4LAJH

Crystal structure of hiv-1 yu2 envelope gp120 glycoprotein in complex with cd4-mimetic miniprotein, m48u1, and llama single-domain, broadly neutralizing, co-receptor binding site antibody, jm4
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTLDYYSIGWFRQAPGKEREGVSCISDSDGRTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCATDCTVDPSLLYVMDYYGKGTQVTVSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/inhibitor
molecule keywords HIV-1 YU2 gp120 envelope glycoprotein
publication title Heavy Chain-Only IgG2b Llama Antibody Effects Near-Pan HIV-1 Neutralization by Recognizing a CD4-Induced Epitope That Includes Elements of Coreceptor- and CD4-Binding Sites.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 31
structure length 124
sequence length 124
chains with identical sequence I, L, M
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lajH00
4ALAH 2DQUL 4WW2F 3CSYA 3IAPA 4PRIB 5DJCB 1OP3H 1RUKH 1U2CA 2FDBP 5LWYL 1CXHA 5CJ8A 4ELMF 5KSBB 5C86A 2XG4A 1CDYA 2EYSB 1FVCA 4XNYH 4K71B 5GZND 1U95B 3O9WD 2WUBH 4OZHE 5DGRA 4ODVL 3T2NL 4YNYA 1K6QL 1LNUB 2DMBA 3NACH 3W0WB 1YEIH 4ZOBA 2QV2A 1BZ7A 4RSVA 1WWBX 1FC2D 4LLMB 4JAMB 4G6JL 1HQ4B 2B2XH 3L1OH 3VFWA 4JLRB 4AIZB 3TFKC 5T1LB 1I8KB 3KXFE 1NCDH 3QFDA 2ZOLA 3HLAA 2X4RA 3QG6A 2BCKB 2GKIA 4N90E 2P45B 3EJJX 4U1KB 3KPLB 2IJ0C 4O9HL 4YJZL 1CFVH 3KPNA 5EBWA 2XN9D 3E0GA 2AXJA 5DFWH 2J8UE 1UJTA 3PWLB 4Q2ZB 1W0VA 4FMFA 5DTFB 1S7TA 4PJ8B 1IC5H 3FFCD 3TYGH 5EU6E 1NGZA 1SYSA 4XWOC 3VFTA 3TN0A 2CO6B 4FQXD 2P1YA 4K8RD 1SY6H 2EDRA 5CJOH 1FG2B 5HHQA 1ZS8A 2R2BB 1YMMA 2XZCH 2KUTA 3FTGA 4XP4H 2YPVL 2OXGA 5LQBH 3HNVL 1JPGB 2SEBB 5E99H 1OSZB 2AJYH 1J18A 5TE6H 4KUCF 5TE7H 4BH8B 4H1LG 4XCNB 4PJBE 1I7ZA 3BIBX 3NZ8A 2DI7A 4QRSB 4XP6H 5DD0L 3UROR 1OM3H 3MCLL 5JA8B 2GAZB 1GL4B 4X4YA 1FO0H 1A3RH 43CAB 1JI1A 1PAMA 5I16A 1XT5A 1RUQL 1AXSB 1FAIL 3UTPD 4HJGA 4N9GB 3Q6GH 1DQMH 1MVUB 4LAJH 4OM0L 5F1OB 3FB8A 4AL8H 2NX5D 4EDWH 1KULA 5CAYB 3L3IA 5IP4A 1SYVB 4NO2A 4KROD 4X6DF 4N5ED 2NY1C 4CMHC 5C09E 5MEOA 1VB9A 2NR6C 5JXAL 1DLHA 1EV2E 1Q38A 4NWUH 1M4KA 5E9DD 2EDDA 1U58A 4QT5A 3RFZC 3RHWF 4G7YH 3FFCE 5F7UA 3FHQA 3DV4A 2UUDH 3C09C 4PJ9A 3K2MC 1IEHA 4F33A 1T1YA 3VXMD 1I7UA 1U8PA 2Y9RT 4LRIC 1G6VK 2MHAA 1TETH 3DVIA 1TXKA 2AEPL 2BVUA 5HYQA 3RZCB 4UDTB 1GIGH 4EI5C 1F5WA 5JORA 5AZ2H 5E2UL 2D7QA 1BZ9A 3E6FB 3MRFB 5GJTL 3QUML 3VFVB 3K2UH 2VE6B 3D69B 2VIRB 3FQUB 4ZFGH 5IW6B 4M6OH 1QFWM 4B7IA 3CD4A 5F3HB 1HHGA 3G6JE 4MXQD 2UZIH 4Y4KB 4Q9QL 4XBGB 1QYGH 1TLKA 4XHJC 4FRWA 3CFDB 3OPZL 2X4OA 3BH8B 3D6GA 3G5ZA 3CFEB 3G04B 4LMQI 3ZZ1A 1MCNA 5FOJA 1DZBA 4BKLA 4XWGL 3REWA 3QNZA 2XQYG 5IESH 5D7LB 4EN3B 1T20A 2HKFH 4PLJD 1MFAL 3G08A 4IM8A 2VR4A 4L8CA 2ADGB 3RVXC 1YMHB 4RFEB 4JFXA 1OT2A 2BC4B 3QDAA 4O5LL 5GS0L 2DS4A 1NL0H 5EBGA 1G9NH 5TH2B 3LIZH 3P4NA 1H15B 4C59B 4XPBL 3IJHA 3L95A 4MNGA 1BJ1H 1L9NA 4QXGL 3ZTJH 1DBAH 3JVGA 2QQQA 3D0LB 5E9DE 5MERB 4HIEA 5FYKD 1YZZA 2VR9A 3I2CL 4G8GA 5DVMA 5I1CL 4PJ9C 1XF3A 2A2QT 4TSCL 2IALB 2HT4C 4LIQE 3VXME 2VZSA 3OKKA 3CX5K 2AK4D 1X5LA 1UKSA 3T0EA 4OD1L 2R1WA 4UUJB 3VRIA 5K9JH 4MS8D 3U1SH 5IG7A 2EDLA 3HC4L 4Q0XL 1D3CA 3LEYH 4G9FD 4V1DB 1DUYA 5FOBA 2AEQH 2H26B 4OGAC 3PQYD 1FNSL 4N8PA 3V4VL 1CU4L 3ULSB 4CN4A 4JFFB 3TWCL 4GBXC 1KCVL 1GC1H 4X5XA 1IM9B 2DTML 3MR9B 1J1PH 4M3JA 4WWKD 2NW2B 3INUH 4DKEH 3S97C 4HG4J 2DMCA 2VITA 4GSDH 4YK4B 4NQDE 4GG8B 4RX4D 1RZGB 5HJ3A 5KS9A 4ZUUB 1NGXB 4I2XE 4YFLI 3HZYB 1YYLL 3B6SA 3EYSH 1BFOA 1A1OA 1A6AA 2HLAB 3O6FA 3JVGC 2XNAB 4L9LA 3N1MC 1X5JA 4ZD3L 1DUZB 1AHWC 4L4VD 4KQ4L 3VFSA 5FYKE 5D70H 1EVUA 3DX7B 5IFJB 4MXVF 3BT2L 4OUUA 5IVXF 1J1OH 5T5NF 4UZGA 1Y0LB 2Z31D 4U1MA 4DKFH 2X1XR 4RIRB 4K94C 3L3JB 4JFYA 2AK4E 3E8UL 3OKDB 2GT9A 4YC2C 2VXSH 1D6VL 3JV0A 1HCVA 3QFJE 4X4ME 1UFUA 5ICXA 3STZA 3JV4B 1QNZH 3VW3H 2R4SH 2KKQA 4G9FE 2HVJA 1OB1A 1M6OB 1QRNA 4KI5D 3SHSA 1UB6A 1RJZA 3PQYE 2B1HL 3U36A 4OF5A 2P5WA 4GOSA 5TDNB 1QSFE 2ZUSA 5IKCA 4NCC1 3D0VA 4M7KL 4Y19A 3U9UB 3SKOB 4R6UA 1T7WA 5DJDA 4NRXA 2A77L 4XVUD 3V8CA 3NVQA 3LQAL 3QEUA 3GBML 2A9MH 2Q87A 4G8EA 3ZE1E 3QUYB 2FL5B 1MLCB 5DD1L 2FECI 5A43C 4JHAL 1U3HA 3TPKA 4YBLB 3MOAL 4LPXA 1CT8B 4X6FA 2WBJA 3GJFK 1BD2B 4L4TA 4LKCB 4X9BA 4YDLB 2AJUL 1MCEA 2WWMC 2VDPH 3BP4B 4L4VE 2BHYA 1N3NA 2CK2A 4Y4HA 2DQHH 1PZ5B 1B2WH 1CDGA 3SDYL 4LFHD 4UILL 4HUVA 3DIFB 1IT9L 2IG2H 1ACZA 4XP1L 4YE4H 3BZ4B 2G2RB 4NPYB 5J6GA 4NN5C 3BDBA 4U1SA 3C5ZD 3VDAA 1IC7H 3O3BA 5F3BB 4GW4B 1RZFL 2X4QB 1I85C 1I75A 3BIKA 3FT2B 2NY7H 1JCKA 2YK1H 4P2CG 5SWZA 4R26L 3MLWL 2BXYA 2HH0H 1ETZB 2W92A 5GGQL 1AO7D 5KTEH 4NP4L 2D7NA 1JF1A 4IRZH 5H2BB 4H20L 4WUUA 3RDTA 3EOBA 3VXSB 4G8FB 3EO0A 3VGHA 1YECL 4JFQA 1H9VA 5DUPH 1ZLSH 2ZUTA 1Q9LB 3KPQA 3KPMA 4HIIB 1TFHA 2EE2A 3RRQA 4G6AC 3QA3B 1D5IH 3FQWA 1DANT 1CGYA 1R3IH 5K59F 1F2QA 3FB5B 1JPSH 2R0KL 3DXAB 4BZ1L 1HHIB 3BRDA 3JTSA 4OV5B 3SJVB 4ZAKD 1BAFH 4NO0B 1U3HC 4R4FL 2MSPA 3OAUL 5EZLB 3U83A 3MLVH 4JANA 5LJYH 2BK8A 3P73A 1P7QB 2PNDA 4FG6C 4LDEB 3LCYA 3ULVL 1HN1A 1NJ9A 5DHYB 1U8MA 4Y4HC 3HZVB 3QDGD 1V7NL 1Y6MR 1JGLH 3HC0A 2BSRB 1F8TL 3QEGH 4PS4H 3UTQB 5I76A 4HXAH 1QSVA 