUOB 4YGVA 3GHBL 1UZ8B 4QXGH 2P5WA 1T0NA 4YO0B 5JIKA 2F5BL 3BWAB 1AR1D 4UOW0 1YYLH 2J7LA 3ALXA 4P5KB 1WQVT 3MTRA 4H8WC 2X10A 3OR6B 3HE7A 5I0DA 3TJHD 2BXYA 1VKXA 2AXGA 2F53D 5E9DA 1S7UA 1JPFB 1KTKE 4JDVB 5EIIB 4J1UB 4KJYB 1FVCA 2Q8AH 4FG6C 3BUTA 4Y88A 1BFVL 5DK0A 1KENH 5CP3A 3EO9L 3CLEH 1VB9A 2GW5A 1I85A 3FQNB 1Y0LB 4KI5F 1R3IL 3ULUF 5KG9A 3S3JA 5BVPL 4JO1H 1H8OA 3MNVB 2OR9H 3RNQA 4AG4L 5C1MB 3MRQA 5CGYC 2XWJB 5EZOL 1VEOA 1UENA 1R3LA 2VKWA 2VIRA 1JPGB 3I02B 4OSUH 1JPSH 4DW2L 3WBDA 2CJUL 3TO4C 4FFWC 2OK0H 2J8UE 2DKMA 3DUSA 2VR4A 1TCMA 3MRRB 1AKJD 1MPAH 3O3AA 4JPIA 4QRPA 5DQ9B 1FGVH 5DZOA 1A7PH 3QT2A 1QZ1A 5KAQG 3ZYOA 4YEFA 3C5SB 3L3KB 2R9HC 2JB5H 1MUJA 4X6CB 2O93L 2FGZA 2BRQA 3AY4A 4NWUL 3HUJF 1KLFA 2PW2B 3HCVB 4NQCD 1I7ZA 3PHSA 4KDTC 4X8JB 1QA9B 1XF3B 5HPMB 1R6VA 5TDNB 5C9KA 4HC1L 5I1JH 3B3IB 4OZGB 4YDJA 4DUWA 4NHUB 4XB8A 3SE4C 4IM8A 2B7DT 4PR5A 3WLWC 3RVUC 5INDA 4Y1AA 4Y16A 2AKRA 1CG9B 5FO7A 2OMBA 4QRUA 2DWEB 3QEGH 3VWKA 3RIFK 4LLWB 1S7WA 1MFEL 4HUUA 2X4NA 1FYTD 4GXUN 1HHJA 1Z5LB 3DPBA 1IGYB 1TFHA 4MD0B 4L3EB 2V5RA 4HFWB 4JQIL 4R96A 3GSXB 4XPGL 3QHTC 2ZUQC 5EC1B 3MRNA 4J3TA 5I1IH 5F1NA 1P4BH 1U58A 5IBUG 5FXCH 1DANT 5IVXA 3TIDA 4AH2B 3ZHKA 1ZXQA 3QEQA 3EJZD 4JZNB 3JV6A 4XXCA 3EOTL 2NY6C 3KHQA 3L3GA 5EWIL 2F53E 5JIIA 2OM5A 1KIPA 2J88L 2P46B 2BRRL 2MHAB 2VLJD 3BP6A 3C08L 3GMRA 3QCTL 3EO0B 3BH8A 2VDOL 1IL1A 1Q9KB 1Q72L 2DQFA 1Z6JT 5DJCB 2ZCKL 2GI7A 3IJHA 2W59A 4R4NC 4NNYA 4AEFA 1JHTA 1YEKH 3KR3L 4KI1A 2VR5A 2HN7B 4HJ0D 5CP7B 4LLQB 1ZHKA 5D2NA 5DI8A 4QOKA 3E8UL 2QR0B 4U05A 1I1AB 4Y5XA 1CE1H 2JTDA 1O0VA 1YJDC 3BPOB 3HE6A 4U0RC 4PP1C 1RULL 3RL2A 4QKXB 4N8CL 5EU4A 1DQJB 3ALWA 4YFLI 3WYRA 4XPTH 3OL2A 3KYAA 1DBML 1T03L 3S36L 5D2LB 1BGXL 1MFNA 4U6HA 3WNLA 2MSPA 2GT9B 4HUXB 1SEBB 1A1NB 2QQNH 3LHPL 1U42A 5SX4I 3QXVA 4QXTA 2Y4SA 1QUNA 1HOCB 3WFZA 4WW2F 4YGAB 1YPZB 3P11L 3SGKC 1B0WA 4I48A 1V3LA 4O2EA 2BSED 4Y7MA 2FBJL 4XVJL 3KS0H 4R7NA 5E5MA 1RK1B 2WIIB 4NQCE 3WFCH 1E6JL 2VXQH 1HEZA 1ZHBA 5GS2H 4CVUA 4K7PX 4X9GA 1ZA3A 1FO0H 3LCYA 3V79C 1WBYB 4YDKH 4KKNA 4RBPH 3OKOA 1LEIB 5C92A 1KCRL 1MIML 5EA0H 1BIHA 3Q6FA 5DVLA 4F57L 5K33A 2PO6B 1M7IB 3QHZH 1AO7A 4PS4L 3FO0L 4OZHF 4JVPA 1FHGA 4G5ZH 1A7OH 3DLQR 1FYTE 4MB4A 4LPTA 3SDAB 1RUQH 4U7KA 2MMXA 4E41B 3RGVD 3NCJL 4B53A 3R1GH 2A77L 3GI8L 3DRQA 4TYUA 1CFVL 3U1SL 2WBKA 4HK0A 2VNCA 3KPRD 4YHPA 3SDXF 5DHVA 4HKZB 1PGRB 3QPXL 4Z7QE 3BKCL 1B0GA 2DMCA 1J0KA 2EDBA 5BRZE 4JVWA 3MFFA 2HJLA 5HY9B 4L9LA 2QSCH 1U8IA 1V7MH 1L0YA 1YECH 2DYPD 3UXFA 5I1DA 1YMMB 2IMMA 3TWCL 5FFLA 4I18B 4KUZL 2VISB 4Y2DC 1R3HA 3L1OH 4KK9D 4JRYA 1AR2A 2L7JA 1U8JB 1S9WB 2R2CA 5J1AB 2F54A 4JAMA 2VLJE 3CSYB 4HJGB 1U41A 1N0XL 5F7NC 3UZQA 1FSKC 5IMKB 1LE9A 1RZ7L 4DZBB 1JWSB 4WI9A 4GLRI 2YA1A 5K9QI 3GRWL 3MV9B 2H45A 2UZYB 5AUMB 1UM5L 3DX7B 3LH2H 4YHNB 2PTVA 2P1YA 1L0XA 1FJ1B 4X5WA 2HKHH 4JKPH 2PXYA 4PJCB 3S3SA 3QFJB 1FNEA 1F58L 4IIQB 3KPSE 3SKOA 1OTTD 5C0IB 1A3RL 3MRMA 1ADQA 4NO5A 1NGWA 3QNXB 4QF1A 1IAOB 5C6TL 1NC4A 2CUHA 1G7QA 1TQBB 5DFWH 4R26H 1INDL 3R4DA 1DBJL 4G6MH 1W72H 2GK0B 2B0SL 3U46A 4M7KL 3AXLB 2NZIA 4S0SD 4ZOCA 3SKNB 2V9RA 2YPKA 2BNRE 1IAIH 4OGZA 3VRLF 5C86A 4RSVA 1JRHL 3LRSB 3MUGB 2XIDA 4P4KB 4QWWD 5B39A 1KULA 4GSDH 5IB5B 3WIHH 2J5LB 3FKUS 5F7MC 1KTDA 4GG8B 15C8H 3AS3A 4JFDD 3P0VH 2H8PB 2W91A 5I30H 3IGAA 3O6FB 5INCA 1JZ6A 4XVUD 4ZAKB 2E7LA 2D9QB 3D2UA 2DL9A 3CFKB 1FFNB 1T0PB 3PABA 3O9WB 1RZGB 3TJEL 4NSKA 3HG1D 5J0BA 4AYFA 2YHGA 3QDMB 3FB5B 1Y6KR 3SKUD 2ITDB 1CS6A 2CLVB 4WV1B 3VWJB 1JWMA 1BD2D 3ULVC 3ETBF 5GJTL 2B5IC 3QXDA 5IWLA 1EGJA 3BAEH 2GUOB 3GNML 5HGGS 2R0WH 4PRPD 3KPRE 4HXBL 3MJ9H 2W0LA 2X1OA 1ZLVK 1FFOA 1JRHI 1KTRL 1RUAH 5C9JA 1UCBL 3U0PB 4ZFOB 4UAOB 5D93C 3LZFL 4JCMA 4NT6B 1ZHLA 2WV3A 3IB4A 3ARDB 3CD4A 3CGTA 