1SJVA

Three-dimensional structure of a llama vhh domain swapping
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
102
Chain Sequence
GGGLVQAGESLKLSCAASGGFMGWYRQAPGKQRELVATINSRGITNYADFVKGRFTISRDNAKKTVYLEMNSLEPEDTAVYYCYTHYFRSYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords r9
publication title Domain swapping of a llama VHH domain builds a crystal-wide beta-sheet structure.
pubmed doi rcsb
source organism Lama glama
molecule tags Antibiotic
total genus 15
structure length 102
sequence length 107
ec nomenclature
pdb deposition date 2004-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1sjvA00
2Q8BH 3F58H 3QYCA 3RY6C 5ISZD 3VRIA 4X6CF 1HHJA 3WS6C 2YD3A 1FVCB 4G43A 1MCPL 1F3DJ 1I7ZA 4Q74A 4ORGB 2QQNH 4U3HA 5IMOB 1KOAA 1I85A 4PJAF 2NY6C 1CGSL 3DX9A 3JV0A 5FO9B 3EW3B 4Z0BH 4J6RL 4JZJB 2YS4A 2X4QB 1ZHLB 3ZE1F 1Q9LA 2Y7QA 2IPKB 1NGWB 5EZJA 2O5XL 5CLTA 5F7NC 5IHBA 4QHMA 1JFQL 1T89A 1NCDH 4JRXD 5T3XE 4KTEL 4LNVA 4L4VA 4X98A 1GC1C 1DBJH 5DFWH 4O51A 2WNGA 1OTTC 4ZNEA 1S5IH 5IHZA 1QSVA 3QUZA 3BPCB 1RIHH 1J10A 3MJ9L 2BJML 1HSBA 1T6VN 1KXQE 2MQCA 3MLRH 3GMMA 2HRLA 5ALCL 5CILH 5TQ2H 3QJHA 3FQUA 4JQXA 3ZTNL 3H9HA 3FQNA 1WBYA 2ADFL 2CMRH 3UTPE 4LCIH 1K5NB 1FZMB 3TN0A 3LKOA 4Y19E 4JFDB 5JW4M 1Q9OA 3CVHL 5CEZL 4Z7WE 4CAGA 1T7YA 4APQB 4YJZL 4WFGE 1P1ZA 1BFVH 3IKCB 2XRAH 1DEEA 3W9EA 4Q58C 3VXRB 5K59F 3KPPB 3QG6B 2J6EH 3JWDH 3VW3L 3UC0H 1F58H 3LD8B 3IXAA 2FD6L 3MBEB 3A0OA 3WXVL 3OZ9L 4P5MB 2VDNL 3CVHB 2ZNXA 4GOSA 4LPCA 4P2YA 4LDEB 4LPWA 4UUJA 1KPUB 5HYIA 3PGCB 2NNAB 4NM4L 3IS1X 2HH0L 5IGXL 5D1QC 2GSGA 5FGRA 2DLTA 1IMHC 5F44A 3VFVA 2V2XB 1FVEA 2VKWA 4LVNC 2YPLA 3ESUF 1BVLA 3JVGC 2OTPA 3MRIB 2NTSP 1T1ZA 2F54B 5JXEA 1H8OA 2F58L 5T3ZE 2EICA 4IRJA 4GXVH 4GRLB 2L4OA 3P77B 4JRYA 4J3VA 4BFEA 5K9OA 1E6OH 4MD4B 5JDJA 4BZYA 3MXWH 2VE6A 3G5YA 2EO1A 3KLAA 3LSOB 1A6ZA 3TBYB 1N6UA 1R5IB 1GSMA 4HKBA 4P2QA 3KGRA 3RI5F 1CGUA 2E8ZA 3GMQB 5IMMA 5C0NC 5GS0L 2G2RA 1UT9A 5EU7C 4HUUA 2AV7A 1T4KA 1XH3B 1MAJA 2FB4L 1NAKL 4PG9B 4HS3B 5GRVL 3IAGC 4HWBA 2R4SL 2VXTH 4ETYA 3PIQB 1KCUL 3LKQA 3PWPD 1V7ML 5C08D 5HHQA 2G75A 1P7HL 3MLVH 3STBA 3MRBA 4LKCB 5T1MB 3ZKQD 4OZFG 1KSRA 2D7MA 4DVRL 1XEDA 3ARDB 4AIXA 1NBZA 4H8WL 4YHKH 5HDBE 1OSPH 2JJTC 4DZ8B 2DWDA 5GS3A 3OPZH 4U49A 1WISA 2DDQL 3HUJF 4LSRL 2F15A 1C08B 2V2TB 4YHYB 4XP5H 4M8VA 3JXAA 1U8NB 4Y4KD 2VSDA 2P8PA 2FZ3B 5IM7B 1GC1H 2FJGB 4A6YH 3BH8A 4OGAC 2V7HA 2VXQH 2EZ0C 1FNSL 5DDHB 5E99L 4GW5B 2ZSVA 4HJGB 1CICB 3JV6B 1UFUA 3R06B 4JO1L 1FV1A 1AY1L 1RPQA 5E24E 4DGYH 3HFML 2DLHA 1MUJB 4LARH 1X5JA 5HD8C 5CHNB 3H3PH 3OAUL 4AQ1B 3NCCB 4Q0XL 1HZHL 3DHJA 3RVWC 3L95A 1H3PH 1C7TA 1JPTL 1WT5C 2YXFA 1DL7H 3EO1B 1CXEA 2NLJA 2NY0D 2AKRA 3F12B 4WGWB 2IBZY 2NY7L 3CXHJ 4F2MB 4PJXA 3B9KA 4P4KA 5BW7C 3FRUB 4NHCH 4E5XA 2DQGL 4R2GD 2UZIL 2GAZB 3PG2A 4MJID 4U05A 3WDJA 5GGQL 2XZQH 3RIFK 2V5SA 2YR3A 3MV01 2OR8A 4PRDB 3RPIB 4PJ7E 4C56B 3VMPA 5K9QG 1FL3B 1X5ZA 2PUQT 1OGAE 2AJUH 4NQXA 2BZDA 2WV3A 3P73B 2J4WH 3Q1SL 4U6XA 3E8UH 1U8JB 2A9ML 1IGIH 5AUMA 4LSUH 2DM4A 4EZMA 3UDWA 1YN6B 3QHTC 4G8IB 4HDIB 3ZDZF 4DQOH 1JYNA 3O81A 3QCTH 2EDDA 3ULUE 4MWFA 3CCHA 3G6JA 1MIML 1HNGA 2R4RL 2H2SD 3LDBB 3VFGH 3DVNB 4CJ0A 1AD9B 2V7NB 3S36L 4L1HA 2C3VA 1IC4H 3PWVB 4BSJA 5I8KL 1KENH 2C1OA 4IHOB 3S36X 1E4XL 5HPMB 5A3IC 4FQLH 4LAQH 4HBQA 2R0ZL 2Y1VA 3HAEH 3GKZA 3SQOL 5IROA 5J7CC 4P2OB 1CF8H 1WIOA 3I50H 1D9KB 3GMPB 4HEPG 3KLHC 3U4EA 1XF3A 2HJFA 5FGBC 1MFCL 4PY8J 3TCLB 1ORSA 2GQHA 4AG4H 1LO2L 4WO4B 4MJ4A 4TVPL 1CFTB 4JQIH 4PS4H 1VADA 4I77H 4LRNL 1U8LA 2EDYA 3GSWA 4F58L 2E6JA 3O6LL 3KPQB 3UJTH 5CCKH 1I9JL 5DS8B 2H6PA 2PTTA 2FGZA 4FNLL 1MFDL 2FJFA 3WS3A 1UM6H 3GSUB 1JPGB 5IEKA 1B0GB 1QA9A 3X12A 4DFIA 2VIRA 4X4XB 2QHLA 2WBJD 3ALWA 5I1CH 4GW4B 3RTQC 1PZUB 5DVOA 4ZUVB 2VXSH 5D2LB 4UOW1 3WFZA 5ID1A 1ORQB 1JMZA 1I7TB 3CFDA 4N0FA 5DT1H 2H9GA 5LCVL 2DF3A 1QLFB 3ES6B 1QHPA 2DTMH 4DGVL 1XGRA 4NPYB 1WSST 4LSPH 3BWUC 2YMXH 1H0DA 4ZXBB 5CD5D 1Q0YH 2Z92B 4UQ2A 2P5ED 3MGAA 3QHFL 4WWKB 2X2YA 3BQUA 2OMBA 1FFOB 4WFFE 3DUHA 3GM8A 4M7KL 1OP5K 3BSZH 1A7QL 1RQ5A 3U0WL 2UZYB 1DBAL 4P3DA 3WNLA 1KT2A 5D8JL 4L9LB 4FTVA 1U6AL 3MCKA 5ICYB 3RDTC 3KPLA 3UTTD 1LP9E 4AEIL 2ICWA 2EYRA 4NUJB 3QWRA 4YZFF 4YBQC 4QRPA 3BKCL 5DMYA 3FOMA 1QRNA 5KANI 3O3EB 4MB4A 4YIQA 5C6TL 3SGEI 1U8IB 2XY2A 2KZWA 1P5VA 4D0BA 3K7UA 5KSUA 1MREL 5ISZA 4LHUB 3EYFA 3QI9B 1L7IH 3EYOB 3O8XB 4LAJH 2EH7H 2IALB 4OGYH 1E4XI 4YBLB 1ZA3B 4UT7L 2R56H 5I1LA 5F7KC 1BZQK 5DGRA 3IU3B 4PJFF 4X4ZA 2OYPA 3OGCB 4P2RB 3BUYB 5F96H 3WO3B 2LVEA 2I24N 4AYFA 2GUOA 4L3EE 1SBSL 4KK8C 4XP6H 4Z18A 3ZKSD 3FO2B 3MSPA 2GITA 3LY6A 2P5WD 1HDMB 5TDPA 3OXRB 3TP4A 4HJJH 1O7SA 1TENA 1A7NL 3U46B 3BYTA 3MREB 5HHNA 1Q1JL 1FP5A 1GGCL 4WHYG 1OP3H 4D0CA 3TWCH 2YRZA 1EFXD 2JJSA 1HHGB 4OF7A 2AABL 3RWFB 1Z3GL 3DBXA 1FBIH 4RDQF 1P2CB 3ARZA 2FX9L 4DCQA 1I3GL 3BE1L 1UA6H 3WFCL 5EZIL 4J8RB 4KVCL 1ZT7A 3IKKA 1EGJA 3IGAB 3QPQD 3K80A 5JUEH 3QEGH 5F6IB 3BPOB 4Q6IC 2OQJB 1TTFA 4JN2B 3BDXA 3BPLC 4DVBA 5K9JL 3CLFL 4PRID 1CD1A 4HFWB 4XB8A 4N0UB 4AIZB 1MHCA 2DD8L 4JM2C 1P7KA 3EJZD 5LXGH 2MJWA 1G7MB 