3VQMA

Small heat shock protein hsp14.0 of c-terminal deletion variant with c-terminal peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
GKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the oligomeric transition of a small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
molecule keywords Small heat shock protein StHsp14.0
total genus 15
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vqmA00
2RH0A 2BOLA 4M5SA 3AABA 1WH0A 1WFIA 3N3EA 5DS1A 3Q9QA 1GMEA 2Y1ZA 2KLRA 3GLAA 3GUFA 3J07A 2CG9X 3Q9PA 3QORC 4ZJ9A 3VQLA 4YL9A 2MNWA 2KMWA 4ELDA 2WJ5A 5DS2A 4PBDA 3VQMA 1EJFA 1RL1A 4PCKA 3EUDA 5LUMA 2N0KA 4YLCA 1WGVA 2N3JA 4FEIA 2Y22A 4JUSA 2WJ7A 3IGFA 3W1ZA 3AACA 1X5MA 2K8QA 3QORB 4I88A 1SHSA 2JKIS 2XCMC 3GT6A 3L1EA 3L1GA 3QORD 4RZKA 3L1FA 3QORA 4MJHA 4YLBA 2O30A 4YDZA 4YE0A 2CR0A 4M5TA 4JUTA 2Y1YA
chains in the Genus database with same CATH superfamily
3CX5J 3K91A 2FEJA 4JDTH 5EULV 1D5ZA 2XPGA 3DVFA 4M00A 4MJID 3GK8H 1R0AH 2AQ1A 1SEQH 3KPRA 3NTCH 4K2UL 4QXVA 3V55A 5J8OA 4H8WH 2V5YA 4MNHB 1OP4A 4FI6A 4R4BA 2ENPA 3QDJA 4ODXA 1MI5E 2X88A 1QLFB 5FHBH 1QW9A 2DIBA 5EU6B 3MGOA 2GQHA 3F62A 4Q6IB 4YC2B 2PF6A 1JFQL 1PAMA 3EYOA 3FOMA 3VVVA 3LRLA 3AAZB 4BFNA 4HW6A 2GTZB 3QO0A 1KGIA 5LDUA 3PQYB 3P0YL 1INDH 3FQ4A 4U4BA 4E9TA 1EJ6A 3RUGF 1CD8A 5IF0A 1CXLA 3D25B 1GL4B 1NBVH 4GMSL 1LQSR 1QEXA 5F7DB 3D39B 4YQXL 5IFJB 3QYNA 3QUMA 4JKWA 5K9KB 1BFOB 1WIPA 1DCEA 4KTEH 1FVDB 4NNYA 1UATA 3II2A 2XZQL 4HIPA 3UAJC 5E8NA 3TCXA 3O6ML 2GVYA 4G6AD 4GLRI 3ZJAA 3IRZA 3CDZA 5AZ2H 3TH3T 3BZEA 2E8ZA 3CN4A 3K4AA 3NIFB 1KN2L 4PJXA 4M7KL 2HTLC 2D7OA 1FBIL 4JO3L 1RH8A 4X8GA 1FL5A 1RLBA 5DRZB 4J4PC 3VFVA 4P3WA 5JQIB 4R8WL 4BSVB 2ADJA 5I9QB 5E2UL 1AZNA 1M7UA 4ZAKC 2VXQA 1RZGB 1D5XB 1CE1H 4W4OA 3OAZH 2M1KA 4RFNB 4WEUD 1CD9B 4L9LB 4YDJB 3UZQB 3D3VB 1RP8A 3QFJA 4MB4A 5MHSD 5BRPA 3DV4B 1UA6L 3IS1X 4PJ5E 4L1DA 2E59A 4PREA 4XXCC 4PG9A 4FQ2H 1AQHA 4ZQKA 3ZHFA 4XNUL 1RJYB 5HDOA 4N2AA 4NQEB 1MG3C 4NQED 5AW1B 2DKUA 2C9UA 3O2VL 1AS7A 4MMXA 4YIQB 2WB1A 3PV6A 4QF1B 2ZOLB 4ZUWB 4DK3A 5I6XC 1T5WA 3PCYA 3V2AR 4JM2C 5K69A 4FGMA 4NZFA 2NY7L 1QQDB 1EAPA 1QEWB 2Y24A 1TTBA 2XTJD 3L9EA 4PJCF 4RMRA 4KKLC 4K5NA 1QSZA 2YQGA 2HJFA 5IW3A 2UVEA 4N9GB 3QJRB 1JI1A 2VDPL 2CKBL 1EO7A 5CILL 3VDCA 4AL8L 3U2IA 5D7LE 2EVJA 2QDVA 3IYLW 1CG9A 1KJVB 1BBJB 4F8NA 4DTGH 1SGKA 3Q48A 4DKEH 3AY4A 2FATL 2Y25A 3KLQA 4LL9A 3KYNA 4PRNA 1MJJB 2YGNA 4NCDA 4WW1B 1MPAH 1PCXA 4APQC 4U1NB 1WBYA 2EACA 5EEYA 1U8CB 4W9IC 5DD3L 3NZHL 5LQBL 3D39E 1F4WH 5CUSH 4YHOL 3CZUB 1HSAB 2NXYC 4GQQA 4ELMB 1E5ZA 2YKLH 1DQJA 2WSKA 3DC0A 1ASQA 1EUUA 4H0IA 2H1XA 1CL7I 1KLFB 1LDPH 4H2AA 4XCEB 2B4CH 4GW4B 4OM1L 3I74A 4N2FA 3L3OC 4Z3HA 3HE6C 1I3UA 3FJTA 5D1QC 2B20A 2GI0A 4JKNA 5A16A 2RTTA 3LMJH 3T04D 1ETA1 3NAAL 1A3QA 5ID0A 3LN5B 3WV0A 4HV8B 5HY9A 1E4JA 5E24E 4A7SA 3EW3B 1F4YH 2LQRA 4NM8H 5AB1A 1AR1B 1U95A 3PAVA 2AKRB 2O30A 5D70H 1IX2A 4HT1H 4XVJL 2AS5M 3F6JA 4S1RH 1U8LA 4ZUTB 5IT2L 2ADJB 4G82A 4OCLC 5IV2A 2A83A 1IC1A 2XRAH 3BVUA 1CMOA 2FHBA 4LIQE 1R33A 3UG5A 1KIPB 1BW8A 5IROC 4KRLB 3ECBB 1BQHA 4UNTA 3K4DA 1BLNA 2AXWA 1MAML 3VD0A 1MCJA 2P42B 4QOKB 2IC2A 4PJIF 1QBLH 1RMFL 3US9A 5E6ZA 1Z9LA 1UWYA 1AD9A 3TFBA 3B8YA 3ARGB 4M6OL 4S11A 3L1FA 4JDZB 1KCRL 3P73B 1L9QA 2I5YH 3D09A 4HC1H 2QZ5A 2NPLX 1YDPB 2O6DA 4XP9H 2V9QA 2E6PA 2H32B 4Y89A 1OGTB 4RMTA 1PZ3A 5D1ZD 3OKNA 2ZYHA 5DFVC 4ALAC 3CBKB 4DP1X 4K3EH 5PAZA 1JNLL 4F15B 4A04A 4MAYA 3FT4A 4HXBH 4IRJC 5KSVB 1TU2A 3H56A 2R69A 3N6YA 4IOSD 4ONGH 2KZ1B 4ORGA 2B1HH 3KGUA 3MRFA 3HW7A 1CJYA 2VE6B 4IBLT 5ICXB 5HHQA 4YZFF 1WAEA 3MA9L 1T1WA 1WV7T 1ZVHA 4AITA 4LAQH 2APXA 4WGVB 3OHMB 1H8LA 1HL8A 2AJSL 2V5MA 3QXDA 4JVPA 3NCJL 3BSZA 4L9DA 4OLZH 1DBKL 1M56B 5I1DB 4ZMAT 3NJMA 5CJ5A 1T04A 3PWLB 5J1AA 1WISA 5FXCH 3GIVA 1OO2A 5K59F 3K71A 2IDFA 1FQ9C 3AM8A 1U8CA 4EI6A 2VDOL 2YXVA 1KN2H 2Q87A 3N91A 2EDJA 5D1XC 1QVOB 2ROXA 2FECL 3ULUE 4LEOA 1WE5A 1HEZB 4LLYB 5E2UH 4MJIA 4Z3GA 2TSAA 3LKPA 3DXAB 4IMLB 4PTTA 4YR6B 3MRIA 3CDFA 4HF5L 5E8OB 4QGYA 4L1SA 5CIPH 43C9B 3VD1A 1C8PA 2ZIDA 3V7MA 2OTUB 3WSQL 5G4MA 2ZD0A 4K73A 2V5TA 2DY2A 4LCUA 5IB5B 5MEOB 3H3PH 1YPZE 3FFDB 5DDHB 5E51A 1E4WL 4Y9EA 4QR7A 3ZOAA 3N1GC 4N0FB 3GSOA 2JJVA 4M02A 4OF8A 5KJ4A 5FUCE 4C58B 4U2YA 2B1OA 1U93B 5CCKL 3CE1A 1HWHB 1BAWA 3RB7A 5HHME 2X6CA 4PM1A 1BLNB 3BGFB 4D7PA 1MXGA 2C3VB 3FBQA 2Z31C 3PJNA 1E4HA 4IRSD 2B15A 3BZ4B 2VR6A 4YUEL 4A67A 4FLRA 1NCDH 5CBEB 3IDNA 3COOA 4O9HH 4PJDE 3VRJB 1V8HA 5DVOA 3VFGH 3D0VB 2GJZA 3FTGA 4G6JH 4O02L 5IZ7A 3QIBD 3VWKD 1VFOA 1XO8A 3KAAA 2I26N 4DH2A 4YHMH 4TSCL 3GO1L 1N5YH 4YX2H 5L2KE 3RX5A 5EU5A 2CE6A 2QR0B 2EP6A 3EADA 4Y19B 2XKNB 5DO2C 1WTGT 4XNUH 4GBXD 4I1PA 2C9PA 3FTWA 4ES9A 3NH7L 4OZHE 1L0QA 1X5ZA 1QFPA 1SYSB 3KMDA 3PDDA 5IBUB 1AFVH 3SDXF 2WQUA 1SJMA 1F00I 1KTDB 1L9SA 1VFAB 5DR5H 3ISRA 3SPIA 1NANH 3WY1A 2Q6WA 4JM2D 2YD7A 4MJ6A 1Q4NX 1HYRC 1YMMB 2WLLA 4U1GB 1YEDB 2B9AA 1IV8A 2V7HB 4L8BB 5DGRA 3IGUA 4UT9A 3VXMB 2ZJSL 1AZZC 3DJRA 3E9TA 4IHOB 4H0HB 4ZOAA 5DQ9A 3V4LA 1IAMA 1RU9L 1B0GB 2VLRB 8PAZA 5HP5A 3WNJA 2E9IA 