1SJVA

Three-dimensional structure of a llama vhh domain swapping
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
102
Chain Sequence
b'GGGLVQAGESLKLSCAASGGFMGWYRQAPGKQRELVATINSRGITNYADFVKGRFTISRDNAKKTVYLEMNSLEPEDTAVYYCYTHYFRSYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords r9
publication title Domain swapping of a llama VHH domain builds a crystal-wide beta-sheet structure.
pubmed doi rcsb
source organism Lama glama
molecule tags Antibiotic
total genus 15
structure length 102
sequence length 107
ec nomenclature
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sjvA00
2A9ML 4FTVE 4M7LL 4O00A 4QO1A 5FGBC 1NCWH 3Q5OA 5CEYA 4JVUA 4NNXB 2ZUVA 3EYQD 5IB3B 1CIUA 3EGSA 1FO0L 5BZDA 3S96B 2UZXB 1E6JH 4HZLB 4WI2A 3GUTA 1G0XA 3D25B 4UDTA 1WLHA 3P4OB 5DK2B 1MREH 3ULUH 2DM4A 3UC0L 3O3DB 5C9JA 4NO2A 3O3AA 2XKSA 4YHLL 1CICC 2OS7A 2EECA 2Z92B 4IBLT 2ADFH 4XVTL 4HS8H 1MI5A 2XKUA 5B38B 5HVHB 3QCTH 1OP9A 2G75B 5C0IB 3VXRD 4TUOB 2BFVL 3GO1H 3GJFA 5FUZH 2OL3B 4ZODA 4KZDH 2VXUH 3HPJB 2ZCLH 1MI5E 4WWKC 1BM3H 1QVOA 4EVNB 1CT8A 4BELD 3NOIA 5AZ2L 3RVXC 3S3JA 3KJ4C 2CIKA 2XN9A 32C2A 1OTTD 1KCSH 3RVUD 4G7VL 1F4XH 1GOHA 5MP6H 4XP1H 5EUKB 1IC7L 4UV7L 1K85A 3GMQA 4P5TA 4QT5A 4PP2A 3ZKNC 4XMKH 3ARBB 3DX9A 3LKPB 2DQJL 3ULVF 1OAXL 2XN9E 5JPNB 5CJQH 5IJVB 2D03L 1IGCH 4NCC2 3SKMA 1LO4H 2Y07L 1JHKH 4J12A 2NY6B 3MGOB 2KBGA 4Z6AT 2V5YA 5E8EB 3I50L 4FQXD 4Y4FA 3IF1A 3HUJB 4QHKI 5HHVH 5B8CB 2X70B 3WFDL 1MCFA 2WLZA 4ODHL 4RNRB 1KJ2B 4S1DD 1A3LL 4EDXA 1P4IL 4J4PD 3P0YL 3DETD 2KL6A 3UP1A 3FQRA 1Y6NR 5BS0B 1RFDH 4NFDA 1EEUA 4LBEB 1IILE 4HUXA 2Q8BL 1FG2B 4OLVH 1KJ3H 1IEBB 3WUWG 2K9UA 4PD4J 5GS1A 2FLRT 4MQSB 1QG3A 1IAIL 2XICA 3MZTA 5DD5L 4HK0B 3QWRD 1JF1B 5F3HA 5B39G 1FH5H 4G9FB 4OAWA 1ZT4A 1DVFB 2I9TB 43C9B 4UT6L 3JUZA 2EDOA 2VZVA 4TOYL 4F80A 3MYJA 3HE7C 4YFEA 2I5YH 4NKIL 4TSBL 4U05A 1OW0C 1P5UA 3HR6A 4JN1H 1CLZH 4XH2A 4LVHB 3E8UL 3EFFB 3KPTA 3RY6C 5CSZA 4M00A 4G7YH 4P46A 1BZ7B 4DVBA 3EHBD 1GZQA 3KYAA 4GKOA 3BEWA 4LSDA 1KCVL 5D72L 1A8JH 1RIVL 3D69A 5FA3A 4AJ0A 1UYWH 3UROR 2B1AL 5EOTA 1YMMD 2VQ1A 5J3HD 1VHPA 1YNKL 3ECBA 2J8HA 2QTEA 4QY8B 5DJ8B 5H37G 1CD0A 4YDKH 2C3GA 5GGQL 3HG1A 5DD6A 4ZD3H 4GG6A 4IRJC 3QEQA 2ZSWA 4HLZH 4CW1A 3LOWA 1RIHL 5C0CD 4Q2ZA 3ELAT 1JL8A 4M6MH 4X6BB 4CMHB 3I6LE 4NO5A 3HG1E 4GG6E 7FABL 3QEQE 3BVNB 5I1GL 4JKPL 1ZV5A 1U3ZA 4R2GC 3EYVB 1IEAB 4NOFA 4X6FB 5CBAA 1EK3A 3PV6B 1YEJH 3RNKA 2BCKA 2JCCA 1RULL 1DDHB 3HUJF 5DHYA 4CU6A 3GSRA 4IJ3C 2KKQA 4QTIL 5ERWB 3ZDXE 1JFQL 2X41A 4LPYA 3TJHD 2JCCE 3OKNA 2ICCA 1SEQH 4D9LH 4ISVA 3GSVA 3V7AG 3FQUA 4FZEH 1EAJA 1A6ZA 4S1QL 4OLXH 1ZLWK 2X89A 2YPVH 3KDMB 1JTPA 3P9LA 3PJSA 3PGDA 2GTZB 4FP8L 1H9VA 2M26A 3TBWA 4HXBL 4C56D 3BGMB 4WVRA 3GSWB 3IJHA 3OQ3B 4XPTL 3TIDB 3WFZA 4QGTA 3GJFK 3IU4L 2RHEA 1BJMA 5F7DB 3DJ9A 4QRRA 4X7TB 3O3BB 3TZVC 1T1WB 5EH1A 1EO8H 3V5KB 1QSEA 1EXUA 3BIKA 4JE4B 3OWEA 5DQJA 1LEGB 4QRRE 3QUZD 1E4XI 2F58L 1MCSA 1JPGA 4JO1L 3BE1H 4JY6B 1QSEE 3TO2B 4L3CB 1GXEA 2AJSL 1ETZA 1T7YA 5BRZD 3DVIA 1LHZA 2YUVA 3HE6A 3QNYB 5CJXC 3EJYC 5D8JL 3NFNA 4YFDB 3KLHC 1BBDL 4Q9CA 3O8XC 4N9GB 4G6KL 2GYSA 1NCBL 5A2IH 1YMMB 1GPOH 3MRBB 5L8LB 4JFQB 4LNRA 4LSQH 2Z35A 1IC1A 2QL1A 2OL3H 4UU9A 1AE6L 2NY7H 5ADOL 3EZ8A 1G7IB 4XNQB 2FATL 5FYLD 2CSPA 4ZAKD 2FJFA 1N5YH 1MVUB 3CK0L 3L5XL 1O5DT 3RVVD 4PB9H 4MA3A 4FQ2L 5DD0H 4RGNE 1G7PB 1JMXA 1W0WA 1HH6A 2UUDH 4OI7A 2CGRH 2NY1C 1YC8A 2ZWLT 2GY7B 4UT7H 5CJ8A 5C2BH 2VABA 4PJ5A 4XC3L 3T0XA 4BQBA 3HTLX 5B21A 1B6DA 1BVLB 1CGSH 2VLLA 4QRTB 4TRPH 3OKEA 3EYFB 4KQ3H 5L88H 4KROD 2VZOA 2XQBL 5F7YC 1BWWA 3O6MH 4PJ5E 1XIWB 4M9PA 1KJ2H 3BO8A 2VZ3A 1P7KA 4YBHA 2ARJB 2YWZA 1KXVC 2NNAA 5C0AA 1F3JB 4FQLH 3DNKA 2XWTB 4LASH 1FLRL 4FTVD 1JPSH 2XQYG 2A6JB 2NZ9D 3GHBH 4HIIB 2H45A 2A74A 2P8PA 3FRPG 4C56B 3MRDA 2VQTA 4KKCD 5C0AE 1OAQH 4NQSA 1XF2B 3A6OA 5EN2B 3ULUC 5C0BB 4ONGH 2A77L 5EBGA 1EFXA 5IBLD 1T03H 3TWCH 5E7BA 1ED3B 3BKYH 3HZKB 1JGEB 1AHWB 3PV7A 5ICXA 5GGVH 5I1AA 1YY9C 2L4OA 2FHFA 5DRZA 1N0XH 1QTYT 2O26U 3O6FC 3RTQD 4JANA 3QR2A 1MI5D 2NXZD 3C6SB 4E42B 1VSCA 5DVLA 3SDAC 1FYHB 3RVTD 4ZS7H 2BRRH 3QEUB 2W9EL 3U6RB 5HDBE 1M05B 1T0PB 1TETL 5INCA 3AS0A 1S7SB 2XN9D 1F2QA 1I4FA 1M71B 1A9EA 4HKXB 1NC2A 4TUJA 3D3VA 1T1XA 3JWOH 3BX7C 5K9QG 2EZ0D 4BFIB 4RIRA 1NEZG 4P57B 1ZANL 3NFPA 1A6VL 3D3VE 3ARPA 1N7MH 2FD6L 1KC5H 4G80B 2XV6B 4Y4FD 1HZHL 3B9KC 5F3BA 3N06B 3U30C 2W91A 1TNMA 4P2RE 3A6CL 2OJEA 3H7LA 3W11D 4YBLB 2HJKA 4H20H 1LD9B 4ZUTB 1JGVH 1HI6B 3ZTNL 1Z5LA 1UCTA 1S7XB 3QHTC 5DJ0A 3QIBC 4HF5L 5IEHB 3B2VL 3BWAB 3JUYA 1KTKE 2EDXA 3PABB 4PRNB 3MRHA 2I9LA 4JPKL 5I0DA 5HHME 5AG9A 3LS4L 2HT3D 2NTFA 4QWWD 2H8PB 3T65A 5CSGA 5AYUL 4FZ8H 1X5XA 3G6AA 1IBGH 5GHWH 3SDCC 2DKUA 1H5BB 3S8WA 3S88H 4L8CB 2VDKL 1U91A 5GGUA 2H9GA 3MOBL 3T0EB 2WBJC 4HX1B 3OX8B 2ZOKB 1OCWL 4P46D 1Z0NA 2VMFA 4PLKC 5J9PA 3JVGC 1J8KA 3V4PL 3BXNA 5EBMA 4QRUA 3RTQB 2CJUL 3KG5A 2YRZA 2ZZUT 3UTOA 5IB4B 1HILA 2EC9U 1C5CH 5GGSB 1MHHA 1C1EH 3NCJH 3UCRA 4HJJH 1WZKA 5CD3B 12E8H 3VXSD 4R3SB 1BZ9B 5EZLA 3Q5YA 5E0QA 4KKLC 4ZXBB 2IH3A 2NY4C 3X14B 1AGBB 2UV3A 4EKXA 