3T8XA 4XZUA 5E00B 2YRPA 3FQXA 4LASL 5FKAA 4Z7WA 5SV3A 2QLVB 3RWCA 5BVJB 4HDIA 3TC9A 4YX2H 4WVRA 4K3GA 2OYPA 4EIZC 3C6LA 1YEFL 2PR4H 3U36A 1FYHB 3O45A 1NAML 1W72B 3K8LA 3NCYS 4ZXBD 4PPTA 1MCEA 3KLAA 5BS0D 1D5XA 1Q9OB 2AJYH 2MCPL 5E7BA 2HFGH 5E6IC 1TZHA 3DGCR 2Y6SD 1V5JA 2JIXB 1A21A 4LEXH 3UJJL 5D1ZC 1MJUH 4P46C 4AK1A 2XQYK 4WWKB 1JBJA 4LCCA 5IHZB 2Z92A 3G9VA 4Q6IC 3N1FC 3VXSB 3U4AA 1DBKL 1UM6H 5C0AD 4X98A 3GIZH 5E5RB 2IH3B 5CSZA 5FM8A 4P2QB 2FCBA 5J06A 3H9HB 5DTFB 2Q20A 4LARL 1IGIL 3WCYA 4F7MB 4GMTH 4EBQL 1NGYB 5E03A 5GPRA 4LVHC 3PWVB 2FR4A 1IZKA 4IHOB 3QNZB 4BKLB 2UUDK 4RIRB 4UTAH 4JO2L 5TFSH 2H2PC 1AQKH 1P84J 2R0ZH 5JIHA 2A1WL 2C9AA 3FT2B 3MRCA 4M48L 5IG7B 5TF1H 2BVTA 1JMZA 4GXUM 4XCNA 3TO2B 4CVXB 5F6HI 1YEIL 3GI9H 2G60H 1MWAH 2P4AB 4KTYA 1E6OL 3OXSA 1CDCA 3VA6A 4FQPA 5IR1B 1H5BB 2DLFH 4AQ1B 4ZQKB 3EUUA 5DK2B 2BCKA 3VDAA 4NKDA 3HG1E 3VXUE 2OJZL 2NXZD 5JXAL 3E1F1 3BIAX 4P5TA 1DE4B 4XP4H 1RZKH 4WEBL 2PTTB 4N0UA 1IT9H 5F7LB 3GSWB 4XNQA 3S35X 3VFUA 4PJFE 4GS7B 1HXMA 4HQQL 3DXAA 1JP5A 1VERA 2G2RB 5CINL 3GBLA 3VFVB 1DLHB 1NLBL 3PJSB 4U1MB 5I8OH 1ZVSA 2BVPA 4AEHH 1JPTL 5BMFL 5ETUA 1A4KA 1HHKA 4U1GC 5EU6B 4LDOB 3J7HA 4H88L 3H7BA 1OM3H 5JUEH 1F6AA 1P5UA 3MGAA 2FJHB 3CMGA 4WUKH 1NCCL 5EORH 4TSCH 3PWNB 5DUBA 5TDPB 3TVMB 1FDLH 1NFKA 5TDOB 1PG7H 1A0QL 5FYKU 3VXOB 3SDXB 1F45A 4OJFL 1QYGH 3FRUB 5JOPD 3CC5B 4IDJH 5FYJH 4PFEA 5JNYB 2PYEA 1YEJH 1BZQK 5DSCB 4OGYH 3OKDA 2F58H 4M7LL 1EAJA 1NCAL 1W0VB 4JB9L 5C0BB 3V6FB 4C57C 5JPNA 5BS0E 5DVNA 1ES0B 2ZCHL 5KSBF 2FRGP 5I73C 4I9WD 5EBGA 4WJ5B 1J0JA 4JDZB 4OGAC 5JO5A 3GSRA 3BUYA 5M94B 5EZJB 2AV7A 4IOIA 5EBMA 5D7JA 1OSPL 4YHOH 4NHCH 1LO2H 4H8WH 5C0AE 2AQ3A 1KCVL 4XHQA 3RNKB 1I1FA 2YN5A 4HJJL 5KSVA 2X4UA 3DO3A 1LILA 4MA3B 3UZEA 1MWAB 2FEDD 4S1SL 4YHKL 2Q87A 3G04B 1UC6A 5ERWA 5E8NA 5F6IC 8FABB 3MA9L 4U1SA 3TT3L 4PGEA 1HWGB 3HRZB 3WFBL 1FVDA 2CKBA 1FCGA 4S2SB 4UV4L 2QSQA 3SDDB 5GSVB 3N85H 3OAZH 4KTDH 4W68A 4UBDC 3T3ME 1A1OA 2AJSL 1FIEA 5FA3A 2ORBL 3VW3L 2VWEC 5E8PA 1A3LL 4RWYL 1XCQB 5F1IA 4OLZH 2ICEB 3UYPA 5DA4A 5KVDH 1MJ8L 1G6RH 5MEPB 3HN3A 5GZNC 5DQDL 4J6RH 3V5HB 4NDMA 3BN9C 5DD1L 5LKNA 3BHBB 4L8CB 3FHAA 5E2VH 5F6HJ 3P40A 3PQYE 1KPRA 2Q76B 4MJ2A 1G7MA 4N0FB 4G7VH 2ZSVB 2P8MB 1MNUL 5K9OA 1RHHA 1U3HA 5EUOA 1UZ8A 4YO0A 2B1HH 3CUPB 4ZSOE 3T2OA 3BWAA 4XH2B 4JY6B 1SVCP 5ACZB 1MJ7H 4P5KA 1V3JA 4PBVC 1OAUH 1DEDA 3OR6A 7FABH 3RPIB 2MQ3A 1OQOA 4X80L 3RZCB 5ICYB 4DGVL 4HIXH 4N5EC 2V5MA 1JPFA 3AREC 5I8KL 3ZHDA 4JDVA 4PY7B 5EIIA 4KJYA 4L8DB 4FFVD 3FOMB 3TFKC 5GZOD 5JOPE 3FHQA 3X3GH 1LP9B 1EHLH 5LGJB 2H2SD 1RIHL 3FQNA 1Y0LA 4GAGL 1FNHA 4S1DC 2EZ0C 4FTVD 5D71L 3OWEA 4JE4B 2XWJA 3TT1L 4HFUH 1YEEH 4PRHB 1JPGA 3I02A 2EDYA 2EDOA 3Q0HA 1NSNL 4OZIF 5CJOL 2WW8A 1B6DA 1DBAH 4I9WE 3MRRA 5GJSH 4N5ED 2MQCA 5DQ9A 5DD6B 4AY0A 3PGCB 3EYUL 4EOWH 2QKIB 1EVTC 3QIUA 5FYKL 2XICA 3W9DB 3C5SA 2D7PA 2IADB 1KCSL 4NWTH 1D5IH 3L3KA 3ZKQD 4CJ0A 2VE6B 3LQZB 4M1CD 4X6CA 3VXQB 1G6RB 3M8OH 3PWLB 4RGMC 2APBA 1HZHL 4MDJB 1LO3H 3TO4B 3ARBC 3MLZH 4OZFH 1AJ7L 1T80A 3HCVA 4DTGH 3C5ZD 3FAXA 3D39E 3KYNB 1OW0A 4X8JA 1QA9A 1XF3A 4LP5A 5HPMA 2C7UB 5TDNA 2M2DA 1BVZA 4PJBF 3VGBA 3T4AB 3OF6A 3B3IA 4OZGA 2VSDA 4NHUA 1OHQA 5DMIL 4JRXB 5JQ6H 4YHMH 1CVRA 4WENB 1CG9A 1AY1H 4JQVA 3VRJA 1LE5B 2IPUK 4F9LA 1J05B 2NX5D 5HI5D 3KPLB 5E24E 4LLWA 2ZCLL 4Q0XH 1BLNB 1MRCL 1Z5LA 3LEYH 1IGYA 4GRLC 4XGZB 1CDIA 4MD0A 4L3EA 4HFWA 1JGVL 1UWGH 2DLIA 3GSXA 4FQLH 4I3RL 2AJUL 5EC1A 1ULVA 5C0RH 4PJEE 5DEFB 4HUWB 1NMBH 3AGVA 3MXVH 1XH3B 1GZPB 5DURD 1UZ6E 3WLBB 1WC7B 3SGEH 1KLGB 5F9AC 4H20H 1A7NL 4XHJC 1BZ7B 2D7MA 4MZ3A 1ZLSL 4AZ8A 5HVGB 5I75C 2VWEE 4JFPB 1NC2B 3O3UN 2MHAA 5CBAB 3EO0A 4KWUA 1Q9KA 1RD6A 3DUUB 5DJCA 1UM4L 4GKZB 3L9RB 5CEZL 2HN7A 1OAQH 4KK8C 5HYJD 4ODSH 5CP7A 