4QCIB 1MH5A 1JBJA 5DURD 4RISH 4YLQT 4GSDH 1UQSA 3MJGX 2E8YA 4D9QE 5I1DA 3LHPH 1AQDB 1T6WA 2BC4A 5MENB 2YN5A 4JZNB 5GGUA 5KVEH 1MPAL 3TBTA 1TNNA 2EXYC 2Y6SC 4F15C 1FC2D 3D85B 3SDAB 3RPKA 4WW2B 2ZCKH 2YK1H 4QHUB 4ZFGH 5EC1A 4PRBA 1TZGL 2RR3A 4Q9QH 5MEPA 1NGPH 3SOBL 3FFDA 4PJGE 1QUNA 4JO4L 4JFDD 1F4AA 1S9VB 4P46A 1BF2A 5HHXL 1YMHB 3HMWH 3VFUB 1DQJB 5E2VH 3P9LA 4S0TD 1U8QA 5I18H 3VXTA 2DIBA 2P42B 1I8LC 2WUCL 4S10A 3T0EB 4P9HL 3HI1B 3VXRD 4AMKH 1XCQB 1F90H 3FTGA 1ZLSL 3TCXA 4NSKB 3PWPA 3UTQB 4NUGH 4PJ7F 3MBED 3C60A 5IBTL 5CEZD 4L5FL 1GGBH 3MFFB 4AEHL 1B2WL 3FB5B 4NZRH 4Y16B 1KB5H 5DRNA 1AGCB 1GL4B 3X11B 1CTOA 3SDDD 5J6GB 5I1HH 3OKNA 4FQQA 4RZCB 2VN7A 4EVNA 1U3HD 5GRUH 3O2DL 1G7JB 4FQ1L 2X7LA 5F9JB 1KLUB 3PUCA 1B0WA 4LCCA 2HKHL 2F54D 1B0RA 4M1GL 3T4YA 3D3VE 5D4QA 2WQ8A 1KNOB 3SCMC 4Y4KA 1N5YL 1KJ2L 1JPSL 4OLYL 4RRPG 4J7RA 5BZWA 4E42A 4EIGB 5AAWA 3UEZA 2Y4SA 1OAXH 2X4UA 3EBAA 2FO4B 5IWLA 3BXNB 5DVMA 4FQCL 5HPOA 4OBRA 2ITCA 3MLWH 3NCYP 5J13C 1TCRA 3EOAB 3U7WL 1UZ6E 3M1BA 3UX9B 5IG7A 3QDME 4ZUTA 4OKVB 3ULSB 1INEL 5D1ZC 1OD7A 5F7HA 1KJ2B 1S7WB 4UOJA 1DN0B 4H5SA 5FK9A 1U42A 3V8CA 1XZ0B 3VFMB 3MXVH 1FFNA 4JDVA 5HXMA 1IC5L 4N1HB 1BJ8A 4ERSL 1CD9B 5FB8B 2BFVL 3ARFB 1UC6A 4FQJL 4J4PA 1F4WL 1QG3A 2GTZB 4ZAKB 1ZT4B 1IAKB 3RL2B 5I15L 4HUMB 3QRGL 5D6CB 3WJJC 3ARDD 5GS0D 1ZE3C 4NRXA 4MJIA 4U3XA 5JW3L 4TULL 1QKZH 3EOYG 4L3CB 3SPVB 2CJUH 4U1GC 1M4KA 4TTGA 2UY6A 4DZBA 1AGFB 1BBJA 2X4TA 2VDLL 4WHDA 5EU6E 3B43A 4XNZB 5FYKE 4YDLC 4QRRB 4U1IA 4Z76A 3EAKA 4WU7A 3VFRB 2LU7A 3EJYC 1I1CA 3KYMB 5ADOL 5TF0A 2R2EB 4KZEH 5HHMB 4X7SH 1ZT1A 3ARBB 1CICD 1XGPB 2R0KL 4EKXA 1ZS8A 2OTUB 1AE6H 3C5SB 5F1NB 4HX1B 2CGRH 4FP8H 2E7BA 4G6JL 3WLWC 4K71C 4DUXA 3GK8H 1GAFL 4M4RA 3W0WA 2FX7L 3IFPA 5IIEA 5K9KB 5E2UH 2UUDK 3T77B 5M94B 5GGVY 4XPTH 3VXSD 4KROB 5FECA 5F7MC 1PD6A 2BNRD 2BHUA 4XVUC 3D0VA 4Z7UA 1OM3L 3U1SL 5JNYB 2WK2A 1LP9F 4OM0H 1CG9B 2C4FT 2DLIA 4GFTB 3JTSB 1EAPB 1UXSA 2CXGA 1U8MB 4LPUA 1QFUH 2HTLC 3BD5A 3BT2L 1UM5H 2DWEA 3OKKA 1MCWW 4C56D 4JQXC 3SKMB 1OT2A 3GJEA 1KC5H 2VR4A 4KK5D 5D2NE 4F7TA 2PYEB 1VGEH 3KPRB 2W38A 3O45B 5C0CE 3DRTB 1DBMH 3TH2T 1FIGL 1WFNA 2XN9E 1JGEA 2F19L 3VE0B 1YY8A 5AYUH 4F3FA 4UQ3B 5SWSD 5I17A 5JHDB 1MIEL 2EYTA 1N8ZB 1CYGA 3MQIA 5BXFB 2GT9B 5GISL 6FABL 2YD4A 4YHZL 3IDMA 3LRSB 1FGVL 3NABH 1GOHA 4OZFH 4RQQB 1YN7A 2H45A 5CJOH 3T0XA 1R3JA 4W4OC 4NC2B 1IEAB 1W0WA 3C08H 3FB8B 2IAMA 3VXMB 4KU1A 3KYKL 4S1RL 2Z8WC 3DIFA 3V4PL 4X5XA 5JW4N 3O2VL 3RA7H 1U3ZA 1NFIB 2DKMA 2X4PA 2BVPB 1U8OA 2VZSA 5TQ0L 2D0GA 4WY7L 1REIA 2HRPH 3TO2A 4X80L 2QHRH 5IB3A 1DFBH 4OCNC 2GJ6E 4P49A 4KZDL 3WSQL 4JFEE 4DN4L 1WZMA 4M5ZL 4Y5YC 4BUGA 4WO4D 3VFNA 4LEXL 1FZJA 3M8OL 2YPKB 3TVMB 1T7XA 2HFTA 4KRPB 1E4WH 3UTTA 4N8VB 4NQVA 3CXHK 4NZDA 1JGUL 4YC2B 5DI8A 3GZKA 1QSFE 2VC2L 3X3FH 4KGJA 3TIDA 5DQJA 3A6CH 4TVPD 4LVOC 1DJSA 2CIKB 5I9QC 2DL2A 2OJZL 4YAQB 5GRJH 2IH3B 2Z8RA 3RWGA 2D7TL 1ES0A 3BIKB 4JO2L 3QEUB 3INUL 4PRAB 4CVZA 2BX5A 4KJQC 4ELME 3BZDA 3ZDYE 2AK1L 2ARJQ 1DQMH 4CU6A 1AXIB 2DMCA 4ZXBD 1DBBL 4GLRI 4U1HA 4R3SA 2XFXA 2MPAH 3STZA 5DZNA 1WIUA 3SKJL 1PDKA 1NCCH 4KJPC 1NCWL 2P48B 1JK8A 5INDA 5ESVA 1TVBA 1CT8A 2P5WA 4LF3B 4FABL 5DWUH 4W6WB 1IAIM 3WIHA 4XNXL 5HJ3A 5TPWL 3PHOB 5M95B 3QIUC 3ZO0A 2X70A 1U93B 2ZJSL 1S3KL 4OZIF 1IGJA 1EFXA 3LN4B 2IQAB 4K3GA 4S2SA 5TE6H 2B2XL 1TETH 1GJIA 1KJVB 1FAIH 3NFSL 4JDTH 4MX7B 3O3DB 4PJ8D 3QQ4B 3DVGB 4LHUD 1CQYA 1XF5B 4LHQB 4O02L 1FVCA 4G8GB 4P4KC 2ESVB 4ODSL 3BP7B 4ORGA 5IMOA 3O41B 2VL5B 1ZAGA 5IMLB 5FO9A 4OUOA 2ICCA 1J0YA 4R0LB 4JZJA 2X4QA 5KZCD 3IT8D 1ZHLA 3OAZK 4LASL 2IPKA 1NGWA 4P2RD 4HG4K 2X4RB 3T3ME 2MOVA 3GJFH 5C2BH 4PJCB 3QCUH 3QG7L 1WWBX 3P4OA 1BECA 4JB9L 3UAJC 4YFLF 1WEJL 3HZYB 4FQIL 1IBGL 1RK0B 4J3UA 3BPCA 1MCFA 4JKPH 3WJLC 2EIDA 2CK0L 3VI3E 5EZLB 1AJ7H 1AGDB 1TVDA 1BFOB 3RVTD 3MLTB 3IRPX 1K5NA 1V3MA 1FZMA 2EE2A 3N85H 3QSKB 4NN5C 5J3HC 4JFDA 1FNLA 3CX2A 3HC4L 4KQ4L 4APQA 4DEPB 4LPTA 3OG4B 3MJ9A 3IKCA 4PFEA 1TJGL 4R8WL 1RZFH 4U6VL 2GI7A 1WAAF 3VXRA 1YEDB 4NZUH 2HMIC 3KPPA 3QG6A 2Q7NA 1MSPA 4ZTPL 5I73B 5KAQG 3O4LB 4K9EC 5FOBB 1FG2B 3MBEA 1CK0L 4P5MA 1OLLA 2PTUA 3CVHA 1J86A 3QFJE 4KTDH 4ONGH 4N8CL 4XAWL 3SO3C 1JMXA 1KPUA 2UWEB 3PGCA 2NNAA 5IESL 3N9GH 2VR9A 3BO8B 2EDRA 5MEND 2NY4C 1QR4A 2V2XA 5GGVL 3DYMA 1JZ3A 1CVSC 3MRIA 2F54A 4NHUB 5HI4D 1EX0A 1RURL 3D85D 5DD3L 3TT3H 1TZIB 5CINL 2A1WH 4GRLA 2RCSL 5BMFH 5DMIH 3TFKC 2EDLA 3P77A 2NZ9D 4KQ3L 3IF1B 4MD4A 5FF6B 4MHHI 4GKZB 4JM4L 4XT1C 4GG6F 1KCSL 3PDOB 3LSOA 3LPGA 3TBYA 4KI5D 1FFQA 3WKML 1AFVH 1R5IA 1V7NL 3ZKND 5BRZB 3VWKC 2YRLA 4QGYA 4RGNE 4H88L 3GMQA 4LSQH 5KG9B 2VLJE 4BSWB 3T0ED 5JOPE 4NYLB 1RULL 1XH3A 2VDPH 5D7KE 4PG9A 5C1MB 4HS3A 5IQ7L 2DLFL 3PIQA 1P84J 3BQUC 2EKSB 1JCKA 3E2HB 3QIWB 1Q9WB 1KEGH 3SDXE 4U33A 3O9WC 4Z7VE 4LKCA 4RGMC 5T1MA 4WUKH 5F93C 1UWEL 4TSBL 4Y16D 3ARDA 1MFAH 4QOKD 4YHML 2A74B 3PHQB 2EEDA 5J06A 3RRQA 4P5TB 1OTSD 3QQNA 4Y4HC 3GSQB 5L2KB 5JDSB 3I85A 4DZ8A 3K4DA 5AZ2L 5IFHL 5LGHL 4P59H 1YEKL 3QISA 5KVMC 4N0CC 1ZLUH 1KTKE 1I9IL 2NR6C 3SE4C 1QZ1A 4LGSB 1C08A 2V2TA 2IADB 3HR5B 5HHOE 4AQOA 