3VQMA

Small heat shock protein hsp14.0 of c-terminal deletion variant with c-terminal peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
GKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Small heat shock protein StHsp14.0
publication title Structural studies on the oligomeric transition of a small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 15
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vqmA00
3J07A 3N3EA 3Q9QA 3QORD 4PBDA 3QORA 4YE0A 1WH0A 3QORB 4YDZA 3VQLA 2CR0A 3AABA 3GUFA 2Y22A 3L1FA 1GMEA 1SHSA 2XCMC 3GT6A 4MJHA 4YLBA 4YLCA 2BOLA 4ZJ9A 3IGFA 4FEIA 5DS1A 4M5TA 4JUTA 4M5SA 3L1GA 4YL9A 2KMWA 2K8QA 2RH0A 2Y1ZA 3GLAA 3W1ZA 5DS2A 3Q9PA 2WJ7A 2O30A 2KLRA 1WFIA 3EUDA 3VQMA 3QORC 2N3JA 1EJFA 4PCKA 2N0KA 2JKIS 2Y1YA 1WGVA 4RZKA 3AACA 4ELDA 5LUMA 1X5MA 2MNWA 2CG9X 4I88A 4JUSA 3L1EA 1RL1A 2WJ5A
chains in the Genus database with same CATH superfamily
2GBUA 3EYSL 2XN9D 1Q72H 2NR6D 2VLLB 5HHOB 1TJIL 2BVQA 3B9DA 3GBML 3D0LA 2A4CA 3FB8A 2WBKA 1XGRA 2L7QA 3R0MA 4JCLA 4NRYB 1RK0A 1DE4B 4G6JL 1NCDL 5A2LH 3PHOA 1M6OA 4IOSA 2PABA 2O72A 1T04A 1PLGH 1HHGA 1S3KH 2Y9RT 2WAQA 4LLYB 3ZTJG 2EVGA 5IVXA 5I1EL 3QG7H 1SJXA 5C71A 4QGTA 3TNNB 1CICB 3TU6A 2L04A 5C6PB 1GZQA 7FABL 2Q2EB 1E4KC 1PZDA 3ALPA 3FONA 2JJVA 4FMFA 3UZQA 1QBLL 4RAUA 1T20B 2APTA 3SY6A 3RL1A 1BQLH 5CIPH 5DMIH 1WCQA 3TBBA 2MQGA 4XMWA 4P3CL 1CIUA 2P4AB 5EBMB 3HHSA 4C55A 5DRNB 3ZHKA 5EF3A 4PLOB 1AE6H 2NW2B 1S7TB 5FKAA 4LSVL 4QHNA 4JGJA 4NRXA 3D7PA 4U1SB 2Q20A 1EXUB 3ARDC 4NZTL 1GR7A 2VKXA 4PJ5A 1P4BL 5T1KA 1DVFA 4FAAB 1S7UB 4HHWA 4FD0A 1X9LA 1Q1JL 3CV5A 5FIEA 1AFVL 1VEPA 2VLRD 3IJ8A 3MN8A 5GS3A 3B8SA 4YSTA 5J1SC 3B37A 2KZ1B 4NI6A 5E70A 4Y19E 4ZSOA 3EO1B 4YBHA 4APXA 1AKPA 2W81C 4QCIB 3STLA 4N3TA 4QXWA 3FQUB 2BINA 5EU7E 1OAUL 2VITB 1E2WA 1RIHH 4N5UA 4KROB 5JHDD 4MD4A 3LPFA 1B0GB 4PJEA 1A4CA 2N0KA 1DL7L 1DTUA 1EHAA 3V10A 4JRYD 2K6ZA 1CLZH 3FBQA 4HETA 4XN5A 4ZUSB 5T3ZL 3WD5L 2FL5B 1I1RA 3TC9A 2XA8L 3PWVA 3IF1B 3X2QB 3ZDYF 1KB3A 2X89D 4MBRA 2AQSA 2BCKA 4OCMC 3LEVL 1KG0A 4N8VA 1CICC 3JTSA 3ZT5A 5IEKB 3ATAA 2VR4A 3TM6A 2WWKO 1XL6A 2BOBB 3IMWA 5BUGA 4WFED 3BKCH 2C9AA 4ES9A 3S34H 1BFVL 3V4PA 2YPKB 4GXUM 1FIEA 4OFKA 1JPSL 5LWYH 2Q86B 1OWRM 2J8UE 4HU2A 1MRFL 2YGNA 1ZHBA 4GRLA 5E08L 2R1WA 4R90H 4HPOH 4KQ3H 1SJHA 1UWXK 4PVMA 5E6ZA 3EOBB 2BSRB 5GSVA 3WS6C 4ZDHA 3SBQA 1E8ZA 3R1GH 3SOBH 4AKPA 4Z8FH 4PRIA 1QSED 2O5ZH 5HHVL 2NDFA 1JN6B 2PTUA 4JY5H 1SUJA 4OFYD 2X12A 2ZXDA 3GSXA 2KLRA 3QG6B 2R1YB 1BDYA 5DWUL 4PJ8A 4PM1A 4LRIC 3QUYD 1WV7T 4WTXA 5CR1A 4LMQE 2ZG3A 4X4XA 5AVYB 1ZAGA 1COBA 5IVXE 2JSFA 5ESVA 3TPUB 2VXSH 1N59A 2OTUA 4KJQC 2F58L 2XVKA 4KROC 3U2SA 3JUYA 3ZQWA 4JRYE 4NGHH 5D7LB 5CBAA 4YXHL 4BWUA 1W8NA 4S1QL 1V3KA 4CU8A 5ACZB 4ZG1A 3WXWL 3QRLA 4AENB 1EO7A 3ZR5A 4ZS6D 3BFOA 1SXNA 1JXFA 5KZCB 1TZAA 2AK4B 3FB7B 2P5WA 4NO0D 4Y2DA 4I3RL 4BZ2A 5J6GB 2FJUB 2YZ1A 4NERA 4Y4HA 3EFOA 4X99B 4PJ5E 3VQLA 4HJJH 3ZE1B 3FTGB 4GO6B 4ZUWB 4HUWA 1GGCL 5LBVA 3V2AR 4OBRA 2VC2L 5AVRB 4KH9A 1ROCA 3FT0A 1DQKA 3RY5A 2DKSA 4ZSOE 3HNVL 1E6OH 4KKNA 1JZ7A 1J12A 4Q74A 4CC4C 3PL6C 3BSZA 2BSSB 4MAYB 3EH2A 3V9FA 3VXNB 5SWSA 4AGQA 1G6VK 4ECNA 4XMLL 4XP9H 3QIUD 3RUGF 3VXMA 4DP0X 4PW4A 3C6LD 4KUZL 1E6JL 4TULL 2GSMB 2JELH 3IGFA 1PGRB 3HUJA 4MA7H 4OCWH 4L4VA 1M9SA 5IHZA 1A6TA 4OZ4B 3T65B 4ES8A 4G8EB 3QQDA 1IKNA 1IT9H 2JLLA 5HYEA 5ABZA 4TNWK 1MLCB 4BK5C 3V5HA 2X44D 2AABH 1SOQA 3B8YA 3BFWA 3MRBA 1IEBB 4UTBA 3BVWA 4OZIA 4RLDA 3WMPA 5JHLL 5FA3A 1MHCB 2FYYB 3DKHA 4HIHB 4LHQB 5INDA 1ZLDA 2AQQA 2LFEA 1AZRA 2D2CC 4M61A 4MNQB 3QHFL 2J5WA 1GOFA 5EWIL 3C08H 2RMNA 2VERA 3Q2WA 3MRIA 2XZQH 4HJUA 1JD7A 5DUBB 2RA1A 1YRKA 4JBSA 5GSRA 4FFWD 3Q9PA 3WLBA 2W9EH 3NFSH 3D85B 3EJRA 5HHMB 3LN5A 2E9GA 3PV6B 3VXUD 3P73B 4HIXH 4IU3B 1M57B 3WLWC 1YMMD 4UCFA 2X38A 1X5MA 3LTVA 1JTOA 5AW6B 2XFXA 1SEBB 1E3ZA 5DQ9B 4JFPB 4TNFA 5KAQF 4N87A 1DBAH 3CDZA 3E9UA 