1SJVA

Three-dimensional structure of a llama vhh domain swapping
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
102
Chain Sequence
GGGLVQAGESLKLSCAASGGFMGWYRQAPGKQRELVATINSRGITNYADFVKGRFTISRDNAKKTVYLEMNSLEPEDTAVYYCYTHYFRSYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Domain swapping of a llama VHH domain builds a crystal-wide beta-sheet structure.
pubmed doi rcsb
source organism Lama glama
molecule tags Antibiotic
molecule keywords r9
total genus 15
structure length 102
sequence length 107
ec nomenclature
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sjvA00
2XTJD 1C12A 5KW9H 4WCYL 4R6UA 1CF8H 4QRRA 5HSFA 5J4MA 4BQ8A 3DOSA 1UB6A 5F1SA 4LHQB 3M1BB 4LSSH 1AR1C 1T04A 1UEMA 2B2XH 2Y36H 3K81A 5IFHH 2FJFA 1XIWC 1I1YA 1Q38A 3QO1A 4TSCL 1AHWC 1DQLL 2NX5E 4NZUL 3PWPD 2ZG3A 5EN2B 1S78D 4EOWH 2N4IA 1X5ZA 1A1MB 3CU7A 4GXUM 4BYHA 1CDUA 5HDLA 5E2WH 4LPYA 3ZE1F 2ZUUA 2IBZY 2X4NB 3RTQC 5IB2A 4NT6A 3UX9B 3OKNB 3VRJB 5FXCH 4G8IB 1HE7A 5JUEL 1FIEA 3RZCA 5E6IA 1CDHA 1V5JA 3KPRB 2ITCA 2YD5A 4X9IA 8FABB 4HUVB 2I5YL 5C08A 2C3WA 3BPCB 4QYOB 2FJGB 1JVKA 3HKFA 2NXZB 2DN7A 4WO4B 2VLRA 3VXSD 3WJLA 4MD4B 1I9RH 5IMMB 4KTYA 3SGKC 3MGTA 3LKSB 1H3VA 4DOHE 3V5KA 2DDQL 2L7UA 5J11B 5C3LD 3IFOB 3HC0B 5C0AB 4BKLB 1CDIA 1QRNE 1YNTA 4JREC 4ZOCA 4JANA 5E2VL 4UNUA 1XGYH 1JNNL 3X12A 1MCSA 3HS0A 4LKCB 2CO7B 2FIKB 3BQUB 1T21B 4X4XB 1E4JA 5D70L 3BI9X 1OAKL 2Y07L 1S7QB 1Q72H 4R2GD 3CD4A 5KANI 5FA4A 3CFKA 3IDXH 4JKKA 3U0TB 4NPYB 3OBAA 4L5FH 1D6EB 4MX7A 4PG9A 1R0AL 2DQUL 3PP4L 5B8CC 3CLFL 4HIEB 5J56B 3MV8B 4QGTA 4XNUH 5ANMB 1GYAA 4LCCB 3DGGA 5DC9B 3RL2B 1OAZL 5AD0B 1JPST 4LSVL 3L6FB 4PJ5B 1EHLL 1T89A 1Q9OA 1F6FB 4QXUL 2BXZA 5T1KB 5C0BA 4NRZA 3EW3B 3GSRA 3V6BR 1BZ9B 5GS0L 2B1AH 4FN0A 2M8XA 2YMXH 5IESL 3VXMA 4PGBB 4MXQC 1CU4L 2BFVH 1IGMH 3FB6B 4YHKH 2EKSB 4XBEH 4MAYD 3WS3B 5F7HA 3VXTA 1J0YA 4WI9A 1J9CT 2E7MA 4MDJA 3NBNA 3D18A 5C0RH 2H1PL 4LSUH 3TN0D 1F02I 1NPUA 4JFXA 4U3CA 2OYPA 5EOCH 4YGVA 4ODUA 2X4TB 4I9WE 5C0GB 1YC8A 5J6GA 2AKRA 4J3XA 1GHFH 5IK3A 4B53A 4FTVA 4F57H 4M02A 2XWTB 1YPZB 4UI2A 2BVQB 2C1OB 2X1XR 2BNQB 3LPGA 2DTSA 3T2OA 4OLWH 1D5MA 3INUH 1VGEL 3QIWA 1BWWA 2OZ4H 1FSKC 1N7ML 2W0KA 3B3IB 2XZQH 2BNRE 4AQ1B 4G9DB 3KPMA 1RULH 3PJSA 5FAAA 1LO0L 2QQLH 3NIDF 4MJ4A 1KCRL 1A7OL 2HJLB 3S34L 2EIZB 3L9RB 3RNQA 4WWKA 4ZXBB 3VFOA 1MWAB 4XPTH 1T7YA 4HK0B 4XWGH 3TJHC 1PSKH 5D1XD 3QDGA 4X5XB 4PJFE 3K2UL 3U46A 5FECB 4XHJD 2JB5H 2DWDB 3MV9B 4XNZC 3O6MH 1KN2H 2OTWA 4HMCA 1FFPB 5FYKU 2EZ0D 5TQ0H 3MOBL 3SGDH 2AXHA 3DRTA 4P3DB 3TA3B 2R4SH 2QQKH 1CD9B 2C4XA 4PG2C 5HI4C 3K1KC 3ZKND 4G8IA 1JGEA 3AGVA 2G5RA 2NCMA 4PJAE 4K9EL 2VQ1A 4BQCA 3WJJC 5DTFB 1S7RB 4E41E 3OKKA 3F7QA 4PD4J 4OM0L 3SGKA 1I7ZA 3QWOA 4XNZB 1GOFA 4DK3A 4NDMB 3MREA 5KTEL 3PL6C 5FUCC 2FEDD 1IQWH 1FNFA 3V5HB 4D9QD 4OGZA 4CVWA 1IC7H 3LQZA 3PP3K 1QP1A 4JKPH 1NFDA 1MWAA 5D4QA 2H41A 3E6HA 3NFNB 4MD0B 3L3HA 3MLZL 3ZO0A 2A6JA 4KI5F 3TJHD 4OB5L 2ZPKH 4L9LB 2V2WA 2BRRH 3EYSL 4LAQH 3IDIB 4XCEA 1HDMB 2MCPH 1QKZL 3TNMB 1ONQA 5ENWA 4U6VH 4P3CL 3LPFA 3LRSA 3P4NA 5HPMA 4UIMB 4P2OA 1BQHA 1UACH 1FNSL 1UJ3B 3QRFM 1DCLA 3CSYA 3KPSE 3LV3B 1V8HA 3I6GA 3DMMA 3V4UL 1Q9KA 3TT3L 4IOSD 3EOBA 4MB4A 4ZFFB 2W9DH 3PHQA 4WW2B 3WIHH 2CDEB 3CZFB 1Z3GL 4PLKD 2XTJB 3KPLB 4KHXL 3TPUB 5IQ7L 3LN5A 5C0ND 1LNUB 4XWOC 5J6HA 4HGMA 3L95A 4JM2A 1CZ8L 4NUGL 1A3RH 4HUNB 3TWCH 3WL9B 2I60L 2OR8A 3FFCA 5EC1A 1ZLVH 4LCIL 3KGRA 5FYLL 4QRQB 2C3VA 3NMEA 7CGTA 5DQDL 5FKAB 3G08B 1Q9LA 1D5BB 1YUHB 2WP3O 3IYLW 3U30C 4FQHB 1U8JB 1FJ1B 5E99H 3L3OB 2Z8RA 2O5YH 5JHLH 3L3JA 4BZYA 4QXTA 2P7TA 2D7NA 5F89B 4QY8B 1RZIA 3H42H 4I0PB 5J89A 1TTUA 3WIFA 3Q5OA 1B90A 1FPTH 4NYLA 4OFKA 4ZSOE 32C2B 1D9KA 3ZL4H 1WFUA 1HHJB 1HSBA 4D0DA 4APQC 1NC4D 5JOFA 2QHRH 3RA7L 4JKLA 2AABL 5C08B 3BWAB 2BMKA 3LIZH 3QUMB 3MJ7A 5GGTL 4FQ1H 1FZOA 1CBVL 2XA8L 1FVCA 1WWBX 3OAZK 1DBJL 2K7QA 3VXRE 2QQNL 5GJTH 3D3VA 4G6FB 3MODH 4FHBD 2JCCB 3WO3B 4H0HB 3C6LA 1G0YR 1H5BB 2EO1A 2FH6A 5CFHA 3G5XB 1CD8A 3QXAA 3WN5A 3RX7A 3SKMA 1FV1A 3CFKB 3QIBA 4HIJA 2ZCLL 3H9YA 4NJAL 2VQ1B 5EWIH 4ZUVB 2UVFA 1KPUA 2JCCF 3L3IA 4KRPB 5LG1A 3MLVH 5IMMA 3F58L 5DLMH 1JTPA 1T21A 4JO2L 4BFGA 4FZ8H 2CLZA 3BP6A 5IKCB 1IAIL 4ORGB 3EUUA 1DLFH 1CGSH 4GS7C 5DURB 3WE6B 3ZLQC 2AQ3A 2ICWJ 4CNIB 1WBZB 1IM3B 4GXVH 5H37H 3UC0H 1DQMH 4W4OA 4IRJA 4MAYA 2HT2D 3IVKB 4JRYB 1KC5H 4MQTB 3TJEL 5ACZA 3DTXA 1I85A 3WEXB 3ULUE 5IV2B 3MJ7B 4PJXF 5IB1A 3QUYB 2B4CC 3GSNB 4G7YL 1JGUH 4OLUH 3AMKA 4YX2L 4MMZC 4QRSB 3TBWA 2VLJE 1NAML 3KR3L 1DL7H 1F11B 1U3JA 3UTSB 1D5ZA 5IVNA 3MRJB 1AGCB 3H3KA 4TSCH 4HUUA 4PRHB 3KLSA 3ULVE 3R8BB 3CFEB 2AK4D 2Y6SC 4G42B 4I3SL 1JFQL 2BC4A 5DD0L 3RHWK 5FO9B 5I9QC 3FB7B 3IXTB 4FQ2H 3MJ8B 4OJFH 2A0LC 1XEDA 4OLXL 1PYWA 3P9WB 4FZEL 4R7NB 2NY0C 1SY6L 1NFIB 5CP7B 4N0YL 4XB8A 1U8IA 1EGJA 1AXTH 1UKQA 4G8FB 3ROOB 3FCTB 1WC7A 5H94A 1KB9J 1I9IH 2A6IA 3OKDA 1RK0A 4HUKB 4U7KA 4WO4C 4QRRB 4H0IA 1RJYB 2F19H 1CBVH 2P5WE 1P5VA 3T0EA 1P69B 1DFBL 4KJQC 4LLWA 4PJGF 1RZFL 1E0OB 2IPKB 4R4BA 5ILTL 4KY1L 4LSQL 1XZ0B 4RCAA 3CGTA 4MNQB 3VFVA 2EDHA 4G42A 5F3HA 1MUJB 