3L9RB 2AXGB 2FZ3A 1X5XA 3WD5H 1LO4L 5IM7A 3J7HA 2FJGA 5DJZB 1CI5A 1EK3A 3EFFB 4MGXA 1M05B 2VXVL 4OCRL 5DDHA 4HWUA 4UT6L 2LTQB 4HJGA 1JGLH 1IE5A 4NWUH 5EDXA 4MDIB 1CICA 3JV6A 3R06A 3HNSH 3TPKA 1MUJA 4TOYL 1EHLH 4WWID 2FHCA 4I4WB 1WJ3A 5CHNA 5TF1H 35C8L 2VITB 5IBUG 5IJKC 4NN7B 4HAGA 4WIQA 3UTSE 3EO1A 5KSAB 5L6YL 5MHSD 3ARFD 3F12A 4XWGL 5ANME 2Q87A 4PJ9B 2BNRA 1HCVA 4TUJB 4F2MA 4XXCC 3FRUA 4PJHB 3RHWK 2GAZA 4K8RC 1HH6B 2H3NB 2VH5H 3C6LD 1VENA 3P9MB 2ADIB 4IIQB 3H6JA 4K9EH 3NFNB 1DVFB 2JJWA 1IGCH 3DMMC 4LU5L 1EHAA 3IDGB 1QFWH 4C56A 5I1GH 3RPIA 4PRDA 2D03L 3RWHB 4P0DA 2AV1B 1FL3A 4KDVA 3S4SG 2IJ0C 1TDQA 5B8CC 5ILTH 2AK4E 4FQXB 4OB5L 4MCYB 3BGAA 3WFDL 5FM5M 2IFFH 1UH3A 2KL6A 5HHMD 3QDGD 5I75C 3P73A 4CDHA 4OLEA 5EO9B 1NFDE 3ARBD 3ARVA 1U8JA 2PYFB 4R96B 3IDIB 5LBSH 2A0LD 1GGTA 1YN6A 1J0ZA 2BXZA 4G8IA 5EOQL 2W9EH 5GS1B 4PJBF 4TRPH 4HDIA 4GS7C 4LGRB 2R29H 4WVRA 1TJIH 1ZGLB 4XPFL 1WVZA 1N4XL 2PO6B 4QGTA 5FYJD 1J88A 4GKOA 1RMFH 1LEKB 5JZ7D 2NZIA 3DVNA 1QSED 1AD9A 2V7NA 2F5BL 4K23L 3WFBL 3PWVA 1NC2B 4IHOA 5HPMA 3J8F7 3OJDB 1CS6A 4IMLB 2UVFA 5C92A 3RL1B 4UV4H 5C0DB 3CK0L 5DHXB 4NP4L 1HHIB 1S7RB 4P2OA 3GMPA 2Y5EA 1T7VA 4JJHA 5KVFL 3CX5J 1BQLL 4LLYB 4JHAH 3ULVE 2KUTA 4QRTB 3TCLA 2HKFL 4WO4A 1IGTB 1CFTA 2PYED 2CXKA 1GVIA 4G9DB 2XWJB 4BUHA 2IG2H 3KPQA 5JQHC 1X5AA 5DS8A 5HTSA 3SJVE 2DQTH 4FZEL 3WUWB 3GSUA 2DQFB 1JPGA 5FCSH 4UIKH 4BH7B 5HYJE 1B0GA 1INQB 3F5WB 4NJ9L 2Q8BL 4X4XA 3F58L 5I1IH 4EQ2A 4GW4A 2PR4H 4ZUVA 5I66B 2YD1A 3K2MC 5F9DC 2LAAA 2QQNL 1ORQA 1GIGH 4Z7NE 1I7TA 5HI3D 4X6CB 1N3NB 1QLFA 3ES6A 3E6FA 4JGMA 2Y5TB 4Z0BL 4HMEA 1C16B 2NW2B 4NPYA 2XTJE 1K8DB 3MTRA 1XGTB 4ZXBA 1CGTA 1A2YB 2Z92A 3L1OH 4PJAB 5IFJB 4WWKA 5IW3A 4HUNB 4Y4KC 1JNLH 1FFOA 4AY0A 3MOBH 4HSQA 4L1DA 1NCDL 2FH6A 2UYLB 1MCRA 4P99A 2ED9A 4PG2A 3T2NH 4L9LA 4K8RH 1I3UA 1S5IL 3C8DA 5ICYA 3EDDA 4KRPD 2AS5M 4PJEE 1Q0XH 3LS4H 1BWMA 2X9YA 1QO3B 3MLRL 4NUJA 4TN9A 1BD2E 3KVQA 3VGAC 5CAYB 1MFEH 1C7SA 1NUFA 5TQ2L 3O3EA 3OKMB 4DAGH 1A1OB 5DXWA 1U8IA 2CMRL 3GSOB 4ZUUB 4LCIL 2WBWB 5CJBA 1BZ7B 4MDJB 3VWJB 2NY0C 1OTUD 4PJ8A 5FUZH 3SBWC 4LHUA 1EGJH 3QI9A 3DOSA 3EYOA 3O8XA 1BFVL 15C8H 2IALA 1HWHB 4HHAA 1MVUB 4R2GC 4UNVA 9CGTA 1ZA3A 1UB6B 3RGVB 2J6EL 3JWDL 3IU3A 2Y23A 1JZ7A 4PJIF 1F58L 3A67H 3UC0L 5A2LH 3OGCA 4P2RA 3BUYA 4LIQH 4RAVB 1TQBB 4JFFE 2Z93B 5DHVH 3NCFB 2WLYA 3ARTA 4JN1H 2CDGB 4I9WD 3NA9L 1WK0A 4U31A 3FO2A 4Y5VB 4XMLH 1HDMA 4YXLH 3ZTJG 3G5ZB 3OXRA 4ODVL 1CLZH 1DQTA 4I0KA 3U46A 3I84A 4L4TB 4XBPB 1HOCB 2XZZA 3MRJB 4GXVL 3WN5C 4RFOL 4HWZB 1JN6B 5IW1B 5GJSH 1YYLH 5HVHB 1HHGA 2VMFA 3RWFA 1E6OL 5JORB 3SDCD 1P2CA 4WUUB 3MXWL 3R0NA 4JO3H 1PLGH 1MNUH 1IZKA 1XAUA 4NGHL 1FYTE 2H2SC 4J8RA 5E95B 4PYGA 2R2BB 4XNUL 2B4CC 4G8GD 5AAMA 4GMSH 1FAKT 1SEQH 1T2JA 3IGAA 4ZS6D 4FXGB 4KDTA 2OQJA 3DRQB 2VXTL 4JN2A 4HFWA 4KVNH 4N0UA 1BQHG 3BZ4B 5IVXE 2ERJC 1TCMA 2HFEB 4AIZA 5GRXG 1G7MA 1P4BH 4QCIA 1I3VA 2W0LA 5F70A 4BZ1H 3FN9A 2BNQE 3QDJD 4NRZB 4YHKL 1OSPL 3DXAE 4U1KB 4L8DB 1T5XB 3RWJB 1AQDA 3TYFB 5MENA 1BJ1J 1U0QA 4JZNA 3OPZL 5DRXB 2B0SH 4Q9RH 2IANB 3D85A 4XCEB 3SDAA 4WW2A 3WFHB 4QHUA 4TSAH 4XP5L 5FXCH 1A6VH 4IOFC 2MFNA 4RGOH 2WBJC 3HUJB 3K81A 4V1DD 1TPXC 4A6YL 2NY6B 1S9VA 2LFGA 2X44D 4NQDB 1YMHA 2EYSB 2VXQL 3OKYA 5LGKA 3VFUA 4LCYB 1DQJA 1OVZA 4ZFFB 1A3LH 3AS3A 3U0TB 4DGYL 4LARL 2EE9A 3T0EA 4UU9B 3HI1A 1J1OL 3H3PL 5CD5C 1XCQA 4LFHG 4U1NB 4NSKA 3O4LD 4N9GB 4XBGB 4DOHB 3UTQA 2OK0H 3UP1A 1H3PL 1C5CL 4A6YB 4PP1D 5D72H 1I3RB 4HF5H 3MFFA 5BO1H 5BV7C 2NXYC 3O0RH 2OXHA 3FB5A 4Y16A 1W72H 1AGCA 3P0GB 3X11A 4NHCL 3ELAT 5J6GA 1OP5H 3Q48A 1PW3A 4RZCA 4U1MB 1J9CT 4G5ZH 1G7JA 5F9JA 1KLUA 3HC0B 4Y8AA 4DW2H 5KN5B 1S5HB 1JP5A 4K7PH 3KR3H 3O11B 2Q86B 5C0AB 1KNOA 4L3AA 4PD4K 5FFLA 4UZGA 3OJMB 4XPAH 4KKLD 3DGGB 2V2WB 2AJUL 3UXFA 1MAML 2J4WL 3O2DA 2FO4A 3BXNA 1BF8A 5BRZD 4YR6B 3E8UL 1IGIL 4LSUL 1D5MB 3AXLB 4H20H 1TFHA 3EOAA 5DSCB 1HIMH 4ALAH 3ULSA 4OKVA 4XVTH 4CADB 4DQOL 1KJ2A 1S7WA 1DN0A 4PJ5B 3QCTL 1XZ0A 3S35X 3JV5A 4NFCA 3VFMA 1PYWB 5I6XC 3C87A 4LRIC 4LVNB 5L9DL 1D5ZB 3BJ91 3ULVF 5FB8A 3ARFA 2B4CH 2GTZA 4ZAKA 1ZT4A 3DJ9A 1IAKA 3RL2A 3C8HA 5D6CA 5BS0E 2FDBP 1IC4L 1KENL 4JY6B 2XZCL 4FQLL 1RJCA 2WQRA 4L3CA 4LSTH 3SPVA 5EC2B 4PRPD 2ZWLT 2H8PB 5AWNH 1F4YH 3I50L 1AGFA 2Q6WB 4N1CA 1DUZB 3CZFB 3FOLB 1A21A 4AG4L 4HGWB 4QRRA 4JQIL 4PS4L 3VFRA 3ZKMC 4I77L 2UZXB 3KYMA 3MV8E 1VFMA 2CO7B 2R2EA 1WV7T 5FM5O 5CCKL 3ARBA 3HAEB 1FC1A 3QPQC 4J3WA 4FS0A 1SBBA 1XGPA 5FDWA 1UM6L 2OTUA 1I8KB 1S9KC 3C5SA 5F1NA 4HX1A 4U1SB 4DJMA 3OG6B 3EJZC 3PQYD 3U4BH 3CSBA 5K9KA 1YY9D 1RZ7H 3AY4A 5FYJU 3T77A 1UH2A 5I1CL 4HPYH 5KAQF 2VXSL 3BEWB 1IKNA 1A4KB 4PJ9D 5DT1L 1CU4H 4AZ8A 5JNYA 3NVQA 4PJEF 4LSPL 2GY5A 1CG9A 2YMXL 3JTSA 1EAPA 4WFEE 3RVVD 1G7PB 3DSNA 1U8MA 1Q0YL 1OPGH 1RU9H 3C5JB 3MPCA 4WV1C 5DJ8B 2VZVA 4LDOB 3SKMA 1NH6A 3TZVD 3BSZL 5BV7H 3WO4C 1CXIA 3TJHD 1F5WA 1P84K 3I2CH 1UXWB 3MX0A 2PYEA 4Z8FH 3KPRA 3O45A 3SGKA 4X7CC 3DRTA 4RNRB 3KHQA 1UM4H 1H3VA 4CN6A 5JA9A 2VLRE 3ETBF 3VE0A 1CD0A 5IQ9B 4QHNB 1DLFH 3EKCA 2QQLL 3NTCH 4UQ3A 5ID0B 5JHDA 1A0QH 3VRLE 2VJXA 3V6OC 1J18A 4N8PA 1N8ZA 