1EHLH 3TWCH 2ESVD 5DS2A 1CF8H 1I7ZB 4YHIA 5D70L 4ERSL 3KYKH 2CHNA 1PFOA 2EABA 2ZUYA 1SUHA 1PZ5A 3QUZC 3DLQR 5F70A 3GMQB 3TOPA 1RZKC 1E40A 2XRAL 3LKPB 4ZAKD 4NO3B 3UG3A 1R0AL 5J7CC 1MIEH 2VSKB 1NKRA 1A4CA 4N2GA 2BJMH 3FO2B 4DO5A 3FO9A 4PI2A 1N8OE 2I9LA 1TUPA 2A77L 3MBWB 5K93A 1EVTC 5TTRA 1MFBL 3STZB 3WDIA 1W0VB 3QC6X 3BPLC 3E6FB 3QBTB 4WFGD 3L4ZA 3VFVB 4KU1A 2UYLA 3PAUA 1XMWA 3A23A 3W39A 4KK6C 5JW4Q 3V5HA 2VLJE 1M05A 3QYMA 1A14H 3MMEA 1CBVH 2JKWA 3LSOB 1NEZB 3LXBA 4KBPA 1INQA 5IBTH 1CGWA 3GJEA 3LN4B 3MRRB 4N2DA 5KYUA 4KJPC 4CNIA 3VSQA 5EZLA 1G1YA 4G8EB 2Z4QA 4V1DE 2NY3B 1Z1WA 2V9UA 5LBSA 2BP8A 4XMKH 5AKVA 4NM8L 3E1F1 4POYA 5KVDE 1I31A 3LQZA 3VI3B 3QPXL 3BSZL 1TVHB 3TBWA 3WBDA 5BQ7A 4LVNC 4Y2OB 1S9VB 3D8MA 1GGBL 1YUHA 3T0XA 2J6EL 2ERJC 4PRPB 5L4MA 1FZMA 1PLBA 3QG7H 3DROB 5T5FL 2G5UA 1C5CL 3TBBA 1U41A 3DVGA 1XFPA 3S3JA 4BGLA 3IDUA 4HJIA 1E3FA 4NCC1 2HKFH 3GSNB 1G7QB 2QTEA 2R1WA 2WYIA 4PJIE 2ZXDA 3GHEL 3MCG1 1L9MA 1DANU 3C5ZB 5CSGA 1YYLH 4JFDB 2Z6FA 4XNMA 2QLYA 5HYJB 3EOYG 4F2ME 1CVSC 5BV7B 2F7PA 3OQ3B 4H1LG 1KJVA 2YPLD 3SGDH 2A73A 2FQDA 4XCCH 1OTTC 2J1KA 4N87A 8FABB 3RA7L 3MRCA 4PRIB 1PX4A 2OXHB 4K7PX 3VQMA 5HJ3A 5LNEA 4LXFA 1ZHBB 5DA4A 4ZMOA 3LVEA 5FLUA 2HVKB 3VXME 2ZKWA 4WW1A 3SJVB 3KPNA 4LHUB 3V4UH 1N6UA 4QHNA 2ETWA 2EXWD 1QTYT 4NXKA 3CIAA 4WO0A 1JYWA 3TCTA 4HZ1A 4A1RA 1JI2A 3KE0A 5E9NA 2EILB 5HDBF 3TYFB 5KBKA 5KS9E 3SDDC 2P46B 4QRPD 5HPOA 4U49A 2ICWA 2Z92A 2AABL 3F7QA 5BJTA 3DX8A 1CCZA 3NA9H 5GS1C 4PBDA 5INDB 4PJ9A 3BMWA 1L9PA 3LRSA 3LPPA 3FO2A 4G8IB 4JFYB 3X14A 4QHUB 5EO1B 4AUYA 2VDOH 3MBWA 4CSSA 3SE4C 2R8SL 1WBZB 1Z6JT 4QRUA 4DGWC 4BQBA 2BMKA 2H3NA 4LSTH 4CUCA 5T1LA 3FT3B 1KGUA 5F1KC 5JNYB 3W9EB 5KEZA 2RHEA 1NEPA 1F11A 2XY1A 3GRWA 3CTTA 4IRZL 2KYIA 1UJTA 1V54B 3GSVB 4G6FB 4NJAH 4BZ2A 3GJEB 3S5LA 4JM4H 4PJFA 2EYTB 1AE6L 1P7BA 2DWDA 5E4AA 5EZLB 1DQDL 3M45A 5CUSL 4YHOH 4FFZL 2UY6B 3ZKQD 2BNRB 2YKLL 5GISH 2AXJA 2RGSA 4L8DB 3RTQA 2YEZA 3SGJC 4XX1E 3BKCH 2AK4B 2CK0H 1ICTA 2D2OA 2EO7A 2BSTB 2PP7A 1HKLL 2ENJA 4DETA 4GSDH 3B43A 3MRGA 5GGRB 3RB5A 3ROLB 1WT5C 3SE9L 4P3DA 3UBXB 1NQBA 3LVTA 5B1JC 5ADOL 3Q2VA 4P4KD 4GRWF 4HUUA 4R5XA 2Q8AH 4GRLD 5EF0A 4DT2A 1LO3H 5E6ID 3ISWA 1A9BB 2H3KA 4KJYB 5IT2H 1WZ1H 4FMVA 1G7HA 1QSEE 2BWDA 4GAFB 5JXEC 2VUOA 4PYGA 1EQWA 1AS6A 4J3WA 2N3JA 3SDXE 2CO7B 4OGZA 4ETQA 3TWCL 5GZOD 3U25A 3AGVA 3X12B 3PNWB 4F33B 3DTXA 4LQ1A 4LBAA 3S4SG 2ED9A 2CBPA 4P9ML 4OJDH 5JO5B 4YGVB 4OZFA 1ZLWK 4YX2L 2W88A 2CM6A 2Z0UA 4NQTA 5EU6D 2EXSA 3RWCA 3FZUD 1T1XB 2V2TA 3ZE0F 3RFZA 2I5YL 4Y16C 3PWPA 4P59H 4F7CA 1H8OA 1MY7A 3VU2A 5LUMA 5K9OA 2OSLA 2MCG1 3WFCH 4EUPA 4HAGA 5D4HA 5DD0L 4YXLL 2A9NH 2VXQL 3X1BA 4F1SA 3D5OF 3VXSD 2WKOA 4CGUB 1JHKH 2C9VA 3FQXB 2CK2A 1U58B 5D2NA 5SWQB 1SN0A 3OJDB 5EEZA 2XI9A 1CGTA 1T7WA 3MLSH 4MZIA 3QWOA 5B7MA 4TLSA 1BVLA 3PQYE 5IEHA 5FW7A 4I0PB 1KV3A 5I71B 1R47A 3M46A 4LLUA 4G8IA 3X14B 2N7BA 4FNSA 4JG0H 2HKHH 4PJCA 5EO9A 1EZVX 5HGDB 2OTUA 2PPFA 2ZX8A 5E9AA 4NO0D 5EUKB 3V7AG 3C5JA 4G8GD 1MCPH 1H6EA 5G2NA 4KK5C 3A4FA 4HWBH 4YN3A 2MQGA 4BH8A 1MCCA 5C0EA 1CFTB 1I9IL 1W8NA 1YPZF 2PTTB 1CGSL 4NO5A 3S3PA 4OCXL 2DD8L 4LEBA 3GUTB 5AW7B 3KGRA 3MVSA 3QG7L 3TZVD 1ZVSB 4I1NB 4L5FL 2ESVA 2BNRE 3FCSA 2QGCA 2AEWA 4HJUA 2PMZA 1QSFD 4L3CA 4I2XA 3KLHD 3QB7C 4U1LA 3BUBA 5ITBH 3D50A 5C6TL 4J8QA 3HUJF 4JRWA 2GJRA 5A2BA 4K9EH 4NRZA 3EGXB 3IMWA 3PXLA 4R4FL 3MX0A 2KC0A 3CZFA 2VMCA 2ZKYA 1OSYA 2ZSWA 3LRHA 4ODSH 4RX4A 5BV7L 5CGYD 3JZYA 2ZX5A 1CD1B 3VGFA 3ZIYA 4EVNB 5J6GB 4KY1H 3UBFA 3QDJB 2F68X 2GHWB 3FUJA 1KYOK 2VLKE 4B9JA 4YSEA 2P5WE 3GS7A 1Q8MA 3VFMB 3H7LA 3W0WA 2VMEA 3WTSA 1XGTB 4FQQA 4J23A 4YBLC 2Q3ZA 5HPMB 2Y1AA 3RIFK 3JV6A 3HBGA 3LRMA 4OUOA 4ZD3H 4ONFL 2HT3D 4PJ8C 4XC3L 2X4QA 4HH9B 4NC2B 4KKCC 5F7DA 2Q6WB 4ZSOA 2IANB 3ECWA 1I7UA 3W9DB 1LP9E 4KUZH 5K9KA 3AG4B 3V0WH 3C6LC 2YKKA 3PL6D 1DQKA 1M3JA 3U7YL 4H25B 2VDKL 4MCZB 4RZKA 1F3DH 1J1PL 5AVQB 4NXSA 3V0GA 3VAEA 1BEYH 4BE6A 4PRIE 3TPUB 1H8SA 4NN7B 5BVPL 4LLDA 4JG1L 2AK4D 1ADQH 1JXJA 1I8LC 3SPVB 1GPOL 3KHQA 4CC1A 4BHUI 1KBGL 1K6QH 1GIGH 2R9HC 3MYJA 2NW3A 5C0AB 3RJQB 1SNRA 2GBTA 3PGCB 4R96B 1LE9A 2YAHA 4PJIB 5T5FA 4JFFD 1LLAA 2IEPA 1I9EA 2N7SA 2DS4A 1TYJA 1KXTB 2DLHA 3QFJB 3K8MA 3TX4A 2ZT9C 2YN5A 2EQDA 2C9SA 1X4ZA 1BF2A 5T1DH 2CK0L 4ZTEA 1DR9A 4RCAA 3FH5A 4Q9QH 4BGDA 1IO4C 4ZQKB 5A1AA 5IJVB 1JDCA 1FL3B 1W15A 4NJ9L 1J05B 2EIKB 3SB3A 3X1EA 2P44B 4YLQT 2YEQA 4AEHL 1T83A 4KXBA 2PYFB 3EZ8A 1J9QA 2ICWI 4PJ5B 4BFKA 4AENA 5JORB 2NY6C 1NPNA 2W07A 2JKIS 1RHHB 4OF6A 4XE0A 3RNKA 2IOIA 1YEIH 3TP4A 5HHOE 1FSKB 5D7SH 4DCQB 1HHJB 3OJVC 3TBWB 1NOAA 3HPJA 3DGDA 5DQDH 2CHZA 5BUGA 4GG6B 4BK5C 4XXCA 4B9PA 5MHSE 2Y07L 5IUSA 1FFRA 1MRFL 1XZWA 4PW3A 4JQVC 1BBDL 2LU7A 4AJYV 3B2PA 2P5ED 2ZWKA 2V8MA 2QSCL 4CSPA 4ZFFA 2HMID 5EEXA 4J4PD 5ICYB 1C16A 1PZAA 2GJPA 3WNKA 1UJ3A 1ZEAH 1D6EB 3O9WC 3QUKA 3EYSH 3GSRA 5BRZA 3NJVA 3VXOB 4BRVA 3OKMA 3MOAH 4TOYH 1EFQA 1P2CB 1BZEA 1HI6B 2VUKA 3QJQB 1HSBA 5HDQH 4QRTA 3B2VL 4XZ4A 5JOEA 4Y4HD 4FEIA 1R5VB 3CFCL 4JUSA 4NQCD 1VGKB 3QQ4A 2W65A 4IRJA 1P1VA 1QYGL 5DVPA 3LHAA 