1SJVA

Three-dimensional structure of a llama vhh domain swapping
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
102
Chain Sequence
GGGLVQAGESLKLSCAASGGFMGWYRQAPGKQRELVATINSRGITNYADFVKGRFTISRDNAKKTVYLEMNSLEPEDTAVYYCYTHYFRSYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic
molecule keywords r9
publication title Domain swapping of a llama VHH domain builds a crystal-wide beta-sheet structure.
pubmed doi rcsb
source organism Lama glama
total genus 15
structure length 102
sequence length 107
ec nomenclature
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sjvA00
3RAJL 2I9TB 3D69A 2FZ3B 3G6JF 3PV7A 3ARFA 4Z76A 2F53D 3FN3A 2Y6SD 4U0RB 5C92A 3U30B 3TZVB 3BP4B 1MFAH 4Z7QF 5GSVA 1JHKH 4G6MH 3BX7C 1YMMA 2WQRA 1LO3L 4I18C 4PJ5B 1GSMA 3PL6C 4FTVE 4WGWB 1EJOH 1INDL 4MNGA 2D31B 2O5XL 3H8NA 4ZYKA 4G42A 1FV1A 2G5BB 4DKAA 3ARED 4UI2A 5DMKA 2FB4H 3EYSH 3NGBB 3CC5B 4PRPE 1AXIB 2O5ZH 4HWBA 5CEZE 4WHDA 5J12C 4X0KA 1JRHI 1AE6L 4KKCC 4GAJL 4HIJA 2FBJL 5ALBH 4PS4L 5C6TL 3IDYB 5C0CA 2DQTL 1J5OH 5TF1L 5FK9B 2BVYA 2CGRL 5E4IA 3MV9A 4P2OB 3V6FA 5HGAA 4BZ2L 5DD5L 2H6PB 5MEPB 1I7UB 3STZB 4IIQA 4MQTB 4L4TA 2F8OA 3UTSD 4ZTOL 4QYOA 5I74C 1X5HA 3CVHH 3KYKH 4CN4A 4WI3A 5BZDB 4XBGA 2Z4QA 3MJ9L 5L7XH 3DSFH 4L3EA 1YECL 4QTIL 1PY9A 2C1PA 5DMGC 3BP6B 4M7ZC 2P5WA 1MCHA 2Y72A 3GB7B 2RB8A 4L9LA 4E0RA 2NW3A 4XCNB 1FLRL 1A7OH 3T2OA 1T3FB 3RDTA 3ZE0F 4M4RA 3U0PA 3U2SB 1YEIH 1SJEA 4JB9H 1G9MC 1TLKA 3D39D 4HMDA 3U9PH 4ONFL 1RZGA 5D71L 3U7WH 4UT6H 4AG4H 4Y5YB 3MV8E 1KLFA 3FO9B 3RUGE 3C5ZD 4RMRA 3WFCL 5DURD 3DV6A 4QNPE 4R4FL 1JPST 3T77A 3SE8L 1CGUA 4IRSD 1GCFA 4PJ8D 1FBIH 5E9DA 3A6CL 4NOFA 5I1GL 4EOWH 4I48A 4OZHA 4JVWA 1L7TH 4M7LT 1J10A 1PZ5A 1YYLL 2DJUA 3DRTA 1OQOA 1ZT4A 3X17A 1ND0A 4Y16C 1DL7H 4HV8A 1T1ZA 4DTGH 4Y19B 2EDDA 2VISB 2X7LA 1N2RA 1MCPL 2SEBB 5D7LA 4APQA 2R4SL 1HSAB 1QEWA 3GEWB 3PGDA 2HFGL 4K3JH 2IG2L 3UPAA 4NBYB 3MXWL 4PY8J 5DK2B 4UIKH 1MJUL 2CDEA 2ZPKL 4M7KL 5IMLB 2GJ6A 3H9HA 5JW3L 1OGAD 4R2GC 4HQQL 3MPCA 2QKIA 4YE4H 3MLYH 5FGCB 4UTBL 3SKNA 1E28A 4JY5L 3WFDL 1NFDA 4FQLL 2ITDA 5KS9A 2B8OT 4KROB 1A7PH 2FH8A 2EDYA 5IB1A 4YDKL 5SV4A 2E7HA 4G6AC 2AQ2A 1FZOB 1YPZE 2AJSL 4O5LL 1SYSB 2BHUA 1B9ZA 3HMXH 5DJXA 3UTSE 1GAFH 5ALCH 2VDRH 5IBUG 4RMTA 4U6XA 2WBJD 4PRID 2ZUTA 1A7RH 1F8TH 1SY6A 1TDQA 4I2XE 1B90A 5CGYD 1QOKA 5IMOA 3B3IA 1C7TA 1KIPA 3QUXA 3ROLA 5EBLB 3ZT6A 5FYJD 1YEDB 1D5BA 5D2NA 5FYJL 5L9DH 1WISA 3QUMH 4IMKC 3WNOA 1AP2B 3S35L 2GSIA 3CH8A 3SJVD 4A6YH 3D39E 4QXUL 5B39B 3HE7C 2VXUL 4GMSL 1TXKA 1I9EA 1JWUB 2CKBL 4Z7VE 5TH2B 3DVIA 1G7QB 5GHWL 3QP3A 3O8XA 2YPKB 4DKEL 4I3RH 5TDPB 4C54A 2P48B 4Y88A 5IFHL 1P4IL 2KL6A 4RGND 1CK0H 3NPSC 3QPQC 1F13A 2NY7H 2PXYD 3QQNA 2X4RA 2AK1L 5MP6L 3QWQB 5ITBH 2FIKB 1B0GB 4JFDD 3MRMB 3O3AB 4JN2A 1BZ9B 1CU4H 4GT7A 3GSRA 4Q6YA 1KJVB 4DGVH 3MLXL 4RFNB 4NDMB 4HHAA 3QDAA 3VI4E 3GUTB 5FO9A 4ZOAA 5ESAB 1I8KB 5CJ8A 3MACH 2IPTH 5D1ZD 3TVMC 5J56B 1BPVA 5ITFB 3KR3L 3QI9B 3RKDD 4YFDB 3VWKD 3ZDYF 3NFPA 5DLMH 5FKAA 5I8CA 1OGAE 4MQ7A 3MC0A 4OD3L 5GISH 3LOWA 3OJMB 1A2YB 3VFVA 5F7LB 4F8QA 4RFOH 3NCYS 1NFIA 1YY9D 1T0NB 1UM6H 1R0AH 1OARH 3QDJD 2GI7A 4E41A 1NBZA 3SCMD 4AJ0A 1RZ8A 4KY1L 1KTRL 4CU6A 4WHCA 2FEDD 2BFVL 3S37H 5E94B 3EYFB 5JW5B 4UU9A 5T33H 3I50H 5DJYA 4PRIE 4BSJA 4XWGL 4NM4L 2OLDA 1B3JA 2XRAL 3ZE1E 5EZLA 5E2VH 5HHQA 2VNCA 3DJ9A 3X12B 5C08D 1CYGA 3SE4A 5EBWA 4OQTA 4XPBL 5J7CC 2JE8A 1F4WH 1JCKA 1OAUL 2K9UA 3BP5A 5FM5O 4HKXB 2NX5D 4KXZH 1H5BC 3P11H 4X99B 5D6DC 32C2B 2AEQL 4MJ5B 2YK1H 4FG6C 4PB9L 4P4KC 4NNXA 5C0EA 43CAB 1YEJH 3E6FA 3T0WA 5I1CH 1FL5A 1FVCA 4JGUA 4JKPH 5EU6B 3E8UH 4LP5A 1X5JA 2QADD 4M1DH 3IDXL 3WSQL 1J1XH 1KLGB 1R5VB 4XBEH 2VE6A 4RGNE 3GSOB 1BFTA 1F6AA 1OP3K 1JNLH 3WFEH 4LVEA 4M9OA 2EECA 1ADQL 4ZPTA 2ZOLA 2OR9H 3KDMB 4AYFA 3QIWD 3CFBB 1P4LB 2EDJA 4KK5C 2WIMA 3ESUF 1FVDA 1VGKA 3PUCA 3EDFA 4D3CH 3BQUB 3MNWB 5C0BB 4NO3B 4NO2B 1ZOXA 3GHEL 1MFBH 4N9OB 2DBLL 4TULL 4PRDA 1H3TA 4LLMB 2H8PB 2F19H 3D87B 1IAIM 2Q76A 5CP3A 1T7XA 1OT2A 3U4EB 1FIGH 2F54A 3LV3B 1CD8A 4LCCB 1DLHA 1DTUA 5CJQH 3UC0L 1EBAA 5FA4B 2AP2A 4PJFB 4ZUSB 5C8JB 1PW3A 2Y5EA 5DWUH 2CH8A 3K3QA 4U1IA 4PJDE 4KPHL 4K9EH 5D7KE 3FQTB 3P73B 1UACH 1OTSD 3GMMA 5DJDB 2DQHH 1QSZA 2YOCA 5FF6A 4KH2A 4UQ2B 3QH3B 3V7AE 3F7RA 1FL6B 1KCSL 5D7IF 5IVZA 5FYLH 1WBXA 3VFNA 4QRSB 4NKDB 4YLQT 3OG6B 1LK3L 5HHMD 1QSFA 3FRPG 2Y36L 5KSUB 1AD9B 1KELH 5AWNL 1I8MB 1P5VA 1IC5L 3IDUA 1F97A 4GG8B 1T7ZA 3NA9H 5IHBA 1P53A 1U91B 5AZ2L 4NQDD 1BJ1H 5IEHA 3PXHA 4PRPA 3WIFB 1WZ1L 2NX5E 1A9BB 1M1SA 1FNFA 3O6FB 1FO0A 4NWTL 4S1DC 3VH8A 2Z8RA 2XXCB 5ICXA 2FRGP 5EU3A 1OF2A 3IF1A 3P3YA 3U7YL 1F3JB 2Q3ZA 1C8PA 2L0DA 4PRBB 3IETB 1IAOA 5F44A 4JCLA 5JXEA 3MRCB 4DGIH 1FP5A 4OGZA 4JANB 2HT4D 2CLZB 3H9SB 3I84A 4QRRB 3U9UB 1IAKA 2JK5B 3OXRA 4IHOA 4JEGB 5EUKB 4KHXH 1TJGH 2NY1D 3EBAA 1NDMA 5E0QA 5D7JD 3OKEB 3BHBB 5B38G 1JTTA 1T22A 3BP7B 2R8SL 3HRZA 4NZUH 5EOCH 1SVCP 1Q38A 4KJPD 5DRWB 1TPXC 4H0GA 1YEHL 3L9RA 1IE5A 1IKNA 1MHHB 3F5WA 2J8UE 1R3IL 4TSAH 5CMAA 3BZ4A 4WO4A 3L5WB 5LG1A 1Y6KR 1MHCA 1RFDH 3VDCA 1RZFH 1UCBH 1CZ8H 3ZL4L 2WAHA 