4LLQA 4RISL 2R8SL 5JMOC 5CJQL 2QR0A 4FTVE 1I1AA 1H8SA 4G6KL 3SCMB 3TZVD 3TYGH 2CPCA 1UEMA 1DQJA 4JM2D 1BOGB 1GAFL 3C8KB 2JB6B 4NCC1 2XXMB 3RIAF 5D2LA 1KUMA 3V8OA 3UJIH 2GT9A 4HUXA 5I74C 1SEBA 1A1NA 1ORSB 4NKOB 4UMGA 1MOEA 1CDYA 4KY1H 3VFOB 2I26N 2BJMH 3WXWL 1HOCA 2OL3B 1QD0A 3LIZL 2XZQL 4IDLA 1YPZA 5D7KE 1CGTA 4NYLB 4MAYC 5AAWA 3D3VB 5L88H 1NEZB 2DKSA 4RWHA 5A2LH 5LBSL 4U0RB 5J57B 2BNQB 2IEPA 4QNPE 1TJIH 1EJOL 1RZJL 3OAUH 4QY8B 1RK1A 3Q6GL 2WIIA 4R90L 3NA9L 4RAUB 1GIGH 3I6LD 5I0ZA 5CUSL 3S6CA 1WBYA 1J1OL 1Q38A 1LEIA 3WNMA 3MJ6A 2EYTB 5TQ0L 4XVTH 3RDTD 1JF1B 2ZUYA 4PV8B 5AG9A 5J7CC 2NX5E 2ICES 4N0RA 5KS9E 1CLZL 4GT7A 2DIBA 4YDIH 5C6PB 3SDAA 4AM0B 1U2HA 2OR8A 4E41A 3RVWC 5DVOA 3DSFH 4NO2B 4QHLB 4MJ5B 4R0LC 3QI9B 2MCG1 3T1WA 4OLVL 3KLHD 4FQXC 4HKZA 3ZKMC 1G9MC 4P9HL 4QLRA 4TTDC 3AUVA 1A6VH 2I25N 4HK3J 3STZB 5HY9A 5IUSA 5B8CC 3FO9B 1EO5A 5F8QC 5K59F 1YMMA 4I18A 2VISA 3PXJA 4RGOL 1H3TA 1RURL 4M5YL 2EDHA 3O4LB 2E6PA 1ZT7B 2X70B 3QBTB 1U8JA 1S9WA 3GIVB 5J1AA 4F3FB 3FL7A 2FL5A 3CVIL 3CSYA 2K9UA 4HJGA 2EYRB 2JJTA 4XC1H 3WHXB 5IMKA 2NXYB 5DJYB 5L9DH 2B20A 4DZBA 1JWSA 5KN5B 2AW2A 4JCLA 3MV9A 5AUMA 3DX7A 1PVHA 4YHNA 4PJ5D 1FJ1A 1I75A 4FQJH 4PJCA 1NBVL 3QFJA 5T1DH 1HH9B 4Y2DB 4IIQA 1KTLA 5IB3B 3ES6B 4OM1L 3ULVH 5D6DA 1CFSB 4QHKI 3MBEB 5C0IA 1IGMH 1S9XB 4M9OA 3EYQD 12E8H 5C08B 3QNXA 1IAOA 1FSKB 4ZTPH 1ZT1B 3TPUB 2GK0A 4R7DB 3AXLA 4F8QA 5F9JB 3FQTB 1IMHC 3SKNA 1JGEB 4KV5E 3B9VA 1DZBA 4OZIB 3UYOD 1K8IB 3LRSA 3MUGA 4P4KA 1VFUA 4ZS7L 3WJLA 3AM8C 3ZLQC 4QT5B 5IB5A 4GG8A 5GXBB 3OKEB 3HMWH 2VQTA 2H8PA 1KJ2H 4WHYG 3O6FA 4QRRD 1U3JA 3F12B 4ZAKA 5FUOL 2YD3A 3L5WB 3BVNB 1AGEB 3CFKA 1FFNA 3O9WA 4IRZH 4OLUL 1S7SB 1RZGA 3LS5L 1ZGLB 3EFDH 5KW9L 5EU3B 2YKLL 3QIWC 1ITCA 1XIWC 2W9DH 1UA6L 3QDGB 5DWUL 3ZT7A 1MQKH 3PV7A 3QDMA 4AEIH 3FB5A 1T6WA 3ALPA 2DQJL 4PJBB 2ITDA 3NTCH 5IMMB 2CLVA 4WV1A 3VWJA 4H25B 1A7QL 2R0LH 3BGFC 1FH5H 4LU5H 5I66B 4X4ME 3UP1A 2KH2B 3EKCA 1MCHA 4P9ML 2GUOA 4XAWH 3SO5A 1EXUB 5K9JH 2GIYA 2AABL 4ZOBA 2RFXB 1PZUB 2Y5EA 2F5BH 5FEBA 3U0PA 4ZFOA 3F65A 4NT6A 4CGTA 5HDQL 3ARDA 3C6SB 2HT4C 4KKAD 5E00A 4MVBC 5HJ3B 5B39G 3UAJD 1X5HA 4LRIA 4NQTA 1HH6B 1WT5C 1X5AA 5BVJA 5HVHB 3DROB 1VEPA 4HBQA 3MLWL 5F9DC 5FCUL 5F7EL 5DUPH 1W72A 2AQ1A 3EO9H 3HA0A 1R24B 4MJID 1Q9OA 3MREB 4PJ5E 2MKLC 4R4FL 1EBAA 1J5OH 2JIXA 2DI7A 4IRSD 1DJSA 3WIHA 4WWKA 1INEL 2BVOB 4KHTL 5IHZA 4DW2H 3VXSA 1JJUA 2IH3A 4P2QA 4GRWB 3TBTB 1EZVX 3HLAB 2YUWA 3QG7L 3TLRA 4APQC 4ZMAT 5DTFA 4QHKJ 1JNJA 4F7MA 3C09C 3U2SB 4NUGH 5CJXC 1NGYA 2W0KA 1T22B 3SDCB 2NY1C 3S34L 1HYSD 1BBDL 3SGDI 2DJUA 4D9RE 4YQXL 4PJ7B 3PWVA 4Q6YA 4M93B 1A6PA 5SWZD 2AQ2A 5D1ZB 2DF3A 4IHOA 3QNZA 1OL0A 5LXGL 4BKLA 1WITA 4RIRA 2BDNH 3NFSH 4MA8L 1S78C 1WAAE 4R9HA 5LWYL 3FT2A 4UT9L 4ELKB 5TE6H 4NWUH 3EOBB 5IG7A 1WEJH 3S37X 3S4SB 3TO2A 4CVXA 2RCSH 4TRPL 5DHYB 5E08L 3EYSL 1JI1A 4TVPL 4EVNB 3MJ9A 4JGJA 4ESKA 2DQIL 1L6ZA 2ESVB 4KU1A 1H5BA 1JIBA 3QUZB 4HEME 4ZQKA 1DQTA 5DK2A 5E8OB 3KJ6L 4JO3H 4U6VL 3HZVB 1DE4A 4RDQG 5D7LD 3GSWA 4NZUL 3BN3B 2G2RA 4HWBH 3VFVA 1DLHA 4M00A 3PJSA 2AGJH 4U1MA 4PJIE 3VD7A 3Q3GB 1INQB 4XPGH 1IZJA 1LHZA 1H0DB 5D1QC 5KVFH 1NUDA 5EU6A 2E3VA 4JFYB 1EFQA 1OP3H 5DZNA 4PJXE 4DVBB 3KHOA 5SX4H 1WUNT 2FJHA 1BVLB 1YNLL 3PWNA 5TDPA 3TVMA 5TDOA 4XVSL 3IFNH 4TUJB 3VXOA 3EOTH 3SDXA 3VI4F 3P4OB 3FRUA 1T6VN 3JVGA 1RUPL 5JNYA 5FDYA 3S96B 5DSCA 4Q2ZB 3C08H 1TITA 2V2TB 3QCTH 1X6LA 2RQ8A 3MV8D 4XB7A 4WI4A 2ZCKH 1TDQA 4HWNA 1W0VA 1LEGB 5C0BA 4GMSH 3V6FA 4MJIE 3T77B 1ES0A 2YD1A 3LN5B 5AZ2L 3K4DA 5BW7A 5JR1H 5KSAC 2M1KA 4TNVF 4WJ5A 1GPOL 3E8UH 3L3OB 2P5EB 4JDZA 4M1GL 4Y5VB 3V6ZB 3O2WH 5EZJA 4AJ0A 1Y6NR 2OTWB 3A6CL 3L3IB 2O5ZL 1DBMH 3RNKA 1T03H 5FYKD 1BGXH 3DX8B 5AZEL 4OTXL 4MA3A 1IKNA 1MWAA 4PV9B 2EE2A 3OJVC 3G04A 