1L7IH 3FQNA 4M7ZB 4TN9A 4JFEB 5CHNB 1KOAA 2I27N 4X9GA 3H9HB 5MHSE 4XX1E 3O6KL 1NMBL 5F7UA 2GHWB 5DJDA 2FEEL 2Q7YA 3QFDB 1FVCA 2H3NA 1CGUA 2HT2C 1NFDB 4OM0H 3FO9B 4F7CA 4N0YH 1M7IB 4HIEB 1A3RH 2RCSH 1ZLUK 5T3ZH 1RUMH 1YEFL 2G5BA 1QBMH 4WTXA 3QUYC 1BREA 3KAAA 2RR3A 2DBLH 4LRNL 5FK9A 1D5ZB 4LSTH 3MRJA 1T3FA 1I8KB 3LKRA 3UBXB 4LFHG 4OQTA 1WFOA 4JG0H 5H8DA 1PW3A 1ONQA 2IEPA 2FHBA 2HFEA 3C9NB 4BSJA 3B9EA 1ZTXH 4KK8D 2AW2A 3IETA 4QRRD 5LAXA 3CH1A 4R26H 3QISA 3QUXA 2VDQL 3RPIA 3K8MA 1QSED 3RNQA 1PX4A 3REVA 2YK1H 1TTFA 3WO4C 3S4SA 4D2NA 5JQ6H 1QLEL 1AD0A 4WI8A 5FO8B 3RY5A 2NY2B 1RU9H 1X3DA 1RZKH 4TTDD 4J2XA 1MFDL 5FOJA 4IHOB 3DUSB 3QXDB 1FFRA 3HE6D 5C0JB 1WV7T 4JB9L 4E41A 1A4KB 4OSUH 5D7SL 1KJMB 5CEZE 4CBPA 1HQ4B 1UA6H 2W92A 2VDRH 3UTTD 2VB5A 3GSUA 1U92A 1U3HD 4YE4L 4E41E 3D1MC 4L4VA 2R2HB 5E2WH 3VXSB 1R3JA 1IKFH 4PLJC 3U0TB 1RY7B 1XZ0B 4PBVC 2DQGH 4HUWB 5E4EB 3BZFA 4L4VE 1ODAA 4FABH 2DTMH 5FV1L 4KKNA 3ZMRA 4RGOH 4GMTH 4G8IA 5EU3B 4HS6A 4CVZB 1PQZB 1OAKL 4CDHA 4C83A 2R0LL 4WUUB 3CFCH 5C1MB 3LKOA 4NRYA 3VFWB 3DGGB 1S78D 2DQHL 4M5ZL 4PJIB 2X4QB 4YFLF 5HGHB 4URTB 1ITBB 1OGAE 2XYCA 4N8CH 4NFBA 2R2BA 2HVKB 5FDWA 2GCYB 1NFDF 4HT1H 5LWYH 2J7LA 1R3IH 4NNPH 2VRAA 2IQ9L 4Y5VB 3RPKA 4G6AC 5L2JB 4LCWA 3V0WH 4CN6A 3KPNA 4KU1A 1YPZB 4K2UH 1I1FB 1N59B 5C0AD 4OZGB 5JW4N 4LCWE 2FGWL 5DI8A 5I17A 1IGMH 1ZA3A 2A73A 3HC0B 1MFBH 2HLFD 1NCWL 3QI9A 1EX0A 4YXKH 1AD9A 3GBMH 1E6JL 1BBJB 1MF2H 3EYQC 4KK6D 4F7TA 1AGFB 1HHJB 3VDCA 3ULUL 5E6YA 1H0DB 2LQRA 1HHGA 2CDFB 4KVCL 4HS8L 4RMRA 4KI1A 1WK0A 4JY5H 3VXOB 3QCTL 5IW3A 5L2KB 3O81A 3MRIA 3S36H 3GO1L 5FUZL 1DCLA 4PGEB 3T08A 3L3HB 1R3LA 4KZDL 2VXUL 5IT2H 2ZCLL 1BM3L 1GOGA 1LNUB 2JTDA 5FUCC 3JV0A 5I76B 1KCSL 3C8HA 3UTTB 2HKFH 1U3HB 5DRWA 1ZT7B 5ALBL 4WI5A 2A6IA 4CGTA 5MP6L 4XP1L 4U33A 1OTTC 1TTGA 1KB5H 2UYLB 4XMKL 1J11A 4YDVA 3GJFH 5GGSY 3RVUC 5CJQL 1IGCL 1NC2D 1LO4L 4W6YB 5JW4Q 3ROLA 1LK2A 4OCNC 1JHKL 5JNYA 4JFPA 5AWNH 2COQA 3DBXB 2ICEA 4M7KH 4ESKA 2R0ZL 3CFEA 5HHVL 4R7NB 4F8TA 1RZJH 1DBAH 2VERN 5KSUA 4FQXC 5CJ5A 3NIGE 3L3IA 1HWHB 2DQCH 4P2RD 3GSXB 1S9KC 4D0CB 5I2IA 1BGXL 1RFDL 3NABH 4XXCC 3ABZA 5ALCH 4S1DC 3VFSA 4JQXC 4J4PC 3DETC 4AQ1B 3K80A 1KJ3L 3MA9H 4YBQD 5FO9B 1NAMB 3R06B 1DBBH 4U1GC 5HVGB 4UIMB 1U36A 2J5LB 1UCBH 2UVFA 5D9SB 5HHMD 4OV5B 2CH8A 1RJYB 1FH5L 4Y5XB 1AC0A 1NGPL 2ICWA 4BUGA 2CK2A 2X4NA 4OZGF 1U3JA 2BVPA 4G8GA 4YDIH 2XZZA 4DGVH 4U1SA 1RSFA 3M45A 2OMBA 1H3GA 1CLZL 4C57C 4G8GE 4HCRH 1Q9OB 4U2YA 2EYTA 4JRXA 1F6AA 4AM0A 5J6HA 3H3KA 2KH2B 4PUBH 5E2UL 3PHOB 5C86A 1E4JA 1XGYL 4XCNB 3L3DA 3FKUS 1RJCA 3QQ4A 2VISB 2AEPH 1JBJA 4JRXE 5FF6A 1JUFB 3EHBC 3TN0A 1UYWL 3HNVH 1UT9A 2XA3A 1IFHH 4X6CF 4KWUA 5IV2B 2IADA 1OTUD 4OBRA 2P44B 5DUBB 4G3YH 2IPTH 1A1NB 2OTPA 1NKRA 2YD8A 1RZIA 4YDKL 5F7HA 5J3HC 4ZTOH 1SY6H 4G6JH 2QLVB 1I7RA 5DHVB 1V7NH 3I2CH 4JAMB 5MHSD 2WBWB 2X4RB 2VL5A 4MAUH 5EC2B 1FLTX 2BSTB 4Q97A 4R7DA 2PYFA 2KZ1B 2VXVH 3VW3H 1YEJL 2R1XB 4P23A 4NO3A 2B7DT 3IFPB 5A2LH 3WLBB 4LCUA 1FZMB 3KLSA 1FFQA 4P2RB 2FECL 2GSIA 1E27B 3IFOA 4IOSD 3WXWH 1DQDH 4BJLA 3OJDA 1SEQL 4D9LL 2FH8A 4FZEL 4OLXL 3WKNA 3TJHC 3EDDA 4ZOAA 3OG4B 4R0LB 1C5DB 4D9RE 2YPVL 5JHDA 3F12A 4QHUA 3MYZA 1EGJA 1HNFA 5D2NA 5CS7A 3IDNA 5A43C 1NGXA 5DT1L 2CXKA 4IS6A 5IMKB 5JHDE 4O58H 2P48B 4M9OA 5E24E 5D2NE 2QQLH 3W2DL 1TCRB 5INDA 2ARWA 2X4UA 1EO8L 5D7LA 4AEIH 3QZWB 4X7TA 2GJZA 2FDBP 3QUXD 2M2DA 5D7LE 1HE7A 2HFGH 1AHWC 3K1KC 3QUZC 4UQ3B 5IROA 5GS0H 2CKBL 3D48R 4RA0C 1RV6X 4YIQB 4H0GA 5CEZD 5FYKU 3U82B 3FT2B 3PWNA 3QP3A 4HG4K 2J4WH 1T80A 4E41D 4GH7B 4N0UA 4QXTA 1GPOL 4ZTPH 1H8OA 3MLTA 1U8QB 2OL3L 2NY7L 2N7AA 2XPGA 3L7FA 3ZKXC 5F6IB 5JMRA 3F7YB 4N0UE 3RL1A 1QFUH 4L4VD 5H35A 1N5YL 5KG9B 2DWEA 4U1HA 1HSBA 5E8PA 5GIRB 4ZMAT 5DD0L 4LQFH 4ZAKC 5CWSA 3RVVC 1MVUA 3LEXB 1SYVA 4ZQKA 2CGRL 2MKLC 4KDTA 1G7JB 2E7LC 3PWVA 4UT7L 1UVQA 3BH9A 4YHPB 3JSSA 1OGAD 5C2BL 1ORSB 1SQ2N 2IH1A 3OB0H 2V9QA 4KRPD 1CGSL 2DWDB 4I0KA 4TRPL 4Q0XH 4KQ3L 5L88L 5GRYA 2ATPA 2AXFB 5IB1B 1OM3H 5D7JB 1R5VA 3O6ML 3B8SA 3UZVB 5J4MA 2FWOB 1KJ2L 5FKPB 3IDYB 4KROC 4OCXH 3CD4A 3KPRB 4Y16B 3DPBA 4LCWD 4FQLL 4LASL 1J0HA 1X5IA 2NXYC 3GHBL 5EPMB 2EH7H 4UV4H 1FL5A 1K6QH 4M43H 2NZ9C 4LEOB 4MMZC 5H94B 3E2HB 2L0DA 5EO0B 4QOKA 3QI9D 4JRYA 4X5WB 4BFGA 1HYSD 4KKCC 4Z7UB 4ONGL 5DA0B 1T03L 3BD3A 5C07A 2I60H 4QOKE 4JRYE 3S9DB 2BMKB 5GGVL 2WIIA 5IBLC 3WS6A 5FOBB 1FIGH 4MJ2A 1N0XL 1ZLUH 1P2CB 5C07E 5FA4B 4KTDH 4I0PA 4BQCA 3G6DL 4U3XA 5F97E 3WDIA 5JUEL 1UJ3A 3VH8G 5C2UB 5EUOF 4DEPB 2NXZC 1UEYA 3GMRA 4WY7H 4ZS7L 2BRRL 3C6SA 3DVNA 1OT2A 4XBPB 3F5WB 3VRLE 5E6IA 3U36A 3QCUL 3RVTC 1NLDH 2XWJA 1YN7A 3LEVL 4YDLB 5TH2B 3AUVA 3Q1SH 4K9EH 4LGSB 1BQSA 3LSOB 1Y6MR 4PRIA 2EIBA 2UWEB 1JF5A 5DYOA 5IMMA 1QLRA 4K7PY 4K7PH 4CVXA 4NRZB 3FAXA 3U0PA 4LHUA 1RZJC 3HMWH 2EZ0C 3T77B 4AMKH 3V6BR 1CG9B 4NM4H 1N7ML 3B9DA 4J6RH 3ROOB 3MRPA 1KC5L 2C26A 1BOGB 2P8LA 1EHAA 4Y8DC 1K9TA 5DHVH 2J1KA 4NCC1 4L29B 2R39A 3O4OB 1OGAB 3S5LB 3IDGB 5DRXB 5C0ND 3SDXF 5TFSL 3SE4A 3HC4H 1T2JA 4Y4FC 1YDPB 1XH3A 5E7FA 4XI5D 5J1SC 1QSZA 4Y4HB 1DQJB 4WDIB 5DLMH 3FO1A 4DOHB 1JGVL 