1I75A 5BXFA 2GT9A 2VR5A 3QQ9D 1UKSA 2Y07H 3MBEC 3VXQB 4LLMB 3LRSA 1N2RB 5EOCH 4RQQA 3IFNH 4NKIL 4TNWK 4KKCD 1IEAA 3FB8A 2PO6D 1L7IL 3VXMA 1BAFH 3OHXB 2EH7L 2XNAB 2ZCHH 1P6AB 2J7LA 3SDDC 2IEPA 4X4ME 4MNGE 3VXOB 1U3HC 5C70A 1NC2D 2R56L 4RMWA 1NFIA 2APTA 1A6AB 2BVPA 3G6AB 3V2AR 1A7BA 4HJ0C 4JCLA 2DB8A 4JEGB 3ABZA 1NCBH 1CXKA 2J8UF 5F96L 2DAVA 3MOQA 5ITBH 4PJFB 4XP6L 2NY5C 1J8HE 5J9PB 5CZXD 3FRPG 4M7LH 1DN2A 2A83B 3DI3B 4G80B 1G9NL 3VH8G 2LVCA 2YPKA 5ERWB 3TVMA 4HJJL 5F9OH 4X4YB 1AHWB 4N8VA 1BZ9B 1UEYA 1XF4B 4WHCA 3TWCL 1W8OA 3DI2B 1WFUA 1FBIL 3MZGB 3V7MA 1TNMA 1UA6L 5JIIA 2CIKA 4PGDB 4KAQL 3OF6D 3CFKB 4G6FB 3WCYA 4YAQA 4PTUB 5DVLA 3ARDC 3T0DA 5EO1B 1G7HB 5EBMB 1S7QB 4L4VE 5FOJA 1JZ8A 3VMOA 4MA1C 5CSZB 2DQJH 3BIKA 3QEUA 4PRAA 3QEGL 1URLA 5JUEL 3RWDB 4DN3H 3HB3D 4ZNEE 2OL3H 1EO7A 2WUBH 2A38A 2L0DA 3W82A 5LXGL 4IM8A 3REWB 4RAHA 5E0QA 4RISL 3RNQB 4GSDL 2H32H 5DFVC 2BVTA 3LHPL 1K85A 5TE4H 1PEWA 2NY3C 4LSVH 1NLDH 1F02I 4LF3A 5IFAL 1CICC 1HE7A 5KVEL 3PHOA 4R6UA 1JVKA 2O5XH 3FAXA 3KHOA 4NQUA 1U93A 2ZCKL 3RTQB 1JFQH 4ZFGL 3UZQA 3LN4A 2IQAA 4Q9QL 3ILPB 1NGPL 4DFHA 1WWWX 1HXMB 1KJVA 4MX7A 3O3DA 1SJXA 3QQ4A 3DVGA 3BKMH 4XWOD 1XF5A 3HMWL 3WIFB 5EO0B 3CX5K 4G8GA 5E2VL 1KPVB 2EO9A 4X9HA 3UJIH 2EDEA 5I18L 2UUDH 4WW1B 2Y06L 2ESVA 5ALCH 3BP7A 4XAKE 1S9WB 4UV7H 5FIEA 2LABA 1E4KA 5CZVL 3O41A 2VL5A 4ZSOB 3TC9A 3QUKB 5IMLA 3NOIA 4AMKL 5I8CB 4R0LA 2YPLE 4CU8A 1K4DB 1F90L 1O7VA 1EZVY 4NUGL 4MZ3A 2EEAA 1MCQA 5J12B 4J12A 1GGBL 2X4RA 3F62A 3RDTB 1N6QH 4KK5C 4JRYE 4PJCA 1F6AB 3MBXH 4NZRL 5CBAB 2OCFD 2A2QT 5I1HL 3HZYA 5A43C 1UCTA 2MQ3A 5GRUL 1RK0A 4P2QE 4MZ2A 3OZ9H 1DQLH 1WUNT 4L4TD 2ZOLB 2OR7A 4OCSH 5EZLA 5MI0B 1AGDA 1F13A 3KLSA 1BFOA 1N59B 3MLTA 2NY5H 2HH0H 1FNAA 4B41A 4WUUD 1I9EA 3N06B 5GZND 1G7IB 1OAXL 1AR2A 1NAML 3RWIB 2ADJB 4WNQB 1IQDB 4IDJH 1O5DT 1YEDA 3ARPA 4X7DC 5SX4H 5D7LB 3I02B 3O4LA 4TUOB 5FOBA 1FG2A 5D1XC 4KHXH 4MXVE 1NAMB 1P4LB 3HI6L 4GRWE 4WO4C 4HLZG 1NC4D 2UWEA 1KIQB 2AXJA 3BO8A 2WWKO 3GMNB 4TPRH 3SGJA 5T1LB 2CJUL 1ITCA 1DANU 4NHUA 1AXSB 2IAND 1QR1A 3VXUB 3VDCA 1TZIA 3AS2A 2P8LB 3JTTB 3GHBL 3IF1A 5FF6A 4GKZA 5GPRA 5CEYB 4UDUB 1TXKA 3PDOA 4KZEL 1J05B 1J0KA 4QTHB 4X7SL 5K93A 4Q6IB 1ZOXA 3FFCB 1VHPA 5BRZA 1MCJA 3BPLB 4BQ9A 4PJXE 5D96C 5KG9A 4BSWA 1AE6L 2GKIA 2CGRL 4FP8L 5HDQH 4NYLA 1J8KA 4ZXBC 3GK8L 5TE7L 4M7JH 4LDLB 2EKSA 1Q9WA 1LMKA 1FL5B 3C09C 3WYRA 1MJ8L 4JO1H 3ZTJH 4G3YH 2ZKHL 5E2WH 4F15B 2A74A 3D2UB 3PHQA 4F7EB 4KRLB 4P5TA 3GSQA 4M1DH 4OM0L 4XTRD 5JDSA 5L2KA 3X17A 4HWEH 3HKFA 4ZD3H 1QFUL 1LVEA 5C71A 1OLZA 3DUUB 1MY5A 1KC5L 2IADA 5CGTA 3PE9A 4OQTH 3BHBB 4JAMB 3L9RA 2AXGA 4XI5D 4PJ8C 5F9WC 1VGEL 5CBEB 5DJZA 1DBML 3G6JE 4KKAC 2YD6A 3EFFA 3PF2A 1M05A 5DJDB 2D9QB 5AYUL 3MLSL 4MDIA 4YBLC 4E41B 1FHGA 4OZHB 1IEHA 3RVUD 3KLDA 4X6FB 2ZUSA 5DEFB 1YPZB 4I4WA 2VITA 4PLKD 1FVDB 4DKEH 3NABL 1MHPL 1F2XK 2VXUH 5CJOL 5IVZB 1G9EA 3MA7B 3RZCD 4MMXC 4RAUB 3O3UN 5IOPB 5KSAA 1Y18B 4OGXH 1CXLA 1FLRH 3OAZH 4YO0B 4G9FD 4PJ9A 4TUJA 3RA7L 1E4JA 3T3PE 4PJHA 3SCMB 1HH6A 2H3NA 3P9MA 1JZ6A 2HRPL 2ADIA 2QHRL 4IIQA 4OZFB 3NFNA 1DVFA 5C0JB 1DFBL 3RVTC 3IDGA 2E9IA 2R4RH 5IW6B 3U7YH 3RWHA 4CMMB 3LKPB 2AV1A 2HT2C 1RZJC 1JL8A 5C0ND 3NPSC 1NL0H 4MCYA 1I7UB 4JKMA 4ZOEA 5D1ZB 3WKNA 4Z7OF 1E4WL 5EO9A 2PYFA 4R96A 4MB3A 3IDIA 5H8DA 5F6IC 4R90L 1PX4A 1JF5A 3BPOC 2GHWB 2OP4H 2YC1B 4KDTC 1P4IH 3VD9A 3X3FL 2FJHB 5DC0A 5GS1A 4TVPH 1BLNB 1S7SB 4EI5C 3THMH 4C54A 4F33B 4JFPB 4JQVA 3DPBA 1ZGLA 3NBNA 2PO6A 1IM9D 4YHPB 4W70A 3DTXB 5GRJL 3W2DH 1Z9MA 4U1GB 1HKLH 1MQKH 4LLWB 1LEKA 4OFKA 3EJJX 3BIBX 4EUPG 3HZMB 1NC2A 2MNUA 3BX7C 4FTVE 5T3XD 3X14B 4KMQA 3OJDA 4PB0H 4YDLB 3I3DA 3SQBA 3RL1A 1DQML 5HI4C 3U0PB 5C0DA 1HHIA 1S7RA 4QRPE 4OGAD 3NIGE 1QRNE 2NZ9C 2MPAL 4L8CB 3BFOA 1QFHA 4LLYA 4AM0B 3RNKB 1EV2E 4QRTA 4FZ8L 1YDPB 1IGTA 4Z78B 1F2QA 3ECBB 5ISZE 2LU3A 4G9DA 2XWJA 3ZKNC 5DWUL 1INDH 4K71B 1EZVX 4W68A 5HD8D 5EZJB 4M00A 5HSFA 2EDWA 2AJ3B 5GRYA 2DQCH 4M61B 5F7WC 3T0EC 2BHYA 3BN3B 3WUWA 3B9EA 2APFA 5I16B 2DQFA 4EI6B 4OF5A 5F1OB 5TE6L 3U0WH 4BH7A 1INQA 3F5WA 2ILLA 4Z7QF 2WINB 1TETL 5C2UB 4OZIB 1FAIL 2BOBB 4JDTL 4L9DA 1U6AH 3O6MH 1RUKH 3MUY1 4LP5A 2EECA 5IF0B 3OF6A 5BQ7B 1RHHB 2RQ8A 1J87A 1FN4B 5I66A 3UMTA 5I8OH 1OTSC 2CR6A 4X6CA 1N3NA 2B1HH 1B3JA 1KXTB 2Y5TA 3FQRB 1C16A 2NW2A 3WE6B 1K8DA 4KI1A 1XGTA 3EZ8A 4Y2OA 4FFWD 1MREH 1A2YA 4M6MH 4PJAA 3FZUD 3WV0A 5IFJA 5HYSG 3ESVF 1QEWB 3QUYD 2J1KA 3P4LA 4NQCB 3BMWA 5T3ZD 4I48B 3QCUL 2UYLA 4I13B 2DL9A 1QNZH 5C6PB 4JKPL 3FT2B 1QO3A 2HTKD 3MLPA 1AJ7L 3CDFA 3GJFB 3KPMB 1RZJH 3OKMA 1A1OA 4NBZB 3GSOA 4ZUUA 1BZ7A 4MXVF 4MDJA 2P43B 4GRWF 1JTPA 2DLEA 4U2YA 5GIRB 5IJVB 4BM7A 2WLZA 2NXZC 4IOIB 1BMGA 4I2XB 3L3DA 1JF1B 2LE9A 4NZUL 3C6LC 1YA5A 1UB6A 1NEZG 2OR9H 1NKOA 5K9QI 4Y5YB 3RGVA 2FX9H 2IPTH 4EOWH 1PKOA 4OTXH 4WHTB 4ZOAA 4KTDL 4ONGL 4RAVA 2Z93A 1LEGB 1WWCA 4BA8A 1M6OB 3N9GL 3L6FB 4Y5VA 3RHWF 5A2IH 3QB7C 3G5ZA 5K9JH 2A0LC 2J6EA 3O2WL 3OSKA 1J0HA 4LVOB 1NMAH 4L4TA 4R26H 4I8DA 4XBPA 5I9QB 3TT3L 1HOCA 1I4FB 3MRJA 3QDAA 2A1WL 4HWZA 1JN6A 5BMFL 1KYOK 5DMIL 5IW1A 4WI4A 3EGSB 3T0WA 5JORA 3AY4C 