3V0VB 4X4ZA 4Y4KD 4KKCC 4X4XB 3EHBC 8FABA 3ILPB 3PGDB 2DM3A 3RA7H 3HRZA 3P11H 3IDUA 1F97A 4S2SA 5SWZE 3SDDA 2WBJD 1CDJA 4PRIB 1FG2A 4RFEA 5DEGB 3JBG7 4ZO9A 4XVJH 4XBGB 3RL1B 5CZVL 2X9WA 1XCQA 3ROOB 3IAGC 2ICEA 4LSTL 4NRXB 1MCSA 4HZAA 5MEPA 1IVLA 3TEUA 3V5HA 3AU1B 3BHBA 4L8CA 2YWYA 4ELMF 1A5FL 3A6BL 3DGGB 2Y1VA 2Q76A 3NBNA 1NFIB 4GLRH 4Y8DC 4N0FA 2ZSVA 1Y18B 2P8MA 1PAMA 5D7LE 3FO0H 2ENYA 3KAAA 1MCPL 3QDJD 4DWHA 3CUPA 3JWOL 1ZSDB 4JY6A 1ZOXA 4C56B 3NCJH 5ACZA 4CU8A 3T0EC 2A77H 3GI8H 1H3PH 4KMLB 3ARUA 2RBLA 1L0QA 3RPIA 4X6FB 1SBSH 3BKCH 4Y5YC 5ICYA 3RZCA 2JCCB 5BOPA 3OKMB 5DS8B 2DQDL 4PJHB 3RUGA 3N0PB 1J8HD 3DI3B 2IPTL 4X83A 1A6WL 4DOHE 3W82A 4PY7A 1UEYA 2QQLL 3LPGA 4KUZH 1EZVY 4L8DA 4LL9A 1IBGL 5I1GL 2X4PB 3FOMA 1I8KB 5E0QA 1LP9A 4ORZC 2HP4A 1T7ZA 5LGJA 1MFBL 3WDHA 2V17L 5J12B 5IT2L 1C1EH 1RZJC 3SDYL 3U7WH 4NGHH 1RZ7H 3TBSA 3AVEA 3STBA 3GRWH 1MJJB 1FFPB 3AREB 4PRHA 3RVTC 5ANMB 3PP3H 1ADQL 1MEXH 1F58H 1NGZB 3H9SB 4RGND 3QO1B 3BOVA 4NNPL 2VXUL 3EJYD 5DD6A 3PGCA 3BYTA 1N5YH 5KVEL 5DGQA 2EKSB 2EYSB 3DMMD 2QKIA 3BE1H 5C6TH 5FYKE 4NP4H 1INDH 3W9DA 2IADA 1DBJH 4LNVA 4I0PD 2VE6A 3LQZA 3VXQA 5JLZB 1G6RA 2B0SH 4M7KH 3PWLA 3MACL 1WFTA 4MDJA 4GKOA 4WO4D 1CICD 5EU7C 3TO4A 1FNLA 1JNLL 1UFUA 3QIBC 3KYNA 4ERSL 4LCWD 2J8UF 3CFCL 2C7UA 5I17B 2WM0A 4BA8A 3T4AA 3ZYIA 4S11A 2O5XL 4JRXA 4JGMA 1R3KB 4G6AC 3PUCA 3BQUD 3GM8A 4FQ1L 4FZEH 2QQQA 1LE5A 4L8SB 5D7IE 4N9OB 4PG2A 1J05A 3KPLA 3OJDB 1GGUA 2RGSA 3WFHB 4NBZB 1BLNA 5LQBL 3MUZ1 5HI4C 3TJEH 1KG0B 4XGZA 2MTPA 5JPMB 4GW5B 4HIEB 1EGJL 4JN1L 4KJPC 1I9RL 1K3ZA 3SE4A 5I1EL 3SE9L 5DEFA 4JEGB 3QDJE 5GJTH 4KGLA 1XH3A 4RA3A 1GZPA 2VUYA 3WLBA 1WC7A 1YEHH 1KLGA 2OI9B 4XP5H 4EI5C 4U3HA 1BZ7A 3WL9B 5DDHB 1UCBH 2GTWB 3IDXH 4NN7C 4GRLB 2OBGA 3ARGB 4JFPA 1NC2A 1HN1A 4YHYC 5CBAA 4LASH 2VXSL 3DUUA 4GKZA 5CEZE 5F3BB 3D18B 4OD3L 4MHHG 4LHJB 2ERJC 3HC3L 1OAZL 4Q58C 1MIEL 4PJ8D 5BOZG 1NAMH 1IAIM 3SCMA 2R1YB 3T0EE 1IM3B 5IJKC 2MCPH 2N4IA 1BOGA 3C8KA 2JB6A 5EB9A 3CDGB 3V0WL 3T09A 2WWKO 4LCIL 1G9MH 3G6DH 2Y36H 1ORSA 4RGNE 3UJJH 4NKOA 3DO7B 3VFOA 4OLXH 3CXHJ 3W0WB 2N7AA 3A67L 4LKXB 1MFCH 1DBKH 4R8WL 3NAAH 2OL3A 5T3XD 4DCQB 4PTUB 2R2HB 3OG6B 2BFVL 1A22B 2KDGA 3U6RB 4NYLA 5J3HC 1IGIH 3D3VA 2VDKL 1EDQA 2NY0C 1NEZA 2WSKA 4TNWF 3PL6D 1J1PH 3HE7C 2BNQA 2F9BT 5CGMA 3RX7A 2BVUA 4QY8A 1N4XL 4TSBL 5FDWB 4NQUA 4RAUA 5AD0B 5C0CD 4JG1L 1U0QA 2AK4D 1T7VA 3EDKA 4JO2H 3WUWB 3W81A 3BKYL 4OUOA 2A1WH 1OTUD 5I16B 1PYWB 4C55A 3SGKA 1E4WH 3HPJB 1YEIH 4YE4L 2EYTA 2Z31B 1JF1A 1U95B 4HF5L 4PV8A 1I85C 4MA7H 5DJ6B 5J8OA 1E6OH 3QHFL 2IWGA 1JUFB 1FIGL 3LOWA 4FQHB 4MXQC 4NN6C 1GYAA 3CH1B 4AEEA 3HAEB 4AM0A 3GO1L 3G08B 2P5WD 3ARSA 1KPUB 4UV7H 5JXAH 4NO2A 4QHLA 4I2XE 4MJ5A 3QI9A 1IC4H 1Z9MA 4F58L 3KDMB 3VA2C 5TE7L 1FBIL 2D7NA 3L5XH 1FC1A 5EU7E 3LKQB 1KN4L 5CINH 3STZA 2J2ZA 4YZFE 1H8NA 3FO9A 5BMFH 1YY9D 3EO1B 4Y4HB 1N0LA 4YXHL 1T89A 3ARWA 5BV7B 1IC5H 2YUXA 3O4LA 3SJVB 4H88H 2VLKB 1ZT7A 4ZS6C 3GIVA 4F3FA 2D31B 1HHHB 1IGJB 2WP3O 3ZTJG 1A0QH 1WIPA 2DOCA 2J3SA 2EYRA 2A38A 3AY4C 4OJFH 1ODAA 2N1KA 4OBRA 5DJYA 4U2ZA 4K07A 5KN5A 1B90A 2FSEB 4Z7QF 5B8CB 3DARA 1NDGB 3VXPB 3T2PA 1T3FB 2FD6L 1CVSC 2NR6D 4ZODA 3FMGL 4Y4FB 1HH9A 4XNXH 1F00I 4M7LH 4Y2DA 4OD2B 4Y16C 1NCAH 3ECBB 3ES6A 1IJ9A 3V4PL 4JB9H 1CFSA 5IB3A 3MBEA 1S9XA 1WZLA 3BSZL 1MELA 2A9ML 3VWKC 5HVFB 1QBAA 2UZIH 5C08A 1MREL 1OT1A 2XZAH 3O41B 1G9NL 3CLFH 2XWTB 1ZT1A 1R0AH 3TPUA 4LMQI 3GMMB 2EKJA 1NCBL 4ZS6D 2R39A 4R7DA 4BQ8A 1FZOB 4CL7A 2UYLB 3FQTA 2WLZA 1OSPH 4M5ZH 2DBJA 1JGEA 2NY2D 2W65B 1MI5D 3WS6C 1OQXA 2R56L 1ONQB 3GBMH 2VO5A 1RU9L 4P2RB 1K8IA 3IS0X 4S1SH 2CKBL 4QT5A 5D1XD 2EC9U 1ND0B 4UIKL 5F9OH 3OKEA 3MA9H 3TT3H 1LO0L 3C60B 4JFFB 4XXCC 3DHMA 1MCKA 1M71B 3WFBH 3K4ZA 4HULB 4UV4H 3F12A 4TVPD 4TN9A 