3VQMA

Small heat shock protein hsp14.0 of c-terminal deletion variant with c-terminal peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
GKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small heat shock protein StHsp14.0
publication title Structural studies on the oligomeric transition of a small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
total genus 15
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vqmA00
4M5TA 3J07A 2JKIS 4YLCA 3AABA 2O30A 4YLBA 3QORA 4MJHA 3QORD 1WH0A 5DS2A 1RL1A 3GT6A 2Y1YA 3Q9QA 3EUDA 3QORC 2KLRA 3L1EA 3Q9PA 3N3EA 4FEIA 3W1ZA 1GMEA 3GLAA 3L1GA 3L1FA 2CR0A 4YDZA 2XCMC 3AACA 5DS1A 2Y1ZA 2WJ7A 4JUSA 2CG9X 4PCKA 2BOLA 2N0KA 4YE0A 4PBDA 1WGVA 4RZKA 4I88A 2K8QA 2WJ5A 3IGFA 4YL9A 4ELDA 5LUMA 2MNWA 4M5SA 2KMWA 4ZJ9A 2RH0A 3VQLA 2Y22A 3VQMA 1SHSA 3GUFA 3QORB 1WFIA 4JUTA 2N3JA 1EJFA 1X5MA
chains in the Genus database with same CATH superfamily
1DQJB 4AYMC 1WITA 1OCWL 1UOWA 2HFTA 2WQRA 1QX1A 3FQUB 2DLFH 3RWCB 5HPMB 3N44B 4PJ5A 1KN2L 3IDXL 2VQ1A 4UM9D 4NNXA 4OLWL 1VRSA 4MQXC 5E8PB 2X05A 5F9JB 4I8DA 4S0HA 1KTDA 3DWTA 3QEQD 4MYWB 3PGCB 3ATFA 3T0EA 1A21A 1A0QL 4LBEA 4GKSA 4ZUUB 3S4SA 1P9MC 4MAYA 3RVWC 3N50A 1HHKA 3LN9A 4O5LH 2X2YA 1HE8A 1G4MA 3WU1A 3GGWA 2XLLA 3EO1B 5IFHL 2EXYC 4WWOA 1G7MA 3MYJB 5E9DA 2ZP0T 3GI8L 1SDDA 5GRWA 3E8UH 3MA7B 1ECYA 4XC3H 1M71B 3BYTA 4E5XG 5KSUB 3ML8A 5L2KE 3EGSA 3NDYE 4XP6L 3OLGA 3VM5A 1TTCA 1MY7A 2XQ0A 2L7QA 2Q2EB 1V54B 3L5WB 1B0IA 2W9DH 4PMEA 2FD6H 1KELH 4N8VG 3SPVB 3SJVE 4ZTPH 3STLA 4FD0A 3U1SL 5J13B 2RIKA 3L5IA 1JJUA 2EXWC 1BQKA 4PJ7F 4UIMA 1PKQA 4GW5A 4G82A 3GKWH 3GSRB 5HHXL 5H37H 2I60L 2R2HB 5J1SC 3WG7B 1W0VA 1JNNH 2O26U 4H20H 1S3RA 4MJIE 4Y5XC 4YSOA 5CLWA 4PGZA 5FO2A 43C9B 1JHTA 4Q56A 3SE8L 3TA3B 5JOPD 4PS3A 3GMLA 1MCHA 2AV1A 2YQBA 4LSVL 1SYSA 2FNBA 2AXHA 2XWTB 2EC9U 1UZ8A 1QFOA 5F97E 1EMTL 3W57A 1YG9A 1N6VA 4IOFC 1JPGA 3HI6L 3QCUH 1AQDA 2NX5A 3T04D 2DYSB 3I9IA 1RUML 4P23B 1IIKA 1TDQA 1LTXA 1PKOA 2BFVH 2I07A 3DTXA 3K4ZA 4UOJA 4BKLB 2Q9OA 2WINA 1ROWA 2P5EE 4X42A 4KVPA 5BRQA 4B9PA 5JHLA 2GHZA 1MIMH 1IZJA 4F3FB 3KHQA 3CU1A 1S7QB 5DEFA 1U95A 2ZAIA 3KR3H 2JKTM 5HDOA 1J9CT 3GSWA 1K9TA 1G9HA 4YUEL 4HCRL 5L0QC 3C12A 5C0CB 3QC6X 3QUKB 4GYBA 4NT6A 1NMCB 2VN6A 2VSMB 4M4RA 1EERB 4NIYE 4OVVA 4IRJC 2CSPA 2IF7A 4KTEH 1MFEH 35C8H 2RH0A 1OT4A 1UVQB 3FTGA 2VLKD 5KEZA 4UT9L 4J3XA 2DQJH 4KNTA 2ZUQB 5DHVB 2O1AA 3C6LB 1J18A 1MSPA 1HCVA 3DXAE 1R3JB 1TQCB 3PWLB 4HJIA 3L6FA 3QDJE 2F5AH 3MUUA 1M6OB 3D50A 2R2EA 2SEBB 1A4BA 4G7RB 3L5XH 2BHUA 3ZDYF 2F74A 2K45A 3D2UB 4NSKA 4R90H 2JKJA 5C0AB 3ARUA 5HYEA 3PV7A 4JM2B 2X10A 3NN8B 4PSRA 1INEL 5I8EA 5GSVA 4UM8A 1VEPA 4D9LL 3CVIH 3S5LG 1N70A 4EVNA 5T33H 5I76B 1OXYA 1TG8A 3B9VA 1DVFB 4WO4A 5KAQG 3K71B 1B88A 1KXVC 4JR9H 2IALA 3TBCA 2X7LA 3PP4H 3KBHE 4PGCB 3TNNB 5LXVA 5ESVA 4TLSA 3T3MF 2NLJB 3TT1H 1OP9A 2ZOLA 1WBYA 1XGRB 1IL1B 3D18A 1TPXB 3F5WB 1GOGA 1MCWW 4WDIB 3VNZA 3N04A 2PYEB 4TL5A 4YPGB 2WBJA 3JT0A 2NY2D 4GQPH 4QTIL 4HIQA 4QGTA 2OXGB 5K33A 3RDJA 4B9FA 4RGMB 3REWA 5KG9A 1TO4A 3AABA 4IMKC 2AJVH 4GMTH 5CSGA 4KKNA 4UQCA 5C09D 2WXGA 4WU7A 2EADA 1KJVA 4IKNA 4P2QB 4G11A 1IM9D 1CFNB 1AVAA 1CUOA 5GS0D 4BV1A 1MHPH 1HHJA 3ABKB 2AQRA 2X6CA 4LSQL 1LVEA 1U8KB 2XQBH 3BVWA 2WLHA 3FSOA 3KLAA 2R9HD 2DZEA 3O3DA 1ITBB 3MRNA 1NMAL 2YBRB 2LHAA 3N1FC 3FZUC 2FAUA 5IHUL 1RK7A 4U1SA 3HCVB 1QFWH 2VDMH 2NRDA 3U7YL 1JPTH 1XH1A 2DWDB 3M7FB 1UA3A 3ZXAC 1JF1A 4B9KC 3FB7A 1EZUA 5C08E 1UUSA 4UYPA 1WFOA 1BHGA 4WV1C 3U6RA 2GC7C 3MOAL 4N1EA 2WTOA 2J1XA 4PJBF 3BW9A 1XQ4A 2AK4A 1NCWL 4P04A 1RZKC 4JB9L 2I69A 2VDKH 4JRXB 3EH3B 2IO5A 3OR6A 2ZCZA 5BZZA 5I8KH 2H6PA 1QRNA 5FOJA 1T7WA 2VLRE 3PJSB 4K8RD 5DTFB 3UZVA 1C5CL 3EOBB 4DKEH 2NSXA 1HTYA 4X6EA 3F7YA 4RETB 1NBZB 1NIFA 2VJ0A 1JK9B 1I7TB 3MRMA 4ZPTA 3IN0A 3RZCA 1CFTA 4D9RD 2OZ4H 4OJEH 3TWCH 1A6TA 2IXQB 4GXFA 4MWFB 2WLYA 4PJXA 5I0XA 4L1TA 4XO9A 4GBXB 5D7IE 1SLVA 4QD2E 1ZS2A 5CF3A 3FH7A 4FN0A 2YWYA 4MAUL 1CLYH 1XGTA 3EH4B 4GW4B 5DFAA 3LKPA 3IFLH 4JFYA 3V7AG 4BFIB 3KPLA 2GUOB 3VX0A 3G7TA 3TNMB 5IB2A 3N41B 1CF1A 4IW4C 4WJKB 4PR5B 5MENE 1LJMA 5GS1B 2ADFL 1FNEA 3HRZA 3ZMEA 1N6UA 2UZXA 4PI0A 1HXYB 3ABMB 1QQDA 1LD9B 2VDOH 3KLSA 4I2XE 4D7PA 3NRQA 5DHEA 2ZPKL 1U8CA 3GINA 4OM1H 3N06B 3BP5A 4LCWA 2HMID 3N0PB 1XGYH 2A83B 4G6JH 4HOZA 4PRAB 2CBPA 4I85A 1H3GA 2ESVD 1DQDH 3PWJB 3BKCH 4P4KA 2HX7A 5HHVL 3OF6D 4WZ9A 3TM6A 4A2MA 1GOHA 2X3AA 3GXDA 1NH6A 3OJMB 4LHQB 1F3JB 1I8KA 4NUPA 5E6UB 4ADIA 4PJFA 4JFPB 2QQKL 3DX7B 2ZKHL 4G6AC 1IBZA 1RZFL 1WD8A 1HS6A 4TNGA 1ZIBA 2X53A 4QAWA 1HXKA 4XP9H 5J4MA 4Z7NE 5L88H 4K3DH 4YS4A 1E4KC 2UZYB 4ZTOH 3F7LA 3LPWA 1KLUB 4PRBA 4HIIB 4QRRE 4WUUD 3R4RA 3STBA 1TJXA 5CKAA 3VWJA 5I8OH 3LEYL 4C56E 4PJXF 1L3WA 1XAUA 5E2WL 1DUZA 1P53A 2WLLA 4K7FB 4NM4H 4PWJA 3JTTA 5DR5L 1BXAA 3HOGA 5D6DC 4AE1A 1A1NB 3RHWK 4NENA 4Q4EA 1F4YL 5CCKL 4RGND 2FX7H 2HH0L 5HGGS 2E27H 4F9PC 3IJ8A 2VXSL 2VW7A 3BUYA 4ICWA 3PQYE 5ALCL 5GGTH 2FBRA 2O6EA 5IB5B 2WYHA 3HG3A 4PRPB 3TT3L 1JPEA 2DQFA 5DEZA 5CEXB 4JM4H 1IGMH 4YHLH 4I0PD 1J10A 4B5ZA 4YLCA 2HRHA 