5C0DA 1GGYA 1T22B 1MEXH 1X5FA 3W11C 2I07A 2NZIA 5IG7B 2PKDA 1V3MA 1VEMA 3GSNL 3V6ZB 3ARFA 2EEDA 3MCKA 3QYCA 2A83B 4HKZA 3T1FA 4DJMA 4MD5A 4O51A 1QACA 1MY5A 2BSRB 4FZ8L 1G6RA 2FIKA 4G8GD 1IBGL 3DURA 3OR7A 5GHWL 2QQNH 4P3CL 3K2MC 2F19H 4WEBL 3F6LA 1CGTA 2HT3C 4QWWC 3S88L 1VFOA 5ESVB 1QFWI 1CXEA 4QTHA 4ZUUA 1OAYH 1JPFA 4P5KB 2M1KA 3D85A 2OQJB 4LU5H 4JRXD 1D5BB 3DIFB 2WZPD 1A02N 2ICWI 2ZJSH 1F42A 2FGZA 4XP5H 5KSVB 3T0EA 4P46C 3MACL 3WCYA 1TVBB 4L9DA 5E5MA 5BV7B 3BP4B 1IM9D 1C5CL 3SGDH 3TN0D 3OXSA 4Y1AA 3PWLB 1C12A 2C5DC 2DQTH 2YHGA 1A21A 1C1EL 3KWWA 4HJJL 1N5AA 4PJBF 12E8L 4Z77A 3PQYA 5FO7B 4KAQH 4O2FB 1RUPH 4Y1AE 1ERNA 4P48A 4UINL 3VFRA 3TBSA 1BIIA 3PQYE 3T4AB 5T1MA 2JIXB 3MFGB 4WJ5B 2UWEF 3C8KB 1L6XA 1YN6B 4MSWA 2PF6A 3OPZL 5EFIA 4JDTH 4P23D 2RAMA 3AMKA 2XA8H 4LVOB 5FDYA 4N0YL 2RCSL 3SKOA 5T3ZL 1PG7L 1RUML 1XGTB 1QBML 4D9RD 4DCQA 4M48L 1FFNA 3DX8B 3FO2A 2DBLL 3ZDYF 4ZPTB 4LSTL 1W72L 1D6EA 4HWBL 2YD2A 3PWPB 5F88A 2F9BT 3VFOB 2W60B 4XWOD 1F5WA 1ORQB 3ARQA 4PS4H 4JG0L 2EO1A 1I8LA 1ZTXL 4OLWH 4GRWE 3SE8L 4X9IA 1NCAL 4R26L 5D7LD 3JWDC 4KK8C 2YK1L 2ADGB 4MJ4A 2BVUA 5C9KA 5JQ6L 4HWEH 2Y23A 4EN3D 1RU9L 3F6IA 1UACH 1RZKL 4JJHA 5HYJB 4PR5B 4YGVB 2ADJA 1GHFL 4O02H 4EI6B 2WQRA 3D0LB 4I77H 4MMXC 4TTDC 4XGZB 3OKMB 3SHSA 3N1GC 5DK0A 4OSUL 3P73B 2AQ1A 4HLZG 3WN5C 1IM9B 3HE6C 4MLSA 2A6KA 4MDIA 2VDRL 4JQVC 1B88A 1GIGH 1MCDA 4FQCH 2A1WH 4HFWB 5E2WL 1IKFL 3CVHA 1U3HC 3S35H 4TPRH 3HZVB 4YDJA 3GEWB 4FABL 1C5BH 5TDNB 2DTML 1PZ5B 3PP4H 3TCLB 1CDYA 4GMTL 4HV8A 4RGOL 15C8H 2W0FA 3CFCL 5FYLL 5B3JF 4Y0GA 5TJWK 1DFBH 2PW1B 4WI9A 2BOCB 1S78C 3DYOA 1L9MA 3FFDA 5E8OB 5DC9B 4N8CL 3TBVB 3QQNA 3VXUA 3WL9B 5LWYL 1N0LA 4HT1L 1R3IL 2Z4QB 1GC1C 4NNPL 2YN3A 2OX5A 2XTLA 3LEYH 3V0WL 2HVKA 3VXUE 3B5GA 4P2YA 3VFGH 4CADA 3OHXB 4OTXH 1KYOJ 1EMTH 4OGXH 5ETUA 3PIQB 4K2UL 3PNWA 4D8PB 3HI1B 2J5LC 1IGML 4LVNB 1B0GA 1MPAH 2L7JA 2EIDA 2NY3B 4ZO6A 1AH1A 1S9VB 2YD7A 3QJFB 3M1BB 1UM6H 3S37X 1CDUA 4YXKL 2HLFC 5M94B 3GBML 2AGJH 3E6HB 1IGTA 1RQ5A 3PDDA 2F74A 3FFCE 4QOKD 1MF2L 2SEBA 1NDGB 5BZWA 4ZFFA 3I75A 3BP5B 3ARXA 2H1PH 4MCYB 3CC5B 4KK6C 4KVNH 4GLRH 5C07D 4PJEF 3SOBL 4FNLH 4I3SH 4EN3B 4HUNB 4LMQE 4XT1C 3CXDH 4NZJA 4AG4H 4JZJB 5MEQA 2YD3A 1H3PH 3LKNA 3MOAH 5B38G 5C3LD 4I0PD 4N8PA 3VXOA 5IT2L 3ULSA 1PKOA 4BKLA 3TH4T 4X6CA 3NZ8A 5IKCA 5L9DH 3QHZH 2D4DA 2R23A 2IANB 4K9EC 2OYPA 2IQAB 2ED7A 2HKFL 1I9EA 3P9MA 3EO1B 5BV7H 4X6CE 5JW3H 3DX6A 3X11B 4TQEH 1KB5L 1EA9C 2V2WA 1J5OH 5LGJA 1X5KA 2X1WL 5FECA 5D70H 1FP5A 1MNUH 4ZUWB 5BMFH 1TJHH 5JORB 4GXVH 4YGAB 3L5JA 5AWNL 2UY6A 3DMMB 3QG7H 1QQDB 2AAVA 2EDQA 4PJFB 1EZVX 4LHUD 4M7KL 1P9MC 1SJHA 3O9WA 2QR0A 1RZJL 3C5ZB 1DBAL 2V2XA 2DQEH 4P9HH 4W4OA 2DQCL 4UAOC 1FE8H 2BP3A 3NABL 2FJHA 2R0KH 2W1NA 1UZ6E 5ALCL 5GRVL 1F8TH 3N1QC 1MUJA 1HQRB 4NOBA 3V6FB 2R4SH 4Q6IB 3WHXB 3MA9L 1A7PH 3NA9H 1RK1A 4RMWA 5SV3A 1DBBL 5IHZB 5DJ6B 1UCBL 4YBQC 3KYKH 4LPXA 1INEH 1D5XA 2X1PA 3NIDE 1T4KA 4LAJH 1MCPH 3ZE2F 5HHOB 5I71C 1X6NA 3WJJC 5J7CC 3ETBF 4WO4A 2CLVA 4EQ2A 1UXWA 3X3GH 1S8DB 1AFVH 1AY1L 5EZJA 4YDIL 5DFVD 3TNNA 5IB5A 4HMCA 4DGVL 3AY4A 3LQAH 3K3QA 3RU8H 2AJXH 2GFBB 4HCRL 3MV11 5HHNB 4KJWD 2YEZA 4PUBL 4XCYA 4JFFA 4A6YA 2VLRB 4PGDB 1UM5H 5DEGA 5IHBA 2B5IB 5C0GA 1BLNA 1PJ9A 1IM3A 3D85D 3E1F1 2AEPL 2OMNA 4LDEB 2BNQA 4W81A 3CXHK 1M6OB 4JFFE 3HNVL 1P4LA 1W8NA 1KPVB 1IFHL 5EO9A 3RUGA 3SKUD 3BZEA 3E0GA 2Z93A 2IPTL 2BNQE 1G9EA 4LPVA 5D1ZA 4Y1AD 3C6LD 1OTUC 5E4IA 3RUGE 3OG6B 4ZTOL 1J0YA 4V1DD 5ID0A 1SY6L 4G6JL 5TQ2H 3S98A 1UWEL 1JF6A 4UDUA 3PQYD 5HGBA 2JB5L 1WWAX 3FN0H 3PF2A 4JJ5A 1V7NL 3I2CL 5KW9H 4G8EA 4MAUL 5KVEH 5HPMA 2HYMA 1IJ9A 3AREA 1FYTA 1TVDA 2VXVL 2H2SD 1K8IA 4ODXB 2EYRA 1OP5H 4KRLB 1BFOA 3FT4B 3LKQA 4PJFF 5DEFA 1ZLSH 1VFMA 2AK1H 1CXLA 3QEHA 2QJDA 3N50A 1FYTE 1KFAL 4Z7QF 2CRMA 3RDTD 3NTCH 4YR6B 4ELKB 1XGPA 1DL7L 2QKIA 5H2BA 3WXWL 1DQDL 2FZ3A 3PWJB 1P7QB 4N8VA 3NCFB 1ZAGA 1X5GA 3LQZA 1F58H 1UB6A 3IYLW 4ZUVB 3FT3A 4PGCB 1PLGH 1WBZA 1ZT1A 3EO0B 3HCVB 4M1DH 5IEKB 1N3NA 3P4NB 4YFLI 3MJ6A 4O58L 1PAMA 2AKRB 4BA8A 3ES6A 4R90H 3ILQD 3TO4A 3ZHKA 5JPMB 5EIIA 3Q3GA 5KN5B 1B6UA 5JW4R 1OAZH 3IDIB 5HSFA 4AEIL 4P5MA 4MX7B 1EGJH 1CN4A 4MD0A 2GJ6A 4E5XB 4JHZA 3VE0A 1FNAA 1Z2KA 4GXUM 3TPUB 2X4SB 2DICA 4XCCH 1HSAA 3JWDL 5KOMC 3QUXC 2E3VA 1BF2A 2GJ6E 4LP5A 1IARB 1XR8A 4WFHD 2EXWD 2HFFA 4UOJA 4M93C 1FFOA 3UBXI 3FQWB 3HNSH 5IW6B 2Z91A 4OZFA 4TUKH 1OARH 4YQXH 5I73B 3MJ8A 3FTGB 2X9WA 5EUOA 1F11B 4ZTPL 4ETYA 2DD8H 5DJXA 3HMXH 3VGAB 5BVJB 3C6LB 1C08B 1EEZA 2IMNA 4V1DB 3EO9H 2F54A 5EUOE 4UMGA 3TM6A 4R96B 4YHOH 5F7FA 4YDLC 5MEOB 5JIIA 4LQFL 2DMBA 4N5ED 1LEKA 3RFZC 1CD8A 2F54E 1LE9B 5FB8A 1K4DB 2X7LA 2KQMA 3G6JB 1KENH 1RZ8A 5IK3A 5SWZB 5C92A 1LO2H 5D93C 5EDXA 1T1YA 1V05A 4Q0XL 4WGWB 4JFXA 4PJ9B 4ZFGH 3CCHB 1SJEA 3SDXA 3VGBA 3RDTB 1OM3L 3KS0H 3Q6GH 3P40A 4KRPC 2C4FU 4MJID 3VXUD 3VFVA 3MNWA 4Y2DD 1CFSB 5IMLB 2QBWA 1KLUB 1EBAA 4IM8A 3SDXE 4J3TA 4EXPX 3BIAX 3GMNB 5FAAA 5JW5A 1NQBA 1X7QA 5DMIH 3QWOA 4OUUB 1T20A 3T4YB 3KHOA 4KUCF 4JPVL 2EH7L 3VFTA 5T1LA 4M8VA 5C0EA 1K6QL 2IAMA 2IC2A 5DJCA 4M43L 4HUVA 1HXYB 1S7WA 