2D3LA 4I7ZC 2BY2A 4KV5F 4NHCL 4J6RH 5C0JB 5EPMA 1GYCA 1E4XH 2ZXWB 3CH8A 3MR9B 1OF2B 1TZHA 3MV01 3BCDA 2QKIA 3NACH 1A1MA 4UNUA 1PBYA 1FAIL 3KG5A 1C12A 1A6PA 4HDIB 3UTSE 2DQDH 3UADA 1M53A 2HWZL 3QDMA 1SF3A 1JK8B 2P5WA 1FH5L 2FGWH 4OJCA 4DHLA 1AI1L 2CR3A 2XN9D 1JGUL 2DM4A 4K9EL 3H9SA 5FCUH 2VR9A 5IQ7L 15C8H 3ATBA 3WFCL 2BX5A 3WUZA 4NYLA 3ARFA 2QSVA 3UTTD 3SKMB 2IPUK 5E9DD 5BV7H 5CBAB 2JCCE 1E5AA 4MD5A 4OZ4B 4WFHE 5IHZA 5IQOA 3ARGA 4R84A 5F89B 4CVUA 4J12A 1YDPA 2IWKA 4HIJB 3TBSA 3T08A 4DO4A 4WHCA 4GPVA 1L3WA 3S88H 4RBPH 1BJMA 3UTZB 4LLAA 4O51B 1RQ5A 4ABVA 3P2DA 3IMBA 1DO5A 1TKWB 4DCQA 1KCUL 2P5EB 3DOSB 3ZE2B 3G6DH 5IESL 3WY4A 1A5FH 4P2QA 5KVFL 3KZ8A 3B37A 2K1MA 3ULVL 1WWWX 3ARED 3UBXA 4HCGA 2WKGA 3CDGB 4BK4A 3GZOA 3AG3B 1PKQE 1TYEB 3MRBB 5ENWA 1DJSA 3IK2A 1A6TA 1XWVA 2LE9A 2VERN 3QXDB 1MFAL 3P9WB 3GLZA 3PHQB 1VACA 5MENE 1E4XI 1G7HB 2VLME 3FT0A 3TU6A 5KVDH 3IMTA 3WUWA 3LOWA 3RQ3A 3VE0A 2I7OA 4GBXB 5G5DA 5IF0B 3NSFA 4Q9RH 1F13A 2BFGA 1ZK5A 1T4WA 4QTHA 2XYBA 3Q8FA 5CP3A 4QXWA 4PJGE 4C56B 4YBHA 1NMAL 4XWOD 2NUTA 1QSVA 4FMKA 4HPOL 3W2DH 2CO1A 2PR9A 5DYOA 3UX9B 2W0FB 3FQUB 2BSSA 2HG5B 5F0PB 2WTRB 2DEWX 1XSOA 2BSCA 3QE5A 1UD2A 1KLUA 3C6LD 3PL6C 4MHHI 3TA3D 4NJ9H 2VCOA 2D7PA 5I16A 4AEIL 3QEGL 1L9TA 3MLYH 4PRHA 1IAOA 3T0ED 2F53E 1QBML 3W57A 3QH3B 1JIBA 2CDEA 1S7XA 3PE9A 5B1KA 3SPHA 4IBVA 5D72H 5CCJA 5KSAC 3BGMB 3U4AA 3GB7B 4J28A 1J1PH 1QMUA 3QUYA 1E6OH 1U93A 7FABL 4TS6A 1CXFA 3SY6A 3NJKA 4NP9A 3QXWA 3SGDI 1KXQA 3CK0H 4PG9B 1ZA6A 5CN1A 4BH8B 3ARFB 1NINA 4HWZB 3Q5OA 3FUIA 2VRAA 3KGTA 4TQEH 4FNRA 5JPMA 1HOCA 3EH3B 3LEYH 4BH7A 1I8MB 2GSMB 3Q8CA 3JTTA 3BH9B 2F18A 4MMZC 2VJ8A 3EO0A 2GIYA 2JTDA 3J7HA 5JQHC 2SODB 1DJYA 3MZTA 5ABZA 5FA3B 2JIXB 4Y1TA 1QLEL 3UPRB 4UTAA 4WQOA 2Z8WC 3GJFH 3RX9A 4K3HA 4L29B 3P2TA 3VXNB 1HHGB 4JQIA 1HHHB 2NXZC 2OMNA 3VO0A 2FO4B 5ESVB 1I75A 3RGVD 1IGFH 2V3DA 3T1FB 4WEBH 3RPIA 4XRCA 3MRHA 5D93C 3NAAH 1XHHA 4JPWL 3ENEA 4AOFA 2ZG1A 4S1QH 4DF9A 4MWFB 2EDRA 2Y7MA 3KGSA 2GJJA 5HDQL 2DF3A 1M7IA 5J11C 2LAAA 3VXQB 4AI7A 2XWRA 4GIPD 4RETB 2WXQA 2CU9A 1MCQA 1DANT 1TT6A 5IFHL 1JCVA 1LO5A 5AL8A 3LKOB 1M2VB 3MUGA 2ZF9A 2MNUA 4RSYA 1HEHC 1NCTA 3GZPA 1I7UB 3W9DA 5IJCC 4JS7A 3CZSA 4Y0GA 4G6FD 4S1DC 2ICWJ 4KKZA 3SDYL 3MLRH 1KACB 5CJQH 1E28A 1MFVA 1WC7B 3K1DA 1RJCA 3X13A 1W6WA 2WWKT 3CUPA 4WGWB 3M88A 3OGOE 5ALCL 4Z3FA 5ACZB 3SY0B 1DJHA 1FH2A 5EV7A 4XNDA 1MI5A 1TITA 4HXAH 1NKOA 2GTQA 4HXBL 4Y2DC 3GSQA 4Y4HC 5MP6H 4WY7H 1OZTG 5F6HI 3CMOH 4AQ1C 4KI1A 3KDPB 4QT5B 4OZIA 3LKQB 3S88L 3NDYE 1M3IA 3B3BA 1K4CB 3VWKB 2ZWZA 5FUCC 2O5YL 3GMLA 1IAKB 2YBGA 4KDTA 2IQAB 4Q2ZB 5DJAB 5IROD 3DUUA 4MA7L 4U6VH 1DBAH 2WBJD 3CLEH 5JPMB 3KDMB 5DJYA 4HA1A 3NFPA 4D7BA 3LQZB 3VI3A 3VQLA 4NN6C 5A7BA 2VXUL 5D7KE 5DRNA 1TQCB 4N0UB 5C09D 5H2BB 4LFHG 2P45B 4Q8BA 2IQ9L 4R4ND 3I6SA 5MERB 2PN5A 2HWZH 4FG2A 2WCPA 3MLTA 1MFAH 1KWKA 1J11A 4WDIA 3HZMA 3APCA 1JZEA 2H32H 3FH8A 5CJXC 2AQTA 1NSNH 1ZLUH 1A7OL 4Z3JA 4NQDD 1EZUA 4U0QB 3MRFB 4XNMB 4GG6A 4OF5A 1MUJA 4MNHA 1NOFA 4P46C 1TJMA 4NQSB 1CT8B 4N1HB 1ZLVH 2NSMA 1WUNT 2GK0A 2PYEB 4G5AA 4IGBB 1NIEA 2FH6A 4Z78A 2GSIB 1AP2B 3B34A 5B39G 5F7KC 5IJKA 4Q6KA 5DD5H 3TZVC 3LQAC 4AGPA 5FM8A 4I3GA 1KBPA 4MXWL 4R0LC 4DGYL 5GXBB 3D0LB 3W81A 5GRJH 1L0YA 1QASA 2KS0A 1OT2A 3Q01A 3K2UH 4NZTH 1KCSH 1S7SB 1YEFH 3FF8A 4QRAA 3MRDA 1XGQA 2FWOA 5HYIA 3AITA 3CXDH 2G2NA 2VC2H 3OPZH 1BPVA 4Z5RB 2GJ6B 1XR8A 2L04A 3FQNB 4S1RL 5IFJA 1D9KA 1WG3A 4GAGL 2W60A 2EYSB 2C4XA 2CPCA 3REWA 1F18A 4KO5A 3NQIA 2FATH 1U8PB 4ZODA 1QR1B 3MRIB 3WXWL 3M8OH 2XN2A 5DJ6B 4AX3A 1MPAL 1U8QA 5KS9A 4GKSA 4PGDB 5DSCA 3BWUC 2MCAA 3CC5A 3CVBA 3LV3A 2ZUWA 5D6DA 5HJGA 5E23A 1MI5B 4FQPA 3FRPG 4Q9RL 2QKIB 3OLDA 4P5MB 2GC4C 1S8DA 3EDKA 4XNXL 4BWWA 3WNLA 1FFNB 2AXHA 1ZXQA 1I9RH 1E3XA 4TQHA 4V1DD 1BQSA 3N2JA 3OGCA 4XN4A 1I1AA 1Z7JA 4LSRL 1HIML 4UQCA 2H2PD 3VFNA 2X53A 3PS6A 1E9OB 3RFZC 1A4KB 5L7XH 3BVWA 5JHBA 4MD5B 1X5AA 2DJUA 1TPXB 4Y4FC 5GS3A 4OD3L 5FDWB 4GRMA 1A6VL 3SDCC 4PIRF 5E5MA 3GMMA 1TCMA 3S3BB 1MFCL 1T21A 3NCJH 4CW1B 4Z7NE 2A4CA 5E6UB 2JVUA 4P57B 3JUYA 4UDUB 2GSGB 4K5OA 3QNZA 4Y1AA 4G43A 3QO1B 2JKJA 4ENZA 2XKNA 1ZTMA 3HE7C 3KCPB 4OH2A 4E68A 2F53A 4D0DB 1NCGA 1MWAB 4PS4L 4ETQB 1FV1B 1XXDC 4X6BA 1T66C 4GUQA 2Z93B 4HFWA 1N67A 4W9DC 4X83A 2AEQL 3PP4H 1YAIA 4AVJA 1JGUH 5FCUL 4JHBA 1FFQA 5CSZB 1OV8A 3UZEC 5F9OL 5EBWA 5HHVL 1ZHLB 1YEDA 1EX0A 4PLOB 5I76A 1A14L 2G4GA 3BHBB 3WKMH 5IKCA 1AJ7L 1CBVL 3QNYB 3H9SE 1MRCH 3OSVA 3V4PA 3U6RA 2J57A 3X2QB 3DGGA 1TZ8A 4I0PC 4KKBD 1F8TH 4NN5C 5I71C 2NXZB 3KYOA 4EI5C 4IBSA 1OE3A 3QZOA 1NMCC 2CLZA 3K5SA 5MP6L 1U3HB 4LSSL 4BFOA 3MROB 2XOTA 5JQ6H 3D9AH 2W60B 2OLDA 5C0AE 4YSUA 2PXYA 4PHZA 2OTWA 2WNXA 4X6FB 5A16B 2BHUA 5D2LB 2W0PA 4BK8A 4QHLB 4RA0C 1P5UA 3E1ZA 1MFDL 1SXSA 1DQVA 2WTRA 3NPSC 5T5FH 5C0BD 5I1JH 3L8QA 2F8VA 3T6VA 5CD5D 5KJ7E 1GJWA 4LPCA 2BW4A 2F8IA 3RWDA 5FOBB 2V7NA 1UB6B 5B38A 4JFUA 1THCA 3O6FB 3FQ1A 4LLVA 4K8RD 4TUJA 1QRNE 2W59A 2PTVA 3EOAB 5D6CA 2Q0ZX 2PTTA 4Z0XB 2ALAA 2XBZA 3VFOB 2YAOA 4PVLA 3NK3A 3O0RH 4P2OD 4ABWA 3GUTA 4XN1A 1CC3A 1IEAB 