3QORD 1A3QA 4H13C 5D1ZA 3V5KB 1QBLL 4N5UA 3D51A 4UTBL 5DUML 2CR3A 4QYOB 5LLIC 5D96B 5B38B 3MNWA 1YQ2A 3SKNA 3E9TA 3MLUH 3ZT7A 4JRFA 1X5FA 3D85D 1TJGL 4HXBH 4AJWA 1Q1JH 2DQEH 5IQNA 4YSEA 3VVVA 3NK3A 4HCFA 3JQOB 2W0PA 2C5DC 4KH9A 5GS3A 3VFRB 2ITCB 2HG5A 5HHNB 1AP2A 4NUJA 3POHA 3TVMC 3FSAA 3IMWA 4F7EB 4P3DB 1CT8A 3ZDZE 3B2UD 2Q2LA 3BP6B 2ICWJ 5C0GA 4Y7MA 5AVXB 4JFQB 4FLQA 3WN6A 1B4TA 5AOKA 4N1HB 1XIWA 3HN3A 2XZAH 2DLFL 5DQJB 5E95B 5IESH 3IU4H 2OJEB 5KBKA 3ZZLA 3N1GC 1GC1H 5B1JC 5IP4A 4EJ1C 5AAPA 1CQYA 2C9RA 2BOLA 1O5PA 5DO8A 3KG5A 3KEDA 4OIAA 2FTAA 5AZ2H 3I02A 1UD2A 4O5LL 3P9LA 3VH8G 1Q8MA 1N19A 1BJ1H 2QR0A 4FFZA 4LLAA 1DQKA 2BS9A 2GITA 3D06A 1XGZA 4WHCA 2CIIB 5JLZA 3E6FB 3E8UL 1WAPA 4XC3L 2C9UA 1PD1A 3VMOA 1JNJA 4XNUH 1QSFD 3GM0A 2JLPA 3FO0H 4UQ3B 2MPVA 5E8OA 2WVTA 2W9DL 2KMWA 3BGFC 1KELL 2JKRM 1C16B 4LAJH 5DVOA 4CBZA 1AR1C 4EUPG 4ZMVA 5BQ7A 2V33A 1CDYA 5CBEA 3BPOB 2DY2A 4PP1D 4JGNA 4JBSA 4WHTB 3ILEA 5JOPE 2NXYB 3GKWL 5KSAB 4PJHE 4H20L 1JNNL 3T2OA 5EBLA 4TUOA 4R96B 4W4NA 1ZS8A 3DK2A 3S35H 3LX9A 5F0MB 4LRIC 3VSUA 3CZFA 1PAZA 2VDPB 1XEUA 1UOLA 4WHDA 4CMMA 2VMFA 3BT0A 3K74B 1E43A 3X1EA 4WK0B 3UABA 5GGVH 3MRLB 1VFBA 5E2JA 1FNSH 1MEXL 2BFVL 2R69A 5F7NC 2UWEB 3O4LB 4B50A 3PL6A 2YPLD 3S6CA 4WJ5A 5IW1B 1RZJC 1MIML 1ZKAA 3BESR 4NKMB 4AUYA 3KR3L 3QQNA 4ONOA 2XV6B 3D2TA 4DVBA 1FF5A 3LH8A 2VLKE 3PE9A 3WE6A 5F1NA 1UWXK 4XOCA 5FC9A 4P46B 1R3HB 1IGCL 2J55A 1BF8A 4AJ0A 4KTEL 5GGSB 3QO1B 2IEPA 3VCLA 2DQJL 4PY8J 4HSQA 4Z3HA 4GKZB 2XG4A 1B4LA 4Z0XA 4B9YA 4JDVB 4AYGA 1KNOA 1T3FB 2ZYHA 5BNXD 1N3NA 3LZRA 1HHIB 2HCZX 4PJDF 4U1JB 2F5AL 4Y4FB 4QGYA 3KPNA 3L5XL 1PGRB 1IEHA 4R90L 3L3JB 2DI9A 2X4NA 1EEQA 4E41D 3RX8A 3IJ9A 1T04B 4RWYL 1KXTA 4JFXB 3CVIL 1R5IB 2DWEB 1KEGH 4X80L 2FJHA 4U0QB 4CVXB 4MJHA 3U46A 3T3PF 4F7PB 4MQ7A 4JR9L 4WEUD 1F4AA 3PP4L 2J6EA 4LCVA 1GZQB 3MSPA 4RX4D 1EAQA 1HILB 1UXLA 3LQZA 3N44F 4GQZA 3TT1L 1SN0A 3QA3A 3K2KA 3BH4A 4L8CA 2Q20A 4B3VA 4IBSA 5EZPA 4WGVB 2JCCE 2R7EA 3HHSB 2YSSB 4F7TB 1QTPA 1QSVA 1X4YA 2W80C 5C0IB 1E6OH 1K5WA 4MA3A 2QVMA 1A3RH 3CPUA 1E0OB 5C09E 3ZDXF 3VTTA 1TJIH 4QHNB 5LGJA 3M88A 5IEHB 1OTUC 4X99B 5D2LA 2B15A 4DGUA 5LWYH 4OLEA 5JXED 1KACB 2WANA 2AJVL 4GMTL 1KB9K 2QEJA 5HVFB 1BLIA 3IYLW 1I7UA 3WIIH 2EH8H 5F7DB 1MHPL 3A22A 1JE6A 4QRUB 2XQBL 2NZ9D 4KK6C 3RJQB 3RJOA 4XBGB 3I2CH 1USZA 4OCLC 5DRZA 1CFBA 2GTZB 1J1PH 4JMXA 5D6CB 5I1IL 5JMOC 5D1QC 3U0PA 1DJGA 4Y4HA 1TT6A 1QFWL 3ZKXC 2VDML 2CRMA 1I1AC 1JPTL 2QSTA 5HI5C 1FO0A 2RGSA 4X2UA 1KB5B 2FO4B 3FMGH 1WFTA 3PY9A 3CFJB 4WHYH 4RFEB 5IHZB 3L1EA 4KK8D 4LP4A 4MA8H 1D9KD 3BUBA 1EXUB 2BY3A 5FPIA 4A7VA 4H0HB 1QSZA 4N20A 2VDKL 5GS2H 1F11B 3EJUA 1YQVH 3GRWL 2IV9A 5I8KL 1OKEA 1Y0LA 4OTXH 1VEOA 4D9RE 5IG7B 2X38A 3CZJA 3JV6B 1EHKB 3Q8FA 5JW5B 5F6IC 1H3WM 4DKEL 1JWMB 1HJCA 2QPEB 3UAJC 3L9YA 4OZHF 1GGUA 4POZC 4LEEA 4NPJA 4WAFA 1MCFA 3BI9X 3U1PA 2OZ4L 3TWCL 1Q9LA 2RTTA 1OB0A 5H37G 3APFA 3NCXA 3HS0C 1A4JB 3ML9A 1RXLA 4NXSA 5ETUB 2CH8A 1BWWA 5JIDA 4TTGA 1DCEA 1QLRA 1CLYL 4CBPA 3BSZA 4PLKC 2Z8RA 4JMNA 3IFLL 3KPPA 4GW1B 4HDIB 4PJ8D 3HJ0A 3GXPA 1ZLSH 3QJFB 4XB8A 1N8ZA 3UTQB 8FABA 2OJZH 3L3OB 2ESVE 4DK5A 1R5WA 2Y3AA 1MUJB 5T1LD 1PS3A 3OGOE 2WW8A 5FHBH 4NLAA 2B39A 3DV4B 3ISWA 4OM1L 2FR4B 1XGYL 4G6JL 1DQTA 1P6WA 2D7NA 3RTQC 1ZVNA 3BKCL 4V1DD 3GUTA 4OLZL 2C9PA 3OAUL 4OZFH 2DJ4A 2KZKA 2ATPA 3ROOB 1FYTA 1KT2B 1UKSA 1FJ1B 5F7FA 3D52A 2QSQA 4WUUE 1BYOA 4NO0A 3BZFB 3ZQ9A 1VERA 2D0GA 4DETA 2ZUYA 4K23L 1DJWA 4XP9L 1HOCA 1T1YA 4K3DL 4ZTOL 1J8HD 4GEIA 5TDPB 2Z8WC 3UDWA 3O0RH 4X6BA 3VYNA 3GDCA 4RGOL 3U9PH 2NYYD 4U05A 1W0WB 3IGLA 3CN0A 2VABB 5DS2A 3UMTA 5I6KA 2YGOA 4AYFA 4ABVA 1LGVA 3WUZA 1JYVA 4RGNE 3FUHA 5K9KB 4P8QA 4XN4A 3T8VA 3L1FA 5DD5H 4ELKB 1MFDL 2VJXA 2NY4D 1YN6B 5FM5O 5EF3A 5B1BB 1RK1B 4BSWA 4F92B 1N59A 4XNZC 3U2SB 2YEQA 2FX7L 5DJ8A 5KYUA 2E27L 3U36A 1EH9A 2MQGA 3VXSD 1BJMA 3FTUA 4WNJA 5GGTL 4E36A 1I4FB 3ESNA 4WFGD 4PRHD 2V2TA 1K3IA 2C4FT 3CUPB 4JM4L 5FGBC 2F15A 1IGML 2VZUA 5EOTA 4YHLL 1KCSH 2QV4A 3FCTA 1QD0A 2APWA 4N90D 3RWJA 1KIUB 1HYSD 1T20B 3IF1A 1U8NB 4XODA 1IAII 2HSIA 2X1XR 4F37F 1MW2A 4X98B 2A6JA 1FL5B 2EYTA 4IBTA 4H7VA 2L3BA 2GJJA 3MLUL 4N2IA 4YE0A 4O51B 4FLHA 3EXJA 3GJFH 3SDYH 2A74B 2FATH 3VJ6A 1Q38A 3PWVA 4FAAB 3DBSA 4I18B 4EIBA 2XN1A 5SWSB 4M93C 5AL8A 1M05B 4KAQH 3RP1A 1OGSA 3BWZA 1YYLH 5FDYA 4OZIE 2KC0A 3TV3L 5IV2B 1PCSA 5DD6A 4ZFQA 3NA9L 3W9EA 1S46A 3ZTNL 5K9OB 1HQ4B 1TJHL 3R7RA 5JPMA 5IVNA 5KSBB 4NOBA 2YN5A 1C08A 4R7LA 2JB6B 5IESL 3IU4L 4GRWF 3ARDC 1HXMB 1UTDA 2V2WA 2PUQT 4YEFA 1I3GH 3F84A 1GC1L 1TZGH 4EIGB 1RHHB 2BNQD 4E5XA 3HFML 1NFDB 1RQ5A 3UZEC 3K91A 1KPRA 5GISH 3FT4A 4MX7A 2ZYRA 3N0AA 2XWBB 4QOKA 5AZ2L 3MV7A 2Y69B 1DSWA 3A6CH 4ONHB 4TSAH 4D2NA 3MRDB 3QWRA 4L05A 3OR7B 1IBYA 2W1NA 3O9WB 2V3DA 4ZFOL 3ABGA 2EACA 3GMNA 5JA8B 1MWAH 3OKNB 4GG6B 3VW3H 5IB3B 3DVNA 3T2LA 3INUH 1E50A 1QSFE 5IVXE 3AT0A 3CFEB 5B8CA 5KUMA 3LH9A 2MH4A 1ZDSA 2ATKA 2ZYIA 4N2LA 4W6XB 3GMOB 1INDL 1CI5A 1DJZA 1BREA 4HJ1A 2I7SA 4ALAC 1BX2B 3QUYC 5T3ZD 1JHKH 2K70A 5AVTB 4NQSA 5D7LD 2BNUB 3FO0L 1RVFH 3ZE0F 3HMXH 