5DD6B 4KY1L 2OI9B 3CHRA 4LOVA 5EORL 3HFML 5GHWL 5SWZE 3TTSA 3AGWA 5TE4H 4YSRA 1RUMH 3OB0K 2W38A 2OZ4H 4MAYC 2O6EA 4IRJD 1MCQA 5ALCH 2MRYA 3PFQA 3LJ3A 4K7PY 4OJEH 5IQ9A 4M93C 4LHJB 5AVVB 5EU5B 2I24N 4R26L 1MZYA 2F8IA 1C5DB 3P30H 2FT8A 3BPLB 4JM2F 3F5WA 1JPTL 4LFHD 2CE6A 4J3UA 4JZJB 4W4OA 5DD3L 1G84A 1PX3A 3JWOC 3FT3B 2OYLA 4ELMF 3MA7B 1IJ9A 4FFVC 4MX7B 2HJFA 3EYOA 5C2BH 3S36X 2B4CL 1S9KC 2JKLA 4NZRH 1I3VA 3C9NA 2D7PA 2P8PB 3KYOB 3D4YA 4P9ML 1E9PA 4NQVA 3ZKMC 5TH2A 4KI1A 3E8VA 1U8IB 2VN5A 3L4VA 4TLTA 2D3VA 1PG7L 2XG5A 3BUTA 4MMZB 5HD8D 1ZCRA 2YEQA 3CFMA 1KZYA 2Q9OA 4JRXE 5GRYA 3VI4F 2HLFD 4MXQC 4TUUA 3D4ZA 1ZLVH 3WUZA 5LG1A 4BQ6A 3VXUE 2F1BA 3UTTA 5LQBL 4MYWB 5FW7A 5SWSE 1EGJH 3EGSB 3VXME 3ULUL 2BIHA 3QH3A 3VG9B 5ACMA 4BCZA 1BX2A 2IH8A 5CJBA 3INOA 3HUJE 4J28A 4N2GA 1QPXA 2XWTA 1OB1B 2FJGA 2OI9C 3HG1A 3LEYL 2OL3B 1I7ZB 1A21A 1JPGB 4R6UA 1IGCH 1NCTA 4Y4FB 3OZ9H 3KL5A 4U4BA 1FLRL 3CQFA 5DRZA 4HX1A 1XWVA 2WQWA 4XNYH 4GKSB 3CD4A 1MCOL 4NI3A 1FSKB 5ISZB 3VWJB 1F2XK 1HIMH 1WE5A 5DK3A 5BS0B 2N56A 1ROWA 3DDFA 4ODXB 3ULVF 2QV2A 4P2OD 1OAYL 3PGDB 4G7QB 3V0IA 2X2HA 3L9RB 3ZT6A 3G6AB 4EUPH 1H3TA 1FZJA 2XJKA 4XAWH 2NY1D 1XEUA 4PV9A 4FHJA 2DJSA 1MAML 1ZVNA 4QRSB 4M6OL 2A77L 1YY9D 1RU9H 1T4KA 1IC7L 3U7WH 1RXLA 4PB0L 5TPWL 4Q9RL 1Z66A 2YJLA 3DHUA 3TNMA 3GMPB 3PWPD 4FQXA 1E5AA 3ARQA 4MMZC 1P5VA 1JYNA 4TNWF 4L2YA 2X4RB 1IC1A 3NPZB 3SY0B 3D50A 3W1ZA 5KN5A 4D0CA 2Y4SA 4AITA 1FG9C 4LIQH 2J55A 3QPQD 4YEEA 2NSMA 3LKSA 3B5HA 3OTTA 3MBXH 4HWEH 2GTQA 2UWEE 4LSQL 4PBVC 3EHBB 3QZBA 4LLQB 3RIFK 1RUKH 2B1OA 2YPVH 1RZFL 2IC2A 3L6FA 1AXTL 4RFEB 2QL1A 3TN0A 4JQXA 1MREH 3MDJA 4RMQA 2ZUXA 3SYQA 5DVOA 5CGMA 3UTOA 4XMTA 2YC1B 3CIAA 4WI9A 3VWJC 1GGIH 5EO9B 5B1BB 3S3JA 3AG1B 1KF9B 3F04A 1ETZA 4Z77A 3WXVL 1CXFA 5KVGL 2V2TB 1SOSA 4DGIL 2FO8A 4WFFD 1CF8L 3LH2H 5JXAL 2QMKA 3ESOA 4N6RB 3I3BA 1SXBA 2VLJA 4FZ8H 2P3YA 1D5XA 1U93A 4WWPA 3T6QC 2DWXA 4P4KD 3ZL4H 4MS6A 3T0EA 1IBDA 5F96L 4H13C 3TYFA 1PAMA 3LXBA 1XF5A 4YGVA 4CAGA 1I75A 3AREB 3PWPE 4JL2A 5ILTL 9PCYA 2DD8L 3MXVL 5I1IH 3T2NH 2ICEB 1G9NL 1AZZC 3IDYB 4HUUA 5I0ZA 2EZ0C 1JHLH 3DMMD 2I07B 4XP5L 3RU8L 4L8SA 1HWGB 3KPSD 5FX3A 5IESL 3HB3C 3S36H 1TENA 3DK2A 4NP4H 1D9KD 3V0GA 1E42A 2YXVA 2EUXA 1CDBA 5I16A 2D4DA 1F56A 4X0KA 1N2RA 5IWLC 2DKUA 3Q2CA 4FXGA 1MFDL 3TO4A 2ATPB 4MNGB 3EHBC 4E9SA 1MN4A 1KFGA 5E1QA 3PDOB 1IM3A 4K7PL 4UT7H 4DVRL 3ZE2B 3F62A 1DLFH 1JTTA 4RFNB 1UOWA 1GXEA 3C2AH 2BNQD 3O6LH 5C8JB 4HWZB 2OW6A 2F53D 2FQFA 3ESNA 4YDIL 2D03L 2FTAA 2ODIA 2VXTH 5CF3A 1YYML 2CGRH 2CR6A 4UDUA 5DVLA 4HYTB 4QXGL 4WFFE 4XC1H 4L37B 1U8CB 3NIDF 3ALWA 4NAMA 5TK4A 3OKDB 5ETUA 4KK8D 4PJ9C 4XWOD 1B0IA 5D7KD 4W6XB 1U2HA 1TKWB 1J0ZA 3FU6A 3UXFA 5HSFA 2FAUA 1L5GA 2UZXA 4G8GE 3UTZB 4M6NL 3ZPDA 3RPIA 1CLVA 3KYAA 2Q8BH 1ZLEA 2HFGL 5JPNB 1QEWB 4TLUA 2ALAA 4KTEH 3QRGH 4OV5A 4IRSC 4YJZL 5IG7A 1ID2A 2ICEC 3CZFA 3MLTB 1OT4A 2DMGA 2XWBA 3CIQA 3IDYC 3MCG1 4MDIB 4PI2A 1MPAL 1F3RB 4FKHA 1FZMB 3ROLB 4BFIA 3ARGD 3BX7C 3NCCB 4N0UA 1NGQH 1UA3A 4JKWA 3VI3B 1QO3A 1MFEL 1T21A 5I74C 4NZJA 3SDYH 1KIUA 3NA9H 4FQ1H 2HX9A 3VXSD 1T2JA 2UX6A 2CO4A 5IFJA 4RVBA 2A1WH 2X41A 4A7TA 2A2QT 2DEYX 3QORB 4KDTA 4HIIB 1BVLB 4EXPX 3DRTB 3RVWC 4R4BB 4HIEA 4HKXB 5E2TL 1F0LA 2RCSH 3L7EA 1OL0A 4YHLH 3HNSH 4RMTA 4CADA 1OAQL 3MNVB 2R56L 3EDKA 2BNQE 2I7OA 1QFUH 2PPFA 3VWKB 3SO3B 1G7JB 2JIXB 3HC3H 4RFNC 3IGLA 1WPCA 2F53E 2PUQT 3P54A 3TO2B 1TTGA 3AM8A 4OTXL 4KMQA 1XR8B 3AY2A 4C56B 2HMIC 2V5RA 1EANA 2DBLH 2G5BB 4Y16D 5FO9A 5I2IA 1K4CB 5I8EB 4X98B 3TBYB 4KKRA 5LGYA 3BHBB 3VXOA 1ED3B 4IRZH 5JMRA 5HHXH 4OJCA 3WE1A 2AP2A 4LLUA 4ZJ9A 3U2IA 5FHBH 5EN2B 4DZBB 4C57C 4XO5A 3P9LB 2IPKB 4L3FA 3CVBA 1DANU 4UOW1 1Y6KR 4D8PB 3H0TB 3FCSB 4CDHA 3QULA 4MLIA 4N8CL 3VFWA 2CKBH 4LF3A 3RI5F 3ZXAC 5HXMA 5T1LB 2GBAA 3U36A 3HE6D 1AOZA 3QXWA 3MOAH 5FUZL 4N9GB 4BFBD 1Q0YH 5H37G 3MMEB 1NM4A 4APQA 2XBDA 2WBJB 4N0YL 1D5BA 3QWOB 3U4EB 