4JY4A 1QR4A 4TN9A 4YHZH 1NH6A 2RH0A 3I6KB 2VDOB 1PLCA 4JDEA 1WBXB 3QEUA 1DEDA 4ELME 2X6BA 4UNIA 4NC1E 1S78C 3VXSB 2OJZL 1AO7E 5T3XH 4YXKH 3ZZLA 2PTUA 3OKOA 3QUGA 1AD9B 5INCA 3O4OC 3P73A 4BDVA 1U4EA 1JGLL 4LIQH 3OAYH 1Z9SA 1JPSL 1VEOA 2D3VA 4NZRH 3QZWB 4L37A 4B0MM 3PPEA 1PTZA 4EBQH 3D3VD 5AW8B 1PZUB 4F7EA 2XG4B 4Z9KB 4HWNA 4HZLA 4UDUA 2G9KA 2ZCKH 2EVHA 4ISVA 2P8LA 1AGBB 3QEGH 1SJVA 5DRXA 4DGYH 4R9HA 4TLUA 1CI3M 3CPLB 4P5KB 5T8IA 2EE9A 5F1SA 5I73C 1BMWA 1JTOA 1TJIH 1J0KA 2Y3AA 4GNKB 4W81A 1OLZA 4GO6B 2A6IA 2NY6B 5F7HA 1KJ2H 5I26A 3MRQB 3ORJA 3BP7A 1JV5A 3T8XB 4I0KA 3C60D 4L8SA 4OLWL 1RULH 3Q2WA 5ISZB 4YDLB 5DUBB 4CADB 1U33A 2AJUH 2BVQA 5C0DB 5DLLA 3AACA 1T83C 4TSCH 2K8QA 4HZAA 5KSBB 1QLEB 4BZYA 3WXWH 1E27B 5AZUA 2WVSA 3KPNB 2WV3A 3FB6A 3OMIB 4LHUA 4WI2A 5HDBB 3ZQ9A 3L9RA 5I18L 1SOQA 5B1CA 5TE7H 5DK3A 1E5UI 3DGGB 5B1BB 2DLEA 1BPLB 2M2DA 1L7IH 3GD1C 1J8HD 3KYOB 3M17A 1R46A 4HCFA 4P2RE 5SX4H 3HRZB 4JPIB 4XAWH 3LIUA 2BNRD 1JFHA 1O7DC 1J5IA 1A2YB 2C7FA 2X1XR 5DZLA 4FG4A 3QR0A 2CO6A 1JRHL 4N24A 5C0CE 1REIA 4ZI8A 4M43L 3A6CH 1P5UB 3CZEA 4YHNA 4U0RB 5AYQA 4NUQA 4DP5X 1OGAE 2F5AH 3M1OA 1I1RA 3LS4H 1KFGA 2CJUH 2KKQA 1VADB 4LCCB 3FKUS 1H6TA 4FD0A 3WIHA 3D85D 4X8JA 1BIIA 2BP0A 2F6AA 2BNQD 2JTYA 3IJHA 3MJ9A 5CGTA 3GSVA 2YGQA 2MHAB 1NBQA 1I8LA 3FU6A 3O6LH 4FQJL 1HQRB 1HNYA 2DQJH 4LPYA 3TH2T 1XL4A 2IXQA 5DFAA 5HHNB 5CD3A 2EKJA 5J12C 3S35X 5D7LD 3KM1A 3EO1B 4F37K 4QRPB 4C47A 2QVTA 2CDGB 4OZFH 1T1YB 2OQJA 2YD3A 3D69B 3I3BA 4XVSH 1OAZH 2BSTA 5DT1H 4CRPA 3HHSB 2VQUA 4BDVB 1QO3B 1B9KA 1R3KB 3O8XD 4F92B 1UWGL 1ZTXH 4L0YA 4XOBA 2HFEA 4LU5H 2GY5A 3MLTB 4ZBJA 4LSRH 5EF1A 1EUTA 2R1XA 3CN0A 1XMEB 2WYZA 4JFEE 1DJWA 4ODTH 4YPJA 3WDHA 1NFDA 2UZIL 5HI4C 3O9WB 2WTPA 1MEXH 1XZ0A 4LCIH 3UYPB 1BZQK 1NUDA 1S5HB 3CMOL 3RZCD 4MQ7A 5GJTL 4Y19E 2UV3A 3KL0A 3VSTA 2R9HD 2CJ3A 2FTAA 2HKHL 4IIQB 2RFXB 4XCYA 3N04A 4A7GA 2GI7A 5AKTA 2OM5A 3DDFA 4U4IA 4IYKA 3C08L 2O6EA 3RVUC 4MJ6B 4MQXD 2AFNA 1OHQA 1VIWA 3EJQA 4YZFE 4DKAA 2DKMA 5B7FA 4WTXA 2NUPA 2YPLA 3G5XA 4K2UH 4RA3A 4DGVL 4KHTH 3ETBF 1OCWL 3IMVA 3EYVA 2C9XA 4G7VH 3RWGA 1WJ3A 3GI8H 2XX0A 3ZDZB 4RAHA 4JFSA 4H8PA 1G0DA 1UZGA 2ZWLT 2RCSL 1JFQH 2J21A 4PRAA 3KWUA 1B4RA 2DN7A 2Q10A 5D71L 1ORQB 1CBJA 1DL7H 3DK2A 3BQUC 2WC7A 1G9ML 1OAXL 3BFQG 3D85B 3HG2A 3GKZA 3NGBC 3PABB 3WIFB 2AK1L 2GYSA 4FMFA 1AE6H 3N50A 3LS5H 3HI5H 2B1AL 3LN5A 5HI5D 1X7SA 1CL7L 4KRMB 4F7MA 3K7UA 3P4NA 1Q94B 3LRKA 4PU2A 1HKLH 1XB8A 5D7IF 4U6XB 1RZKH 2HZHA 4LSSH 4M7ZB 3SKMA 1CQKA 1EBAA 2NY4D 4XOAA 4JFZL 4P4RA 3CHOA 1S9KC 3D2UD 2R7EA 3BQVA 5F89A 3A24A 2Z4TA 3O11B 1J8HB 1SHWA 3BW9B 2HLAB 2X1PA 1J0HA 2WXPA 4FI8A 2W0LA 2X1QA 2G5RA 4H26B 1LK3L 5A6MA 4AM0A 3POCA 3Q5YA 1S7UB 3ZQWA 4I13B 4XN2A 4O58L 5I1HL 1YHPA 2GHZA 2QPDB 4A7QA 3DTDA 3HC2A 3PQYD 3MUJA 1U9KA 3NPSB 3D87B 3L2NA 4N5EC 3OKDB 5AOKA 1QO3A 1KYDA 3THMH 5MENB 5C0BB 3PL6A 2DYPD 5ICZA 4G1MB 4M7JH 1RIHL 2OJ1A 4AZUA 5JIIA 4HK0A 3QS2A 5DVLA 4MLIA 5FWQA 2HB0A 2H2SC 1KPRB 4QJ5B 5BMFH 3QIWD 1CI5A 1TTGA 1VZGA 4R2GD 3QDGE 1DVXA 1FO0L 5DMGD 3WFHB 1IILE 3GMOB 3MV9E 3TBTA 4FFWD 1SPDA 2VXTL 5E94A 4L3EE 3H85A 3SE9H 4K3JH 1F42A 4GSRA 5T1DL 3MJ8B 4JFEB 2WK2A 3MUZ1 4PRIA 5EC2A 4P23B 2JJSA 1IKFH 1QRNA 1MLCB 3HTLX 1N64H 2Y5TA 3LIZA 3A67L 2CRYA 2WLZA 3HNSL 2EE6A 3JUZA 4BUHA 2VDPH 4NZDA 4AXWA 5DHDA 4D2NA 1OGAB 1HTYA 2Q3AA 4OM0L 4D9QD 1B2WL 1T2JA 1SY6H 2WY3B 1X7TA 3PHAA 4IK7A 2VXVL 4OLWH 4X9GA 5CU5A 5HXMA 4P5TA 4Y9CA 1QFOA 4UANA 3T65B 2LVEA 1ZPLA 1TTRA 5E2TH 3LH8A 3FFOA 3LQAH 4HUMB 3WMSA 4PLJC 4B97A 1S3RA 1CYGA 3WS3A 5F6IC 2FYYA 3GMPB 4OD2B 1YA5A 1GYAA 4EIBA 2PCXA 3KS0H 5FHBL 4GP4B 5ITBL 3FN0L 1C08A 1QX1A 1NAMH 5D7HA 3UJJL 1B3JA 1Q94A 3CFJA 1GAFL 4HWUA 4LL1A 1A25A 1U8KB 2A9NL 2VXQH 3MREB 4OUUA 5IJVA 3KPSA 1ZTXL 4F15C 3DV6B 4U3CA 1E65A 3TIDA 4LU5L 2BP3A 1EMTL 2JQAA 4LSDA 3IGLA 1FFOB 1J8HA 4Y5VA 5DFTA 4BZ2L 4KKAD 2UZIH 2BNRA 4YQXH 3HG1D 3PHOB 2W07B 1OOAA 3K80A 3WN5C 5L2JB 2OSYA 4DW2H 1ZANL 4UQ3A 3RUGB 4RGND 2XWJA 3G04B 4QRRD 1Z5LA 4XMPH 2R4SH 4YNYA 2DD8H 3U1QA 1DHKA 2WBWB 2XA8L 1X7QA 4AGMA 4QHKJ 4Y4HA 1NAKL 1NICA 3JWDH 4UYQA 1ORSA 4AQ1A 3QFJD 3E38A 1ZS2A 2OMYB 3WLWD 3FUMA 2VDKH 4HIHB 4K7FA 1Y1UA 4Y5YA 4K71C 1G9NH 3AAZA 3UBGA 1J9SA 3I6LE 4XE5B 5I8KL 3WTUA 4GI6A 3BLPX 4UUJA 4U6HB 4OLXH 1C16B 3LEVL 3T6ZA 3EO9H 2G3ZA 3WJLA 1DQQA 2HJKA 4NO2B 3PNWA 3VI4A 4F33A 4NHUB 3ZSSA 3NCBB 3X11B 2R56H 4X7CC 2VLKA 1SQ2N 5KW9H 1OAXH 2DLFL 2QKSA 1QRNB 2V17H 4ZFGH 5IEKA 1U3JA 5E8PA 3WFBL 2G30A 2EEFA 4XMUA 1YZZA 1B0IA 2ZUVA 1QA9B 3DK0A 4KKQA 5JZ7D 4B9YA 4R7DA 2L8AA 1J1OL 2ZAGA 3G6JE 4PRBA 1WC7A 5ESQB 5FUOL 2QQQA 3EYUH 4NKOA 3UGUA 5D1QD 2OSLB 2ZAHA 3J2PA 2K70A 1K2DB 5D7EA 3M1BA 2H5UA 1Z2KA 4F2FA 5MI0B 3T3PE 1IM3D 1OM3L 4CSTA 5DRZA 4GAAA 4P5TB 3OJDA 2G75B 3VGDA 3LYRA 2CKBH 3QUML 3TXAA 4ECNA 1GC1C 3BKJL 4LKXB 4PJCB 4FQXC 3DX7A 2AF2A 5AW2B 1WEJL 1XVSA 3SKJL 2GTWA 3IF1A 1OCWH 3E6FA 3BKYH 4XNYL 5JPNB 4HJGB 4J3OG 2D8KA 4YSPA 1HL9A 4JKMA 1CFTA 3ABMB 3L3DA 3KW7A 3SCMB 1YO4A 4FFYH 3ZRSA 4ATTA 4ZUUA 4S2SB 3MRMB 1ZLSH 5H4ZA 1F2QA 4JL1A 5IIEA 5LQBH 4P99A 4MB5A 