3FFCD 5F6HI 1MJJB 5T5FL 2IBZY 2MFNA 3RWFA 3U4BH 5BVPH 2ARJQ 4D0DB 3QI9C 1XMWA 1HYSC 4EQ3A 3EOAA 2YBRA 3PL6A 1X5YA 2YRLA 4Z8FH 1F3DH 2B4CH 3WNNA 1N2RA 1FIGL 3HAEA 2BVTA 1QHPA 3IJYB 3DOSA 1VGEH 4KTDL 3PDOA 1ZHBA 4KC3B 5EZOH 4I4WB 1XGQB 1B0RB 1V3LA 4Z7VB 4GUPB 5I75C 1A7NL 1PD6A 3QHFH 1CFQA 3FOMA 1ZVYA 4IMLA 4WY7L 4JZNA 1FAKT 1RHHB 5CD5D 1JNLH 2V7NB 2AJYH 4O9HH 4TYUA 5IVXB 2IG2H 4HIJA 4PJBA 4NC1C 1NLDL 2NYYD 2JB6A 3LDBB 4M1GL 3I3DA 2PN5A 1WITA 4K9EL 5IR1A 3PUCA 2Y5EA 1QOKA 3EFDL 3LRSA 1BQHA 4PJBE 1YEHH 3RWDB 4QHMA 1AXSA 3HMWL 3LH2H 2F5BH 5FYKH 4AMKL 4NM4L 2EIEA 2UWEA 4J6RL 4O2CA 5F1SA 1CDIA 2D0HA 4QHNA 1FZOB 3GMOB 2PYED 4JY4A 4RA3A 3O9WD 4NWUH 3ZDZF 3QDJD 3V8CA 2QV2A 3M17A 1JZ8A 3HC4L 3IDMA 3WS3B 4M6AA 1CXKA 1J0KA 5EOQH 1P4BL 3L3OB 3ZHLA 3MA7A 1TQCB 1A4JA 5DLML 5ANMA 4MJIB 2Y7QA 5DDHA 4XI5C 4Y2DB 1UM4H 1GRWA 2NY0B 5GSRA 5I1KH 2C7UA 1MEXL 1KB9K 3P4MA 1A9BB 3Q6FA 4PJDB 3V52H 3QRFM 5ANME 1D6VH 2V5RA 3LB6C 1E28B 2OSLA 5BO1H 2WUCH 1BX2B 4LCCA 1J05A 3ZDYE 1FZJA 1AO7E 2YA1A 4NO0B 5I1JL 3LQAC 5DR5L 3VRIB 3UTZB 3B6SB 4WO4D 4UOW0 2P4AB 4L4TB 1U8MB 4NKDA 2QQNL 2F19L 3BPOC 5IQ9B 1I3RA 1EJOH 2BVQB 5F9JB 1H8SA 1OAYL 4PJ8D 4X7DC 5JOPE 2E6PA 3ARZA 3ILPA 3PGCA 4OGZA 4X4XA 2ZOLB 4X98B 1TIUA 2ZJSL 4JFFD 1FZKB 1BD2B 3CGTA 1XF3A 4XP5L 1PDKA 1G6RH 1JE6A 1CE6B 4JCLA 3K7UA 3VD9A 2BNQD 4RISH 5JHLH 2W65B 3L3GA 4HAFA 3IXTA 1T1ZA 5KSBF 4RFEB 1HH9A 2VQUA 2DQTL 2I25N 3OAUL 3QG6B 4Z7VF 3WIFB 2IPUG 4Q9BA 1KIRB 5K59E 4JGMA 1FIEA 3TN0C 1MQ8A 5I6XB 2WV3A 3L7EB 1QEWB 43CAB 4WTWA 2MKWA 3EYOA 4U1LA 3WIIH 3RX7A 5TE6H 4HGWB 3MFFA 2AQ3A 1KG0A 3BQUA 2HFTA 3T0VA 3VXNB 1NJ9A 5E03A 3ARED 4FXGB 1FYTD 1T7VA 5HYSA 1ZS8B 1UADC 3NGBB 4RFOH 2PYEB 1CDBA 1XF4B 3VXTB 4L5FH 2XA8L 1Q0XL 3STZB 3QDJB 4P23C 5B3JE 2NW2B 4XHQA 4NNYB 1JWSA 4LLUA 3KHQA 3V9FA 4YPGA 3DRTA 4WUKH 4FQJH 4UI2A 2JK5A 5GZND 5ESAB 1BFSA 3KS0J 4OZ4B 3UTQA 1QYGH 1KLFA 5D4QA 1TVHB 2Y72A 5DVKA 3MV9A 4GRMA 3I6GA 4PJDF 4HBCL 4MQ7A 3UBXG 4PS4L 3GMPB 3UTSA 4XWOC 4LVNC 4GKSB 3VFOA 5IFJA 2VIRB 3KPLA 5D2NC 2WK2A 3H6JA 3MV9E 2Q6WA 3TO4D 5FCSH 4OLWL 4P4RB 3UTSE 3FCTA 4PJCA 4PJ7A 1N6VA 5F7LB 4JREB 3HZYB 5KVMC 3KYMA 3RX8A 3TBTB 4GRWH 2GJ6D 2MHAB 4PJ8B 3U4EA 1A7BA 1UACL 2CLRA 5C09A 1K4CA 2X4TA 3HPLB 4PJEA 5GPRA 3MJ9H 3Q5TA 1WUNT 4PJ7E 4PJCE 3MSPA 1DBJH 4O02L 3P4LA 4ZFZA 4EN3C 2Y25A 1G1YA 4I77L 3OV6A 1NDMA 1F3DJ 5C09E 5SWSA 4PJEE 2C1OB 4PREB 1KLGA 5MERA 1T5WA 4NRXA 1GIGL 1A6TA 4FQCL 4PY7B 4X7SH 2XG5A 4MB5A 2A1WL 4YHMH 3OKOB 5SWSE 3HRZB 2CMRL 4KXZH 5CEZL 4OF0A 1MHCA 5CKAA 1SYSA 3BP7A 2YPKA 4GS7C 1R3HB 3S35L 1ZVSB 2XNAB 4TPRL 3QB7C 3HS0B 4KJPD 2F54D 2RB8A 3OKKB 4XCEB 5CJOH 1Q0YH 4XP4H 1C5BL 3PP4L 1WICA 15C8L 3BEVA 4Y2OA 1JWUB 4Y7MA 3TYFA 2FIRT 3MRRA 2AJ3A 4JHAH 3G5XB 3TNMA 3ZE0F 3RAJH 1IL1A 2H32B 3RBSA 5DQ9B 3TCLA 5SX4I 1WC7A 1DFBL 4EUPA 5TQ0H 3BW9B 4AT6B 1J86A 1FFPB 1WT5A 4FFWD 1ZA6A 4UIKH 3F7RA 1FO0B 1CFNB 4MJ5A 3W9DA 1OF2A 1D9KB 4XZUB 1WBXB 4Y4KA 4J3WA 3MRNA 1HEZA 3K8KA 3LEYL 3F58H 1Q9WB 1KT2A 4Q6IC 1I1AA 2H6PB 3VFGL 3CMOH 3I3BA 4OTXL 2F15A 5I0ZA 1EMTL 3ARDA 4LLQA 4OGXL 2VAAB 1CU4H 2R9HD 4G9DB 3K4AA 1MPAL 5KSAB 3KR3H 4WFEE 5T1LD 4WU5A 1ZOXA 4ENED 3B83A 3CUPA 4JCMA 1MCWW 4GBXA 3LV3B 4BH8A 1U2CA 1BMGA 5F1NA 3ZE2E 2B4CC 1J12A 4IMKA 4GAJH 4FQQA 4PRAA 4F7MA 4R6UA 2H1PL 3R8BB 4S2SB 4KVNL 2EXYD 4XNXH 3RA7L 1CK0H 3BRGC 4FNLL 1KXQE 4H1LB 4I3SL 3PL6D 4DTGH 2P8MB 5KZCB 3CXDL 3G04B 1IE5A 1KPRB 4AG4L 4NKMA 4EDWH 5D6CB 4I1NB 4I48A 1HHIB 1H3PL 1NBZB 3MOAL 2BNUA 3GMMA 2PCPB 4ZFOB 2FX7H 3MJ7A 5E2TH 1BQLH 3WS6C 2CUIA 5HPOA 3WE6A 4NT6B 1S7QA 5L9DL 1RJLB 3QHZL 4I0PC 4ONOA 2YD9A 5IVZB 5J11B 5D5MB 1GGCL 1KN4H 4NQDB 5HDQH 1UJ3C 5JW3L 1IGYA 3BN9D 4TQEL 5K9KB 1J5OL 5IUSA 2OTWA 1WCQA 3QCVH 4NGHH 5D70L 3VCLA 4YNYA 4HFUH 5BMFL 1TJHL 4GXVL 5JTWA 3ME0A 4LCYA 4HDIB 3L9RB 5ID1B 5T1KA 1RK0B 5K33A 3UYRH 5HY9A 2PTTB 5E9DB 2C1PA 1KIPA 4Y19D 2DQEL 5FKAA 4FQHB 1KCKA 4PTTB 1FE8L 1FL6B 2R0KL 5GISH 3I85A 4TNVF 2R4SL 4G6MH 2AJZA 3BUYA 3SE4C 4Z7QE 3NA9L 4MA1C 4KTEL 3NPSB 5ACZA 1YNTB 4X5XB 4RX4A 3KYKL 4X7EC 1INEL 5DVNA 3VXMB 1G7QB 1AO7D 3ZLQC 4JVPA 4ODWB 3NPZB 5GGTA 2DF3A 1KN2H 5B22A 4X7FC 5LG1A 3T2NH 3X3GL 5IB2B 3CMGA 1AFVL 1M1SA 4U1NB 2GSGA 3LQAL 3RU8L 3FB5B 2AJXL 5JOPD 5DSCA 3ZYOA 3QDGB 5DFVC 3PG2A 1A6AA 1WISA 3NACH 1XCTA 3LHPH 2DAVA 1UM5L 4RBPH 5TE4H 4KJWC 5SWQB 2VXQH 2BY1A 4WV1B 4ODBD 3V5DA 5DURD 2IGFH 4IIQA 4PRPD 2VR4A 4HSQA 2YN5A 4P2OA 4X99A 3FOLA 3RGHA 4A6YH 5I73C 3GKZA 2E8YA 2FO4A 3B2UD 5TQ2L 2Z31A 1V8HA 3LAFA 4XXDA 1CFVH 3VGAC 4MJ6A 4NHUB 4F33B 5I18H 3C6LC 1DUZA 4RZCB 1K5NA 3PHQA 1R5WB 5D5MF 4KGJA 1JGDA 1ZK9A 3A0OA 3TT1L 3RX5A 5KW9L 3IXAA 5KVEL 1RJZB 4N0FB 1IQDB 1AP2A 1UZ8A 1ZLSL 2E9BA 3VFUA 2H2SC 2AK1L 1CFBA 2FX8H 4XHJD 3MXVL 4H25B 1ITCA 3MRGB 4Y19B 5TGBB 4PY8J 3NTCL 4UB0H 2H32H 1TQBC 3IRZA 1JI2A 4BQ9A 5ENWB 5LBSH 2UY7A 4OZIB 3VFMA 1S7UA 5EC1A 2ORBH 3MUZ1 1JWMA 1F58L 5A2JH 4LF3B 1QRNA 1PLGL 3QIUA 1ZHNB 4I8DA 3VD4A 1FJ1A 3DRQA 4XNUH 4GXUN 3C60A 1IT9H 2DRUA 4FHBD 3MR9B 4YAQB 1QRNE 4G8FA 1RUKH 1J8HA 3CU7A 5D6DA 1JTOA 1AO7B 4OZHF 1VB9A 4R90L 4U1KA 3CDGA 5C08A 1ZSDB 3RWJA 3U9UB 