1I1AC 1G6VK 1T5WB 1JL8A 5CILL 2IANB 4NO5B 5DA0B 1IFHH 4OSUH 2Z92B 1W0VA 2QSVA 1MJ8H 3MV8A 3RUGA 1L6XA 3P9MA 5K33A 3F7VA 1CDHA 4ZQKA 5JA9A 4HIXH 1DVFA 3WE6B 5F72S 4R90H 4YXKH 5HHME 3VMNA 3MROB 2X1OA 2X4OA 5EZOH 2H32H 4HCRL 1BQLH 4JFQA 5IFAL 1DQJB 1N8ZB 3VMPA 2XWBB 4JFPA 2D9QB 3PHOB 2HA1A 2PUQT 1AJ7H 2P8PB 1MHPL 4NQDE 2CKBB 4QOKD 3WIHH 2YPLD 4HIHB 5ADPH 5CBEB 1NBYB 3BIKB 2P4AB 1QFUH 2AXGB 2DIBA 4LGRB 4JM2C 4R96A 5HYEA 3QIUC 3U79A 4NQEB 3JSSA 5CZKA 2ENYA 2HVKB 1TJHH 3MNVB 1J11A 4OZIB 2VDNH 4XPFL 4M6ML 2LVCA 1X5ZA 4M62L 5J6HA 1J1PL 1MJ7H 1YPZA 4HUXA 3QWRA 4OFKA 3V5HA 4JRXD 3BWAB 1T03H 1FNSL 4KK9D 5C7XL 1IM9D 4YQXL 3IFLH 2WW8A 3KWWA 5HGGS 3VFTB 1LEKB 3OKKB 1E6JL 2C3XA 3EO9H 4I2XA 2HLFC 1KJ3L 1G0DA 1NCBL 4PJAA 2UYLA 5KBNC 3V52H 5DJCB 2P8LB 4K8RL 4IRJD 3TBWA 2EYRA 3P0YH 4QF1A 4G8IA 3ROOB 1KCRH 3I6GA 1I7TA 2I24N 1FGVH 5D96B 4F15C 1AGCA 5JOPE 1S7TA 2VDKL 4LCWD 2F5BL 4F2MB 1LDPL 5EO1A 4PV8B 2VITB 3NFNA 4Z7VA 4HWBL 1NMCB 5A2LH 3UEZA 4EZMA 4HUMB 4KTDH 4ZXBA 1NUDA 3QQ9D 3QO0A 3X3FL 3V6OE 2EH8L 4IRSA 4LGPB 4FQJH 1Q8MA 1FHGA 1XIWC 1DBAL 1ZS8A 3BKCH 3HMWL 4G8GE 4PJEE 4XBPA 4KJWC 5HHXL 1M05B 3HR6A 3TWCH 2R0LL 4QWWC 3IRZA 1OQXA 4PJ7E 1KEGL 1VACA 4NNYA 4NP4H 4Y5XC 3M07A 4QOKE 3RVXC 2YPLE 2DMKA 1SEQL 2IPKA 3ZDXE 2BVOA 2PR4L 4JZJA 4KJYB 5JIKA 2ZOKB 1ZT1A 3O45A 5H94B 3QDME 1BFSA 5ID0B 3FOMA 5I8OH 5K9OA 4FN0A 4MSWA 4CVZB 4F7CA 4KK8D 5IOPB 1DDHB 3SO3C 3KYOB 3G04B 1NGXA 3H3PL 4JVPA 3VRJA 5DD0H 4Z7UE 4MS8D 5L2KD 4Q9RH 5HGDB 4NHCL 5EFIA 2AJVH 1F90L 4U1LB 3FT2B 4JRXE 1Q72L 2MTPA 3MGTB 1C12B 4G5ZL 1X5GA 2VLJB 4YDJB 2DLTA 4OCXL 1XF3B 3TBSA 2J6EL 5INCA 2MKWA 2DD8H 4YHIA 3T0EC 1X4XA 2A73B 3PGFL 4MXQD 1KNOA 5H35B 3RWEB 4MMZC 1PGRB 1U3YA 4QRPD 4CDGC 1AQDB 1KFAH 3BD3A 4S0TD 2RR3A 4ZPVA 3GSWB 1AGBA 4JFYA 4W4OA 3KPQB 5IB3B 3HNVH 2APVA 4LCWE 4TUKL 4KDWA 1IC7L 4N8CL 5JUEL 3IJSB 4HW6A 4LCUB 5D1XB 3EGSB 3MA7A 5C07D 3DUHA 5DJ8B 3SKUD 4B7IA 5KSAC 1KSRA 2F58H 2DQEL 4KTEL 4LPWA 1ZHBB 5BVJA 5I19L 1RZKL 3FB7B 3CFEA 2EYSA 2NY4B 4F9PC 3MLVL 4EUPA 2AV7B 1F00I 3TT3H 1NUFA 3ULUH 4X6CA 4WHTB 5DRNA 3RBGA 5DMIL 1EAPB 3PIQA 1J1OH 1R6VA 2W0FA 4GH7B 3FHAA 3AAZA 4JPKH 4FQ1H 3C6LA 4R7NB 3TA3C 3W11C 1G6RH 3DUUB 5GGQL 4KKBC 4ZG1A 2H41A 2E7LA 5C6PB 1JGEB 4HXAL 5M95B 1JBJA 3LZFH 25C8L 1LVEA 1A14H 4NQXB 2AJUH 3RNKB 4U05A 4X8JA 3PHQA 1T1YA 4Z7WF 3HCVA 4EN3C 1E4KA 1QNZL 2A6JB 4AQ1B 5L2KE 4OLUH 2YEZB 3REVB 2R4RL 4PJDA 4Y2DC 3GJFH 4ZO8A 3PP3H 3LMJH 4TVPD 3BPLB 3LKOA 2BC4A 2XWJB 1MELA 3ARSA 3IAQA 3OKNA 5FECB 5F6IB 4RMSA 5C71A 5KANI 3S6CA 2Q8AH 3GJFK 3DVNB 2C3WA 4GLRH 1KTLB 4HUWA 3EJJX 2NY6B 5IW6B 1JF1A 4QRPE 5TPWH 3CVHA 3RNQA 1FLTX 3JWNC 2GK0A 1OAYL 3HAEB 1A1OB 1TZHB 2ZJSL 1U8IB 3T2NH 1U36A 4YDLB 3UX9B 2FX7L 4K94L 3ARBD 4KGJA 2VZSA 3E2HB 2NX5A 2BX5A 1N5AB 2WWKO 1DSFH 5DS8A 5C07E 3ZTJG 5INDA 3MRNB 1CXKA 3B83A 2CJUL 2QSCH 2GTWA 4XP9L 1R3JB 2G2RB 2BNQB 4K7FB 5FYKD 5FYKL 4GO6B 4ODSL 4GBXC 4ZAKD 4OCYL 1G9MH 3VGAC 5I1LA 1OCWL 1FE8H 2FYYB 4LLQB 3HG1E 4GMTH 4DCQB 1RJZA 4DZBA 1TTGA 4WUUE 3O9WC 4BFBD 5KTEH 5C0GB 3RWGB 3FZUC 5FB8B 3IFOA 4IM8A 2PN5A 1JFQH 4JQXC 4AEEA 3RL2A 3UO1H 1QLEL 3OF6A 4WTWA 4U2ZA 5CP7B 1LO0H 4QHUA 2ICCA 4GOSA 1D9KD 4O51A 1U41A 4WV1A 5C2BH 4MD5A 2W92A 3UJTH 2BZDA 1FFOB 4ZDHB 1WF5A 5F9JA 3IDMB 1EV2E 3SGJA 5ACZB 3D85D 4X7SH 3RA7H 2ADFH 5CSGA 1RIUH 2A2QT 3UTTB 2WWKT 1U0QA 1LILA 3QT2A 1P5UA 4OQTL 3WL9B 5HHNB 4WENB 4M3JA 1X5YA 4N0YL 5JQ6L 2VXQH 4R9HA 5JXAH 4TVPE 2FJGA 4GQPH 2V17L 2O26U 1CL7H 3D69B 3J8F7 3ARFB 2B20A 5IBLC 4Z76B 2EE6A 3K2UL 5TE6L 2IQ9H 3KPMA 1D6EA 4O02H 3HMXA 2V9TA 1QBBA 4ZUVA 2EDQA 1AFVL 1YMMB 4ELMA 2NY2D 2H2PC 4TNWK 3C60D 4M8QB 4NZTL 1HDMA 4MNGB 5BZWA 4ZYKB 5C0AE 1J0HA 4G42B 1FV1B 2H9GA 4I0PD 5DMKB 1B4RA 3BPNB 4HEME 2H26A 3A67L 3GIZH 4HKJA 1WTLA 3O4OB 1TTFA 3EJYD 1NBVL 4X0KB 5DD3H 1KBGH 5CFHA 4ZO6A 1L9NA 4WCYH 3QUMA 3U4AA 1V7NH 4V1DA 2V2XA 1FNGB 4A6YA 2DB8A 3L3DA 4XP4L 5C0CB 1G1YA 4OI9A 5FYKE 1J86A 1KPUB 1QBML 1U93A 2VDOL 1XGYL 3WEXA 3GSXB 1NCCL 3MV9B 5DQ9A 3V6FB 4LU5L 1D5ZB 3DYOA 2WMPA 4IIQB 5E24E 3DETD 4L4TB 4PIRF 3CAFA 3C5JA 4QYOB 1YA5A 3RVUD 3ZO0A 4IS6A 1EVUA 1T83C 5JHDA 1A47A 1INEL 3VFOA 2AK4D 5BXFB 5DVOA 3ZTNH 2C1PB 4GW4B 5C9KA 3L7EA 4R4BA 5IROA 3IU4L 4L9LB 4E0RB 4F3FA 3RDTB 5D7SH 3U0PB 1SJEB 1KACB 2JCCE 2A77L 5IT2H 4JDVA 2BK8A 3PL6D 1FGNH 4J2XA 1RZGB 1QFWI 5IB5B 4G7YL 2EDEA 3BOVA 1J8HE 4XH2A 2ZNXA 4UDTA 4OCRL 4L9DA 5IP4A 4JG1H 4RZCA 3DV6B 1MAML 3CFDA 3EDEA 2IWGA 3L3JA 3T77B 2I60L 4KKCD 5E9DB 1UGNA 3UYPA 4KKAC 4EXKA 4G8GA 4OZHB 2E9IA 5B39G 3HNTH 3SDAD 3EYUL 3GMNA 1NANI 5JR1H 1PZ5B 3DRTB 1ZT4B 1ND0B 3BUTA 4HV8B 4KVNH 3DYPA 5MEOA 2ID5A 2FCBA 4RNRB 4PJ7A 1CE1L 2X7LB 4LAQH 5D7LB 4QOKA 4APQB 3QUKA 1OP5H 2CDEB 4NKIL 1CFQA 4J1UA 3DWTA 3GNML 5EUOE 4FNLL 3QDMA 2GJ6B 4FZEH 1CIUA 1O7VA 3TO4A 4KUCF 3B5GA 3B9AA 2QKIB 1C08A 5T3XD 1NAKH 2EE2A 5T3XL 5DMGD 1OP5K 2VR9A 3SKNB 1E28B 4HFUL 5F7YC 2ITDB 3SKOA 5KS9B 3WJLC 1RVFH 3BDYL 2UV3A 2K3TA 3KPRD 4MGXA 1N59B 4G7VH 4Z7UA 4MHHG 3BPOB 2XOTA 4LPXA 1VFBB 4BQCA 2R39A 4LL9A 5DJXB 3TN0A 3DX8A 3GSNH 3UDWA 1EDQA 3KLAA 2VZOA 5EG6C 1PG7X 4JJ5A 1R5IA 3AGVA 