4B50A 1RJLB 2QFPA 4U6YA 4OCNC 4OZGE 3N40F 2WIIA 3BE1L 4U6TA 4WLCA 2WSDA 3EG9B 3TBVA 1Q9LA 1U8NA 3IDXH 5L8JB 4NCC2 1FE8L 3PGFH 3OB0K 5GGVY 1JHTB 1LO0L 3IFLH 5IK3B 2WUBL 4J3OC 4RRPA 1V3KA 3MNVA 3R0MA 4EVNA 4U3SA 4KDTC 1H9DA 3GZQA 2WQ8A 2IFFH 4K7PY 4R0LB 2QHLA 4DEUA 3QUXA 4N8VG 4ACTA 5GRUH 2CJUL 1TPXC 3FT2B 1TO5A 2P8MA 4G42A 1AMXA 4HIHA 3MXVL 2NY0C 2QBWA 4Y7OC 5KTEH 1BQLH 1S5HA 5EOCJ 2DRUA 3KYNB 4HLJA 2R23B 5CCGE 4TQPA 3TV3H 2O72A 5EC1A 3UPAA 2X44D 4QJ3B 2GAZB 1WBYB 2Q20A 3HFMH 3Q8BA 4D3CL 3I9GL 4NPYA 3RVUD 1I1FA 2ZUUA 3GSWB 2DQJL 4F57H 3N3EA 1DQML 4LCWB 2A4ZA 4TQEL 4TNWK 3ZE1B 2DTMH 5B3SB 4P9HL 2P9RA 4LNRA 3DI3B 5IQNA 4WHTB 3KCWA 1A6AA 5BS0B 2DICA 2P24A 2WBJB 1FHNA 4G5ZH 2VQ4A 3HB3D 2Q7YA 3VDBA 2J1YA 1G7PB 3C09B 3KBHE 1EEQA 4NQCB 5T5NF 3UPCA 2EIMB 1YN6A 3C2AH 5DEFA 1CS6A 1IC4L 2D3JA 3GJFB 4K3JL 4OGYH 4WUKH 2A6DA 3NMEA 5HHPB 2ODIA 4FJYA 3VD5A 4LMQI 4HS6A 3GLEA 2NY4C 1S8DB 1IKFL 1MW1A 2GIXA 3EHBD 3L54A 4E0RA 4MJJA 2QHRL 4NNPH 4Q6YA 3UZVB 4KROB 2ED8A 1LNUB 2GFBB 4OZGB 1ZT7B 5KYWA 3OF6D 4HKBA 1NM9A 3BZDA 2VXSL 4KO6A 3WI9A 2K8MA 3L45A 4P4KB 4JM2A 3ULAB 1OANA 4W9KC 2ZOKB 4YBQD 4ZXBD 4AYDC 5AG9A 2EIBA 3QAQA 4U6XA 4A2EA 5JNYA 4MTMA 5E9DB 4B9GA 3L5WA 3TURA 4N8PA 4DIXA 5I15H 4WNQA 1DUYA 3CVCA 1DVFA 3AG2B 4JM2F 1SJEA 2PWHA 1IGTA 3QFDA 5E5MB 3T77B 2PYED 4IGBD 4LARL 1OSPL 3QXTA 3DYOA 4A2DA 1SDDA 2UZYA 3D39D 3ZKNC 3VFUB 4B9FA 3U2JA 3V9EA 1BAGA 2Z8SA 2DMKA 1ZVYA 3TA3B 3CZNA 3MKKA 5IK3A 2X89D 4WJ5A 3UCRA 3OHXA 1UCBH 2NCEA 2PETA 4Y1AE 1UXWB 3HBQA 3MV8D 3KBEA 3MHZA 4JVWA 4Q6IA 5HGHA 1UCTA 3O3AA 5DMGC 2YGOA 2VLLA 3ZKXC 1ZLEA 4ZFGL 5LBGA 4YL9A 2VMJA 3T4AC 1NGYB 4JRXA 4AM0Q 4JEGB 1GYUA 5ALBH 4P2QD 6TAAA 3P9LA 2Y9RT 2BS71 3BSGA 5BS0D 4LEEA 1OL0A 5GGRY 1ZANH 5I28A 5EZOL 2ICEA 1CDUA 4QYOA 5KN5A 1A5FL 2XQYG 2YJQA 2QDWA 3MV7A 5JHLA 2NNFA 1QVOA 1PY4A 4EDXB 5CJBA 5JDJA 4CL7A 1DCLA 4WSGA 4KITB 5I1KL 3O8XC 5H94A 5C8JA 1BFOA 4OFQA 4L4VB 5ANME 1HDMB 1IJNA 1XCTA 2F5BL 35C8H 2WBJA 1ZT1A 3FSOA 3DXAA 2IPKA 3O2WH 4NQVB 5DFVD 5AOLA 7FABH 3P77B 5DI8A 4PB0L 2XWBA 3SKJH 1VGKA 4G6JL 4JZNB 4U33A 4Z7WB 1K85A 3I2CH 4OLXL 5EA0H 5A2IH 2PP9A 4OFDA 4YHML 4NP4H 3SY0A 1XEDA 2GUOA 1R5IB 4X6CA 4XCCL 5LBSL 3L3KA 1V3LA 3GMRB 4BKLA 1OF2A 4K5MA 5BXFB 4FQHB 2VERA 2VISA 4MFHA 2UWEE 3T0WA 3RY4A 2A1WL 2F0CA 2WP3T 4I0PA 4MA1B 1SVCP 2X2IA 3R06A 4WZ9A 4EI5A 2QEJA 3ARSA 3S5YA 1QI5A 5IVXF 3NRQA 2KT6A 2X05A 1OQOA 4W93A 3ZE0B 3BZFA 2GBVA 3N1MC 5K9QG 4DP4X 3MBEA 1R5WB 2QV4A 4Y88A 4ZRGA 3R19A 1CWVA 3QQNA 2AABH 2IH9A 2Y3NA 2DQEH 1N64L 5KG9A 3NFPB 1KFAL 2OTPA 4M5ZH 4BEIA 2UUDK 2J88L 3SKNB 3HB3B 3IU3B 4JANA 4Q56A 5FO2A 1QATA 1JV2A 4M8VA 3T5WA 2ZPKL 4UM9D 2ZX6A 4M6NL 1P1ZA 4L3CB 4A7VA 3CN3A 1AO7A 4WKZB 4K7PH 4EE2A 5F3HA 1SDDB 2UZYB 3DO7B 1ILSA 3QI9B 2YMOA 3ARDA 3CV5A 4K07A 5B1AB 1G6VK 2FJFA 1AGBA 2P8LB 4WAFA 3R1GH 1E30A 5IB4B 4POZC 4LHQB 1JDAA 1DDTA 1UM6L 1HNGA 3C87A 4P2QB 1XT5A 3QW9A 4JFHD 4KFZC 3WTWA 4U1SA 1BMGA 4NQSA 3TASA 4S1DD 4FF9A 3E2HB 1UACL 2PWDA 4LK4A 3DURB 4WWKC 5CJ8A 5JW3H 5D1XA 1WFTA 1O6TA 1GAFH 3VXRD 4Y5YB 3ZDZF 4IHBA 2APVA 3M7OA 3T2QA 2F54B 3BWSA 3FQWA 5F7BA 5KSAD 3ZTJH 2M26A 1RERA 4JB9H 4M7LH 3CHQA 2VR4A 1HVXA 4YK4B 4HH9A 1NZRA 3BIBX 3T0AA 2E46A 4EDXA 2MSPA 4QTHB 1VZIA 1CLYH 3CWGA 4U0RC 3HRZA 4FOMA 3FRUB 4ZW5A 3NN8A 5SWZD 2BSEA 5E8PB 4FXKB 4PP1D 3BSZH 1S9WB 2FD6L 3T0EB 4ZMXA 4DEPB 1PLAA 4NPJA 2VRQA 3C6EA 3VCLB 4KTDH 1BVNP 5IVOA 2YSSA 4HPHA 3QUXD 3TJHD 1G7MA 3VH8G 1ZT4A 1IAIH 3BFOA 2CKBA 1OCOB 1AYRA 3Q1SL 3SKUD 5I8EB 1FFPA 4JKLA 4PW4A 4P04A 4ZX4A 3QZMA 1BV8A 4LF3B 2O5NA 3IKKA 2Y2TA 3ME0A 4P3CL 2XV3A 5C0ND 4YPGA 5GGUA 4H8WC 4JZJB 3GBNH 2JLLA 5DMJB 2BNUB 3ECBA 2WQXA 1B0RB 3NIGB 2FBJH 5IW1B 1ETZB 5EIVA 4UIMB 5LN4A 1DVSA 1UWEH 4F8PA 3OKKB 1MWAH 2CGYA 1WA0X 5F3BA 2YFOA 4QRPA 5D96B 5AB9A 2WP3O 4BH7B 5DJXA 5KG9B 1I8MA 1SLVA 2K78A 3QDJD 2FHFA 5CFHA 3BAJA 4MA3B 3BEVB 1B90A 1F3JA 2D9QB 1JV2B 1LK2A 1JN6A 1TQVA 4XMZA 4ZMTA 4PW9A 1OGTA 1OPOA 4WKZA 5DVNA 2FSDA 1O7DE 2GITB 3PG2A 2YQ3A 1Q9LB 1U8NB 3OKEA 1HHGA 4P2RD 1TU2B 4UINH 3QORA 3U46A 2DLGA 4N0CD 1LJMA 2X3AA 2IADB 3QDGA 2OS7A 1MWAA 3NJJA 5SWZE 2CO2A 3X1NA 2BWQA 4QEGA 1B4TA 1JK9B 5AZEL 1ND0A 2J1ZA 4UF7C 1ITBB 1B6UA 2X12A 4A55A 1JWMB 5J1TC 1ZE3H 1R4XA 5LGHL 3FT2A 3S8WA 1QUPA 4YDIL 1Q0YH 4P2AA 2JI2A 1UT2A 1MVYA 5FUZH 1XH1A 2E7BA 5DJDA 4C4BA 3KJ6H 1CE1L 3CLWA 5KVMC 4HUKB 3UTTB 1VSCA 1BZDA 4KROD 4X5RA 4EI6B 1JF1A 3IXTA 3NGBB 2RIKA 1LO5B 2UUDH 3QJUB 1G7JB 3D25A 3AT8A 2ZXEB 3QCUH 3GNML 3QUKB 4M48H 4IRZA 3D39A 3IU4L 2CLZB 2Z92B 1FP5A 2ICWB 4TF4A 3TJHC 1Y6KR 3PGDA 3ZDZE 1NMBL 2IOOA 5F9JB 2NZ1A 3O6KL 5I23A 3O45A 2XXCB 3G6AA 3HEIB 1E2ZA 1QZ1A 2NY7H 4KKCD 4QHUA 3OVUB 3ZE2F 1HCFX 1PS3A 5BPPA 4GS7C 4G8AC 2VL4A 3ESNA 5JIPA 1YECL 4JPSA 1KIUB 1WYJA 3L1GA 2DQEL 4BIKA 1M7XA 3ATDA 4QMEA 5DHMC 5TDPB 3U9PL 4PY8J 1ZCRA 1SXCA 3ML9A 1WCBA 3T2OA 1SOKA 5LJYH 2FHCA 3QHZL 4IDJH 4RGOH 3HFML 2WJ5A 1IEAA 4D3CH 2ATPB 2NY1C 4CGTA 3OG6B 3MFGB 5D7JB 3BD5A 3AFLA 1KIRA 5ECGA 3N1FC 2WXIA 4MNGE 3FXIC 3GI9L 4PREB 4GO9A 3VSUA 3DYMA 1NDGA 1DDHB 3H4HA 1FNAA 2PWEA 4P9HH 5DZVA 3QCTL 4GRLC 