1KGYE 1J88A 1J9QA 2DJUA 3LZFL 3LCYA 2NY6B 4I9XA 1OAQH 4QTFA 1HESA 4YN3A 3KW7A 4U1MA 3FNKA 3NGBC 1R33A 1U3JA 2CO1A 3VFNA 2NR6D 3U25A 2QFRA 1OGTB 3AC0A 3OX8B 1NFIA 4QCIB 4F9LA 2V3EA 3FOLA 3VRLE 4PS4H 1OAKH 4ZFZA 5KBNC 2E47A 1NC2A 3VSQA 5CD5D 3C6SA 2F7PA 1U41A 2VSKB 2YPLE 3K46A 5FGCE 5J12C 3B56A 3KPSD 1LLAA 1URLA 4ZAKC 3X11A 4PJCB 5BS0D 4NQDA 5GGVL 1QBAA 1A7OH 2D3NA 8PAZA 5PCYA 2IAMD 4JY4A 4PV8A 3PREA 3RNQB 4LBEB 4EN3D 4GKSB 3S4SB 4LKCB 1RULH 3F7RA 2NCEA 5FKAA 4CW1B 2BHZA 3GGWB 4HWEH 4LCIH 2YFOA 3ZT6A 5F9WC 1AO7A 3OKMB 1G7MB 1NEPA 3TBVB 3U30C 4G6FD 1SDDB 4TUKH 3DUUB 1AD9B 3GXFA 3CHPA 5DXWA 3BUDA 3TIEA 1RZGA 4TVPH 4IEFB 1G9NC 4Y4KA 5D1ZD 3F6IA 1R3IH 2BZCA 3CHSA 4PGEA 3VU1A 3S5LA 2CXKA 4Y5VC 1KCBA 2ALWA 2GVYA 3D39D 2V7NA 4N6QA 3FPXA 4AL8H 4E41E 2UXFA 2CNZA 4R2GD 4ANVA 1B2WH 1XB8A 2VM4A 4PJ7E 4UIMB 2OP4H 5FUOL 1DVSA 1CXHA 1JZGA 3LKSA 1W0VB 5LDUA 1LP9A 2QLVB 3BPLC 5ANHA 1JHTB 1MN4A 4U1LA 1MNUH 3APNA 4U2ZA 1PLBA 2FECI 4U2YA 2H0JA 1FFQA 2B3RA 2EO7A 2IWGA 3L2MA 5HYQA 1KEMH 3LXCA 2AF2A 1PX3A 1JPGB 2GT9A 1HVXA 2IPUG 2NX5B 3THMH 1OSPH 3ZUCA 3H2WA 2NTFA 4LEOA 2W60A 2I07B 5AG9A 5JHDD 4R7DA 4P9HH 2WINB 1QFWM 4HAFA 4P2RA 3CXDH 3RWHB 2FT8A 4ISVA 4XI5C 4R3SA 2VMCA 1E6OL 4CRPA 4DT2A 3ZJAA 3FTYA 1A3RL 1U95B 5CP3H 5SX5H 4IKKA 3IDIA 4YE4H 1U9KA 1ACYL 3GSWB 5CEZD 3TZVD 1TJIL 3TP4A 5BZXA 4NO5B 1SHXA 2X89A 2M2DA 3P2TA 1FFNA 4KGLA 2PTTB 2R1WB 4FXKC 4IKLA 4X9IA 3RVXD 1F97A 5AUMB 1RZQA 2OR8A 3WIIL 4JE4B 3ULVC 2IWFA 1PKQE 3APDA 2EH8L 1TKWA 3P4NA 1AGFA 5C0BA 3SCMA 4IOIB 3T6XA 5IOPA 3OKLB 4G9FB 3QZOA 4JPIB 4DOHB 3LEVL 3EYOA 1MFAH 2H1XA 4G43A 1LK2A 3K2IA 2ICEC 2AXJA 5T3XL 4PREB 4ATTA 3ZDYE 2F74B 3MYZA 4KVCL 4NSKB 5KWYC 1OW0C 4OSUH 3BGFB 3FB8B 4MZRA 3AZUA 2J3SA 5I8EB 1QLEL 3K1DA 2GJZB 2WQ8A 3O4OB 1D6VH 2OXHA 1EGJH 1O9ZA 5GSVB 4MA8L 4NIKB 5E4EC 4Y5YA 3L3GA 5DVKA 1PLGH 1JVOA 3TURA 4DF9A 4UV7L 3VE0A 1FGVH 2IALB 3B3IA 2YKKA 4APQA 1YQVL 3T3ME 3CWGA 3WIFA 4KK5D 1BXUA 1AYRA 2FT7A 4OTXL 3NQIA 3K0WA 4TSBH 2ZOLB 5L6YH 7PCYA 3FBKA 4WI5A 1PYWA 1DJXA 2QSCL 2V6HA 3D18B 5GZOC 2UWEF 1WF5A 2OL3H 2WBJB 4NAQA 5MEPA 4N8UA 1DFBL 3Q6FB 1IILE 2V3FA 2H3KA 3ISYA 4GFTB 4M03A 3LMJH 1NJ9B 1KBPA 5GGUB 5E51A 5KG9B 1OV8A 5JZ7D 3OG4B 2WWNA 1WFNA 3SDAC 3QEUA 3V9CA 5A2BA 2EINB 1ZLSL 4J27A 3A3YB 1KJVB 3H6AA 5BQDA 3Q8AA 5GRJH 3VDCA 4BKTC 3QAZB 3VFUA 2VO5A 4HCRA 1HWGB 4ERSH 1HHJB 2E76C 2HUHA 1J5IA 4AENB 5FHBL 4BHUI 3HHRB 5I1HH 3KLAB 2QVKA 2VJ8A 5FX3A 5BUPA 4AYEC 1A2YA 4WI3A 2LTQC 5C2BL 4U1SB 5DJXA 2CG9X 2MWCA 2Y7SA 4WSKA 1IMHC 4P2YA 1TOXA 1S78D 1SQ2N 4OZ4B 5F44A 1J8HE 3II1A 4QTHB 3KYKH 5E0QA 4PJBE 4M3JA 4TVUA 3BW9B 2AK4B 4FNLH 4ZW3A 4MCZB 5D5MB 1Q0YL 4KKPA 4JJ5A 5I73C 3O0RL 1YEFH 3LD8C 5E8NB 1L0YA 1TQBB 3U9UA 2A4CA 2H6PB 1QRNB 4AQ8A 3L2NA 4ANXA 2ICWA 1QSEA 1JDAA 5B7MA 4PCKA 4TNVF 5CGYD 1KJ2H 5DD5L 3VXSE 2UYLA 5A2JH 3MRMB 1HQRB 3RZCB 5C0NC 4PP2B 1CFTB 4Z7UF 4WFGE 1DE4A 1EV2E 1V7MH 1YPZA 4PRHE 5EF1A 4Y5XA 3WN5C 5B7FA 3M86A 2ZG1A 2O30A 4N90E 3WY1A 3K4DA 3MR9A 2HT3D 1QWHA 1I3UA 4P23D 1OZUA 3ZL1A 2XY1A 4IBUA 4FA8A 4TXVB 3CU7A 2CZNA 3KPLB 5JPNC 4QY8A 1NSNH 3F7VA 1KCSL 2D3VA 4X4YB 3S8FB 5L8KB 3WY2A 1M3JA 4GAYA 1FNEB 3HRZB 4UBDC 1UZGA 4JN1H 2CXGA 3O3AB 4P5TA 5DC2A 4X6DF 1FVCA 1U8CB 2VR8A 3BP5B 3V0WH 2DJSA 2WWKT 1LK3H 3LRLA 5FWRA 2R29A 4J28A 2PWHA 4P4KB 1SVBA 1P6FA 5DURD 5KZCB 2FATL 5IKCA 3D87B 4H1LB 3UGEA 3ARBD 2D3LA 1MCBA 1I8KB 1EBPA 1F5WA 5GQBA 4PJFB 3LKNB 4CSSA 4A6YL 2TRYA 1YYLL 4AWJC 3CCHA 2HFGH 5I5RA 2CIKB 3ZKXB 2H32H 2BNQE 3Q6GH 4HFWB 43CAB 4PRNB 4J3OC 1H3PH 1MHHB 4PRBB 3V6OA 3D2UD 3GEWB 4CU8A 1SMDA 1CS6A 3VWJB 3HC0A 3MRJA 1BFOA 1I3GL 2UY7B 4PJXE 3SOTA 4JVUA 1DBAH 1OANA 1TZGL 1QYGL 3UBXG 1WUNT 4AVHA 1DUZB 3NTCL 2WLLB 3Q5YA 2JI2A 1M7IA 1MJ8H 4OFYA 5GISL 5CFHA 4U1IA 3GTTA 4KQ4L 1DVFD 3M7OA 1P4IH 3A6CL 3O3EB 1N12A 4LHUG 4NRYA 4JY6A 1P7QD 1T0MA 3C08H 2YA2A 3DSNA 1MWAL 4EUPA 3VW3L 4WCYH 4U6HA 4RAUA 1DVYA 1Z5YD 2VC2H 1ZE3C 1WYJA 3AY4A 3INUL 5F7AA 2BSTA 2EDFA 5D7LE 2J1KA 3D25A 1VEMA 1Q9WA 2ZUXA 5HYJA 2FLBT 4GMSH 3NRFA 5DJAA 3KXFD 5AOMA 5IWLC 1PTZA 4GG8A 2PYED 3ARED 3P4MA 1HL4A 3RKPA 1JHKL 1LEIA 4HHWA 4H8WH 4RISH 2XUWA 1RVFL 1WV7T 3HMXL 2QDWA 5DMGD 1UADC 3MNWB 2EVFA 1OAQL 1S2EA 4MD0A 4N9OB 3HPJB 2Q87A 4LSDA 4NS0A 5E6YA 2WXIA 1T2XA 2DQGH 4OLVH 1MLCA 1KGCD 3JWNE 5JDSA 3WS3A 3MRIB 2R2BA 1L5GA 3MCLH 2HG5B 2XWRA 4P2QD 4TVSa 1K6QH 4NUJB 4HKZA 2FSEA 4W9GC 1CT8B 1N0LA 2FNWA 3KPSE 4HOMA 1S5IH 4Z7IA 4NCC2 5C0GB 4I3SH 4PS4L 1OAKL 5BS0E 3D69B 2XIBA 2W9LA 2YARA 1XIWB 3IRCA 1AGEA 2J7LA 4M6OH 3MRPB 1IT9H 1U8LB 5F7EH 3GXTA 3WJJC 4DW2H 2MTAA 3IJEA 2DIEA 4MJ6B 1MG3C 3KHOA 4R0LC 3BZ4A 4K2UH 2R0WH 4HFUH 2EDYA 3I02B 1RULL 2P5WA 3SZKC 1JCKA 4OZFG 5KBPA 4HWEL 4Z77A 4IRZL 4F7MA 4NQUA 3L3IA 3BZ5A 3QO0A 3NK4A 1NGWB 2QR0B 1PFCA 3S3SA 2GITB 3DJZA 5EPMB 5I1AA 4TUKL 3D0VB 4CKVX 2YD1A 2WIIA 1DL7H 3D39E 3O3UN 2A9BA 4TVPL 2OLDA 3SQRA 1R3IL 3DMMD 2VLJD 1I85A 4K3GA 1F86A 4GBXD 1EX0A 1IBHA 5H4YA 2HLFC 2XWZA 2MKWA 1NM4A 1SVCP 2ED8A 3DJRA 3NQKA 3EGDA 4YNYA 3LXAA 5BQ7B 1GS8A 5AYUH 3NJXA 4AL8L 1KPVA 5BO0D 3UADA 5CMAA 3I74A 2Z31C 4DPCX 4ZX4A 