5FGCB 5A40E 3UTSD 1A5FH 3BH8B 3S36X 4WI3A 1PKQB 1OAZL 1J8HE 3EOBA 3ILQC 2FJGA 5C08E 1EGJL 3AAZB 5HHQB 1I8LC 4XVSH 3SJVA 4Z76A 3QZWG 1IAKB 4HHAA 3SKNA 2YKLH 1INQB 4RAVB 4XCCL 5AZ2H 3OR6B 2H26A 4HC1H 4ODUA 4NQEA 1B0WA 3MV01 4YHIA 3EAKA 2NX5D 3SJVE 3HNSL 4TUKL 3PWUA 3GIVB 2VL4A 1OARL 2DQFB 1HDMA 2EXWC 4MB3A 4NQEE 1U8HB 3B3IA 2Y07H 4PRPB 3GBNH 3TC9A 3GGWA 1DEEA 2BOBA 3H9SA 3HMXL 4Z5RB 4P3WA 2G9HB 2DLGA 1B4JL 3EO9L 2H41A 3GB7A 2DOCA 4YHOL 2CRZA 1KCRH 4APQA 3H9SE 2E9JA 4GW1A 3H42H 1Q38A 4U6VL 2OM5A 1A6UH 4HWZA 3L5HA 4GRLB 1OHQA 5J6GB 4N5EC 2LU4A 2Q8BH 1TZHB 4U1JA 1KENL 2D4FA 2ZUQB 3VI4F 4GAGL 4M02A 2ZG1A 5DJZB 2E8ZA 1MLCB 3WUWA 2EE6A 1LO2L 1DANT 1I8MB 3AS1A 4ZFGL 5FXCH 2RBLA 3Q6GL 1MQKH 5B39A 4B50A 2XZQH 1ZGLP 2Y5TA 5GRZA 4PFEA 4CRPA 3ZDZE 4UT6H 2Z8SA 4Y4KD 5J1AA 3CX5K 3UMTA 4Y2DC 1KTDB 2J6EA 3SCMA 2K1MA 3O0RH 1NGYA 1I1AD 2Z8VC 1CFSA 4TSBH 2YPLA 4LSUH 5DMIL 4TVPE 2CPCA 2ADIB 2GTWA 1CICB 2CUHA 2BXZA 3DTXB 4X80H 4EI5A 1T7ZA 2FL5B 4KMQA 3FAWA 4KKBD 4M8QA 4NN6C 4OFYA 1AXTH 3RZCA 3WDHA 1VEOA 2EYSA 3U4BL 5BVPL 4WWKB 4WEUD 2DM2A 3SDDA 4GBXD 4WW2A 3PGFH 3KJ4B 1DLHB 1FNLA 2HTLD 3MMEA 2B4CL 4OF5A 4EEEA 4UUJA 3SE3A 1VGEL 5CMAB 5F44A 2AXGA 5EZOL 1KIQB 5CEXB 2NX5B 3LVEA 4MAYA 1R5IB 4JZOA 5FFLA 1MCHA 3IJYA 4PPTA 3VDBA 4RAUA 1S9YA 3MLUH 5KSBA 2VLJB 1JNLL 3C5SA 4XMLH 5D7IA 2AJYL 4O9HL 4J1UB 3HKFA 2A6DB 4Z7VA 3HAEH 2IG2L 4WNQA 5CD5C 5KSBE 1Y0LA 3I3EA 2V7NA 3LKSB 4GAYA 5D7IE 1RULH 2O61A 3ARGD 3QA3A 2NYYC 4XB7A 2PUQT 1YEHL 4M61B 2ESVD 2F5BL 3RQ3A 1QRKA 1QFHA 4KDWA 4ZOCA 3M8OH 1TXKA 1WEJH 3QUMB 5KS9B 3KXFA 1QLFB 1U8OB 3FN9A 3CFKB 3G9VA 5F7WC 3IDJA 1A1MA 2A9NH 3VXPB 1ZXQA 3O9WC 3QNZA 3S5LG 3KXFE 1LK3H 5DJAB 2YRPA 3T8XB 5D2LA 3CJJA 5EOQL 2EDWA 3VMPA 4QF1B 4NUJB 3U2SA 1UENA 4W4OC 3CDFA 1S9XB 4OF8A 1UM4L 3HE7B 4OKDA 5D1QA 5D2LE 1RUAH 3V52L 3MRFA 1C8PA 2GK0A 1D6VL 3MGTA 3MRLA 4PRDA 4KUZL 4RDQG 3L5WB 3OAZK 5BO1L 2WUCL 1FORL 2H2PD 3OXRB 3WV0A 1HXMB 1H3WM 3MREA 5DTFB 4ETQB 1OB1B 3N1MC 4Z7WB 5JDSB 1BJ8A 5L8KB 1R24B 5D8JH 4ONHB 4HW6A 5ISZA 1MIEH 1XAUA 4G43B 4LHJB 3FO0L 4WO4C 2DS4A 2XY2A 1G7HB 3KJ6H 5DJYB 4TTGA 2WWKO 3AGVA 1R3KA 2IALA 1NCBH 3BGFC 4IRJB 1GZPA 3O4LA 1XGRB 1MJ7H 5ISZE 4H26A 5A3ID 3AY4C 4OD2A 4PJ8C 4UT9H 2CXGA 1G6RL 4F9LA 1U93B 5DVOA 5AAWA 3R4DA 5I19H 3O4LE 1HHHA 4RISL 5JHLL 3REWA 4XPAH 4R2GB 4PRBA 3BHBB 1HYRC 3MV7A 3VFPA 4NSKB 4P9MH 2NPLX 4XP6H 5F89A 4LLYA 4HUUB 4L8BA 2W65A 4L9LB 5DS8B 3UEZA 1F4YH 1F2XK 2ILLA 2WINB 4LPWA 4ZS6D 5HI5D 3MV7E 4X83A 4PRHD 1BVKB 3MBEA 4U1IA 1KB9J 2Z31D 4F37F 2VITB 2GITB 4HS3B 3ZKQD 5JIPA 3H7BB 3WIIL 1CD1A 3ARGB 3DX7B 1SM3H 3KNBA 4MD4B 2Z0BA 3EIFA 5CINH 2BDNH 2VE6B 3EBAA 2ESVB 2P24A 4HH9B 4O2EB 4BSVA 3QO1A 4JFYB 4BK4A 5T3XE 4RFOL 3ZHDA 3MRQB 4L5FL 3AREC 5KS9F 1AXIB 3ZE0E 1JV5B 3D5OF 5TDPB 1QO3B 1SBSH 5CKGA 4WUKL 3FRPA 3TZVB 1QPPA 5HYEA 2Y1VA 1YMHA 2OTUB 4K3HA 4LAQH 1QRND 3QIUD 1QYGL 4I2XA 3UJJH 2R4RH 3F65A 4X6DB 5GZNC 5DD1H 2YUWA 3C60D 3WLWD 2P45B 3ORJA 3X12B 4ELMB 3UDWA 1L7TL 5HGDB 4I2XE 4JPIA 1J8HD 4G42B 3WYRA 5EU7E 3SPVA 2P5WB 2EIZB 3FB6B 4F7PA 3MO1A 5BW7A 5C08D 3DV4A 3ARYA 3KYNA 3G5ZA 3O8XB 3QAZC 2F53B 4J3OC 1ZHLA 2YZ1A 2JJWA 3TO4C 4OF7A 4QCIA 4YO0A 5F1IA 4WU7B 4GO6B 4ZDHB 3SJVD 1ZEAH 3MJ9L 4NYLA 3MNVA 4LPCA 2X4OB 4L3ED 3F7VB 4JFDA 4NQED 5EU4B 1DLFH 1CBVH 5FCUH 5MEPB 1FV1A 4KY1H 4K7PX 2V2TB 3MNZA 1T04B 1I7ZA 1MWAA 3KPSA 4JFDE 3TIEA 4BH7B 2R1WB 4X7SL 2XWBA 2HG5B 4YHML 4YHNA 4X0KA 1NEZA 3FB7B 1CS6A 1UWGL 3H9SD 3MRCA 5C6WH 3UYOD 4R4BA 3CSBA 4DUVA 5F9AC 2R15A 4TNWK 4B53A 4K3JH 3V5HA 1PYWA 3X17A 3ZSTA 4R8WH 4PRHB 4LIQE 5IWLA 5CJOL 1Q0YL 1L0YA 4XP4L 3W9EB 5CBEA 5I30H 5HGAB 2Z8RA 4APQD 1N8ZA 4V2BA 4LLWB 4KJPC 4LDOB 2ITDA 2WMPA 4OKVA 4JHAL 3RAJL 4AIZA 2ITCA 5TQ0L 1IAOA 4CMMB 4ERSL 3HZMA 5L7XH 4I18A 4NQTA 3ARWA 1MAMH 4UIKL 1JYXA 3CFBB 5DJ2B 5TE7H 3QUMH 1MSPA 5E00B 2DMCA 2J8UA 4FFWC 5HYQB 3D0VA 2HLAA 4N5UA 3KPQA 2XZAL 3TV3H 3ARTA 2VAJA 4TVPD 3CMOL 1QSFB 4PTUB 2J8UE 1HIMH 5I8CB 2EH8H 5EIVA 4Z0XB 4WI7A 4ODSH 3SCMD 4HAGA 4P4KA 1AGCA 1UB5B 4K7FA 1EEYB 2GUOB 5J56B 3KR3L 2R9HC 3QXAA 3VFNA 3O6FB 3P77A 3ZE1E 4ELMF 4EI5D 4X4YA 1G7LB 1Y18B 1C16A 4J8RA 4HKJB 4JN2B 4YHYC 5SX5K 2GAZB 2VJXA 2D2OA 5EWIH 3I02A 3QFJB 1OP3K 4IRZH 4ENEC 5FYJE 5T5NG 4GAJL 3SDAB 4JDVB 1YNLL 3V2AR 3H3BC 3FQXA 2P1YA 3SDDD 3WNLA 4XNXL 3LV3A 1CK0L 1VFAB 5GRUH 5DMJB 2FEDD 3DI3B 4Q6YA 4DTGL 1FQ9C 1IMHC 2EXYC 2PTUA 4K71C 4EDWL 5CZVH 4L3EB 3PL6C 2XFXA 4NQVB 5E2TL 1BQLL 3MUGB 1JRHI 5EB9A 4MNQA 4K94H 4GW5A 3SGEI 2DYPA 1FC2D 3QIWA 5ESQB 1U8KA 3TVMD 1P6AB 2MQCA 1FNEB 2EDHA 1AKJB 2OP4H 5HDQL 5FM8A 4MNQE 3NIFE 4Z95L 5HTSA 3B9KB 4X6EB 3QCVL 4NGHL 1FN4A 1M7DB 2XQYK 3K4DA 3BDXA 4QRPD 3U30B 1DE4A 1B90A 3BN9C 3DUUB 4TSAH 3CSYA 1D5MB 1KPUA 3KLAA 4Z7OF 4MA7H 2PTVA 4JQIL 1RZGA 1FNGB 3IGAB 3QIBB 3LZFH 1IGIH 3KXFD 4NP4L 3KYOB 2IPKA 3BJ91 3IKCA 4MA8L 1I7UB 5IF0B 1WCBA 4HJ0D 4G6ML 1VFBB 5EU5B 2BC4A 4PY8I 5F7KC 3FQTB 4UQ2A 4HKBB 3SDCB 5DK3A 1DBKH 1DR9A 3ULUF 4W6WB 4QXGH 4JFOA 1VKXA 5D1QD 2BERA 4LGRB 4OCWL 4DKAA 5EBLB 3J8F7 2EKSA 2WBJB 3DLQR 2DN7A 1KTRL 2Y06H 5CFHA 4QHLB 2DB8A 1KN2L 4OZHA 5TDOA 3W81A 4DZ8B 