4NOFA 2CIKA 2AJ3A 3EYVA 4W4OC 2Y07H 4YAQB 4XMPH 1MAJA 4NO3A 2FBJL 5J9PA 4FQ1L 4U3XA 5C08D 5EA0H 1JHKL 3T0BA 4C59B 2ADFL 1EEYB 3BQUC 4HT1L 2R0WH 2W60A 4ZNCD 3WXVL 1UQSB 4AEHL 1C5CH 1MVUB 3UAJC 3BP4B 4Z7UF 5F88B 1DBBH 3DARA 5CJ5A 4YFDB 5JPMB 4YFLI 3TZVD 3GKZA 4NC1E 1MFEH 3ZYOA 3FAXA 4TVPD 4K71B 3WJLC 5E03A 3PWPA 5C7XH 4HF5H 2X7LB 1U41A 5DHVA 5L6YH 3CMOH 1YECH 5JHLL 1RY7B 3C6SB 2EO9A 4RNRA 1KFAL 3G5VA 5DHVH 5TH2B 3H2WA 4UU9B 2R2EA 3FRUB 4PRID 4TUJA 1MCDA 2NLJA 4RWHA 3G04B 1S7RA 2D03H 4AIOA 3GSWB 3EFFA 3QPQD 4GRLC 2WINB 1WAAF 3IFPA 5DHYA 1YN6B 4EI6A 1FZOB 4NQUA 4P2OC 1X5HA 3QISA 4NUGH 4XC3H 1ZHBB 5CCKL 4WHYH 3GMOA 2DL2A 4P99A 1CN4A 2V7NB 4PGDA 5LBSH 4KJQD 3CVIH 1RURL 4R0LB 3LEVL 4TULL 4YDKL 2RBLA 3AROA 3LS5L 4OBRA 2WV3A 4Z7VE 5FUZH 2YHGA 5IEHB 1YN7A 5CD5C 1AY1L 4MVBC 4YHZH 1GH7A 4WVRA 3VDAA 4NQCA 2E6QA 4POZC 1MEXH 2NMSA 1KSRA 5DTFA 1FN4B 3VJ6A 3MRBB 3V6OA 3B5HA 2DLFL 4P57A 5L2JA 1G6RH 4GG6F 4HZLB 1I3UA 3FB8A 4NQEB 5FYJE 2AP2A 3LEVH 4TULH 4JM2C 4QO1A 4Z5RA 3W9EA 4ZAKD 1R3LB 1KJMB 1TJGH 2G5BA 2ZOLA 4NO5A 1DTUA 1JPFA 4KROB 1YDPA 3UO1H 2VL5A 1IQDA 3G6AA 5HI5C 1JF5A 4LAQL 1FCCA 1YEJH 4HCRL 1MHCB 3FFCD 2FB4H 4QXUH 5C0EA 5CGMA 1DLHB 3IF1A 4XP5H 2ZG2A 4FTVB 1IRAY 2ADGA 1YNLL 2EE6A 3NAAH 1F4WH 3TBYB 4Y8AA 3HZKB 1HOCA 1D9KD 4HD9A 5C9JB 1U58A 3VFNB 3PWPE 4R2GC 1NCWH 1XF5A 5K9OA 1QLRB 1UJ3A 2J5LB 2Z93B 4FFVD 3D85B 5IBTL 3M8OH 1NAMA 4P59H 4M6MH 3TT1H 5AAWA 4S1SL 5BS0D 3L95B 3C9NB 1I1AD 4IDLA 1ERNA 3HAEG 4OSUL 4V2CB 4C56E 5KSAC 3AXLA 2IBZX 2IADB 3O4LB 3MACH 2YA0A 5CJOH 3QUXA 4Z7WE 5T1MB 1RZ7L 1KIRA 4YBQD 3HAEB 1XR8B 1TQBB 3KS0J 3VXSE 3T2PA 5D1ZB 1T03H 4MJ6B 4RSVA 5FYKD 5I1IH 1QEWA 4LCIH 1GC1C 2OSLA 1BEYH 3C5ZB 3WFEH 3LPWA 3V7AG 3W2DH 1QZ1A 1P9MC 5C0BB 5I71C 2PYFA 4G6FD 1X5LA 1FHGA 3HZKA 4D0BA 5I1EH 4L9LC 3DGGB 5DUMH 5HXMA 4JFEE 3TN0C 3HZMA 1GAFH 4LPTA 1MCWM 3UDWA 3VA2C 4KJPC 1W8NA 3TBTB 3K7UA 1ZHKA 3GMPA 4TUOB 1QHPA 1S9VA 5EBMB 3L5XL 1ZVSA 2A9NH 2FHFA 1TPXB 1EFQA 2NY6D 2ZSWB 3A0OA 3C08L 2XN9E 2XTJC 3RWEA 1QR4A 4TN9A 2DM7A 1CFQA 5D1QA 5IBTH 1WEJL 5CJQH 4JFFA 3CFCH 3KR3H 1KXTB 4Z0XB 2GKIA 4XTRD 2B5IC 2BZDA 2EDNA 1JTOA 3IFPB 4OIIH 2DI9A 5DHYB 5DUPL 1SJXA 5IESH 3BZ4A 3E3QE 1YEDA 3FN0H 5B8CA 3ULVH 4OB5H 4R9HA 1LK3L 4LNRA 1YMME 1P7KB 5DRNB 5D1XC 3WBDA 4H8WH 3WIIH 2DQEH 3FO0L 5HDQH 4CADB 1IAMA 5CHNB 3GRWH 1KCUL 2GY7B 5D7LE 3SJVE 4OD3L 5DF0A 1YN7B 4YDVB 1ZHKB 4PJCE 3QDGD 3U0WL 4U1LB 2RAMA 1FL5B 4PTTB 2VZSA 4Y5VA 5E9DD 3U4AA 1RFDL 4LRIA 4OD2A 1DEDA 3HZMB 1X5GA 4YFEA 5D7JC 1K3ZA 3DXAD 3WIHA 3MV7E 2UV3A 5LGJB 4XCFH 3J7HA 5SX4H 4A6YB 4R0LC 4L29B 4UBDC 4WV1B 2IANA 4OM0H 1ZVSB 2X44D 4KJYA 5DO2D 4JY4A 5D7JA 5C07D 4DVRL 4KJWD 4UV4H 3BW9B 1KJ3H 2UY7A 5EU6B 3WUZA 3VE0A 4JM2F 4Q9QH 4JHWH 2WWKO 1RHHB 2MPAH 1QFPA 1ZS8B 2GTWA 2PO6D 4U6YB 5DJ2A 2IFGA 3KYKL 3T8XA 5AZEH 1XZ0A 1XGPA 3MLXL 1CDJA 1S7XB 5EZOH 2V9TA 3ARDC 3DV4A 1ROWA 4XPHL 2BJMH 3UBXB 4ZS6C 3WHXB 4MB3A 3DRQA 3QQ3A 5FYKE 5E4IA 1MI5E 3H9HA 4YDJB 5JTWA 4YHMH 5KSBB 1H3WM 3QUXC 5E70A 5LAXA 1GXEA 2A6KA 3PQYE 1L9NA 2HFEA 1LHZA 4G9FB 4LQFL 2AEPL 3P2TA 3H7BB 3TZVB 2BCKB 5I66A 4Y1AB 3SE8L 4DKAA 4CJ0A 2FSEA 5I1GL 3UZEA 3SKOA 4M4PA 4MA3A 3O6KH 4MX7B 5HY9A 1IMHC 5A2FA 5JLZB 4K94C 5EZJB 5CJBA 5FUZL 3VXTB 2A6IB 3PL6B 2IBBA 1BQLL 3HZVB 5I8OH 5D2LE 1UA6L 1S7XA 2XZCH 2EDRA 3AREB 4JHZA 4ORZC 4JRXB 5EU5A 1P4LB 5T1KA 4NRZB 5BXFB 5IK3B 4AMKL 4P5MB 2D9QB 1WUNT 3GIZH 3MBED 3D39E 4MNGA 4R90L 1CI5A 3BEWB 3RVXD 4UV4L 1DQLH 5ERWA 3SKJH 2XICA 5GISL 3PIQA 1FV1B 1KELH 4YXHH 4PJXE 4HMEA 4MAYB 3V52H 4G8EB 4WGVB 3TV3L 1NEZA 3LEYL 4ONFH 4IEFB 1B3JA 3CMOL 4RAVA 1OOAA 1X3DA 2CK0L 4B0MM 4B41A 4UDUA 5INCA 2OP4H 1CLYH 4MJ2A 1R5WB 4Y2DB 3OPZH 1AKJB 3MRKA 1S9WA 3L3DB 1D5ZB 4QXGL 4Z7QE 3QT2A 2YS4A 1JK8A 4PGDB 1JPGA 4PJXA 2YD7A 5TJWK 1DQTA 5B3JE 1H3PH 4PRBB 4XNUL 3V52L 2A83A 4MA8L 3WNKA 3BT2H 4PRHD 4L3EB 1UFUA 2VN7A 2OZ4A 1FORH 5F7DB 4NQCB 1IM9D 3L3JB 1O7SA 1PG7H 1R3IH 3QDAA 4HK3N 4O2FA 1I8MA 3BEWA 3LKSA 4L8SA 2VO5A 1WWWX 5FOBA 4OKVB 4PP2A 1BZQK 4APQD 3FT4A 3LZFH 2CLVA 2CRMA 32C2A 2V7NA 3BE1L 1MFCH 2D7QA 4LPUA 4MCZA 4WFHD 5IMOA 4HJJL 1SEBB 1D7FA 2GAZA 4KPHH 3V4VH 4QTIH 3DVFA 3LKNA 1AHWB 3O6KL 4QRRD 4RFNB 2P5WB 4QHUB 5KVFH 4CN1A 4D9RE 1FLRL 1OW0C 1A6TA 1FLRH 5HVHB 5D72L 1BQLH 5I8OL 2GQHA 1ETZA 3KWWB 3QDJD 4KQ3L 4XMKH 3QUMA 4QF1B 1ES0A 4OCWH 4OGYH 4K8RH 4KROC 3VD9A 5BQ7B 1NGXB 4Y16C 3WYRA 3GJEB 1MFBL 4L3CB 4P48A 5J1AB 4TRPH 4R96A 3V0VB 5L2KB 4WW1A 2YRZA 2K9UA 1BEYL 4P4KC 4LIQL 4P46B 3O11B 1IGIL 3U48A 2A77L 1ZMYA 2Z31C 5FUCE 5BS0E 2Q87A 2OJZL 1BJ1H 2OJEA 4M48H 3ULUL 1JMXA 1RV6X 5GJTL 1I3VA 2KQMA 4UTBH 5C2BH 5J13C 5KAQF 1FNGB 1WSST 4LFHG 1IFHL 1UT9A 5GGSB 1K2DA 2Z35A 4YBLB 1J1PL 1NGWA 4P2YA 3VRIB 1R5IA 3TESA 3KDMA 1Q1JL 5F71A 5DWUH 4KRPC 2VLKD 1XIWB 3WFBL 1PW3A 5IGXL 5ICYB 1KB5H 3DECA 1F4AA 5SWZA 2GAZB 4UAOB 1QKZH 5ID0B 1FORL 5HY9B 2HRPH 2OTUA 4HV8B 4YHNA 5KSVA 4R97C 3ARDA 4PLKC 5I15L 3GJFA 1J0ZA 3OR6A 4ODTH 3D69B 2YD3A 3BJLA 1G7IB 2GSIA 4XP6H 5DMIL 1ZA3B 1BQSA 5GZND 4NWUL 5C6TL 1MHEA 1F3DH 2EXYC 5IW1B 3TA3D 5L7XL 1T1WA 4QRUB 4RQQA 3FKUS 4DUVA 4PY7B 3MRQA 3QQ4B 