3TN0B 4LQ1A 3L5WA 1AGEA 3WFDL 4N90E 2R69L 4UQ2B 4ZDHB 4IRJD 4NZJA 2ORBH 1S7SA 2DIAA 4G8FB 1ZGLA 3DV4B 1TMCB 1A3LH 3ARZA 3H3KA 4RWYH 5EU3A 1VFBB 4PJ9B 2W9EL 3LKNB 1NL0L 3QDGA 4PUBL 2WLYA 1WV7T 4LFHG 5IMMA 2P47B 3OGCB 1CLYL 2VXVL 4JFXB 3EGSA 4H25A 1QO3B 4CJ1A 2YK1L 5I66A 3RY5A 1WWWX 2P5WE 4Y5XC 2X4OB 2CIIB 2FJFB 1GOFA 2EH7H 1FLRH 4PJAB 1HHIB 4DKEL 3NOIA 3HE6C 3U9PL 1EXUA 1MNUH 4XPHH 3LB6C 1FGNH 2R4RL 2RFXA 1RI8A 2PETA 3FAWA 2GKIA 3UDWC 1BEYH 3QXAB 5IJVB 1PY4A 2ZG2A 5E9DE 1R5VB 2D7TL 4G6FD 4F37K 3P9MB 1QRKA 3C6SA 5IBLC 3TPKA 2YRLA 4KMTL 4X80H 3B5HA 3BGFB 5C0FB 1AI1L 3R8BB 5ID1B 5D6CB 1HH6A 4PLKC 5L2KB 3L3HB 2DI9A 3DROA 3TNMB 5CCKL 3GJFK 1JHKL 4XWOC 2QEJA 4QOKD 3D85D 1H3WM 1QFOA 3F8UB 4OCXH 4LAQH 2XZCL 1R24A 4ZPTB 2VZTA 3DYMA 4LIQL 4GAGH 3MREA 3VGDA 3KXFB 1QACA 3JTTB 1DQDL 4XCYB 1OGAD 5FCSH 2X42A 2VJXA 5D71H 1M7DB 4LLVB 2BVOA 1NSNH 3RTQD 5CJOH 3TBTA 3AS2A 3IDMB 1GOHA 1T2QH 5FM5O 4BZ1L 2JJWA 1C08B 3U2SA 5A3IC 2WQRA 4N0YL 4XPBL 5IFAL 2BXZA 1T22A 3SDCA 4DFIA 5EZLB 1J1XL 1K3IA 3RJQB 1B3JA 4PJ7A 3QPQC 1KCSH 4OLEA 4TOYL 5D1ZA 1C5BH 4D3CL 5T5NG 1A2YB 2WQ8A 1O5DT 4NQEB 2BP3A 4ELKA 1K85A 3EOBA 4QXGL 1KACB 1AJ7H 4RFNC 1T04B 5KZCD 3S4SA 5EIQA 4TVPE 4EVNA 1QOKA 2DQUL 3BD3A 2EH8L 2ESVA 1AO7D 1AXIB 3O8XD 3QUZA 5E8OA 4X6DE 2NY4C 1C8PA 5EU5B 3HZVA 5MHSD 4PB0H 1OCWL 1CDHA 5ITFB 2ZCLH 2PXYC 2Q8AL 4PBWD 3TBYB 4HGWB 5JW3H 1YC7A 2CH8A 4XI5D 1JGVH 5IVXE 2IQ9L 3Q3GA 1INQA 5T1LD 4I3RH 2AJUH 1OT2A 1UADC 2WP3T 1H0DA 3MA7B 1I9JL 4GKSB 4JFYA 3HI5H 3QEQE 5HD8C 2OR9L 3EFFB 4DVBA 4JRYD 5DJ0B 1QTYT 3ORJA 3SKJL 1BVLA 3OB8A 4OSUL 1JPSL 4HLZG 4TUJA 2R1XB 1A7NH 2HFFB 1EX0A 3P4OA 4OB5L 4EDWL 4ONGL 2OK0L 4MHHI 4M4PA 3R0MA 4BFIA 1I3GH 5A2JH 4PJFF 5I71C 1C5DB 3S96A 4Q2ZA 1F4YH 1GC1H 5HXMA 1VGKB 3PDGA 2V2TA 2P8PB 2VQUA 2YD5A 1P7QB 1VGEH 1A7PL 5D2NE 5DMJB 2C4XA 4P2OC 3DVGB 1UM4H 1LEGA 1EAPB 4QOKE 1ZVHA 3LDBC 2JB5L 1FYTB 5CEZH 2E7LC 3T77A 1P5VA 3LN5A 3QH3B 2GEEA 3ZKND 2R8SH 1JFQH 1OGAE 4YDVB 3L3OA 2IG2L 2P5EA 4Y5VA 5CJQH 5SV4A 3V6ZA 4G6KH 2QHRH 5E4IA 3ZE0E 2OTWA 4F9PA 4GO6B 3L3IA 3DX8A 5SWSD 3SBWA 5DZLA 1XFPA 1GH7A 5DHXB 4PV9A 4LHQB 2DI8A 3QEGL 3V0VA 5GGQH 4X4XA 3ILPA 3PGDA 3BX7C 2VAAB 4YJZL 4LKCB 3ZHLA 3LIZH 2XZQH 1U8MB 2D7OA 2VN7A 4K2UL 3QZWB 2C1PB 3KPQB 4M7ZC 4PRIA 4HAGA 5E4EB 5TGBB 5DEGA 4CKVX 3CX5K 3WIFB 1MFAL 1EJOH 1P4BL 4EXKA 4XBGA 4HWBA 4XAKD 3RL1A 5CUSH 4KKLD 4CN6A 2XOTA 3ROOA 2IFGA 3QO0B 4NRXA 4KPHL 2GQHA 1ACZA 4PGBB 3AU1A 1AO7E 1J1OH 3CSPA 3GMLB 2OCFD 4PGJA 5EC2B 3DGGA 3L7FB 1EHAA 1XR9B 1NFIA 5L0QC 2N7BA 4D2NA 2JK5B 1SJHB 4PD4J 3ELAT 4MQSB 3UTTB 1Y18A 4FQQB 4GBXD 3VJ6B 3OV6A 1V3MA 1AC0A 3T3MF 1ZSDA 1PSKL 4C56A 4WFFD 3SY0B 1YEKL 1DQMH 4LCCC 5D5ME 5I1KH 4OLVH 4X6FA 5DMGD 1P2CB 1IQDB 4MMZC 2FZ3B 4PREB 2JCCA 3OKMA 4QTHB 3QYCA 4PJHA 3TV3L 1CE1L 1UVQB 4JRYE 2EXYC 3GKWL 2F54E 4NZRL 1Q8MA 1CXEA 4G3YL 4XPTL 1RURH 1YQVH 1I8KA 4M5YH 4NJ9L 1TVHB 3C6LD 4B7LA 3H9YA 3MRPB 4Q74A 2QQNL 4ZTOL 4FABH 2R0KH 3CMOL 3VFNB 3BIKB 1CBVH 3LPWA 1L9MA 3CVIH 3I9GH 4J3XA 3MRDB 2KQMA 2XTJD 1ZWIB 5CZXC 2UV3A 3UROR 3QWOB 1IAKB 1MJJA 1FFPA 3AREA 4G80B 5KTEL 4JZOB 3C2AL 1JI2A 5ANMA 3P9WB 2IANA 1NBVH 2E7MA 1NGZA 3H9SA 3WFCL 3QO1A 2VXQL 4M62H 2HH0H 1GHFL 2EKSA 2J6EH 2X1PA 2EYSA 4JKWA 4KJWD 1FRGH 5FUCC 5SWSE 3GSQB 1JWUB 2DYPB 5JLZA 4RMVA 3B9KC 4WW1B 3QHZL 2WUBL 3T04D 4Z0BH 4G5ZL 1T5WB 4L8BB 2Z91B 1NGPH 4NFBA 5CWSB 4ZS7H 5I17A 5FV1L 5IOPB 2LAGB 1CD0A 3BI9X 2ZP0T 1R3KA 5D72H 4XAKE 2O5YL 4P4RB 4L8SA 1P69B 3REWB 1ZGLM 5GGRB 1T2JA 2FO1A 1YECL 3OJDA 3L5IA 4P5TD 4KHXH 3WFHA 3ET9F 4YR6B 1WIOA 5HYSB 1KB9J 3L1OL 1KG0A 2YKLH 4POUB 4U1HB 1KYOJ 3RY6A 5DWUH 1UA6H 5JPMA 4GW5A 3BO8B 4HIEA 1OP9A 4OKVB 4ZOAA 1L7IL 1MVFA 4Y19D 4XPFH 1WK0A 4WFFE 2DN7A 3HB3D 4ZFOL 3KGRA 5HPOA 5D7JC 1IAMA 1CGWA 2AABH 4PRAB 