3ULUE 4U6XB 4Y4HD 5CHNA 1CF8H 4XI5C 1YYML 2IF7A 3C2AH 3QIBA 3MSPA 1AGFB 4K7PL 3K1KC 5IMOB 2GUOA 3ROLB 3QUXB 2YD4A 1D5BB 5D2NB 1OAXH 1IC4H 4JQVA 4GKSA 3QAZC 3O4LE 2OMNA 4XXCC 3W0WA 4LLWA 4OKVA 2GSIB 4RAUA 3AFLA 2VSCA 2O93L 3OKOB 3DSNA 3O3DA 2RBLA 1JP5A 4NN7C 3OX8B 4J3VA 2J12B 1QBLL 3WKNA 5K9QG 4Y16D 5HDLA 4OZIF 1X5FA 5E5UB 1IAIL 3LKNA 4RMUA 1FNHA 2V9RA 3FMGH 4JFZL 1MAJA 2EDWA 4OV6F 3MGOA 4HPOL 1CGSL 3KPOA 4YGVB 1EIBA 2X4RB 2UWEE 4U6VH 1LWRA 5EOCJ 1URLA 4N1HB 3FL7A 4C58B 5ESQA 2HFFA 1DANU 5DVKA 4BZ1H 5IM7B 1JGLH 4D9LH 2WQ8A 1YUHA 3VWJA 1RUAL 4HHAB 3LKRB 2GYSA 5E8DH 1OW0A 3VXMD 1DLFH 3MCLL 5SWSE 1EUTA 5FO9B 2LU4A 4XPAL 1A9EB 4KI1A 3SDYL 4BSVB 1AGEA 3NFPB 1EPFA 5FKAB 4Z8FL 2FL5A 4MQ7B 2VQ1A 2HLAA 5T3XE 3QZWG 3VFVB 4GW5A 5HGHA 5JW4M 3P77A 1JTPA 1NFIB 3KPRE 1RPQA 3HE6A 3HI1A 3HFMH 1M7DB 1FFNB 5IBTH 1NBZB 2OZ4H 4TSCL 1ES0A 4OLZH 2VDML 1BFVH 1B4JH 5KSBE 1W0WA 4KU1A 4R26H 1CBVH 1FQ9C 1RIHH 1A7BA 5T1KD 3AY4A 9CGTA 4XP5L 1FAIL 5D93C 3KPTA 2QJDA 4HKZA 5DJYB 1OT1A 1KV3A 2BDNL 2GK2A 1E6OH 4IEFB 4QTHA 2EXWC 3R0NA 5TFSH 4QEGA 5EZLB 5HHQB 4LSUL 3X14A 4BUHA 4OGXL 4TNVF 4H1LG 5IJKA 1MCOH 3QPQD 3P9LA 3R1GH 2BOBA 3SQOL 2H1PH 1KB5L 4ZO7A 5F9OH 5EBWB 5EORL 3EHBD 1ZTXL 3BP5B 3TIDB 3ULVH 3T3PF 4YO0A 4DVBA 4XNZC 1N5YH 1J9CT 3DLQR 3OGOE 3QHZL 4GKOA 1T1WA 1TJIH 4NNXB 4LEXH 3NN8A 4ZS6C 4DN4L 5C0EB 8CGTA 3E6FB 1SHMA 4PJGB 1FVCB 1Z0MA 2QTEA 2BOCA 3RTQD 5DTFA 1IBGH 4IJ3B 4XMPH 3TVMD 1T89C 3KLHC 1MOEA 2AEPH 4MWFA 1F6AB 4L29B 2DQDL 1J0JA 5T1DL 1U8KA 4X4XA 1N6QH 3HG1A 4PLJD 2EDBA 4ZPTB 2ZOLB 1UT9A 4WFHE 4WUUA 1MLBA 2C1OA 4JAMA 4P5TC 3QB7C 3OJVC 2NY3B 2NXYC 4I4WA 4ALAH 3VXME 4OM1H 2APXA 1RUKH 1W72H 2VXTH 5K59F 2IBGA 4NNPH 2H32A 5HYJD 4E42A 3MJ8A 1IGCL 4P99A 4JO4L 3PXJA 3ZKSD 4PRDB 3OJDA 1ZT7B 1ZLVH 1SMOA 2FGWL 2Q76B 3U46A 3WIHA 1LK2A 4H25A 2UUDH 2D4FA 2F54B 4OD1H 2ERJB 5KVDH 1DLHB 3WS6C 5EH1A 1OSPH 3RZCA 1JMXA 2YC1A 3MV11 1KCVL 4EBQL 1ORSA 5DJ0A 1FZJB 1JPSH 4P59H 3GMMB 3O6KH 5DHYA 5DUBB 3V6ZB 4WI5A 1WEJL 3BDBA 4M6OL 5IVZB 2G75B 1WBXB 1ZHLB 3ARGD 3VFNB 4P3DB 4CJ0A 5E1AA 3KPSD 4JRYB 4UV4L 2JJTC 1MPAL 1QSFB 1P7HL 1UM5H 1D3CA 4NWUH 4MZ3A 2F74B 4ODVH 2FX8H 4J7RA 4UAOC 5JQHC 4OUUA 5C0AA 2NY0C 4JO1H 4GG6E 1OAKH 1OP9A 5ANMB 1FO0B 4G6ML 5DUPL 4MX7A 4KK5D 3VH8B 4D9RD 2DQJL 3TF7C 2ESVD 5ICXB 3RQ3A 1OF2B 3IF1B 3SE9H 2JIXD 4E9LA 3QEHA 1DBKH 2N56A 4HZLA 4L1HA 3CSBA 3RP1A 5GSRA 5TDNA 3T3MF 3GK8H 1S9XA 1BM3L 5KVFH 1IAKB 1OOAA 4P9HL 3DGCR 3OXRB 4IHOB 3VFGH 1DUZA 1INQA 2CRMA 2DI7A 2JJSA 3T4AA 4ZFOA 3MBEB 5EWIH 4Y5VC 1BOGA 1TETH 5H2BA 5HDBF 3T04D 4FS0A 1NDMB 2HN7B 3V5DA 5J13C 1KIUA 4LHUA 5GZOC 2EIBA 4J8RA 4NUJA 1T22B 4NFDA 3HRZB 3MCG1 5HYJE 2EXYC 5FHBL 5DFVC 4HS8L 1NCWH 4AZ8A 2XV6B 5EU7C 2J88L 3L9RB 3F5WB 2ORBH 1B0WA 5CMAB 3BZ4B 4WO4B 4GFTB 1FJ1A 1MHCB 1RZ7H 2HKFL 3DO7A 3EDKA 4KZDL 3D85A 4X80H 1JF6A 3DSFL 4TPRH 4WW2A 3ZKNC 3CFCH 2HTKC 5GRVL 4LRIC 4WI8A 4Z7OF 1J8HA 3FFDA 5KVGH 1W0VB 1TQBB 2LU7A 4U1HB 2BSSA 3RUGB 4YFLF 3P9MB 1HE7A 3F7VB 3K8LA 3T65B 4ZQKB 4EKXA 5EIQA 4ZUTB 4CVXA 1DVFB 4XRCA 4LSQL 4S1DD 4BQ6A 2P43B 2XN9D 3KPSE 5CGMA 1BF8A 1EEYA 5F88A 4FQ2H 1AIFA 4L1DA 4ELKA 1OAQH 5GS0C 1U2CA 2DDQH 1F4YH 4P57A 2X4OB 3U7WL 1KEML 3S96B 4JFQB 1S7QA 3LEYL 4JFPB 1P1ZA 1P7KA 1BP3B 5LWYH 3BESR 2O61A 1VEOA 3JTSA 2VR4A 3MRDA 3O2VH 4I0PA 3V7AG 3QG7H 1WTGT 5GGVH 3QUYC 1AKJB 4F58H 4HBCL 4D9RE 4WFFE 1AGDA 4MA8H 5IVXA 2ESVE 5EUOA 5J9PB 4DJMA 3N1PC 4R96B 3OPZH 4X98A 2HYMA 1DL7L 3MODL 3MLRL 1OY3B 4U0RC 1I9IL 3TZVC 1MCFA 1JZ8A 5B3JF 2KBGA 3H42H 4U4BA 5EPMA 3RGHA 5BMFH 5I9QC 3WNLA 3S36X 2VLKD 1OAZH 2XFXA 5J6HB 2GJJA 5GJSL 1YPZB 4HUXB 4PJBE 2EDNA 4I9WE 1MRDL 2X1XR 3QQ3A 3OBAA 3V5HB 4C57C 1C7SA 4EI5A 5I75C 4Y1AB 1I1AD 5HPMB 3NGBC 3MLYL 4HKBA 4YE4L 5HYSG 3FB5A 5CJOL 4PUBL 4KRMB 4F7MA 3MNZA 1A7PL 1RZIA 3E3QC 5JDSA 4KAQH 2ICWI 4Q58C 4XPHH 1SM3H 4I2XB 3IFPB 1ZAGA 1W8OA 2A1WL 2UYLB 4PJAB 3NCMA 3IDYC 1NAMH 1GHFH 2EYRB 5JA8B 1G6RA 1NL0H 3S88H 2WUCH 4QF1B 2UZIH 2HT2C 3O4LA 4G8IB 3THML 3I6GB 4BFIA 1I7TB 1F6FB 3B2UC 4GSDL 4H20H 5IQ9A 4KWUA 4Z77A 5BVPH 1S7TB 3ARWA 4FQHA 1QRNB 4Z7NF 4I18A 3LB6C 1FPTH 5EO1B 4KQ3H 4NHUA 3NFNB 1UZ6F 4YFEA 3KPPA 3K46A 1LE5A 4U1SA 4CMHC 1NSNH 4PY7A 1BQSA 4ZXBB 2EDFA 1MCJA 1MFDL 1P4BH 1YDPA 1U8OB 2I5YH 3RJQB 2WV3A 3LKSB 1FYHB 4JM2D 1ZS8B 3DXAD 3GJFA 4ZS7H 1C5BH 1MCCA 1MF2H 4Z9KB 2FEEI 4XBPB 1QFWH 5GS3A 4DEPC 1KB5B 3D5OF 2LTQB 5HHPA 5F3HA 3SOBH 1ZXQA 4AEHH 5J89A 1VACB 4NNYB 1K4CA 3HI6H 3OWEA 4FXGA 5SWSA 5HHVH 1JGUL 2NY7L 5TQ2L 4P2RD 2IPKB 5JPMA 2PCPA 2BVOB 1WWBX 4JZJB 1N64H 3ABZA 4HDIB 1KXVC 3FOMB 4W6WB 5FIEA 5K9OB 3KPNA 4RISL 4JM4L 2WINA 2VH5L 1ZANH 4LPVA 2WUBL 3B6SA 4MSWB 4F7CB 5F8RC 3U4BH 3OXSA 3BZFA 3FO0H 5GGTL 3KPRA 4KUZH 3MACL 2H3NA 2IPTL 4OGYH 1NGXB 1QYGL 4BKLA 3OZ9H 2VLKE 2NXZD 3MRKB 4NZRH 4M02A 5DLML 5EFIB 5GS2D 5HVGB 5KSBA 3MLZH 1NBQA 1NGYA 2W9EL 4OZHF 4QXGL 4WUKL 5I8EA 4RFOL 4QGYA 2XACC 2V5YA 4YHOH 4BUGA 2PW1A 5KZCD 5INCB 2ICWJ 4YHIB 3BXNA 4Q2ZA 1P7QA 1SJVA 3CJJA 1KNOB 1UC6A 2VRAA 2DLGA 3MX0A 4R4NC 5DSCA 5E4EB 5BW7C 1XIWD 4ZPVB 3QDGD 4KROC 2XZCH 1AGBB 1U8JA 5IJVB 4JFYB 5T3ZL 5TE4H 3I50L 