5EIIA 3RVTD 1WBXA 4N9OB 3THMH 2AJZA 1XCTB 5DMKA 3STLA 1QLFA 1I8LA 4UAOC 3ZTJG 1CDGA 4XNMB 5JOEA 5D1QB 2ED8A 1K8DB 5JZ7C 1PZ5B 5D9SB 1U92A 3B8YA 3DROB 1CIDA 2NQCA 4MDIA 3S36L 5IJVA 5CEXB 2I9TA 2D4DA 2CK2A 2ZUQB 5I8EB 1CD1B 3QHTC 4K94H 3X3FL 1OARL 4CGTA 3Q3GB 1NCCH 4JZJC 4OM1H 4A2MA 1BVKA 2W0FA 3G5XA 5CILH 1OP5H 5I17A 2OTPA 5GGTA 3QDJA 3L1OL 4Z0XA 4TNVF 2F5AL 5T5NF 5HGHB 5EU3B 1U91B 4PJAF 1OAKH 5HYJB 4P46C 4G6KH 1NSNL 3KPSD 5D2NA 1RIUL 3OHXB 3HB3C 4XVJH 3MCKA 3IRPX 4QRPA 1DSFL 5FF6A 5IM7A 3RKPA 3QCUH 4NDMA 4E41D 1WCBA 1ZT7A 5HHNB 5DJXA 1G9ML 2HJKA 5FOBB 1UCBL 1VPOL 1QBLL 1YQ2A 3OKMB 5D2NC 1G9MC 4K23H 3EO9H 3JV0A 1NKOA 1EK3A 1K8DA 1A14L 3RI5K 4ZFOA 1T6WA 1FVCB 4I77L 3EYFA 2RR3A 5C07E 1D5IH 3RWIA 2X89D 2IADA 3O4LA 4C56B 4XPHH 4IS6A 1SQ2N 2OZ4L 4EN3B 4R4FH 1QSFB 4MDJB 4FQJL 1BD2B 4RGND 3NZHL 2V2XB 1CK0L 1UKSA 4LKXB 4J1UA 3VXOA 2MHAA 1MCBA 1A3QA 3G6DL 4I4WB 5F7YC 1XF4B 1TMCB 5CZXD 4Y5XC 5C6PB 3BT2L 3MA7B 3O2WL 2A6DA 1EBAA 4JY6B 3ZYIA 3BPLB 1G6VK 4JPWH 4HJGA 2EIZA 5BRZE 1OTSD 1F4HA 1VHPA 2WWMC 2DS4A 1RHHA 2XNAB 1CK0H 5ID1B 4ZFFA 3ZKXC 3SKNA 3PP3H 4KKBC 1P53A 5KSAA 1EVTC 5CEYB 3RVWC 1DANU 1CL7I 4NQVA 5JO5A 3MA9H 5HHNA 1CT8A 3RWGB 3TWCL 1A3RL 3NCFB 5FA3B 3LKPA 1AO7B 4JDTH 2FL5B 1HCVA 4FMFA 4L8DA 4JAMA 3U4EA 2R69L 3G9AB 4L8BA 2DLGA 3EO9L 5I1AA 2QSTA 2Q3ZA 3SKOB 3PP4H 5F3BB 3IDUA 1RJLB 2NW3B 3CMGA 1D6EA 2K7PA 1T80A 1NC4B 4UDTA 1U9KA 1YYLL 1ZHNA 3TT3H 5HGBA 3OXSB 4RGMB 2ESVD 1IBGL 3OGCA 4YWGH 1NQBA 3CX2A 5L9DL 4XPFH 2MHAB 2ADJA 2YBRB 3KXFE 3HG1E 3N85H 2VABB 5C0JA 1LP9A 1V7NH 4NC0B 3SN6N 5GRZA 1A4JA 3CDGA 4J3UA 2J8HA 4PB0L 3HZYA 2IPTL 5D7SL 3MREB 4OCYH 4YZFF 2J8UA 1OD7A 3IETA 4MD0A 1FAIL 4LLMA 4G6JH 3N1MC 4TRPL 4LP4A 1UZ8A 3RWFA 3TZVC 3BPNB 3S5LG 1PZ5A 1EGJH 1QFHA 4PJHF 4YC2B 5EB9A 2LAAA 2FCBA 2GTZB 3MXWL 5C7XL 4HWUA 1T22A 1IKNC 4WW2F 3WS6A 1ZHBA 1OAYL 2XTLA 2WLZA 5INCB 5JW4M 2BNQE 2AEQL 1TQCB 3IFNH 3MV8D 4MHHG 1OARH 12E8H 1H9VA 2P5EB 1DBBL 3QDJB 2EYRB 1I9JL 4NWUH 1I8KA 1QSEB 2NTFA 4PRNB 1J5OL 1FL3A 2A83B 1BZ7A 3IKCA 3V0WL 2EDEA 1E4WL 1MCOH 3OXSA 3C5SA 3RVVC 4F7TB 4J2XA 3MNWB 2OX5A 3O45A 4JR9L 1ZGLM 5JQHC 4ONGL 5AYUH 3S88H 5FGCB 2YSSB 2EDOA 2HVJA 4ACPA 2B4CH 4WU5B 2Y72A 4LCWE 3VXME 5GS0H 3NN8B 1Y0LB 2HJFB 4XNYL 5E7FA 2VKWA 3RAJL 4ELME 5C0NC 3HR5A 3P0VL 4K3EL 2NXYB 4H88L 4H1LA 2VWEE 4TVPL 4X5WA 4Y19B 5JIHA 5DHXB 3D25A 3QDGB 1LO4L 2OJZH 2H3NA 3LKOB 4X5XA 4CMMA 4G43B 4CJ1A 4HIHB 4E9LA 4OIAA 4QF1A 2QR0B 3MCLH 4FZEH 1ACZA 3ILQC 4P5MA 1JGDB 3JV6A 4CMHB 4HKBB 5DQDH 4M7LT 4Y5XA 5GSRB 4M3JA 3OR7B 3W5NA 4MXQD 5I74B 3OJ2C 1CE6A 1G7QB 3W0WB 1J0IA 4JY6A 1S7WA 2IPUK 3ARPA 3TV3H 2AXGA 1IGJA 1DE4A 4NJ9H 4U1HA 1U8KA 3NPZB 2VLJA 4CUCA 4MHHI 1BIIB 5A16A 2CXGA 2QV2A 3FB5A 1CLOL 4PJ9D 1OPGL 4ZSOB 4NKIL 1X5XA 4O4YH 3JWOL 1AY1H 3C8KA 2D03L 4JFDA 3FQXB 4F2MB 2JELL 4EI5A 3T0VA 1ZGLB 1BFTA 2XZCL 4DJMA 1J8HB 2ARJQ 4Z8FL 4CMMB 4YGAB 2IFFL 3P77A 5C0RL 5JW4Q 1B0RB 3BHBA 4NJ9L 4J3OC 1IAIM 3VXRB 4Y7MA 1T89C 1MHPL 4JE4B 4XBPA 1SM3L 2JCCE 4C54A 2AJUH 2KZWA 1IAIH 1LD9A 5T1DL 2C7UB 4LGSB 5IBLC 1U8OA 2H6PB 3QUXD 4L3ED 1BM3H 4TVPE 3CK0L 1FBIL 1QLRA 4HS3A 5GS1C 4KFZC 4MA7H 5BS0A 3ILPB 2ICWI 4XHJC 1HYSD 1U91A 5E9DB 1UVQA 3DTXB 3TFKC 2GJ6B 4RDQG 3MUGA 4M1CD 4L8SB 3WEXA 5D2LA 5D71H 2Y25A 2HH0L 4MNGE 1NDMA 4U1MB 1QRKA 3GJFK 2H2SC 3KLDA 3LKNB 1ADQH 4MAUL 5I2IB 4O2CA 5F93C 4NJAH 4GAGH 5IGXH 1CF8L 5SWZE 3BP6B 4BUHA 5IKCA 1VKXB 4XXCC 3O3EB 2ESVE 1H8OA 2VRAA 4AIXA 4C55A 1N6QL 5I19H 3PGCB 3MBEC 2VNCA 3QJFB 4EKXA 3OHXA 1V7ML 5H8DA 5GGUB 3I3BA 1OLZA 4S2SA 3DI2B 2ARWA 3IFOA 1NFDF 2RB8A 1FJ1A 3QB7C 1X5IA 5ESVA 3T0WA 1MY5A 1YNKL 2HN7A 4LLUB 2ATKA 3UZQA 4PR5A 4NBXB 1NMAL 2C3VB 3SE4A 2FJGA 4WO4A 4L4TB 4PJFF 2EKJA 3U1SL 1MWAH 3QCTH 5DT1H 4OZIE 3PGDB 1D9KC 5A2KH 4WEBL 1LK3H 2X5PA 4QXTB 3H3PL 4Z8FH 5KVDL 1GGIH 4PGZA 5FM8A 3BKYH 4C83A 5DK0A 1GPOH 3GBLA 2NY3B 5C0CE 1ORSB 5D7LD 3SKNB 5KS9A 2LV4A 3O6LH 1QFWM 2YPKA 3O8XA 4XVTL 4HH8A 3VFRA 3NACH 5MEPA 3MNZB 4KPHL 1FNGA 1V3LA 5T1DH 1MLBA 2J2ZA 1I8IB 5ALCL 5I18L 2GFBA 1YPZF 2CDFA 4LVHC 5JOFB 1NLBL 1UYWH 5SV4A 3T3ME 3FT2A 4ZUTA 5EBGA 4YHPA 4PP1D 4XC3L 1VGEH 2IANB 3HI5L 4MXWL 5EZOL 2IPKA 1RZJL 4YHNB 1HKLH 4JO2H 1N0XL 4Q6IB 4FXLA 4J1UB 2QLVB 1AGEB 3IU4H 4X8JB 5JXAL 1RU9H 4P3CH 4GG8B 3LRSB 1CDBA 1G7QA 1B9ZA 3IU3A 4RQQB 3GMNB 1QSFD 2ZPKL 3GEWB 2GUOA 5E4EC 3FN9A 3TZVA 5BV7C 1JWUB 3N9GL 5DVNA 4ZOBA 3QIUC 3EOBB 1NMCC 3W39A 1JNHB 5T1LB 3AMLA 1KYOJ 2YMXL 1IC1A 2VZUA 4ZPTB 4LF3A 3IXAB 3PWJB 1BLNB 3QEQA 4JRYA 2I9LA 4JFFE 4PJEB 4JM4L 2VDQH 4I48A 3C60B 1NL0L 4AM0B 2EIEA 1Q9WB 3MMEA 4JPWL 3MRLB 1G7JA 3DUHA 4LVNC 3RGVB 1TZGH 4E41A 3H0TA 3T0ED 4MA1B 2W0FB 4ALAH 4XPAH 4HHAB 3NFPA 5KS9F 1EX0A 1DBKH 1DUZB 5T3XL 2J8UB 5DVMA 4PS4L 1RFDH 5DR5H 4OCLC 4DGVH 4XVSH 1GJIA 3RIFF 2BSTB 5DRWB 1KLFA 4DN4L 4Y1AD 2LAGB 5AZ2L 3QUZA 4OD3H 4N1CA 2B1HL 2FLBT 4AYFA 4E42B 2BVUA 2HT4D 2UZYB 4F58H 4ZAKC 2W1NA 5DQJA 2VDOH 2Q8BH 3W9DB 3MLWL 2VKXA 3BZEB 4LVOC 4K9EC 3DNKA 3FQRA 2ZKHH 4LCWD 1A2YB 2FGWL 3QCVH 4HH9A 1C1EH 5DUML 2IPTH 2ZNWA 2GITA 4FQPA 5DEZA 5F7DA 3IB4A 3BZ4B 1F00I 3BMWA 3ZT7A 4DEPB 3QFJB 3O4OB 