5CBEB 1ORSB 4QHPA 1B2WL 4UTBA 2OP4L 4A2LA 1OK0A 1KDJA 1Q94A 5FYKL 5G55A 4R4FL 4R4NC 5IR1A 5EBLB 4OFKA 4TUOB 5L4IA 1SDAB 1L9MA 2CGYA 5LN8A 3SO3B 3BQUA 1ZSHA 3CZFB 5JHDE 1T4WA 2ZNWA 3G3LA 3FC8A 4CMMB 3SSGA 4UQ2A 3B2VH 4TLKA 3VGEA 4HP5A 3CH1B 1K72A 3C8KB 4GP4B 2MOGA 2OTPA 5HPOA 1KEML 5LGHH 1NCHA 5FO8A 3THML 1OSPL 1VFBB 3BWAB 3QIUC 1TEGA 1BIHA 2FZ3A 5CEZE 1AJ7H 4P9HL 3PL6B 4PJGB 1SMAA 3FF7A 1CE6A 1PG7W 2XHNA 3G5ZB 3ARDB 3QUMH 2FE0A 6PAZA 4PGDB 3JT2A 4LLDA 2OI9B 4XNMA 1SLWA 3UJJH 3AB0C 3UEQA 1CDGA 3KVPA 1HH9A 5AW8B 4DVBB 3SQBA 2C3VA 3WE6B 1FH5H 3CN4A 1E4KA 1ID2A 3CQQA 3IXAA 1AR2A 4PBVC 3OAWA 2VH5H 5DCCA 2EDHA 3IWUA 4HU8A 4QNPF 4ZFFA 1FDLH 1M57B 2AC0A 3EDJA 4FF9A 4HG4K 1MFVA 3BH9A 4Z0XB 4MD5B 1E9PA 3OVUB 1EAJA 1FC2D 2Z92A 4MASA 1N3NB 3EHBD 4PJDE 4ZYKA 4L23A 3KPNB 1F2QA 2YXVA 4OSUL 5KVDL 5TQ0L 4DIXA 3T8MA 2X4NB 4WW1A 1D6VL 1EGJL 1KXTB 4Z18A 3AM8C 1GA2A 2Q7YA 3L2LA 5FM4A 4K94H 2VITB 2C4XA 2FJHB 2YC1A 1GTFA 3EJSA 4PJAA 1RZ7H 4L9LB 3T3PE 2XN9B 1FGVL 3HUJF 4MQ7B 3Q0HA 1QASA 4FCAA 5KW9H 4G8GA 1IBBA 5C6TH 5C0JA 3WFEH 1B6DA 2AQPA 3B8YA 2LFGA 2V37A 4TSBL 5L6YL 4L8CB 4PJCF 4E0RB 2WCGA 4BZYA 3CIAA 1YSOA 3HG0A 5EFIB 5FCSH 2RACA 2BVUA 3S9DB 4FTVB 4WSGA 2OL3L 4MA3B 3GNMH 2LU3A 3IXTB 4TLTA 1N10A 1JUFA 2OYMA 3ZDXE 3PS6A 1OAYH 4MKMA 3BWSA 3FHEA 2NPLX 1VF5C 3DO3A 3LMJL 5D2LB 1P7KA 1U3HA 1DLFH 5EOQH 3WLBA 1FIGH 1NBQA 3RWEB 1ZHNA 4JHWL 4W9JC 3VYOA 1I7UB 2AXFA 3N6YA 3Q9QA 4DKDC 3U30B 2DQIH 3RAJH 1CFQA 2BP8A 4W9KC 4ZPVA 5I1HL 3IFOA 4NI3A 1JZ5A 4GAJH 4OCXH 1FZKB 3T2NH 1A6PA 3PPSA 4OW6A 3U9WA 4TQEH 3GIVB 3NJJA 5CD3B 2VERN 2B2XH 3UTZA 1I53A 4M6ML 4BRVA 4FFTA 1FO0B 2BP0B 1G6RL 1T5WA 5IFAH 3GXNA 3V0AC 4MDJB 2PWGA 1XDTT 3KYKL 4Q9RL 1P4UA 2HAZA 3ZYOA 1OD7A 3MRGA 4FNLL 3E8VA 4D3CH 2OMWA 2X4RA 2EEBA 3R8QA 3VB9A 1S7RB 2V0AA 4N3UA 4JO5A 1MCJA 2ZXBA 4ORGA 3MNVA 2MOVA 4S11A 4GRLD 3HR6A 1NLBH 4Z7OF 5J89A 4HX1B 5F1IA 5M7QA 1IRAY 1WQVT 1O6SA 5GRUH 1KJ2L 4AYDC 4TRPL 4XP5H 2Q3AA 4OF7A 4OZHE 3P4OA 2W5PA 4FZ8H 1QR4A 4MZ2A 1V7ML 4HUWA 3MBEA 1FUNA 2GI7A 3DPBA 4K4KA 1T83A 1FAIH 5ESQA 1NEUA 4NFBA 3GJEA 1E28B 3OKOA 2IWEA 3DI2B 1NSNL 5IQLA 3F2LA 2J20A 1ES0B 2H2SD 2EEAA 4WTZG 5AOZA 8FABB 4X7FC 1WZLA 1J5CA 5HDWA 1CQKA 4GI9A 1MJJA 1ECZA 4JN1L 5I1KH 3VD5A 3WXWH 1X5XA 2RHEA 2YRBA 2Z3FA 1CDIA 3NJGA 4JZNA 4MCMA 4ACPA 3CPLB 4HS8L 3IETA 4NC1C 3VI4B 1LK3L 5BV7B 1BGXL 4M3KB 1DP0A 3GUTB 4YIQB 2GSIA 1OAUH 1XF5B 3BLKA 1AZRA 1DDHB 1YMMB 2ATPB 3FU8A 1G1YA 1MCLA 3CQPA 2EEXA 4K0OA 3DSFH 4GXVH 5KJ4A 3MLPA 1NBYA 1LE5B 1XCQA 4NO0B 2WWMD 4QF1A 3RPBA 2HFGL 2BIPA 2GJ6A 2MEJB 1UCBL 4K5MA 1HOCB 4B53A 4NGHL 2APTA 3OPZL 3Q6GL 4OCSH 4Y4FD 1YCSA 1AXSB 3FCSB 4WW2C 2W8CA 1NBVH 1H3PL 4X6BB 2WN3A 1YEDA 2YO3A 3WJLA 1LE9A 3ZUNC 4J4PA 4AYFB 1BZ7A 4W9LC 1IAIH 2CHXA 1KGUA 1TCMA 3QARA 5EORL 3NJFA 1LMKA 1P4IL 5HXMA 1RIVH 3GRWA 4BSWB 2GG1A 1N59B 3NFNB 1KTKE 3KXFE 5DJ8B 2PYEE 3U36B 2GK2A 4WCYL 4Z1PA 2WVSA 2VC2L 1B4JH 3WL9A 5I0ZA 1JXGA 3QGVA 1T6BX 15C8H 4KKRA 4A7UA 1PZSA 4GMSL 2APXA 3Q8EA 5C3LD 4N3TA 2VZSA 3RWJB 1TJMA 3KPQB 1UM5H 1V10A 4MQXD 3F12B 1KGCE 3ULUF 2A6IA 5I9QC 4NHUA 5CBAB 2A6JB 4P2QE 4XWGH 1EXGA 4EZMA 4TNFA 5D2NE 2V5SA 2MCG1 4TPRH 3RVWD 5D1ZI 1E9QB 3LRSB 1EAPB 4OLVL 4WIQA 3VJ6B 3C87A 3IAGC 1YUHA 4NNPH 2KERA 5I66A 4IGBC 2EXYD 3GRGA 2EDWA 1K6QL 1CN4A 5KS9B 3FFDA 1GKEA 1UC6A 4LOVA 1H8OA 25C8H 3QUXA 5DD6B 3OSVA 1S5IL 2JKIS 5E03A 3RX9A 1BQLH 4Y1AA 3W9EB 2BFGA 4BE5A 5JPMB 5C2UB 3MRFA 1WISA 5BMFH 4EI0A 2IADA 3PWPB 5HYFA 4OLUH 1OY3B 2VAJA 3MGAA 3NEOA 3L95B 1J0KA 5J9PA 3EF4A 5D5MF 4M6OL 4GRWE 5F7EL 3WCYA 2V2WB 4DW2L 3OXSB 4HGMA 2WXKA 4YDZA 1FVDA 2APSA 1C9SA 4E5XB 1DQQA 4PV1C 5EEWA 3DPDA 3O2WH 4JO1H 1E8ZA 2EXWD 1PW3A 1D6EA 1TQWA 2DKSA 4K2UL 4MX7B 1WT5A 4PWFA 4QOKB 4XMPL 5D4HA 2E7DA 3N85H 2Z7ZA 2YD7A 2EIZA 3IGAA 3RRQA 4NP9A 4BZ1A 5FYJE 4F7CA 2OBGA 4N8VB 3GMNB 5F88B 3Q5TA 1UJTA 2R0ZH 1SOQA 2VLJE 3NP3A 3QQ9C 4YDJA 1SZNA 2VZVA 5D7HA 4E9YA 1Z9OA 5B8CB 5LNGA 3MREB 2FEDC 4OT1H 3SBQA 4DO5A 2PTUA 3CDZA 5A16B 4W4OA 1DL7L 2E86A 5SV4A 1BPLB 4XPBH 4P2OC 1K5NA 4NQSB 3MJ7A 3ZTJH 3ZE0E 3QW9A 2PWEA 4EMZA 1IIIA 1Z6JT 4Y2DC 1XGQA 2CCLA 4HEPG 4JJHA 3FO2A 3GMQB 4DH2A 1JXFA 1D5XA 5FHAH 3B7TA 3E1F1 5AYUL 4ABWA 3K2MC 3OKDA 1CICC 5CU9A 3WUWG 3VFNB 3X12B 3GIZH 4NKQB 5IIEA 3HS0A 2H8PA 4ZOBA 5B21A 2H47C 5DHXB 1NFIB 4QT5A 2Z4QA 2QJDA 1ZV5A 1X5IA 1AMYA 3E2HC 3LPFA 2YD8A 3FOLB 2H26A 4RWHA 1Z9MA 3O2DH 5IGXH 5JW4N 2WVVA 3HA0A 4G80A 3FOMA 4IRJD 2HLAB 4AIZB 2AQTA 1IC5H 5EOCJ 4BFKA 4ODSL 4OKVA 3B2VL 2Z7YA 5IQ7H 2Z1KA 2JWYA 5KN5A 2ZWZA 2WNXA 5LGHL 2ZCKH 2WGXA 3HE6A 1CL7L 4NQDB 1FGNH 4IBZA 3EDEA 5SX5K 2IOOA 4ZO7A 4PV8B 1AJ7L 2PW2A 3RTQA 1RZ8A 1SFHA 4LSPH 5BJTA 3QUML 5FKAB 4AK1A 2GBTA 3JWOC 4ANKA 5C0EA 5BZDB 4ZMOA 1Z9NA 4U31A 3QIWA 1AO7B 1HFUA 4MCYA 5ADOH 3T0VA 1J0HA 1FH5L 4HLJA 5E2VH 1U2HA 3LS5L 3EAKA 5I15H 2G0LA 3TIEB 1MJUH 4ZFOA 2K1MA 4XCCH 4Y4KB 3NJMA 4WI6A 4HUVA 3CV5A 3L81A 3KDMA 4J5VA 3S5LB 1W72B 2F54B 2F7OA 3T6WA 2V7NB 1RFDL 3F7KA 2NW3B 5MHSD 1SEBA 3VFSB 4JE0A 3SYCA 2O5NA 3UTTA 1D5BA 4MMZA 3GS7A 5AVSB 1QR1A 1MFUA 2ATAA 3KH4A 5EN2B 3L13A 2D7QA 