2VDQL 5IWLC 3BRGC 5E00B 3FQXA 3WFHA 4KJWD 5IUSA 3ALXA 1WWAX 3UZQA 2ADGA 4WTZG 5ILTL 1NFDF 2RGSA 4N8VA 3FFCA 3OTTA 5CEYA 1BIIA 3CDGA 2ZUQB 4LNVA 3RVXD 5BVJB 3NZ8A 1HYRC 3CFEB 2EYSB 1JF5A 2FATH 3HAEG 2R2BA 1K3IA 3QXWA 4EUPB 4ODTL 1S7VA 3DXAE 3D1MC 4PREA 3VXNB 2LABA 4X6CB 2CO6B 2R23A 2P46B 5DRNB 4KK6C 3IDNB 5T5NF 4HEPG 1RUMH 1AXSA 2W0FB 5C86A 4M1DL 3P4MA 1J1XL 2CDFA 3AAZB 4P49A 3C6LB 1JTOA 3VXMA 4EI6A 1KC5L 3QXUA 4G9DA 3U0TA 3BD4A 3LKPA 3WHE1 1J0YA 4CMMA 4P2RE 4LLUA 4MCZA 4ZOCA 2X5PA 3M1BA 4KQ4L 3RHWF 4HG4K 4LSSL 1GXEA 3VFWB 1DQTA 4KDTA 3DARA 4GRLD 5DQDH 3U7AA 3CDYA 3HI5H 4D0CA 4D3CL 4MVBC 4ONGH 4X8JB 1T1YB 3T0ED 3HCVB 3IXAA 4FABH 4S2SA 1XEDA 4LIQL 3RJDA 4PJDB 2B1HH 4RFNC 1KCUH 3ARUA 2N7BA 1FG2A 1DN0A 5T1KA 1FORH 3ARTA 3HE7A 1FIGL 3LKOB 2F8XC 5AEAA 2ATKA 2BC4B 5BS0D 3OKNB 2YBRA 3NCYP 4NZDA 4RX4A 5KSAD 3QI9C 5C09A 3LD8C 4NCC2 2PW2A 5JW4R 1UKSA 2OTWA 4K9EL 4NBZB 1NPUA 1VA9A 1JF1B 5EU4A 5I2IA 1JZ3A 4PGEA 1GC1H 1U8MA 3CVHB 4NJ9L 4U1NB 4WEBL 3RNQB 1NLDH 2A6KA 2I27N 2GK0B 1FC1A 3LHPL 4M7JH 4L5FH 3RBSA 1DFBL 2JKXA 3QDGE 4AENA 2A38A 4NN6B 5FYLL 1Z9MA 4KTYA 3V4UL 1EBPA 3O6MH 5D72L 2V5MA 3LY6A 5DS8B 2D2OA 3V79C 2ZCKH 3HLAA 1T2JA 3LKQA 3W11D 3IXTA 4JJHA 5BOPA 5FV2A 4KKBD 4ODWA 2GTWB 5C0IA 4P2QA 1HQ4A 4LK4A 2IALA 5E6IA 2NY5C 2ZCLL 5JOEA 3UTPD 5I1LB 3UTZA 3IDGA 2Z91B 5I1KH 1YY8B 5KVEL 3M17B 1RJZB 4DZBB 2YMXH 5SWZD 2QHRH 1YEKL 3MBXH 5F3BA 3IFOB 3VXQA 4UT7H 1KYOK 3RL2B 3QO1A 5J1AA 4ZSOB 1GZQB 2PYFA 4LSRH 5HYJA 4H0IA 3VMOA 5MEQA 4IDJL 4QHUB 4MJID 3CDFA 3LCYA 4WV1B 1V3MA 4KHXL 4LSVL 4R7DA 4MD5B 3A6BL 2VLRB 1JZ2A 3ARDD 5F9JB 4QRTB 4FQPA 3T0EE 4UDUA 4PR5A 5LVEA 5EO9A 4HWZA 5EOCL 5GRYA 1I7ZA 2WSKA 4JQIL 4PBVC 4XMLL 4F57L 3WIIH 5EIIA 3TNMA 4TSAL 5C0RL 1BWWA 2FJGB 2E9JA 3BQUC 4ODHH 1RFDL 4Y4KD 1H5BA 2DWDA 4NO0D 4OLWL 3QEQE 3MLWH 4UNVA 2AKRA 1H3XA 5BS0E 5L2JA 2IAMD 4O2FA 4P4KA 1I8LA 4HAFA 3F58H 3TO2A 2V6HA 4LKCA 1D6EB 1A7NL 1QA9A 2YD3A 1J18A 1S9YA 3GSNA 4ZUVB 3WXVH 2FIRT 4ELMB 3DIFA 5ID1A 4KMTH 1I9JH 2LE9A 2DL9A 3HNSH 4WWKD 4KVCL 3WV0A 5BZWB 1I4FA 2CKNA 1BD2D 1J05A 2R29L 2H9GB 4PFEA 4EXPX 2H26B 3O9WD 3QEGH 5CKAA 3S5LG 2ZP0T 4CN6A 1H3PL 1PY4A 4NQVA 1VERA 4TQEL 3QUMB 3BH9A 1ORQA 4V1DB 2FX9H 2V2XB 4L8SB 4A6YB 3L3DB 1MRCH 2DLEA 3I3BA 3GM0A 4OIIL 2E27L 1U93B 3UTPE 1GGIH 4Q9QL 4N0UE 4U2YA 3E0GA 5DQ9B 2YD5A 1A6VL 3R4DA 2W9DH 5IESH 1IRAY 3DOSA 3TJEL 5SWZE 4GXVL 3P30L 1NC4D 1CTOA 4PJBA 1HN1A 2IH1A 1DBJH 3VXSD 2DLFH 3CCHA 3C5JB 3G6DH 3TBYA 3O6FC 5JHDB 3VFOB 2Z31D 5TF0A 5LXGL 3L7EB 4R4BB 4LASL 2VB5A 4F80A 1CG9B 2ICES 2AJXL 4HS3A 1KTDB 4PJ8C 4M43H 1RHFA 4F7EA 1SQ2N 1MWAL 1X6NA 2IFGA 3B9KB 3GMQB 4FQIH 1T03L 3GJEA 4ODXA 4JDVB 1TENA 2H2PD 2ILLA 2P45B 3N85H 1IJ9A 4LPTA 2XKUA 4C55A 5T1MB 4XH2B 4UDTB 3PWNA 1F4XH 3AB0B 3D2UB 4JKWA 5JPNA 2HKHL 1IGTA 4P5MA 5BQ7A 4UTAH 3CFDB 3L3JB 4OCWH 2HJFA 4YHMH 4UILL 2OZ4A 5E2TH 3HZMB 4JO3H 1UH3A 5CSZA 4K3DL 1KGCD 3JV6A 1AO7D 2XA8H 4PYGA 3MOQA 3BSZL 5EBMA 3BGFC 5CJ5A 2Q87A 3GMNB 2JB6A 4U3XA 1OTTC 1BD2E 2C4FT 5MEOB 1L0XA 4PJHE 1XF1A 4NJAH 2RIKA 4ZFOL 4FQJL 1QPPA 5E8EA 5I30H 3QUKB 5MHSD 2B2XL 3MOBL 4XT1C 1TNNA 2NZIA 3SDDA 4WY7H 4BSWB 5E2WL 1CFQB 4J1UB 1ONQA 3QDMB 4OJFH 5DI8A 1MCRA 3TO4B 1CT8A 3FN9A 3TWCL 3NACH 4KV5E 5K9QI 4PJIE 3EZ8A 3IFNH 4YXLH 3N9GH 3IDIB 3RUGF 3TT1L 2X6MA 3SKOB 2BRRL 2E6QA 4RRPG 3RKPA 3FQRA 5EN2A 3UYRH 5IW1A 3MV7B 4AMKH 1YEGL 3HUJE 1DN2A 1Q0YL 3VXSE 3TN0B 3DX8B 3SEPA 2B4CL 1RUPH 3OKLA 3KLAB 4H8WH 4ZUUA 3O2DL 4XC1L 4JJ5B 1R5IB 4TTDC 5DHVH 3W2DL 3KJ6H 3NCJL 3TYFA 3Q48A 4G6FD 5DD0L 3QIBB 1JGDA 3ILQD 1Z0NA 2ZUYA 3JZ7A 3BKJL 3LN5A 5FCUH 1JGVH 2PXYC 3HN3A 4S10A 1W72A 1Q9OB 5DD1H 2AI0H 2BY2A 3W0WB 4KKAD 4PBWD 4LLWB 1FH5H 3TBTB 4OKVB 4DUVA 4RAUB 1UH4A 5F1SA 1NLBL 3SY0A 3BH8A 4PJ9A 4L8CA 3RVTC 4MXVE 1FYTB 4FQXB 2X10A 3BT2L 1HKLL 3UJJH 5SWQA 2AXFA 1S3KH 1JNNL 5CSBA 3H3KA 2AABH 5F7UA 5J8OA 5D70L 1YPZF 2R0KH 5DVMA 3VXRD 5CLWA 3VW3H 2CIKA 1NGWB 2Q8BL 3VWKC 5E08L 1I3UA 4FZ8H 2E9BA 1KGCE 3DXAA 3KPOB 4RGOH 2C4XA 1AO7E 3Q5YA 1CLYL 1JI1A 3UJIH 3QIUA 4XCFL 5ESQB 2VABA 3V0WH 1LO4H 5BRZD 4NZJA 3MFGB 4V2CB 1YY9C 4ZFFB 4P46A 2ZCHL 3VWJB 3OKMB 4PJAF 1MREH 3SCMC 1NMBL 5ISZB 3H2WA 3HKFA 3BGMA 4DVRL 5MHSE 3GGWB 4PRHA 1N4XL 3QCTH 2FEDC 3L5HA 3LEVH 1QO3A 4O4YH 4QRUA 3S9DB 3M45A 5JDJA 1AGEB 4PGBA 3OHXB 1J1OL 2A9NH 2FL5B 3WHE0 4Z7VF 2VQ1B 2HLAB 4Z7WA 4PGDA 4XI5D 4I5BB 3MRPA 2HFEA 3NCBB 2ZSWA 3IJHA 1PLGH 2CIIA 4L8BB 4GW5B 5HGHB 1DBML 1S9WB 1PEWA 1S7WA 3UBXA 3HE6B 3HI1B 1I3RA 4P5KA 1E4XL 4U1GB 3SKJH 2I25N 5KW9L 3U1SH 4Q6IA 8FABA 4LSTH 1W0WB 4G9FD 3I9GH 4LNRA 3K4DA 1A14L 2AJUL 1QPXA 3O2WH 6FABL 3GSVB 4OZGA 3I6LE 5CJXC 1MIML 2GSGA 3VI4F 2QADC 4QTHB 2FSEA 4YHLL 3BIAX 2MOVA 2R15A 4A2MA 5IR1A 2DWEA 5I1DB 3X14B 3LN4A 4G6JH 3P9LB 2PTUA 3L7FA 1BAFL 4AL8L 3HZKA 3QIWC 4FA8A 2GT9A 2XKNA 4DVBB 1I3VA 4M93B 4X9GA 5E5MA 5TQ0H 3NN8B 3RGVA 1DQMH 4WI6A 4Y5XA 1NCAH 2BOCB 4OD2A 5DTFB 2WP3O 3T2NL 3LQZA 1B88A 3GHBL 3VXRE 1JN6A 4RWYH 5BV7L 5FUOL 5LGKA 1A8JH 1BVLA 1U8KB 4X4XB 5F9WB 3HG1B 3VCLA 4TVSa 1DSFL 4WUUB 3FN0H 1MLBB 4N90D 5BRZE 2C1OB 4JAMB 2AS5M 3ES6A 3S97C 2P42B 3B9DA 