1RULL 5ERWB 4UINL 4NGHL 3W2DL 1HH9A 5GS3A 1YEKH 3Q0HA 1T22B 1W8OA 4QTHA 5D7IA 3MTRA 3FQWA 2CRIA 3OSKA 4JB9L 1QHOA 3D0LB 1OGAE 2AEWA 2R23B 1YYLH 4PJIA 3TIDB 5E8PB 3JVGA 3CFIC 3ARBC 2C1PA 2UWEB 4PJGA 4ZS6D 3Q6FA 3BYTA 4GAFB 1XH3A 2BNRD 2HKHH 4JPKL 3NZ8A 4M61B 4KVCH 2B7DT 4PBWD 4WNQA 2DD8L 1N6UA 1S7VA 1I1FB 2YKLL 4GRLA 5E56A 4JLRA 4ODUB 2X4TA 4XP9L 2EYSA 5CEZL 1A6UL 4HQQL 1T3FA 1G7MA 2O5XL 3A6CH 4EDWH 1EZVY 1MCQA 4X6DE 1NCAL 1ZKAA 3C6LD 3REVA 5E2JA 3NH7H 3D3VD 3AM8C 3BSZL 1SYSA 2R29H 3QEHA 4F3FB 1FNHA 3BKJL 3MJGX 4URTB 1KPVB 3KYOA 4D9RD 3KLHD 1L0YA 1SBSH 2NPLX 3EHBD 1ES0B 1A7PH 3GMRB 3SDYL 4ISVB 1QQDB 3RFZC 2N1KA 3CNKA 3DVNA 2V5RA 4S1RH 5ECJE 2HT3D 5C0AE 3N1GC 3EGSA 2WLYA 4AZ8A 2GT9B 5IF0B 4K3DL 2R15A 3RVXC 1C08A 3JBG7 3I6GB 4OZFA 5T3XH 2D31B 1CXLA 2DQFB 5FA4B 1N2RA 4L4VE 4PJIB 3MRFA 3TIDA 1RPQA 1BWMA 2ZNXA 1YJDL 4CW1B 5T5NG 3MRCA 4GBXD 3O0RH 1Q0XH 5BCAA 3BDYH 4Z7WA 5KANG 4YK4B 2W0LA 4HZLA 4I8DA 4NQEA 3I75A 3SE3A 4JLRB 5E2VH 4LARL 5GGVY 3F7RA 3IF1B 1BBDH 5HHMB 3U0TA 3U83A 1C5DA 4NCDA 3QIBC 2CKBL 2DWEB 3FO9B 1BAFL 1AP2B 1MPAL 2F5BH 3QXUA 4NBZB 1E4XI 5DZOA 3VWKA 1RI8A 4BSWB 4CMHC 4CDGC 4HGWB 2XZAL 1N7MH 2C4FT 3I2CH 3ILPA 5GS1B 5D93B 4DUWA 3D6GA 3L6FA 2IALA 5I73B 4RISL 2EICA 3MRMB 4MYWB 4WWKD 3MRIB 4NKDB 3JWDC 3QPQC 1I7ZB 4KK5D 1DQJB 4XVJL 4P2OD 1KXVC 5FHBH 1X6NA 3BDYL 2EDLA 1ND0B 3BIBX 3MUJA 1YECL 3UBXI 4MXWH 5FYKL 4PRPD 3GSOA 2HT3C 4QHLA 5F1NA 5J57B 1WFTA 3K4AA 3VGAC 3NPSB 4XGZA 1IGCH 3RWDB 4M6ML 1RZKC 3QO1B 4PV9B 4HAFA 1UM5H 3CVHL 5D9SA 5CD5D 5IMKA 2YEZA 4D0DB 3ECBA 1CU4H 2BFVL 4MZ2A 2DM2A 1H0DA 3HPLA 4AQOA 2HFGL 4U2YA 1A4JB 3CDGB 1XCTA 4JPIA 1HZHL 1IGJB 2H32H 4JDTL 5IHUH 3HNTL 1PKQB 2ADJB 2YBRA 2NX5B 3I84A 5JQ6L 4JKMA 1HCFX 4V1DD 2GW5A 3ISWA 5EO1B 5F7WC 4JFYB 1OP9A 2DYPB 1A1MA 4A2LA 5GRJH 4EUPB 3WN5C 1S9VB 5EBMA 2AJYL 4HC1L 3F12A 1CTNA 2BRQA 4JO3H 3C2AH 1EFXB 3A6CL 4X99A 4EQ2A 2F19L 3EDDA 3RUGA 2ZUYA 4PJFB 4AH2B 4N90D 5FCSH 4LSVH 3IU3B 2MWCA 3MROA 4LASL 1NGQL 2Q6WB 3WXVH 1U36A 5C8JA 5ITFA 3VWJA 4NNXB 4PB9H 2EE2A 4PJDF 3RAJH 4HG4K 1J86A 5EUKB 1DVFA 4OLVL 5FECA 5K9KB 5E0QA 2AABH 4DOHB 3SGEH 1ITBB 3HC4L 1SJVA 4PJAB 1KXQE 1QRNB 3D1MC 4L1HA 4R4FL 3K8KA 1MF2L 1FC1A 1UM4L 2QADC 5CBAA 1U8HA 4JVUA 3MO1B 5C2BL 3OZ9L 3PUCA 3UTTD 2I25N 2F8OA 2AW2A 4X6FA 3F5WB 3RWHB 1AGFB 5D7LB 1FNLA 2A6DB 4FABL 4XPBH 1G9EA 4JFPB 2O5YL 5I73C 3P4MB 4B50A 4OAWA 3TO4A 4JN2B 1CT8B 3DO7B 2BHZA 3PV7A 5GGSA 3TN0B 3OAYK 3VD7A 4GUPA 3PWLA 5FYJL 3SE8H 1YEGH 3PV6A 4UV7H 5E00B 2HVJB 4LKXA 3QEUA 5JXAH 1A1NA 2ADIA 2MNUA 2X1OA 2FJHA 1X5JA 3C5ZC 4S1DC 5IB5A 2XY2A 1RUPL 4ZXBC 1RUPH 1JFQH 5EUKA 2ED7A 4Z7NE 4U1KA 4BH7B 3CCHB 3FQTB 1LO2H 2VR5A 4JQVC 4JVWA 4O2FB 5F97E 4Y19A 1OSZA 2IFFH 5E08H 1EJ6A 1NUFA 1YEGL 4MMXC 5MI0C 1INEH 3O4LD 1HDMA 5I76A 1E6OH 1EEUA 1TZHB 1DVFC 1HEZA 4RX4A 1Y6MR 4I2XA 4JO4L 4OLYL 4JZOB 4JHBA 4XX1E 1CLZH 4D8PA 1T2QL 4N8CL 5J7CC 3ULSB 3VXMD 3CUPA 5KSBE 3VWJD 4ZS7L 5LQBL 4R2GB 5L88H 4YUEH 4UQ2B 2PTTB 4MLSA 5HYSG 3B2UC 4NQSB 2KL6A 4LASH 2NLJB 4QRPD 4GBXA 2XTJE 3KXFD 4HH9B 1YY8B 2NW3A 5HVWA 4H26B 4RWYL 4ORGA 3WE6A 3OB8A 3OG4B 5IMOB 3MV7A 1I7TA 1QA9B 3Q48A 4QRQA 3VG9C 4NC1C 5DJCB 4I0KA 5E6YA 4R4NC 2VUOA 4JM2B 4U2ZA 5TQ2L 1LK2A 3ZDXE 4YDLB 1T4KA 1F2XK 4W6XB 2AJSL 2DQHH 1RVFH 3A6OA 1QYGH 1KCLA 3VFGH 4NRXB 4XNYH 3OXRB 5C86A 1BGXH 4JO4H 4S1DD 2W65A 3X17A 3GK8H 5KJRL 2J7LA 3MLRL 4U1MA 2X42A 2NW2A 3CPLB 1MCEA 5BS0B 5IEHA 1MH5B 4H5SB 4JDZA 1HSBB 5FKAA 4LAJH 4PJEF 1FE8L 3HPJA 4I2XB 3RVUC 4R90H 5C70A 5F21B 4KK8D 3BJ91 1BFVL 3QHFL 5KVGL 3L5XH 4N0UB 5ID0A 4LRIC 4NKMA 4KKAC 1IGIH 5K9OB 5IVZB 4JQXA 3FQNA 3RY6C 2KUTA 3DX9B 4NM4H 5MERA 4U3HA 3STBA 3MR9B 4CKVX 2VDMH 1U8NA 5GZOD 1K2DB 2P8LB 2Z35B 4GRLB 1JMZA 4KDVA 1WAAA 3B9AA 3BUYB 3G5YB 2DQCL 2QSCL 4XCYB 2DLIA 5F9DC 2P43B 1S8DB 4LLDB 1PSKL 4M03A 1RZJC 4OZFB 3SE3C 2Z91A 2J8UE 1CQKA 4O58H 2OL3B 3QIUA 3CDFA 4LHUA 1ZVHA 5IEKB 2HJFA 3RWHA 1J10A 3UTSD 4JKPL 3HUJA 2R0KH 1ZK9A 3FO2A 4MVBD 2N7AA 2F5AH 4GW4B 1A64A 4AEIL 4Q2ZA 4HUWA 4LSPH 3QDMD 5CZVL 3MLXH 3RUGE 4WI6A 3QZWB 2OXGA 3BOVA 5IBUG 4GKSB 2I9TB 1GCFA 4DVRH 2DQHL 2CKBA 4P23C 5TFSH 5CWSB 5J1AA 2PN5A 1GRWA 4PRPE 2QL1A 1MJJA 4NQCD 4UZGA 3EOTH 1CFQB 1A5FH 3TEUA 4POYA 5KN5B 1KT2B 5DSCA 4HFWA 3IJSB 1NL0H 4K9EH 4KXZI 2GK0A 3GSVA 2OR9L 2BOCB 1BVKB 5GS2H 4Z7OF 1YMHA 4GKZB 5IFAH 1AJ7H 5E6IC 1BOGA 2R29L 3BSZH 3BRFA 4L1DA 5B38A 5IT2L 5FIEA 1NGYB 4QNPF 5DJXB 5E1HB 1LWRA 5I1HH 4PRAA 2RQ8A 2K1MA 2LTQB 3GO1L 4HWEH 5B22A 4Q9RH 8FABA 3O2WH 2BNRA 5EU7E 2FHBA 1E4KC 3BIKB 3B9KA 1UZ6F 2QKIB 1UM5L 3CVHH 4ZYKB 3QUYC 3DYPA 2KH2B 5TE6L 1EEYA 3B9EA 1KC5L 3TJEH 2A73A 3E8UH 3FQUB 1PDKA 3D39D 5BMFL 3S4SA 3GSOB 5D7IF 1IGTB 3MFFB 2GK0B 3GSVB 3WKML 5DJZB 4YAQA 4OIBA 3T1FB 4AIZA 3I6LD 4JZJA 4LNVA 4FFYL 1HQRA 2BVYA 1RHFA 3OL2A 2HT4C 5JW4N 4DW2H 3WS3A 1TENA 4K23L 4PJHE 3QQ9D 2P42B 1BBDL 5GS0C 3C5JA 2NY7H 3GSUB 3VFMA 3EZ8A 3GO1H 4XPBL 1FVEA 5CSZB 4W6WB 4HEME 1FH5H 1I9EA 4PJBB 3O8XD 4OKDA 3K46A 4PRDB 3TVMA 5J6GB 1FZJA 3QO0A 1AO7D 3ZT6A 3L3GB 1QNZH 2O61A 1LE9B 2BK8A 1MLBB 4L4TD 1XR8A 5TDPB 4HIEA 3L5WB 5C0DB 3HI1A 1B0GB 3BPOB 