4WUUA 4JKWA 3PWPE 4BQ8A 3LS5L 2VUYA 1XGUB 1AFVL 2R2BA 5JZ7C 1JI2A 2YSSB 5L8JB 2DIAA 4LSQL 4GG6B 4QT5B 1RUQH 3QEQB 2ICEB 4MJ6B 4FXGA 2VDPL 2BY1A 2HT3C 3SEPA 4YFLI 1YECH 3IDUA 3DRQA 4FHBD 1MCDA 3MCLH 3HZKB 3BZ4A 4BSVB 2HFEA 1KEGL 1JNNH 3RDTD 1A7RH 4WUKL 3QIUB 2DKUA 1MFAL 2QJDA 4NRZA 4YBQD 3MV7B 4U1KA 2C1PB 4L8DA 1T5XA 3OX8B 3RWJA 3TYFA 4HXAH 2HFGH 3CVIL 2DQEL 4P59L 1NUGA 3ZDXE 5DRXA 3UJJH 1FO0H 2IANA 3RY6A 4XCEA 1RAMA 3D0LB 5T33H 3WFHA 3CDGB 3GB7B 4RFNB 3WS6A 1G84A 3I3EA 2E9JA 3HUJA 1A5FL 3WD5L 5E1HB 1J0JA 1A6TB 2EDKA 4NQDA 2EYSA 4XNMB 3K2UH 2HKHH 4LCYA 1JGLL 2X4NB 3CFJB 4NWUL 1KIRB 5HI3C 3OKOB 4ZFFA 3HNSL 1QSZA 3U0TA 1EHLL 1JPSH 4UU9A 4MJIE 1F4XH 4KK8D 5TF1L 5D7LD 5B21A 4U1NA 2FR4B 3HNTH 4N9GA 4XBGA 5JW4Q 4GAYB 3PL6D 1EJ6A 4A6YA 4UI2A 1I3RA 1YMMB 3OMZA 3U7WH 1MCEA 4KFZC 1ZWIB 5EA0L 2F5AL 4GH7B 5ESAB 2BHZA 2OZ4H 4KRPC 4U1MA 3VD7A 1W2KT 4K94C 4NCC2 4NNYB 2VH5L 5T1LD 3HC0A 3TNNB 2GY7B 5KN5A 4K9EL 4NN5B 1S5HA 1IGCL 4ERSH 4NIKB 1SM3H 2BFVH 1QFWL 5C3TA 3VXUD 5I1GL 3QWQB 5E6ID 3O11A 2Q86A 4HZLB 4QYOB 5C0AA 4NZTH 2IH1B 4GAFB 4PV9B 5ILTL 2CQVA 3PXJA 3W0WE 1I9RH 4XRCB 1OTUC 4U2ZA 3DGGA 2V2WA 2IFFL 2AEWA 2JIXD 4DKAA 5E9DB 1DQDH 3TPUB 3FFCD 5ICXB 4YR6A 3QNYB 3E3QC 5LBSL 2D9CA 1D5MA 2X1XR 3AXLA 5A2FA 4ZUSB 4Z7UE 5DSCA 3SO3B 1DBKH 2W9EL 1HYRC 3BAEH 2L7UA 3S3JA 4CADA 1K8IB 4PJ5A 2R29L 1TJIL 3TBVB 5FYJH 1PYWA 1RUPH 4PJBB 2NY4B 1D5ZA 2XWBA 5GXBB 2FEDD 3JVGA 1RMFL 3LMJH 4K7PY 2EXYD 5BCAA 3C8KB 1L9MA 4PRHB 4Z9KB 3D2UD 3VD3A 4JY6A 1GZPB 3WXWH 4UV4L 2ZUQC 2W0FB 3FMGH 5EC2A 2H8PA 4G6AD 1KGCE 4BYHA 5MEOB 5FM4A 3L3JB 2Q6WA 5H2BB 3SDCC 3FL7A 1DUZA 3VWKB 3FOLA 3QBTB 4HGWA 2RGSA 3DO3A 4G6KH 3V6FB 3MLZH 4JPWH 4JHWH 4PLJD 2IG2L 3B3IB 5EUOF 1SJHB 3HAEA 4ZS6C 4GLRH 2DQTL 3UTZB 2XV6B 3G5XB 4WRLA 1I8KA 3O9WB 4UIKL 4RGMB 4U1SA 3HE6C 3VRJB 5I76B 3ZT7A 4HIHA 4HLZH 5I1IL 1BQUA 2GW5A 5FYLE 4Y4HB 3VCLB 3NIDF 2N4IA 1KN4H 5I1AB 2PR4L 5DJYB 3NCEB 3BEWA 1A4KA 1GIGL 4E9LA 2XQYK 4TNVF 1TMCB 4NKQB 4KC3B 4PTTB 3WDIA 4PJDF 3UTTE 1XCTB 1G7PA 4YDJB 1QFWI 5JIHA 3EDEA 4H1LG 3L1OL 3C5JA 4FFYH 4P3WA 2J12B 1JNLL 5DJ8A 3QCVL 2VLLB 2D7PA 3MOBL 1MHEB 4U3CA 2A73B 4NBYB 3O2VH 3ARWA 1UXWA 4Y5XB 3T2NL 4K8RL 4RNRA 3VI4F 1HYSC 4DEPC 4K94H 4WY7H 1Q0XL 3LS4L 3V9FA 5IQ9A 4QHNA 3GIVB 3GEWB 5ID0A 3RY5A 5SX5K 1MFEL 4JRXB 1PQZB 4GXUM 4DAGL 5CGYD 4QTIH 4LEXH 3VXQA 3N1GC 4PP1C 4LLMA 1N2RA 3O4OC 3HR6A 5F1IB 1CBVH 3SE9H 1S7UB 3OHXA 15C8L 2XNAA 3DUSB 5E5MB 1JGDB 2VB5A 3DMMB 4OZGF 2PCPB 5SV3A 3VXOA 1DLHB 2P5WE 1A6AA 1I8IB 5B8CB 1QLEH 3G6AA 3A67L 5FGCB 4UAOB 2MCG1 2MCPH 4AEEA 2Z8SA 4LIQL 1F00I 5I75B 5IHLB 4HGKC 4PJIB 4PJFA 4D0DB 1MQ8A 5I1KH 4JN1L 5LVEA 4KKLC 2GK0B 4JO2H 5J9PA 5C07B 1KXVC 4XMLL 3QUMH 2AK1H 2A83A 4G80A 4YXLL 1L7TH 5ERWA 1CLZL 1OCWH 4X4YA 5JMOC 3H7LA 1AHWA 4CGTA 3H9ZA 1BZ9A 4GS7B 3P4MB 1XF4A 5D71H 5HGGS 4KUCD 5GJSL 1YYLL 4ODWB 5DHVB 3LQAC 1BVKB 3JV4B 4OKDA 1NCWH 3QXUA 1PZ5B 3E2HC 1C12B 4JO3L 1PLGL 1MNUL 1OGTB 4PGDA 2OJEB 3CFKA 4ORZC 1UACH 4GMSL 4PTUA 2HTLD 5EO1A 1G7HA 5EBMA 4UNUA 1S7QA 3S98A 1V05A 4M6AA 5CSZA 5FGBA 1Q38A 3RWDA 5JTWA 1VSCA 2I5YL 3EO9H 3VDBA 3ZDXF 4U1LB 2J8HA 4KVNL 3L5XH 3LEVL 3KYOB 4KRNA 4G6MH 2FSEB 3IB4A 1VPOH 1NEUA 3D3VD 3REWA 4BZ1L 3RNQA 3ROLB 4JFDE 2RB8A 4YDKH 3L5IA 4F57H 5GHWH 2JB6B 5C08B 2B0SL 4Q9RL 3B2VH 5C0GB 3VFPB 3DVIA 4TSAL 3VXRE 1P53A 4WFHE 1VGKB 3QG7H 5C09B 2GTWB 1S9XB 3ILPA 4RGOL 4NJ9H 1YY9C 3QDMD 2IF7A 1CLOH 5CEZE 1KJMB 1NGZB 4P2CG 3WIFA 4EUPH 5EO0A 5CSBA 5B3JF 4XNYH 4PJ9C 1KPVA 3LOWA 3O6KL 4DKFH 2XI9A 4WW1A 1N0LA 1A3LL 2ZNWA 1S9WA 1CFBA 3LH2H 3KS0J 4ZSOA 3U48A 3QUKA 1YZZA 4X7EC 5I8CA 2XXCB 5T1KD 1K4DA 4CUCA 3CLEH 2F54E 2OK0L 3DGCR 1EHNA 3TLRA 1ZANH 5D72L 3TZVC 4HF5L 3RDTA 1CL7H 5BO1L 4ZYKB 3O0RL 4WI9A 1F6AA 5CBAA 2C3XA 1W72L 3VGAB 1V3KA 3H9SB 4OCWL 5DFTA 5KS9F 1F8TL 4G5ZL 1I8MB 1G0YR 4K7PL 3KR3L 1FG9C 2NY0B 2ZOLA 2EIZB 4K7PX 4GG8B 5ETUB 1N59A 3QQ9C 1VFOA 2D31B 4YGAB 4K3HA 1W72B 5GSRB 4R2GB 1NKRA 4KKCC 3MRHB 2PO6C 4DUVA 1S7XB 1H3XA 3DROB 1G7IA 4JRWA 3RWIA 2HG5B 2ADJA 4WNQA 2VQTA 3U9PH 2NX5B 2C5DC 4XVJH 3T2PA 1IQDA 4H20L 5GGTH 1EIBA 1HK6A 4EN3D 4ALAL 3OR6B 4RFEB 4ZO9A 4XVTL 3LQAH 5J11C 5F1KC 1IRAY 5EG6C 5D7LA 3GO1H 3I02A 2FH8A 4TUOA 5ENWB 2AVGA 4TNWF 4XX1E 1LNUB 2YZ8A 1UENA 2B4CL 1NAMA 1P4LA 2AERT 5CZXC 4BK5A 1ZHBB 3QIUD 4NC1C 4JLRB 3C5ZD 3MV7D 3WN5B 1KIQA 4X9FA 4X6DB 3GMNA 1L6ZA 5T1LA 4LSTL 5C0CD 1BPVA 5AWNL 1F4YL 2IFGA 8FABB 1AXSA 3VXUA 1UKQA 1EMTH 3JTTA 1JRHH 2R0WH 2P8LA 1X7QB 1HH9B 1ZVSB 4ZDHB 5CEYA 4UDUA 3W5MA 4YHNB 3E1F1 1ZXQA 1J05A 4QTHA 2MTPA 4Q6IA 3FFCA 3KPSB 2YPVH 3U9UB 1OSZB 3AMLA 3RZWA 3I3BA 1FZKB 2ERJB 2V5YA 3HB3C 1NMBH 4LVEA 2AQ2A 2AJZB 4I5BB 3U4BL 1AQKL 1RZ7L 2R2HB 3MFGB 3VJ6B 4Y4FD 1HQ4B 3W9DB 4C56E 4HPYL 3S3PA 1FL5A 2G5BB 1YMMD 2GJ6D 4RDQG 1CU4L 5INCB 3DVFA 5FA3B 3D2UA 1OAYH 4JFED 4AK1A 5ACZB 4OD3H 4F7EA 4L8SC 3P9WB 4RMRA 4U0RC 3UBXG 2WBJB 4QKXB 1NFKA 1OPGL 1RU9L 43C9B 1CDUA 3ARED 3DUUA 3MRLB 4MJ5B 3MRPB 3MJ7B 5BV7L 4LLQA 2XPGB 4FQ2L 1QD0A 3BHBA 3DX8B 4JAMA 2D7NA 3I2CL 4Z8FL 4XWOC 1I8LA 5CBEA 5FDYA 5IUSA 3B5TA 1DR9A 5KSBF 1UM4L 2HMID 5DJDA 2P5EB 7FABL 