1G9NC 3LMJL 5JZ7D 3GGWB 4JKPL 4ZYKA 5DDHA 2GTWA 4GRLA 1KPVB 2VSCA 3M17B 4JFDB 4DN4H 4Z7WE 4ZUTB 1X5YA 4I13B 5ACLA 3SGDH 2GITB 3BMVA 1QLRB 3PG2A 1OSZB 2CR6A 4N68A 1KEGL 3OKNB 4R26L 2AAVA 4PJEF 3TH2T 5CP3H 1W72L 5KBNC 5F3BA 3D18A 5C6WH 4P2YA 3MLWH 2APTA 4RX4A 1UZ6F 3GM0A 2XTJE 5FCUH 2GK2A 1IAIL 3D9AL 3H42H 2NPLX 2A6JB 1YN6B 2HT2C 1LEKB 3O2DA 3B8SA 1BD2B 4GSDL 2R1YA 5H35B 1FZMB 3WIHL 1IM3A 1PX3A 5C0GB 15C8L 4BJLA 2APWA 4ENED 3ZKSD 3CDGA 3FO2B 3P0VL 5MP6H 3PP4H 4R4FH 1OP5H 4PRPB 5KANI 2HTLD 3DO7A 2K7QA 3U0WH 1S7QB 1RMFH 1ZS8B 2DAVA 3NCCB 1INEH 4KHTH 3JUYA 4RMRA 3W0WA 4LKXA 3QQ9C 5GGVH 1U3HC 4W4NA 3PE9A 3BMWA 4DCQA 4PTUA 2R2HA 3U6RA 4JQXC 3H8NA 1KF9B 3CIQA 3QG7H 4EZMA 5FYJU 2PW1B 4ZFFB 1YA5A 4ZFZA 5ENWB 2FEEI 4YQXH 5FDWA 3SN6N 2YPLB 4RCAA 1U8OB 4BFEA 5LXGH 2ATKB 3HRPA 4GAYB 2R0WL 4J23A 3WUWA 3MJ9L 5CHNB 5I16A 1IAII 1PYWA 2BY3A 2BNUB 5GS0L 2HT3C 4NKQB 1RUAL 5E08H 3HPJA 5DRWB 1YUHB 1MVUB 2Z31A 3EYSH 2NY0B 1RK0B 4M7LT 3QEUB 5IFHL 1NMAH 4N0UE 2A74B 2GAZB 1JUFA 4FQHA 5GRJH 4WEMB 3CH1A 3HAEA 1T4KB 3G08A 4ONHB 4QNPF 1KPUA 4KZEL 4PLJD 3DXAE 1OTSC 4OZFG 3WXVL 3ESVF 4YBLB 2YC1B 4YX2L 3KDMA 1JMXA 3BT2H 4NZUH 1R5IB 3GBNH 2DTML 3VFMB 4EUPH 3VMPA 3LKQA 2ZUXA 5FGBA 3MRBA 3EO1A 1EEUA 2AJYL 2GSIB 4Y4HA 3MV11 5FGCE 4EIGB 2Q3AA 4IEFB 3UTSB 3SJVA 1IARB 4LEXL 5KS9F 4K8RL 2VLKA 4HMCA 1MJUL 3Q5YA 1RVFH 2X44D 2D31A 1IGJA 4XVSH 1UM6L 4FQXA 3GIZL 1RJYB 1G1CA 2X4TB 1U36A 3CZFB 2FSEA 3EYOB 4WEUD 1AD9B 4CU6A 5B8CA 1NDGA 3V4VL 3VXPA 5DJZB 2VDLH 2IQAB 1T3FA 5IFJB 3V6OA 3PWUB 4Z0XB 1EHXA 4Y4FA 3MLYH 2LU3A 5JXEA 4YPJA 3RHWF 4K94C 3BZEA 3SE3A 4OD2A 3ECBA 2EE6A 3I3DA 5IP4A 4JQVC 4J8RB 3MV7D 4UTAL 1Z9OA 3GMNB 2R0ZL 3NGBB 3O41A 2ZG1A 2DM2A 3W9EB 2XWTA 5TF1L 1EEQA 1GPOH 3QIUD 1SM3L 4QYOB 1F90L 3GMMA 3GI9L 1MWAL 2EE3A 3H9ZA 3S9DB 4H1LH 1FZOA 4AL8H 2UYLA 5GRXG 4IMKA 3A6CH 1WSST 3H3PH 1F2QA 1IEAB 1JZ7A 1ONQA 3G6JA 5AZEH 1WBXB 4P2RA 3NACH 1UB5B 3DTXB 2CXKA 4KTEH 1ND0A 1RZKL 1TIUA 3UO1H 1NGQL 4OI7A 4ZUUB 3OF6D 3C60A 1UH2A 4JFFA 2DQHH 4XTRD 1M71A 2FIKB 4Z76B 2M26A 3TN0A 4K3HA 4AEHL 2E27H 5E95B 1QBML 4UQ2A 4ZDHA 1CDBA 5F8RC 5DLMH 1BJ1H 4EUPB 4Z7UE 4KV5F 4G8FA 4JDTH 1A8JH 3DV4A 2CO6B 1VFBA 4PJ9A 4LVOB 3LKNA 5JUEL 2ICCA 3AM8A 4ODUB 1B0RB 5EORL 3Q5TA 1PG7L 3OGCA 4JFXA 4MGXA 3PWPB 1QO3A 5EUOE 1IGFL 3V5DB 3RVVC 1I1AC 5C09B 2X4OA 2CIIA 2FJFA 43CAA 4PJAA 5FYJL 1HHIA 1Y6MR 4RMWA 2C3WA 1YEJL 2IBZX 2I60H 4OGYL 1XR8A 5FOBB 3HC4H 4DAGH 4XNMB 1WZ1H 4HPYL 4JFHD 2X5PA 3MSPA 3QXAA 2HLFC 1XF1A 5IJVA 3KPMB 4UU9B 1QPPA 4WGVB 1R5VA 2BVQB 4OKDA 1Q1JL 1X5LA 1TTGA 3P9MA 3NCBB 2FNBA 4GG6B 3P4NB 5C0FA 3UC0L 5ID1A 1K4DB 5D6CA 1URLA 4DKFH 5L2KA 3L3HA 3TNMA 1S9VB 1F4WL 1A6WH 4P23C 4NHCL 4ZG1A 2QQLH 3DETC 4H8WL 5DJXB 4K7PH 5KAQF 1IBGH 1DEEB 3LPFA 5CJ8A 5I1GH 4L29B 3RWDB 5ISZD 4ZUWB 4CAGA 1KXVC 4H1LB 5BCAA 4ZPTA 1MFBH 2BY1A 3INUH 3RGHA 3SQOH 4LIQE 3FZUD 3KXFA 1EPFA 3JTTA 3SDYH 3MO1B 4XCYA 3ILQC 2XKSA 1M7DA 4F7EB 4LLVA 1EEYB 2PO6C 5C07A 2UVEA 3N85L 1Z9SA 4KTDL 4I77L 9CGTA 1ADQH 2CRZA 3IDMA 4P0DA 5B21A 2AERT 2YXMA 4OFVA 1XGRA 1C08A 4NNPH 1YY8B 3QWRD 5MENB 5DF0A 5KVDL 1PEWA 4X6CE 1G6RL 1S9YB 5EZLA 2VR9A 4BM7A 3X11A 5GS3A 4NJAL 3NFNB 2EDDA 3MGOB 4OIAA 3UPRB 5CJBA 4G7VL 4NQXB 1A2YA 1QKZH 3QP3A 3HNTH 2CK2A 2YBRB 5FO9A 2VDNH 2ZNWA 4OZGE 4GQPH 4NQEA 5CLTA 3N1GC 1JNLH 4O9HL 1T04A 3KPNB 2B1HL 4G42A 4F37F 1BHGA 3ARQA 1SMAA 5C0ND 1OAUL 4MCYB 7FABL 2O5XH 2JJTC 5HDLA 2LABA 3N06B 4FQ1H 4LF3A 4QXUH 3SDAD 5GRWA 4HIXL 3V5KB 4JJHA 5EU5A 3ARFC 3X3FL 4L3EE 4E5XA 5ITFA 4JPKL 3O2VL 4FXLA 4LSPL 2DQEH 3TBYA 2VN4A 1WAAF 5D6DC 4HGWA 3D5OF 2LU7A 2EIZB 1L7TH 3EZJB 5I1EH 3MA7A 1PLGL 3ULUC 5F71A 2ADGB 3SE9H 1YMMD 4GKSA 1TQBC 1QSED 1MCLA 3W11D 3EFFA 2EDEA 4HFUL 1N59B 5DJ0A 4I0KA 3MLVH 2F74B 5DD5L 2DQGH 2B39A 1T7WA 3CCHB 