4ESKA 5F6IB 2XZZA 2F8VA 3U4EB 4M9OA 1Q94A 4YHYB 1A21A 5FGSA 4DTGH 2P8PA 4JHWL 4XMLH 3QIWB 5FA3A 1JGDA 1R3HA 3UTTE 5GJSH 2BC4B 1JNJA 4JAMB 3GSRB 1DVFB 2XQBL 4HT1H 3EO0A 1KENH 4NZDA 1A6WL 5DQ9B 2R0ZL 4EXPX 3BUTA 3ME0A 1U3HD 5H35B 1MAKA 3E1F1 3HG1B 5DJ0A 4PJDE 4FQQB 3UTPE 4EN3D 3SDXB 3VGDA 4ELKB 4P57B 4BQ6A 4XPGH 5L2JB 3D9AL 3GMNA 4RMUA 3DUUB 1KEML 4DCQB 1PY9A 5I66B 2CUIA 4NZTH 4W4NA 1KLGB 3K8LA 4NNPH 1YMMA 1NJ9B 4ZOEA 1CGUA 1EAJA 5IFAL 1TZGL 2ZSVA 5HHPB 4JFOA 2LABA 3V5KB 3D5OF 2DQTL 4PJ8D 1MIEH 4CN6A 3I02B 4N8VG 2FWOB 5EU4A 1M71A 5KZCD 3NGBB 5E24E 4S0SD 3VA6A 4OFYD 5F7KC 3GGWA 4WFGD 1FZKA 2BY2A 4M8QB 2E8ZA 2P8PB 5IB4A 4LEOB 1M7DB 1KJMA 2ZOLB 3O9WA 4MA7L 5ESAB 5GGVH 2DLFH 5HD8D 1HKFA 3VXRD 3CAFA 4QOKB 5CS7A 2XACC 2QADB 5IHBA 1HHKB 4U6HB 2UYLA 3HNVH 3QDJE 4FTVE 2DF3A 5JR1H 4GRMA 4PRBA 1IGFL 5E9DA 5AWNL 4PGCA 1S5IL 2VSDA 2BOCA 1T2QH 4N8CH 4QRPE 2HTLC 4GBXC 2Z8VC 2YA1A 4BM7A 3PWPB 1MELA 5DD6B 1SJHA 3QUZB 1HKLL 4OD2B 3T0EC 4YJZL 3C09B 1B2WH 3CFJB 1VPOH 3MV11 2MKWA 3MLSL 1QLFB 3LS5H 4XC1H 1K85A 4F33B 1FVDB 5HDBF 5ACMA 3ZHKA 4UOW0 2YD9A 3P40A 4PJ5D 2DIAA 1T5WB 4PPTA 2E9IA 2ZUVA 1VERA 2ICCA 1EJOL 3O4LE 1KCSL 2X4SB 3IDMB 5IVOA 4MDIB 4OCWL 2Y5EA 5IBUB 1IEHA 3U36B 3O6LL 3VXSB 1YNKH 3LQZB 2EXWD 1T03L 3NFPB 5DQJB 4GMTL 4UQ3B 3UZVB 3HC3L 4YXKH 3S4SG 4F58L 2JB6A 4TPRL 4CU6A 3HR6A 3NIGE 2JLLA 3QCTL 5DT1L 3X14B 2WINA 3BZDA 3GFUA 2BSTA 3KXFB 1JYVA 2WP3T 5HHOA 4D0BB 5DD3H 2GEEA 3W0WA 1DBJH 5EO9B 2VLMD 3JTSB 5ISZE 3M8OL 4OLZH 4K3JL 3MO1A 2VIRB 3MOAL 3REWA 3X3GH 3I3DA 4FXKA 3PNWA 5JDSA 2VISB 3GI8L 4XH2B 4MLIA 3BZFB 1UB6B 4M6AA 4IRJC 3LV3A 4MQ7A 4MB5A 4Y4HD 4JN2A 4G6AC 4NFDA 4X7CC 4QCIB 2J4WH 1A3LL 4ODXA 5C6WH 1K8IB 1IAOA 4NKOB 1VDGA 35C8L 3T09A 3RJQB 3VRIA 4ODTL 2DWDA 3MV9A 4LSQH 4TQEL 2VB5A 1QPXA 2EDYA 4YLQT 3QZWA 1SY6H 1U95A 5I75B 2XKNB 4JEGB 1ZLSH 1NGXA 4OV6F 4AL8L 4WFED 5EFIB 3G5YA 4TSBH 4EEEA 2EDJA 5FYJU 1BPVA 4X4YA 5KVMC 3BDBA 1HOCB 3N9GH 4F7TA 5BVPH 3MV8A 4MGXA 3C6LC 1KGCE 2AVGA 1DEEA 1MHPH 4MNHB 1T1XA 4MZ3A 4PG9B 5IHUL 3FN3A 3H9SA 4JPKH 2YD6A 2CRZA 5DEGA 2UVEA 1YEDB 4J23A 4EI5C 1VFBA 1W0WA 1OAXL 5C8JB 2Z9TA 2P49B 4P46A 4JFQB 4JFDD 3GSQB 1QUNA 2DQIH 2X09A 4IRZL 2X9YA 3GKWL 5E2WL 3WFDH 3HLAB 3HFML 3QJFA 4GH7B 5TDOA 1INDH 3MV7B 4YDVA 3VGBA 2X70B 2RJMA 4HJJH 1WEJH 2ZUWA 5ISZD 3BQUA 4X4XA 5DJCA 1E4XH 4UUJB 1CFTB 2R1YB 3WUWG 3OZ9H 2CO6B 4LDLB 1LEIA 1NFKA 1YEFL 3ZDYE 1BFOB 4OCXL 4KU1A 4XBEL 2IGFL 4H1LB 4BZ2H 4WI2A 4LDOB 1XAUA 2ZKHL 1GSMA 3HUJE 3BAEL 4J3VA 4JRXD 3CDYA 4QOKA 2VDNH 2KKQA 5KVDH 3VXUD 4D2NA 4XZUB 4UV7L 2VITB 4WDIB 4H25B 5TQ2H 3GHEH 3MRDA 3PWVB 2R69H 4X0KA 1MREH 4UIKH 1FFQA 5JW3L 1J8KA 3UPRB 2WAHA 4P4KD 4PGCB 5DC0A 4MXVF 3QIBB 2CH8A 1T7VA 3MRHB 4I2XE 4OKVA 1YY9C 1MFCL 1CGTA 3T3MF 3WMSA 3C6LB 2VC2H 5KSBF 5EIIB 4Y1AE 2BHYA 5IW6A 2AJVH 4P5TC 2B4CL 3TBVA 4LLYB 4AEHH 4DAGH 3MRMA 3AU1B 5EN2A 1WBZA 1A1NB 5D1XA 3RY6A 1EV2E 3OKOB 1KPUB 2B8OT 1TITA 4P2RB 2FR4A 4KKLC 1TZHA 1YYMH 4RZCA 1HEZB 3IDGB 4B5EA 4PP1C 1HXMB 4JFEB 2FECL 3CVHA 3IJYA 2YK1L 3HZVA 5J6HB 3DX6A 2W9EL 3KJ6L 5DJ6A 3SGEI 2EDDA 3VXRA 2X40A 3IFNL 1M1SA 4DEPC 3NZHH 2VE6A 3GMPB 4HWBH 5KG9B 4ZO7A 2N7BA 1ZT1B 1J0HA 3MUGB 4ZPVA 2D0HA 3EDFA 2R2BA 3VFWA 1I9RL 3FFDB 3V0WH 3G08A 1VENA 2Y06H 2VLRB 1LE9A 3WNLA 4I77H 3S6CA 3G6JA 1MRCL 5DMYA 5HDQL 1XF2A 5A43C 3GB7B 4F8QA 5HYSA 2AEQH 4LPXA 1FAIH 2X89A 3MLSH 1S7SA 1CE1L 2XWJA 3LD8C 5CBEB 3MRNA 3JWOH 3HRZA 2ID5A 3GSXA 4KDWA 2PR4H 1TJHL 2C26A 4EN3A 5ABDE 4G8GA 1FL6A 4PJFA 4AG4L 5CEZH 3OKDB 3V7MA 1GOHA 3UJTL 1YQVH 1MCWW 4U0RB 5DJ2B 4PJ5E 43CAB 4ELKA 1C7TA 1DL7L 5L9DH 3EYVB 2YPLA 5D2LF 1P6FA 1TVHB 2H8PA 2XN9A 2Z0BA 1BZ9A 1HILA 4N0FB 3WDHA 1CLCA 1P6AB 1KCKA 4P2OB 1S5IH 5T3XE 4NZJA 5DD1H 4IJ3C 1ADQA 5TE7L 4L4TE 2AXGB 2NY2B 4Q9RL 2A0LD 5C0FB 3JVGC 4OT1L 4QWWD 2R2BB 3SQOH 2FGZA 1JF1B 1LE5B 4GQ9L 5I0DA 3EFFB 1LEKB 4NO2A 2NZ9D 3PWNA 3CH1B 3WFEL 3T04D 1Y18B 2YUZA 2ZCLH 1RMFH 3TNNA 4ZYKA 3DIFB 2X05A 1NC2B 2R2EB 1ZV5A 1KOAA 3LHPH 3KG5A 2COQA 4WUKH 2YPLD 1JJUA 5ELIA 3UTPD 2F74A 5D96C 3FQWB 1KNOA 3SJVD 4UILL 4JZJB 4IJ3B 3V5DA 3IDIA 4ZTOL 3S8WA 1AGCA 3O6FC 3U2SA 4ELMA 4OF3A 3GSWA 3TNMA 2J6EH 1MCLA 1KEMH 2GITB 3BX7C 1E28A 3PL6D 3FMGH 5DR5L 4IM8A 4ZFZB 1NBYB 4P5KB 5C0IB 2NR6D 4RFOL 1S9YA 3B9KD 1NCWL 1DBMH 1T2JA 4JFED 4UU9A 1EVUA 4RGOH 4IMLA 3T1WA 3MBXH 2BVPB 2DMBA 4RAVB 1BZ7B 3IKCB 4HS8L 1JF1A 2BY3A 3UTQB 3HZYB 3NIFF 5CSBA 3MOBH 2VLKA 3DV6B 3BO8A 2BDNH 4JVPA 4WWKB 4MS8C 4RRPG 2E5EA 4YZFE 1A14H 3ARFB 4PTUA 1KTDA 3GMOB 2V5MA 4R4BB 3V2AR 2Z8SA 2DM4A 4KRNA 1OAYH 1H15B 2WQRA 1LMKA 1FO0A 2Q86B 2F74B 1D9KB 2X10A 4XCCL 3UTTB 3MRQB 1UZ8B 3RWFB 1QTYT 3DIFA 5E6ZA 5B4MC 4PY8I 2H2PD 1JGEB 3V79C 1T20B 1ACYH 3ZE2F 3RX5A 4P9HH 4OF5A 4XMKL 3V6OE 3IJSA 5DD1L 2ZOKA 3GJFB 1HINH 1OT2A 4IIQB 4JCLA 3QWRA 3FO1B 3SDXE 1XGUB 1Q9LB 3S3PA 1NCCL 2DBLL 3DVNB 3C9NA 3IU4L 1XR9A 4NSKB 4MQSB 1QSZA 3JZ7A 4LK4A 3T65A 4OCXH 2EDXA 1ZEAH 1G7LA 1RZGB 2Z31B 1DE4B 4PJIE 1TXKA 1U58B 3VFNA 3UJTH 4U31A 1ZTXL 4Y4KC 1DBML 4KI1A 3OKEB 5DRXA 5BV7L 2WQ8A 4KGJA 3THML 1HWGB 5L2KD 4JM2D 5C71A 3HRZB 2IAMC 4RMTA 4ALAL 5EZLB 3UCRA 