4OCMC 5IR1B 3OKEB 4OCSL 4YHNA 4B53A 1P4IH 4NBZB 2Q6WA 2CDEA 4FTVD 4XNZB 1T4KB 1PKOA 1CK0L 4AYFA 4FQIH 3EO1A 4QHLA 3EOYG 1JZ5A 1CE6B 1AO7E 3KLAB 3RDTC 3NCCB 3QI9D 3OGCB 5LXGH 4W6WB 3BSZL 1G7QB 5DEFA 2NTSP 4KK6D 1BVLB 1MFEH 3KPSD 3V4PH 4D0CB 5AYUH 4NNPL 2BSTB 2FHFA 4YHKH 2DJSA 3SDXF 1SEQL 5AYQA 3TV3H 3C6LA 5CEYA 1WFNA 2BFVH 1C5CH 4ESKA 1CDIA 3O4LD 4JHWH 4PJIB 2BOCB 5F89A 5T33H 4CAGA 2FJGA 1FL3B 2YR3A 4FZEH 4HKBA 5EBMB 3STLA 1KIQB 3PWJB 4MA3B 4MVBD 3TBSB 1DVFC 2VUYA 1S7RB 3RL2B 4HLZH 2ZKHL 2WV3A 5F7FA 1FGNL 5I8EB 4J4PD 1MWAL 3MV9B 1CE1H 1NUFA 2APXA 5C9JB 3UJIL 1G9EA 4LFHG 1K4CB 3QDGE 4R90L 4OZIF 3MV8A 4KJWC 4R4BB 3MO1A 4IDJL 1UH4A 4MHHI 5LG1A 4KY1H 2DMKA 4P59L 1B0GA 4LCUB 4QHUB 3NIDE 4K7PX 3IDMB 3KLSA 3THML 1TNMA 1LHZA 4JO2H 5ESAB 1JRHI 4ZUWB 2I9LA 2DLGA 2JKXA 3TCLB 2PYED 1AQKL 3GSXA 2Z35B 4FTVE 4WI3A 3BI9X 3H0TB 3O11B 4RZCB 4LVOB 3S9DB 5ENWB 3NCFB 4WCYH 3QJFB 4PRPA 3GHBL 2XKSA 4U31A 4N0FB 3QWRA 4IJ3C 4R2GD 4GKZB 3PWPB 4NGHH 1OP3K 5ILTH 3HI1B 4UB0H 3KYKH 3UP1A 4E5XA 3PL6D 1WK0A 3D2UD 4WI4A 4C56B 2V6HA 5K9OB 3KPSE 4NM8H 2ZJSL 4ZXBB 3O4OC 3P9LB 1LP9E 2E8YA 4OLUL 3MLRL 4QYOA 3IDNB 4KDTA 3O4LE 4OT1L 1KIUA 4LSQH 3Q6FA 4LRNL 1DTUA 1GHFL 3VMPA 1RUPL 1O0VA 1V3KA 1KB9J 1G7HA 4FQPA 3AB0C 5EA0H 1U93B 5DEZA 1K8IA 1GJIA 4XNQA 4MMXC 4M5YL 2OMNA 3BRFA 4JR9H 5GS0D 2BNRD 4WHTA 4BH7B 3TIDA 1FN4B 4NKMA 2IPKA 5D2LB 3IU3A 1FV1B 4OJFL 1OGAA 1HH9B 4QY8B 3BQUB 3EO9H 4KMTL 5DJAB 4LSVL 4X7CC 3QXTA 5TGBB 2WAHA 5D2NE 1BIIA 1G7PA 4MYWB 1AY1L 5B38B 2HN7A 4DZ8A 3FONA 4D3CL 3ELAT 1MQKL 1X44A 3P40A 4LBEB 5FYJU 5FCUL 5E2TH 3GM0A 1G7MB 3ZHLA 4UINH 1ODAA 4ZPTB 4OD3H 5EULV 4OBSA 3WFHB 5E2VH 2EIZA 1R3KB 2QR0B 4PP1C 2B4CC 4EQ2A 5C0EA 4Z7UB 4RMUA 3MLSH 4Z78A 4HUMB 4U0QB 3ECBA 4PG9B 4QLRA 5ESVB 2MMXA 4XBEL 1NGQH 3K4ZA 4MX7B 4WI9A 8FABA 1N59A 3OF6D 1IFHL 1IGCL 4TNVF 3GSWB 3QG7L 3VH8G 4D94A 3B9KA 4W81A 4ZUVA 4YDKH 3WLBA 3P4MA 5GGVL 4C4KT 2E27H 1WEJH 3QXAB 5BQ7B 5HSFA 1SJXA 4HJ0C 1IBGL 2BNRE 1IGYA 5H37H 1P4BL 3TZVA 1ED3B 3MODH 3WJJA 3MRGA 1XIWA 3VD3A 4XVJH 1QBAA 5GQBA 3IJSA 4HKXA 1AIFB 3EDEA 3C8DA 3D87B 4GKSA 3MGOB 1OAYL 3ESUF 2VN4A 1WBYB 1IGML 2YBRA 5E00A 1ROWA 2GW5A 3KPRD 4YZFE 3MGTB 2ZCLL 3BPNB 1QO3A 1CGSL 3QDJD 4JZNB 3KLDA 3WN5B 5C0BB 2GJ6B 1ZHLA 1OLZA 1LILA 2APTA 2P24B 1AJ7H 3QCUL 4J3TA 5JW4R 3WIHH 4I3SH 4M8VA 3DMMC 4PJ5A 1MAMH 4XH2A 2OTWB 3BEWB 3C5SB 4LF3A 4NHCH 2CDGB 4M1CD 3SKNB 2ZCHH 1NFIB 2CQVA 1RZKH 4LLYA 4YUEL 2HG5A 3NZHH 4N0CD 3B9KC 3Q1SL 1KJ2B 3RBSA 4F7MA 5I17A 1E27A 3X3GL 5IGXH 1N64H 3GIZH 1J0JA 4I9WD 3DX9B 1E4WH 5L88L 5EN2A 1XIWC 3TA3D 1KPVB 1SMAA 5D1XD 5GSRA 1KXQE 1KELL 4KWUA 5BRZD 4PD4J 5D7IE 2IAMC 2PTTA 3K1KC 2VDLL 4JO4L 2W0FB 3VGEA 5ALCL 2AK1H 5FHBL 3T3ME 4BZ2H 2Y06L 4KK5D 4HJJH 1IKNC 3MJGX 1S9XB 5E2WL 4CVWA 4XP9L 4UIKL 3B9AA 4Q74A 4P2OA 3QDJE 2ICCA 4GRWF 3QAZB 2WLYA 5GRWA 3GK8L 4L29B 5TFSH 3WFDH 2JB5H 3S6CA 5GS1B 5AZEH 4GAYB 4N8VG 2BHZA 2EKJA 3O8XA 3QIUB 2PW2B 3X13A 4F15B 3D39B 4X6EA 2ZCKL 1QA9A 2QADB 4ISVB 1CD8A 3AS2A 2FEDD 2YOCA 1I3VA 4J12A 2FX8L 4UV4H 3QIBB 2CJUH 4JDVB 4PJEE 5F9AC 3QZWB 1DQJB 2E7LA 1RVFH 3V6OA 3TVMD 2NMSA 2OP4H 1T21A 3NCEB 1Z2KA 3LS5L 3IRPX 5I75B 1KIPA 3MOBH 5DRXB 1GCFA 4K3DL 5KS9F 4GLRI 3LRSA 4FXKA 3HI6L 3EAKA 4IRSA 25C8L 3EOTH 2WLZA 1SM3L 3ROLA 4U0RC 4I18A 4MNQA 3MLTA 5ADPL 1K3IA 1BJ1J 4I9WE 1QR1B 3VXQB 3MRKB 4GMTL 2P8MA 3UZEA 2VAAB 5F9DC 1CR9L 1MFDL 5BRZE 1R6VA 3MLUH 1A6UH 3ULVD 1TVDA 1A7OL 1A7RH 3BFOA 2XQBL 3VXTA 4WY7L 1N0XL 2OI9C 4S1SH 4WGVB 2MKLC 2XA8L 4P2OC 4QTIH 5BV7B 3OAZK 1S8DB 2AAVA 5L7XL 1WFTA 1R3HA 3L3OA 3VRLF 3N0PB 2CDFB 3MRQA 4ZO6A 4U3CA 4Y89A 4KJQD 3VWKA 3CCHA 2XTLA 4YGVA 4LVHC 3OX8A 4HBQA 3O8XC 3GI9H 2HAZA 3TJEH 2J5LB 4OAWA 5BMFH 4KZEL 2IAND 2UWEB 2VLJA 3PWUB 1S9VA 1D9KD 4G5ZL 3K7UA 4H25A 5EBLA 1FNGA 1VFBA 4W6XB 1FAKT 2AGJL 5CD5C 5DQDH 2FIRT 3V7MA 3I85A 2E7LC 4UT9L 3V6OC 3V5KB 5I8OH 4FFZL 5ITBL 3RIFF 3K8LA 3QO0B 1INQB 5KANG 1LE5B 1TIUA 1YEJH 3RL1A 1KTLB 4IRSC 1B0WA 1C08A 4QOKA 4OCWH 3VFGL 3WUWB 2IADA 4I18C 1YEHL 1N4XH 1ORSB 2NY5C 2AQ3A 4Z5RB 4YHYC 1UYWH 5DR5H 5GGRY 3KHQA 1EVTC 2XY1A 4PRHD 4NNXB 4OF0A 4HWZA 4YHML 1MEXH 5CUSH 3VDCA 1N6QL 5IB2B 5IW1A 3A6OA 1A14H 2DF3A 3O2VH 1NBVH 5ICZB 2E3VA 2R69H 3SY0A 4HPYH 1P6FA 4XXDA 5E8OB 1TZHB 5FO7B 3VFPB 4JB9H 4ZOCA 2NY2D 3ULVE 4F7CA 4YEFA 3CAFA 4BYHA 3QPQD 4ZFFA 1F13A 4Y4FD 4AJ0A 5C71A 3QH3A 4Y16D 4L5FH 1KJ3L 4BA8A 1FE8H 4U1JB 3MRDA 3RTQC 3MXVH 1CIUA 1OAZH 4I3RL 4P4KD 5CJQH 4ZTOH 1NGWA 3IDXL 5T3XH 3DO7B 2DQJH 1M05A 1OLLA 2IANE 4DEPC 1WFOA 1S9WA 3HA0A 3KYOB 1AGBA 3EOAA 4APQD 2AABL 1PG7X 3A6BH 3MXWL 1MJ7H 3R0NA 1U42A 1CLCA 3PNWB 2IBZY 1BEYH 2X70B 2NY0C 1NUNB 4E42A 1WIPA 4NO3A 4U1NA 5EFIA 1A1NA 3UMTA 1C7SA 4PV9B 5F1IB 5GSVB 4GXUN 2AJ3B 2CLRB 2D03L 2IMNA 4HWNA 4IBLT 1QLEL 5F9OH 3M1BB 4I8DA 1CTOA 1OWRM 1AI1L 3MBXL 3ORJA 4UIMB 4PJCA 2CR6A 1U8NB 4NC0B 4MSWB 3V52H 1ADQA 1LVEA 2PYFA 3D3VD 1ZWIA 4LU5L 5JPNB 1D5BA 2XT1B 1CLOL 4M61B 3FOLB 4LVNB 4DVBB 4XAKD 2X89A 1NAMB 3P0VL 4OLZH 2XWBB 1MCPH 5KSVB 1BFVL 1KJMA 4JO1L 5IFAL 2DLEA 4UDUB 4MNHB 3UCRA 5IQ7L 4JRXE 1WC7A 3MLYL 3Q2CA 4ZNEA 2C1OA 5I71C 3LS4H 1JHKL 2EDKA 4HEME 3BDYH 4XVTL 