3G5YB 1U6AH 3T2NL 3V0VA 3EOYG 4LCCC 4M7JL 5ICYB 4OZHE 1FNHA 5ISZD 1TZIB 3TA3A 3BPCB 3LHPL 3GSOB 5CCKH 1V5JA 1Q9LB 4O5LL 5TE4L 4LLDB 2AK4B 1DN0B 5GSVB 2R1YA 3O4LD 5A16B 2BNRA 2VXQL 2NY4B 3AFLA 5I74C 1GGIH 4AENB 2NW3A 3AXLA 2ZSVB 4HUKB 8FABB 2IGFL 2ED8A 5DMKA 5E56A 1JNHB 2BVOA 3IU3B 1LO5A 2C4XA 3FONA 2BNRE 2W0LA 3CSPA 2RJMA 1KSRA 4A6YL 3MV7D 4D94A 3TVMB 3LRGA 3D39E 4JDZA 2FSEB 2AV7A 2VLME 4BSWB 1CFVL 3LMJH 1LEIB 2CDGA 4PJHB 3PXHA 2DQHH 4M5ZH 5I18L 3IVKB 4M03A 4L8SA 2AV1B 4QRQA 3B2UC 1JI1A 1NEUA 5I16B 3MBED 4IRSA 2CD0A 5CP3A 3VWJA 3HR5B 4QRPB 4RQQA 4F9PA 1FVDB 2Y36H 3P30H 3QUYB 4P59H 5T3XD 1A1OB 1XR9A 2PXYD 3K81A 3VI3F 2IQ9H 4KV5E 4LHUG 2FX8L 1LVEA 5C8JB 1SEBB 1U8JB 5FUOH 3QPQD 3BAEH 4XHJC 4C58B 2FGWH 5LBSL 5JLZA 2ORBL 1KELH 2HKHH 4LKXB 4RMQA 1DUYB 3SY0B 4GG8A 4XNUL 3GRWA 3NA4A 1U58B 1IT9L 1NCNA 2R8SH 3O45A 3WO4B 2CKBB 4F7EB 4F2MB 4FXKA 1RUKL 5TF1H 1OVZA 1PEWA 4KJYB 4AH2B 2NMSA 3I6KA 4PJAB 4GW4B 4KVCH 1A5FL 3VG0H 25C8H 2B20A 3MRMB 1LDPH 4XVSL 1YEEH 4OCLC 2YKLL 5IIEA 1WF5A 3ZKSD 4HC1L 1T83C 4HBQA 1I9IH 4MDJB 2VLKA 4KRNA 5ALBH 1AQDA 3MLPA 1MJ8H 4OLUH 1S7RA 2VLKE 1JHTB 3GBNL 3RWGA 3HC3H 1DTUA 5I66A 1WBYA 4ZFOL 2R0ZH 1S5HA 3DWTA 1U8NB 3QQ3B 1UXSB 1Q9KB 3EDKA 4GFTB 3VGEA 1KCRL 2N1KA 2GI7A 4P2QB 3RIAF 3WIHH 1ZGLB 1I7TB 1LMKA 4PJHF 5F7MC 2OZ4H 1T21A 3H42L 5ITBH 1CI5A 1A7QH 4H0IA 1BGXH 1A6UL 1U95A 1L9NA 1AGDB 4DUWA 1AGEB 2J8OA 5K9QI 1TDQA 1L6ZA 1ZHKA 2PXYB 2P7TA 3JTSB 4NDMA 3L1OH 4RMUA 1LE5A 4HPOH 4Q9QH 1XF5A 4BUHA 4ZO9A 4MXVF 1MQKL 5EO1A 4WI6A 1NGPH 2X4PA 1CL7I 2XZQL 5JOFB 1GGUA 1WT5C 3BP6B 1U8LB 4FMKA 3H9ZA 5BQ7B 5MENA 2O5ZH 2O93L 4U4BA 3O0RL 1U0QA 1QBBA 1CIDA 4LSUL 4LGPB 3WKMH 4ALAH 4Y4KC 3LN5B 1MY7A 2BSSA 1I1AC 5MENE 4X80L 1GOFA 1OSZA 3RWCB 3GJEA 5E2UH 3K8LA 1KTLB 2LVCA 3MRKB 1OT1A 2W0PA 1ND0A 1XGYH 1AXTL 2OR7A 5FYJD 4OLZH 3IJSA 1NANH 2X5PA 3QO0A 1NGZA 2J6EH 5DD3H 4KKBC 5CIPA 3WEXA 3VXRB 5LXGH 3PGFL 4KGLA 4MCZB 1I9JH 3AU1A 2V7HB 3R8QA 3NN8A 4JLRA 4UBDD 3DO7A 4GBXC 1WFUA 3QNXA 4IMKC 1S7TA 4NKOA 1K8DB 4D0BA 4K94C 1KNOB 2HTLC 1MCWM 4ODTL 1TJGH 1NMAH 1TNNA 4E0RB 3MLUL 3N0PB 1XGUB 3KPOA 4MNQD 1TCMA 4PGJA 4XMLL 2VDPH 3QIWD 2R29H 3U7AA 4BQ8A 5KTEL 3DSNA 3RHWF 4L9LC 4FQXB 4PG9B 3CX5J 1HOCA 2N7BA 3MCLH 4ZUSA 4JM2A 3BI9X 3OJMB 2HJLB 1A2YB 1MFEH 1ES0A 1IC4H 3PHSA 1A6WL 3ARGC 2D31B 3H9YA 5JMOC 4HMEA 3TPKA 2CO6B 5JO5B 3X13A 3DVGA 5GGRB 4Z7NF 3M8OL 3O41A 3GSNB 1WEJL 1PSKH 2HVJA 4XNZC 1Z9OA 3L6FA 4U1GB 1X6LA 5D7KE 5AYQA 1MAJA 1BEYH 4LKCA 3FB8B 2A9NL 1NUGA 3IRPX 3STLA 3KPMB 4LSSH 4PIRF 1LK3L 1U8OA 5DT1H 3SE9H 2FR4B 3OKDA 2P5EA 4U6YA 2X09A 3RIFF 3VWKA 4NQXB 4QYOA 1HHKA 5I8EB 3DXAA 3E6FA 5HBBA 4P3DB 3W2DH 2RIKA 4XCFH 4XBGA 1V3KA 1XCQB 1U8PB 1RUAL 2PO6A 1IAII 1WZLA 5JIKA 4PJGA 3UPRA 1BHGA 2LV4A 1FCCA 3DV6B 3DXAE 3VJ6B 4HZAA 3I9GH 2BHYA 4PGBA 4F15C 5BJTA 1OW0A 4PV8B 2RFXB 2B2XH 5HHPB 1NMCC 1CLYH 4PJGE 4U2ZA 5C0FA 3RY6A 2H2PC 1QA9A 1LWRA 1VPOL 2B8OT 2CKBH 3VU2A 2YSSB 4HIHB 4GQ9H 1CQYA 4X4MA 1YY8B 5E1AA 4H5SB 1MIEL 1K2DB 2YS4A 4ETQA 4IOIA 3DROA 2VDMH 3KJ6L 4Q9RH 3HI5H 4KI5F 3W0WA 3G08B 1MJ7L 4X4ME 2IBGA 3TA3D 4MB4A 2YD6A 4ZYKA 3KPPA 4M6OL 4UT9L 5A3IC 1FL3A 2BNRD 4ZSOA 5C0CB 3EUUA 5I19L 1CF8L 3W0WE 3SKJL 4MNHA 4KJQD 1NFIB 4XPAL 1IQWH 4I5BA 3D39D 2PNDA 1NC4D 2A2QT 4KKAD 4P9ML 2Q1EA 5I1LA 4XP6L 4ZSOE 4N90E 2BZDA 5J57B 4IIQC 4JR9L 1F4YL 4ZO7A 2QSVA 1I1YB 4N9OB 1XF1A 4PJXA 4XPBH 1BOYA 3W39A 4WW1B 5HI5C 4ZS6C 1S9WA 4WHTA 4GKZA 1CLOH 3TBYB 1SM3L 2Z31C 1W72B 5IMOA 3VWJD 3H0TB 4PJXE 5CINL 2BDNL 3OKLB 1OGTB 5C6TH 1P5VA 1YEDB 1FVEA 4WIQA 2JJTA 4O4YH 3JV4A 2NXYD 4U1MA 1NBYB 5I9QC 4OM1L 3UO1H 1LO3H 5DQDH 4ZPVA 4S10A 4JFYA 4OFPA 3T09A 3MV8A 3EKCA 3EZJB 4UOW1 3QUKB 1SBSL 4R97C 4WFGE 5M95B 4M7LT 1WAAA 3MLYH 1GGBH 5E8NB 3D2UA 3MV8E 4LAQL 1BECA 1IKNC 3UJJL 4Z78B 5AD0B 1FNSH 2R4RL 4L1HA 3HLAB 5D1XA 1QR1B 5DD1L 1WAAE 1WJ3A 4QRSA 3QIUC 4PV9A 1UQSA 1VGKA 3QUZB 1KJVA 5HJ3A 5GGVY 5A1AA 3C60C 3WLWC 1MVFA 4NPYA 1G7MA 1IGJB 5BRZB 1Q94A 2GT9A 3G6DH 3O11A 3FB6A 5CJXA 3GMLB 5IESL 5JUEH 2BVEA 3C5JA 1BP3B 2C3VA 3VH8A 4X7CC 3RJDA 35C8H 1TPXC 1ZEAL 2CIIA 4OT1H 3ZKXB 4EJ1C 4F37K 2VDOH 3QCUH 1CFTA 2VN7A 4J3UA 1LP9A 2VLKD 3LEVH 1DLFL 1NGQH 1CBVL 4B41A 5FCUL 4KY1L 2NLJB 5C6PB 2G2RB 2R2CA 3CZFA 4P5TD 4ZAKB 1DQML 2ZP0T 3OAYH 3AM8A 1LP9E 3QULA 1BF8A 1F6LL 1NC4B 1ZWIB 1NLBH 3QDAA 4OGYL 4U6HA 2CQVA 3RL2A 3VRJB 4CKVX 3L95B 3D18B 4K3JL 4R8WL 1E6OL 4LPTA 3CFJA 5I30L 3MROB 3VXQB 4XRCB 5DGQA 5TFSH 4NZTH 4NZUH 2EICA 2DI9A 5DRNB 4KROB 3OGCB 4APQC 1FSKC 3SQBA 2DMKA 2DIJA 5CP7A 4LLWA 1U8IA 2NXYB 1L0QA 5L7XL 2ATKB 4P49A 1NCDL 3RWHB 1MAML 5GGRY 1VADA 3GSNH 4FTVB 1ZE3C 5TE7L 3QUML 1KACB 4YZFE 3QXWA 2HN7B 2PW2A 3RWEA 1T5XB 3TV3L 1Z3GL 3V7MA 2D7TH 3QH3A 4JFZL 1HIML 5CEYB 2EH8L 1SJVA 4P3CH 5MEND 1OD9A 4WEBH 4ODSL 5IOPA 3EGSB 5BZDB 5K9OA 4FXLA 3GUTB 4UDTB 3SCMC 5KVDL 2Y4SA 3ULUE 4GKNA 2WAHA 5C9JB 4NO2B 1T2QH 3O3AB 3INUH 2CDEA 4L8DA 5EWIL 2CUMA 4IRZL 4EI5C 3MACH 1MI5B 2NXZB 3P3YA 3MLZH 4NJAH 3JTTA 1KB5B 1MH5A 2GAZA 3GJFB 5ICZA 3QJHA 4U0QB 1FNFA 3FRUA 5FYJH 5GRUL 3I6LD 4PD4K 3SDDC 3HG1D 1QVOB 4WW2C 5EU6A 5GQBA 1CT8B 4H1LG 