1BGXL 3FQNB 1RUAH 3S3SA 4J7RA 1FL6B 4WI4A 1CFSA 3MRCB 3S37H 5F9JB 1ED3B 1S8DA 4DN3H 4K3GA 2GCYB 3CFEA 2YWZA 2H9GA 1KJVA 2HWZH 3D25B 4BSVA 1OAZH 3GIVB 4H8WL 3Q5YA 3MRJA 3HPJB 5BVPL 2WBJD 1CFNB 1SYVA 3NABL 1P4BL 1WJ3A 4QRPB 4XCYA 3EYOB 1A22B 2HLAB 4OZGB 3LD8B 3RWIB 5HYJA 4DKDC 1MFEL 3QULA 4Y2DD 1KCVH 5B3NA 3QH3A 2YRPA 5HGDB 2A74A 4FMKA 5DWUL 5JOPD 4K8RC 5GRVL 4ONFL 5CZVH 5CUSL 5DMGC 5C9KA 3GUTB 4NUJB 5E8OA 3H9SD 1LDPL 1YNTB 1KENL 4YIQA 4I4WA 4FFVC 1M6OB 4S0TD 2V9RA 2DM3A 4XP5L 1J1XH 3DURA 5IFJA 4JQXC 4C58B 3MYZA 3O2DL 4LLYA 5BJTB 3T0AA 1VKXA 3CJJA 5E94B 1R3LA 3SPVB 1W72A 2FEEI 3C8HA 5CP3H 1FZMB 5IW3A 1FG2B 5FGRA 4JANB 4KVNH 1FNEA 4YEEA 5LBSL 4MJ5A 2VSCA 4XXCA 3QAZB 4ZUUA 3TPKA 3UYRH 1MFNA 3G9VA 1R5VB 3IJYB 4N0YH 4F7CA 4U1GB 2VQTA 5ETUB 1I85C 5D72H 3U79A 4GAYB 1GGCH 2X4UB 3V6FA 4P2QE 1I8LC 5D1XB 1F3JB 2NY1D 3GHBL 1MCPL 3BP5A 2XZQL 4KWUA 2IPUG 2OQJA 1PZUB 4NZUH 4EDXB 3ZKSD 3OAUL 5TE6H 4IOFD 5IW1A 5E94A 4Q0XL 2FX8L 4YNYA 4PY7A 2VXSH 5IJVB 2W07A 1MFAL 2YPLE 1QRND 4JY5H 2P5ED 1KB9K 3RZCB 1HHHB 4JHAH 3OKLA 5FO8A 4JO1H 1Z5LA 4U33A 4HUVA 4U7SA 4O2EB 3KYNA 5H37G 3HNSH 4LVHB 1TNNA 5D1ZD 1W0WB 2FYYA 5I1JL 5CBAB 1J0JA 2XRAL 4KKNA 1EO5A 4KV5F 3L9RA 2BVQA 4DGYH 3F7VB 1I8IA 4X6CB 2VLKE 5T3XD 3TO4D 1VACB 3U0WH 1CICC 3DXAA 5H2BA 3DMMB 3LQMA 2CDFB 2Z31A 2Q7NA 3QEUB 3QPXL 3P4MA 4FG6C 5GS0D 3FZUD 2AV7B 4D9LL 3MRNB 1D6VL 3P9LA 1XFPA 1X5YA 5GGTH 3U7YH 1AGEA 3QUZC 5F7LB 4XNQB 5T1LA 4JY5L 4OJFL 1IC7L 1QFWI 1KG0B 1QFWH 2R2HB 2IWGA 3ZL4L 1IE5A 3BKMH 4OTXL 2B0SH 2YSSA 1UYWL 3P73A 3TYFA 1HHGA 5LGHL 2EH7L 1MCOL 1T66D 2FYYB 2ICWB 3WO4C 2CSPA 2QBWA 5FO9A 1J11A 4OLUL 5EO9A 4HMDA 1FL3B 4OZHA 3JTTA 1FN4A 3VJ6B 2PCPA 2EDKA 4MNQE 3CFDA 5DDHA 3L7EB 2VDOL 2V9QA 4J4PD 4GQPH 3LKQB 1FL5A 4PTTA 2VXQL 3OKOA 1RIUH 5HYJD 3HE6D 1SVCP 3UTQA 5I1EL 1NDGB 1IKFH 1U3HA 3L5IA 1X4XA 5FDWA 4DKFL 3V6ZB 3GHBH 4WI8A 5IROC 1L4IA 3TBVB 1RUMH 2O5ZH 4ODWB 1ORQA 5L8KB 1OAQH 4H26A 4M7KL 1R24A 3SO3C 3WS6C 2IH3B 2EZ0C 1KF9B 4X7SL 1N5YL 4NOBA 3HE7A 3SPVA 4FG6D 5BVJB 4DFIA 3BIAX 5F7UA 3ULVF 5GGUA 4MCZB 3OQ3B 1IC4H 1IC5H 2HKFH 4A6YH 1AE6H 1JWSB 2R8SH 5B3JF 4L4TA 4NO0D 5EU6D 4GMSH 2WANA 4ZUSB 1PVHA 2V2TB 5JW5B 3IRZA 4FFZH 4R0LA 1REIA 3FT4B 5TDOB 3TVMD 3MLYL 1MF2H 2AEIT 1JWMB 5L8LB 1F4YL 5DYOB 1WCQA 4YHIB 4XAWH 4Q9QL 4Y5VC 1YPZA 3RPKA 2CLRB 1OT1A 2ZCKH 4JR9H 4UDTB 5I6XC 3SDAA 4U1KB 2VAAB 4BH7A 4RAUB 1HHKA 3DSNA 4AENA 3G5VB 3VFSB 3RDTB 4M7LL 1A1OA 3C6SA 1X7QA 5E5MA 3WJJA 1OQXA 2GJ6D 2GSGA 1I9JH 1I1CA 3FQXA 4F2MA 3C2SA 1HQ4B 3QUMH 4GKOA 5GISH 3SY0A 3S96B 4KI5E 5SWSD 3LSOA 3FN0L 3ZKXB 5E6IB 4GSDL 3SDDA 1Z0NA 2D0FA 3WFBH 1OSZB 4PJCA 1SYSB 1KBGH 1N59B 2W38A 3QNYA 2IH3A 5F9JA 4NQED 2EYTB 4YHLL 3GMMB 3RTQB 4YO0A 1Z2KA 2DD8H 1QQDA 2H2SD 4MNGB 2CDGB 1FZJB 3T2NH 1HHIA 4KKLD 4MJIB 3KPTA 2A77H 5GJSL 4PB0H 5FM4A 1IQDB 4X8XA 3QEHB 2IJ0C 4F3FA 5IF0A 5K59E 1DDHB 1NGZB 1IAOB 1FRGH 1V05A 2B20A 2ESVB 4NP4H 3WIFB 2P5EE 3W9EB 1H3GA 2VR4A 3OX8B 5GSVB 2ZP0T 5HTSA 3QWQB 1U93A 4FQXC 4R3SB 1MWAL 1HIML 1GGBL 1MAMH 4DQOL 5ITBL 2P47B 4B7LA 5D70H 1ONQB 3NCEB 3MUHL 4XX1G 3SJVB 4F7MB 4AG4H 3S37X 2EC9T 3K2UH 1KPVA 5E5RB 5GRVK 3D85A 5FYJD 2G75B 1U8KB 3QDHA 2HFTA 3L7FB 1BVLB 3UTZB 2Y23A 1KLUA 3PXJA 2FHCA 1LO0H 2QQLL 5B38G 1VESA 4ELMB 4Z7UB 4GRLD 2WMPA 1MPAH 2Y06L 3DV4B 4R26L 4G6KL 4E42A 1I1AA 2E6JA 3KPNA 4L8CA 4V1DE 4QLRA 4Y5VB 3LCYA 2A1WH 5I1KL 4XCEB 4PJCF 4K3JH 5CMAA 3O2DA 4Q58C 1J1XL 5IVXE 5AAMA 4BH8A 3BXNB 1KV3A 4IMKC 3SDDD 4J8RB 4WUUB 4ERSH 3S5LB 4GAJL 1OM3H 4MD4A 3SOBL 4OF7A 4RA0C 5FDWB 2QKIA 5IM7B 2BNRB 4YHOH 2XN9D 2FBJH 3DROA 2F53B 4HWEL 5DS8A 2H1PH 5F1KC 4AJ0A 2IANE 4OZIF 4WDIA 4LSSL 3PQYB 2VZTA 4NHUB 5HGHA 3WKNA 3ARBA 3U9UA 2YEZB 3V6FB 3TGXA 3JWDL 4Z7UA 1OGTA 1YZZA 4Z7QF 5GPRA 3EHBC 1ZE3C 1A7PL 1CD1A 3CH1A 1D5IL 1KCSH 4BSWA 1G7PA 4YE4L 3ULVC 3LY6A 1WITA 4Y4FA 3DX8A 4X0KB 3QQNA 1RJZA 4N5EC 4TUOA 4AEEA 4MNQA 3VFVB 5I15H 2EC8A 2YXMA 4MSWA 4QYOA 1B6DA 4L5FL 4ERSL 2JK5A 2AK4E 3O6FD 3S34H 3SCMD 4O4YL 3G6DH 2HFFB 1S9XB 2VLLA 1OW0A 1M05B 4LF3B 4M7JH 1P9MA 1EERB 2CGRL 4POUB 1IAKB 1M7IB 1HH6A 3MRRB 2GCYA 1JZ4A 1MVUA 4YUEL 1I7UB 3EFDL 4WHTB 3I6KB 2Q7YB 4YWGL 4HGKC 4WUUA 3OJDA 1G1YA 5CILL 5DFWH 5EZLA 4JFZL 2DKUA 1ULVA 2YRLA 1TJHH 5DHVB 2CIKB 3M17A 4HJGB 5CJ8A 4MQXD 4GT7A 3LKRB 1XGTA 1MCNA 4P2QA 4DVBA 4EIGB 2DDQH 3GMRA 1AFVH 4ISVA 2NY3D 3NIFE 4L8DB 1FC2D 4X6EB 5I30L 1RURH 5JNYB 4LCYB 1OHQA 1Z5LB 3VXOB 1AGFA 1A4KA 2E6PA 4U1JB 4P2RA 1A47A 5EU6E 1HIMH 4L3EE 1MHHA 2GT9A 1CR9H 1F3RB 1DN0B 2R1XB 2ENYA 1AI1L 3QG7L 4P4KA 4LL9A 1NJ9A 4TSBL 4ZTPH 5KSUA 3MLWH 4X6DA 4WFFD 1XGPB 1U95B 2HP4A 5J12C 4JJ5A 3F6LA 5A3ID 3MR9A 2YPKB 2BP3A 4KI5D 1C5CL 3VXUA 3V4VL 2B1HH 5CZKA 2X9WA 4OLEA 3VWJB 1W2KT 3RIFK 3NAAL 4GAJH 1MVFA 1IILE 4ZQKA 4R7DB 2BNQA 1NCNA 1U8IB 4WJ5A 1FYTE 1OP5K 5FF6B 4HFUH 5DRXB 4PJIF 1CD0A 5DK2B 2OK0L 1QYGL 2ED9A 4QNPE 3QNXB 1YNLH 4U7MA 1EGJL 3B9DA 5D6DA 3OTTA 2DQGL 1SEBA 4KKBD 5E8DH 1Z0MA 1GGUA 1MCFA 1PFCA 3BESR 2YN3A 3F7YA 1L6ZA 3QI9A 2HRPL 4Y2OA 3ORJA 4YC2C 1C16B 2BVOA 1NUNB 1UB5A 2XWBA 4BA8A 3LKQA 2VAAA 4FQLL 2WBWB 4BELD 4ZNEA 4KTDH 5DJDB 1AXTL 