35C8H 4LP4A 5IB5B 2Z1KA 1PKQA 2Y2WA 5C1MB 2P42B 4WNQB 4BHUA 2ORBH 4FFYH 4N0CC 5C3IA 5CZVL 4I2XA 3VDAA 3WL9A 3EUDA 3AXHA 2W1NA 3QUZC 4G9DB 3QORC 4J1UA 4EZJA 5AW4B 1HQ4B 1E30A 2W0FB 3KBEA 4ZOCA 1A6VH 2Z35B 3FDWA 4Y5XA 5CP7B 3KXFB 5HGAB 1J8HD 1A6AA 4RISH 3VWKC 1UM6L 1HWHB 1L0QA 3SO3C 3RFZA 4L1DA 4M7LH 1G1OA 5JW5B 2MQCA 3DVIA 4Z0XA 4OJYA 1S78C 3A6BL 4IMLA 3DBXB 2BERA 2NZ9C 4GRWF 4R7NA 3S5YA 1ETA1 1KN2L 2DL9A 1E27A 1HJBC 4I1PA 4ZBJA 5AW2B 1LEGB 1YEDA 4WJ5A 4DEWA 1HE8A 2XICA 4ZOBA 1XF3A 2D31B 3BZ4B 3S9DB 1UVQA 1F4AA 3H4FA 1A1MB 2FUQA 3ECUA 5DA4A 1ORQA 2OXGA 4P8QA 2Q3ZA 1O9VA 3LV3A 3FT9A 1JVKA 1HILA 3LZRA 3HW7A 4ZUTB 4AYBA 4ALAL 4GJTB 3LS5H 2C5DC 4H0IA 2Y07L 2AJUH 2CBOA 2OR9L 2MOQA 4XBGB 1HHKA 1KCWA 3Q8BA 1REIA 2C4FU 2K3HA 2OCJA 5DK0A 3WELA 3BO8A 3DJTA 1F4XH 4R0LA 3PXHA 3TASA 4WNSA 5IOPB 1BBDL 2ESVE 2WBJC 5K39A 2H4EA 4XODA 5C09D 4K3EL 3O2VL 5F1NA 3UJIL 1P1ZA 2PP9A 1BEYL 3GJFB 1BD2D 4PJDE 3RIKA 4Z23A 3DXAD 3F83A 1OK0A 3WS3B 1U8QA 4XVSL 2ZP9A 1CPUA 1EAJA 3SPVA 2ISDA 1IE4A 1UXMA 3C5XA 3DX8B 1J8HE 3FO1B 3OF6D 4LEOA 2D7TH 3FQXB 3H7BB 5CXPA 3O3EA 5I1LA 1NBZB 4OZFH 4HU8A 2H32A 3H4HA 5BXFB 2B1HH 2Y06H 4NQSA 1MI5B 4NQDA 2GJ6B 2PYEE 1KJVB 1MFAH 3CJJA 2APWA 3MQIA 4RBPH 4BCYA 5JO5A 1BVOA 3WIHA 4KMTH 3KLHC 2X6VA 1OCZB 1FRGL 2J3SA 3GNMH 5AZEH 3TA3A 1EAPB 2ATKA 2W88A 3BW9B 5IBUB 5I1AA 1CIDA 5INCB 3MRQA 4XXCC 3DJZA 5EU3A 2PO6D 2ZUYA 4A7GF 3MV8B 4A67A 4F58H 5BZDA 4RRPA 4L1SA 5B38A 1DN2A 2W95A 4GLRI 4XMKH 1JV5A 4AGPA 1DFBL 2EDWA 2JK5A 3CQPA 3DRQA 4NAJA 4RWHA 3WGUB 2W65B 4YDLB 4Q9QL 4Q6KA 1Q94A 2PCYA 1FH5H 2LHAA 3AITA 1A3QA 4NKOA 1AGEA 1HHJB 3UYPA 1I85A 3EGDB 4LDOB 1AG0A 1SEQL 1SMAA 3NFNA 4FYSA 1CGSL 3OLEA 2YD8A 3PRZA 2Y1VA 4NN6C 3QJFA 1PZUB 5ICYA 4Y5VB 4GSUA 3DXAE 3BP7B 3BOVA 3ML9A 3Q8AA 3V4LA 5A7EA 3CSYB 4P5SA 3VMNA 4TSCL 5KSAB 5M7QA 4OW6A 5EOTA 1OTUC 5EU4B 4FNSA 3QUHA 5F7FA 4BZYA 5LBSL 1I7TB 1U3JA 5CEZE 5I1GL 1CU4H 4IOIB 1A4JB 4NENA 3QIWD 4LL9A 2Z9TA 4XCFH 1OAJA 4X9FA 1MIEL 4PW9A 4HV8A 2QBWA 1S2EA 2VMJA 3FFCA 4Y1AD 2KH2B 5HHNB 2ZIDA 4X80H 5DD5L 2J71A 3BUIA 4K15A 2Y7SA 4FKEA 1WICA 3H9HB 2HZHA 3VNZA 4AQ1B 1BZOA 2J1ZA 2X1OA 3MREA 4NC1E 4R8WH 5SX5H 4GMSL 4K0OA 4Y9EA 1CL7H 1OCOB 4F15B 2W0PA 1J05B 4CUCA 5KTEL 1KELL 4GI6A 2EUZA 1E7VA 1FNEA 2HKHL 2VISA 3RILA 4HKJB 3Q9QA 2QV4A 1F1AA 3SE9L 4M5YL 1QR4A 4PY7B 5DQJB 1CK0H 5DEFA 5KJRL 2CUIA 2GQHA 5T5FA 5KVFH 4WUKH 4HWNA 4WW2F 4AMKH 1A7PL 2B4CC 3OAUL 1UM5L 3DTXB 1L7IH 4X9YA 5EFIA 1YNKL 4R9HA 5I18H 4Z7VF 3UPRA 3REVB 5F9JB 4YDLC 4JO3L 1B2YA 2Z34A 1M71A 1EVTC 3UAJD 2GC7C 1S7QB 5K1NA 1IB5A 1OANA 2Y7QA 1CXIA 4I87A 5HJGA 3I74A 4ZFGH 2N0MA 1HYSD 5HJ3A 4J8RB 2CH8A 1X6LA 2LLNA 1T2QH 4KJYA 4Y5VC 2UUDK 4J3OC 5KEZA 4NP9A 4NQDE 1LDPL 4NS0A 4L0YA 3OMNB 1RIUL 4JFVA 1BZQK 1LWHA 2VTFA 3MRDB 1OOAA 3S37L 5KSAC 5LDUA 1I1AD 2CD0A 2ZUWA 1WWCA 4FTVA 5E1AA 3FT2A 4AUUA 4M43H 3QCTL 3MRPA 2QELA 3PWNA 5IKCB 4Y1AE 5AD0A 4PJ6A 4RRPM 4NZ8A 1MCLA 1ES0A 3ZUNC 3H1ZA 3RDTB 2AXGB 2X6MA 5EC1A 3UO1H 1ACYL 3TFKC 5DYOA 4AWJC 3P40A 2A73A 3O45B 4BFEA 4AQ1C 2DH2A 1QFOA 3WNOA 3REWA 1XVSA 2I25N 1HXYA 4U1LB 1Q9WA 3GSQB 3NCWA 3NZHL 1LP9E 2D3JA 3K1DA 3Q6GH 4UZUA 5KSBA 1ND0B 3K71A 5K9QG 3APDA 1H0DB 3RB5A 4U0RC 4FA6A 1CFVH 2IO5A 1V7NH 4EBQH 4GUQA 4NHUB 4P0DA 4MGXA 4M7LT 2JJTC 4HHAA 3BD4A 4JANA 1T7ZA 3GZKA 1JRHH 2V7HA 3DPBA 1TLMA 4JHAL 2AEOA 3ZKND 1HSAA 5HVFB 3TVMD 3N1GC 2XOTA 1FV1B 1M2VB 5C6WH 5EZOL 1D6VL 1IM9B 1PYWB 2VABA 3CMOL 2WXGA 3Q6FB 4HUVA 4EI5B 3A23A 1OSEA 2Y36L 3H85A 4OLWH 3VXQB 1CE1H 5IW1B 1CBVH 4OZHB 6PAZA 2XTJB 4GW4A 5C0AB 1UWFA 5EUOA 3UL4A 4IHOB 4CA4A 2F54B 2QZ5A 1OP3H 4RA3A 5D7IE 3D18B 1UADC 5DMKB 5E4IA 3PDDA 4PGDA 2GEQA 4UNIA 2FQEA 4P46A 4AIEA 1NL0H 3P0YH 1MNUH 1ZE3C 5L4MA 4KPHH 1ZKAA 1W15A 4M5TA 1IKOP 3MV7A 4KJPC 4ZK8A 3QCVL 3PLYA 3RDTC 2B9AA 3SKNA 1JNLH 1EHKB 2PETA 5D1QE 2K4AA 5HDLA 2Z31B 4P5TD 1OLZA 4YNYA 3SEPA 5IJKA 4NFDA 4LSPH 2DMHA 4DFIA 4OQTA 4LO9A 