4NIKB 2Q76A 3QEQD 4CU8A 3T3ME 2CIKB 5CZVL 2FEDC 5I1DA 2XN9B 32C2B 3LN4A 1DQQA 4YK4B 4UINH 3RWIA 1B4RA 3WFHA 4HEME 4K94L 2OJZH 4P5TB 4QT5B 4PP2B 1UKSA 3DX9B 4F57H 4HXAH 4NQVA 3SKMB 2OP4L 4ORGA 1VACA 4KHXH 4XNMA 3TVMC 4UZGA 2XKNA 3OPZH 4R9HA 5IW1A 4Y4FB 3IF1B 4LL9A 1IC5H 3RGVA 4TSAL 4CNIA 1CXFA 4DZBA 4JM2D 5IM7A 1PG7H 4EDXB 4HQQH 2D7MA 2BHUA 4MA7L 1MHEA 5D7KD 3FQRB 4M48H 1NCCH 5AUMA 1BVZA 4XAWL 1P1ZA 2R2EA 3LZFL 1W72H 4HWBH 1IGIL 1HWGB 4HUXB 3ZSSA 2DLIA 2YC1A 2X89D 4PG2A 5EOCH 5GS1B 4NBXB 5A2FA 1RHFA 5F3HB 3VWKD 2HJFA 1UJTA 4OAWB 4HJ0C 1PFCA 3DXAD 1DBKL 1ZT4B 4QXGL 2X42A 3SE8H 1NCAH 5EU5A 2F8VA 1E4XH 4DW2H 4LLMA 5GZOD 2PO6D 2VH5H 5E08H 3MYJB 4RGMC 5DVMA 2Y06L 5D1QC 4OFIA 4DVRH 2HH0H 3JV6A 4XH2B 1AIFA 1U6AL 1AR1D 1ADQH 5CSZB 4P46B 4MXQD 1GHFH 1ZLVK 3CPLA 4DVBB 1ZVHA 4BZ1H 1H3XA 4M3JA 1GZQB 4HJGA 4FQ1H 3BEWB 4MNGA 2EKJA 1P84J 1NGWA 2ZUSA 3D69B 5CCKL 5FA3B 3LS5L 1WWCA 2G60H 5EOTB 2VQ1B 5L0QC 3ECBB 3W0WD 2BRQA 4MNGE 1GGIL 3ZT7A 5IBTH 3HG1B 5DD6B 4GG6B 5EBWA 4RGND 3QEQB 4FQPA 2ZSWB 3QDMA 4LLDA 4X9FA 4CW1B 1PY9A 4N90D 3G5VA 1I9RH 4Q2ZB 1EO5A 3HAEG 2CLZA 4OIIL 5EG6C 1JK8A 2WIMA 4NO5B 4F3FB 3U46A 4F9LC 4LDLB 3WMSA 3QDME 2OLDA 2EEBA 1JN6A 5FYLH 5GS3A 3DVFA 3LMJL 3ULVE 1J1OL 1I3GH 1I8IA 5CBAB 5IFHH 2E9WA 3L3KA 3NFSL 4QHKJ 4CL7A 1T7WA 1YUHA 3RNKB 2BCKB 4PJ5D 3T3PF 5E95B 2JCCB 2VUYA 2Y36L 1GCFA 3MBEC 3P30L 4P59L 5DHYB 3O3UN 3GSRB 4NQCA 5BXFA 1RD6A 5DEZA 3EYUH 2XTJE 4NN7B 4FOMA 3OKNB 1MLBA 2FEEI 2J88H 6FABH 2PXYC 4ISVB 3GSVB 1NCTA 3FQUB 1WTLA 4NQCE 1A6ZB 1N6QH 5FUOL 3BAEL 2MQ3A 4QLRA 5B4MD 2X40A 4WFGD 4GAFB 1HN1A 2FYYA 3CFDA 1YEKH 3P9LB 3PJSB 3PGDB 1WIOA 3QPQC 3K4ZA 1KELL 4Y5YA 2HKHL 4E9LA 2WP3O 3TBWB 4U6XB 1DJSA 3IJHB 4MXVE 4K8RD 2VXSL 3EYSH 4LKXA 3D2UD 2R8SL 1L0XA 4QRRB 4NNXA 4CDGC 1DUYA 2OXHA 5TF1L 3HI6H 5D1XD 3U83A 5IB3A 1SBBA 1QSEB 1EXUB 2HAZA 1EFXD 3GI9H 3BIKB 5GS2D 3S96A 4WCYH 5DQJB 4HZLA 3EJZD 3D25A 3SOBH 5EU7C 3P4OA 4AY0A 5DK2A 3VG0L 2WSKA 4K55A 25C8L 3O3DA 1JPGB 2FHCA 2MNUA 3UDWC 1ETZB 2Z92A 1ZLWH 2EDDA 1LDPL 3HE6B 3WN5B 1YEEL 5B38A 3NFNB 2G75A 2WP3T 5C0IA 4TUOA 4R4FH 2OL3A 1YZZA 3HPJA 1I9IL 4G6FD 2D0FA 1MJ8L 4EVNA 4OLUL 3RP1A 4XP9H 4LNRB 2YD1A 2Z35B 5DFWH 3V0AC 4UU9B 2KZWA 4RGNB 4GG6F 1TITA 3D3VD 5EUKA 2FJFB 2AP2A 3HB3D 3ARBA 3LKPA 4JFHE 3HC3L 5JPNA 1ZGLM 5IJVA 3C08L 1CDJA 1W0WB 1OTSD 1BPVA 5IVNA 4LOUD 1HH6B 3MGOA 3WIHL 4PJIF 5E8EA 3SGJA 2OZ4L 5ITBL 1A7QL 1MHPH 3HUJA 5B8CA 2X70A 2VABB 4PJ5B 4RNRA 1KJ2A 3ZDXF 2P42B 2VLLB 5IWLC 3OKEB 1BFVH 1D5IH 2OR8A 3HUJE 5BS0A 5JA8B 1QZ1A 3T1WA 2F8XC 4LBEA 3BO8B 3L1OL 3NAAH 4HPOL 3P9WB 1FG2A 4HWNA 4Q9QL 1IEBA 1P7KB 4FFVD 5BS0E 3RY4A 1Q1JH 2NNAB 5C0AB 1YPZF 3KLDA 4HK0A 1JF1A 4I18C 2A74B 5EOCJ 2P8PB 2VXTH 4G9FA 3MRDB 2O5ZL 1EHLH 1AY1H 3UZEA 4HULB 4NQSB 1PGRB 1DVFA 1A0QH 2I9TA 3WKML 4ALAL 2DM3A 43C9A 4NJ9H 4G9FE 4MQXD 1F3RB 2QHLA 3MLVH 4POZD 1EFXB 3T2PA 4RWYL 4OV6F 1KF9B 1A7RH 2NY5H 1T0NB 2DQUL 4OLZL 3EFFA 5ICXB 5DD3L 2J6EL 4LEXH 1BZ7A 2YZ8A 4YXLH 5I1AB 1DN2A 5DRZB 5LXGL 1FAIH 3H8NA 4JANB 1I9JL 1QNZL 5IBUG 4I0CC 3CVIH 5L8JB 5F9WB 4XVUD 5ABDE 2Q20A 1G1CA 1OPGL 3RIAK 2V5SA 4UBDC 4QY8A 2DQDH 1UWEH 5DJ8A 5INCB 2JB5H 5CIPH 4NQUA 1TJGL 4KI5E 1FG9C 1I4FB 1NMAL 3SO3C 1A9EB 2E5EA 4TUJB 1NC2B 3D3VB 4X6BA 4CVUA 1S3KH 1T1XB 5FHBH 2VDPL 1FDLH 2R29L 3BVNA 3K0WA 2VR5A 4RIRB 3QIWC 3NFPB 2GY5A 2ZCHL 3EYVA 4UAOB 1IEAA 3MCLL 4X6FA 1KFAH 3PV6A 5DMYA 3N85H 1MFEL 4HUMB 2FB4L 5DC0A 3RGVD 1IC4L 1DL7H 4JM4H 5F3BB 2Q3AA 1DDHA 4ZG1A 4XXCA 1PSKL 2YR3A 3DUHA 4JQXA 4L4JA 5ERWA 4A2LA 1C7TA 1NH6A 3K2UH 1BEYL 2OJEB 4XC1H 2HJKB 3M07A 4RCAA 1ULVA 4LSSL 5I71B 1Z5LB 5HHMB 3SE9L 1XFPA 3C2SA 4S11A 5DJ0B 2X05A 3KDMA 3MBXL 4JRWA 5I8KH 1A64A 2GTZA 3BYTA 3MRHB 2I9LB 5DWUL 4XCFL 3BGMA 3GSWA 3RKPA 3TIDA 2NTFB 1V3JA 5F7DA 2DL2A 3T65B 5JR1H 3I9GL 3O3BA 3G6AB 1T1WA 2B2XL 3V5KA 3WD5H 1K3ZA 1CLYL 1HCFX 3JWDH 3P11L 1LEGA 1U91B 5GGUB 2H9GB 1DSFL 4NBYB 4GQ9L 4WTZG 4AZ8A 3TO2A 4JY6A 1H15B 2UUDK 4L3CA 5J9PB 4FFZH 2VDML 3CIQA 4Q9RL 1U9KA 3HI5L 3BXNB 3QNYA 4QRUB 5EBMB 5KJRH 5HDOA 2YA2A 4YXHH 1HILB 3RHWK 4N9GA 5HDBF 4Y8AA 1MHHB 1YMMA 4ORZC 3TA3C 5HHXH 3LPGA 3MRBA 2HWZH 4JFQA 1IQWL 5EZLB 1N64L 3T04D 1G7IA 2IH3B 4XNQA 1AQKL 3ULVD 4KJQC 3FQNB 5ACLA 4KKAC 4NM8H 3TESA 1G7PA 2W9DL 2KUTA 4XPBL 4FN0A 1INDH 1CLOL 5DJDB 3O2DA 5DFTA 1WIUA 2Q7YB 1FVCB 2H3NB 5C6TL 3BPLC 1T66C 4L8SC 3FZUD 4F7CB 4OFKA 1BVLA 4QRTA 3VWJC 3EYFA 4O4YL 3QEGH 4KTYA 5T3ZE 4NQCD 2ZNWA 4GQPH 2G5BB 3WHE0 3GI8L 1EHXA 3UO1L 1LO3L 1XIWA 5DQDL 1GC1H 1GGTA 5FK9B 3SGKA 4MZ3A 4AL8H 3MRJB 4JPVH 2ARJA 1CD9B 1T3FB 1Z9LA 2MWCA 2FECI 1F3JA 5F93C 1EZVY 3LKRB 2XWTA 3MLYL 1GGBL 2A6JA 4HIIA 4DGIH 1B2WH 2V17H 5T5FH 4C56A 3K1DA 1FNSL 4Z9KB 3BMWA 1ONQB 1XF2A 2HFEB 5EN2A 2B1HH 3IETB 5C0BA 4TSCL 5TPWL 5LQBH 4C56E 5LAXB 3WNPA 4MLIA 3CH1B 5CSBA 3QUXB 3RPIB 1RIUH 2KPNA 3RNQB 1JMZA 3REVB 3BGAA 4M93B 3S4SB 4K8RH 3MODH 1AD0B 2OBGA 1ED3A 3HZKA 1JGEA 5C0BE 1AHWA 1P7HL 4XPGH 1NFKA 3W5NA 1OLLA 5GS2H 1A7NH 1NAKH 3N9GH 1MCIA 4N0RA 4E41B 5JDJA 4E42A 35C8L 4OT1L 5MI0B 2VDOL 1TTUA 4UNUA 4U49A 3QEUA 4M1GH 3GSUB 1NGQL 2VZSA 3U6RA 1U92B 5F1OB 