1A6AA 1D6VH 2QBWA 3ZE1F 5EULV 1I8IB 3FKUS 3DGGA 4YIQB 1BFOA 3FQNA 3HC0A 5D1XC 1S9KC 2H32B 5CUSH 1KJ2H 3MJ8B 3QWOA 4E42B 3CUPB 3GI8H 5GS0H 2GITA 5HSFA 3OJDB 2EIEA 1LD9B 1FNLA 4UMGA 3U46B 2APTA 1LK2B 4O58H 2NY4C 3QQ4A 4H25B 5L88L 1GGUA 4GAGH 3RZCB 1AHWB 2YC1B 1XGQA 1SBSH 3AROA 4YDIL 1ORSB 5DJ0B 1KLUA 4DKFL 3ALPA 1RJCA 4WI2A 1HZHL 3P4OA 5C2BL 1K8DA 2BCKA 3FTGA 3G6JB 1U8LA 5DHYB 1MFEH 4K3EL 1IAMA 4X6CF 2NCMA 3ZTJH 5J1SC 4G3YH 3QEQA 3V8OA 5IHUL 1MIEH 4X7SL 5BS0A 5F6HJ 3CVIH 5E1AB 4ZS6D 4DN3H 5KSAA 3EYVA 1IQWH 4OLVL 4DW2L 4KJQD 5EBGA 5DD6A 2NMSA 3S8WA 1PG7H 2XTJB 5JO5A 1L0YA 3KLHD 4F9PA 4ZFGH 5C0DA 1YNKH 4OUUB 3PP4L 3GSQA 5C0AB 1CL7L 3NTCL 3B2VL 1QLFA 4AQOA 3U0WH 5EZJB 2J5LB 2NY1C 1NJ9A 3ZT7A 4O02L 1J87A 1NAMA 2PO6B 3RY6C 4P5TD 4NKMB 5D7JC 4S1QL 2QQLH 2VUOA 3BPLC 2VDPH 5KSVB 3TA3A 4LVOC 1PQZA 3UZVB 1ZLWH 4KJPC 4HZLB 4PJDF 4FFZH 2MQ0A 5F6IC 4OM0H 3T0VA 3C9NA 2R56H 4PGJA 1CQYA 2KPNA 3VXUA 5TDNB 2NY6C 4S0SD 2VZUA 1S9XB 3BJ91 2NTFB 1CLCA 1ZLWK 4WCYL 4N90E 5FUZL 5SX4H 3PWLA 1V7NL 1DUZB 1INQB 4YDLC 1CGWA 4ZFOB 4K23L 3BKML 3PQYE 1BOGB 4EN3A 3VJ6A 3V5DB 3QEUA 4LHUB 3BO8A 3LDBB 4J8RB 4NUJB 4XVTH 4YHKH 4Y2DA 3DUSA 3S3PA 4B7LA 1KB9J 2V5SA 4QHLA 3NFSH 1QVOA 2IFFL 3V6OC 3RY4A 2EDXA 4H5SB 4UINH 3RX7A 3VDBA 1HHJA 1FJ1B 3DVFA 3BZEA 4HXBH 4HC1H 1GRWA 1B2WH 3WUWB 4I3SL 2XZAH 2R2EA 1MQKH 2DQIH 1XAUA 2FEEL 5FEBA 4R97B 2CRIA 4C56D 3HPLA 2J4WH 3EOYG 1G0YR 3DX7A 1J8HB 3FFDB 4NPYB 1KT2A 4U1MB 1U42A 2NY0D 3TNNA 5HHOE 3VA6A 2BSSB 3UPRA 3SE3C 4H88H 1WT5C 4H26A 4ORGA 1IGFL 2MQCA 4CVXB 4NO0A 4XRCB 1LP9E 3MRHA 1IGIH 1FDLH 1X9QA 3BPCA 3QNXA 5F88B 1FGNL 1UVQA 1WBYB 1GYAA 1Q0XH 1AIFB 4ELKB 4KZEH 1KN2H 5AAWA 5A40E 3BRFA 2DYPD 4GBXA 1S7QB 5E8OB 1NGPL 1MFCH 4JG1L 1P1ZB 1P7KB 1CFVH 3JTSB 3MRDB 4O2CB 2J8UF 4PJHA 3LQMA 4NIKB 4M1GH 1WIUA 3DROB 4U1JA 43C9A 5HVWA 1X4YA 4FQCH 4MNQE 4JGJA 1AGDB 5IVXB 3MRGA 5I71B 2J2ZA 2XNAA 4UV7H 5EUOB 4YUEH 1LEGA 2AQ1A 4WNQA 5F89B 5GZOD 4PLKC 3ARFC 3LH2H 1ZEAL 1A64A 4LVNB 4PJIA 2X4QA 3SHSA 2EXYD 2Z8SA 4FP8H 4GAYA 1G7HA 5DFVD 4K8RC 3FAXA 1A1MA 3KJ4B 2FHBA 2LAAA 2R1WA 5EPMB 5DUMH 2AJZA 3WFZA 5F7DA 1P6AB 1JPTH 3KXFB 4MAYB 4YC2B 2XFXB 3GBLA 5F1OB 1L7IL 1ZGLA 4XCEB 2VLLA 3QQ3B 4EI5B 3BPNC 4HKBB 3ZKND 3EOBA 4O9HH 2VIRA 4ELMF 3O4OC 3FB5B 3JV5A 4F7MB 3T4YA 3MNZB 1RVFL 1BBDL 5JDSB 5KJRL 4G7VL 4Y4FD 5KAQF 4F8TA 2OSLA 3QQ9C 1YEFH 4L4VA 3V9FA 5CAYB 4KRPB 5E6ZA 3D0VA 5GJTL 1G6RB 1KN4H 2GFBA 4CADA 2DL2A 4LLAA 4XC3L 4NQUA 4YPJA 5I1JH 3O4LB 5I8KH 5K9JL 4BFIB 2G60H 2CSPA 5IQ9B 5GS0D 5LQBL 4ZUWA 3HZVA 4Z77B 3F6IA 4FQHB 2OL3H 5GRJH 4C56E 4XWOC 4NHUB 1AY1L 1ED3A 2HRPH 1U8QA 3QG6B 4P9ML 2Z0BA 1LE5B 4U1SB 2IGFL 3CZJA 4ZNEE 4PY7B 1G9NH 3QUYD 4NSKB 1N7MH 2A6DA 1X4ZA 3VE0A 1K5NB 3HZYA 2I9LA 4L9LC 2X4PA 1R5WA 1YNLL 5IB4B 1VGEH 2ARJQ 1MCKA 3TZVD 4POYA 2C7UA 5HHPB 3GBNL 5F3HB 4XVJL 3BE1H 4PJ5D 1HHHB 4NFBA 5D8JL 5IB2A 4FXGB 5SWSB 5ACMA 2PETA 4XNXL 3K0WA 2JELL 1ZA6A 3MRFB 2PCPB 5HD8D 4FXKB 4EUPG 3IKKA 1PDKA 4NRYA 5MENA 5I74B 3GBML 4BZ1L 2OMBA 3QHFL 1T83A 1G7PA 2EO9A 4D9LL 3KPNB 2EKSB 4RAVA 2IMMA 2VERN 3IYLW 4IRZL 3B6SB 1C5DA 4M5YH 3OXSB 3BZFB 4Z95H 5EU7E 4KHTL 3VRLE 3I85A 1EHXA 2H3NB 5FM8A 1NCDH 4Q0XH 2E5EA 2P5EA 5I17B 2HT2D 1ZLUH 4FQQA 3B2UD 4P2OD 4XCYA 2XKSA 4ZTPH 2BNRB 4GQ9H 4J4PD 3WS3A 1NGYB 2J8HA 4APQC 3ZMRA 3LB6D 4RDQG 5A2FA 5C2UB 2M8XA 3BAEL 2NY5H 5I8EB 1WVZA 1HCVA 3Q6GH 5CZVL 5IF0A 3KLSA 2BHYA 2VXSH 3RWHA 1P84K 3I02A 4YXHL 1RZKC 3T1FA 4PJ7F 1CE6A 1P7QB 2CMRL 2XZZA 3HC4H 2RFXB 2X89A 1VSCA 3MZTA 1B4JL 1YQVL 2Q3AA 2X70A 3ZDXF 4HJJH 3WKMH 2DM4A 1CBVL 3RL1A 1T20A 4YHYB 5DSCB 3TLRA 4YFLI 2IBBA 3W9DA 1U8JB 5JIIA 4HIIA 4JFEA 1SMAA 5ADOH 1U58A 1N0XH 3FQXB 5HVFB 3WFHB 3BPOC 1E6OL 1RSFA 1WZMA 3Q2CA 3RAJH 3SDCA 2ADGB 4F7TB 3FRPA 4N8VB 1B0RA 3FFCB 1XFPA 5CEYB 1BIIB 3ECBA 3CDGB 4O2EA 1MCOL 4Z7UF 2RQ8A 2AXJA 3NZ8B 3GSUA 3VXRA 1LO3H 1F3DJ 5L6YH 3GDBA 2R2BB 1BLNA 3PDOA 1RULL 5MERA 3ULVL 1D5MA 1S7VB 3UP1A 2O5XH 2X40A 3QUXC 1U6AH 4LARH 5D2NC 4LEXL 4XXDA 3Q1SL 4RQQA 3WJLA 3P4MB 1AE6H 2CDFB 2IADB 4EI6B 2ICEA 3BMVA 4G9DB 3U0TB 3LKPB 4CMMB 1A3QA 5C6TH 4JPVL 1VFOA 3DMMA 4MCZB 4OZ4A 2DQTH 4Y19D 6CGTA 2EICA 4WWID 3M1BB 3RU8L 3K4AA 5TF1H 4PGCA 5H8DA 3MLUL 3CX5K 4NUGL 3RPIA 3L3KA 5DD5H 2FDBP 3E3QE 2YN5A 2IMNA 3UAJC 2H45A 3NVQA 4NNPL 3WDJA 2XICA 4LDLB 4ZTOH 5B38A 4H1LH 3IXAB 1JNJA 1I1RA 4OFYD 4S2SB 1PKQE 4K94C 2Q20A 4KROD 5DO2D 5FAAA 1CTNA 1D5IL 5HGBA 3X13A 5IMMB 5D7IB 4U3CA 3HE7B 4HIEA 3LPWA 2ATKB 1FLRH 1OSPL 5C1MB 3ELAT 5C09B 4LMQE 2PW2B 4PJXA 1NCNA 1MI5E 4ZAKC 1JPSL 5EU4B 5I2IB 4PGEB 1U8MB 4NCC1 1XF5B 4ONFH 2A6KB 3NPSB 2EE3A 1NGQH 2AJYH 1C1EL 4AENB 1Y6MR 1SEBA 1JMZA 3NIGE 1V5JA 4TOYL 2HT3D 4YGAB 3WFCH 1LE9A 4R4FH 2YD8A 3SE8H 3DURA 1PSKL 3HLAB 3EFFA 4XVSL 1HINL 3A6CH 3EAKA 3LKQB 2YS4A 3IXTB 5I1GH 4ODWB 1D9KC 4P2QB 4JO1L 1HQ4B 5BOZG 3PV6A 2IALB 4EDWH 5E6IB 3W9EA 3VXOA 3EOAA 3UTZB 3IDGB 1YYLH 1XH3B 3E6HA 4KI5C 5EC1A 1QFOA 1XGUA 4X7CC 3O81A 2YSSB 4AEFA 2R4SH 3PJSA 4D9QD 3SE9L 2HFGH 4MVBD 3MXWH 5F3BB 1BBJA 3PQYA 1HH9A 4BFGA 4M7KH 2VL4A 3QO1B 5J1AB 2CXGA 2PYFB 1BVZA 3L5XL 4NRXA 4HQQH 3PDDA 5MEQB 4Y19E 