5FF6B 3IGAB 1UB6A 3D39A 3UC0H 1SDYA 4ZX5A 1AXSB 4GH7B 3GS7A 1QSZA 4W6WB 2X9XA 4F7EB 1HL9A 3P77B 4PG2C 4JFZH 2J56A 4KV5F 4B9KC 3FZUD 1O5PA 4QRPB 3KPRB 4GQQA 3QR1A 4P3DB 3Q3GB 4EAEA 2YBRB 3PQYB 5K59F 1MCJA 3QEGL 4XO4A 1CFBA 3CPLA 4HLEA 3VGAB 2MTPA 1JD9A 1YEHH 4N8UA 2ADIA 3K4ZA 3UCRA 1IGIH 3L3OB 1VACA 5HPOA 4O51B 1NCOA 3D2UA 3MYJB 1X5LA 1NFDE 1WTGT 4OKDA 5F3HA 5TQ0H 4HJ1A 3D69A 3WY4A 4UB0L 1G9NC 1FF5A 3RGVA 5CILL 3TJPA 4EI5C 3ZZLA 2RALA 4N8VG 1N8ZB 3TPKA 3GJEA 2FHFA 2ZQKA 3SHSA 3S8WA 4ZMOA 4MAUH 4TNVK 3QQ9C 1JK9B 5KWYC 1UT2A 1M1SA 1OTTC 2FWUA 4OFIA 4UDTA 4XWGL 3L5XH 3A21A 3N44F 3Q48A 1J1OL 1I82A 3AT0A 3BAIA 1KJ2A 1IAIM 4HCRH 4N85A 3O3DA 2JCCA 3GMLA 1VENA 3H2QA 3L3DA 2FO4B 2WWMC 4I8DA 4LZKA 4OFDA 1KLGA 3RZCB 4P2QE 2UZIH 4OLZL 5C7ZA 4NJAH 4JUSA 5CD3A 4GBXB 2WWNA 1HSBB 1NINA 3O6ML 1ZHNA 4PRAA 2CNZA 3FUIA 2ZWYA 2Y3NA 3FTUA 2QVIA 2DQJH 1S9WB 3T2LA 4TOYL 3VRIA 2FX8H 4BK8A 2Z31C 1FYTA 1OE3A 1XF1A 3GI8L 3H3KA 1MUJA 1BZEA 5D2LA 4UMSA 2PMZA 3HR5B 3QXDA 1CQKA 4L0ZA 4AJYV 2P1YA 2VCOA 5CIPA 4WLCA 4EPSA 1F90L 2IGFL 2R27A 2VQ1B 4U6YA 5KANG 4FQCH 5BZWA 1XTMA 1F4YL 2YEZA 5H35B 2BVPA 3VD0A 1RY7B 1SFHA 5CINH 3O9WB 4ZW8A 4AG4H 3VD7A 3CVIL 3S5ZA 4F9LC 5GS1B 1FWXA 4G7VL 2DJ4A 2CDFB 2NNFA 5EO1A 4YPGB 3UJTH 5IR1B 5C0NC 4QXVA 2HT3D 3BH4A 3S88L 4OCXL 2A0LD 5C07B 3C5ZD 5EUOE 4YN3A 2PN5A 4RZCB 4XNZB 4EXKA 3L3OC 4E9WA 2VQ4A 2OJEB 2W94A 1FYHB 4WU5B 1OSZB 2O93L 5GJSL 1BLIA 3MSPA 2DTMH 1NGZA 3ETSA 2K0RA 3QO1B 3EZJB 3EJZD 1QUNB 3DUUA 1L9OA 2F7QA 3Q7JA 4MNHB 2CO7B 5CCJA 3ARWA 1MFBH 4XNQA 1ADQH 3O2DA 4XP4L 1J1XH 4AZ8A 3H53A 4MD0B 1G6RL 4NJ9L 3E7JA 4QRFA 5TDNB 5AW1B 3HBPA 3QJRB 5CJXA 2JXMA 3NSFA 5JNYB 3EF7A 1QLFA 3CFEB 3ERXA 3SKOB 3CHSA 5GGQL 4J39A 2ZP8A 3T3MF 3TIDA 3W11C 3RZCC 1A7OL 2XQBL 5D1XA 4GBXC 1FLTX 1Z1WA 2CMRL 2APFA 1HAUA 1NUNB 4LEBA 3IDGB 4N22A 3QJQB 5D7JB 3T0AA 3UZVB 1Z9SA 1DVQA 2ZG2A 2NY2D 2R59A 1XCQB 4LHUB 1EIBA 1YQ2A 3OHMB 4TPRH 4PGEB 5CSZA 4MB3A 2CHXA 4H5SA 2Z4TA 3DX3A 4NQEA 4AH2A 3M8OH 1BPVA 2VZSA 1S7WA 1MELA 1BXXA 2DQIL 1I7RA 4X7EC 4D0BA 2BXZA 1DBKH 3O9WC 5CCKL 5GS1C 3WHXA 2AJYH 5DJ2A 4EI6A 1TQCB 4LDLB 3DOSA 1OP5K 3QISA 2R69L 1MW0A 1OP9A 1A0QL 4KXBA 1XT5A 5GS0C 5IEHB 4L48A 5E8OB 5ID0B 1E5ZA 4JY6B 4ZS7H 5J1AA 4XNZC 3CX5K 3HE7B 4AQAA 3MFFB 2XXMB 1YPZA 1CMOA 2P5EA 4P23B 2WLMA 2Z91B 2ZF8A 3ME0A 2PWGA 2WANA 3MRGA 5ITFB 4CC0A 1T03L 4MQXD 3Q06A 2XN9B 1WZKA 4WCYL 4DGYL 2ZAIA 1GHFH 5A3ID 2QGBA 5JIQA 3FSZA 1P5UA 2PKDA 1AS6A 1G7LB 2KLSA 4GQRA 4OH2A 4S0TD 2HRPH 2OMVA 1G7IB 2VE6A 1GA2A 2G4GA 2FLBT 3BEWA 4L05A 4XOBA 1V3MA 2E6QA 5D2LE 5JDSB 1F8TL 1FGVH 4JN2A 5CCGE 1VIWA 3EOAA 3CFTA 2A9CA 3NEXA 1L0YA 3WDHA 1M7IA 3S96B 1KYOK 4BZ1L 5DHYB 2IBZX 4DTGH 2C9VA 4H4NA 2IXQB 1MEXL 3IAGC 1ZA3B 1XX9C 4UQ2A 2GK0B 1UA6H 1X5AA 2XV0A 1EJOL 1ZDSA 2DM7A 1EFXD 4W9FC 4DN4L 4DVBB 5F1KC 1MJUH 4MBOA 4Q58C 3AUWB 3W9EB 1T89C 3O8XD 3TL5A 3DVGB 1U8LB 2ERJB 1A8ZA 1D7FA 3WEMA 1OZUA 4OI7A 3HI5L 2C34A 1I4FB 2CBQA 5L6YH 1FL3A 1LGVA 2W92A 4QF1A 1EZSA 4FZEH 4H8WL 1CTMA 3CC5A 3GBEA 5IOKA 3T8XA 3UAAA 4DEPB 5DD0L 1A3LL 1RHHB 5F3BB 4YE0A 5HHQA 4HULB 3LPGA 2VLRB 1TQCC 5T33H 4V2CB 3N50A 3W56A 1JZJA 3ESMA 4WQOA 2YSTA 2A6JB 2JJSA 4MCYA 1HDMB 2BZCA 1CLYH 4ZYKB 4QHMB 5AZ2L 4QTFA 2CUMA 4X6DA 3RWEA 4D3CL 1BA9A 3EBIA 1AQMA 4NBZB 1NMBH 4JN1L 3ESPA 3LNFA 5DZNA 2H0FA 3PWUA 5JHDB 4PJFF 4H25B 2PWDA 4ZMYA 2VLKE 1KPVB 1SY6A 2NR6C 1CFSA 4LL4A 1YYLL 4DW2L 5I30L 4JRYB 5AOIA 3OD3A 1BM3H 4K8RC 1CT8B 3GRWL 2W59A 5C0JA 3VW3H 3SDDA 1H3UA 2BJML 3H9YA 3K4DA 2V5TA 4BSJA 4YHPA 3E6HA 4EVNA 3S2CA 3PCYA 1A9BA 4QI3A 5F1IB 5FM4A 1DJHA 4O2EB 3FCUB 3MKKA 4ZAKD 1DHKA 3FT4B 2XQ0A 3OGCB 2YN3A 3INUH 4FTDA 4WKZB 5D55A 2C9QA 4OKVA 2C3WA 4EE2A 3NIFE 1JVOA 1OHQA 3G04A 2MCAA 1QD0A 4EOWL 3MBEA 4JLRA 1MWOA 2YD1A 3GD1C 1YSOA 2ERJC 2H26A 3B9KA 4LLVB 1JWUA 4QHKJ 4UT6L 2YUWA 3T4YA 1Z5LB 12E8L 4WGKA 1AJ7L 4LLDB 4NDMB 2HT4D 1AY1H 2WLZA 4YQXH 3BAJA 4WO4A 2OL3H 1QSEB 