2GK2A 2ZNXA 1M05A 4L4VB 2MSPA 1QR4A 4YK4C 1S7SA 3EFDH 1YC7A 4WI4A 5AEAA 4ODVL 1M71A 2VWEE 4HKXA 4P5TC 1NLBL 3NCEB 3BZFB 3IFLH 4PRIE 5CAYB 3ARBD 4G8IB 4BFIA 1GH7A 4HS6B 4P57A 2E7LA 5D93B 3LKOB 4NRYB 4DAGL 2QSCL 1EV2E 2NY6D 2W59A 2A0LD 3BN3B 3HHRB 3DO3A 4KRPB 1ZLVH 1VENA 4G80A 4NZTL 4NZUL 3BSZH 1RPQA 1P4BH 2YXFA 2R2BB 3T0AA 5FDWB 5F9DC 3LB6D 1KCLA 5BS0D 3BKJL 1JPTH 4LCWB 1G9NC 1LD9A 4KK9D 4ZUTA 1W8OA 1HI6A 2OK0L 3KPNB 5GS1C 3MUY1 4M5YH 1S7XA 4DGYH 5IEHA 3BWAA 3RWHA 3PABA 5DI8B 3OZ9L 5I1JH 5I17B 1ZA3B 2A73B 4PRNA 5DR5H 4KHTH 4MQTB 2D7TL 3QI9B 4G9FD 4UTAH 2Q87A 4Z7UF 1AD9B 1DVFD 2H8PA 2NY5C 5E5UB 5FM4A 4F7TB 1H5BA 1T2QL 4L8CA 3INUL 5F8QC 1HHGB 4HX1A 5I75B 3OX8A 2ZOKA 3MLZL 3IDUA 4K3EH 4NJAL 3MRIB 1OWWA 1R3LB 5JW4M 3OAUH 5FYJL 3RTQA 3T0EE 5IB4A 4DK6A 1EBPA 3U1SH 4JG1L 4KI5D 4JO2H 1KB5A 3OB8A 5GGSA 2JJUA 5GJSH 5CD3A 3HFMH 5DRWB 2A6IB 4R3SA 2NTSP 2OJZL 1BZ9A 4ZXBA 4YDVB 3X14A 1AGBA 4F57L 4X9HA 4CU7A 4HXAL 2G5RA 4KHXL 3ROLB 1LK2B 5E8DH 2XIDA 4M6NH 4JFEA 5E2VH 2V9RA 3BIBX 5JNYB 4JFPB 5CHNA 3BOVA 2YA0A 2ICEB 1IZKA 3CFEB 1IC5L 3GKWL 3H9HA 3MC0A 1Q0XH 4JFEE 5KSUB 3NH7H 3OBAA 3QFDA 4F58H 3L3IB 4HQQL 1NFDA 1TZGL 4JM2C 5I2IB 3FO9A 1HCVA 1QBLL 1NCCL 3BRDA 1M7IA 4HIEA 4OUOA 3VFSB 1U42A 3T3PE 5LCVH 4NN7C 3BT2H 1NFDE 2APVA 5EOCL 5HYFA 5JHDD 4KZEH 4RDQF 1D5ZA 3BMVA 4HBCH 3UPCA 3LQMA 1I8KA 1JVKA 3UBXA 1J1PH 2ICWB 5HD8D 4MHHI 3AS2A 2X4NB 3BPOB 2BVPB 4PP1C 4G8GB 3VWKC 1E4XL 4HCRA 4DW2L 1JYNA 5D71H 5E08L 2VH5L 1BWMA 1UWXK 3C2AH 3C9NA 3THMH 4OQTH 4U1SB 5FHAH 5GZOC 1H3VA 4DVRL 2PO6C 2HH0L 2Z9TA 5J6HB 1ADQL 2EYTB 4JRXB 1F6AB 1BAFH 4AM0B 4LPUA 1MCKA 5IHLB 5FO8A 3WFEH 1HK6A 4BZ1L 1AR1C 3L3DB 5CILH 3EJJX 3QQ4B 4FQ1L 4MXQC 4IHOA 1YJDH 3DUSA 3QXDA 5FF6B 5CGTA 3TN0B 2G60L 2N4IA 5C0JA 1SY6A 2IADB 2D3VA 3S34H 5J13C 1A4KA 1KJMA 2CMRH 1RZIB 5CEZH 1CDHA 5IBTL 5T1DH 3UXFA 3DYMA 1HQ4A 2DJUA 4OFVA 1I7RB 3SDYH 1I9RL 2R2HA 3VXSA 4RGNC 3U0TA 1XZ0A 4HUWA 4KMTL 3OMZA 4J23A 3VXSE 2VL5B 1I3GL 4F3FA 5EU3A 4CVZA 5IFHL 1PQZA 4R7DB 2PYFB 2C3HA 4WUUA 1J1XH 3W82A 4P23B 3VFWA 4NO3B 1NUFA 3ULVH 3NIGF 3DGGA 4PJIA 2Z8WC 2X4QA 1F97A 5T3ZD 4LCUB 5HGHA 4QXWA 4WUUE 4EIGB 2CR6A 2XG4A 3EYUL 2BY3A 4PJIE 2GSIB 3IFOB 3OJDB 2GCYA 2J88L 6FABL 1OWRM 1FRGH 2EEAA 2LABA 3FJTA 1N6QL 4K3GA 4Y5VA 1XIWD 5L2JA 2JJTC 5JHDB 1JPST 3F12B 5DZOA 3DSFH 4N1HB 1YEKL 2LU7A 4QHUB 5D2NB 4RRPG 1YPZA 3IDNB 5B4MC 1NGXB 1JZ4A 1I1FA 1D7FA 1N59A 2BK8A 4OZGA 3HN3A 4IS6B 5KANG 3HC0A 1NBQA 1MRDL 5CZKA 5I1EH 3EYSL 4JRYD 4U6XA 1YPZE 2GQHA 4KH2A 5INDB 4I13B 2X4UB 4OZGE 1A3QA 3HI6L 2IPUK 5D7LB 4K8RC 3GI9L 2E6QA 4WCYL 4UNVA 1BBJA 3RA7H 5C0BD 1AGFA 1HHJA 5D1XC 2GJZB 3V8OA 1H0DA 1QP1A 3EJZC 1VDGA 2JKXA 2CDFA 3GRWL 1F45A 5J06A 4HEPG 5L2KA 4R4FL 4PGEA 3L3HA 3PWNB 4HLJA 3WN5A 1OY3B 4ONFH 1GGCH 4GS7B 4N0UB 4OCRH 4JQVA 4QXTB 5F9WC 5E6ID 1L4IA 3E3QE 3BZDA 3MLTB 5GRVK 4XP9L 5HGGS 5L2KE 1LNUA 3OF6A 5HXMA 1E4WH 5I76A 1ACYL 2XPGB 3UTTA 3L7FB 1U3HA 1ZT7A 5H35B 3RL1B 4PRID 2DWEB 2UYLA 4U1HB 1HSBB 5E8PB 5E1HB 3UTTE 5CWSB 4S1SL 3HB3C 3QRGH 3AM8C 1SYVB 3IDXH 4ZQKB 1CQKA 3DBXA 2WANA 1OTSC 3PWVB 1MHPL 4LOUC 1UVQB 3BH9B 4R7NA 3MGAA 3OKYA 3BKMH 2IH1B 4LARL 4KK5D 1BFVL 1D5IL 2ATPB 3GSXA 4D0CA 1R5VB 1MCBA 1RZ7H 2MPAH 3NAAL 4KTEH 1YECH 5ELIA 4KPHH 1F6FB 2ZPKH 5FO9A 1Q1JL 1NAMA 3R06A 5ACMA 4UIMA 3ARFD 5D9SA 4FFVC 4OCYH 1G9NL 4KQ4H 4OV5A 1RJYA 2XZCH 5BOPA 1UKTA 2VXTL 1FL5B 4Y5XA 1EHLL 1T2XA 1QFWH 1A0QL 1ZMYA 5T5NF 5LGHL 4QOKB 4JRYB 3IKKA 4NJ9L 1OQXA 3UPAA 3H3PH 3MLVL 1WSST 5DO2D 5C07B 1A7RL 4MQXC 2NY5L 2X1OA 1Q9OA 4POZC 2WIIB 4LEXL 4YXLL 3PHOA 4CAGA 3LY6A 4MZ2A 4XCNA 4ZOEA 1FAIL 3T0ED 1T0NA 4I0PB 2VISA 3CVIL 1OAUH 1MCEA 1JUFA 2MTPA 1LILA 1UJ3B 3QT2A 5IV2A 1UH2A 2YD5A 1YEGH 3GMRB 2DLEA 5DUBA 2DQDL 3DVNB 1A1NA 4XVUC 5E6IB 3U36B 3MLRH 4N68A 1OLZA 3O3EB 2XWJB 1YN7B 4X9BA 3TT1H 1S3KL 3FN3A 5FHBL 1FDLL 4PRIB 4RFNB 2VSDA 5DYOB 5IMMB 4ZXBD 4XMPH 1QLRB 3U4AA 4CVXB 2P47B 5DHVA 3U0PB 4LHUB 2QQKH 4JAMA 4P2CG 2X4RA 1P9MA 2YD4A 3VD3A 5EC2A 4JFED 3MRPB 2BSTA 4N1EA 3MXVH 2P8LB 3N85L 2R1XA 2ERJC 3TGXA 1CTOA 4JM4L 3IFPA 1FC1A 4MHHG 1NCUA 3WLBA 2WBKA 4LRIA 1FZMA 3RGVC 1XH3B 4MA1B 4P2RA 2VKWA 3A6BH 3K2UL 3S7GA 1E27A 4H0HB 4XC1L 3FO1B 1CXIA 4RMSA 5C0DB 4R0LA 3N1PC 1C5DA 3ESUF 1FPTH 2I07B 5I8KL 4PG2C 1CGXA 3ARFB 3WJJA 2EDRA 3MCKB 1MELA 5IMKA 5I1CH 4HKZB 3T1FB 4RWHA 4MD5B 4O51B 3DYPA 4OI9A 1G6RB 1TCRA 5JR1L 3P0VH 2FIKB 4OD3H 3DURB 3OR7B 2EDLA 2ZUTA 3MZGB 3WD5L 1EUUA 3QZWA 4QTHB 2QADC 4MGXA 4ZUUB 1JPFB 4GSDH 1YJDC 3D85B 5KBNC 4FFZL 4U7KA 4UQ3A 2VYRE 2NY2D 4H88H 3BFOA 5KJRL 2D9QB 4PLOB 2HTKC 4YIQA 1H15A 4YXHL 5E5MB 3OB0K 5IVOA 3FT2A 3O6LL 2M8XA 3AROA 3OXSB 4Y1AB 3VRLF 3S37L 1NSNH 1G0DA 1C12B 3B5TA 5MI0C 1CTNA 1B4JH 5HHXL 3KWWB 1N5AB 2HWZL 4Z77B 3PQYB 1U8QA 3QDHA 3U48A 3O2WH 3F7YA 4NUGH 1X4XA 1DANU 4U6VH 3VFRB 3ZYIA 5KG9A 3TBSB 1BIIB 1PEZA 5T1MB 5GIRA 1NUDA 4NM8L 3ULVC 2HRPL 2EC8A 1W0VB 5CJBA 3TP4A 3LEXA 4GAGH 4MSWB 1INDL 1JGLL 1G9MH 1G7JA 1TQBB 4JVWA 5EFIB 4WUUD 1CDGA 5D96C 2OI9C 1LGVA 4YHPA 2MJWA 1ORSA 3R1GL 4DKEL 1PY4A 2DWDA 3SKOB 1CCZA 3QEGL 5DZNA 2XTJC 2AXFA 5IB1A 1MIMH 5D7JA 3FZUC