2O93L 5FUCE 1NDGB 4M1GL 3ZE2F 2C7UB 3D85D 1DBML 3VWJB 5K9KA 2A6DB 4M62L 2VJXA 3VRJA 5CCKH 1KLGA 4IMLB 1X4YA 4YXLL 5BOPA 4XNXH 4HGMA 4DW2H 1IAIH 4PREB 1QSED 3DX8B 5BVPL 5IROA 2OTUB 3CSBA 4H1LB 4DCQB 5IK3A 2V17L 1XF1A 1JGDB 4YIQB 4P99A 3F58H 2V2XA 4I0PB 4JJHA 5TF1H 5DGQA 1W2KT 4Z77A 4LSRL 3GSVB 4X9FA 1S7SA 2QQKL 4L3CB 1ZGLA 5CD3B 2H2SC 4Z76A 5B8CA 1S78D 2NZ9D 1U41A 5HI5C 1VDGA 4HXBH 4TVPD 2W0KA 5MP6H 2VXUH 4PV8A 5I1EH 2I24N 2R1YB 1PD6A 3DVNA 4QWWC 1LD9A 1NEUA 1DDHA 4DK3A 5F7EH 5J4MA 5KJRL 1JNLH 4GRLB 4XAWH 1YN7A 3C9NA 4KAQH 1YYML 2YA0A 4PYHA 3PV7A 4CNIB 3WLWC 3PG2A 1EGJA 1KNOA 4XAKE 3NFNB 5C0CA 4RRPA 1F6LL 5JHLL 3VFNA 1KB5B 3GB7A 2WANA 4MXWL 5LGHL 1HWHB 5DI8A 4ALAL 4YDJB 3V6ZA 5EUOE 4PRIA 5KVMC 4WGWB 1HSBA 2GTWA 4H0IA 1FSKC 5EOCH 4XNYL 15C8H 5HD8D 2WUBL 1U95A 3NACL 4HPOH 1PEWA 2VLKA 1YEIL 1IAKB 2QSCH 1LNUA 4JJ5B 1EMTH 4PJBB 5C09A 5IROC 1BLNB 1PYWB 2B2XL 3L1OL 1B9ZA 4LLMA 4JAMA 2EDHA 1HQ4A 1QSEE 2EDTA 2NNAB 1F42A 4JLRA 4AIZA 4IHOB 1EXUB 1NCDL 4HHAB 3VE0A 1OTSC 1I8KA 1WFUA 1D5MA 5B3JE 5FFLA 2FR4B 1XH3B 2BCKA 5E56A 1JHLH 3U30B 4U1KA 2D0GA 3KPLA 1JK8B 3BN3B 5E8DH 4JY6A 4TVPE 4WJ5B 4U7SA 4EXKA 4P5TA 3PWLA 3NIGF 1IC5L 3TYGL 1FNFA 3T2OA 5F1NB 3F12A 2G75B 4PJAE 1SY6L 2XN9B 1WZ1L 5CJOL 4XT1C 3RWEB 2BP3A 1J0HA 2XZCL 4LCWD 3WMSA 4ZQKA 1FG2A 1G7JB 5DUMH 2R2BA 2AJZB 4XP4L 1M7IB 1S5HA 4OQTA 5LQBL 1IARB 3OG4B 5E99L 2AJYL 1ZTXH 2HKHH 5TE6L 3B43A 1OSZA 5TE7L 3LKSA 2HJKA 4HFWA 4XP6L 4BH8A 5DMKB 5DLMH 1G6RA 4MGXA 1JI2A 4P9HC 4XCNA 1OM3L 2WK2A 1U8LB 4K71C 5DJZB 2GAZA 1FO0L 9CGTA 1I7RA 4QXTB 3VFMA 1UQSB 3E2HB 43CAA 2EKSB 1K2DB 4DFIA 3WCYA 3ARGD 1R24B 2KH2B 3S35X 2C9AA 3Q6GL 3EJZD 1DQML 4N9GA 7FABH 4EUPH 4Z7WA 4EDWL 1KACB 2LV4A 4XZUB 1HOCA 1PW3A 4M4PA 3HZKB 3V0VA 3QEQD 4G80A 4AH2B 2VZ1A 2FX9H 2ESVD 3NABH 5GS2D 2EDFA 2L7JA 1BQLH 3O2WH 4GW5B 4NWUL 3H9SE 2NX5B 4NQTA 3ARTA 3IAGC 3WNOA 1J0YA 4LLUA 1L0XA 4PJGA 5JW4Q 1U2HA 4HWEH 4KROB 3RU8H 1PGRB 3NN8A 1HEZB 3DSNA 4PY8I 1TETL 3V5HB 1J8HB 3BKCH 2H2PC 5E9DB 4BFIA 4LCWE 1GIGL 4OV6F 2ZOKA 5AZ2L 4M8QB 3K2UL 2GCYA 2H9GA 3E6FA 3VXMB 4LHUB 4M6OL 3VFVA 2W65B 1KT2B 2VE6A 3D69A 3FQUA 5DEGA 1T0MA 2UZIL 4PGJA 5F3HA 4NQDA 1JF6A 2R39A 5HVHB 3E6HB 4ZSOE 1NMBH 3NCJL 5EO9B 2VMFA 2I60H 2CO7B 2DIJA 3FRPG 2GY7B 5IESL 4WIQA 4O2CA 3MQIA 3DTXA 2HKFL 4JFDB 2YC1A 5HYFA 5HHOD 1CDBA 3VD7A 2LU3A 5DC0A 4V2BA 3FT3A 1YMHA 4RFEA 1MUJB 1NL0L 1JL8A 3T09A 3QEQE 1G9NL 5KSAA 3LIZL 4MAYD 2ESVE 3WO3B 3W9EB 3OGOE 1KBGH 2LFGA 3QQ9D 1MHCA 3OXSB 5JMOC 2DYPD 2EICA 1DBAL 1ZHNA 3BHBB 5HBBA 4RCAA 5KW9H 3QFJA 4I2XB 3H7BA 3D0LA 1T80A 3RVUC 4NC1C 2ZP0T 5MERA 3UYPA 1OTUC 2DAVA 4OCYH 4A6YB 4XBPB 2PXYD 5D1QA 5C1MB 2FCBA 3RUGE 5IJVB 3VGAB 3QDMB 1UWEH 1H5BA 4HUUB 4Y2DD 2HMID 3RKDC 3RZCC 1QSFA 5BOZG 2OQJB 3GHEL 1IEAA 3U1SL 5C0ND 4I77H 3TO4B 4KUCD 3LEYL 5HGDB 1GVIA 5C0DB 5EU7E 3RVWD 1E0OB 2AEQL 4HSQA 4V1DA 4Y4KC 4ELME 2AK4B 2CKNA 2H1PH 1DBKH 3PGDA 4KQ3H 2VUOA 2PCPA 3LDBB 3VCLB 1PSKH 1GC1L 4TRPH 1CICD 3HNSH 2BNUB 4G9FB 4C83A 2WM0A 3BJLA 1ZHBB 3MR9A 1J1PL 2YPLE 3MV01 2Q86B 5DVKA 3INUL 3PQYB 4EN3C 3BPCA 2JJSC 4DKEL 2NW2A 3DURB 4GSDL 3RWCA 5HHOE 5HGBB 5EDXA 5I1DB 4FP8H 1SJEA 4R7DA 2XYCA 4NJ9H 1FYTA 4LKXB 1XGQB 3LN5A 1EEQA 1WZLA 3EYSL 3ARFD 2HJFB 3I50H 4HK3J 5C0JA 3ZKXC 2HLAA 5IB1B 1UKTA 4LCYB 1EHXA 2C1PB 1MPAL 5AUMA 4J1UB 5ID1B 1I1YA 1CDCA 1EGJH 4AENB 1MCHA 4JKPH 4U6VL 1J1OL 3MRCB 1H5BC 4DKFL 5CJXA 1Y0LA 3UTOA 4HIJB 4HAGA 4RIRA 1NCBH 3GIVB 2WIIA 3L3JA 4L4VB 4OF8A 5FXCH 3OKDA 4WU7B 4M9OA 4UTBL 1QNZL 3VW3L 3SCMD 2R4SL 5A2FA 4NQXB 5C8JB 2CPCA 3JV6B 1NCNA 5JXEC 2Z31B 4QCIA 3JTTB 3KLHC 2EIDA 2GUOB 1JFQH 3WEXB 4OD2B 4B41A 1IAOA 1FNEB 1N5AB 3C60D 5EB9A 3MLPA 1M71A 4DAGL 1HYRC 2PO6D 1MREL 4RWHA 1BREA 2DBJA 3FKUS 1VFAA 2A9ML 4YK4C 4U1GB 5F6HI 5JW5B 4CADA 5DVNA 1H3VA 3HE6A 2J4WH 5TE4H 1QOKA 1M1SA 3OJ2C 2CRYA 1OAKH 1MLCA 3RWFB 5GRZA 5KAQF 1NCWH 1BMGA 1OAUH 4WFGD 1CLYH 1CT8A 4KVNH 3KWWB 2WW8A 2EXYD 3J8F7 4LKCA 4OGYH 1XF4A 2VDPL 4LPCA 1S7XB 3OBAA 2DQHL 3VI3F 1PZ5A 5CJXC 2Z92A 2IG2L 4ORZC 4YE4L 2R2HB 3DIFA 1OSPH 1E4XL 2G2RA 1JZ6A 4P23B 1IC7L 1RIVH 3O0RL 2EECA 1HQRA 3FCTB 2F74B 1G6RH 2FYYB 3G9AB 3T0XA 2NY7L 5GGSB 1PKQE 2X4QA 3U4AA 3QWOB 2YK1L 2VZUA 3F7PC 2HH0L 5KTEL 3GSQA 4LEXH 4IRZL 1I9JH 3C5ZB 3ILPB 2AJSH 1N8ZA 2XTJB 3F62A 1OF2A 1LE9B 1L7TH 2BERA 5DUPL 4PG2A 1ZLSL 5KBNC 1C5DA 4UMGA 3ARXA 4NHUA 4B7LA 4HIIA 1AO7B 1D5IL 4FXGB 2GK0A 1R3IL 3O6MH 3QA3A 4U6HB 3DHMA 3W81A 1JPSL 2AV7A 4JN2A 2VC2H 4MA8H 5E8NA 2HRPH 5DHXB 1FVDB 4XPAH 3BMVA 3VD4A 4LIQH 4X8XA 3QUYC 1BAFL 1HHIA 1NKRA 2ENYA 1C8PA 1KPUB 1VEOA 3MFFB 3RVVC 3UJJH 3MLVL 4NNYA 4JY4B 4YBLC 3EFFB 3S4SA 4PJ7E 1SHMA 2HTLD 5IV2A 4WFGE 4Z7VB 4YDLC 1IEBA 1YPZB 2NPLX 1UM4H 4PJCF 1G0DA 5DHYA 1CD9B 4PS4L 1UXSA 2LVEA 4JKWA 3UTQA 1IQWH 4OCRH 1RHHB 2X4NA 3OB0H 4Z0XB 1P4IL 3WS3A 4OM1H 1ACYL 2NXYB 1G7IB 4AEHH 5LCVH 1T4KA 3FO0H 4GUPA 1NPUA 1L9MA 2R4RH 3HZMA 2CLVB 3CLFH 4EIGB 2RAMA 5LXGL 1CE6A 5F9JB 3QUZB 1G7QA 1MFEL 2YD1A 3V4PL 5AYUL 2OL3A 2DKMA 4W4OA 4YHKL 5HVFB 3TV3L 4D0CA 5HVWA 3BVNB 4R0LB 1R5WB 1V8HA 1FL6B 2FEEL 2BFVL 1C5CL 3ZKMC 3QI9B 4JQVA 3DBXA 4JHWL 3VXRD 3NBNA 3DRTB 4PJIA 2J8UF 