1CD1B 3CXHJ 4UTBH 4HWEL 3R8BB 1L0QA 4JY5H 3WFDH 2GHWB 4C4KO 4FQLH 3OSKA 4IJ3C 4R7DB 1XF2A 1I1YA 2KQNA 2YD7A 4OTXH 3QI9D 2EDOA 3MCKB 2XY1A 3MOAL 3F7PC 3ZLQC 2AJSH 4O5LH 1KIRA 4UDUB 2NY2C 4PR5B 1KG0A 2O5YH 3C60C 3B5TA 1XF4A 5EO9B 4HWZB 3JWOL 5FGCE 3O3BA 4PGZA 1DQQB 2NY3C 1UEYA 5DVNA 5EIIB 3TNMB 2Y1VA 2W1NA 5HHOA 4OBSA 3EJYC 3GKWH 4OIAA 1O7SA 2GJZA 3QJHA 4FMFA 3X3GL 4MQXD 4FFYL 1H5BB 2DWDB 3LRGA 1LP9A 2AKRB 4X5XA 3QRFM 5KANG 5L2JB 4TPRL 5FYJH 3OR6B 3TO2B 1CFBA 4LKCB 5I76A 5GGSB 2BVTA 5I6XC 3S35H 1S9YB 3GSNB 3IU3A 5KVGL 5ID1B 3DIFB 4QXUH 1MCWW 2IC2A 4YBLC 3DI3B 1UENA 4EEEA 4GMSH 2ERJC 5DHVA 2CKBH 1I4FB 1QZ1A 4OFDA 1PD6A 1J05B 2DF3A 3LQAH 1U3HA 4PTUA 4NT6A 4DKEH 1ROWA 5ETUA 1YJDH 4FQ2L 4M4PA 3Q5TA 1RQ5A 4P5TA 5IFHH 2DDQL 1P4IH 4MNQA 5LKNA 1Q1JH 1WCBA 1YN6A 2BHZA 3BH9B 1ORQB 2FH6A 4WI9A 2BSTA 1BVKA 2AK1H 5MP6H 1OWRM 5J4MA 2Y07L 4MA7L 1PAMA 4M5ZL 4J6RL 3QG7L 2J7LA 1MCBA 5EU6D 3MLXH 1JPGA 1KPRA 4V2BA 1U8NA 4WU7A 3O6LL 2OJZL 3IVKB 4D9QE 3CXDL 5FDWA 4PJBB 5HY9B 1WWCA 4X4YA 3QUZA 2IH1B 3OPZL 3CCHB 3WS6A 4X7FC 1EEZA 4K2UL 4NQCB 3KR3H 2BSRB 1Z5LA 1Z6JT 3C09C 2E7CA 5BMFL 3VD4A 2E6PA 1MVFA 5DJZA 2QR0A 4OD3H 2YUXA 4YK4B 4PY8I 3F7YA 2WWMD 3BQUD 5JTWA 4PP2A 1HCFX 4HS3B 5GZNC 1UWGL 5C0BD 1TCMA 4JHAL 4R6UA 3CK0L 2JJTA 4YX2L 1ZLSL 4QRQA 3GJEB 4KY1H 3SDAC 4BH7A 4OGAC 4YNYA 1EERB 2VZVA 4PD4J 2BFVH 4HSQA 3JWDL 1K2DA 3HPJA 3QPXL 3KNBA 1WFOA 3IT8D 1A22B 3MBEC 2HVJB 2FNBA 1MCNA 3GFUA 4NM4H 4L3CA 1H9VA 4ZNEA 5JPNB 2XRAH 1IGTB 4P5MB 5BQ7B 1RV6X 5BVPL 2HJFB 3OAYK 1A6PA 5FV1L 3JV6B 1UYWH 1FZMA 4XPBH 2F5AH 1OAUH 1QSEE 3ILPA 2JB6B 2MSPA 1NSNL 2AEQH 4PB9H 1CLOL 1QFPA 1UKQA 4HUVA 5AD0A 3SGEI 5E8EB 3PWPA 1ACYH 1MFNA 3IDXH 4ZS7L 3WSQH 3SDDB 1IGYA 1PYWA 4MNHB 4X9IA 3AS3A 2JCCF 4Y5VA 1ONQB 2DS4A 4WW2F 1NCTA 1DEEA 4JDTL 1OGTA 5DI8B 4Y4HC 3O6FD 1DVFC 3U36A 5JLZB 1CT8B 2FECL 4RMWA 1ADQH 3SOBL 2D7QA 3EIFA 3FCTA 5HHVL 1WAAA 5EU6E 2F53E 1UFUA 3IRPX 3QXDB 4P23D 2HAZA 5IW1B 1Q9WA 2VC2L 4ZO9A 3ZKXC 3BUYA 5D6CA 1I3GH 4XAKD 1GVIA 4CNIA 3H9SD 1BQHB 1ZANL 3GHEH 4QRRD 3L95A 2DBLH 3OKLB 4QHMA 4TULH 4XB8A 4LRIA 1RK0A 3GO1L 1K3ZA 4HLJA 3TYFB 2PYEA 3OZ9L 1NUNB 1OB1A 5L8LB 1JGDB 5GS1C 3UC0H 3P40A 2DLHA 5C0BE 3VRIA 1W72B 3PNWB 4G8EA 5IVXF 4KPHH 1KJ2A 5SX5H 5EUOF 2YXMA 4X5WA 3EYQC 4QHNA 3SY0B 5ENWB 3BH8B 4PJ9B 4L8CB 4NYLA 2OK0L 4R8WL 2QLVB 2MKLC 1KCSH 3CPLB 1UJTA 1OTTD 3OJ2C 4DFIA 3MYJA 3WMSA 5SX5K 4UB0L 1EH9A 2ADIA 4PJFE 4XAWH 2W91A 2IAND 1LK3H 5DEGB 4KUCD 4Z78A 1LEIA 4OF6A 5AWNH 1IC5H 2CIKB 4YEFA 4NM8L 3D3VA 3DBXA 1QFHA 4LFHD 1X7QA 2ZG2A 4LPCA 1U8HB 3OG4B 3ZYIA 2DTML 3QIUB 5AZ2H 1BZ7B 3ULUF 2VABB 1H3VA 3TZVA 3BP4A 4AY0A 3VXPB 2GAZB 4P46B 4NWTH 2IBZX 3HC3L 5GGSY 5D1QA 1CGYA 4TUJA 5DVLA 4URTB 3U7YH 3BGMB 3SGDH 1YEEL 3F8UB 4PRHB 2CLVA 1CI5A 4MLSA 1QO3B 5I1IL 4QRUB 4PGBB 1EZVX 4TTDD 1HH6A 1QKZL 4Z7WB 4PGDB 2HFEB 2ZSWB 2FWOB 4NFCA 3IJHB 2CIIB 1MQ8A 2VR5A 1EFXA 1S7WB 2NNAA 3UBXB 4NQED 2IPUG 1I3RB 4P5KB 5FK9A 4HZAA 1GIGL 2LTQC 1PKQA 1UM4L 3T0AA 1AXTH 3EHBC 2OP4L 3S34H 4Q6IB 2R8SH 5DQDL 2UWEF 4XAKE 5KN5A 2H6PA 2CUIA 1YEHH 4M9PA 1NEZA 3RVTD 3K8KA 4OZGB 4JZJC 3DVGA 1F3RB 3QFDA 1FSKB 3AXLA 2GSGB 3RTQC 2VL5A 2FSEB 1BQUA 1MI5A 4GRWH 3HAEH 3ZL4H 1OTUD 5IR1B 2DWEB 5CILH 5JHLH 3QBTB 3LN4B 2AGJH 2P47B 3GB7A 4PLJC 1EGJL 1BX2A 3L7FB 4KRLB 3LRSA 5FGBC 3HZKB 4AIOA 3RWJA 2YN3A 2GT9B 5EO0A 1Y18A 2XKNB 4FMKA 1CQKA 3S7GA 4HULB 3WO4B 5E5MB 3RGVB 1A7QL 1GC1L 4LEOA 5E03A 15C8H 4HC1A 2IANE 4Y5XB 2W59A 3CFIC 4OD2B 2YD2A 1JN6B 2EZ0D 3W39A 4HCRH 5KSBF 4J3OC 2Z35A 1MHPH 1VFMA 2ZCKL 5E4EC 4ZD3L 3ES6B 1BECA 3VFUB 1RMFL 1EEUA 4W4OC 5FYJE 5CJBA 1E0OB 1N26A 1A6AB 5EA0L 3DGGB 4DGYL 3L6FA 3FQNB 1BFOB 1AQKL 1BZQK 1MLCA 3HC0B 3SJVE 1TMCB 5I1KL 4P48A 4XMKL 4Q97A 3QWOB 1IEAB 1KCLA 4N9GA 2VISA 2EIDA 5TDOA 5LCVL 3UPCA 2SEBA 2GITB 2Z8WC 1HSAA 2QHRL 5KVMC 3ARGC 1OP3H 3L5JA 4ZODA 3KPLA 4JGMA 4XPFH 5DK2A 2VN7A 3NABL 4M6MH 3RVWC 3H9ZA 3KAAA 1DQDH 3QQ4B 5CD3A 4M62H 4Q9CA 1J1PH 3WLBA 1LO2L 5IMLA 3TGXA 2VQUA 1G7JA 4MJ6A 4YWGL 5LGHH 3K81A 3LRHA 1XGQB 4NQEE 1R3HA 4BYHA 1KLUB 4YHNA 3WXWH 5C7XH 4JFDE 2CPCA 4YQXH 3SKMA 4OZIE 3P4OB 2V7HA 1K8DB 2BCKB 3C6LC 3KS0J 1JI2A 3L3OB 1KJ3H 1NCBH 2D7MA 3QEQB 4K8RH 1IAII 3I3DA 4LCIL 2Q7YA 5IGXL 3ARPA 2DOCA 3RIFK 1DCLA 1WV7T 3WUWG 2FO4A 3WIIL 5DD6B 4WDIA 2VLJD 5LJYH 2VDKH 4GAFB 5JO5B 4WTXA 2F5BH 4AEIL 1IZJA 4XNUH 3C6SA 5EZIH 4GS7B 5C0DB 3MLWL 5EBLA 5I18L 4P9HC 2EDRA 2VUYA 5ICYA 3MREA 5ESVA 3WO3B 1NJ9B 1NAMB 4YDVA 1AP2A 2X1QA 1XZ0A 2XYCA 3X3FH 3QDJE 1TCRA 2EH8H 2DQCL 1EO8L 3TA3B 1ZV5A 1DBAH 1PQZB 3HNSL 4P0DA 1I85A 5D1XD 2OL3A 4EDXA 4UNUA 4EVNA 5HHXH 3VXUB 1HIML 1NMAL 3S3SA 3R0MA 2R0LH 1GGCL 1OHQA 1XGPA 4YJZL 2HWZL 3CFKA 1ZVSB 2NY4D 3QNZB 3AMKA 3PWLB 1SEQH 1X44A 3PE9A 4FTVA 1GL4B 2PR4H 4NN6C 1MRCL 1A1NB 1B0GA 4EN3B 3SDXE 3ALWA 3O3AA 3PG2A 3GMPA 5C08E 3QEUB 2UY7A 1GGIL 2NQCA 4Y2DB 5B4MD 1F4AA 3DUSB 5IESL 4QHLB 5T1LA 1BIHA 1CFNA 3B43A 1QVOB 5C9JB 4X5LA 2DIJA 3H3PH 5C0JB 1HHJB 2A9ML 3BZEB 2AEWA 3TCLA 4P23B 4NHCH 2EDKA 2R2EB 3T3PE 1F90H 3MRBA 1Q72H 1WUNT 1ODAA 3HPLB 4G5ZH 3DX7B 3VI3E 1KT2B 1NKRA 4OCXH 4LLYA 3TNNB 5F7HA 