2GJZB 1ODAA 5K9KA 3K6SA 1F3JA 5DC4B 2WCPA 5BO1L 4PS7A 2IQAB 5DUJA 4DUXA 1B4LA 1MW1A 2XVLA 4AEIL 3VRLF 2VDML 3QUYB 3D4GA 4JY4A 3WFEH 1OGAA 1V3LA 4MJ6B 2HRHA 4Y2LA 4NNYA 5DMGC 1S8DB 4CSSA 3HRZA 1FAIL 4MQSB 1U30A 1GYCA 1ZLUK 4AE0A 1DANT 4PGZA 4UV7H 1AI1H 1O6SB 4R96A 2RFXA 1R3JA 2X7LB 3O2WL 5DZOA 1ZLSH 1MWAL 2HLEB 3BGMA 3BPOC 3GRBA 2XZCH 5E8EA 4HKZA 4IOSD 3S35L 4KHTH 3THMH 1F58H 4HS8L 3BKJL 1M3JA 1P4LA 5A2BA 5L2JA 1MCEA 3AG2B 2BRRH 4GI9A 5TTRA 4NO0B 3FQWA 4X6FB 4R84A 2RD0A 3KPOA 4K5NA 4DO6A 5CGBA 5FA4A 4JO1H 1NAKH 2EJ1A 4M7KH 5PAZA 3QXUA 4PJ7E 1F11B 2WUCL 3O11B 2WVSA 1FC2D 3BAEL 3CN1A 1F13A 3KGSA 5FO2A 5C0RH 1EJ8A 2WLNA 4PJAA 4UTAH 1KPUA 1B4JH 2DB8A 1QTPA 1EGJA 4LDCA 4A6YL 4GW5B 1DQLH 4PJHA 2VXVH 5KSVB 1BMGA 4QTIL 5T1KD 3RVTD 1DVFD 1FNGB 3LEXA 4X6DE 1B0WA 4EIUA 3JSSA 5IJCC 32C2A 3S7GA 5FB8A 4BH8B 1LO3L 3OHXB 4Q52A 3QIUB 1YNTA 1GJUA 5FOJA 2EDHA 3GMMA 4PJCB 4XP1H 2AGJH 4WWKA 1E8XA 5GIRA 3IFOB 3TCLB 3C6LB 5BQ7B 5FV1L 1QPPA 4XCEB 4LPTA 3J7HA 2D9CA 3VGGA 2F08A 4CVUA 2B0SH 3CBRA 5DI8B 3UGXA 7PCYA 2CK0H 3QUYC 1WLHA 4YZFE 2BHZA 4XAKE 2LQRA 3T6VA 5IUSA 2F8XC 1JZ2A 2EDJA 3GHEH 4OD1H 4J5VA 1RK1A 1UGKA 4Z3GA 5C0EA 3IMBA 5I66B 1GSKA 5DU7A 1KEML 2VQUA 4DP4X 5FECA 1MHEB 5AYUH 3VX0A 4M7ZB 2ZCHH 3PJSB 3CFJB 3OKNB 4EUPA 3MJGX 4KAQL 5JQIB 1I31A 1HCYA 3EYSH 1KWGA 3VFGL 1T5WB 3KDMA 1QNIA 2GJPA 2YLHA 3NMEA 4R5VA 4OCYL 1DUYB 1TJIH 3IK2A 5AUMA 4DEUA 3GBMH 4ZS6C 4HUKB 2QKIA 2YAQA 1SMDA 3MRCB 4DO4A 3ECBB 4G6JH 2EDBA 1NCDH 4ONGH 4C47A 5I24A 4JFHD 1S7RA 1TTAA 4HS3B 3IETB 2BNRA 3TXAA 4B9CA 3QDGA 3K1KC 5ANHA 4X7SL 1YMMB 3V6OC 2CLZB 2OMYA 4UIMA 2IANA 3RKDD 1D5ZA 7FABH 1U8MB 4GRLD 4G70B 4KI5E 3MLUH 5E5RB 3BCFA 3BVNB 3MUJA 3TV3L 4P3CH 4JQIL 5D71L 4P2YA 4PRID 1RIVH 1S7XA 1MKFA 2ZG1A 3P11H 4S2SB 1UZGA 4G1EB 4XBEL 2J8UF 4LSVH 4IRJB 3OHXC 4OBSA 4ZPTA 4YHYB 1NEZA 3QIUC 1ORSB 3FO2B 3QP3A 4ELKA 1I3RB 4UQIM 4XR8C 4P4RA 2VQTA 3C6LC 3ZYJA 1P4BH 4IJ3B 3X14B 2B59B 2WM0A 4I0CC 4JFFA 3K80A 1NCIA 1AFVH 1OTSC 2L3BA 2OK0L 4PWJA 5FUCE 2Y22A 3DJ9A 1ZJAA 3O4LA 5JIIA 1KCUL 1JCVA 2QDWA 3V4UL 3IFPA 2WIIB 4MD5A 4OJFL 2GCYA 5CBEA 2LR4A 3CZNA 4M7ZC 1VGKB 4PRHD 5DJZA 1Z9OA 2PPAA 4HOMA 4N90D 1RURH 4PCTA 5IVXF 3ARFD 4ZMLA 1BVNT 3SDCD 1C5CH 3N9GL 3HS0A 1WFOA 1JTPA 4O2FA 2WXQA 1NBVH 1KCSL 2YHGA 4MQTB 5DZPA 3U0PB 4ICWA 4Y2DD 5KBPA 1MJ8H 3KPPA 3ASWA 1S7SA 2HVKB 4MCNA 5ABDE 4UILL 2EEFA 3ECWA 2WTRA 3K81A 4KKCD 4PJHE 4YBQD 5LKNA 4YDZA 3U7YL 1F3DJ 2LU4A 1CGYA 1TXKA 1HI6B 3K91A 4G8IB 1YY8A 4FFWC 4S1DD 2P8LA 3QJOA 3KPMA 1X5IA 2QTVA 4F80A 1H6FA 1QHOA 3ULAB 3FW6A 1CXKA 3T2OA 1M1XB 3LEVH 1Z3GL 1NDGB 1J86A 2PXYA 1UENA 3IXAA 4E42A 2UWEB 2EE6A 2X09A 3OWEA 4M8VA 4ZUVA 1FZKB 1OV8A 4JFDA 1BQ5A 2Z0BA 4AL8L 5FDWB 1DJSA 4D9RD 1KTLB 5TE7L 1BFVH 1LDSA 5JHAA 1UJ3B 3UTQB 1JPSH 1WBXB 1DDHA 4F7MB 1MRFH 2YAEA 4IRJC 5E08H 2XWJB 4IBTA 4YHYC 4F3FA 1Z5YD 1TEGA 3CDCA 1QR1B 3QZNA 2BIIA 3L4ZA 4I48A 4XO8A 5IGXL 1RFDL 4L4VD 4P2OB 4IJ3C 1MXDA 5ACLA 3CVHA 3JVFC 1NCNA 4PJEF 2BP5M 5JOPD 2E76C 1IC4H 1IBYA 4PLKD 2NY1B 4ETQA 2X28A 2XBTA 4AM0A 4DGVH 1WISA 5DWUH 5HYJA 4X7TA 4JFEA 4PRHE 1VZHA 4YHOH 4Z76B 4OF5A 4LB8A 4XOEA 2V9QA 2IFFL 4TNGA 4AE1A 2J6WA 4NQXB 1TVBA 2FD6L 3I02B 1FDLL 2F58H 2IANE 3P69A 3PWPB 5DS8A 3Q2NA 1J48A 2H1PH 2HUHA 1NC2A 2QSVA 1MFCH 3WEXB 4JFQB 3CSBA 4MAZA 4LIQE 1G6RB 1NOLA 5E1IA 4YXHH 2CUAA 2OMUB 3DX7A 1R0AL 1C1EL 4MMXA 4PTTA 5CN2A 4BKLA 4EZMA 1E40A 1JGLL 4ZW3A 5BVJA 5K9QI 2WGXA 4KXZH 1DQMH 1UH2A 4K9EC 3CU1A 2TRYA 4IYKA 3LX9A 1NLBH 1QBML 4NO5B 4OIIH 1X7QB 1VFAA 4QRQB 3UPAA 4CSPA 1AHWB 1AGDA 4I3RH 1K8IB 1J11A 1HQRB 2Z8VC 2BW5A 3US1A 4FQHA 4HJGA 4XPHL 4Z1PA 4M8QA 2H6PB 4M5ZL 5DJXA 4D9RE 2KHAA 2QQNL 4I0PD 5MEQA 2NY5L 2AMGA 1NGWA 4P5KA 1AZVA 1CFNA 3H2WA 2DF3A 1Y7VA 2B2XL 1X5KA 3GMNB 4UYQA 2OSWA 1F97A 4CBPA 3MV9E 3HNVH 3RNKB 2FATL 5IF0B 3BQUA 2ADGA 3MRHB 2FHCA 2Z8RA 4CVXA 1J7VR 3E38A 1OWWA 3JWNH 2IOMA 3DUSB 4FG4A 3VFVB 1QLRA 4PJXB 