3KPSB 4FZEL 1NC2D 3DOSA 1FL3A 1LP9B 4OZ4B 1KIQA 2H6PA 1SBSH 3TBSA 4J3UA 2FO4B 3CDCA 3RL2A 4LGPB 3I6GA 1CE1L 2OYPA 4QGYA 3U46B 4L8BB 2Z0BA 4K2UH 4FN0A 3MPCA 4PLNC 5I1AA 1K4CA 2WBWB 2VQUA 3GFUA 1LK3H 2CUMA 2BVPB 4MXVE 1RAMA 5IVXE 4KY1L 4JQXC 5J3HD 4TUJB 1RULH 3VH8B 1CXKA 3HRPA 1U8KB 5I8KH 3SE4A 2DJ4A 4JO2L 4QHUA 4IEFB 3IDMA 4N0UE 2OSLB 4XNZC 4ZUWA 3TCLA 4NN7B 4WDIA 1A4KB 1QFWH 1OPGH 4NFCA 5FM5M 2Z35A 2CRMA 3O11A 3OJVC 4WCYL 4MWFB 4JPVH 2FLRT 4N0YL 4PJFB 1MI5B 4WW1B 4YEEA 2NY3D 4RAVB 4DWHA 1JZ2A 1J05A 1TZGH 4NGHL 2PYEB 5ILTL 2F8VA 4UB0L 5D2NB 3KYKL 4GG6A 4GKZA 3PWPA 1NUGA 5DD3L 4W4OC 1KLFA 1X5ZA 5FB8A 1ITCA 4NM8L 5E94B 5FDWB 5K9OA 4JPKH 3MUZ1 4OI7A 4ZXBA 3PWVA 3I6KB 2G9HB 2GSIA 2BDNL 2BOBB 4PGDA 2YA1A 3IDNA 4LSQL 3K8MA 3PL6B 3D2UB 3VXRE 4XP5H 3V7AE 5HYEA 3DRQA 3IJYA 4MD4B 5B22A 1U93A 5DVLA 1A3QA 4WI6A 4Y5VB 3VU2A 3V6FA 4ENEC 4JR9L 4M1DH 4KTDH 3MREB 3ARDA 1GZQB 4N68A 1FN4A 3N1FC 4FFVC 4KJPC 4OZFA 4HWUA 4X99A 1NC4D 1BWMA 4KMQA 4QXWA 1Q9OB 3QUXB 2AJVH 4UBDC 3MFGB 4NQUA 4JRYB 1VADB 4M48H 2JB6A 3MA7B 3HB3C 2P5EA 4LVOC 5TGBA 5I66A 1XR8B 1J5OH 2EDXA 2MTPA 4NQSA 5GGRB 5D6CA 4OLVH 1RIHH 5E2TL 4UINL 1MCDA 1G7MA 4OD3L 3IDGA 5E2VL 3QEHB 4ZPTA 4ZXBC 1R3KA 2QR0A 1BVKA 3U4EB 4F9LA 2CXKA 2DQFA 3MLSL 5EH1A 5IEHB 4MMZC 2RIKA 5IBLD 3V7AG 5GZOC 2VL5B 1JV5B 4UI2A 5CMAB 1NGQL 5ESVA 2W07A 5C2UB 4FQLH 2O5XH 4Z7WF 5HI4D 1K8DA 3MX0A 4N8VB 4CMMB 4UQ3A 3DPBA 3AGVA 4YO0B 3ZHKA 4WFHD 3K74B 1P7HL 8CGTA 4YFLF 5ECJE 2OJEB 3QXDB 5MEPA 4YDKL 3OR6B 3BDXA 3UPRB 2E27L 1WEJL 3ARDC 1GGYA 2OR9H 3TH4T 3MODL 3VFUA 3BJ91 4JPIA 4PJGF 4RQQB 4XVJL 4KKBD 5IT2H 2C4FU 5FKPB 5FM5O 4WNQB 1AIFA 4LHQB 4XWOD 1JPFB 5I0ZA 1HSAB 4XTRC 3G5XA 2X7LB 3CXHK 3MGOA 1INEH 1WBYA 3KPOA 4Q9RH 3FQXB 1DEEB 1R3JB 1V3MA 5IB4B 2NY4C 3CFJB 4DFHA 2YSSA 5CSZB 1Q9KB 1CFNA 5DMGD 5F7KC 4PJEA 5C6TH 2LU4A 1AJ7L 2D31B 2P24A 3KPRB 3WIHL 3VGBA 3BZDA 3NA4A 3VMOA 5DQJB 3JWDC 5CP7A 3SDXE 4LQ1A 2ED8A 4XGZA 1P69B 4NHCL 1BOYA 3B5HA 2OTWA 2NLJB 1VACB 2ZCHL 2OJZL 4YWGH 3SKNA 5L8JB 1RZKL 3ME0A 1WQVT 4X4ZA 4CVXB 1A47A 1NFIA 2ATPA 2VLLA 1YNKH 1TQCB 1X5IA 4LLDB 4MJ6A 5DRWB 3IVKA 3NZHL 4WV1B 4CU8A 1MSPA 1YY8A 5ACZB 1KJ2A 4WFHE 3DGCR 5HGAB 5CEXA 3GIZL 3WFEH 4JCMA 1E4WL 3DHJA 4FMKA 5C6PB 3DX9A 5KVEL 3LPGA 4Z7NF 5C0AE 3BZEA 3ZTJG 3DX6A 3BN9C 4OZIE 2A9NH 2X4SB 4P57A 3HNVH 4M00A 1T1XB 3TN0D 2AK1L 1XZ0A 4BZ2L 2H3NA 1YMMD 5D1XB 1S9XA 1REIA 3BESR 5BRZB 3O6KH 3BPNC 3ZYOA 2Q8AH 3DNKA 5GRXG 3WFDL 1A22B 5TFSL 2DQIH 5CHNA 1QBMH 1RUAH 2JB5L 2OL3H 4L29A 5AZEL 3BX7C 2BVOB 4LPWA 4GAYA 2NXZB 1DQDH 2P43B 1FZMB 3UPCA 2V7HB 4HMCA 3QIUA 2ICWB 3VXPB 4Z0BH 2FHCA 4OLYH 4ZG1A 1KCKA 5IVOA 3L5XH 3H3BC 4KHTH 4UV4L 5E8EA 2CJUL 3PDGA 4ZO8A 5D71H 1RVFL 3QIBA 3BD3A 2OP4L 1DQJA 5F93C 3HPJA 3MOBL 5FV1L 2QL1A 1A9BA 1QPXA 3QBTB 4S2SA 1AP2B 3X14A 4IOSD 1NAKH 3AU1B 3EHBC 4Z7OF 4R97B 3TGXA 1S3KH 4NC2B 1QR1A 2AEPH 5L0QB 3MRMA 1HINH 4PJXB 4MZ3A 5LVEA 4XX1E 1RZJH 5DK3A 3HG1E 4PJDB 4RDQG 3MLUL 1A6UL 1F90H 2X4UA 3S8WA 1LO5A 3QUMH 4KJYA 4OFVA 3TNNA 5GJSH 4PJ9D 2HVKB 1A7RL 4ODUB 5EIQA 3HNTH 2ARJA 1I8IB 5D1ZA 3D25B 2YD2A 1X6NA 1YMME 4S1SL 2BNQB 4QTIL 3V95A 1S8DA 4FQHA 3QAZC 2MPAH 5FECB 5GGUB 5L6YL 5GS1C 1AC0A 5SWQB 1YY9D 2V9RA 4HUNB 2XQYK 2X9XA 3TJEL 4HULB 5BMFL 3QIUC 1WCBB 1IAMA 3T3PF 2UWEA 2VNCA 1T7ZA 3PWUA 2E9BA 3MUJA 2QADC 1B0RA 2GSGB 3U7YH 4X7TB 4HGWA 3MV11 5DQDL 5IHBA 5D93B 3QIBC 5I8OL 2IANB 4R7NA 3ES6B 3CFIC 2FHBA 5I75C 1YEJL 2ZUQB 2EIEA 5GRVL 1LE5A 4OCWL 1A4JB 4G8IB 1KTLA 4X5LA 1N4XL 3WUWA 1RK1A 4ELKB 3KNBB 3T77A 4QRRE 4P9ML 1G0XA 1UYWL 1ORSA 3BW9B 5DR5L 4XX1G 3QT2A 2Z8VC 4OZFH 2P44B 1MEXL 5I9QB 1GZPB 2DBLH 4NNXA 3HS0A 4JRXA 5CUSL 1Q9WB 5AAMA 4NFDA 1A14L 3DGGA 3O2VL 1NBVL 1FPTH 3OKMB 4G8GD 5KANI 2R69L 3QB7C 4HPYL 4YPGA 4JB9L 3O45A 1AR1D 1KXTB 4PRHB 5D1ZC 5FO7A 1U8JA 3RJQB 2ZSWA 4NKDA 2MWCA 1IVLA 3EFDL 2W9LA 3T0ED 4XVSH 5BV7C 3IXAB 4L5FL 3WFCH 3LN4A 3TNMA 1FE8L 1MWAB 3C2AH 1MFCH 1T2XA 2NY2B 2YA2A 2OZ4A 3MXVL 1L0QA 1OAZL 4G43A 2X4TB 4ZTOL 5T3XL 2WQ8A 2DQJL 3GMNA 4Y4FB 3DO7A 1WLHA 4Y16B 3F5WB 3U79A 2ICWI 2VO5A 3FN9A 5AD0B 1YYLH 4TN9A 3A6BL 1SQ2N 1MJ7L 1JWSA 4P4KB 4D8PA 3MRBA 4CN6A 4P2RA 1ZLUK 3HAEA 4KPHH 5SV3A 1R5VB 3VD5A 5J1TC 3RX5A 3G5YA 5F7LB 2CKBA 4APQB 3GI8H 5F9OL 5F1IA 3CDGB 6CGTA 2AJ3A 4NKOA 1NFDA 1R3LB 3M1BA 5EU5B 2EH8H 1INDH 3OKLA 4QRUB 3O6FD 3V52L 3CU1A 5I1JL 4F58H 4L3AA 3SKJH 4MNGE 5EUOA 4TTDC 4ODSH 5JPNA 4M61A 4G8GE 2I9TB 3VG0L 1S7VB 5CBEB 2WWMD 2ITDA 1LO4H 4KDWA 1AGEB 4DVBA 4OLZL 5IHZA 3PWNB 1MCPL 1TVHB 5I8CA 2AV1B 4MD5A 3TYFB 4KTEH 2XWBA 1OT1A 3LRGA 2ERJB 3D3VB 3O6LH 1QEWA 3OB0K 3LS4L 2BVQB 5CLWA 4ZFOL 4ZTPH 3BDYL 4QF1A 1YNLH 3FO2B 1JTPA 4GRWE 3Q0HA 5TDOB 5BS0E 3MJ7B 2P7TB 1QRND 2C7UA 1YEFH 1ZKAA 3LQAH 5DO2C 5CCKL 1P1ZB 3I02B 2P5WD 4HKJA 5C0RH 5IMKB 1KYOK 3IGAB 4XNXL 2NYYC 4K7FB 5D96B 4IMLA 4DW2L 4ZYKA 1D7FA 4Y19D 1IAIL 4AEIL 3GSOA 4HV8B 5DJYA 3DX8A 4JHAH 3WIFB 3FT4A 1HE7A 4H1LA 3SGKA 4PRBB 5FK9A 4DCQA 3F58L 3ULUC 3U6RA 2A74B 1JGDA 4YIQA 5TF1L 1XGRB 4XC3H 1ZVSB 4PJIF 4JE4B 2HWZH 7CGTA 5KS9E 4GAFB 3CSGA 5TJWK 4F3FB 5J9PB 1UXWB 5LKNA 3CZJA 1QVOB 3HE7A 4HXBL 5GRYA 1WF5A 1I3RA 2A6JB 1U3HD 