2F15A 4OBSA 1EJOH 3HE7B 1EEZA 1AGBB 3RWJA 3VXUB 2HMIC 3RUGF 1WQVT 2BVPA 3IKKA 3MRHA 2DIJA 4WEMB 5ISZB 3MYJB 2FD6L 4NO2B 5IWLC 3JV4A 3QXDA 3WFHA 4Y5YA 4HHAA 3CUPB 4KHXH 1R5WA 1T1WB 4QRUA 3QEGL 4R7DA 4RNRB 3BGFB 4LHUG 4POZD 3NCYS 2APWA 4IRJD 5LGHH 4WEBH 1YEHL 4V1DA 2ZCHL 3MXVH 3BE1H 2G2RA 5CKGA 4AM0A 4YR6A 1WF5A 1YY8A 2ERJB 3ARUA 4G8EA 1KNOB 3N1PC 2UY6A 4JFOB 4I5BB 3ZYZA 5M94B 4MJID 4FZ8L 3NACL 5HHOD 2OI9B 2MJWA 2B1AL 5D2NE 5FUOH 3VG0H 1UQSA 5TH2A 2WM0A 3WFZA 3QIBD 5IB3A 5MEQB 1UWXH 1F97A 1AQKH 2XKUA 3I85A 3TBSB 2XKNA 4Z78A 4LHJB 5K9QG 3HAEA 3D69A 2P8LA 4WHTA 1BIIA 3CDCA 4LBEB 4U1NA 5A16B 1EHXA 2UUDK 4EVNB 1E27A 4JRYE 4JFQA 5F7NC 3KPRA 3S36X 2WUCH 3VFUB 4NRYA 4O9HH 3QJHB 1MIEL 1UJTA 4MCYA 4OAWB 2XFXA 3QQ4A 4CDHA 5CEZE 3H9SB 5E7BA 3SEPA 1CE6B 5SWSA 2OXHA 2BOBA 4IIQA 5I1DA 3JWOC 1JUFA 1UENA 4GKNB 3UTSE 4PJ9A 5EOCJ 1IQWL 3EDEA 3QFDA 1F13A 4PRHE 3U7YL 3P9MA 3CZFA 4FFZL 2FJFB 3KPOB 3MCG1 5GS2D 5IVXF 1WZ1L 2R0ZH 5LWYH 2FX9H 3OAZH 3DX9A 3VWKD 1CXHA 1P7QB 1J5OH 1T5WA 3TA3C 1KTLA 3O11A 3EJYC 1AQKL 1Z9OA 3Q1SL 4H0GA 4HUUB 2YC1B 3GJEA 2CQVA 1EUTA 3H42L 1I4FB 2Q8AH 5TQ0L 1CICD 4LPWA 5JW3H 3BUYA 4OFIA 1PKQE 3E2HC 3MGOA 3ARQA 2PXYD 3EJJX 3CFBB 5I1DB 1PYWB 2DJSA 4GBXB 5L8JB 1OB1B 4NCC1 1WISA 5DRZB 1TQBC 4XAKE 4LGRB 4LCCC 3DHJA 6FABL 1AXSB 1MFAH 1SMOA 1PQZB 5BZDA 3DWTA 1N0XH 2I60H 5IROA 2GIYA 3VI4F 1ZANL 5D8JH 4CU8A 3DURB 2WIMA 2J5LC 1S7QA 1FZKB 4ZMAT 1RJZB 5ALCH 5I18H 3VDCA 4ODSH 5HHVH 1I3RB 4PBXA 4J8RA 3EYUL 4OLWL 4XT1C 5FHBL 5DMGD 4G7YH 1AP2A 1QBMH 1TLKA 1KEGL 5JORA 1FP5A 5SX5H 4D3CH 4CVXB 1GPOL 4C4KO 1RK1B 5D1QC 1NDMB 1ZHNB 4FQIL 4JDVA 3PDGA 1W72L 4YPGB 2R39A 1GHFL 4HAGA 1IM3A 4ODVL 5CSGA 4XCNA 1ACYL 1FAKT 3NPSC 4KDTC 2VABA 2BMKB 3FONA 1D5MB 2DB8A 4X7DC 3H8NA 4ZUVA 4KVNL 2BJML 4Y16D 5BO1H 5BRZD 4HFUL 3TN0A 2PUQT 4M1CC 1C12B 4QHLB 4U0QB 2R1WA 3DSFL 4CU7A 3QXAB 3PL6A 4NO0B 4LLMB 3TBTA 1J1PH 4MXVE 1W72B 1DN2A 2DLTA 5T3ZH 5HHQB 3ETBF 4RBPK 2X41A 1IEAA 4ZO9A 1FNEB 1T1YB 3KPLA 2Z31D 5GRWA 3H7BA 5GGQL 1S9KC 1U3HB 1ZGLA 2OR7A 2SEBA 2ESVA 4ONOA 5CBEA 2OCFD 4I9WD 4NN7C 1K5NA 3ET9F 1ZGLP 1LEGB 1U8PB 2Z92B 4KJWC 4UB0L 3ZYJA 4LCWA 1KCVL 1LD9B 3WL9A 2J6EL 5IOPA 2ORBL 1JCKA 3RL1B 4LLQA 1RK0B 2AK1L 4KHTH 3RX8A 3BEVB 5C2UB 2PTUA 1P7HL 1CS6A 3B2UD 4X7EC 1BD2E 3MNVB 3TH3T 4J6RH 3DXAB 2WIIA 4LLVB 4JPVL 1DQQB 2V5TA 3VDBA 4TNWF 1QR1B 1XCQA 1ZVYA 5KVFL 1RUAL 2X4QB 1JUFB 3NTCL 4JFYA 5F9OH 5KSAD 5ICZA 1ZA6A 4K2UL 1RMFL 4LOUC 3G6JE 4UT9L 4IOIA 1FVEB 5FDYA 4P23B 3WUWA 1N64L 3TP4A 3TCLB 4KUZH 1A4KB 5EH1A 1DSFH 3BH8B 5CJXC 1NBVL 4FFYH 2SEBB 1KN2L 4ODXB 4RIRA 5LGJA 3GJFH 5F1IB 43C9B 4WGWB 4YGVB 1F3DJ 4KVCL 5TDPA 2F53D 3MLPA 1B4JH 1Q8MA 3ARSA 1T0NA 1FNSH 1KB5A 3RKDC 4B7IA 4M7JL 1OTTC 2UZIL 2UZIH 2V2WB 4NPYA 1RUKL 3UJIH 5KSBA 4UT7H 2C4FU 3UTOA 4OGAD 4M6NH 2GJJA 1NFDB 2AAVA 2C3XA 3OF6D 1CYGA 2AQ2A 4S1SH 2HG5B 1WTLA 3P4NB 1JP5A 4UINH 5HPMB 5I16B 3QQ9C 4MWFA 4QHNB 1EEQA 3DETC 4N0UE 4JG1L 3V5HA 3FMGL 5ICXA 4JO3L 4S11A 4OZHB 3VI3F 2R0LL 1DBAH 4LHUD 5C0BD 1U8MB 3IT8D 4ODWA 4TNWK 2A73B 4PY8J 4DZBA 2WBJB 2AJSH 1A6VL 3R4DA 4NCC2 1I7UA 2IG2L 1FO0B 1L6XA 3KHOA 3LQAH 3GMQB 4WIQA 3NIGF 4L4VA 5C0CD 1M4KA 4PG2A 1U6AL 2VXTH 3MLTB 1H15A 1UH3A 3DRTB 5DRWA 1Z9MA 4DGVL 4X98A 25C8H 4KZDL 3WHE0 1UXWA 4WUUD 5DVLA 3LMJH 2LU3A 5BV7H 4P5TA 3CH8A 3QFJA 3TFKD 2NY6B 2Y5TB 3U46B 3WXWL 3L7FA 1TVHA 2H8PB 2XN9B 1BVLA 1CG9B 3E0GA 1K4DB 2D4FA 2R4SL 5DXWA 4PLNC 2EDTA 2OMBA 3PWNB 1JTTA 3V6ZA 5FKPA 1WFNA 1X44A 4WUKL 2JB5L 2LFGA 1AD0A 1MQKL 1GIGL 4UBDD 1VADB 9CGTA 4KV5E 4MWFB 4Y4FD 5DJAB 5FYLH 2A9MH 1VFAB 4IRSC 5D7IE 2OTWB 4R97B 4EVNA 1S3KH 3TNNB 5HPOA 4QCIA 4XP4H 1NCDH 2GJ6E 1HHHA 2ICES 3GMLB 1MCJA 5FGCE 1FIGL 4W70A 3FOMA 4GOSA 5C09B 2WBJC 3GHEL 2WSKA 2ADGB 3RTQA 4FP8H 3HI6H 1AR2A 4LEXH 1LILA 3S35L 2QSCH 3EYOA 4WHDA 1VFMA 3AXLB 2IGFH 3O41A 4MD5A 1QD0A 1AHWA 3KXFA 2J88H 3QDMB 3GGWB 3NIDE 4NRYB 3J8F7 3K74B 3O3DA 1NGZA 4PGBA 1E4XL 5CEYA 4NP4L 1HH6B 3GSNL 1XCQB 1QO3A 5D8JL 1C08B 1HNGA 4HKBA 1Z6JT 1DBKL 4PV8B 3Q5TA 1UCTA 4HIIB 3P3YA 3GK8L 4F9PA 3AAZA 3FRPA 3TBYA 5HJ3B 1NANI 4RX4D 4APQA 5D7KE 2PNDA 4NN7B 4G43A 5DK0B 4R8WL 5GHWL 1M7XA 1AGBA 2W59A 3DUSB 4WENB 1KFAH 5C0AA 4BKLA 3BD5A 1A6VH 2XWBB 4PRHA 1G84A 4HPOL 1NMAH 3PG2A 4QXGH 2YD4A 4M6OH 1R0AH 1DUYA 3UROR 1CXEA 2DKSA 4H20L 5C0CB 5JHDB 5SWSE 1BX2B 2OI9C 5EWIL 5I8KL 5IJKC 2AJYH 4F7CB 1J8HD 1KYOK 4QHUA 4HQQH 5EPMB 3MCKB 2ZOKB 5FYLE 3L5WA 4K7FB 2YK1H 4ZAKB 4XCNB 3RVTC 1TTGA 2EYSB 5A3IC 4M7LH 2VWEC 3HC0A 5LWYL 1JBJA 4RFEB 4IRJB 2E9WA 4PRDA 3TVMB 5D2LB 2NY2D 4JHAL 1CTOA 2IF7A 2I07A 3P0YL 1MEXL 1S7UB 3CC5B 3E6FB 3RA7H 4EIZC 5INDB 4G6AD 1A0QL 1A7RH 1T7WA 3MLUH 4ZOAA 2CKNA 5D5MA 1UJ3C 1B88A 4X80L 4M7KH 2H6PA 4ETQA 2PW1A 4O9HL 4ODBD 4LKCA 2BSSA 2XPGB 2ARJB 3UPAA 3U30B 1WBXB 4S2SB 4O5LL 4BK4A 5E99L 3WFDL 6CGTA 5JORB 2IQAA 3HB3D 5J9PB 5DYOA 2GJ6A 4JGMA 5K33A 3QCUL 1SYVB 4PJ7F 2DL9A 4ZFGH 4M1DH 3MUZ1 3GRWA 4HZAA 5KOVC 5EOTB 3WCYA 5HYFA 1JV5A 1UH4A 1F58H 3VXNA 3PF2A 2F5BL 2YD8A 1JZ5A 5F8RC 2B5IB 1BAFH 5HGBB 3PHOB 5JIIA 5LKNA 4O00A 4N68A 5JUEH 4WRLA 1CXKA 3PABA 5LVEA 2VZVA 4BZ1L 4Y16A 