4FG4A 1R17A 1CTNA 1QBMH 4K8RH 4XPHL 1LP9B 3CFDA 1XT5A 2DI7A 5FUCC 4U1LB 4JFED 4F93B 5T1DL 2B14A 1C5DB 2E9JA 4K94L 1ZHBB 2QMKA 3MLTB 3MUGB 3IDYB 1YEHH 1BZ9B 1RZ7L 2HLEB 4LVNC 3LSOB 1DCLA 2NW2A 3FO1A 3IFPA 2XX0A 5HYQB 2MKLC 4KZCA 5KW9L 3VD3A 5C6TL 4GLRI 3WFEL 1PD6A 3ZHFA 2W60B 3FZUD 5EBGA 1KTBA 4R7DB 4XNQA 1RUQL 2BVTA 1EFXA 1Y6NR 4P2RB 4NZFA 1MCNA 2DQTL 3S3BB 4PI2A 4R3SB 2FGWH 1WTLA 3U4EA 2C1OA 3GNML 3FONA 5DRNB 3BP4A 1CTMA 3TJHD 3WEMA 3IDIB 4EI5A 3SE3C 1ZANH 4F1SA 2ZXCA 4WTXA 5K93A 5HDLA 5HGHB 5EOQL 4BA8A 4PMFA 3QISA 1DLFL 5IQMA 1FIGL 2DEXX 2LLGA 1OO2A 2Z8SA 4HIJA 4XH2B 3V4UH 1MXDA 1IVLA 3WKMH 1KB5H 3QSKB 5DYFA 4PFEA 3P4NB 1UB5A 2DQIL 1AGFB 4LCCA 3N42B 5E8DH 1PG7H 5EC2A 5IOPB 4FQJH 4KRNA 3SGEH 2AS5M 1MELA 1DZBA 2E9IA 4OCXL 1KN4H 3T2NL 4AQ1A 1CFSA 4TQEL 4L8DB 4XXDB 4Z5RA 4ONGH 1WBXB 2B2XL 1AXIB 3O6FA 2CDEB 1DDTA 1N18A 4LASL 2WGNB 3ZZSA 5IFAL 4IBQA 3BAIA 1G7QB 2OXHB 2CWRA 4QHLB 4Y5YB 3GXUB 3QUYA 4DUWA 2C7FA 1FWXA 3B3IB 3EYSH 4APQB 4G3YH 2MRYA 1II4E 1NLBL 1XVSA 3SKJH 4CADA 4NFDA 4AGPA 1PYWB 5D9SB 4BYHA 4XP5L 4NJ9H 3TO4A 2UWEE 1FVEB 3BZDA 4FZ8L 2IFFH 1PD0A 4PJGF 5MEPB 4UUJA 4L8SC 4G6AD 5DT1H 2VXUL 3Q01A 3ZY7A 4U7KA 3EBGA 1NBCA 4M4PA 4P5KB 1XHHA 3BXNA 4U33A 3RU8H 4M8QA 3ARFB 3BVDB 2DF3A 4I77L 1JGDA 2PCXA 4M6NH 5D7JC 3QEUB 4KDTC 1W80A 1JG9A 4ZAKA 4H44C 4HH9B 4DCQA 1XXDC 4W93A 5ISZA 5I1KL 1AZBA 4GSUA 4X5WA 1GL4B 3WXWL 3GZPA 1U2YA 4YHOH 3CN2A 4ABUA 5CIPB 3C8HA 1SXSA 1A2YB 2R23B 1OAUL 3QZBA 3ZO0A 1UATA 3MN8A 3UBXA 3ZMRA 1PFOA 4JPVL 4GXVL 2QQNH 3ROLA 4RZKA 1S3KH 4JFFB 4JCMA 1UYWH 3EJZC 1ZLUH 4OCSL 1T2QH 4JJ5B 2X4OA 5LGYA 1NBVL 4LVHC 3G5XA 3S37X 1JTPA 5LJYH 1P4LB 1XD0A 4Y5VA 3QRBA 5TE6H 3ZBMA 3F62A 4G7SB 4OJFH 1QSEB 1NA8A 4ADGA 5CCHE 3IJ7A 2UYLB 4JVPA 4KVNH 1RIVL 3TVMD 3BN9C 4Z7UE 5IUCA 3WFZA 2X6VA 3QPQC 1SXNA 5K1JA 3VD7A 1OF0A 5IJCC 1CF8H 1BD2A 4H0GA 3QNXA 3SDCC 3MR9B 4W9CC 1B4JL 2C1PB 4L3FA 4V33A 2O5YH 15C8L 3SE9H 1QO3A 1JWSB 1G7LA 1CGYA 3IBOA 1U4FA 2XA3A 1UM5L 3DV6B 4FGMA 4KK9C 4YC2C 1TQVA 3RPIA 3FRUA 2EP6A 2ILLA 2J4WH 4P5TB 3NACH 2ZUUA 4XWGL 3NFPB 4X6DE 1EBAA 2VL5A 4I1PA 4MLSA 4XNXH 3AWFA 2WSKA 5DJDA 4TPRL 4H2CA 4K07A 3BOVA 4AV5A 3LPOA 1X9UA 4NN6C 3ZL4H 2PO6A 4NNPL 1MHEA 3HE7C 3RY6A 1J05B 1KYOK 5AVRB 4IU3B 5DVNA 3D9AL 1KFAL 1T0NB 4G9FD 4GJTB 4UZUA 1BQLL 4H8HA 2DYRB 2ZUSA 2CCVA 4AX3A 2X40A 4XP4L 5E6IA 1PIGA 4R97C 5BMFL 3VH8B 3DOSA 4XWOC 4GAAA 4M7LL 2WKGA 2EE9A 3E0GA 3H3KA 3MRJB 4HF5H 5ANMB 1KUMA 2FDBP 1AR1D 1BM3H 4L8BA 4PH8A 3RNKA 4AEFA 3O2WL 4JO1L 4XXWC 7FABL 4B3EA 3ESMA 2ZWNA 3E9UA 2PABA 3N85L 4JQXC 1GGCH 3MPCA 4NRYB 4CNIA 2UV3A 1T0MB 2WWOA 3DSNB 4EUPB 1G0XA 3EDFA 3HB3C 4PVNA 4RAUB 2R0ZL 2BSTB 1CXLA 4X5LA 2WUCH 2LQRA 3C60A 3U1QA 1JF6A 4MQSB 1I9IL 4OT1L 4BFNA 4EF3A 3I6SA 1HINH 4JPSA 1FV1A 4PG9A 2XQYA 2PPAA 4XCNA 4XPBL 3O6LL 1LEIB 1KCWA 1AS7A 3Q06A 1GIGH 2Q3XA 3AQXA 4F7KA 1D5ZB 4LLYB 5T5NG 4MD0B 2OPCA 3H4FA 4HZLA 2PXYA 4X5XA 3VGAB 3TN0B 2EJ1A 1N4XH 2WAQA 2B4CH 3ULUD 1QI5A 3VI4F 3WS3B 1OIOA 2R2BB 1L5GB 3M8OH 1FZOB 2B0SH 4HKZB 1NCAH 2FSEB 1N0LB 1X4XA 3EYUL 2F19H 3RQ3A 3GJFA 4NQCD 1ZGLP 3D12B 1YN7B 3FQ1A 5D1XB 4KWUA 3APCA 3T0XA 4A6YA 4ZODA 4KXZI 1FG2A 5EEXA 2XVGA 3IJEB 5KOMC 2YRLA 1O7VA 1U8JA 1UACH 1FGNL 2N59A 1TZAA 3ULAB 4WNQA 3BZ4B 5CR1A 1JD9A 2FYYB 4WVRA 1U0QA 3H9SB 4V2BA 5EU4B 3A4AA 4NWUH 4LSPL 1EZVX 2P5WB 5ID0A 1XCTA 3C5ZC 2ZQKA 4JRYA 5GS0L 1VZIA 3L3KA 4YVUA 4PCYA 3HIZA 3DX0A 2YAHA 4PJ6A 3ZE2F 2Y22A 2Y2YA 3PHAA 5ADOL 5E2VL 3SGDI 1BQ5A 5LO7A 5I1AB 2BM3A 3U7WH 5I15L 4QUOA 1MJUL 4NAMA 4BH7B 1G7JA 1RMFL 1KCRL 1IAKB 2HWZH 2LLNA 4K9EC 1NKGA 4GOSA 4YLBA 5MHSE 1MWAA 5A1AA 2CR6A 2FECL 3JV4A 1FNLA 3FN9A 1EO8H 3EJQA 3MROB 4F80A 4P57A 3L7EB 5DQ9A 3VI3B 1BSIA 2ZXAA 3EGDB 3GD1C 2BHYA 4QLRA 3VXTB 3ET9F 3HLAA 2BNRA 4HJJH 4JFEE 4K3JH 2H2PC 3FQWA 4L0ZA 1CDUA 3HMXA 1BAGA 3TEUA 1MI5B 1OTUD 3LEXA 4IHOA 3NOIA 4IJTA 5IR1B 1QBML 3US0A 4K8RL 2CO4A 2D2OA 3GSNA 1SFDA 4JZOA 1AS8A 4XE5B 4YAQA 5JHLH 1EXHA 3LNHA 3L4WA 4HIHA 2FO8A 3QR1A 1V3MA 1YEHL 3L4UA 3QORC 4AEEA 3FUNA 2RB8A 4UQ2B 2J8HA 3FT2B 4Y88A 3T6ZA 1PX8A 5IEKA 4KK6D 4BIKA 4OB5H 4A63A 4N0CD 1PY4A 3N55A 1YY9C 3GQFA 5D1QD 2OMBA 2FZ3B 1AKJB 5JYLA 1KV3A 2KZ1B 3V0FA 3QXAA 5CU5A 1I1AD 1CE6B 1JV5A 3I50H 4YHPB 5HI5D 3U2JA 2QGEA 2M83A 1SGKA 3AVEA 3O0LA 4IOSA 4N68A 4XZUA 2Z0UA 1HH9B 1ZANL 3B2UC 3EKCA 1RERA 1DBKH 3SQBB 4L29B 1RKRA 4PJIB 3VGGA 3UEZA 2AGJH 2AJ3B 3QUZC 1ASPA 4N2NA 2QELA 4LSSH 2YRPA 4QRTA 1KGXA 4FRWA 3VFVA 4IRZA 2OYLA 3MXVL 3V4UL 3WKML 3CZEA 5I6MA 1AIFB 4QNPE 2ERJB 3P02A 4ZFFB 5E8DL 2WPGA 3VD1A 3JBG7 1T22A 3WFDH 1PG7L 5I2IA 3MODH 4FQJL 4PVBA 4KZDL 3BH9B 4MGXA 3UAJD 1HHHA 1L7TH 4POZD 2RCSH 1KN4L 1XR9B 3TYGH 1S7VA 3P0YH 4HD5A 5D4JA 4OIFA 2VAAA 1FCCA 4ZYKB 5DF0A 1KLGB 2J1ZA 1IAMA 3CGTA 1QRKA 4ONGL 1MVUB 3ZO9A 5ACZA 3VWKC 2R51A 2XVLA 5E00A 3W37A 3HZMB 4PLKD 4MXQC 4UNTA 3CDFA 4WW1B 4XTRC 4IM8A 3HHMA 2O5XH 4JKLA 3V0IA 1OLLA 2YC1B 5EC1A 1FL6A 4R9HA 4PJAB 1T0PB 4FQ1H 4ZMTA 3HUJE 2EDXA 3DK0A 4FXGC 4G1EA 3IGKA 3EYSL 4Y19A 2XTJB 4G8GB 4Q74A 3HN5A 3ME0A 3W5MA 3ZTJG 2VL4A 5C0JB 1C1EH 4IBYA 4JDEA 5ALBH 1ET8A 4FHBD 