5EU4B 5MP6L 2VXUL 2JELH 4UILH 5I1EL 1EH9A 1MLBB 4HLZG 5I0DA 5EU3A 4Z7QF 2WBJD 2R1YA 4L4TD 4XAWL 2NY6B 3RWHA 2OS7A 4KAQL 4LVNC 1UM6L 4Y4HD 2VDMH 1MFBH 4CNIA 4LNVA 3HRZA 3MRPA 5I6XB 5DURD 5GGQH 1UJ3B 5J6HB 1MF2H 4BUGA 1BPVA 2JCCB 4F7EA 1VFMA 2E9IA 3M07A 4MD0A 4PJAB 3KDMB 5HDBE 3ILQD 4G6FB 3PGCB 3W82A 3WNPA 3VRLE 2KQMA 1OQOA 2FGZA 5EOCL 4ZS6D 2VDRH 1NBZB 4JN1H 15C8L 5SWZD 5EOTA 4QRTB 3NCMA 2QSCL 4DOHB 4WUUD 3RDTD 1EMTL 4MDIB 3P4OB 2P5WE 5IB5B 4GG6F 3I3DA 4JJ5A 3LKQB 1UZ8B 4LPVA 3H9SA 2AVGA 4Y19E 2J6EA 2IF7A 1BLNA 1PYWA 1A6WH 4HS3B 4NQEB 5F7WC 1KTDA 2NNAA 3LMJH 4WFED 4IHOA 4I0PC 1W0WA 2UVEA 1EXUA 2DB8A 2R9HC 3NFPB 2C3HA 4BELD 1JHLL 2ADIB 1ZLWK 1AD9B 3HE7C 3AM8C 1Y18B 1P2CA 1KSRA 3AREA 3PF2A 3UBXI 1GGBL 3QRGH 1HH6B 4NT6B 4OCSH 5EUKA 4LOUC 4U1LB 1GGIH 4GRLC 5I15H 4JEGB 4Y1AE 4L4TE 3KS0J 5K9QI 4DUWA 4OFIA 5DS8A 5DUML 4TYUA 4POZD 1JNHB 4NQCA 1G7JA 3EGSB 3HUJB 3DYPA 4MAUH 4M6NH 1ZTXL 2HKHL 1IM3A 4GS7B 5DLML 4ZUTB 1CTNA 3X12A 4LCWB 4AM0B 5KSUA 1MHEA 3T8XA 1F4YH 5DMKA 2AKRA 4MJID 3DWTA 3GRWA 5SWZE 3EYVA 4LCCB 4MCZA 4ERSH 4LCIH 5HHXH 4WUUE 1MCJA 4I5BA 3MROB 7FABL 4IS6A 2B7DT 3C6LD 1TZIB 4ZSOB 1E4KC 1XF2B 1I8LC 4WFEE 3HZKA 3IT8D 3NABL 2D4DA 3ARGB 3U30C 1NDMA 1BQLL 3GUTB 3O2WL 3C5JA 2VSCA 1XGTA 5CJ5A 2K7QA 3QEQB 3WDIA 4HWEL 3RGVA 2ESVB 1DEDA 1D6EB 4FQJH 1UT9A 1TTGA 2GYSA 1SMOA 1GSMA 3B2UD 3BKCL 1J12A 3MV8D 2EE9A 2BX5A 1J8HA 3KYNB 3SKMA 1R0AH 1SEBA 2RFXA 5J1AB 4UV7H 2OZ4H 2Y36L 4XCEA 5GGTA 2YPLA 1TJGH 3RY6C 4RAHA 4LHUA 1B6UA 1KT2A 3TM6A 4EZMA 5C0IA 1EO8H 3ZE2E 3F7RA 1KCSH 4H8WH 1Q1JH 3MA9H 4OLUH 4PRPD 1DL7H 1JPTH 5FHAH 4OF7A 1NMBL 3SDDA 3E2HC 1T3FA 2IMMA 3QWRD 3B5TA 4PJEF 4ACPA 3P77A 4Y5XB 2I60L 1KG0A 4LHJB 3SGEH 4IOIB 3S96B 2YD5A 2EC8A 1ORQB 1A0QH 5JPMB 4JFDA 5CS7A 2CKBH 4L1HA 3T4AB 5GXBB 3OG6B 1KFAH 1E6OL 2JJVA 3BEVB 4JFHD 2CH8A 5FO8B 3OZ9H 3U0WH 1WISA 4I48A 4X0KB 2KDGA 1KBGL 2CIIB 1ES0A 3M17B 1MY5A 4OJFH 4JG0H 4D0BB 5FCSH 5E1HB 5KW9L 3MRHB 1V3LA 5IF0B 5DD6B 3UTTE 4N5EC 4MAYB 3TT1H 4OCYL 5JR1H 2L0DA 4ONFH 3MMEB 4A6YA 4RAUB 4P2QA 4NFBA 4XBPA 2XOTA 4HJ0D 4ONOA 2DYPB 2ENSA 3MV8E 1Z6JT 2MQ3A 3QDMA 2GJZA 2Y25A 1A1MB 2YD4A 1OGAD 2V7NB 1OWWA 3GJFB 3AXLA 5D6DA 1FVEB 4YDVA 5IMLB 2VQTA 2R0WH 4I77L 4NO5A 2PXYB 5F8QC 5JDSA 1XF5B 3TO4A 1Z9MA 4Y2DB 4QRPE 3H7LA 5C0DA 1DBKL 3JWOC 1IKFH 4KQ3L 3SDCA 1FQ9C 4OFYA 1C7TA 1F3RB 1PSKL 5HVHC 5JW3H 3QULA 4PRPE 3VCLA 4TRPL 3BGMB 3HNSL 3PDDA 2WMPA 3CMGA 3I9GL 4M6AA 5DRZB 4TVPH 3QNYB 2J8HA 3IFNH 3BP7A 3S3SA 1NCAL 2VABA 5AG9A 3QP3A 3QG7H 3DURA 4RGND 5CSGA 1FCGA 4OCLC 1J9CT 1CFSB 1CICB 4NJ9L 3GGWA 4JFHE 4LKXA 3I50L 4OQ1A 4PLJC 1P4BH 5A16B 5F7HA 3GSNA 4KC3B 5T1MA 3MLXH 3B9KD 4LCYA 1FZJB 1EFXB 2ZG1A 4JM2A 3M45A 4U1IB 3NIGE 4XB7A 4X6DB 3ARFB 1EGJL 5ID1A 4JKPL 1IGMH 3CC5B 2ORBH 3VGAC 4M43H 3O3DB 3TZVD 1XIWD 4F7PB 1CL7I 5D6DC 1UEMA 1NCBL 1OGAE 3NIFF 3MBEB 3CUPB 3DV6B 3ZDZF 4WU7A 1WIOA 3TO4C 2YEZA 5FGSA 4NQXA 5C8JA 3HC3H 3GSRA 1JFQL 5AAWA 1ZA3B 1H3PL 3BH9A 1C1EH 2GUOA 4FQCH 3LDBC 3WEXA 4MS8C 1FNEA 4Y88A 2H45A 5LGJB 5F96H 1PKQB 1N5AA 2J6EH 1UZ6F 4NDMA 5DJ6B 1KCUH 4PJ7A 2UWEF 4PJ5D 4KRLB 4BK4A 3GEWB 1B6DA 5C07E 3C60B 4RGNE 4PB0H 4TSBH 2D9CA 5TE4L 5IMMA 1OAKL 3QNXB 1OVZA 5L88H 2OK0L 1Z9SA 3W11C 1EA9C 3MJ8B 1NCWL 3LD8B 2FB4H 4HDIA 1OAUL 1KELH 3GMOB 3NA9H 3FZUD 2AXHA 4KVNL 4LNRB 5E4IA 1LO2H 5ID0B 5JW4M 4OGYL 3RPKA 1NEZA 2ZPKH 4RFNB 2NCMA 1CQYA 2QSQA 4CGTA 1BOGB 3PP4L 5DC4B 4LSPH 4JZJA 2QBWA 4OI9A 4O2EB 1VKXA 3TO2A 1OSPL 3O3UN 4X7SH 1YDPB 3JXAA 3TPUB 2ICEA 2BVEA 3VFOA 1RIVL 4ZOAA 4P23A 1G6RL 4HQQH 5GHWH 4PY7B 1VCAA 5GGSA 2DIAA 3QWOA 4KHXL 3CZFB 3WNKA 4LEXL 1I9JL 4P2OD 1URLA 1CIDA 2AJSL 2YD7A 4MQSB 3G5VB 5E8PA 3ILPA 1L7TL 1LE9A 5JLZB 3D5OF 3O8XD 4KI5C 5H35A 3PIQA 3O6ML 5AG8A 4FXGA 5DA4A 3BPOB 3RZWA 2VC2L 2HRPL 3L7FB 3PDOB 4U1GC 3HI6H 3NPSB 4XPAL 1VHPA 4GW1B 25C8H 4KKNA 2YRZA 3VMNA 4LIQL 4JFOA 4JPWH 4WU5A 4AQOA 2GFBA 1KPUA 4XVUC 1C12B 3ULUF 1MCWM 2XWJB 3EFFA 1CR9H 1ZHKB 3L3DB 3U9PH 1G9MH 1ONQB 1WAAA 4IRSD 1NFDF 5JUEL 4HH9B 2WZPD 1UM4L 4L3EA 4J23A 2XQBH 1X3DA 5KZCB 4XC1L 1NH6A 1GRWA 4GT7A 2HFGH 5EIIB 5JO5B 5FGCE 1IQWL 2KPNA 4OCRL 5EUOF 1CXLA 2XA8H 2E7CA 1P53A 1TJIH 2XA3A 5JQ6H 5BXFB 3EW3B 3JWNC 3I6LD 4OM1L 1XMWA 4P23C 1NQBA 1F3JA 1FNLA 4AEHL 3MCKB 1CVRA 1P4LB 5LCVL 4NRYA 3KVQA 1A9EB 2IGFH 3FO0L 5IVXB 5F6IB 1ZT7B 3QO1B 1ZA6B 2YS4A 4NSKB 2R4RL 1MCBA 3WDJA 5J7CC 4OLXH 2O26U 2CLVA 3CLFL 1UA6H 3CVHH 2XTJC 3HKFA 3VWKD 4MJ5B 4XNMB 5F9JA 1Q0YH 3QUZA 3ZTNH 4YXHH 2CD0A 4XCYB 5GPRA 1E28A 1UB5B 4EDXB 4FQQB 1S9YB 3BYYA 4LLAA 1OCWH 2VLJD 3RIAF 3R0MA 3WSQH 1U92B 2XPGB 3LKNB 1IL1B 3ZYIA 3VXUA 4CW1B 4LEOA 3MNWB 1ZLVH 4HUXB 1P84K 4AK1A 1QQDB 4K3GA 4KKAD 4LPTA 5DK2B 3ARPA 1SBSL 4OZ4A 1EEYB 4RA3A 3V6OE 2R1XB 2X1PA 5C3TA 3MTRA 4QOKD 1FO0B 1IE5A 4RFOH 1SJHB 3CMOH 2NW3A 3S37H 1NC2B 1QSZA 4K2UL 4ONHB 4PR5B 5EO0A 1VGKA 2M1KA 3MGAA 2FRGP 4R4ND 3U46A 4WTXA 3WO4C 4L8BA 5INDB 1JZ4A 5HYJA 4MNQE 3W39A 2R8SH 5EO1B 1LK3L 1HHJA 4P46A 1T1WB 3FQRB 1RULL 4JREB 1RY7B 4TUJA 3PABA 4ZMAT 5I8KL 5LAXB 2NXYC 4ETQA 4X5WA 1YEEH 2FJFB 3O3EA 1QFWL 1OPGL 5K33A 5HGGS 1M7DB 1EDQA 3U4BH 4OFKA 1W0YT 3L7EB 4MWFA 2WQRA 3CVIH 