2IJ0C 2J6EH 3UPRB 3CD4A 4H26B 4ORGB 1BEYL 2C3VA 4Z0BL 3PGFH 3ZHKA 5HXMA 1JHLL 3MRHB 4NKOB 1T6VN 4JY4A 5F96L 1XGRA 3N85L 1K6QH 5JMOC 1EZVY 5ICZB 5JW5A 2VLJE 4J3WA 4XP1L 5E56A 1S7SB 2VAJA 4GBXB 4JO2L 1KULA 1QSEA 1YN7A 3VGAB 2E8YA 4N8CH 5JUEH 4U3HA 2DQGL 3O3UN 2NY6D 1SBBA 5CBAA 4PJHB 4YHML 2DQEH 4KTEH 1OD7A 4U1JB 1RZKH 1XMWA 43C9B 1V7ML 3NZHL 3MRGB 2XNAB 5JZ7D 4K71B 1LEGB 4HKXA 4I77L 4WNQB 4X99A 3L3IB 1NC2B 5EIVA 2DI9A 3IJYA 4PJIB 5E8NA 2X4QB 4TSBH 4GAYB 3DPBA 1G7HB 35C8L 4JVUA 4NJAL 1A1MB 2R1WB 5M94B 2F53A 2BNQD 4IBLT 2AJZB 1ZKAA 1WJ3A 2AXHA 1F45A 1I1FA 5GGQH 2X05A 2D4DA 2Q7NA 1KIQA 2VLLB 4D2NA 3WCYA 1M7IA 5DDHA 4PRAB 3EOBB 4HXAH 2VIRB 3CFBA 1QLRA 2ZG3A 3AREA 3QZWA 3T4YB 1GOGA 2ZSVA 4UUJB 4DQOL 4L8SC 3UYRL 2G5RA 1BOYA 3BQUA 1H8OA 4I0KA 4L4VB 3D0VB 1QNZH 4NO3A 4NO2A 3DYMA 2GFBB 4CADB 1RUPL 2R4RH 1DEDA 4H8WL 4WHYH 4RGMB 3OL2A 4DOHB 4ZUWB 3HZVB 4OZFG 2APFA 2BVPB 3KJ6L 3WN5C 3U4EA 1CXFA 4TVPH 5GGVY 3LV3A 3UTQB 4BQ9A 2CRYA 1TIUA 1U8QB 3UTTD 5FCUL 4PJFA 1JRHH 1S8DA 1NGZA 1RZJL 1TZGL 2OR7A 4H1LA 3UTSA 3FQTA 4X7EC 4JHZA 4PJBF 3P73A 1SYVA 2A6DB 3VE0B 4IOFC 1OAYH 3HZYB 2I9LB 4UQ2A 1JZ5A 3QH3A 2X4NB 1R5WB 4JFFB 4LRNL 4ONHA 4PLKD 3ARFD 3UJJL 1S78D 2FX7H 4YH6A 1GGBL 1G7MB 3B9KC 2C7UB 1OM3L 4K8RD 4OT1L 5JOFB 1YMMD 2NXZC 1I8MA 1A3LL 4Z5RA 3VW3L 1RAMA 2QV2A 3MV01 1F2XK 5F7NC 4GRWE 2OM5A 5CEXA 2CJUH 2B0SL 1ZA6B 3D39A 4XP9H 5GQBA 5FYKH 3UJIL 1U91A 3AB0C 2X9WA 2D7PA 5MENB 1OCWH 3WIFA 1H8NA 5DT1L 3O6FA 2COQA 1MUJB 4WVRA 3WDHA 4PRNB 4CW1A 1G1CA 3T2PA 3C5ZA 4MXWL 5I1AA 3T0BA 1CLZH 2CK0L 4JN1H 3ZYJA 5C0CD 2BNQE 5J06A 4PJ8A 4MJ4A 2ITCA 1TQCB 2P5EB 3Q3GB 3CLEH 4FQQB 3MV9D 4XCYB 5J6GB 2GTZA 1T66D 3QCUH 2CO7B 3WS3B 5A43C 1CS6A 4AM0A 1PLGL 4WRLA 4OFPA 1EX0A 2PTVA 2C26A 4XWOD 4L4TD 2AW2A 2EDHA 1MRFL 5IF0B 4HK0B 3RWHB 3I02B 2A0LC 3T1FB 3L3HA 4PB0H 3CFJA 3ZE2E 3RWDA 2X70B 4ERSL 5DR5H 3KGRA 3WD5L 1JYXA 3RL1B 1OGAA 1MHHA 2NR6D 3W9DB 4HIIB 4JFEB 3L5WA 3OB0H 3RDTD 4YAQB 3VFSA 3LIZL 3ULVF 2P24A 4N68A 2R0ZL 1VFAB 3SDCB 2N4IA 4L3AA 3TN0C 3UDWC 3UTTE 4BELD 4UT9L 3T1WA 3K2UH 5TE6H 1ZHKB 2IANA 3EW3B 3ECBB 4O2EB 3NCCB 4W4NA 4NO5A 3OB0K 1Z9OA 1AFVH 3GSUB 4BJLA 2Z92A 1DBBH 1UXWB 1BLNB 4NZTH 5MERB 4GRLC 2WBJA 4PRIA 4U7SA 5DZLA 4OLEA 5TQ0L 4AT6A 5E9DD 3A67H 1UB6A 3VG0L 3MROA 1NBVH 1WFTA 3VD5A 1VADA 1YMME 1IKFL 2D7TH 1FNEA 4G8FB 3G6AA 4OCSH 4DZ8A 4FQXC 1CXHA 4JR9L 1WCQA 1UA6L 3SJVA 1JVKA 1OLZA 4XP4H 2X4SA 3DMMB 2ED7A 2R9HD 2QQKH 3IDJA 3FN0L 4PGCB 2VDOH 2CKBA 4IOIA 5D7LD 4APQD 1XGYH 3WFBL 1P9MA 2DMBA 3RPIB 4R0LC 5AZEL 3L3KB 1TVDA 2QSQA 4LU5H 1D6VL 4K9EC 4YR6A 5A3IC 2GJ6D 3K2MC 5CUSL 1KJ2L 5B38B 5IQ7L 3GI8L 4NRZA 1IEBA 2PXYA 2W60B 1UZ6E 1FVEA 4KRNA 2HTLD 4JFDA 1INEH 3MV9E 4YEEA 3RVVC 1YQ2A 4JM2F 1L4IA 4P2YA 1OW0C 5HGBB 4O58L 4S1RL 4HIEB 3IU4H 3W81A 2P8MA 1CFTA 2BRQA 5D9SA 3G5ZA 1Q94B 3QXAA 4M6NL 4UOJA 4N5EC 5HI4C 1SBSL 4PJXB 5D1ZA 2A77H 1U95A 1SY6L 3OKKA 3VWKA 4G7YH 3QUXD 1CGXA 1EEQA 1SEBB 4OCRH 4U1GC 4QXTA 1FFPA 1LE9B 1MAMH 3LPGA 1AI1L 3QDJA 2I60H 1FFRA 3DURB 3SCMA 4F2MA 4GXUM 5DYOB 4JKKA 5CCKL 3PV6B 2HG5B 1ZA3A 3VXOB 3W9EB 2DQUL 3EOAB 2W65A 2R0WL 1NKOA 3E6HB 3ARDC 5EC1B 1XGUB 1CE1H 4OZGF 2QQLL 1Y6NR 3PJSB 2VDPL 3UAJD 3N06B 5JORA 3EFDL 1BBJB 3L3GA 4OZHE 3PQYB 1HH9B 3SDXA 2JB5L 2EYTA 4FNLH 5C08A 4M93C 1M05A 1E4WH 4NRXB 4HFWA 2FGZA 5IK3A 5T3XH 4Y4KC 1QRKA 4HFUH 2IAMC 1QBAA 3LPFA 3PF2A 2R1XA 2YPVL 3BDYH 1XF2B 1I1YB 4KJYA 1PG7W 5CJXA 1VDGA 2ZUSA 2GJ6E 4XVTL 5HYSA 3GMOA 1KG0B 1CICB 1XF4B 1MEXL 2N7AA 4WWKC 3Q6FA 1N3NA 3O3BB 5H37H 1ADQA 5KS9E 3G04A 2A6IA 2XG4A 4UINL 3QIWA 1YYMH 5HHOB 2VN4A 1T21A 4Y8DC 2GJZB 5HYQB 3V6BR 4K7PH 4XNZB 1BWMA 1AH1A 4X5XB 1B2WL 1T5XA 5DJAA 4IOSD 1M7XA 3QFJB 1HWGB 2J4WL 4OF5A 4KXZI 3NCEB 1MVUA 1RIVL 2KUTA 5F7MC 4H88L 2J8UA 1QBLH 5DHVB 2A73A 4KI5D 4B41A 4J12A 1AHWC 4OB5L 3RZCC 4RWHA 3TCXA 1YMHA 1U3HB 3NAAL 1AQDA 5D2NE 2VDLL 5ETUB 1I9RL 1Q0XL 3NIDE 4QCIA 3GSWA 4FOMA 5HJ3A 4MNQB 4XTRC 3P0VL 3RIAK 3QXTA 2NXYB 1RHHA 4JFZH 1YN6B 4YZFE 2Z31C 2OYPA 4BQ8A 3IJSA 2BSTB 5E5RB 4YHPA 1SJHA 5FOJA 3CLFL 5CIPH 1T1XA 1RUAH 2C4FU 1KPRB 2XTJC 1I75A 1U8NB 3MCLH 5GSVB 1IGML 5C0FA 4F7PA 4B50A 4XPAH 4X4YB 4NKQB 3QUZB 1BJMA 3OAUL 1EEZB 2J5LC 4OLXH 1Z5LB 2PO6C 3EO1A 4Z8FH 2NY3D 1G0XA 5DUML 5E8PA 4NQDA 5DJZB 1J0KA 2R1YA 3DUUA 3F7YB 3BMWA 4PP2B 2HJKA 1CIDA 4HJGA 4HIJB 2MNUA 1WITA 4HWUA 4TSCH 1EO7A 2VDMH 4X4ME 4QRQB 4BH7B 1BQHG 2QQNL 4YNYB 3BYTA 4XGZA 2F54D 4NQXA 1K2DB 1FAIH 3HPJB 4MA1C 5HGAB 3KNBB 4UAOB 3CSYA 5CGTA 4L3CB 3H3BC 2BDNH 5I1JL 5LBSL 1HQRA 3RY6A 1MCEA 3V0VA 4OF8A 4LSUH 5D7JA 3FT4A 2OL3L 4OGXH 4XBGB 2Z4QB 5GRJL 3SQOH 1A3RL 4L3EB 1KB5H 2HRPL 3TH3T 2P5WB 1FZMB 1ZTXH 1VFUA 4JRYD 4K3HA 4WTZA 4ZMAT 1QSFD 2NW3B 3D6GA 5B8CA 1EXUA 1KTLA 2J1KA 1G9NL 4KI5E 4XP6L 4HUVB 1N7ML 2LAGB 4R97C 4XCCH 3HAEA 3PWPB 3D9AL 2B4CC 4MDJA 5CLTA 1PYWB 3R8QA 3ZHDA 2ZKHL 4Y5VB 1DEEB 2DQDH 1OGTB 4QT5A 1HXYA 4BA8A 5T1DH 5J13B 1N5AA 1FO0L 5CEZL 1OPGL 1JNHA 3BE1L 4KGLA 3ILQC 3RFZC 2C9AA 4PJGE 1C5CL 2WBKA 3V6OA 1R3JA 5ERWA 5GZND 1S5IL 4ENEC 4JKLA 1Q9WB 4I48B 4LLQA 1JPFA 4PJEA 3ZT5A 4HCRA 2JLLA 4OGAD 5D6CB 1IGCH 5LGJA 