3ARTA 3AC0A 4X6FB 3MFGB 4F57L 1C8PA 3V6OC 1H3XA 4K55A 4WFHE 3ZE1E 3SQBA 2BERA 4PJGE 1YJDH 3PWLB 4XNQA 4MA8H 2BXYA 4LCUA 4U0RC 2Q76A 2YC1A 4Y4KD 1KG0A 1BF2A 4RBPH 2ZJSH 5F88A 5JNYA 4YHYC 4QRTB 1OTSC 3N0PB 15C8H 5AUMA 2JK5B 2BSED 2WZPD 3MRGB 5EOTA 5IVXA 2JF1A 5HYQB 3QZWG 2CMRH 3PHQB 2RCSH 4KK9C 1QOKA 1S7VB 4KRPD 4ZFOL 4L8SC 1JWUA 1MNUL 1YEIH 1NCBL 5IV2A 3HMWL 5IB3B 2D9CA 3FHAA 2CRYA 4UT6L 1SEQH 1U8LB 5DEFB 2Q3AA 5DVOA 1QSEA 2NTFB 2OP4L 4C83B 3IXTA 2OQJB 3BVNB 1X5AA 3RRQA 5FUOL 1NH6A 4GG8A 3OJMB 5HI3D 3GI8H 2VDKL 1T3FB 1WZMA 4JPIB 3ZTNL 4CBPA 2UWEE 5FK9A 3W11D 2FX8H 5IMKB 1OF2A 2VN4A 2X4PA 4HUXB 2ZCHH 3MXVL 3I3EA 3NFSL 3O2VL 4EUPH 4PLJC 4ZFOB 4M48L 5F7FA 1A6WH 1ZWIA 4EUPA 5IR1A 3B6SA 1JRHI 1NAMH 5T1LD 3GIZL 1JNNH 3QIWC 1PX3A 1JRHH 3MSPA 1I8KB 4PRNA 1N4XH 4NKIH 2R23A 3ARGB 4QKXB 1JPTL 4P5TB 3BN9C 4UQ2A 5GGSY 3ZE0E 3SKUD 1ZT4A 3TO2B 4F7PB 3DI3B 3NN8A 2IEPA 4LEOA 4ZG1A 5DFVD 1KIPA 3A6BL 2DYPD 7FABH 2KBGA 4Q74A 1MOEA 4U05A 1J05B 4PJ8B 2XA3A 5F6HJ 5DS8B 1AQDB 3BRDA 3MRFB 4YXLH 4PJDB 3D39A 1S7UA 3L3KB 2BVEA 3E6FA 4RISH 5GRUH 3EOAA 3PGFL 4HKZA 3W9DA 3W81A 1XGRB 4GRMB 4OCSH 4LQFH 2BRRL 4WFFE 4HULB 5I75C 4NRXA 3FO9A 2NY1C 2XZAH 5EO0A 2D7TH 5EOQL 3DPBA 5HHXL 1Q9WA 5DJDA 1SJEA 1G6RA 4FQCL 4F9LA 2AXJA 1AKJA 5DA0B 2FL5A 3BKML 4OTXH 5GS1A 2X70A 4M8QA 2ORBH 1CL7L 1X6LA 2QHRL 4AT6B 5SV3A 4E5XB 4HGWA 3RVVD 1S7SB 2CJUH 2H45A 3QUKB 3TIEA 3BPOC 3P4OB 4MJIA 3SGJC 1LO3L 4U1HB 2DQFA 2MCPL 4DWHA 3QFJE 5MP6H 3G6JB 1XF2B 1P4BH 3FTGA 5F44A 3U0PB 2XYCA 2NY4D 2WIIB 4LLVA 2YD2A 1J8HA 3SCMB 1OQOA 1ZSDA 1WT5A 5C09A 5D1ZC 1X4YA 3TPUA 5AG9A 4L4JA 1LP9B 4Z77A 4P23A 5F7EL 4DKEL 3FFCB 2VDRH 4FQ2L 5T5FL 2CK0H 3JSSA 4G7VL 4WHCA 3OKYA 3VXQA 4OI8A 1C5BL 1KPRB 4QT5B 4Z7NF 3QDMA 1P84K 4JQIL 1TJGL 5D6CA 3V0AC 3T77A 2EEDA 4U1GC 1HH9B 1UC6A 3RVWD 4LBEA 4U1NB 2UUDH 1GZQB 1MRDH 3RJDA 2CLRA 1NUGA 2R1XA 1GC1L 1MCHA 3ZHDA 3RZCC 3CFCL 2F54B 5J3HC 3GSNH 2VIRA 3REWB 2R1WB 2YXFA 1PY4A 4IBLT 3LKOA 1MCKA 5GIRB 4HKJB 2DIBA 4WTZG 1K5NB 1RZGA 4P9HL 1HQ4A 4PUBH 4PJ5A 4OGXH 1MCIA 2Q1EA 4UT7L 2G9HB 4PRIE 5ITFB 4OF6A 2HN7B 4KMTL 5C9JA 3O6ML 4J3WA 3RDTA 3VGAB 3QFJD 1GC1H 2LVCA 1DLHA 3V8OA 3SDAC 2GY5A 4NQXA 2ICEB 1J0KA 3NCBB 2JIXA 3NTCH 4IHOB 1G0DA 5C0EB 4GKZA 1YMHB 3AFLA 3EO1B 4NBYB 1F4XL 1F58L 3DX6B 5E8DL 3ZKMC 1E6JH 4EZMA 1K6QL 4TVPH 1U92B 4FQXB 4PRIA 4KUZL 2WUBH 1E28B 1UM6H 3BIKA 1UADC 5B39B 5AEAA 3IDJB 4DN4H 3ARFA 2YD1A 4MJIE 2VERN 1FGVH 4U4BA 4K7PL 3WLWC 5BJTA 4GAYA 2HYMA 3BP7B 4PRAB 3LEXA 3D0VA 4Y4FB 3T1FA 3LN4A 5CGTA 3K4ZA 4N1EA 1RZ8A 1MLCA 2ZSWA 2Y9RT 4PJ8A 1FFNA 5EOCL 3ARFC 2X1QA 1L0XA 5IFHL 3RNKB 4BJLA 4NQXB 4U1SB 2ICEA 2AI0H 5HGAB 3KYMB 4KZEH 4K3DH 5MENE 3MRDB 3PWVA 3O81A 4JM4H 3MRIA 4TUKL 3GSQA 4L4VD 3KPPB 4NWTH 4LSPL 4GS7B 4AEIH 3KAAA 5I16A 3MXWH 4HKXB 2FH8A 4LLDA 2JJSC 3VW3H 3B4NA 1DP0A 4OUUA 5D7LA 5DVKA 3Q3GA 2MTPA 1HILB 1XMWA 2EH8H 4XP1L 4ZPTA 1VFOA 5EOQH 3RDTC 4HS6B 4IHOA 2R56H 4X4ZA 1XGYL 5I1LA 1LEIB 3CX5K 3UMTA 1BJ8A 3QR2A 2RHEA 5GZNC 2BX5A 5FV2A 1UEYA 3IDYB 2OJEB 3KLHC 5E00A 1P4LA 3ZKMD 3FO2B 5BXFA 4QGYA 1FBIH 3P11H 5IVXB 2O5XH 4HPYL 5HYQA 4L8CB 2IQ9H 1QBML 3TLRA 1KEGH 1QSEE 4X8JA 3QSKB 4KI5C 2J3SA 4I48B 4BUGA 1MHHB 1TVBA 2X6MA 1U8PA 4LCUB 3GIVA 1K4CB 4ODVH 2DTML 3ES6A 2OS7A 1TDQA 3QUYD 5CEZD 5CGYD 4OCMC 3ROOA 3NCJH 4DK6A 3ZDZE 1CFSB 1IC5L 1IC4L 4PR5B 1MUJA 3NCMA 1R3HB 3M07A 1BBJB 1OGAA 1NLDH 1A6PA 2O93L 4AMKH 5F9WB 1HINL 4GLRH 6FABH 4IS6B 1KGCD 5SWSB 2BOBB 3EOYG 3HI1B 3WSQH 3T4YA 3D18B 1J7VR 4Y4FC 3T77B 1JL8A 3RPIB 1W0YT 4NQDB 1N6VA 2DTMH 1RUQH 3K2MC 3RL1A 3UC0L 2DQCH 5AUMB 1OTUC 4KDTA 1ORSA 5KS9B 4G3YL 2PXYC 1LP9F 3PDDA 3MGAA 2VOTA 4X4ME 2DICA 1TNMA 3EO0B 5L6YL 1MJUL 3UTTA 4WTXA 3EBAA 3IDGA 3QCVL 2FGWH 5KW9L 2IQ9L 4NQVB 3O8XC 4U6YA 5D96B 1H8SA 5T1KD 43CAA 1I7TB 1QA9A 3B5TA 4NQDD 5F96H 2NY0D 4PTUB 3OV6A 2H3NB 3QHFH 1BFVH 1DVFD 4RMSA 5ACLA 3U1SH 5ADPH 3SO5A 3CLFH 4L3EA 3SGDI 4XVSL 2DMKA 1EHNA 4K3HA 3MRBA 1AD9B 3VXPA 1A6ZB 3FQUA 3QNZA 3VXUE 3BDXA 3CFJA 5D5MB 1FYTA 3IDXL 1OP3K 5GRYA 2A1WL 5I1KH 1R3JB 4TVSa 5I76B 3AS2A 5GQBA 5BZWB 1N5AB 3MOAH 2CLVB 4ZTOH 1QBAA 2EEAA 1ADQL 1OVZA 4HXBH 1H3UA 2BNUA 3HMWH 4M1GL 3X12B 4JG0H 1BF8A 3O6FB 1ZT4B 1T5XB 4U1IB 2PTTA 1I7RA 4NQSA 4DAGL 4FNLL 1RZKL 4J3TA 3ARGA 3UAJD 1RZFH 4YHIA 3ULUD 2FX7L 5CMAB 4X7SH 1NDGA 1A7OH 4RWYH 1OTUD 4XHQA 3VD5A 3FZUC 1OL0A 3NVQA 5MHSD 1MJUH 3U2SB 1HNFA 1A6ZA 2C7UA 5ADOH 4OGYL 1CZ8H 4D9QE 4I13B 5CWSA 4G6JL 3ALWA 4WW2C 5IMLA 5JW4R 5KVEL 3U82B 5FM5O 3VG0L 4OZGE 3TYGL 1CGVA 3QEGH 1U8JA 3BWAA 2H26A 4YHZL 3KPOA 3EAKA 2B39A 1UVQB 1DUZA 4IRZH 4FQQA 4NNYA 1VACA 1JZ6A 4GG6B 4RGMC 3ULSA 3CVIL 1TZIA 4PRPB 4U6TA 3QRGH 5LXGH 4N8VB 2CUHA 3QFDB 2AQ1A 3KYOB 4RDQF 1UM4H 2R9HD 1IM9B 5I0ZA 3I50L 1WWCA 3I02A 1Y0LA 2W9LA 3SBWC 1GZPA 2F54D 1UWEH 1P7QA 1JI1A 5JA9A 1L7IH 2P44B 1U3ZA 2DAVA 4WY7L 4Z0BL 5HYEA 4MNHA 4LPVA 4JFFD 3KPRD 3VE0B 3P73B 3TYFB 3U7WL 1DANT 1T04B 4FXKB 1CFBA 2VISA 4L9LA 4XP6L 5DMIH 4X83A 5CIPB 3S7GA 3UYRL 3ULUC 5DK3A 4X4YB 1NCTA 1ZOXA 4XI5D 1AH1A 1UGNA 2C1PB 5HHMD 4OD1H 3L5HA 3K80A 1ZLSL 3WHXA 4UT9H 2DQJL 3LN5B 4JGJA 3H9HB 4YDJA