4LU5H 2P8MB 3NTCL 4O4YH 1MCKA 4E41A 1A0QL 3PGDB 2D03H 5JIPA 4OZHA 4ONFH 4X6FA 5DMJB 3WIIH 5DEFA 4IMKC 4BZ2H 5BV7B 1MRFH 1RFDH 2KPNA 3RUGF 1YPZA 2NXYB 5IMKB 2Y07L 5E8DH 1FVDA 5EOCL 3IFNL 5DEZA 5IVZA 4Y1AB 4XC1H 3MA7A 2Y25A 1OW0A 4RAUA 1IGMH 5IOPA 1Y18A 3R8QA 1BAFL 1VCAA 1CFVH 1FGNH 2ZCHL 3CC5B 3Q5YA 1H8SA 4YO0A 1GGUA 4FXLA 3WNNA 1MLCB 5EOQH 3TA3B 5J1SC 4HCRH 2XA8H 1JGVH 4KV5E 3SCMA 3H3BC 2EDJA 4NO5A 2XY1A 1NCBL 4GAGH 4OZFA 4FFVD 5CZKA 5C0JA 3S37L 4XC3H 5IW6A 5ITBL 4CMMA 3LKPA 2F5BH 2J8UB 4G42B 4JG0H 1HI6B 5GZNC 4M7LL 3X3GH 1I7UA 1RZIB 1H3UA 4J3OC 5D1ZA 5KSVB 5F9OL 2JELH 5D2LE 3GHEH 1PG7H 5I6XB 1J1PH 4HEME 5E7BA 2YC1A 4OQ1A 2FJHA 3O9WD 1BLNA 3WJJA 1S7SA 1YYMH 4F33A 4M7LT 3OB0K 1E27B 2I07B 2YD2A 3LVEA 3S5LG 4YHPA 3ZMRA 3DTXA 3MRDB 4LLWA 4N0CD 5IBUB 2BSSB 2DQJL 3HZMA 2LV4A 2Q76B 3NPZB 3KNBB 5EULV 3X14A 4DN3L 1BOYA 1FE8H 1NDMB 2OL3L 3U0PA 5D7IF 5IB2B 5FV2A 2YZ1A 1I1YB 3LPFA 2WUBL 1ZGLM 4YDVB 1IARB 2XQYG 4L8CA 1R3HB 4AM0A 3RNKA 1MJ7H 4JFHD 2XZAH 1YDPA 2NW3B 2EEBA 4Z78A 5TE4L 4LSVL 2NYYD 3ECBA 1NLDL 1JF6A 3TH3T 1JNHB 4PRIB 2OL3B 2M1KA 5LAXB 1AP2B 3RWEB 4D9RD 1G6RH 2AJ3A 1R0AH 4C57C 3S4SB 4M61A 5DJXB 1ZVYA 5DURB 5I16A 3CPLB 4M7ZC 3L7FB 4EI6A 4Z77B 1UZ8B 3B9AA 3P4OB 3FHQA 4D8PB 5FUOH 2H32B 5HYEA 3EFDL 2WINA 3WFEL 4OZIA 4P2RE 2BOBA 2IMNA 3V0VB 2Q3AA 1B90A 3BKML 3BWAB 4K8RD 5IF0A 5BQ7A 1RHHA 3UJIL 1FN4A 1MVFA 4HS8H 4JFQB 3DMMD 4WI5A 4UV7L 3U2SB 4XTRC 4WV1B 1T7WA 4Y7MA 5GGRB 2O61B 3FQRA 3WE6A 3WO4B 2AEPL 5CS7A 3STLB 1YJDC 3LKSB 2XA3A 5LG1A 5GGSY 1L6XA 2CRYA 3V0AC 3S8WA 2Z4QB 1QEWA 1BFSA 1N6QL 4NQCA 2VQ1B 4XI5C 1OT1A 2CDEB 4I48A 3MBXL 3DURB 2YUXA 5C07D 3RVUC 2CK2A 1DQLL 3FT2A 4K7FB 3ZE2E 4W4OA 4OCSL 4RGND 4WGVB 3GJFA 2NY5L 2VLJD 3NA9H 4PLKC 3KPMA 2V5TA 3SDDB 2MKLC 3QDMA 5JOPD 3RZCC 4ZFZB 1U3HB 3BGMB 3ARSA 4N0UE 1U8PB 4ODVH 4MNHB 2J3SA 5GIRA 5IJVA 1ZHKB 2EIBA 4IOIA 4IDJL 1SVZA 3G6DH 4I2XA 4RFOH 5MEQB 3K1DA 1F3JB 4H1LH 3BKJH 2EE3A 1JF1A 5MENE 4Y5YA 2PW2B 1N7MH 1AD0B 2P47B 4NGHH 5A16B 5C0FB 1WAAA 4KHXL 4XNUH 4WHTA 4OCMC 1LEGA 1FNGB 5C7XH 4L8BB 5FYKU 4NWTL 2GJZB 4RWHA 1M6OA 5HHOD 1FYHB 1CCZA 3L6FA 3ZL4H 5CJ5A 1EEZB 5C0RH 4TPRL 4KI5E 1A22B 4K07A 3N1QC 4NNXB 2K7QA 4BELD 1I4FA 3LV3B 3T0EE 4NNPH 1MCIA 3EUUA 3EGSA 5C09D 3LRHA 4O00A 3GBML 4MA1B 2V5MA 1XGUA 1XF2B 4KJWC 3F65A 3ET9F 5L7XH 2YSSA 3UTSD 4GG6A 4QT5A 3TEUA 3QEQA 2ICEA 4MJ6A 5HDQL 3O6FD 4M7JL 3BPNB 2R39A 1Z9OA 1OAZH 1K4CB 3HZKA 2NY3B 4BSVA 3AAZB 4C59B 5BOPA 1ZA6B 5GJTH 4G3YL 4MXWH 3QIUA 5E2WL 4WDIB 3MV7A 3H9SD 2FLRT 1J1OH 2C1PA 3OX8A 4M1DL 2HP4A 1BOGB 3MV9B 4PGBB 4HWEL 1YJDH 1KLFA 4ZD3L 3QR2A 1C5CH 1F11B 3RKDD 4IRSC 1RK1B 3MYZA 3VXSB 4KRMB 3D0LA 1MAKA 4NKDB 3UPRB 3CDGA 3GB7A 3BVNB 4P3CH 4PGEB 2BNRB 4OQTL 1PBYA 1ACYH 1LGVA 4NZJA 4J1UB 3FO1B 1A6TA 1IJ9A 2GCYB 3S9DB 1NSNL 4XNMA 3MUGB 1NUDA 3PHSA 2X4NA 3CFJA 2NX5D 1QYGH 1KIRA 2W65B 3OKOA 3UROR 4GW1B 1AH1A 4FFZH 2ZPKH 4KV5F 1T5WB 5SX4I 2W9DL 4KXZI 4FFWC 3SY0B 3FZUC 4DKEL 2FR4A 3LKRB 2VXUL 3QUYC 4GAYA 4D2NA 5GZOD 1MAMH 4OGXL 3RAJH 4GXUN 1FLRL 2FIRT 5FUCE 5SWSB 1YMMA 2E7CA 4QRRE 3WJLA 3UYPA 2IC2A 5KOMC 1ZWIA 3HE7D 3RJDA 5CGMA 3ULVD 5ESAA 1RD6A 1BQSA 1BQHB 5HHME 1AHWC 3CJJA 1NLBH 5D2LF 4WTWA 4NNYA 4OUUB 2HTKC 3T0VA 3TNNA 2X09A 4KPHL 4RMQA 5L9DH 1OF2B 2B7DT 2VDML 3L3IB 3U7YL 4HZAA 4HKZB 1KJ3H 4U6HB 4HZLA 4QYOA 2IH1A 5GRWA 3QIBD 4PV9A 3RP1A 2XZCH 1NL0L 1X6NA 4XRCA 1G9NC 1DQQB 1H3GA 4WEBH 5KBNC 5E9DA 4LKXB 3TPUA 3KPSD 5ICXA 3L3GB 3QNYA 4TQEH 5HVFB 5D1XB 4ZUSA 2X5PA 2VWEC 2OP4L 1JHLH 1P4IL 2HJKB 2QLVB 1LO5B 1WBXB 1K8IA 1FFRA 1KB9K 3THML 3Q5OA 4LPYA 3IFOB 3TBVA 1TIUA 4PJBA 2J5LC 3W2DL 1HKLL 1MQKL 1M7XA 3CUPB 5T3XH 3C8KA 1BVZA 2PYEE 3AFLA 4PRHA 3KPRE 3LEYH 5D6DC 3KDMB 2Q1EA 1GZPA 1SEBB 4PB0L 2FIKB 3SKOB 4IOFD 2W0FA 1X5LA 5JHDE 1YEJH 2ZUYA 1IGFL 3OBAA 5MEOA 3L3JA 3CD4A 5H2BA 3GMOB 5EIIB 3HS0B 3VWKA 1BD2D 3E6FB 5D96B 2YD9A 1OWRM 3V6FA 1V3LA 4GQ9H 1INDL 2X4SB 3VXME 2IWGA 5CIPH 3B3IA 1IFHH 5F88B 1N0XL 1SJHA 1KIPB 5KTEH 4PY8I 3CSGA 2DQCL 4O2FB 2BSRB 4RRPA 3UTZA 3G5XA 4IS6B 1G1YA 3C09B 2IQ9H 3O9WA 3S3SA 5DK0B 2NXYD 4Z7WF 2DQUH 3MJ8B 3VRJA 2PETA 5J12C 2DM3A 5I76A 3O6ML 4LLVB 4Y1AD 1RUKL 4Y4HA 5GGSB 3VCLA 3G5VB 2YEZB 5I1AA 1Z2KA 2RJMA 2QQLH 5DJYA 5I8OL 4JFFD 3NA4A 3SE4A 3TA3D 2B1HL 4PTTA 1AR1C 4NQSB 1OARH 1XCTA 3K74B 5I1JH 4YDJA 4PJ8B 4NKIH 5F9WB 4M6ML 1KCKA 5MI0C 3L3OB 1RY7B 4YXKH 5T3ZH 2F53B 4YX2H 2VLLA 1MHEA 3BW9B 4HHAB 2A73A 3DSFH 1ZSDB 2A77H 1WZKA 5I71C 1Y0LB 3FQWB 4Y5XA 1QNZL 3ULUC 2X41A 5ALBL 5KZCB 4MD5B 5IJKA 1RIVH 1C1EH 3GIVA 1YC8A 3D1MC 1MWAH 1QACA 4JRXA 1PQZA 1RZJL 3ZYOA 5HDLA 3V6ZB 4HH8A 2JJVA 1A47A 3MLYH 3PL6C 4WW2F 4XXCA 1G9NH 4Q6YA 3MRRB 5F1IA 2KKQA 4U7SA 1S7UA 1X5GA 4I9WE 5CJQH 3RIAK 3DUSA 5E5MA 1JGDA 3DMMA 2PCPA 5HVWA 1DLHA 3HNVH 2OR9L 2APWA 2IPTL 1QPPA 4EOWL 1I8IA 5B8CA 3X13B 4OTXL 2HVJB 3NPSB 2W0KA 3ZKMD 4K3EH 5F6HI 2EDFA 5E6IC 4KAQH 5FHBH 1QVOB 5DK3A 4LP4A 5HDBF 4PJIA 4D0DA 1Z0NA 3RKPA 2GK0A 2XKNB 5EH1A 3DX6B 5C07A 3MGOB 5DC9B 1VEMA 2HWZH 3SGDH 4G8GE 2WWMC 3B4NA 4EI5B 1GGYA 3A6BH 4J3SA 1NMAL 2ESVE 3U6RB 4NO3B 3P4MA 4R26L 2AGJH 2VDQH 4S1QH 4NKOB 4ODWA 5DHVA 