5K39B 3P9MA 3KLAB 1UXSA 4OFIA 4MA3A 4N0UA 2ADIB 5E8EA 1ES0A 1IC5L 1IGTB 2ZUSA 4K9EC 1ZSDA 1FRGL 3BISA 1V7MH 5DD0H 4YXLH 2LU3A 3P3RA 4WUKL 1CR9H 1WF5A 3CAFA 1AJ7H 1XCWA 1MJ8H 3WFZA 1ONQA 3L3HB 4BBWA 3QJVB 5A2AA 3TFKD 4N0RA 4X98A 3EFDL 4Z0BH 4FFZA 2DQGL 1CLVA 3I3EA 4MMYB 5I6LA 1XGUA 1JWMA 2ZPKH 4D0CA 4CADA 4HWBL 4KTEL 4EN3A 4ODHH 4JQIH 1T7XA 1JD7A 2ZXBA 1MLCA 3LZLA 3VA6A 3KPRD 5F0JB 1MLBB 2AZAA 5KYXB 3H0TB 1S7VA 3HMWL 1DBML 4QXTB 2ZOUA 1QACA 5CXPA 2X2HA 4ESKA 1CDJA 1FNLA 4AGQA 4H1LA 1A1OB 2OK0L 5C8JB 3FQRA 4OCMC 3SE4A 3C5ZD 4KMTH 1CDHA 4N2EA 4KQ3H 3T65A 4GMTL 1X9QA 4ELKA 2CO6B 2GT9A 1PZBA 4L23A 1H3PH 4LSVH 1WHPA 4KJWC 4N2NA 3ULVE 4JZNA 1P69B 2W0FA 1HOEA 3FQUA 1U91A 1FZJA 2PCFB 1BFTA 3EGSB 5FYKD 1GHFH 4JB9L 4M7LL 1VFUA 2GUOB 4BKSC 1CGVA 4PJ7F 3BUDA 4WFHD 1NBVL 1LEGA 3HMXA 4FQHA 4GUPA 1MCSA 2YGPA 1BM7A 1RJZA 1LL1A 5IMMB 1OP3K 3BRDA 3D9AL 3FDWA 5ALBL 4NKMA 4G2AA 1BIIB 4NZRL 5IGXL 5GSRA 3R06B 1NEZA 1RZJH 3G9AB 5HI3D 4BWUA 4Z76B 4GYBA 4FYSA 3RZCA 1IAII 4UOJA 4XPBL 1HHIB 5ERWA 2P3YA 1HQRA 4P5TC 2ZCKL 1YUKB 4LRNL 3MBEB 4OF3A 3T3PB 5E6SB 2EINB 4HIIA 1XF2B 3IPBA 3BSHA 3OXRB 4QOKA 4W6WB 5I19L 2VMFA 4BFBD 2WZPA 1XD1A 3BUTA 2OI9C 3RDTA 3JTTB 1X4XA 4AL8H 2O61A 3WJMA 1FAIH 3IU3A 1DVZA 4LGSB 1BEYL 3VYNA 2Y7LA 4AUJA 3RGHA 1JZDC 3DROA 2BPBA 3OKNB 2FGWL 2IANE 4JFED 4P57A 2DW5A 4KC3B 3DXAE 2Y7QB 3P69A 3SDAA 1TTUA 2XPGB 1G1KA 4N9OB 4OAWB 1IBHA 4PYHA 3R0NA 4JO4L 4HF5H 3QDMD 4H44C 5HYJA 4YHLL 4L4TA 1IVTA 2J8UA 1E67A 2RJMA 2DQTH 2CAKA 2XWCA 5HGBB 4GQ9L 2HG0A 4PR5B 4NHUA 3D0AA 2ZP9A 3IMUA 1H3GA 1E4WH 2K7PA 3AWEA 4AT6B 4Z1PA 5GIRA 3PXHA 5F88A 3ZYIA 1MLBA 2XQ0A 2XFXA 3A6CL 3HZKB 4FHJA 2BSRB 3SO5A 1EAOA 3P0VH 4S1SH 5T1JA 3TA4D 2YPLB 5DEGB 2FZ3A 4X4YB 2XV6B 2H0EA 2JQMA 1P6AB 3OB8A 4N0CC 4NO0B 2NYKA 3MOBH 2Y2WA 4E9SA 3D4ZA 3QGVA 1IKNC 4LEOB 4LLYA 3V8OA 4P2RA 1WZAA 3NIDB 1QSFE 2F2HA 4OV5A 1S9WA 3KPQB 4AGOA 4DSYA 5TK2A 3LZRA 4J3OF 3VX0A 4DVBA 1SDYA 4GKNB 2HT2C 1EIBA 2D4DA 1IGMH 4Y1SA 3GMNB 3MNWB 2FGZA 5D7IB 4ZX3A 3JV0A 4HWEH 3KYMB 4S0TD 3FOLB 2IV9A 3CXHJ 1FL5B 2ENSA 2QMKA 4G3YL 4UT9L 3SGEH 4LLQA 4M48L 3FBKA 3GSQB 4L0PB 3W9EA 5DJ8B 5EU3B 3U2SB 4TL5A 4YXHH 3F6LA 2VXTH 3QIUB 5DURD 4XXWC 1MCOL 1PIGA 3CX5K 2NY5C 4JVUA 3GJFK 4TV3A 3VFSB 5IW1A 3L3OB 3DHPA 5DJAA 3I02B 3PWVB 4HHAA 5DEZA 3AXHA 1TQSA 3CH1B 3KDMA 2DL2A 3MO1A 4EDWL 1XF4A 3OKOB 4HLZG 1ETJA 4BA8A 3MLYL 4RRPG 2ZSVB 2WZAA 3HNSH 1FLRL 4FAAB 4CBZA 4XVUD 4Z7VE 1ZGLA 3HPJB 5D1ZI 1WLHA 3B1TA 4F80A 3GQFA 3UJIH 4C8XA 2YR3A 5D7IE 3HZMB 4IRSC 1LM8V 4Y8AA 1KPRA 5EU5B 2VDLH 3E6HB 1VDGA 4A6YB 3D48R 2FJGB 1JZHA 1SM3H 3RHWF 1DBMH 4HHWA 2BCMA 2K6WA 3BRFA 32C2B 4YHYC 3P4MA 2J8UB 1RZ7L 1FPTL 4N6RB 3GBNL 4HC1L 2J5LC 4HIEA 2ED6A 5HDRA 12E8L 1YNKL 3LN9A 1KJ2B 4RISH 4JMXA 2D7MA 3C09C 1UWEL 2TAAA 1UZ8A 3HE7A 3KBPA 5F2FA 5E4EB 5KSBA 1ODAA 5FGCB 1A3RH 4TSBL 2AVGA 1MEXL 4H8UA 2Q1EA 4WFFE 2WBKA 3PWPB 3LNEA 1GHFL 3WEBA 4MDIA 2ZNWA 2BC4B 1R3IL 3QG6B 4RVBA 1XGQB 2FWOB 1NEUA 2ZKHH 3WUWG 4YMPA 3K2KA 4TULH 1J7VR 4A68A 2GJ6A 3FQNA 4PQXA 1DQJB 4N20A 1NBYA 4WHYH 1TMCB 3MRJB 1DSFH 1PG7H 3C08H 3MCKB 4JFZH 3WENA 4PVBA 3TO4B 1SQMA 3IDGA 2NDGA 1BXAA 1O6SB 1CF1A 2IWGA 1SVBA 2W92A 5ANHA 1XCQB 4HUVB 1SN5A 3UTPD 3EBIA 3GI8L 5FOJA 5C0RL 2BDNH 3IJ8A 2WB7A 2VN3A 5JHAA 1WCBB 3UAEA 1FCGA 3N85H 5EU3A 4L5FE 4O02H 4WI3A 3W3BA 3SDYH 1LE5A 3EO9L 4EKXA 3KWWB 5EZJB 2VDRL 3ULUD 4YHKL 1DE4A 3TO4D 2ESVB 1BZ7A 2ITCB 2IAMD 2WINB 2X28A 1BECA 2PO6A 3AS1A 2Z7YA 1CICA 4U1MA 5CZXD 4L8CA 5LB1A 5CR1A 4PJFF 4FHBD 3TA3A 3CVIH 3DOSA 1AANA 1CFSB 1J1OH 2EKSA 2ATKA 4YDVA 2XWJB 3ULSA 5C08A 3GXTA 4WUUB 1FIGH 5GJSL 3U0PB 1OTSD 1I85C 2NNRA 2XPZA 4WK4B 3KPOB 1ORSB 4AQ1B 2HFGL 1RUML 4HJTA 4PJBF 3FT4B 1Z3GH 3PWUB 3VI4F 3QO1A 3OLEA 4LMQE 4MD4A 4A2MA 2QADD 3VX1A 3L4CA 1HH9B 2CIKB 2X4SB 4F58H 3MRNB 1PCSA 1XR9A 2NR6A 3C6SA 3MBEC 4HFUH 3QHZH 3BKJH 4HSQA 4ZMLA 5CLTA 5H37G 2FEEL 1XXFC 1JUFA 4I89A 2FQEA 2LR4A 1MCNA 1WFNA 2H9GA 2O26U 3LQAL 3L4TA 3WLWC 4AEFA 3TT3H 5E1QA 2B4CC 4F5CE 1VFMA 4DZBA 5A6IA 3WOVA 2CUAA 4H25A 1I3RB 5EZIL 1P7QA 3UL4A 4KV5E 1ZGLM 3Q1EA 3WLBA 4PRBB 5I0VA 5JDSB 4UZGA 2OAAA 1ULVA 2Y23A 4QXUL 3U6RB 1C1EL 4WW2A 4HD5A 4DOHE 2X9ZA 4Z7WA 5T1LD 4JN1H 4MNGB 1CURA 4UT9H 3X3FL 4AY0A 1K2DA 4NOBA 2NY1D 1IGCL 3C2SA 5E6RB 5HVFB 4PJAB 1SXAA 2X0WA 2XIBA 4AH2B 4MSWB 5EF2A 4B95C 1FE8H 2NW3B 5E0QA 1A7RH 2X70A 2W5PA 2CGRL 4FKEA 4I18B 2EDEA 4PGBB 1YY9D 1OT1A 2FIKA 3BPNB 4GO8A 1K8IA 4IKLA 4JL2A 4OKVB 3LD8C 1OZUA 4HULB 2ZJSH 2JXMA 1I4FA 3ATAA 1X6LA 1KYAA 3MUUA 1F90H 1LD9B 3TBCA 1DVYA 4BK5A 3QISA 3KYKL 5T1LB 1XQ4A 2K4WA 2OX5B 1VCAA 2HRLA 3TNMB 3DSFL 1EFXD 3W38A 2DL9A 3H9YA 1YNLH 1OCCB 4JANB 4KRPC 1NAKH 4TRPH 3ULVF 3PY9A 2X41A 4J3UA 1FIEA 2JIXA 5AD0A 4ALAH 1KGWA 2RR3A 2WIIB 2VIRA 5E7FA 4HIIB 3AM8C 4IOFD 2NXZD 4TLKA 3S3CB 4OZIF 1MCWW 4G3YH 4CN1A 3I3DA 1P7KB 1HHJA 2O61B 1PZCA 5CO1A 3MLPA 1BXVA 5JIQA 4HKXA 1BF8A 4KOBA 1YNKH 2A9ML 1OARL 3P4OA 4L37B 3TEWA 5CM1A 4XXDB 1UWXH 2BOCB 1AC6A 1JZ2A 1LMIA 5T33H 4F7EB 1XCXA 5D96C 5EU6A 1ZKAA 3FHQA 4ZMQA 4XGZB 4R90L 4HOMA 4OIBA 3STBA 1SUJA 4XMKL 1OAJA 1XB6A 