5BJTA 3HR6A 4XMLH 4X5RA 2YAOA 1U8NB 5GRXG 1VRSA 3PAYA 1V27A 4J27A 1QA9B 1MCCA 4KUZH 3N6YA 1JERA 3GXFA 3OPZL 3CFKA 4IRZA 4P4KB 4PRPA 2K1MA 1G9ML 3MZGB 2EE3A 4ZQKA 1W0YT 2TSBA 4M1DH 3VCLA 1BIIA 1AGCB 3DK0A 3MA9H 3ARTA 3F84A 1YY9C 4N9OB 4NO2B 1ACZA 2R0WL 2HVBA 2YQBA 1A4AA 2XV3A 3IEAA 1UA7A 2WLLA 3BIKB 3FQTA 3UABA 4PLJD 1EHLL 2H9GB 4JPVL 3VYNA 3DMMB 3F7KA 1CLCA 1ZOXA 2OMZB 3LZPA 5DDHA 4CMMB 4CSZA 3FCTB 3KPSB 3UTTD 5DCCA 2F0CA 1D9KB 4YHNB 3V0FA 2C9SA 2BSBA 2I9LB 1MRCL 2BIPA 2X4NB 2P49B 3C2SA 4UAOB 5DT1L 5HGHB 1E5CA 1AHWC 2A5UA 2GT9A 3LZFL 2CXGA 1IAMA 4R5XA 5E0FA 3GJFH 3H6AA 4M4PA 5J11B 5D5ME 2A9DA 1UC6A 4NOFA 2ZKYA 2JKIS 3BWAB 3T1FB 3TWCL 4HMCA 5HGBB 3BP4A 1XF4B 2HJKA 4MDJB 4N26A 3MRJA 4NXSA 3H9SA 2BVOA 1SM3H 4TUKH 3UOAB 3VTTA 5DK2A 2BNQB 4LKCB 4WI8A 3HUJF 1IAIL 4I3SH 4KY1H 1AR1C 2G2PA 4XVUD 5GHWH 1SHMA 5KS9E 4I85A 2G9KA 4RGND 1BECA 2BP0A 3LDBC 1XGPA 2XJLA 4K3DL 4RRPG 5B38G 1TG8A 4KXCA 3KPQA 4OZIF 1CJYA 1PZAA 2Y7NA 4HDIA 4ODHH 2R7EB 3G6JB 3R8BB 4R26H 2E7BA 3CAFA 4Q0XL 2FWLB 4LCWE 4LPWA 4LK4A 4P4KC 1JPTH 4WV1C 1NANH 4Y89A 2VXQL 1A64A 3E3QE 5DD3H 1L6ZA 3RWGB 5I0DA 4YXKH 4FG2A 3QHZH 3NBNA 3VJ6A 2VUKA 2HSIA 1KNOA 3CZKA 4XZUB 1TU2B 1Q9LA 2B4CH 3LKQA 1AD0B 1ZLWK 4P9MH 5CFHA 5I5IA 3AXLA 2VAAB 4PGBA 1ZV9A 3O6FA 1SQ2N 3CDFA 5AB2A 4V1DA 3ARGB 1RAMA 3QPXL 4A37A 4LASH 4QT5B 2YPLA 4H88L 1PG7H 3VSQA 1YN6A 4L0PB 4EI0A 1PU0A 3VXSB 1FIGL 2MOVA 2NPLX 5JOFB 5KYWB 3H54A 4UAOC 4Z7WA 1HHHB 4WSJA 4LQ1A 2ADFL 4JGNA 1IFGA 4J3OH 4HK0B 2JTYA 4UUJB 5LQBH 3MOQA 5AYTA 2WXHA 2LLGA 3QFDB 1T0MA 1A2YB 3VFNA 4J6RH 4HPYH 5L2KA 5DEGA 1ONQB 4ABVA 2UUDH 4RMUA 1PIFA 2P7TB 2YA0A 1LO0L 3FHEA 4HUXB 5F7KC 3WEOA 5D2NE 4OGXL 3LEYH 1YJDL 2LT9A 1S9YA 1C12A 2XRAL 4KZDL 2WINB 1YEGH 5I6XB 4GKZB 4OZFA 1Y6MR 1FLRH 4XN7A 2G0KA 1KPRA 4FOMA 5L8JB 1T1WB 1TZOA 3DVNB 2BY0A 1ET7A 3APMA 4KK8C 3CN0A 4XWOC 3ZE0F 2NYZA 3WFDL 5SX4H 2QLYA 1CTNA 1I1FB 3LKRB 2A9BA 3I9GH 3BLPX 4MJIA 1JPST 4X7DC 3HZVB 1KBVA 3K0YA 3LKOB 3AQDA 2K8MA 4BDVB 1LK2A 3WYRA 4F7KA 2QVKA 3X3FH 5K93A 1BLNB 2H0PA 3PWLA 2A6KA 3HJ0A 4ZNEE 4LLMA 1MWAB 5GRJL 1ACXA 1Q72L 2A77H 3B9EA 4FP8L 3T9WA 1IC7H 2FYVA 3HE6B 4PB0H 1IEAA 4Q9RH 3L1FA 3H9SE 2C1PA 5IBTL 1P84K 2EH7H 2OP4L 3B2UC 3FQ2A 1AZBA 1ZIAA 4ACTA 3Q43A 3TO4D 4AC2A 3FNKA 4Z3JA 2HFFB 3CLEH 3BRDA 1QP1A 3QG7L 2W60A 1JE6A 1GIGL 2R4SH 4B27A 2V9RA 2WVVB 2DJUA 3V5KA 2ZCLH 3IS0X 3IDMA 2AJ3B 5LHDA 5C3LD 2E7LA 4MJJA 1R17A 3MZTA 4E68A 1J8HB 3IPBA 3PAZA 4Z7UB 4A6YB 1AE6L 3MVSA 3NZ8B 4N25A 4FA8A 2OXHB 4L3ED 1ZE3H 3P0GB 4PP2B 1RZFH 1J5OH 4E0RA 1XFPA 4KKAD 2AV7B 1UUSA 1YMHB 5IMOA 3HCVB 1U8KA 3PXLA 3ZL2A 7TAAA 5I6XC 2YGVA 4JPIA 2HB0A 2CO1A 2UXGA 2NLJA 3P4NA 1IGTB 3DHJA 5E2UL 4XXDA 1L6XA 2EXWC 2J57A 4V1DE 3T4AA 3WXVH 5KVGH 3ZDXB 1HOEA 1CF8H 3R0NA 5L8LB 3PJNA 3R4DA 3RVUD 4RAVB 3BEVA 5EC2B 5TF0A 3QDJA 1MJJA 2AXHA 1CI3M 3T77B 5E6UB 3RWCA 1HH6A 3GIZH 4Z7WE 3SIKA 4QWWD 1WAAA 1GTNA 1SDDB 2F74B 1L9RA 3IRPX 4XRCB 5KBNC 4UV4L 1ID5I 4PWKA 3V7AE 3HE6C 1V7ML 5L2KE 1J9QA 5ILTH 2X1PA 2DD8H 2WZPA 1L9NA 1IL1A 1G9NH 3GWJA 3EYVB 5C09B 2B15A 4ZUUA 3BN3B 1PY0A 3ABZA 1CVRA 4XP5H 3RU8H 1BD2B 4WU7A 4H2AA 4PJIA 4JREC 5IESH 3DXAB 2R29H 2P80A 4QYOB 2ZUUA 4IIQB 3C09B 4FI6A 3ILDA 1CC3A 1XGTB 5D4JA 2GTWB 5E6YA 3WUWA 1RZPA 2ARJA 1GKEA 5IIEA 1MFDH 4CU7A 2B16A 3A24A 2VDRB 1IX2A 4WUUA 4CVZA 5FPIA 5IROC 1E50A 5JA8B 3DJSA 5GRVL 1WF5A 2DQ6A 3LPPA 2CLVB 4K7PH 1XIWD 4JDVA 3VDBA 2ZXCA 1RJZA 1XZ0A 4HPOL 4KQ3L 1EFQA 3DSNA 3GM0A 2ZOLB 4MJIE 4IBZA 2F5AL 2YARA 3AU1B 4O02H 1MCRA 3GBNL 1EEUA 1AQDB 2V33A 5G5DB 2DLHA 3R1GL 4FXKA 5I76B 4Z8FL 2O5ZL 4YDIH 1GGUA 1SXCA 4JY5L 2D03H 2ZWKA 3AGVA 1AANA 2FSEB 4YPJA 1YYMH 4PI0A 4QXGH 3V55A 3IE4A 4P9HL 3CSGA 4LGRB 2EE0A 4YDJB 5DD1L 2PO6B 1KV3A 3T2QA 1XCXA 2YFNA 2VDPH 4JFTA 2Y5EA 3IU3B 2GUYA 1H6TA 3MLSH 2P45B 4HW6A 2GTZA 3DIDA 1ZGLA 2IDUA 1KXTB 1HN1A 4WW2C 4Q97A 1SHWA 4M6NH 2DQFA 4NGHL 4TXVB 1AYOA 1N5AB 4KKPA 2JKRM 2NCEA 