3T04D 1BVKA 4ZMAT 3JV4A 1PZ5A 4P5KB 1C12A 1J0IA 2FEDC 5IFAH 1OGTA 2O93L 5BVJB 1CDGA 2OJEA 1NMCC 1ULVA 4PJCE 4JR9H 3W11D 1RUQL 2BRQA 4Q7DA 4OIIH 1YECL 5C0IB 1KPRB 2YUVA 4F9LA 3MCLL 4G6AC 4U1LA 2BY3A 4BK4A 4WTZG 3T09A 1U3YA 2H41A 3KYOA 1JNNL 2FSEA 4CNIB 2EDQA 3QXTA 4NRYB 1A7RL 2Y06H 3ILQD 5CZVH 3ROLA 4PLJC 1WC7B 1JTTA 2HFGL 4HXAL 4OV6F 3BH9B 4ZO6A 1CDIA 3ROOB 3MLXL 4LBEB 2JB6A 5C08A 3UJJL 1FO0L 5CJ8A 5EPMB 5C0GA 3VFPA 2E5EA 3U4AA 4PP2B 3LIZH 5T33L 5IP4A 1BX2B 1VGKA 4QOKB 3VH8B 5C09A 2GTWA 1S9XA 3IDNB 3BOVA 3O4LE 1OW0C 2XQBH 2VOTA 3ULUH 5ESQB 1KJMA 1NGZA 3K2UL 5B38G 2QSCH 4RMTA 4HJ0D 4FRWA 3IETB 2UWEE 1FO0B 5LWYH 3IXTB 1F4XL 5BS0D 3ULUF 2WIIB 4GBXC 1R5VB 3HNTL 3NAAH 4OT1L 1NAMH 1EAJA 1H9VA 1U8KB 4ZYKA 3ME0A 1AGEB 4HS6B 1BM3H 1CFNB 4KUZH 4O9HH 4MA7H 5L8LB 5SV4A 3H9SA 1XGYH 2OZ4L 1JPST 1T1YB 4R7NB 3CSPA 5BRZE 3MV8D 1I8MA 1SM3L 3HI6H 3SBWA 4N1EA 5BZDB 5CGYC 2EIZA 4GG8A 5ETUA 5C0BB 4JGUA 4NZTL 2D31A 2NXZB 5AD0B 2DI9A 4LLUB 1AO7E 1I9RL 4UMGA 2EDTA 5SX5H 1W72A 5GSRA 1SY6H 3MRHA 1S7XA 2BVQB 3C6LB 3DROA 1DQDL 2HG5A 4X99B 4HUXB 4YHLH 2HVKB 2NX5A 2R23B 2ENSA 5FO8B 1K3IA 3IDYC 5E8NB 1L9NA 1DBKL 3OR6A 4RFEA 3BAEL 1LEIB 3QNZB 5L2KE 3GHBH 5TDOB 2D0HA 5DFVD 2NQCA 1JYXA 2HAZA 3QDGB 5ENWA 5FYJL 2NCMA 2NY3D 4WFED 4MAUH 1RUPL 1LNUA 3LMJL 5FDWB 1ZHBA 2ADGB 4C4KT 4JLRA 3WN5A 4UTAH 3WXWL 5TE7H 4X6DA 3ZYIA 1TTUA 3MV9D 4NFBA 1Z6JT 3FMGL 1QBAA 2QSVA 3FAWA 8FABA 4MS8D 3MR9B 3K4ZA 1MJ8H 4D94A 1IGYB 1QSEB 1KTDB 2ZKHH 5DUMH 4XMPH 1T0MB 1X7QA 5D9SB 1HH9A 1ZVSA 1EBAA 1QFOA 1JNJA 2ICWJ 1B4RA 4ZDHA 4JY4B 2D4DA 4G6KL 3VMNA 3MLZL 4JPWL 4YHNA 3C9NB 2R0LH 4JHWL 2AQ3A 5JW5B 1B4JL 2APXA 4RX4D 1RIUH 3KPSA 3U9UA 3VGEA 1OSZA 3VFSB 1FNFA 4OFYD 1ZLVK 1FZKA 4EEEA 2CH8A 3AU1B 4HULB 4PJHE 5EUOB 1YEGH 2I9TB 2OM5A 5TGBB 2AJZA 3VGGA 4I5BA 3V4VL 2R2HA 5D5MB 1OP9A 3VJ6A 1HQ4A 3W9DA 1KN4L 3MLSH 4XZUB 2G5BA 8CGTA 5J89A 5DD5H 4FXKB 2BVOB 5INCA 5FA3A 5ACZA 4PRNB 2YKLH 4DK3A 1MHPH 2RBLA 2WBJA 2AEQH 4YQXH 4FFYL 43C9A 4PJEA 1FCCA 4PJDB 3MRLA 4MJ5A 3MRPA 3BGFB 3MJ7A 3RWCB 2XPGA 2NY2D 3DX8A 4Z95H 1IAMA 2BNUB 4X0KB 1L0YA 5EU3B 3ZSSA 4K94L 4A2LA 4QXGL 2UV3A 5L8KB 2P5EA 1ZTXH 3GSVB 2P8MA 2YHGA 2D4FA 2VUOA 5D1XD 2JCCB 3PGDA 5I8EB 4KY1H 3SKUD 1KBGH 1PKQB 4KMTH 4QTIL 5IMKA 1NCUA 1CXFA 2O5ZH 3G9AB 4Y1AA 3K8MA 3SE9L 1CBVL 3RX7A 1MCCA 1CE1H 2EDBA 5E6ZA 1YUHB 4LL9A 3CC5A 1QP1A 1JYVA 4R90H 1MLCA 4LFHD 3TA3A 1B6DA 3ZHDA 3EDFA 2XWTB 3TN0D 4OD2A 4HPOH 1XIWB 1QLEL 4OZGB 4JREC 5DMKB 2MCPL 2DJUA 5EWIH 4NQEB 4DGIH 5KJRL 3LRGA 4LCUB 5I1KL 2P7TB 1GOGA 2J8UA 4G42A 3HC3H 1HI6A 1A02N 3WHE0 3GRWH 3QUML 1X6LA 1RZIA 1L7TL 4ZG1A 4XCCH 5KSVA 5T5FH 1OCWL 3MRMB 4EN3C 1RUMH 4X6CE 4LRIA 3VGDA 5D71L 4PJGF 4F7PB 2FO1A 1ADQH 2FCBA 4FZ8H 4K2UH 4XAKD 5DJ0B 4GAJH 1DP0A 2AJVL 5E2TL 4PJAE 4KUCF 3QUMB 1E27A 4POZD 4B7IA 5JXED 2CIIB 2I07A 2ZUQB 1UACL 1A9EB 3ISWA 3MRDA 4IRJD 3GIZH 3C5ZC 1D6VH 1TLKA 2LQRA 4HKJB 4XMKH 1MJUH 3HMXH 2BSSA 1CR9H 3F7PC 5D2NC 3RGHA 2Q76A 2XG5A 1RVFH 3KNBA 3SDCB 3EO9L 1UB5A 4M1CD 1NDMA 3QO1B 5IB2A 2GIYA 3L5XL 1I1YA 4M5YH 4G6ML 4RFNC 1LWRA 4KKAD 4YDVA 1VPOL 2F53D 1R3HA 3RY4A 3GMLB 2UVEA 1NQBA 4AH2B 2JKXA 4KK6D 2QR0B 2ARJB 2NW3A 2BOCB 4YDKL 2VDOH 3MC0A 4C83B 1EUTA 5DJAB 2WZPD 5DLMH 3HE6B 4NO0B 4F57L 5GHWL 3DO7B 1JNHA 1MCOH 2OL3A 4PRIA 5LAXA 1AP2A 5FO7B 3RWEA 4G7VH 3B2VL 3S4SA 1FORH 5FA4B 5DJXA 3TYGL 3CPLA 3L7FA 3QDJB 4Z77A 1UZ8A 4YDIH 4D8PA 4CRPA 2H32A 4L29B 4Y4FC 5CP3H 5K59E 4C55A 3K0WA 1CLOL 2DQIH 3V0VA 4Z0XB 3BWAA 3H0TB 1UZ6F 3V0WH 4XNYL 4DKFL 4JFQA 3LH2L 3U2SA 4WV1A 1ZLWK 2FEEL 5GGRA 1B6UA 2O61A 4V1DB 2HT2D 3CLEL 3STLA 3LKSA 3TIEB 4V2BA 4L4TE 1ZANL 3AREC 3PNWB 4MYWB 2Z4QA 4MQSB 3IDXH 4EUPB 1CL7L 4LLDB 1JYWA 2VQ1A 2E7MA 2CDEA 3DURA 5FYKH 4MAYC 4WUUE 2VAAB 1TTGA 1YNLL 2BDNH 3V6OA 3AC0A 3P2TA 1G1CA 3SE8H 1JZ2A 2FX8H 2X6MA 3G04B 4EI5D 3O4OB 5KS9B 4I18A 4K7FA 1YQVH 5HHVH 1T03H 3QDHA 2W92A 3NZHH 4WEUD 1VERA 4EXPX 1II4E 3SDDA 4RIRB 4ZFZA 1A1NB 1U3HA 3BGMA 4MQXD 1U8PA 3O2WH 4MNHA 2YA0A 1NANH 3KG5A 1NBVL 1CLYH 1ZHKA 3U9PL 4XVJL 3VGHA 5J56B 1QR1B 1IVLA 5GGTL 3P40A 4JVUA 1DANT 5MEQA 1F3JA 5JO5B 4JCMA 1KELH 3LQAL 4HUVB 3T65B 2R9HD 5ITFB 3SDYH 2PW2A 4FFVC 3LS5H 3GO1L 3MRGB 1AD0A 5LKNA 5A16A 2IANE 5C0FA 2VTFA 25C8H 4C58B 1FNGA 4UTBL 4L8BA 3HRZB 2GJZA 3JZ7A 3HUJE 3AB0C 4JZOB 3MMEB 4NQDE 1EEZA 5HYSB 4O2EB 3LCYA 4GQPH 5CUSH 5J4MA 4P23C 4NNXA 1ERNA 5C8JB 5SWZB 3LV3A 2AW2A 4YGVB 3F6IA 2QV2A 1T1XB 1EMTL 1JRHL 2R0WL 2GSIB 4KMLB 1NGQH 4DOHE 4FQPA 4NDMB 3CVIH 2DQEH 4WHYH 1XF2A 4PRPB 2YPVL 2E9BA 1FDLH 1IT9H 1XGQB 3OB0H 3VFOB 3CMGA 1RSFA 4PR5B 2FEEI 3AS0A 1NMBL 1KN2H 5HGAA 3F7VB 4R9HA 1A5FH 3NACH 1MEXH 4OF8A 1K4CA 4LSSL 1F6FB 1CL7I 3HG1B 3AAZA 3MROB 5C0AE 1L4IA 3DETD 3QZWG 1ZA6A 1NEZB 4Y5XC 2NYYC 4WDIA 1OAYL 2B20A 4OD3L 4MJ2A 5FKAB 1JPFB 1BOGA 4Y2DC 3MV9A 4PGBA 4CMHC 3PQYB 1GZQB 1F11A 1QHOA 5J8OA 1RK1A 3DECA 4M93B 3VXSA 4NKDA 3UPRA 3BVNA 4GMTH 5C0BD 4PGEA 1R5WB 5EA0H 2NXZD 2F5AH 4PJ5E 4GRMB 4J1UA 2JE8A 3FO1A 5B39G 2GCYA 3ZDZE 3B5HA 3MUGA 4N90E 1CDHA 2ENYA 3TH4T 4XXDB 2JK5B 2W65A 4O4YL 1MCBA 3LZFH 4GW1A 1UJ3C 4ONFL 2XACC 3TZVB 5KSBB 5F3HB 1T5WA 