4KU1A 4PJFA 3L6FB 3GMRB 1TZGL 1MI5A 5GIRB 4AG4H 3QUZC 4RAVA 3T1FB 2HFFB 5FA4A 2BVTA 2Z93B 1N7MH 4G9DB 3UAJD 4JPKL 5FDWA 4R0LC 2VR5A 2JLLA 3ALPA 3R06B 4ZPVB 3QI9C 4OZGB 2NY3B 2HFEB 2H8PB 1JGVL 4KK6C 2DQGL 2Q3AA 4XP5L 1G1YA 2UYLB 1CQKA 4H26B 3GSNH 2GITB 4OF6A 3QQ3B 3UPAA 1WWWX 3AUVA 2M26A 3U0PB 5I2IB 1EBAA 1JGEB 4NJAH 4Y5VA 3UDWA 4X6CA 1AXTH 1QZ1A 1KPRB 2W0LA 4M1DL 4GFTB 3TC9A 3FOMB 4KTDL 5F88A 4ZODA 2H2SD 3P0VH 4MVBC 4XCCH 3BAEH 2A6KB 1QG3A 2R2EB 3VI3E 4WI8A 4JO3H 4J4PC 5DF0A 2AJVL 2E5EA 3QUXA 4I13B 2EZ0D 4JRYA 4M48L 2X89D 5TQ0H 3R8BB 2W9EH 1VADA 5H8DA 3QIWB 2BRQA 4E41E 3LPWA 3LSOB 1J5OL 1NC4B 4J6RH 4OLVL 6FABH 3HMWH 1H3TA 4TQEL 4KGLA 1RIHL 4PGBB 3Q5TA 1MJJA 2FLBT 2ADJA 1IGIH 5C7XH 2F5AH 2V2WB 1YEKH 1PEZA 2HYMA 4PTUB 4P5KB 1KUMA 3IFOB 4R8WH 3WYRA 2X05A 3U4EA 1IGJA 5IEHA 1HK6A 3X17A 1W72A 1E6JH 3PL6C 4O51B 4FQLL 2O5XL 1T89C 5C0AA 1MCCA 5CIPH 4EUPG 4M5ZH 3SDXB 3MNZB 5DC9B 4N8VA 3UX9B 3Q3GB 4Y5VC 1D5XB 3UDWC 1GAFH 1YUHB 4I3GA 3OKYA 5CEZL 3QXDA 1HXMA 3OR6A 2E6JA 3T0DA 3UPRA 4S0SD 1CG9B 2OR9L 4PJCE 2X44D 5F1SA 5IT2L 2YPKB 2X2YA 4MXWH 2DI8A 1FZKB 5CWSB 2FIKB 2MCPH 32C2B 3QUXC 2C4FT 4OUOA 5FKPA 4JGJA 4FXLA 1JPFA 4R3SA 1INEL 2PW1B 1HSAA 1T03H 5C0CD 4Q9RL 4Q97A 1N2RB 4WWID 3KAAA 4N1CA 2A0LD 3WD5H 1EO7A 5IB4A 5C70A 3QUKA 12E8H 4ZNEE 1I9IH 1P7KA 4U3XA 1FGVH 4JZOB 1V3JA 3IF1B 3OQ3B 5C6TL 3TBTB 4QKXB 3DLQR 4LQFH 1H0DB 1QRKA 2BSED 3V8OA 4AIXA 1RZ7H 2R23A 2VLKD 3CSYB 1X5GA 5C09D 2NLJA 4YWGL 3FJTA 3WHXA 3S98A 1FVCB 2K3TA 1YNKL 3FO9A 4CVXA 4LLDA 5DRWA 2Y23A 3HG1A 1DE4A 5BZDA 5ELIA 5T5FH 4WV1A 1J0KA 1FL5A 3NCBB 4HS8L 4NZDA 1BZ7B 4BSWB 1XGYL 1XCTA 2ADFL 2X1OA 1WZ1H 3WFEL 3TBYA 3VFWB 3X11A 1X4ZA 4LRIA 4MA7H 3EDKA 3OAYK 1CGUA 3GO1H 3SGDI 2ZOLB 1Q8MA 3HLAB 4P5TD 2A9NL 3QG6B 5CP3A 2CK0L 1U6AH 2WNGA 4EI5A 1W8NA 5D5MA 2FNBA 5IQ9A 1T1XA 3KPNB 5EBWB 1QP1A 3A0OA 3F6IA 4PLOB 2K7PA 4LAQH 5FKAA 1WSST 3FHAA 5C0CE 3O6KL 1S7TB 1NGZB 5J57B 2Q8AL 3VFTB 3TN0B 4U7MA 4JM4H 2FATH 2DQIL 1QBML 1RUAL 3OHXB 5E24E 2OL3L 3T65A 4PRIE 5HHQB 1P9MA 1II4E 1YMMB 3T4YA 1DQDL 3EDDA 4ODTH 5J56B 4GRMA 2CIKB 2V7HA 4Z0BL 4OLYL 1DQQB 2VLKE 4QRRA 5HGHB 3L5XL 4KHTL 3W0WE 4X7DC 4LMQE 1TPXC 3NZ8B 4JY5H 4OKVB 2VISB 1WICA 5D71L 1TQCC 4MB4A 4WV1C 4X4YB 3O3AA 3EBAA 3H9HA 3U82B 1WTGT 2FWOB 3IDJA 5FYKU 4M1CC 1BECA 5J89A 1AP2A 1J1XH 3SO3B 3EYFA 1NAKL 1AGFB 1A2YB 3IKCB 1MNUL 1S3KL 3F7YA 1NCTA 3L3IB 4HX1A 5HPOA 1HINL 1F4AA 2F54A 1RZJL 2Q8BH 4PJXA 4JM2F 1NBQA 4NO2B 4DZBA 4LSUH 1F90L 3SKUD 3CK0H 1UWGH 3RVUD 5GJSL 5MEOB 4RRPG 3HNTL 1DLHB 1X4XA 1I8IA 2CMRH 1U58B 4QT5B 3RKDD 2BNQA 4MZ2A 2YRPA 4NKQB 3MV7A 3DV4B 3NCJH 4GBXA 2MPAL 1OP5H 3PXJA 4PJ9B 2EXWD 1G7LA 4F33B 1T1YB 4KK5C 2C4XA 1P9MC 1U8PB 3ZKSD 5EC1A 2MHAB 3MRNB 1XCQA 3BUYA 5C2BH 1FHGA 2NXZC 5D8JH 1A6TA 5HYQB 4NQDD 3GSUA 1UG9A 1BZ9B 1DP0A 2Y5TA 3U7YL 1BWWA 1HZHH 3CSPA 4HG4K 3QJHA 4X7TA 2XG5A 3JBG7 1HHGB 3WNNA 3N85H 4PJ7F 5F7DB 1VEMA 5JHDB 3BRGC 5E6ZA 4Z7WE 1BX2B 4LLQA 2H32H 5B4MC 1T7XA 1QLRA 5HY9A 2X4OB 3G5ZB 2ED7A 3DARA 2FEDC 2B5IB 1AHWA 5KSAD 4U05A 5HYSG 1S7QA 3REWB 3QNZB 4U2ZA 4FFYH 3BW9A 4R97C 1T20B 2D7TH 1LMKA 2DBLL 3G08B 4L8CB 3TESA 4JFXB 4PY8J 4YBQC 3QFJD 3GHEH 1FPTL 5BJTA 3FB6A 4PJGE 1FORH 3OKMA 1VERA 1FFNB 3ZT7A 5BS0A 5L8KB 4NC1E 5D1QD 3IJHB 3L95B 2F15A 4PRHA 4MNGB 2XIDA 1QSFD 4L4JA 4XVSL 1K85A 1RFDH 3WFCL 4HIEB 2RJMA 4MA1B 1JGUL 1XF3B 3ULVC 3C2AL 1MFCL 3ARVA 4X8JA 5ALBH 3OKKB 4V1DD 2IH3B 5ETUB 3JWDL 3T0EB 4DN3H 3KLHD 3VRIB 4YC2B 5EC2A 1W72H 5IG7B 4XCFH 4KJQC 1HHKA 3KHOA 5D93C 5DD5H 1F97A 2V9TA 5FOBB 1CZ8H 4KPHL 3WXWH 5I1LA 2F53A 1L7IH 2ZUQC 2VERN 3WIIH 5T1KB 1R5VA 3GI8L 1MPAH 2BSSB 4MJ4A 4X5XB 2R15A 3S34H 1FYTD 5C0GA 2JIXA 1TTUA 3LZFH 3DROA 4U6VH 2EH8L 2W38A 1INDL 2CUIA 5I9QC 4F58L 1FNHA 2Z8WC 2VITB 1DLFH 3AS1A 3CIQA 3BWAA 3KYAA 3SKJL 3UBXA 4Z7NE 4ODSL 3ZDXF 5HJ3B 5KS9B 4F7TA 1RZIA 1BZQK 4UTBH 1N6UA 3B6SB 43C9B 1LO4L 2I9TA 1BFOB 1S7VA 1A1OB 1A6AB 1I85A 1AGDA 1TVBB 3O6FB 2O5YH 4KTEL 1TVHA 5D7KD 3O6LL 4L9LB 4X7EC 3TYFA 5DDHB 1U8IA 2E9JA 3CFKA 4RMTA 1J11A 4ZTPL 3VFSB 4M9PA 2BVQA 1LDPH 4A2LA 1YNLL 2YWYA 4DAGH 3E3QC 3SE3A 4OUUB 2HA1A 1MREH 5TDOA 4U1MB 4NUJA 5HDQH 4XMLH 1YEFL 4V1DE 4JFYB 4XB8A 4Y16C 4NN5B 1P5VA 5C0RL 1P1ZA 5KOVC 5ICXB 4Y8AA 3STZB 3AY4A 4X7FC 3SPVB 2XKUA 4K7FA 3FFDA 4UQ2A 4P4KC 2ICES 2D7PA 3ISWA 1QRNB 4WO4D 4WI7A 1RJZB 4MCYB 3U36B 4DVRH 2P5WB 4PRBA 4Z8FH 5IKCB 4XC3L 4Y1AA 3D0VB 1IQDA 1XGRA 2XZAH 2HWZL 2EDNA 3HE6D 4Y19B 1ZLVK 2G5BA 1FYTE 4F3FA 5J9PA 5DJDB 5FA3A 5SWSA 4NRXB 3F65A 1F02I 2JELL 4WTZA 5DZOA 4Z7OE 3QEUB 5CGYD 3GMMA 5EU4A 4ODXA 4K7PL 4ZDHA 3WJLC 1MLBA 4HIXH 2Q20A 1E4XH 4G8EB 2FEEI 2MQ0A 3RWJA 3BKYH 2GTZB 3O41A 3O0RH 4F8QA 4YQXH 4L9DA 5CEZD 4HWBA 2JJWA 4K3JH 2VDML 1MFBL 1MFNA 4GAGH 4K3HA 2DQTH 2LE9A 1MF2L 2WBJB 1YNTB 3NPZB 4D2NA 5D7KE 4L4TB 1AGCA 2JCCA 2FX7H 5JOFB 2W1NA 5EORH 3SE3C 4PBWD 5MHSD 1N3NB 4JDZA 1O7SA 3BP6A 5IWLC 3AVEA 1I7TB 2R29H 5IOPA 2VDRL 4JN1L 4HUVB 3BPLB 1ND0B 5DURB 3PP3H 4Q6YA 1NBZA 4PJFF 3K8KA 4WHCA 5CFHA 4QRTA 3AY4C 3T3PE 5ESQA 2AS5M 1J87A 5CZXC 4MDIA 5D96C 3P4OA 4P3DA 3BIKB 3LKQA 4XNUH 1UZ8A 5SWZB 5F6HJ 1A6WL 3SDAB 1AD0A 3LMJL 4HS3A 1DVFA 