4PJCE 3RTQD 3SKJL 4NB7A 1WTGT 4S2SA 2G5UA 1N0XH 1VFOA 4S1SH 4NJ9L 3VFPA 5C3IA 4J3OF 4WI7A 2IFFL 1HKLH 1T5XA 4HPOH 5DT1L 1JUFB 1PVHA 5DFWH 4BK5C 5F9AC 5CJ8A 3ES6B 1MCOH 4PRIA 3RU8L 4BQ6A 4BQ8A 2KHAA 3O8XA 3QJSB 1E6JH 1P7KB 4A7GA 1M2VA 3R4DA 5J0BA 4M6NL 1NDMA 3JV5A 2CJTA 5F89B 1A25A 3WHXA 3IT8D 1IEBA 1AQHA 5I28A 4N8CH 5D93B 4DHLA 1FFOA 3QQDB 3QZWG 1BYPA 4EDXB 2BP8B 2UVFA 1YRKA 4ZPVB 4YHOL 1TVHA 3X3FL 4M7ZC 3MUY1 3RHWF 3OV6A 1T21A 2EKSA 1UJ3A 2OMYB 3UYPA 1TF4A 3WTVA 1SQMA 3G6JA 2A4ZA 4A7TA 3GYRA 2X5PA 2GSGB 2AQQA 2QQNL 1GOFA 3BWUF 1S3KL 1ZJAA 8CGTA 1HX0A 4HWBA 3BVUA 3D0AA 3MRGB 1Z7JA 2OMWB 2X4RB 4AZ8A 3BKMH 4WI0A 1T2QL 4NEHB 2NNAB 2IQ9L 4ORGB 3SD5A 5JHMA 1T1ZA 3N3EA 1WWCA 1JNHB 3EYVB 4LFHD 5G2NA 5TE6L 4Z7OE 1H9DA 4HJTA 4Z3JA 1O6SB 5EZIH 4RDQF 3JWDH 2DYPB 1OAXL 2XYCA 5JW3H 4KVNL 3P4OB 2ICWI 2EC9T 5EA0H 5D7EA 5T3ZH 2Y7QA 4HUWB 3NCYP 4XBMA 4KRMB 2YD3A 2CKBL 1CF8L 1KGJA 4I1NB 4W70A 5TDNB 3IN2A 3K6SB 2HT2D 3ALPA 3CFKB 1JZEA 3G5VA 3US9A 2O5YL 3SE9L 4Z3TA 5I19H 1JXJA 1YNTB 3TO2B 1DEDA 4IKIA 3ARDD 2VMDA 1QI3A 2BSEA 2X6UA 1U92B 3OBAA 1AI1H 1W91A 1MJJB 2BIMA 2J4WL 3B8SA 3WO3B 3KS0H 4KRPB 1JZ7A 4XNXL 3N42F 5FYLD 3JWNH 2FL5A 3IETB 5J8OA 4MNQB 2R1XB 1PSKL 4G9FE 3T71A 3P30H 4KQ3H 4N1CA 1L4IA 4XT1C 1EWHA 4ZMPA 5J11C 5E9NA 3QPXL 2KS0A 3IWVA 4FFWC 1S7UA 2C34A 3ZQXA 3C2AH 3ASNB 3G6AA 2GJ6B 1A7RH 4M8RA 1RZIA 3UXFA 2VDMB 3OJDA 2UXTA 1N2RA 3SDDC 2H9GA 3GHPA 1XR8A 2EABA 4NZUH 4CUCA 2JCWA 2XV3A 1D7CA 3PNWA 3ZGHA 1AHWB 1G6RA 1UXWA 3RUGB 4ELMF 4Z7VA 1CE1H 3FFCB 3IPBA 4HF5L 4MDIB 1OD9A 1BM3L 5CLTA 2VRAA 5CILH 5LKNA 4J3TA 2Z93B 3ESVF 3I75A 3SQOH 4G8FB 2VDKB 4Y9EA 2DM7A 3JZYA 3MA9H 1GGCL 2EXSA 4F2MB 2XN9D 2DTMH 3GEFA 1LWJA 4R6UA 4WKZA 4KK8C 4LPTA 4JN2B 1D9KC 3WL9B 3ZTDC 1ZHKA 3QDMA 4XXCC 3WUWA 3V6ZA 2WUCL 4XCEA 2A1WH 3IGFA 5C07A 5TE7H 1HINL 2BK8A 2YK1H 4ZAKD 4FTVD 1FG9C 4P5MA 2G2RA 1TO5A 3H42L 2B1OA 1J8RA 3EH1A 5ISZD 2WD0A 1UFGA 2A6IB 1COBA 2DI8A 1GIGL 3OB0H 4FQXC 3ULUE 2GIMA 4NHUB 4F20A 1NFKA 4G9DA 1BVKA 5JXAH 4RMTA 2W59A 3L3DA 1MRFH 3RTLA 3MMEB 3MLWH 5EHFA 4DQOH 4FNSA 3P1VA 3V5HA 4OLXH 2PPEA 4NQCE 1XF4A 1CVSC 2B4CL 1YUHB 3KE0A 1BIIA 2VWEC 1KBVA 3M8OL 4XOBA 1A7QH 4PJ9C 3WEXA 1T1XA 1INQA 4Z7VF 3FFDB 4KX9A 4LQ1A 5SWQA 3S3CB 2F19L 3QNZB 3QUXB 2R2CA 2HYMA 3BSHA 4M1CC 5A2KH 4PJ8C 1EA9C 4WU5A 4Y1AB 4A2EA 5EUOA 2EDLA 3MRFB 2GJPA 2OULB 2YAOA 3T0WA 1J9TA 3UO1H 4JVWA 4TL4A 5EU6D 2F61A 4G72B 2YR3A 5GHWH 1WS7A 5C0FA 4HUXB 4G8IA 3ILQC 4FFZH 5D5ME 1Q90A 4J12A 1RUKL 3CLEH 3WOVA 2B3IA 1UACL 4A67A 2R27A 5L4MA 2Z65C 5F7MC 1TLMA 3L8QA 1D6EB 5J6HB 1WIUA 3NRPA 1AGDA 2K6WA 4CN6A 1WGVA 2EIZB 3IGAB 1H8NA 3FU5A 5GJSH 3W0WB 2EIBA 2H3NB 1AH1A 3BGAA 4NUQA 3MLXH 4NBZB 4YDJB 5E4IA 4YX2H 2BSBA 2FLRT 2VLMD 3DO7A 4NX0A 4XN7A 4ZQKA 3QNYA 3RVUC 4Q8BA 1N5AA 4CDHA 1AD0A 4HH8A 3SDCB 1K5NB 3A47A 4RMSA 3MJ7B 2A77H 5DI8A 1EO8L 1ZJBA 4Q6YA 5L2KA 1L7IH 3EGXA 4Z7QF 4XI5D 4DTGL 2YGQA 2HUEA 1KJMA 1F3RB 3OHXA 3BPCA 4HJJL 1I7RA 3OKDB 4K3JL 4NO3A 3SJVA 1TVDA 4JAMA 5CINH 5IIEB 5JHAA 3Q3GA 2H8PB 2Y36L 3DTDA 5F3HB 2Z4QB 2GI0A 2R69H 4H5SA 2XACC 2H26B 1A6WH 1EJ6A 2WVVB 4G80B 5CZRA 1FFPA 5JHLL 4MJIA 4NN6B 3W1ZA 4LO9A 4OY9A 1A4KA 1HH6A 1KBKA 5D1QE 5I1GH 4J7RA 2ZYSA 2IAND 1YMMD 3A24A 4Q58C 1KCLA 2PYFA 4HG4J 3NIDB 3SB3A 4Z7WF 5KN5B 2FH8A 3RFZC 1U8MA 5AAWC 5TF1H 3HC3H 1K4DA 5L2JA 4F8QA 1IM3B 1F6FB 5A6IA 1OF2A 2AQ3A 3NPSC 5MEQB 4OV6F 4BELD 3I50L 2X0VA 2P5EA 3MNZA 4AGNA 3DGGA 3HR5B 4ANWA 3QYMA 3WIHH 4MNGB 4A2FA 3LRKA 1DBKL 4MCYB 1LDPH 4AYBA 4YHIA 1RIHH 2AGJL 3DA0A 4ZFOB 4L3ED 3IPEA 4WW2A 4MBRA 3FB5A 4U6TA 3ARGC 1BQSA 2GIYA 4UIKH 3RZWA 1DVUA 2DQMA 4MMXC 1QNZH 3QWOB 4YSDA 3WFDL 3KDMB 1S7XB 1OE2A 3MODL 2BY1A 5GZOD 3GZOA 2X2JA 4GLRH 1L7TL 2RCSL 4AOFA 1VZGA 1SEBB 1GZPA 2VR6A 3TYGL 1RL1A 3P0YL 1U8HA 3QH3B 3UTTB 1D5BB 4MMZB 4EI6A 4OJAA 2J6EH 3HZYA 3DXAA 4F91B 3QDJA 1PZ5A 1XEDA 4HD9A 1I8MA 1IGFH 2IH3B 4KJQC 3CFDB 4QR7A 1KV7A 2VQ4A 4E9SA 1PX4A 2X88A 3SDAD 4FE9A 4WY7L 2O5XL 5KSVB 4RMRA 2CKNA 4KGJA 4W9IC 4FQ1L 2HVBA 1CD0A 4N9GA 2KQNA 2R0LH 1MFBL 4KV5F 5TTRA 1CTOA 2OMNA 4Q0XH 2ZJSH 3RDTB 1HNYA 4X5RA 3VVWA 3KVDD 1C1EL 3VXMD 3QR0A 5IHBA 3E7JA 4KXCA 3T4AB 4XNQB 4RQQB 2I25N 5EDSA 4AM0A 2NY5H 3V4PA 2ZNXA 1N0XL 2NR6C 4S1SL 1HSAA 3DX9A 3PWPD 3GRBA 4M7LT 4NN7C 1WEJH 4Q52A 4WW2F 1RPQA 2FJFA 2C1OB 1HKLL 3FF8A 3FONB 3MBWA 3BP4B 4Y0GA 5I18H 1CI3M 1MCKA 2BSSB 3DHMA 4HPOL 4EI5B 4WK4B 1MCOL 2UZPA 5F6HJ 3MKKA 3QR2A 4FCHA 2IH1A 4NI6A 4NQVA 3SYAA 4POUB 3MV9D 1E6JL 4XNYL 3BP7B 1JWUB 1B0WA 5CD5C 5KANG 3C5ZB 3T9WA 3Q2WA 1A6AA 1FFTB 1YYML 1FO0H 2ZSWA 5I74B 4HGWA 1AKPA 3GSQA 4N8CL 4OZGF 5EC2B 3VMNA 1KMGA 1XO8A 2PMZA 2PKDA 1VGKB 3BCFA 5F0JB 4JL2A 4ODBD 3SPHA 5DSCA 2V8LA 5C0ND 1QLFA 2OMTA 2X3CA 4AQ1B 3VI3F 4QRSB 1U8PA 2CPCA 5ICXA 4Z5RB 3D3VA 4ZSOB 1Z3RA 3EZJB 3WV0A 4B60A 3GSXA 3QWNA 3QULA 1ZT7A 3AUWB 4NC2B 1S4IA 1IGIL 5C08A 1V55B 5TK4A 4ZZFA 2NDFA 3FK3A 3BKML 5ADPH 3V0VA 2ENQA 2PW1A 3V0JA 2YGVA 3BSZH 4MJ2A 4FOMA 3NIGF 5DMKB 4PW3A 5C1MB 1HI6B 5TQ2H 2FIKB 4CADB 5EZIL 1S7WA 2OZNA 3JWDL 4JFVA 2E8YA 3EO9H 1JN6B 3TO4B 3PWNA 2OMUB 4IRSA 4KRLB 5EBMB 