5FO7A 4JO4H 4QHMB 1CXLA 5C0GA 1RK0B 1L9MA 1T1ZB 4J23A 3RWGA 2FGWH 1N2RB 3MBED 4HPYL 1A5FL 1QEWB 1NCDL 2YPLA 1CR9H 2PYEB 2BJMH 3PGDB 1OB1B 3X11A 4U1KA 4PJHF 3SE3A 4LVNC 1RU9L 3S4SA 3PABA 1KCVH 3H9HB 4EBQH 4DUWA 1KJ2B 4JPWL 4Y7MA 1MNUL 1IT9L 4X5WB 4D0BA 4WO4D 5F9DC 4QHNB 1Z9SA 4MAYC 4YC2C 3PHSA 5GRXG 3UMTA 3K74B 4PJIF 1NFDB 2EH7L 3TJHC 2F54E 4NYLB 1EVTC 3QYCA 5F71A 4M6OH 4XHQA 4EI5C 5IB1B 3EKCA 3MYJB 3HTLX 2ADIB 4HJJL 4NN5C 3G5YA 3QR2A 4Z78B 1LEIB 5HHNA 2K7QA 1NEUA 4JRXA 5ADOL 3D3VB 3DBXB 1KENH 4GRMA 4NC0B 1IM9A 2AK4E 4IDLA 2APWA 3AC0A 1DVFD 1WK0A 4KRPC 1BJ1J 2HH0L 4JRYE 2DM3A 4XPTH 3B3IB 1KIPB 1QSFE 2VXVL 4IRJA 3I2CH 5DUPH 2DQJH 5D1QB 3MYZA 4YPGA 5L6YL 4LOUC 5I9QB 4TUJB 4M8QA 3HRPA 3ULSA 1S7UA 1KUMA 3V2AR 3RY5A 4LCWA 2CLVB 1U6AL 4LARL 5I75B 3WLWC 3RI5K 1AKJD 1UWEL 5ANME 1OL0A 3O8XB 4MXVF 1BM3H 1HH6B 1T80A 2EEAA 4P9HH 2B1AL 1FNGA 1NH6A 1EFXB 1KPUA 2NNAB 1CDJA 4XNYL 1PKQB 2XQBL 3GSXA 4ODUA 5GIRA 4JN2B 3EYQD 2MCPH 4TRPL 5FHBH 4MCYA 1D5ZA 4HS8H 5KN5B 3GSRB 3TPKA 2D7NA 2J88H 4BM7A 1NEZB 5TE7H 3QWRD 5C6WH 2MWCA 5FYKU 3DVGB 3EJZD 4Y1AD 1DQLL 3QFDB 1WZLA 3AXLB 1AC6A 4CU7A 4BH8A 2HKFH 3K7UA 2VL5B 4CMHB 4KZDH 5BV7C 1MI5B 5BXFA 2NYYC 1KJMA 4GW4A 3WYRA 1GJIA 5I8CB 1UQSA 1IVLA 3S36L 1BX2B 3LRSB 4HK3N 3RWJB 5DRZA 4MA3A 1C16A 5EO0B 5CZXD 1V05A 1Y18B 2X1WL 2YKLL 4DEPB 2LV4A 1K4DA 3WNPA 5GRVK 1R3KA 4LSQH 5L2KA 4Y0GA 4E41B 1QRND 4LEOB 2YA2A 4XNMA 5C3LD 1RZ8B 4OLYH 1RJYA 1NGQL 4M3KB 5IB5A 4WU5A 1UJ3A 2AJYL 5EOQL 1KEMH 3W39B 4LVHB 4MLIA 4RMVA 2Z35B 3G9VA 4GW1A 3LEYH 4UU9B 5D2LE 1XCQA 1XT5A 4ZXBD 3S5LA 2J6EA 2MPAL 3M8OL 1HNFA 1QSVA 4YHYC 4W70A 4HBCH 4QRPA 1X6LA 4RBPH 3WBDA 4EDWL 3NH7L 5I1HL 3L6FB 2APBA 1MLCB 2BVEA 1A6UL 3RZWA 1NQBA 3MODH 4RNRA 3MLRH 1I9IH 4N9GB 5TDOB 1QTYT 5F8QC 4RBPK 3LS5L 4JFXA 1JYVA 4X6EA 3TV3H 3QCVL 4XPGL 2DN7A 5C07A 3KPLB 2WLZA 5JMRA 1FL5B 4P3CH 5CD3B 1XGTA 1H15A 4KJQC 1V3JA 5GJSH 3WLBB 1BGXH 4YHZL 1EMTL 1G7JB 1MRDH 2VE6B 3HHRB 4MJ6B 4N1CA 1F11A 1R3HB 4ETYA 5CJOH 4YHNB 4I8DA 4PUBH 3SKMB 3KYAA 2WK2A 2V7HB 3OR7A 5SV3A 3EOTL 2P7TA 1N59A 4DUXA 4OTXL 5DEZA 7FABH 2A1WH 1FVDB 1VFBA 1DR9A 1VGKB 2O5YL 4NGHL 4B53A 3PDGA 2Q7YB 4Y1AE 2ED8A 1RUQL 3OKDA 5A1AA 3THMH 5FA3A 4KDTC 4GSDH 3LVEA 2V7NA 2FO4B 4WDIB 3TYGH 3G9AB 1JHTA 3C6SB 3GKWL 4PJAE 1S7RA 1X5XA 1AGFA 2X9XA 1ZWIA 2FJHA 2NW2A 1P2CA 4X6DE 4DK6A 5ICYB 3MREB 5ESVB 4YDVB 1MFDH 1E4JA 1XZ0B 3O41A 4EIZC 4U1IB 4B0MM 3OKOA 1TCRB 3MXVH 1QRNE 3VU2A 1OWWA 3OX8A 5DC9B 2VYRE 4M48L 1EAJA 3ZSTA 3FT3A 5DC4B 2OL3B 4EDXB 1T7YA 3VA2C 5FF6B 3LQAL 4EVNB 1EHLL 1AD0A 1YJDL 3KVQA 1XGPB 4TN9A 1FRGL 3CFKB 3RVWD 4NC2B 5TJWK 5B3NA 3LEXA 1Q1JL 4LSPL 2EIZA 2I07A 1JGUH 1YNTA 5F1IA 5TQ2H 4U0QB 1F2QA 4YGVA 1E4XI 4OQ1A 4PJXF 4FTVB 3UTOA 2H2SC 3GMPB 1I7RA 5IM7A 4LFHG 4RISH 3ARBA 3LKRA 4JM4H 2VH5H 1R3LA 5AG9A 3C6LD 5IEHB 4PRPB 2WUBH 4RRPA 1MFAL 5T1LB 1CFNB 3K8MA 1JHKL 3NIFE 4JREC 5GGTH 2GIYA 1A9EA 3VGFA 5EU3B 5E6IC 1QYGH 1EJOL 5F1KC 4BSVA 3LD8B 5GGRA 3TCLB 1UZ8A 3GMRA 4X4MA 2OI9B 4OI7A 1IAOB 4DAGH 5GS2H 4ZAKA 2FB4L 3EYSL 2W9EH 2O5ZL 3MRBB 4C83A 4QXGH 1ZSDA 4OFVA 4WUKH 2BY0A 2JTDA 3FHQA 5I66A 3OKYA 4GLRI 4LLYB 4HMEA 3DRQA 5ALBL 1M7DA 1FFNA 5HI5D 4E5XA 5D7KD 2C3VB 4UNTA 4RAHA 4X9HA 1J5OL 3VGDA 4JY4B 1XGRB 3C5SA 2VKWA 5T3ZH 3U83A 1D9KA 2VDQH 4MD0A 3INUH 1QSEB 1YN7B 1JWSA 1LMKA 5ILTH 5CBAB 5A2KH 2OQJA 4POZC 3CVHL 3KYKL 3I6KA 3AVEA 2JCCA 5L7XL 2DKSA 1UYWL 4Q9BA 1FIEA 5HDOA 2YUWA 2GY5A 2F5AL 3MFFA 3TIDA 4ODTH 1A7OL 2Y5TA 3MV8B 4Y4FC 3IJYB 5E8NB 3JVGC 1I8LC 1IMHC 3VD9A 4OI8A 1YEIL 4PJGA 5CKGA 4JB9L 4LPUA 2Z8VC 2F53B 1ACYL 1VESA 3U9PL 4XZUA 5L0QB 1LP9F 1KC5H 3MMEA 1I1FB 4KMQA 1W2KT 4L29A 1KIQB 4UT6L 4AG4L 4X8XA 3C60A 3C2SA 1A4JA 4KQ4H 4B5EA 1M7IB 4X6CE 5DDHB 4JPIA 4LSSH 1QLRB 3DV4A 3AREB 3QZWB 3SBWC 2ZSVB 1FBIL 5E99H 2PTTA 3WJJA 3OF6D 4EOWL 3KYNA 1L7TL 3P2TA 2VTFA 1I3GL 3QISA 4LIQH 3RWIA 4PG2A 1ZT7A 4DTGL 2BNUA 1SVZA 5J3HC 3U30C 3MUGA 2VLRD 1CL7I 4K3JL 1RJLA 5IFJA 2WZPD 4UIKL 3CMOH 4GKNA 4WGVB 5I0ZA 5HTSA 2V2WA 4JFOA 4BK5A 3DECA 2P44B 1S8DB 1NGZB 1FZJA 5HD8C 4H1LB 4X7TA 3UTSB 4PJCE 1SYVB 4YK4C 4WEBH 4NJ9H 2Y7QA 3LHPH 5DUBA 2AK4A 2EC9T 2DAVA 3N0PB 1OSZA 2Z9TA 3KWWB 3V6ZA 1DFBH 4ONHB 5J0BA 2G75A 1RURH 1ZHLA 4P3DA 3V4UH 2AEIT 4JRYA 4XAWL 5D72H 4M6AA 1LGVA 3HMXL 3TBWB 5ACLA 2F74A 4MD4A 4Z5RB 3ARXA 1GAFL 4J3TA 1MY5A 4P2OC 4OV5A 5ALCL 5FHAH 2VDRL 5CEXB 1AGCB 1JYNA 3CIQA 3D39B 4J4PC 1A7RL 1F8TL 1M4KA 1WC7A 3PL6A 4JFHD 2ZCLH 2XTLA 4Z7VB 5ANMA 5KVEH 5D5ME 4XNQA 4CW1B 3C5ZB 5L9DL 3QUML 5DURB 5I1AB 1S5HA 4V1DD 3BYYA 1YEKH 4JE4B 3QO0B 4A6YL 5A16A 5A2JH 2XN9E 1PJ9A 4IRSB 4U49A 4PJ8B 2ITCB 1HNGA 2UWEA 2XPGA 3T0XA 2GTZB 3SDAA 2Y4SA 4IDJH 2C5DC 4F37F 4I3RL 4AM0B 4LSVH 3PGCA 3A6BH 3SDDC 1CK0L 3MBEA 1QR4A 5ABDE 2HN7A 3L3HB 3OGCA 3CFJB 5JHDD 4Y5YC 1AXTL 5ITBL 1VEPA 3S34L 3BISA 4ZSOE 3RWDB 1ZT1B 3ULVC 5DMYA 5KOVC 3O45B 5MI0B 4AK1A 5DEFA 1CU4L 3H7BA 4JQIH 5FM4A 4XMLH 4DGVL 4IOFD 1OGAB 4F57H 1FC2D 1NANH 5C0RH 2VLRE 3GIVA 5JNYA 3VFSB 3BGFB 1ZHNA 3B9KD 2P24B 4OLWH 3VRJB 1WAAF 5JOPD 4LAJH 3VRLF 5JHLL 2AGJL 1CDUA 1A7NH 3VGEA 5GISL 3F6LA 3S35X 2XG5A 1VKXA 4U1HA