2H2PD 3WIIL 4BZ2L 1R3IH 1MRFL 1RFDL 4UAOC 4OQTA 5EOCJ 5E8DL 4PBVC 3SY0A 2F8OA 3LKRA 2I60H 3VFWB 4XC1L 1G0DA 1IGML 3RUGB 1CFVL 1FGNL 1U58B 3QWRD 1XT5A 5SWSA 4ZNCD 1J11A 1QRND 4ELMF 2PXYB 3ZDYF 4F37F 1RUAH 1R3KB 2E6QA 1W0YT 5EU7E 3GI9H 2JB5H 4HCRL 1P9MA 2XA8L 1BQHA 1JGVL 2V17H 1JUFB 4H26B 1FPTL 4JFXB 5BVPH 4OUUA 5HY9B 2CPCA 4GAGL 2LAGB 4RGNC 2B1AH 1OF2A 1JRHI 4XC3L 3L3IA 1BBDH 2CRIA 4HKZA 3V5KB 2CDFB 4U6HA 3VD5A 2FHFA 2EC9U 4ZO7A 5A2JH 1SYSB 2BCKB 4JG0L 3X3GL 3IFLH 2GEEA 5D70H 2IPUK 3GNMH 1DQQA 2HT3D 5J11B 2JELL 5DO2C 4LKXA 3IJSB 2COQA 3GHEL 3L3GA 4OAWB 3NFPB 1U91B 5D1XA 1PG7L 1CDYA 1NDGB 1J1PL 1A6WH 1PG7X 2HJKA 2WM0A 4F9LC 1ED3B 1LO5A 4LMQI 5CJXC 1WBXA 5IVOA 1YYML 3T4AB 3SE3C 1A3RH 3IFOA 1FFPB 3M07A 1EUUA 1MCLA 3RBGA 1A64A 1A7OL 3CUPA 2Z91B 1I1AC 3MRQB 1QFWM 4I0PC 3U30C 3KDMA 1FL6B 4LGPB 1SEBA 1H3WM 1FE8L 3LAFA 2FIKA 4W81A 3SKOA 1ONQB 3T3MF 1CQKA 3VG0H 5DR5H 1OQXA 1HXYB 2YA1A 3ZYJA 5BOZG 4YHOH 5HVGB 1CFSB 3GMOA 3QQ3B 1G7LB 1D6EB 2FATH 4U1JB 5D7IB 3HS0A 4NOBA 5GSVB 5HGHA 5EIIA 1MJ7L 2XZAL 4YZFE 4X6BB 5EBLB 4I3GA 5CP7B 5F7UA 4IJ3C 3BP5B 2X4SA 5IBLD 3VI3F 4GO6B 2R69H 3AM8A 5F88A 1G6RL 1R0AL 1KIPA 2Z9TA 1ACZA 4O2FA 2BSRA 3A6OA 4R4FH 3C6SB 3O6FC 3QCVH 4F7MB 3TJEH 4IS6A 5DK0A 3EYUL 5FUOL 5T1DH 3MJ8A 4Q9BA 4L8SB 4LLVA 3V7AE 5GGSA 1T04B 3G5VA 1QBLH 12E8H 2YEZA 5JLZB 4PJFE 4U0RB 4HS8L 1G6RB 1HINH 2QQQA 3K8KA 2DQDH 2ZG1A 3D39B 5JIKA 4LOUD 2E7LC 4PGJA 4XCFH 3RVXD 1XIWD 2V9QA 3RKDC 4P46D 4AL8H 4NQSA 2Z0BA 1VFBB 1H3TA 3L3OA 3FKUS 4NQED 1CVRA 1H15B 2F53A 1IKFH 3BW9A 3ORJA 4OFVA 5KW9H 1I1RA 3L3DB 3TO4B 1ZSDA 4KJYB 1AKJB 1Y0LA 1RV6X 3FQWA 1BFTA 4LK4A 3C60D 4MD5A 1D5IH 2PTVA 1FH5L 2VLME 3OQ3B 1F6LL 4M9OA 3FB6B 2DI8A 1Q72H 3GMRB 4IRZH 2CO6B 3SKNB 1TITA 5DJ6B 2VWEE 4NJAH 4MB5A 3V6ZA 5GZOC 3Q3GB 3T0AA 2GK2A 4H0IA 3MRRA 4JHBA 1MI5B 5KVGL 5DEGB 5I74C 1SJVA 2D7QA 3I9GH 3BYYA 3HE7C 3IAPA 3ULVC 3G6DL 3HZVB 3GBLA 3QXWA 3BKJL 2NY1D 2WP3T 2R8SH 3HPLB 3SDXF 1N7ML 3X13A 2HVJA 4Z7VF 4XPHH 4YHIB 1JI1A 2NPLX 1EVTC 1QVOA 3FT3B 3SHSA 1RZ8B 3NGBC 3QIBC 2KBGA 4LVHC 5C7XL 2GFBB 1BGXH 2EXWC 3C2AH 4TNVK 4U6TA 1JJUA 2XKNA 1J1XH 3D9AH 3DX6A 3KS0H 3MGOA 3ZL4L 3FN3A 4H1LB 2I5YH 5C0RL 5ADPH 3HE6D 4NO0D 3LEVH 4EI5A 4UBDC 3NCMA 4J4PD 4OJFH 3U6RA 4NO3A 4ZSOE 4NNPL 5JW4R 4NKOA 1NC4B 2ZG3A 2XTJC 1X9QA 1H8NA 4P5KA 1HSAB 2XIDA 1QOKA 2YBRB 3MGTB 1PX3A 5BVJA 3S88H 4QY8B 1BEYH 5L7XL 2RIKA 2W0PA 1UWGH 2Q8AH 2EH8H 3IRZA 2X4OB 3I6LD 1T2QH 3T2QA 2Z31B 3QEHA 4MNQB 3EZJB 3H9YA 5C0IA 1KPRA 4OI8A 1T22B 1NBQA 1OAZL 1MCNA 5B4MC 1HYSD 4CNIA 4MQ7B 3O6KH 5DJCB 2M26A 4NRYA 3BMVA 5GJTL 4LQ1A 3N0PB 4MXWL 5IKCB 3TT1L 5EIQA 5JPMB 3S35H 4M7ZB 1WC7A 3W0WD 3BH9A 3EHBD 3P4NB 3ROOA 4LBEA 1YJDL 5CEXB 1UJTA 5EPMA 1X5YA 1P6FA 4PP2A 5C9JB 4P3CL 3FRPA 3TBWB 1BX2A 3BRFA 4QOKA 3VH8A 1ACYL 5D7LE 2DTSA 3IDNA 4OCWH 2BRRH 2C9AA 5CSGA 1NFDF 1F8TH 5ESQA 1K6QH 4OCXH 2WSKA 1QYGL 3TA3C 3IETA 4HIJB 1JWMB 2DMKA 4XCNB 1FO0A 4FFZL 2ZPKL 3GSRB 4B0MM 3FB7B 2NTFB 3IXTA 1T7ZA 2VLKE 3B6SB 5HGBB 2WIIA 5T5NG 1R5VA 1MFBH 3VXUE 3OV6A 3RAJL 4HG4J 1KGCD 4PUBH 1U8KA 3ULVH 1AGEA 4HS6A 1CFQB 3DWTA 3LKNB 1CFNA 2YUWA 4NM8H 4XBEH 3PWNB 5F8QC 1NLBL 1T1YA 4R7NA 3FFCE 1YNTB 3RZCB 4K3DH 2IAMD 4XHQA 2XWBB 5F7LB 3LQZB 3M45A 5SWZD 4XH2B 5BZDA 1KJ3L 5C0BA 4G9FB 5AD0A 3QAZB 4LLUA 2XXMB 4Y8DC 2ITDB 2CRZA 2CR3A 4ODBD 3DLQR 1WBZB 4WEBL 2BVQA 3C6LA 3KXFB 2OZ4A 5IHUH 4G8EB 5FYLD 1ZVHA 4X99A 1D5XB 4HUXA 4NBXB 2HVKA 3BJLA 2R23A 4LCWB 4TQEL 5FO8A 4S1SL 5DQ9B 5E8NA 4AEFA 5HHPB 4CW1B 1JHLL 2ZUVA 5E08H 1LEIA 3QNZA 3FT4B 5TDOA 1MRDH 2AI0H 3QDGA 4XP1H 1NCAH 3HG1D 4HUKB 5H94B 5D7JC 4CVXB 4Z7NF 4LEOB 4MXQD 5CLWA 2DQHH 1M1SA 4I0CC 3RIAF 2WANA 5T3XL 2ADGA 5FGSA 3TF7C 1YNKH 3LEYL 1ETZB 4ELKB 4P48A 4HIHB 1AQKH 4UILH 4U7MA 2GYSA 1YEJL 5F6HJ 4E41E 1IM9B 3KWWB 4OZHE 3MR9A 1IZJA 4OGZA 2IMMA 1IGYA 1QSEA 1KTDA 1YPZE 2DKSA 1T0MA 5D9SA 4ZOBA 2XTLA 1VACA 4JY4A 1RZKC 3Q5TA 3PDGA 2VSCA 3C9NA 4GQ9L 2YWZA 4J3TA 5JW5A 1IFHL 3W11C 1A4JB 4NOFA 5ACMA 5KTEL 3VFSA 1YQ2A 3AU1A 3R4DA 4FQ2H 5EUOA 2IQ9L 2FGWH 2I9TA 1L0QA 3RU8L 2AXHA 2DQUL 5TGBA 5JXAH 2A9NH 4F9PA 4Y19B 1GRWA 2R1XB 5D5MA 5JOFB 3ILQC 3P11L 7FABH 1JHKH 4Z7WB 2RFXB 5CIPB 5FKPB 4XZUA 5J1TC 2F8XC 2PXYD 3MRFB 2VERN 3LN5B 4IRSB 3TGXA 4FXKA 2BVOA 4PRNA 2I27N 1G7QB 4I1NB 3HPJB 3U36B 3T1FB 1OARL 5I1JL 4I18C 4YXKL 5T3ZL 3BKYL 1VFUA 3RJQB 4PJDA 4KWUA 4YX2L 1LDPH 3RWCA 1W0VB 3DSFL 3KPTA 2A77L 3K3QA 3MODH 3FQXB 1BHGA 2BNUA 3GKWH 4X0KA 3GSNH 5EU3A 3WNOA 4TYUA 4QHLB 3BDYH 5C86A 1QLRB 5LQBH 4LNRB 3CH8A 1RIVL 3GSVA 1C1EL 3OKDB 3DARA 3QJFB 1U3JA 3QUYB 2BMKB 1ITBB 3S37H 1MWAL 3BD3A 2JCCA 3B8SA 2AXFB 5I8EA 2ATPB 3QT2A 1F3DH 5I19H 1PKQA 2EDHA 1OHQA 3T08A 2IPUG 5E8EB 5SWQB 3MLYL 5I2IB 4N9OB 3UPAA 3BDBA 4CVUA 3F7RA 4J3XA 4RMSA 2A6DB 4KTYA 3MV11 5DD6B 4HIXH 2AJXH 1YUHA 5CJQL 2IBZX 1NCTA 3N50A 4ENEC 1EVUA 1U9KA 1IILE 1MWAB 4M43H 4CKVX 4PY7B 2QSTA 3HNVL 2XWTA 5IVXF 5IEHB 4FG6D 2P45B 5DZOA 1XIWA 2G9HA 4Y0GA 4OZGA 2HLAB 1KEMH 4K3EL 4OSUH 5DMKA 4KHTH 4APQD 5FHBL 4YEFA 4HC1H 4NQEA 4DKDC 5DD1H 1T0NB 4M3KB 4LCUA 3HLAB 2P7TA 5C6WH 4P4RB 4WFHD 3UBXB 4OZIE 1CDCA 2HWZL <