4NQEA 3BYTA 4GJTB 1MH5B 1NSNH 4WUUB 3S36H 3ZKMD 3EOBB 3RHWK 3EO0B 3QSKB 3BP5A 2XWTB 3W2DH 2PUQT 4JFQB 3KPQB 3KPMB 2ADIA 3NTCH 3P30H 2V5TA 1DANU 1ZT1A 2GJJA 5I1HH 3FQWB 1JN6B 2Q76A 1WZMA 2IH1B 3QRGL 3UTSB 2PN5A 1GGIL 4X6CF 5I15L 2NY6C 3JTSB 1ACYH 5E0QA 2DLFH 1D5ZA 1VFOA 5FGRA 3K0WA 4LK4A 5CEZE 1XGPA 4JANB 2F19H 3CGTA 3P73B 5I6XC 5J11B 1EJOH 2F8OA 4OGXH 4MAUL 4PTTA 4M6NL 3VJ6B 1NJ9B 2XXCB 1RK0B 3HC0B 4FHBD 5GISH 5MHSE 5C0FA 3RA7H 4R9HA 1F4YL 4ZUTA 4FNLH 5FUOH 4ERSL 4LCIL 1CGWA 5HHXL 2Q6WB 1A6ZA 2G5RA 1XR9B 2CDEB 1OHQA 4KRPD 4HFUH 4KV5E 3WFZA 3H3KA 1RD6A 2WIMA 4DN4H 4N8CH 4AT6B 4GAJH 1DFBH 4MJIB 3EO1B 5HD8C 5E2JA 5JNYA 3MROA 4QXUH 3CFBA 3VFRA 1BGXH 5I18H 5IIEB 1I3GH 4U4BA 1KB9K 4LLWB 3UTTA 4IOFC 5DEFB 1T5WA 4KVCH 3S5LA 4F2MB 4M7ZC 4NM4H 4POYA 1VFUA 2I5YH 3GUTA 3C6LB 4QRQA 5CEYB 5C9KA 2A38A 4K94H 3U0TB 5DK0B 1LEIA 1VSCA 3L9RA 4GRWH 5F89B 2GQHA 2FJGB 4FQJL 3FRUB 4HKBB 5FGBA 1D6EA 1T7VA 4MHHG 4QRPA 2P49B 4O02H 1I1AD 1NBYB 4RISH 5FF6A 4WENB 1CS6A 2Q7YB 4F80A 4N0YH 4KJPD 3KYNA 1R0AL 4UV7L 3L3HA 2OZ4L 5C92A 4FQ1H 4UBDD 1ZT4A 3RI5F 1TJGL 5DD3H 3MV8B 4GS7C 3EYUH 3BXNA 4PGCA 3MO1B 4YFEA 4LASH 1EO8L 3HB3D 1UC6A 2DWDB 1B0GB 1KCSL 4H8WL 1Q1JL 5DHVA 3MA9L 1DL7L 1JPTL 5FHAL 1FLRH 2BDNH 3FQTA 2I9LB 3LV3A 2ARJQ 3GSXB 3PWPD 2COQA 3VGDA 2AEWA 3S96A 2LQRA 2VH5H 4FABH 1EO5A 1A0QL 3ULUL 4ZXBD 3BKJH 4EI6B 2CKBL 5JPMA 4FZ8H 2BMKA 5F9WB 1KFAL 4E5XB 1I8MA 3OZ9L 4QNPF 3U0WL 2AQ1A 3OR7B 3EJZC 4PJIE 5FO8A 2C5DC 4KMLB 3S4SG 4NKIH 4RMRA 1FRGH 4X0KA 2CIIA 1HIMH 3M17A 3MUGA 5E70A 4JG0L 3GKZA 2JF1A 4D0BA 3RNKB 1I1FA 5FGBC 4Z7QE 3BISA 3Q6FB 3TT1L 5JR1L 3V79C 1X7QB 4ONFL 1G7HB 1JWMA 4QTHA 4NOBA 3MMEA 3ARDD 1NLBH 4RAUA 1OAXH 4RMSA 5D5MF 1A1MA 3HCVA 3FQNA 4O4YH 1UADC 2FSEA 3GJFA 3GNMH 4LSTH 5HVGB 2R0WL 3RQ3A 5M95B 1BQUA 4WHTB 3HN3A 4YDIH 4XTRD 3TIDB 5SX5H 4E0RA 3IU3B 2P5ED 2Y6SD 1OGAB 1IKFL 5C07A 1V7ML 2NY4D 3DMMA 4G6MH 5JW3L 2LAGB 3MRIA 2D9QB 2YWZA 5IBUG 4YPJA 4U7KA 3PHQB 4TVPL 2RHEA 2UY6A 1WJ3A 1BIIB 5E5RB 4GG6E 3PWPE 3DVFA 2EYTA 3IFNL 2HN7B 3QNYA 4DZ8B 1LEKA 3FONB 3BZFA 4BFBD 5C6WH 3ZHDA 5I1GH 4XPHH 4TULH 5F7NC 2HTKC 4TSAH 2XKNA 2DQCH 5C0EB 1UENA 4G3YH 2X1QA 2ZNWA 4RGNB 1BM3L 1NMCB 3MLXL 1BF2A 2IAMA 1LEGA 2P4AB 1FZJA 2WINA 3LB6C 1EFXA 1KIRA 5M7QA 4PD4K 4HWBH 2QKIA 2UUDK 4MAYC 4U1IA 4YHLH 8FABB 2ORBL 4PLKD 3C8KB 2C3WA 1G0YR 4M43L 4H0GA 5DSCA 1IKNA 2E7BA 1UCBH 1FLTX 2D3VA 3O3DA 5IUSA 2EDBA 4PJXF 1NANH 3KG5A 4ZUVB 5LBSH 3WLBB 1GPOH 1BQHA 2X4PB 3LQZB 3MBEA 3EYOB 2DTSA 3CUPA 4J8RA 2PXYC 1FIEA 1IGYB 5J06A 2XFXB 3TZVB 3HC3L 3MRGB 4Y2DC 1MJUH 2P5EE 1C1EL 2A83B 3IJSB 4FQCL 4WEBH 3U2SB 1A7QH 4WI2A 4M7JH 1AKJA 5KG9B 5FO9A 4YFDB 5F96L 1OP5K 2J6EL 2OJZH 2YBRB 5E00B 4HK3N 4ZS7L 3F7VA 3RVWC 1KCUL 3IXTA 1F11A 5I73C 1KLUA 1HI6B 5B39A 2KL6A 3OKNA 1QO3B 2VLRB 4JVWA 1W8OA 4PB0L 4TSBL 4XXCA 4Z7UE 4OIBA 4ZFOB 5CSBA 4ZUSB 5KVEH 5E7BA 5T1DH 5IMOB 1OTTC 4QHKI 1DN2A 4OLWH 4ETYA 1BF8A 2FB4L 3LKRA 3NA9L 4PJ5B 3HPLA 3LKOA 4XH2B 1LO2L 3GMOA 1UACH 4LNRA 1OARH 5I1IH 2ZPKL 1A7BA 4LLYB 4HUWA 4OZFG 4LSPL 2VZOA 3C2SA 1T5XB 4X7SL 5I17B 4KKCC 5HHVH 4BM7A 3CPLB 4MDJA 3MBEC 5ANMB 3GKWH 3ZSTA 4QEGA 5MEQA 4HQQL 5GHWL 2AXFB 1MCWW 5EN2B 3W9DA 5J1SC 4N9OB 4PY7A 2PTTB 1BFTA 3ROOB 2VDKH 5DVOA 2GHWB 3NGBB 5C0BE 4N1EA 1X9QA 4U2YA 5EZJB 4IRJA 2HT2D 1ZEAH 4JFEB 5KVFH 3LAFA 3UZQA 1ZXQA 1NGPH 3FAWA 3QIUD 1TMCB 4XXCC 4JG1L 3C60C 4K55A 1DSFH 2QADD 3L7FA 3PDOA 3D18A 4OIIH 4JPWL 1DQLH 5DYOA 4C4KO 5JOPD 3O8XB 3QIBD 4EXPX 3DI3B 1DBJH 3DUUA 3X13B 3LD8C 3GZKA 4X6EB 1QA9B 3GMPA 3BMWA 3IETB 1FFOA 3U9PL 2CUHA 1G9ML 4LGSB 3VDBA 2ATKA 3C6SA 4RFNC 3EKCA 1T7YA 4HH9A 1R5IA 1MHHB 2HFGL 4OCXH 3A6CH 5EIIA 1KIPB 5HDBF 1TJIL 2Z4QA 3LRSB 4FXKB 5JQ6L 1F6FB 2VLMD 4PB9H 3HHRB 5BXFA 4I18B 3MLTB 5E5MB 5MENA 5L6YH 2HP4A 2XI9A 4U3HA 4I4WB 3RTQA 2IGFL 5HI3C 5D1ZD 2B4CH 1S7UB 1A9EA 5DHVH 5A40E 2P8MB 3T2PA 5DT1H 2EDJA 2LTQC 4OLXL 1XEDA 1UA6L 3I84A 3CVHL 4Z6AT 1EAPA 3S3JA 1NGYA 1Q0YL 4YXHL 3ZTNL 4IRJC 3QCTH 4XNMA 5H94A 1SY6A 2OMBA 3ARBB 2IQAA 1IZKA 1OCWL 4EDXA 5DUBA 3WSQL 4HT1H 1MRCH 2EYRA 3BPOC 1R3HB 3L3OB 3MRQB 3NPSC 4BK5A 3VWKB 3OX8B 4P9MH 4HUXA 2EDEA 4OAWB 1QQDA 5JOPE 4XRCA 2VLJB 2VKXA 2B0SH 3MRJB 3T2QA 4D0DB 2X41A 1VFBB 5ITFA 2R1XA 2QEJA 4RFOL 5BZWA 1NFKA 3CMOL 1FO0A 5D9SB 3S37L 2BY2A 1SJHA 4ONHA 4PR5A 4E41A 1IAII 1JWUB 2R8SL 2EDOA 4EUPB 4JRXD 5EO1A 3RL1B 3EFDH 4QOKB 1MCIA 1X6LA 1KCRH 2IADB 4TTDD 5EWIL 2VLME 5LAXA 1I3UA 3NIFE 1YEEL 4Q9CA 4M93B 4HMEA 5ISZA 4J3VA 3T0BA 1FFPB 3ZDZE 2FJFA 5F6IC 4PJHA 3U4BL 1RJYB 5C08B 5IW1B 1EBPA 2JCCF 3D9AL 3CVIL 3IKKA 4AG4L 2A6IB 3ARUA 4YR6A 1EERB 3UO1H 4F7CB 1N7ML 3ET9F 1BP3B 5SX4H 1UZ6E 1I1CA 4TNVK 4TPRH 3QH3B 5E08H 2UWEE 4ZPVA 4OZGA 2H8PA 3MRDB 2A73A 3ZL4H 3QHZH 5EZIH 2UYLA 2E9WA 1NGWB 2VYRE 3GSNL 4P2RD 5DQ9B 1M05B 5I1JH 2I07B 3ULUD 1S9WB 1AGBB 3EOAB 3KJ6H 4NJAL 3O2DA 2XRAH 1JGEA 1AXTL 1RPQA 3MACH 5D7JB 1EUUA 3VG0H 1UGNA 3CH1A 1UM5H 5L2JA 1KPRA 2YUWA 2PETA 3SO5A 4XCCL 2IWGA 3BAEL 4JQIH 4NO3B 4HCRA 4U1NB 5EFIB 4E42B 4XHQA 1A1NB 3B2VL 4X6BA 4JO3L 4JREC 5L2KB 4GMSH 1NLDH 3VXNA 1F6AB 2BJMH 1ZSDB 5TQ0L 2W9EL 4PJCB 4U1HA 3RKPA 2PYFB 3QIWA 4PRNA 