2R1XA 2HFFA 5J4MA 3T0WA 4MYWB 4P4KC 1C5DA 5GJSL 5GRZA 4I3SL 3WJLC 1F3JB 1QBBA 2J5LC 1ZHNB 3EOAB 1VGKA 3P0YH 4XCEB 1IRAY 2P8PA 2E6JA 3S4SG 1P7QA 4MAUH 1IFHL 2QL1A 3FFCD 1KB5H 3DVGA 4LFHD 1EAPA 4NWTL 1D5IL 2YXFA 5DJ8B 3SHSA 4TTGA 3MC0A 1FYTA 4RQQB 3VMNA 4PJXF 4OD3H 3OSKA 3T0AA 3QH3A 3O9WC 1LO3L 1KELH 2Z8RA 4YDVA 1MCCA 3K0WA 5D2LE 1DVFD 5GS2D 2XFXB 5CJ5A 1F6LL 2NW2B 4KQ4L 3G9AB 1QQDB 5JA9A 4WV1C 4X9BA 5DURB 4Z8FL 4YHML 2FO4B 2OL3L 4ETYA 1AHWB 2NQCA 1AY1L 4P2OB 1JTTA 5DD3H 3GSVB 3LDBB 4HXAL 3ZT5A 1CT8B 4MQXD 4KKBD 4R8WH 2VAAA 1YNKL 4LKCA 5JW4N 4Q0XL 1U8MA 1NGXB 3LEYL 3EBAA 3O6FD 3KPQA 2VDKH 3QZWA 4UAOC 2Q7NA 3HNVL 2IBZY 3TP4A 1UWGL 1QVOB 4ZAKD 3IDYB 3K8MA 4QGYA 3ARDC 3WIFA 1RIUH 5C0EB 3FB7B 5C0RL 4MJ6B 4M02A 5ALCH 4NM8H 1I7TB 2A73B 5HYJB 3MXVL 4K7FB 5IHBA 3QO0A 3QDMD 5HI3D 3KNBB 1K5NB 3BKYH 4J4PD 4PGBA 3A6OA 4ZUSB 1AFVL 4H20L 4HWEL 3TZVB 3GMLA 3VWJD 2E9BA 4OCRH 5EC2A 1SY6H 3L7FA 4JM2B 1XR9A 4YE4H 3K7UA 4G7YH 1CR9L 4E41E 1JZ2A 2JK5A 2XKNB 1SJHA 3UTTA 2HVKB 1HI6B 4ZO6A 3QHFH 4FQQA 4P3WA 2G5RA 4X7DC 1VPOL 1BF2A 3VJ6A 3FOLB 2VKXA 2A0LC 1S7XB 3JTSB 5I9QB 2VC2H 4YFDB 3SY0A 1IGTB 4JHWL 3WN5B 1OAQL 4F58H 1XGUB 2DQCH 4M3KB 1P2CA 1IQDA 3D25B 4ODSL 4MS8D 1FBIH 1YMME 2FZ3A 4PREA 1KB5B 4QTHA 3WMSA 2VABB 1BWWA 1QSEE 1KN4H 2H6PB 5L0QB 1UVQA 5B38B 5DC0A 4HEPG 4XCCH 3TYGL 5A43C 5F7DB 2B2XH 4YXHH 3BPNB 5GRVL 1NCNA 3P2TA 1TVHA 3PF2A 3MRPA 3HMXH 3VFNA 3BIKA 2YR3A 3BDYH 2BJML 3MV9E 1TVBA 4P49A 4YH6A 3RDTB 5I1AB 1ZWIA 3MRHB 4WW2C 4PJCE 3FFCE 3QFJE 1GGBH 2JIXD 3QXWA 2V2XB 3QWOA 4OLWH 1IAKA 4G80A 4JZOA 3RVXC 5HYEA 4WWKD 3BYYA 5GS0C 3VXSD 1TJIL 3OAUL 1UWEH 1B2WL 4UI2A 3JUZA 1E27B 2B1AH 3BSZH 4U6XB 2GYSA 1PFCA 2C3XA 5EZIL 1G9NH 3GSQA 1JWUA 2DYPA 4HBCL 2C3GA 1EFXB 4XVTL 1T2XA 3WUZA 2R56H 1VACB 1BMGA 1T5WA 4L8BA 5EDXA 2Z91A 3P4MB 3KVQA 5CWSA 4KK6C 4CW1B 3O6KL 3DSFL 2CKBH 3QUYC 3I85A 2R23B 2H1PH 4UIKH 3TVMC 1LNUB 5IOPA 1MRFL 1LO0H 4K8RC 3VGEA 1OY3B 2WIMA 1RAMA 3JVGC 1MCFA 4P4RA 3REWA 3B9KB 5GGRA 3WFDH 1U2CA 3QDME 2R69H 3O11B 1ETZB 2PTUA 1KCKA 4YR6A 5HYSA 1BZ9A 4F7CB 4Q97A 4U1HA 4XMLL 2W9EH 1X44A 3BO8A 4KRPC 3CDFA 4OKVA 4PUBH 5BW7C 1CLYH 2VXVH 4URTB 3TH4T 3T4YB 4XC1L 2NZ9D 4U3XA 5L9DL 4KROD 3WHE1 1G0XA 4DKEH 1LD9B 2Y07L 1U8NB 3U9PH 2JELL 2R2BB 2ZOKB 5FV2A 5DJDB 4DVRL 4PRAA 5D7IF 4W6YB 3GJFB 3GGWA 1Z9LA 2HWZH 2YD9A 2R4RH 4FQJL 5T1DL 4MNQB 1IKNC 2EIDA 3ULVL 1KPVA 4JFDA 3M17A 5J9PB 1IGML 4YC2B 5DFVC 4ZUTA 4QRRB 4WI3A 2GITA 1M7XA 1QLRA 1WFUA 1OSZA 1X3DA 5K9QG 2X4SB 4LLUB 1AI1H 3OKNA 4CMHB 2CD0A 5IEHB 3GJEB 3SDDC 4D0BB 4EXPX 1K4CA 1HE7A 4MCZB 2J6EA 2VAJA 4U31A 4YBQC 5D9SB 5CCKH 4X7SH 1JHKH 4NQSB 1YN6A 1JNHB 4EN3D 1LEKA 1C7TA 1BD2A 5H35A 1LGVA 1FZMA 2XWBB 2EDKA 4LIQH 4PJGE 5L8LB 5C0GA 2Z8VC 5F96H 3FO2A 3VXSE 3HS0A 2V2WA 1JK8B 3ZE1E 4PRPA 4P2QE 2WWMC 2HMIC 1S7QA 1ZS8A 4ZOEA 1JE6A 4NRZB 5CEYB 3E2HB 4P48A 1A9BB 4HWUA 4PYGA 3BZDA 2PW1A 2W9DL 4ZFFA 5F1OB 5IFAH 4F33B 1CTNA 4XBPB 3RPKA 4NBXB 3WS3B 3PXHA 5IJKA 5ENWA 3NTCL 4WHTB 4HCRA 4S1QL 1FL6B 3RZCC 4OZ4B 4LU5L 2YPLA 4LVNC 5K9KB 5IVNA 1U8OA 4TOYH 2ATKA 4XAWL 4ODVH 4GAYA 3O4OC 1E4XI 2QADD 2ZSWB 1WLHA 2XQYG 5CHNA 4O02H 2BNUA 3VGAB 4K94H 5DRWA 4EKXA 5TPWL 1YUHA 3OZ9L 1MVUA 5C0JB 4NQDB 1RK0A 1RZFH 2DQUH 1PEZA 2EH8H 3QEUA 1JGUL 2A74A 2GAZA 4IRSB 4NO3B 1NQBA 3MX0A 1T4KA 4ONHA 1BIIB 4OF8A 5FYJD 3RWJB 4KJQC 1OCWH 4MD5B 1PKQB 2YC1A 1A6AB 1ITBB 3NPSC 1R5IA 1AXSB 3VFMA 3IXAA 5EU6E 5DUPL 1I1CA 1F4HA 1OAXH 2IQ9H 2UWEB 2P42B 1L4IA 2D2OA 2GSIA 5DO2D 5F21B 8CGTA 3EJJX 3MUY1 1I9JH 4M6MH 4YK4B 3UTSA 1J5OL 4FMFA 2HG5B 4OFKA 2ATPB 4GAJH 4OM0L 3SKJH 4BK5A 4NOFA 3DX9B 2X4TA 4OB5H 3TNNB 4ONGH 4EDWH 5E2UH 5F1KC 1A4JA 3CZFA 3PDOB 3EYOA 3OHXB 1AD9A 4LLYB 3WUWG 1CDUA 2VLME 1BQUA 4NUGL 3QRFM 4PRHD 5DJZA 4HG4K 2IQAA 5IFJA 1DFBL 1C5CH 