3F7LA 4MD4B 4XPFH 1M7IB 5FW8A 3BIKB 1NGXB 1OSZA 4G80A 4AQEA 1U3HC 2WO4A 4AE0A 3ZUCA 5D5MB 3LAFA 4HKZA 3BIAX 3MRKB 2GTZA 2K3TA 2CO7A 3ALWA 3QO0B 4UTAL 1GZPA 5HHMB 1MNUH 2DM3A 1JPFA 5DC9B 4D0BA 4KAQH 1M2VA 2O5YH 1DP0A 1HH6A 4LCWA 4GT7A 1AZBA 2NY0D 4JE4B 4BA0A 1N2RB 2HP4A 4DVRH 4MQSB 3NA9L 2F58L 2NY1B 4P23A 2V4LA 4K23H 4WU7A 3LPFA 5F7FA 3AMLA 2XBTA 1T1XA 1RK1A 3A21A 3HZKA 4PJDB 2H8PB 2ZP0T 3VGAC 5H35A 3BC9A 3AQDA 1I8IB 4YDLC 4KZDL 2Z31A 3B9KC 3K8LA 1DSYA 1NJ9B 4PJGB 5AALA 1NUNB 3JV4A 3AG1B 3TNNB 5LVEA 2FIRT 4ZPVA 1ASPA 5IMOB 1KJ3L 5A2LH 5SWSA 2X6AA 4BYHA 2Y5QA 1QOKA 4OV5B 2X4OB 4O2FA 1RV6X 2LGNA 2V6HA 3HMXH 3MN8A 4GAJH 4UTBA 4QTIH 5L4JA 3MTXA 1Y18A 1WAAF 4HDIA 1NM4A 5LCVL 4E5XG 1D5RA 2AQQA 3ZMNA 3EKCA 4N2MA 2I9LB 3H7BB 2J4WH 3O4OB 3RNQA 2L0DA 4UU9B 4KVCL 1NDMA 3ZT5A 1C08B 3FT1A 2CA3A 3BQUA 3OWEA 1YY8B 4ONOA 4LCCA 5C3TA 2LAGB 4LEXH 4X50A 1JE6A 2A74C 3F6IA 1XBRA 5E95B 3B56A 3L5WB 1B4LA 1YEEH 5IHZB 1FNGA 3RVWD 1T2QH 4JN2B 2IFFL 2N0MA 1MW0A 3ZE2E 2WMPA 4NDMA 5IM7A 2FH8A 5AZ2L 3PIQB 2H6OA 2GJ6D 2K3HA 4X99B 3IE4A 1G5GA 1UT1A 5FCSH 3G5VB 2C4FU 3MV7D 5AUMB 1JSYA 1U92A 3EGXA 2A3TA 4PRDA 5FLVA 5KUKA 4HFUL 1JGDA 1D6VH 1PIFA 3OAWA 4ENED 3O81A 3WEXA 2XDHA 3N85L 5L0QC 4XXDA 3MLWL 4LCYB 3UBXI 1SN2A 1CGUA 1N9PA 1YN7A 1E4KC 1FVCB 4YZWA 2ZYSA 4AW4A 2FJGA 2A1WH 4AJ0A 1NGXA 4LVHB 5BZDA 3OR6B 3OX8A 3BOVA 2AEPH 3MCLH 1KEGH 3W5MA 5EBLB 4AL8C 1OOWA 4M6AA 2CCLA 1JWUA 3CFKB 2VW7A 1HXMA 4FG0A 1R24A 1J0JA 4X4XA 4GRLA 2OMTA 1IEBA 4N25A 3DPBB 3QORC 1KGXA 4OSUH 1FYTA 1XR8B 2KMWA 3QUYC 1PD0A 1Q9KA 1CFNA 1Z3GL 2PKDA 2DH2A 1KFAH 1PF3A 3CFNA 4GW4A 4M5ZL 1HDMA 3WFDL 3X1FA 2NUTB 4H88H 3EJTA 2XHNA 4FFVC 1QAWA 1KCVL 3BPCB 4YBQC 3HAEB 2GK2A 1TJIL 2QJDA 2Z31B 4XT1C 4AYFB 1J8SA 3VXUD 3VRIA 5I1CL 4JFWA 4CVZA 4ANXA 1UFUA 3IDYC 2BM3A 1NWOA 1TQCC 5EIQA 1PQZA 4NKDB 5EOCL 3FC8A 4GXUM 2WQWA 3RFRA 2WW8A 4MYWB 3UAFA 4AMKH 2VDLL 3E9UA 4A7GF 2ZX7A 4BSJA 4PRHB 5DQJA 5TGBA 1SM3L 4JFQA 3IRPX 1URZA 2IO5A 4FG6D 4TRPL 1KY6A 3LRSB 2XQBH 4FX5A 3IMRA 2AQRA 4H8WL 3ARBD 4J27A 2X4PA 3CHPA 2FB4L 4LASL 2Y07H 4J5VA 1KIPA 5C0GA 3B6SA 1XCQA 3QYCA 5DWUH 5KOMC 1H15B 2OCJA 3CSYB 4DKFL 1EZVY 3X3FH 1NKGA 2BERA 5F7YC 1MW2A 5DK2B 4AZ8B 2AJ3A 4UTCA 1U2CA 4NENA 1OD9A 1INDL 1EGJH 2E27H 3NCMA 3HUJA 4GH7B 1G1CA 3BW9A 2E0PA 4I2XE 4PJ5A 2WLIB 3ULVC 4FI7A 3WAJA 1FCCA 2EYRA 3SN6N 5JQ6L 1INEH 3KLSA 3QAZB 1IZKA 1JHTA 5EEUA 3VTTA 2OJEA 3TZVA 3KPRB 4KTDL 5ICZB 3MOQA 5KJRL 1CD0A 1W0WB 4N2KA 3KS0J 4WUUA 4X6BB 4RWHA 2NTSP 4U1KA 5ICXA 5MEPB 5EN3A 3KPOA 2ARJA 1XGZA 1J1XH 2VAJA 1CLCA 1FBIH 2ARWA 4KUZL 2OI9B 3VJ6B 4LARH 2QZQA 5DYFA 4NZUH 2HXAA 1GOGA 1PKOA 4UDTA 3K6IA 3R8QA 1OAKL 3Q6FB 1OAZL 5AW0B 5GRVK 5KYXA 1PJWA 3QNYA 2GAZA 1BFVL 2LU5A 4Y2DA 2WOYA 1FH5H 3U36B 2AV7B 1R24B 4HSAC 4X5WB 3FT9A 5IQ7H 1C7TA 3MJ8A 1D2OA 3LNGA 2OXGA 3QWRA 5F9WB 1AZUA 4AKOA 3KNBB 1GMIA 3U1SL 4XVUC 1IIKA 2X4TB 4QHMB 4NQXB 3OKMB 3T3PF 4AIXA 1A6AB 3O6FD 2YMXH 3GYRA 4QRTB 3NRFA 4LLMB 4GIAA 1V55B 4F20A 4X6FA 4AXWB 3L48A 5HI4D 3RTQC 1HNFA 3Q06A 1OM9A 1V3JA 2D0GA 3SBWA 3VRIB 3ARFD 1YN6B 3O3BB 3O3EB 2CUIA 1MNUL 4KDWA 3IKCB 1I7RA 2D3NA 5EUOB 3T6XA 2X4NA 1T0PB 2EXYC 5A43C 2F15A 1X6NA 2ERJB 3CD4A 4LOFA 3KPRE 3WNPA 5IMMA 2UXFA 1LEKA 4BSVA 1J87A 4E0RB 2NX5E 2DJ4A 2F5BH 3WY2A 4M6NH 1WD8A 3H8NA 4PBVC 4GKLA 5JYMA 1JDDA 4YDJA 1KYUA 2PCPB 3UZQA 3F58L 2FBOJ 3I75A 4HS3A 4WI4A 1LWRA 3BP6B 4URTB 4X6DF 5EA0L 4XOCA 1XF2A 4JFOA 3FO1A 5LBSH 1MHEB 1G43A 4NN7C 4FQXA 3BZ4A 2A6KA 4P49A 5HI5C 5AAMC 3HMXL 3QXAA 1YC7A 1CK0L 3AS2A 3WJMB 4QTIL 5E08H 1OLLA 1EO8L 5TE7L 2EDHA 2W9EL 3D4GA 1HC1A 5DMIL 2BY3A 3GC3A 5DJ2A 1BBDH 4LCWE 1DBBL 2VIRB 2IF7A 3IU4H 2G3MA 4G7RB 5TF0A 4Y16A 4TNGA 3CBJB 1YRKA 4Z7QB 1D2PA 4XCNB 5CZKA 2Z65C 4MLSA 1ZV2A 4EQ3A 5ES4B 2BRRH 1GZQA 2FT6A 1S7RB 4OFKA 3IGAB 4UQ3B 3RUGA 1BYOA 3RZCC 3U7AA 1W72L 3HG0A 4WJG3 4YVNA 4XP5L 1SYSA 4UM9A 2EUXA 4M61A 5DHXB 3UJTH 4UQAA 2NDFA 5FGRA 5TQ0H 4ZS6C 4PR5A 5CS7A 1P53A 1E5CA 4MBOA 3V10A 2VLLB 5I5MA 3MOAL 2Y6SC 4XN8A 4FZEL 1UKTA 4IU2A 1GGYA 1YMMA 2WLLB 2NXYD 3PHQA 1L0XA 3P9LB 4LPUA 1KLGA 4XO9A 3D0LA 4FKHA 5J1SC 1YNLL 2YOAA 3GLAA 3EJPA 3RY6A 4PJBA 5FHAL 4DERA 1OB1B 1JPFB 4X5WA 2I07B 1AR2A 1NPUA 3QIBC 1IBDA 4BFFA 1SJHB 1JXKA 3LHPH 1MQKH 4IBUA 5LAPA 3LEYL 4B5EA 3VWJB 4D9LL 4PJHA 3SCMD 1TQWA 2DBLL 2XTSA 3QZLA 3UTSD 3VMOA 2C1PB 3KH4A 5KUMA 3O2DL 1VCBC 1WFMA 4PGDA 5E1GA 5DSCB 1TIUA 5I1IH 5IHBA 1RSFA 1IBGL 1WDAA 1MWAL 1PMYA 5DEJA 3L3KB 4JG5A 2AEIT 3SDCA 3VXUE 4CDGC 3FTVA 2UYLB 3PGCA 4LCIL 4R96A 4FFVD 4B60A 1URIA 3O41A 5IUCA 2XJLA 3CFBA 1FFNA 3WFDH 4Z0BL 5HHOD 3T71A 2OR9H 5E6YA 1QSEB 1INQB 1PYWB 2Q86A 3ABKB 1JCKA 1KIRB 1NFIB 5CD3B 3CZKA 1KG0B 1IAIL 1SY6L 5F7MC 1YNTA 2DQHH 1ASOA 5EOCH 5IESH 3V6OE 3C5SA 4FNLH 3TVMD 4LPWA 1G7IA 3ABGA 3SE6A 2CGZA 4FS0A 1R3KA 5IIEB 3BRGC 3TM6A 4Y2OA 2ZWYA 1AH1A 1UZ6F 4I5BB 3UYRH 4E9VA 4LOVA 1JF5A 3NZSA 4FCHA 4AENB 1PG7X 4O02B 4LHJB 2WKLA 5BV7C 1FYTE 4Y16B 1RHHA 2ZF8A 3FHAA 4ZFZA 1H8NA 4HD9A 2LVCA 5IW6B 2FRGP 4M3KB 3FYEB 2IWEA 4YSDA 1NAMA 1BWWA 3IGAA 4PJ7E 3T1WA 3TEYA 4X9IA 4RAVA 3C5ZA 4UQ2A 2WZ0A 3FN9A 