4TLKA 4YL9A 5ANMA 1PTZA 4G7SB 5FEBA 3KMDA 5CZRA 4AIXA 1MPAH 4G1MB 3NJKA 3VSUA 1K9TA 5ICXB 2LU7A 2FLRT 1WFTA 3DARA 3HZMB 4RZKA 4QMEA 3ASNB 2UYLB 4HJJL 4O2CB 5I1DB 3FO9B 4ENZA 3TEYA 4IIQC 4M1GL 2Z93A 4Y5YB 3C09C 5GGVY 3S8FB 1CUOA 4MHHI 1CFMA 2B7DT 2VLLA 3TEWA 3QIWB 4PJGB 5HHOA 1KWKA 4FXLA 5E2TH 3BWZA 5L0QC 2ICWI 4NRYA 4Y1AB 1DE4A 3OG6B 3V0WL 1E6OL 2NT0A 1SJEB 1OAQH 1HXMA 5F0PB 5JQHC 1X5ZA 2AKRB 4LLYA 2B3IA 1UTDA 3U30B 1WAAE 4XP9L 3TNNA 1CICA 3US9A 1PZBA 4FG6C 1WP6A 3TEUA 3ARDD 3P4OB 1NGXB 5KVFE 5DMJB 4CILA 4MB5A 1HE7A 2YGQA 4AIZA 1QSFD 2PPEA 1T22B 5DO8A 2WP3T 1T20A 1LP9B 2EDOA 3TV8A 4FHBD 5EBMA 4ANUA 1X5JA 4MA7L 4OCWL 1CYXA 1L6PA 2PO6C 2BHUA 2NW2A 3C8KB 4P04A 1ZV2A 5H94A 4IOFD 1AAJA 3R4RA 1IT9L 4U1SA 1EXUA 1ZA6B 3WGVB 4G6FD 2OSXA 5EU6A 5GS0H 4KZEH 2ZOKB 2OFQA 1GCYA 3GO1L 3R7RA 1S7UA 1FHNA 3D3VD 3Q5OA 1OP5H 2DYPD 3FSWA 4WUUE 3DO7B 3Q5YA 4JPWL 3G5YB 4ZQTA 2CO6B 3EO1A 3MUHL 4LRIA 5FUZH 4ELMA 2XZQL 1T1XB 4NX0A 3WDIA 1R3HB 4QCIA 5DTFB 4NZDA 1KIQB 2VN3A 5I1JH 1I1AB 2W9EL 3NFSL 2FJHB 3V5DB 4F5CE 2ZCZA 5D7IB 1QACA 2WXPA 1E9QB 4HIXL 4N2HA 4Y5YC 2KKQA 2WWOA 3K8LA 3CFNA 4PJDF 1KN4L 1B0GA 1A5FH 1OKEA 5GZNC 3QIWC 2DWEA 3BH9B 3IKCA 2QFPA 2X88A 4AL8C 1R3KA 4FE9A 1M3IA 3JTBA 2LVEA 2V8MA 2FL5A 3IRZA 5TE4L 1HYRC 2AEIT 3MACH 4ZO6A 1RUML 3IF1A 2OZ4L 3B2XA 3WN5B 5ALCL 1X5GA 3U30C 4DT2A 1QSFE 3A6BH 1RQ5A 5C0GB 5IEKA 4JPKH 3NJHA 4JG0H 1JOIA 4D2NA 3LHAA 2M2DA 3VX1A 3P30L 4LXFA 2EC9U 3OG4B 4A04A 5ANME 4NIKB 2YPKA 4Y9FA 4ZOEA 5GGTA 3A22A 3QZWB 4W68A 2EP6A 4UIKH 1DFXA 4X8GA 1AVAA 2YQ3A 3SSGA 3PFUA 3TVMB 4EDWL 2BSRA 4I9WD 3L3KA 5C2BL 1UURA 4NKMA 4QRUB 4LAJH 4NZRL 3QUKA 2DEWX 2P48B 1U3ZA 2HN7B 6TAAA 2V5MA 5E94B 1ZD6A 2OR9H 1JN6A 1PQZB 1NFDB 2YR3A 3WTUA 4CMHB 2VYRE 4KJQD 3AWEA 1UUNA 5HHOE 5C0IB 3EXLA 3QG6A 1HYSC 5AOLA 2R1YA 1TCMA 4MS8D 2I32A 3K8MA 1ZWIA 2Q0ZX 3IM1A 4ORGB 3G3LA 1U91B 4FI8A 5HDQH 3RL2A 2V3EA 2DL2A 3ETBJ 4YBLB 3P2DA 4ODWB 3TPUA 4BE6A 3E6FB 5F70A 1ADQA 1BEYH 3GLDA 1NCBL 1DLHB 1PZ5B 5IHUL 3EH1A 4TLSA 3WCYA 1XD1A 1QWUA 4QKXB 3QHTC 4CSTA 3RGHA 3O3BB 3SKUD 2VN4A 5ACZA 5MERA 3T3MB 2VDNB 4FLQA 5E2JA 4AENA 2NW3A 3QVAA 5DJDB 4P5TB 1IGCL 3OZ9L 2AK4A 1MCDA 3FB7A 4DAGH 5J6GA 4XNYL 4X42A 3HPLA 1XGUB 3Q5TA 2FBOJ 1URIA 1UD5A 3E80A 3PL6D 4XN1A 4HWBA 4HPHA 3FTGA 5AENA 4ZUWA 4NUJB 5J12B 5IT2H 1UWYA 1I8IB 1H6EA 1TZIB 1NZRA 4JJ5B 2AI0L 3O3UN 1XXDC 1PEWA 1AKJA 3EYFA 3GLZA 4P5MB 4JRWA 1FRGH 2ADJB 4N2BA 4XAWL 4KUCD 2R2HB 1G9MC 1I9EA 2CJUH 4OVUA 3U1QA 1OF2B 4LPUA 2NNXA 5LN4A 1TFPA 1DVTA 2BSSA 1RU9L 3CH1B 4MZ2A 3U7WL 3BRFA 3SB3A 2ZWSA 5BUAA 5A1AA 1WUZA 3V4VL 4X5XB 4CMHC 5B3JE 4Q9QH 2P43B 3ILPB 5E0QA 5GGVL 5E5MB 4P5RA 4HUNB 4Q6IA 4AQ8C 3WNLA 2KUTA 4OCRL 3L5WA 2YMXH 4KO5A 1SEQH 4FTVD 4FKKA 4OZ4A 4J7RA 3T65A 2BVEA 4YBLC 1MW3A 4TM9A 5HYSB 3C12A 5ES4B 1ZLUH 5HPMB 1MLCA 2QHLA 3BMWA 1IEBA 1SVZA 2C3VA 4AC4A 1BVKA 1RUKL 1MHCA 1LJMA 2FYYA 2TAAA 2YPVL 3AFLA 4K3HA 5E24E 5DRWA 3QYMA 2A74A 3B7YA 5LBSH 2G3ZA 1AGBB 1T5XB 4PJBB 5I1GH 4MNQA 4UBDD 1ZVSB 5F7HA 1MREL 2BVUA 1MIEH 4P5TC 1P6FA 2CGZA 2WXFA 1R19A 4NSKA 5DD5H 4Z78A 1JZ4A 1IKFL 2P24A 4OY9A 1GGIL 3D85A 3LIZA 4X4YB 3SZKC 4DO5A 1EXGA 4IU3A 4D9QE 2JTDA 5GZOD 2EIJB 1LLAA 3LH2L 3FZUC 2GUOB 5KTEH 1WS7A 5DQ9A 4JFPA 3GSVB 3LZLA 4XPTL 5DD6A 1YEJL 3ZL4L 3SE9H 3C5ZB 4MTMA 1MOEA 5IMMA 5KJRH 4DP6X 3EDEA 4ZX3A 5J6HA 3AG3B 1JCKA 2YIHA 3CXHK 2VZTA 1A7PH 3QA3B 2X6AA 5FWQA 3FXIC 3KS0J 4C83B 1FNSL 3W9DB 3GK8H 5I1IL 3L17A 5D7LE 1MFVA 5EU5A 4JO3H 3F7PC 1C5DA 3ZKMD 1X4XA 1KXVA 1BYOA 1JHLL 1QI4A 2VWEC 4JZJA 4WIQA 1AS8A 1WZ1H 1JWMB 1PX4A 4IBLT 3S36L 4E9LA 4GAYB 2J88H 5EMYA 2AK4E 3NJIA 3AS1A 2E7HA 4MX7A 3VA2C 1P2CA 3QUMA 1NICA 4MXQD 5FGSA 3LQZB 1X44A 1WK0A 3ZE1E 5B3SB 3MV7D 3NABL 5DHVB 1G7MB 5GGSY 2DWYA 1VFUA 3QCTH 3OLDA 4GP4B 2JVUA 2NY2B 1SYVB 5FFLA 3D39D 3ML8A 3O6LL 3DYOA 4L3AA 5EHFA 2JQZA 4AQEB 5C0FB 1YJDC 3KYKH 3RLSA 3U9UB 3ISYA 4FNUA 2R51A 3IDNB 4LKXB 2EVHA 1OIOA 