1LMKA 3PWUA 4YIQB 4Z0XA 1NANI 4FG6D 3STLB 3GZKA 4LPVA 4NRYB 4J8RA 1RJLB 4PG2C 1LWRA 2BDNL 3RAJL 3GMNA 3NFSL 2P44B 3HAEG 5HDOA 4BSVB 1I9IL 3ZKXB 1QPXA 5TE6L 5EOQL 3W9EA 1MH5B 5JW4M 2IG2H 1WEJL 4QYOA 5A40E 2RCSL 3ZDZF 3MUJA 1ROWA 5CGYD 1OD7A 5IB2B 1IEAA 4WI5A 3EDJA 3TO4D 1WBXA 4FFWD 4KK5C 3X12B 3RIAK 1BBJB 1UB5A 4JO3L 1AIFB 3DTXA 2EC8A 4TQEH 4ZUUA 5CBEB 3F7RA 4JRXD 1T20B 1AE6L 4K2UH 2FIKA 4Z76A 3ZTJH 4HWBL 5FYLL 3LQAH 1J0ZA 3O3BB 2AGJL 2R9HD 3MV8B 1FFRA 1U8LB 3WS6A 1MFAH 2Q7YB 3N1QC 3VD3A 5JOFB 2JJSA 4EUPA 5KVFL 2D7QA 4BH7B 5BRZD 3OXRB 2FLRT 4FRWA 1Q0XH 1E4KC 4ODWB 4ODUA 1B0RA 1MY7A 5F97E 4KPHH 3IS1X 2DJ4A 2ZUTA 3IFNL 5JW4Q 5LVEA 1S3KH 3OKLB 3PWPA 1I3UA 3WLWD 3V5DA 3RVUD 5E8DL 2ZJSH 2YZ1A 5C09A 3SCMC 5FYJE 5JDSB 4GW4B 3GSNB 2YMXL 4ZNCD 3KYOB 5FOBA 4XXDB 1X4YA 3BZ4B 4XNMA 1U8KB 4Y4KB 3NABL 1G1YA 3P0GB 3FN9A 1PSKH 4LEOB 4AIZB 1F5WA 3KPMA 4UU9A 4GMSL 3RUGE 2BVQA 3X13B 1NC2D 4E9LA 2WBJB 4GG6A 5JR1L 3P4NA 2AXJA 2HLAB 3ARPA 1SQ2N 3WKML 1K4DA 3KPSD 3TV3H 3O2WL 1LP9E 1P1ZB 1S9VA 3IVKB 1UYWH 3GKWH 4Q9RL 4NZRH 3QSKB 4G3YH 5DJXA 1DEEA 4L29A 3RWDA 4NJ9H 2BMKB 2NY6D 3UDWA 1A9EB 4ZUWA 3GB7B 4ZTOH 4H1LA 1Z0MA 3CMOH 2G5BB 1MRDL 1WCQA 1MAJA 4PRHE 4JGUA 2BNRD 3EDDA 3MO1A 5E6ZA 5IK3B 5E6YA 1QNZH 1VEMA 1J0YA 5T5FH 3RA7L 3B4NA 3S36X 3KPTA 4F7EA 2R4SH 4R4ND 1EEYA 3NIGF 5KTEH 3C2AH 4P23B 4KDVA 5IW3A 2RJMA 3ULUH 3RI5F 3PDDA 3KYMB 1D5BB 1YY8A 3MROB 3QAZB 5MENA 3UZVB 3QI9C 4LOUC 3MPCA 1H3XA 2I07B 1S9YA 4PP1D 1II4E 1GHFH 1J8HB 4L3AA 4J3SA 5IESH 1T66C 1ZMYA 5TH2B 3TA3C 1TJHL 3MGOA 4NKIH 3UPRA 4NQXA 2XA3A 1LQSR 2WUBH 2YBRA 1WZKA 3OJ2C 1T89C 1EERB 3KPNA 4JRXE 2IBBA 3BGMB 4L4VB 4HGKC 2CRMA 3GMOB 1H3PL 4DKAA 1PQZB 1U91B 4MCYA 3FCTB 1SBSL 1C16B 3VGHA 2NXYC 3DWTA 5DXWA 2O5YH 3V5KA 4YHIB 5FUZL 1IE5A 3MXWL 3BD5A 1MSPA 2X09A 1RV6X 3MJGX 3L95B 1YQ2A 5H37H 5T3ZL 1D6EB 3VFSB 1QSFB 3MBEC 2EIZA 5HGAB 1XGYH 1L7IH 1R5WB 1C1EL 4I0PB 3QA3B 2ADGA 3U7WL 4NGHL 1QHPA 3ZDYE 4K3EL 1XF5B 4TUKH 3LEVL 5FAAA 1N59A 2J8HA 4X6DF 2F74A 3ARFB 1FORH 3CCHA 3LMJH 3EZ8A 4LCWB 1A14L 3FN3A 2IPUG 1BWMA 5E8EB 1MEXL 2LVEA 4DGIH 1F3JA 5D70H 1DQLL 2NY5L 1ZHNA 3BQUB 4XCEA 1N5YL 5IVXF 1OPGH 3BE1L 4NP4L 1KEGH 2N56A 4KRMB 4KDWA 4L5FL 4Y2DD 5DJ8A 4RQQA 2NTFB 3O2DL 2APFA 1C12B 3LSOB 1A7BA 4I2XB 1QBLH 2COQA 3D9AH 1OOAA 5EO0A 4LSDA 4DEPC 2CUIA 5GRUL 2NYYC 2XFXA 4HS3B 3ZT6A 2NW2A 3G5ZB 2C5DC 2QQKH 1QQDA 2HTKC 4NM4L 2FO4A 2NCMA 3Q1SL 3TYFB 3VH8G 5DD0L 1AHWA 4FZEL 4P2OA 3D69B 1MY5A 3GSVA 1CT8A 2BK8A 3D3VE 5TJWK 3MODL 5SX5K 2A83B 2VDQL 3MRIB 4LVEA 4NCC2 4F15C 1NGXA 3HUJB 3VXUD 4J12A 4HLZH 1JGLH 1TTFA 1QVOA 4Y0GA 3M45A 3ZE0F 2X9YA 4BFBD 3NH7L 5C0EA 3FB7A 4MJ6A 5DVKA 4G8IB 1I7TA 2A73A 2DD8H 3E3QC 5HYJA 4K7FA 5HVHC 4PJ8B 3CVHH 1YEHL 3KNBA 1K5NA 2LTQB 3IFOB 4ZUSA 4XP5L 3TZVA 3AC0A 5GS0H 3JZ7A 1CL7L 1I4FB 4XT1C 4JM2A 3IDXL 4XC3H 2WUCL 5HYQB 4BZ2L 2HVKA 1HI6A 3NMEA 3EAKA 3NZHH 4WCYL 5IFHH 4UOW1 4KUCD 3K4AA 3LAFA 3MLSH 3TBWB 3DIFB 4UILL 3FOLA 2QJDA 1S7XA 4KZEH 1JNNH 3JTSA 1IGTA 5F93C 4A2MA 1U93B 3WN5A 3WXVH 5GGSY 3ZSTA 1XGUA 5BQ7B 4OGXL 3D25A 2V7NB 1KB5A 2DTMH 5E99L 2VABA 1N6UA 1NDMB 3H6JA 2H6PA 3PL6B 5BV7L 3ULVD 2AEQL 3O4LE 5B38A 4PRNB 3SDCC 5F7DA 5IV2B 2ARWA 5C0CB 2AK4B 3QZWG 4M93C 4CBPA 4K8RH 1G9ML 3G6DL 2Y36L 5DJAB 2DLGA 2YD7A 4OLXL 4K3DL 3S37H 4YDLB 4HW6A 2DTSA 1MFCL 1RY7B 4WFGD 3NAAL 3RDTA 5I1AA 3MRHA 5D5MF 3NCFB 5BZDB 4BELD 4QRTB 1CL7I 2V2XA 3PNWA 3PIQB 3JSSA 3V4VH 1J1PL 5C08E 3QQ3B 1OWWA 4KVCL 3UBXI 3QUZC 1J87A 5F7HA 1DN0B 4DFHA 4ONFL 2BHUA 3LKPB 3QUXC 4X6BB 4U6XA 3F7YB 2X41A 5ICZB 2X4QB 3SDCD 1QFWM 1OF2B 4WW2B 1SM3H 1E4WL 1EFXA 1F90H 5E6ID 4TNVK 5IM7B 4N1EA 1F8TL 5D1ZD 1BX2B 3CVHB 4P46D 4MA7L 1WFNA 4Z7VE 1HILB 1VACA 2CUMA 1SY6A 3P4MA 4EJ1C 3PQYD 1PJ9A 4CW1A 2QSTA 1L6XA 1E0OB 4UV7L 2R23A 1UB6B