2H6PB 4ZNEE 2NYYD 1E0OB 1SBBA 5IBTL 4ODXB 4I9XA 4KVCH 2LFGA 1T0NB 4NBYB 3MRCB 3ILQD 4EN3B 1P5UC 4HQQH 4EAEA 5FYJD 2YMXL 1SEBB 1QWUA 3AZUA 1ZHNA 2HFFB 4JLRA 5B8CC 4BFRA 1ZHLA 1CE6A 1JOIA 3LKRA 3MA7A 3CZGA 2JJTC 4FLSA 4GFXA 2F54A 1R9FA 4JAMB 4F91B 1WITA 1XBDA 1JWUB 3PQYA 4MS8D 5GS1B 2VDKB 3DSNB 1OP5K 2I07A 2E9JA 4X4ME 5AB2A 3QJXA 3M07A 3TYFA 5JOPD 1A1OA 1FJ1A 1KYFA 4RDBA 1IQDA 1MQ8A 1MDTA 5KZCB 4JO2H 3KH3A 4WI0A 3B2UC 3JBG7 2D7TH 3DX9B 3GS0A 2PXYB 2XYCA 3AUWB 3ZL1A 3THML 2IMMA 3X13B 1VKXB 1YYLL 1PEZA 3KJ6L 1BCIA 2W0KA 2CMRH 3MJ7B 2CBMA 2BO0A 5GPRA 1XGPB 3T2NL 4LCUB 5IB5A 2WBJC 1R3HA 3WU1A 3VG9C 3L9BA 3LIZL 3ZTNL 3JQOB 1AC0A 2MMXA 4XX5A 1QRND 1ZWIA 4Y2DD 4OZIB 5A2KH 4X6DE 4KO9A 4P4RB 3SO3C 1FVEB 1QSEA 1X5KA 3BLKA 3H9ZA 2B9BA 3BWUF 5A7EA 5F93C 3JSSA 3ZO0A 1DE4B 2RBLA 3SYOA 3DX3A 4Z8FL 2HLAA 4F27A 1EEUA 1OK0A 1N26A 3GMLB 1RVFL 2EXTA 2ITCA 3CSYA 5AW6B 4BZ1A 1IQWH 5K9JH 1BVKB 4X4ZA 3T0VA 2ENYA 2HUHA 2HT4C 1UD5A 5ADPL 4MXWH 4FA7B 4QNPE 2X7LB 4WFGE 1WRFA 4N8VA 4YWGL 3FH7A 3ULVD 4J3BA 4RMSA 3UDWA 3IFOB 4YSCA 3VD3A 2WLIA 2IAND 1WWCA 4HUCA 3G6JF 4KHXL 1OSEA 1WEJH 1Z9MA 2MFNA 4ZAKA 4DZ8B 2XTJE 2YPVA 2Y7QA 4LSTL 3RKDC 2QR0A 1OWRM 1UT9A 1VFBB 2IG2L 4RAVB 4UQ2B 3QDGB 1UXLA 1PLGH 4R7NA 2FB4H 4LASH 3MJ6A 4IBQA 5CIPA 2PO6C 1RFDL 4JM4L 1PNCA 1SJXA 2DI7A 3UOAB 1USZA 2VZ1A 3EOBA 4AQAA 1BGXL 2XJKA 4MMXC 5C2BH 1ET5A 2L4OA 3I85A 3T0BA 5JO5A 2O5ZL 5TPWL 3RTLA 3E3QE 1BVOA 3WL9A 4PJGF 1MJJA 1MH5B 3EH4B 1PFCA 4JAMA 4L8BA 3LRGA 1JGEA 4X5QA 4YDKL 1IGJA 1W72H 2XVBA 1S7TA 2AEOA 2O5XL 4XPHH 3AW5A 4GUOA 3WKNA 4BXVA 2DQGH 3VG0H 2E3VA 1OCZB 5L4FA 4DP7X 1J8HE 5TQ0L 1P4BH 4J2QA 2VH5H 4WY7L 4P2RB 2NQDA 4BSWB 2MOVA 5GRUL 3SOTA 1U58A 5D2NB 4JQIL 2JKRM 2IDUA 1FLRH 1UADC 2YUWA 3Q43A 4KUCD 5KBDA 1HYSC 3QQXA 4XPBH 2JE8A 3B1UA 2FYYB 4MXQD 4WCYH 3L3IB 4OY9A 5IFHH 1T22B 2UWEF 3JWDL 3ZDYE 3KYMA 2ZX9A 3IMSA 1EZLA 4QHKI 4IS6B 4U31A 5C71A 3QQDA 2X1OA 3LH2L 1KB9K 5I5RA 3EDDA 4BWTA 4AMXA 5JUEL 3LNFA 5SX5K 2X0VA 2WQAA 2WCSA 3CFQA 3L16A 4XPGH 3V4VA 1N0LB 1H3VA 5AKRA 1H3PL 2KDGA 3I75B 4HS3B 1A47A 3HR6A 3SYAA 2MRYA 3RA7H 4GQZA 2KPWA 3L3OA 4BCXA 5F1NA 2CM5A 2A9CA 2NMSA 3MODH 4Y9BA 1TOXA 1XH3A 4XPTL 2MQ3A 4PY7A 1GW0A 5HYEA 4U1HA 5K39A 1ACXA 1KSRA 2IFGA 4WVRA 3MLSL 5JYLA 2X7LA 1TVHA 2ADFH 3K6OA 5FDWA 1P6FA 1DN2A 4HEME 1IBZA 2JK5B 3GSUA 5I30H 3EHBC 3C8KA 3IJSA 3O3DA 5IWLA 1AIFA 1NEZG 4TLTA 1BAFL 5KVGH 2A74B 4XGZA 3QI9A 4PJ9D 2QGDA 3DX1A 3LEXA 5SWZB 1PG7L 4KVPA 1VFBA 4RFOH 3FAXA 1M6OA 1LO2H 2WXMA 2Y7NA 3P0VL 4AQEB 1P9MA 2MNWA 4JW3A 3OF6A 1S5IL 32C2A 5M7QA 3KL5A 4UUJB 5IFAH 3BVNA 3P0GB 4LE8A 5CIPB 3BJLA 1MJ7H 2Z93A 4TUUA 5E1AB 4L1LA 1TEYA 4L5FH 4F9LA 4Z3EA 4D0CB 4LDEB 2YPKB 1PDKB 3D2UB 2EVFA 5D7KD 2EUVA 2WXFA 3LPOA 5IB1A 3DETD 3NIGF 2OW6A 4LVEA 4B7LA 3BVXA 3BHBA 1FC1A 1KLGB 1QNIA 1OP3H 1T5KA 3VXMD 2DMBA 1ZLSL 3GSNH 2R0ZL 3R8BB 1YYML 2VDRH 2QSQA 2B2XH 3WHE1 5C9JA 3K1KC 1A8JH 3VFRB 5C07D 4DNLA 3X1GA 2J8HA 3BE1H 2QADB 3BEWA 4P2YA 2FCBA 4TUOA 1X44A 3VWJA 1UXMA 1ZV5A 3JVGC 3O2VH 2A7BA 3ARPA 3L3JB 2WWNA 2A38A 2BFVL 1F3DJ 4PJ8D 3ZDYF 2NTFA 1E9PB 3WEMA 2XKSA 5HD8C 4LFHD 4R2GB 4ZTOH 1X5IA 5IHUL 1FIGL 5DJCA 5GJSH 4YOKA 3ZKND 2RD0A 1DVTA 5J4MA 5CZRA 4FTVD 4KNQA 2X6VA 5FKPB 3K2UL 1F6FB 4ZK8A 4JREB 2H3NB 5JPNA 4FZEH 2VC2L 3OPZL 4HBQA 4Z7VB 2JCCA 5FGBA 4YWGH 5I1KH 1I8KA 2I24N 4FFYA 3LH9A 2E5EA 1CZ8L 3ESOA 3NIDE 1IGYA 2N0KA 3GPSA 3N42F 2ICCA 5E5RB 4KHXH 1HHIA 2EDLA 2MEJB 3CQQA 4G72B 4JDEB 4X9HA 3VD9A 3S96A 3QDME 4DO6A 1G84A 4P9MH 4WSJA 2BK8A 3LZFH 5HHMD 2OKMA 3AC0A 4E9XA 4UOW1 3F8UB 3EG9A 2I25N 2JB5H 1R3LB 5FYKL 3JYBA 1DVUA 5GRWA 4W6YB 5I18H 1ACCA 3V9FA 4K55A 3U4EA 4ZMWA 2VLRD 4PG2C 4JJ5A 4EMZA 5H2BA 4Y5YC 4NSKA 1T5WB 1UHVA 4G1MA 4ZW6A 4I5BA 1ZLVK 1P7QD 5DRWB 2EDYA 3C60C 3B2XA 4N3TA 3CPUA 4M1GL 4ZFZB 4H20H 4BJLA 4C57C 4ZZFA 3DX0A 2HJFB 1HQ4A 5DRXB 1QD0A 1UASA 3CU7A 4Y19A 2JELL 2CGRH 5DUML 1JPEA 3QORB 3U46B 4YDKH 4XBPB 2FO8A 2RMNA 4EDWH 4LL4A 3LMJL 3IXAB 2N01B 1AKJA 2ZKHL 4HAKA 1TJHH 3CFKA 4XBEH 1K3ZA 4X0NA 1EEZB 1ZK9A 2VXSH 5HGBA 2HMIC 1YPZA 3IS0X 3DTXB 1SMAA 1J48A 5IR1A 5DD6B 5IBLC 2FL5A 1KF9B 5HJBA 5DHVA 3F85A 4PRPD 3SOBH 4OZGF 4LNRB 4EEEA 2CQVA 2DLIA 3RWCB 5HDBE 4R3SA 1U8MA 4F7PA 2XWXA 4U1NA 3UIYA 5DS8B 1N0XH 4JO1H 4KQ4L 4Q74A 2DMHA 4CA4A 3D34A 5CLZA 3DSNA 3O4LB 1L0PA 4OF0A 4MNGA 5EWIH 4CVZB 4YHIB 4W6XB 2CXKA 5ECJE 2HX9A 3UERA 4ZMVA 12E8H 3IFNL 3NCYP 1FZOB 5IJBC 5B38G 1WGOA 2TRHA 4S10A 3IJEA 4Z7UE 4ABUA 4OQTH 1UGKA 4RLDA 3MLVH 4XVSL 1UD8A 3NCFB 3D51A 1FNSL 5DT1L 4FL4B 4HC1A 1N5AA 2WXRA 3O45B 1UWGH 3WS6A 4WHDA 3W0WD 2WO2B 5EU7C 5HYQB 4KGLA 1K8DA 1KPVA 2W91A 3HS0B 1BYPA 3P0YH 5I74C 2P5WB 4XCFH 5HY9B 3ETBJ 3N44B 3A6BL 3C5JB 3CN2A 1GGUA 4QRFA 3T09A 3PWPE 1NGPH 1JXDA 2R1YA 3QDJE 4JJHA 3UMTA 2VR7A 1N4XH 4JZOB 3L7EA 3CVIL 4NQEE 1U8LB 3CQFA 1P4BL 3MREA 3IEAA 5CBAA 4YK4C 1S6NA 1SLXA 3L95B 2QFRA 3DV6A 1A4BA 4GS7B 1Z3RA 3QIUA 5F7EL 5I1LB 4FN0A 4ONFH 3GBLA 2D0FA 5L9DL 4ANKA 4QNPF 5KVGL 5BCAA 3TF4A 4HEPA 2Z3FA 1NL0H 1DUZA 1CIUA 3PWVA 4B9KC 5D4QA 5GGQH 3PHOA 4NHCH 1LO2L 1I1YB 1R3LA 1TTFA 1M57B 4JO3H 2D7T