3ARQA 4J6RL 1ZWIB 1MRDH 5T3ZD 6FABL 1KXVC 1D5BB 3HMWL 1IC1A 1F00I 1L6XA 4LLVA 3ZE0F 1PBYA 4PGBA 1IGIL 5C7XL 2FZ3A 3DYOA 4AEIH 2F5AL 3EZJB 1YEKL 2DLIA 2W60A 4OZHB 2ICWJ 2AJXH 1KJMB 5DJ0B 1WC7B 1EAJA 4R8WL 2NY3C 3L5WB 1ZVHA 4NBXB 4HKZB 4MB3A 1E6JL 2AP2A 3PJSB 4P4RB 5I74B 4PP2B 4O51A 1RZ8A 1BBJB 3KXFB 4M5ZL 3S88H 3LKPA 5AWNH 3VRJB 4P2RE 5HHNB 4PBXA 4PUBH 2N7AA 4GKNB 3QQ4A 3MNZA 4OSUH 2K9UA 3Q3GA 3IFPB 3WE6A 3ULUE 1KTKE 4Y5YB 1GAFL 2R9HD 3ESVF 3T0VA 3VXOB 2J8UB 1MY7A 1UM6H 4RNRA 1NFDE 3HE7D 4K7PY 3I75B 1PQZB 5EU6B 2V2XB 3GMLA 2YPKA 1CWVA 4Z77B 1KCLA 3TIEA 5HXMA 1KN4L 2MCPL 1S7SB 2P42B 1ZGLB 1I4FB 2Z8RA 2VWEC 2BRRH 32C2A 5DJCA 3UYRH 5B8CB 1G9NC 3B3IB 1SVCP 1JMZA 4K07A 5KSBA 1T03L 3QIWC 4PV8B 3RY4A 2EYSA 3DVNB 1LD9B 4TUKH 3MUY1 5HHMD 1DDHB 3WD5L 3JV5A 2HT3D 5T3ZE 4WEUD 1YN7B 12E8L 1I9IL 3W0WA 3C9NB 4KK8D 1FGVL 4CDGC 1P5UA 4HZLB 3ZKND 4LQFL 1KNOB 3IF1A 4ODWB 3VFNB 1H0DA 3O9WB 2IFGA 3GB7B 1RZ7L 5JIKA 5T1LA 3DJ9A 2VDQH 4Y7MA 3ZKQD 1MCOH 2NY5H 1CI5A 1AFVH 3WL9B 1F3DH 1HSBB 3H9SD 2GTWB 3SGJA 3HAEG 1SVZA 3B4NA 1IGTB 5JW4N 4JGUA 4Y2OA 5FYLE 2VLKB 4Q2ZA 5T5FL 1GGBH 5FIEA 3N1QC 5DTFA 2APWA 4PJ8A 5IBLC 4UU9B 5C09B 5SV4A 3EYQD 1YC8A 1GC1C 4QO1A 4BSWA 2YKLL 2Q7NA 3I3EA 4X98B 5A2KH 5HI4C 1LO0L 2DI9A 3ARED 4MA7L 4NUGL 3GO1L 3VE0B 1EHLH 4WFFD 3GJEB 3FFCB 2YD3A 1U6AL 1D5MB 3NFSH 4KK9D 5CZKA 4FQXB 1JPGA 2IC2A 2SEBA 1B4JH 5HYSB 4JY6B 5GRJH 4LAQL 4QRSA 4NQCD 5DFTA 4P5TB 4KKBC 5LGKA 5HHME 4JM4L 3F12B 2FATL 2VSDA 3G6JB 3OHXA 1AXSA 2R2CA 4ZO9A 5SX5K 4ZQKB 4ODTL 1TQBB 1MVUA 1KN2H 1S5HB 3RIFK 3N50A 1JMXA 2FBJH 1GGUA 3AAZB 5I30H 2CIKA 2IPUG 3KPPB 1YQVH 1SYVA 5DMGC 3LKSB 1DQQA 2HJKB 3SGJC 3RVTD 5HGHA 5AEAA 4HFWB 4JY5L 4RBPH 1G6RB 4WHYH 3WS6A 1CD0A 3AS3A 3NCYS 3BD4A 1X5YA 4OKVA 2VISA 1QKZH 1I7RB 1CFQB 4PJ8C 3VFMB 3C08L 2FWOA 1J1XL 3NCYP 2W59A 4Z7WB 1TCMA 1AGFA 1A2YA 2JTDA 3IKCA 3LVEA 1HOCB 1L0YA 1OL0A 2Q8BL 3EDJA 3V0VB 3RZCA 4UDTA 1YEGH 4WFFE 4LSUL 4G80B 1KGCD 3RGVD 4KZDH 2YXMA 3CK0L 1UWGL 1JIBA 2Y36H 5F7MC 3MRFA 3DVGB 1U3ZA 1QHOA 2VIRA 1OD7A 5IW6A 2XN9E 4QHNB 1J8HD 2CMRL 4Y4KA 4LLUB 3ARSA 4XBGA 4PJGB 2OR8A 4URTB 4NQCE 2BY1A 1DN0B 3TN0C 3NN8B 3CFDA 2EDYA 1G1CA 3BH8A 4ZOEA 3G04A 3CFEA 2YPLD 1FG9C 1JNJA 4KRMB 3TJHD 4ORGB 4LHUD 5C2BL 4BFIB 3MRNA 5D8JL 5KN5B 5D7LA 4EN3A 2AI0H 1YN6B 2JJSA 2X5PA 2ZOKB 1RIUH 3MYZA 2ADGA 4YHPB 3SDDD 1HZHL 3RNQB 2BC4A 2GCYB 2H9GB 1E6OH 3WS6C 1Y6KR 2ZG2A 5TH2A 5DWUH 1WIUA 4RGOH 5DEGB 1T0MB 3N85L 1H15A 1ADQH 5F7DA 2HFTA 4NQDB 3IDUA 4JFDD 5JHDA 3O2DH 1CFBA 1BX2A 1KC5H 3ZSSA 2X40A 5DRNB 3SO3C 4P2YA 3CNKA 1V05A 3MUHL 3SEPA 2MFNA 4FFYL 4O2CB 2IALA 3DTXB 4HCRH 2D7TL 1AQDB 3UTPE 2YC1B 2VDOH 1A5FH 3SGDH 5DFVC 2IPTH 3FT3B 3J7HA 2NX5E 3IB4A 2JE8A 4L1DA 2DDQL 5KSAB 3SQOH 1FORL 1KGCE 4UUJA 1FFNA 2FJHB 4P2QD 4AEFA 1MHCB 5ACLA 5JXEA 3QDMD 1ZHNB 3ZKXB 2H26A 3QFJB 1J8HE 1RFDL 3H7BB 3ULSA 4JFFA 1QLFB 5D1QB 3I9GH 1IM9A 5ALBL 3TO4D 1AR2A 1H5BB 1NCAH 1VGEH 1QSFB 4DN3L 2IH3A 3SDCD 4OFYD 1IEAB 5ETUA 2VXVH 1W72L 4M7LT 4XCFL 4GG8A 1RZGA 3AC0A 5IJKA 4ZUUA 1U9KA 1NGXA 1Q72H 1YY9C 3HZYA 5DD5L 1A3LL 1J0IA 4GXVH 4WWKB 3V5DB 3B9VA 1CZ8L 3RWDB 3PGDB 4KKLC 3WXWL 2PCPB 1L7IL 1ERNA 2XNAA 2PTVA 4G6KL 3WIIL 4JFDE 4DGYH 4GQ9H 2WBKA 1DUZA 2B20A 2B5IC 5T1KA 3S3PA 3S34L 2BSSA 4C83B 3LZFL 4Q58C 3DX7A 5CINH 5IFJA 3BPCB 1F45A 3W11D 4M03A 3RWCB 1DLFL 1UVQB 1WV7T 5BW7A 1SJEB 4TVSa 4R7DB 4JM2D 2O5ZL 3TT3H 1FYTB 3LN5B 3MZGB 1CBVH 43C9A 3JV4A 4P9HH 1JHTB 5C0JB 2O5YL 1TVBA 3N9GL 4P2QE 2CXGA 1M6OA 1H3PH 3ZYJA 3QDME 5DDHA 3TIEB 2C26A 5AUMB 1LDPL 4MA1C 5TDNA 1I1YB 4LHUG 1AR1C 3CX5J 3U9UA 3BOVA 3SKOA 3V0AC 1HNGA 5HDQL 1WGOA 4XMLL 3ARWA 2FD6H 3UEZA 3T0EC 5E1AB 2WIIB 5FYJL 3UXFA 3P0YH 3OAZH 1T1ZB 4HGKC 2YMXH 5IJKC 4Z18A 4K3EH 3FN3A 3QUYA 3SPVA 3OKOB 1OOAA 2FL5A 3MYJB 1HDMB 4QCIB 2OK0H 1PZUB 2ITCB 2VXQH 4DVRL 2Q3ZA 1VPOH 3PXHA 4J3OC 4EVNB 1IAOB 4MCYA 4Z8FL 5GRVK 2R0ZL 2XZAL 1BD2A 1M71B 1FFRA 4AMKH 3BP4A 4KXZI 3PP4H 3ZLQC 4WO4B 3CFCH 4OQTH 4JKKA 4JKMA 1VFAB 5BW7C 1T66C 4HIXL 3KGRA 3BZ4A 4NPYA 1T04B 4CADB 3BKYL 2D0HA 4J3WA 3HE6B 4BQ8A 5ICYB 2GTZA 1EHNA 1BBDH 4YQXL 5F3BA 4GW4A 4K9EC 4K3JL 4S1DC 3O6FC 3FT2A 1VESA 4GAGL 2F8XC 2DQTL 4KHXH 4L9LC 1KENH 4O00A 1ETZA 5E6ID 1YNTA 2FX7L 5H2BA 1XF4B 5EORL 5JOFA 3VXSA 4G8FA 4P23D 2EEBA 4HZAA 2R29L 2Z92B 1Q9LA 4JFPB 4PJHF 4K23H 1I7TA 4MB5A 3M8OH 4XMKH 1ND0A 4DKAA 3CU7A 4UNUA 1N5YH 3FB5A 3K80A 1HQRB 3DXAA 2XTJD 4OV5A 3MNVB 3SJVA 4BSJA 3ARYA 1PDKA 4XNUL 2JK5B 1JJUA 4NO0A 2HJLB 4HC1A 1QFWI 3GSQB 4HF5H 5EZLA 3SDAA 4KI5E 3BO8B 4OZGF 1NSNL 3S36L 2QQNH 1P7QA 4U6TA 1N8ZB 1MH5A 1LO3H 1OF2B 5F44A 1T0NB 3W2DL 4ZAKB 5JUEH 1C5DB 2XWTA 3NTCL 3P30L 4JVPA 3HZVA 4NHUB 2XZZA 4XC1H 2BSRA 3V6BR 2GK0B 4CN1A 5I1HL 4FQ2H 1PX4A 1JN6A 2YUXA 2AV7B 4JN2B 3WIHA 1MAJA 5E8NB 2IH1A 4OFPA 5IR1A 2IBZX 4JQXA 3OKEA 2DL2A 2DLTA 3UTSA 3QDGB 2DLFL 1GGTA 4L3ED 1WVZA 4NNYB 4XI5C 2F19L 3S4SB 3V4UH 1MCLA 3F7QA 2WBJC 5CKAA 5IV2B 1EJOL 4LDLB 1IEBB 4OGXL 3KLAA 4FTVB 3OGCA 3VJ6A 1ZE3C 5A1AA 2NXYD 4FFWC 5E03A 5GISL 1BVLA 1RK0A 1UXSB 1YA5A 5TDPB 3RA7L 5IBTH 2BSTA 3BPLC 4FNLL 2X4NB 1IC4L 5FUOL 3WS3B 3ILQC 3WBDA 4HFUL 1XR9A 2BOCA 3QUZD 3SQBA