4PJGE 5EA0L 5T3ZL 2CQVA 3WGUB 1DUYA 1YECH 5CFAA 4YBQC 1NC4A 3ESOA 4M8QB 3DRTA 5I19L 2CDFB 2Z1PA 4J3OD 5D7IA 3HI5H 1KULA 4U1GC 4PJIF 4YDLB 2IJ0C 1Y6KR 5FYLE 1JGLH 4WTWA 3U82B 1AI1L 4OF0A 5C0DA 4DCQB 2ZP9A 1JPSL 4JDZB 4MTMA 3TPUA 5E24E 4X5WB 4DN4H 5MENA 3U48A 2ENPA 3GS0A 5KOVC 4PU2A 1WICA 2Y5TB 3FQXA 3MCYA 5IMMB 3W2DH 3FCBA 3QHFH 2D4DA 4NO2A 4I3RH 1UM6H 3P30L 3MFFA 3VXUD 4FEIA 3UBXB 3BH8A 4NBXB 1LO5B 1R5VB 5FKPA 2BWIA 2F54D 5DRXB 3V6FA 3C2AL 4DERA 1LNUA 5FECB 5CXPA 4LHUB 3VX1A 2ZWLT 3FO9B 3RVXC 1U93A 3VWKB 5IJKA 4GRWH 3V0EA 2W0FA 4U6XA 4NZUL 3QZMA 2X4OB 3OQRA 3WIHA 3ZYZA 4CVUA 5K9JH 4M1GL 5JW4R 4DFHA 2Y7MA 1QLEB 1CE1L 5CSZA 1DN0A 1Z5LB 2XN9E 4GS7B 4X7TA 5F93C 1E7UA 3UAEA 4QRRA 4ACTA 1MCIA 5CILL 3V9EA 3IMVA 2K7PA 1JZIA 5LNEA 3BRGC 5FYJH 1ADWA 5IF0A 1P1VA 2VISB 4C56A 4U4BA 5CSBA 1LWHA 3MA9L 4AW4A 3DIFA 2PCYA 2BCKB 2OV0A 5BZWB 2DTML 3AQDA 2UY6A 4CGTA 4FTVE 4X8GA 1BD2B 2CO3A 5B1CA 3C5JA 3V8OA 5ISZE 2WLIA 4DEPB 1U58A 4UF7C 1AOZA 4DKTA 3UACA 2V7HA 4XR8C 4Y16C 2A1WL 3PQYA 4JFTA 4NJAL 3KDPB 3TEYA 5TE7L 2VZOA 4BSJA 4BCZA 1E8YA 3CFIC 2YK1L 3PYCA 5J1TC 1KG0A 1JZ8A 4KFZC 2YD9A 4YXLH 1S9KC 2NUPA 1BXVA 3GLZA 3NYKA 2LAAA 3FRUB 4H8WC 4JGMA 2P8PA 5JXAL 1IC0A 5GIRA 2P8MA 1MRFL 2F7QA 4X6FA 3MLWL 1TFPA 2FQGA 4OLXL 4YXKH 1MHEB 2HJLA 1GPOH 2BOCB 1A7QL 5EU6E 3QPKA 1TENA 4UNIA 2EZ0C 3L08A 4UTCA 5H94B 4C83B 5JZ7C 4QHUA 3ABZA 4XHJD 4FKEA 4OZFB 2PCFA 3S36H 4LPUA 5E6IB 2I24N 4UM9A 3LAFA 5GHWL 3KYNA 2HLFD 3B9DA 3CVBA 2VZTA 1M56B 1KTCA 2B77A 3GZKA 3V95A 2HB0A 3QEQA 4RNRB 5CEZL 1UT2A 4BJLA 3TEZA 3CLEL 1T89A 3QQ3A 4O58H 3TCLA 2VLLB 2Z31D 2O5ZH 4GKOA 5E1HB 3PIQA 5DRWA 1JTOA 1OLZA 4WGKA 3HZKB 4QMEA 2VLME 4R4ND 3W81A 1WZKA 3AUVA 4CNIB 2F53D 3FB6A 3MLXL 4OD3L 3V52L 2JI1A 1BDYA 3TC9A 4EIUA 2E46A 3C60B 5J13C 2WAHA 3LS4H 4XNBA 5DYOA 3EOTH 3UPAA 1XH3A 1UH2A 1BOGB 4NZRH 1YNTF 1HEZB 1NEZG 4AQEA 3QIUD 3EFDH 4P4RB 2A77L 3OM3B 4FQHB 2C7UA 5IFJB 3WNNA 1HYRC 3Q2CA 4KXZH 4WFFD 3TA3C 1IBGH 1L7IL 3WNPA 3NDZE 1UOKA 2VDLH 3CFMA 2DLEA 3SO5A 1G5GA 3ARFD 3S5YA 4HZLB 2PXYB 1X5MA 5FB8A 5DD3L 2Z9TA 2LT9A 3BD3A 1CVRA 1CLZH 2I32A 3VI4E 2WXFA 3OKKA 3QBTB 2H1LM 4NQXA 5CINL 2CO6B 3N9GL 5IJVA 1RJZA 5EO0A 4JPQA 2IANE 1YMME 4RBPH 1YMHA 3NIFB 2VW6A 1E27A 2R69L 1TXKA 3GJFB 1A6WL 4PJHA 5EG6C 4PWGA 4C47A 3SGDH 4DP8X 5KVEE 1ODUA 5I1GL 2D8KA 2AEQH 4A6YB 1DTUA 3WBDA 1AQKH 1FG2B 2H0FA 5F8RC 3RWFA 1REIA 1TEFA 3J2PA 1T0OA 1U8JB 3S97C 4CSZA 3RUGF 3LNGA 5TF1L 4JFFD 3HC3L 2XFXA 2CMRH 3SDDB 1DJIA 4AIEA 1DHKA 1NMCC 3JWNG 4OFVA 1CXKA 4YDIH 3NCMA 3ZOAA 1QMUA 3GMPB 1KBBA 2P24A 4YQXH 1QVOA 5ID0B 3VTAA 3ECBA 4L3EE 2ZUQC 3L3KB 5BVJA 3C6LC 2J88H 2X4SA 3UCRA 3A21A 1W6WA 1KZYA 3ZE2E 3LKRA 3GHEH 1LDPL 1QACA 2VKWA 3B5TA 4FNPA 4HKXA 5KTEH 1RIHL 4KPHH 4GIPD 5HD8C 3JVFC 3T4YA 1MHCB 3P40A 2VLKA 3C09B 1F4WH 2CLZA 4GY4A 1AAJA 1MWAB 2AQSA 2X1PA 3JVGC 2DV6A 3JXAA 4HMCA 3QE5A 4JM2C 4GKNA 1QNZL 3OLIA 1X6LA 3AG3B 4HV8B 1JGUH 1DVFC 3H3BC 3B2PA 3LRGA 2EDMA 1GW6A 4LBAA 2WVUA 3FQWB 1ZA3B 1EIBA 1VESA 2J6EL 3PWUA 4O2EA 2H6UA 3QIBB 4DP9X 4IHOB 3U4AA 1BPVA 1XCXA 1IGFL 4HS6A 3LIZA 5J6GB 4RH4A 1G9MC 3DKHA 4N5EC 4HIHB 3CH8A 1KN2H 1TPXC 3VXME 4ZZKA 4L3CA 4ZOCA 3MO1B 3QDHA 3AWGA 4MSWA 2R0LL 5TH2B 2VR9A 5DMGC 3PWPE 3QJXA 4Q0XL 2ZJSL 5EZLA 5DS8A 4RGMC 4WEEA 1U3ZA 2RQ8A 3KPOA 3GSUA 5H4ZA 2I9TA 4AGLA 4YSCA 2NY5L 2BSDA 2F7RA 5LAXB 3DTUB 3AW5A 3EBIA 1JV5B 5IFHH 3MV9E 3QZNA 1WEJL 3GI8H 4J1UA 2JCCA 5ID1A 3EJRA 2EDRA 3PV6A 2VB5A 2ENJA 4DP4X 3ESUF 1P7BA 3H9HA 4XP6H 5C09A 3WAJA 2ADIA 2WK2A 3SKMB 4QRTB 1IM9A 1ZT1A 2TAAA 3VFVB 3UOAB 4YPJA 4WI2A 5FF6B 5DJ2A 4TUJA 1T22B 5I2IB 3IFNH 4XXWA 4GT0A 1QZNA 2D7OA 3NCBB 1F58H 1HHHB 1G1CA 1NWOA 2Y6TE 4FHJA 2E4TA 4YOKA 1I9RL 1S7VB 3S88L 2FQDA 2P46B 2VAAB 4OQTA 1WCBA 2VW4A 1VCBC 4FG6C 4B7IA 4KXBA 5EU3B 2OTUA 3RA7H 3L54A 4JS7A 1F3DJ 2BZDA 2IOIA 1TCRA 1NGYB 3O45A 4PGJA 4LP8A 3RY5A 3CD4A 3GLEA 3MVSA 5ADPL 3B43A 5E6SB 1NUNB 1BECA 4Y19B 3TL5A 3K8KA 1G43A 3ME0B 4H8QA 2HPTA 4G71B 3B83A 4JDEB 1GZHC 5EO1B 1M2OA 1PEZA 1T80A 3QEGH 1N5YH 1M7UA 2C8NA 5D1XD 2CLVB 2DEWX 3EO9L 2NY1B 3IU3A 4OUUB 3VFPB 2XNAA 4HCRH 4IIQB 4LVOB 5GS1C 1YHPA 1ESOA 4L4TB 4XZ4A 5EEUA 1T5XB 3RFZB 3WEOA 3WJMB 1ZD6A 3QI9B 3BEWB 5FIEA 4PRIB 4JG9A 3O8XB 3RGHA 4XMUA 1CD8A 1HIMH 3B9KB 1KTLB 4HWZA 4HKBA 3HI5L 4KDWA 1OGAD 2WP3T 3WTXA 4PJEF 5CEYB 3RI5K 3SDXF 1JGLL 4MZIA 2WXQA 3TU6A 4ORZC 1JSYA 4LOEA 2AI0L 3CHXA 3NPZB 4J3WA 1O9WA 4BKSC 3VXUE 4DN4L 2ESVA 4CU6A 1TLKA 3HBQA 3S35X 3OF6A 4I1RA 2AXGA 4AV4A 1SDYA 2F54E 3UYPB 5DJZA 1UJ3B 3KLLA 3GTVA 3BPNB 3QHFL 4I3RL 1UM6L 1CIDA 1KPUA 3A67H 3G6JB 4D9LH 5IB4A 2OQJB 4N0RA 3NVQA 4X9GA 5H8DA 1F1DA 5ENWA 2FWOA 3B7RL 3KLKA 1NDGA 5IMLA 4AC2A 4QXTA 1I9EA 5IVZB 1R9FA 4P59H 1F56A 2A6DA 3CHOA 3NABH 5IROC 3RL2B 3UBHA 4WUUA 4AZ8B 1MW3A 1BXXA 3ARZA 4MMYA 4WI0B 3T1WA 1ONQA 4YBLB 1FZJB 3KGSA 5K9JL 4CN4A 1FRGH 4X6CB 1T1ZB 3LVTA 1DBBL 4I0KA 1BVZA 5FM8A 2CLRB 2A2QT 3RE0A 4S10A 1S9YA 5FYJL 1CDCA 1Y07A 1D7BA 4IGBD 1K8DB 3ZW3A 1SJHA 1HL5A 4XVSH 4JQIA 5E0FA 2ZCHH 4H0LC 3KBFA 5FUZH 2Y7QB 3VGBA 3V55A 5D55A 4FERA 3BAWA 3G04B 1CDHA 5AEAA 5D96C 1X44A 2W65A 5LBSA 1RHFA 4NKDA 2Q8AH 1AKJD 2R29H 1G4RA 3OB0K 5TDOA 3ILDA 1H15A 1G7IA 3QORA 5DZAA 2OL3B 1JYWA 1MJ7H 3FT9A 2R56H 1NGXB 3VTMA 3UTPD 1KYUA 2LABA 1KLFB 3QNFA 2G5RA 1X5ZA 3BIKB 3I9PA 3S3PA 4YXLL 5F2FA 1JF5A 1EQWA 1E40A 4G1MB 3JSSA 4P99A 1O0VA 3U7YH 2FL5B 1PLCA 2QSVA 5I1LA 4JKWA 1J8KA 1YA5A 3D3VD 1ZPLA 2W95A 3ZYIA 1BZDA 3MOAH 3P73A 2EYRA 1ASOA 1GPOL 4YGAB 1UD8A 3OLDA 3ZE1F 1FI8C 1CDJA 4AMKH 4N2BA 4YBHA 5AW5B 2AMUA 1FN4B 2A0LC 2FEDD 3IMUA 5DGQA 2RMNA 4R26H 3ULSB 2QQLH 4YHNA 1RZIB 4P2OD 3S36L 4OZIA 1DLHA 4WTQA 2H9GB 2P48B 4MD4A 4JCWA 1G6RB 1UXWB 4Z6AT 4Y2DD 4C8XA 4EUPH 4ELME 1BZOA 4X8JA 3INOA 1XBDA 4MBOA 1R3KA 2O5ZL 3I75B 2F53E 1CICD 3BIBX 4L1SA 3CDCA 3V7AE 4FDWA 1LEGB 1Z9SA 3FU3A 5C0RH 5TD4A 2N01B 3MX0A 1LO3H 4DN3H 3CG8A 5F3BA 5ELIA 1AZNA 5HYSG 2NQ3A 3QZLA 3FS9A 1KJ2B 1ZHKB 3QDMB 2Y2WA 2YAMA 3WUWB 3BPOC 1GMIA 3HG1D 4ILDA 2MHAA 4WFFE 1U33A 2NXYC 5IHHA 2OX5B 3EOTL 3GMMA 5C07B 1QSFA 5KSAC 4JO2H 5IVXA 1EZLA 4P5MB 2CKBA 4NZRL 3CLFL 2HTLC 2CO7B 1QWUA 3EFDL 5EIIG 2O93L 4FULA 4IDJH 4Q9CA 2PR9A 4G9DB 4LIQE 4X4XB 1IBGL 4U1GB 2DB8A 2VDLL 2JIXD 3L3DB 4JQVA 3O2VH 1TITA 3V5HB 4E9XA 1A5FL 1EEZB 2QQKH 1RP8A 1CLZL 3B2XA 1BIIB 4BK5A 1QOKA 3AADB 4KHXH 1S9VB 4OI8A 2CBMA 2Y6SC 4H25A 1T1XB 1INQB 3WEXB 4JFDA 1SXAA 1WLHA 2ZOTA 2BOBB 4Z7VE 1BLNB 1CC3A 3FQTA 1JP5A 2OSWA 2UZIH 3K3QA 2DICA 4HJ0C 4WU5B 3UTSD 2F9BT 1AQMA 3IS1X 3I85A 5AKVA 6TAAA 4JFFE 4YDMA 1R19A 3LEYH 3BMVA 3POCA 1TZHA 5E2WH 2XN0A 1PEWA 3WKYA 5DR5H 4ENEC 4G8IB 5C0FB 5AW9B 1AQKL 1CMOA 2EUVA 2WQAA 3ETBF 1MRCL 2YPLA 3H0TA 1RZKH 2ZF9A 2H32B 4PY7A 2CMRL 1ZV9A 4P46C 1D7DA 4OCNC 5DFTA 4YXHL 3QFDA 2X1QA 4YDIL 4LLWA 3DHPA 1KC5H 2E6JA 2HN7A 3CNKA 3F6JA 2K9FB 4GKLA 5ALCH 3V6BR 5JNYA 3VACA 3VXRB 1THAA 4Z3GA 4XNAA 5CCGE 4JFOA 4QO1A 2J88L 1N26A 3LN5B 2WWMC 2XU9A 1VPOH 3LRHA 4WF7A 3GHEL 4PRDA 3NJVA 3OAYH 1HDMA 4KPHL 5IVOA 2DYPD 3BO8A 1B90A 2QPDB 3A0OA 4UTBH 5DUMH 2EKJA 3OXRB 1F4WL 1S9XA 1T6VN 1N5AB 1XB3A 4I89A 4N2DA 1AD0B 1YAIA 3OJVC 4HW6A 2FIRT 2VC2B 3KPMB 1AIZA 3FUKA 1TJGH 2OTWA 3NJIA 1T7ZA 4LEBA 1FQ9C 4F8OA 3SGJC 4E42A 4Z7QE 3MV01 4O4YH 3WKQA 1JGUL 3T2PA 1UOVA 3M17A 3OHXB 1S8DA 2Q76B 4WK2B 3VFWA 1I7RB 3IDJA 3K7UA 4RRPM 3W11C 4BZ2H 4XRCB 2K8QA 5LBVA 1ACZA 3DO4A 4JAMB 4XO5A 5INDA 4G7VH 3Q3GB 4E41A 2PP7A 5LBGA 1N6QL 1JPST 5KJ7E 1WZMA 3CTTA 4PJ7A 4XOAA 3ATEA 1Y1DA 4MJ5B 1ND0B 2DQCH 4YHMH 4UT6A 1R24A 2RA1A 4MJIB 5C92A 4IBVA 4PB9L 4MNQD 1A4KB 1HH6B 3EDDA 3J8F7 5IHLB 4ZX6A 4RX4A 4BH8A 2PYFB 3KD4A 3D05A 4Z7WE 3MRQA 3EOYG 3HTLX 4BA0A 3I6GA 4MJJA 5CLYA 3B6SB 3GO1H 4M62H 5ANME 4HETA 3JYCA 1RJLA 1OF2B 1X7QA 4FLRA 3MRRB 4Y9CA 4BXVA 4FKKA 1UD6A 4ADJA 3A23A 2P5EB 3O11B 1QUNA 1DQLH 1Q72L 3DGGB 3FFCD 3LZQA 2MNUA 1GS7A 3BLBA 2F8XC 5JXEA 3ZSSA 3UCQA 1A1MA 2WXHA 5DUBB 1ETB1 5DD1H 1TZIA 3FB5B 1I1FA 1OE3A 1DJHA 3P2BA 4RA0C 4YSPA 4UDTA 3JUYA 2KUTA 4JZJA 4ZMYA 2HJFA 4ZMZA 2V8MA 3KCPA 3IFNL 4ZXBB 3DVFA 4X4ME 3EUUA 1F58L 2IPTH 1QKZH 2GCYA 3UIYA 5HGAA 5GGRB 3GMRA 4L48A 2Z0BA 2N7BA 3LZPA 4EI6B 4UQAA 4P3WA 3QDJB 5E5MA 3PDOB 2E7LA 1I8MB 1D9KA 1XF2B 3RA7L 4MZ3A 4XX1G 1ETZB 5D7JD 3ETSA 1HE7A 3I3BA 4G2AA 1NLDL 3NIFF 1TTAA 4NC1E 3B4NA 1GTNA 1PIFA 3X14A 5HGBA 4LLMA 3AU1A 5BO1L 3OPUA 2O61A 2D4FA 5D1XE 3CK0H 1MEXH 4KV5E 3ZQWA 4I9WD 4Z0BH 3ELAT 5E2UL 1XXFC 2W94A 3TTYA 3VRIA 3WIAA 3BZEB 2B1HH 1ETA1 4BFEA 3QEGL 1N5YL 2G5BA 2JK5A 3H56A 3L3OC 4FJYA 4TYUA 1K8IB 2FJFB 4PJ9A 3LPPA 1OGAE 2VDQH 1XGPA 4N0FA 4FMFA 5DO2D 5F7BA 3S34L 1IGCH 3EJZD 2J1WA 5B3SB 4PJ8A 2IH1B 2I9LB 4I87A 5SV3A 1K3ZA 3FYIB 1HIML 4N2FA 3QUMB 4EAEA 2MTPA 1E8XA 3HLKA 3IJHA 5T1LA 5F1KC 2ZSWB 5KVFE 4QXUL 4HGWB 1H5BA 3W0WD 5JA9A 2ODHA 4XMWA 3T65A 4OZGE 3R7QA 3Q1EA 4GRMA 2ADGB 1EZVY 5ABZA 4LQFH 1MAJA 3TBWA 5T1KD 4V1DA 4GFXA 4TMPA 2G75A 1QLFB 2D31B 2OMTB 3BN9D 4LPCA 1GGTA 3QPQD 3VI3E 3T8XA 5ICXB 3SE4C 3WE1A 3SDCD 4HEME 4RWYH 3A67L 4HUUA 4OGQC 3RL1A 2IH8A 1ZT7B 3QULB 4X80H 2VQUA 2MSPA 3S96A 2CHNA 2PWDA 1OPGL 4QDGA 4LXFA 2DIBA 4N86A 4Q6IA 1J8HA 4KI5C 3MRHA 5EBWA 2J8UB 3NABL 4P59L 3WEBA 4NP4H 1FNHA 2X09A 3VA2C 4KK9D 3P2DA 4WLCA 3V0VB 4PJBA 2WTRA 4AG4H 1FRGL 2PW1B 3DVIA 2ARJQ 3BQVA 3NZ8A 4WWKB 4YSSA 4K7PX 3NIGE 2R8SH 4PGBB 1GXEA 5ESAA 2VLRB 3HE7D 3VAEA 2QKIA 3CAFA 3PWNB 3MLRL 4IRSB 4XVSL 2ZCHL 2ZSVA 4X50A 2RFXA 1GGIH 5FUZL 2PTVA 1BBJA 3VXSA 1DUYB 1XWVA 3MV8D 3UTPE 3JTSA 4PRHA 5IMOA 1RZJH 5C9JB 3B3BA 2Q8AL 5D7KD 1QEWA 2A74C 1IM3D 2R29L 3HBGA 2IIJA 4KNSA 4NQEB 4XWOD 4ENZA 5D7IB 5LXGL 4JANA 3SBPA 4PJIE 3X1NA 1MJ7L 4I18C 3ZHNA 2R56L 2EDTA 1WFJA 4NOFA 2JB5H 5ICYA 3D3VE 4FQPA 5C0DB 1ADQL 2BVOA 3ECWA 3ZHLA 5I1IH 1ZTXE 2IFGA 3X13B 3MUZ1 2H41A 5MENB 3IJSA 5L8JB 1P69B 3MXWL 3W82A 1P4BH 1UZ6F 1ACXA 4I2XB 3T1FA 3RGVC 3ZU8A 2DIJA 1ETJA 5INCA 3TJHC 2OMVB 3HB3D 3PUUA 5CUSH 4JLRB 5J56B 2X70B 5FKPB 4AMKL 3LNDA 1FCGA 3V6FB 1L0PA 1N9PA 4R26L 2P43B 5I1DA 2YGNA 2QQLL 3GK8H 3GRWH 2W0FB 3DIVA 3O9WC 4YO0B 4JCLA 3MHZA 5AW7B 3TF4A 3AXIA 5H35B 5DJCA 2X4PA 4MMXA 5CHNA 1JVLA 4Z7NB 2BNQA 1Q4NX 5CSZB 2FH6A 3MJ9A 2X4TA 1SHMA 2BS8A 5AVYB 4QRRB 4UINH 1YVLA 4JHVA 3MLZH 1SM3L 4C56B 3F04A 1KB3A 1NEZA 5HHMD 5C0RL