1FBIH 2VXTL 2CR0A 1R1CA 2VR8A 4HLJA 1NLDH 2SODB 2WVUA 1V8HA 3EGSA 4R3SB 1B2WL 2K70A 4UNTA 3RTLA 2EIMB 4HMDA 3ZOAA 3QFJD 2Y5TA 2R8SL 3TBVA 1DP0A 1O0VA 2XA3A 3BAXA 3CFUA 4M4RB 4Y8AA 4KNQA 5CLTA 5IMKA 4WFHD 3LQMA 5IB3B 3T3PF 4EUPG 1N10A 2HT3C 2ZT9C 5B8CB 2F7IA 4FNTA 2A0LC 5F93C 4IMKA 1I7ZA 3I6KA 4ZX4A 1JPGA 3NQIA 2Q8BL 3N41F 1F45A 4Y4FA 1UD8A 43C9B 3S5LB 3RGVD 4JHAH 2H45A 5A2FA 2J20A 4KTEL 3QRGL 4L8BB 3VWJA 2IADB 2V17H 3UBGA 4LLAA 4ZFOL 1D6VH 1GVIA 4ODXA 2O5YL 2YK1L 5FM5O 3OXSB 1UZ6E 4M8UA 3QJXA 3L9RA 3G6AA 1M56B 1NGQL 3GSNB 4M62L 5FWRA 3MUY1 1W72L 2A9AA 3SDYL 4DZ8B 3SPCA 3NA9L 4FQ1L 5I73B 1ZT7B 4U3SB 1TZHA 2DY2A 1MCWM 1B9ZA 1VADB 4X50A 1WIOA 4ELDA 1IILE 3VH8B 1MDTA 3QI9C 2ED9A 3BISA 5HHME 4MMYA 4O58L 2RCSL 1S3RA 1BG9A 5ID1B 3EH3B 1NEZG 3GMPA 5FO8B 1FYTD 1XHHA 3EO9L 3FRPB 1EFXB 4PSPA 2NY2C 3DSFL 5KSBF 1ULVA 3KYNA 2X4RA 3SY0A 2VDLL 3QWRD 2YKLH 3O8XB 2DBLL 1E28B 5IWLA 4NRZA 1JNNH 2PW1A 4BH7B 3QFJE 4Z0BL 3ASOB 3TX4A 4GG6B 2IG2H 5HHXL 3X17A 4LLQA 1TOXA 2E59A 1R3LB 2PPDA 4WWOA 4JFUA 3O0LA 5B8CC 2FJSA 5HDBF 4S0HA 4RFEA 4ZMWA 1TJMA 2DM3A 5DS1A 4QRTB 4WVRA 4L5FL 1RD6A 3LB6D 5I1CH 1RVFH 4OGYL 1A6PA 4NT6A 5DZJA 3WI9A 2WK2A 3IJEA 1I1YB 2CKBL 2YC1A 5EUOF 4ADIA 3VQ2C 2BP3A 1IGMH 4MQXC 5CU9A 5EO9A 1MJ7H 4B0MB 3EXJA 4IBVA 5D4IA 3H3BC 1YECL 1S4IA 3MOAL 4M6MH 2D7MA 5A3IC 2XKNB 1Q0YL 4UB0H 2DQHH 3C87A 5DMYA 1IBGH 3KLDA 4R2GD 2CM6A 3OKLB 3RWIB 4N1EA 2EZ0D 5DQDH 3NH7H 4FFYL 4OM0H 3CFDA 3FO0L 3O6KL 3FAXA 2EXYC 1KLUB 2J5LB 3HB3D 3P02A 5GRVK 2AQ3A 3LRMA 4ZAKB 3VFRA 5B22A 5I6MA 3WJJC 1J1OH 3FUEA 2IH1B 3AREA 1FFPA 1OW0C 1A6VL 4XBPB 2YSSB 4FL4B 4LGPB 2P8MB 4OIFA 5AKTA 2ICEA 1D5MB 2EQDA 3FPXA 4I89A 3SKMB 4OLZH 2I07A 2VN7A 3IAPA 4GKNB 4M9OA 2EYTB 3I6LE 3R7QA 4ZXBC 5I26A 2A83B 3MGAA 3IWVA 1CYGA 4TOYH 2J6EL 4MB4A 3GI8H 2CJTA 3KLLA 5ISZE 3FTXA 2ATPA 4MNGA 5C0BD 1S7VB 1PSKH 5CU5A 5BS0E 4U31A 2IGFH 3PDOA 1KTDB 2VNCA 1X4ZA 3IJ7A 2NNAB 3OAWA 1HEZB 2H0EA 1YUKB 4PIBA 1MDAA 3CVIH 2W07B 4CGUB 1O9ZA 4G7VH 1FNFA 3LS5L 4PJ9D 2B20A 1BXVA 2AJUL 3G5ZB 5H4ZA 2IWEA 3MRKB 3P1VA 5DC2A 3VFTB 2BWQA 4NQCA 2XACC 3HBQA 4LOFA 3RIAK 3F58H 3D0LB 3UERA 3FB8B 2J73A 3UMTA 4K23L 5CLYA 2IGTA 1HL8A 1M2OA 3NJXA 5GJSH 4L37A 1U8CA 2JCCF 4KK6D 1BF8A 3OKDA 4IRSD 4OLUL 1HHGB 4HT1H 4K5MA 4H26A 3OLIA 1SFDA 1TKWA 2Z8SA 4HZAA 5CGYD 1GZQB 4NNPL 4TUJA 3UTZA 1VEOA 3CUPB 2J5LC 4GUPA 1G6RH 3GGWA 1M05A 3FONB 3L3HB 2O26U 4ZAKC 3TZVD 3UZQB 3WY2A 5JPNA 5IHLB 1EQWA 2B14A 2SEBB 4X8XA 5D2LF 3NACL 3WOVA 4FL4C 3G5VB 3RGBA 4JUTA 2E7MA 3MLTA 3QZOA 1V54B 2ENPA 3LNHA 5GGQH 2OPCA 1WZAA 4MDIA 1A7OH 4U3CA 1R5VB 2DPKA 2B1HL 2EKSA 3BVTA 2Y06L 4TQ8A 3VI3A 2I9TB 3QCUH 3ZTJH 2BO0A 5T1KB 1DVFB 4JG9A 1ASQA 3VXRD 2YEVB 3QORA 2WOBA 2VXUH 4HIIA 4KMTL 5HY9B 1BVLA 1SYSB 1HINL 3QDAA 4HKXA 5E6SB 4L9LA 3N43F 4X6CB 4DP7X 3KNBB 5J3HD 2WO2B 3MLVH 3MNVA 5L88H 2EDYA 2N7SA 4LCUB 4JK0D 4M1CC 2JI3A 2JIXA 5CCKH 3TO2A 1WAEA 2BC4B 4F58L 1A9EA 1XR8A 4C56A 5IMLB 1WITA 5KUKA 1FVDB 1GPOL 4UU9A 2G5BA 1A0QH 5IJDC 4XMKL 1K4CA 5I8EA 3NEEA 5A16A 3QJHB 1ED3A 2QPEB 4HUCA 4L3CB 1P9MC 1D5IL 1KBGL 1UH4A 1T03H 3N1MC 1OD7A 1DO6A 1HHIB 1AR2A 3QDMA 5EN2A 4DZBA 4XH2B 4TL4A 2VDKB 3P9LA 4NO3B 5HJBA 2ZSVA 1HKFA 1RK7A 2IPKA 3G6DH 2HXAA 1KG0B 4M03A 1L9SA 4LVNB 4D8PA 3RPKA 3U4KA 3FCSA 4N2KA 5FR3A 3L13A 3V8CA 5D72H 3QEQD 1PZ2A 2FT7A 3ZR6A 3ZSTA 4MNGE 1F8TH 4JG1H 5HDRA 1N67A 3QUZD 1UWGH 5T1LA 3WSQH 1D7CA 1HZKA 2COQA 1CE6B 3X3GH 3MBED 5CD5C 2F9BT 1L4IA 1ZHBB 4GRLB 2R1WB 5D6CA 4N9GA 3MJ9L 3ZE2E 1SJHB 3MMEA 4JKLA 2IH3B 1MXGA 2XG4B 3U4EA 3QWOA 5IB5A 1R5WA 1MQ8A 3B3BA 3CE1A 3H55A 4PRIB 1DVFC 4KK9D 4WO4D 3GSRB 1QKZH 3U4BL 4DN4H 4R8WL 4UQEA 1CL7L 4G9DA 2CBMA 2NZ9D 2APSA 1HQ4A 1IQWL 2W0FA 3HI5H 5CJQL 1YPZF 4UANA 1ZGLP 5I8KL 3ELQA 4GLRH 4DGUA 1TSRA 2Z35A 3IGUA 1J8SA 3DGDA 4H8WH 4I77H 5CP7A 2IALB 5HGAA 4GP5B 4X4XB 3AU0A 5DD0H 5KVFL 3NIGB 5TJWK 1WQVT 4HXAL 4WUKL 1HZLA 4YDMA 5F0MB 5JW5A 1VCAA 5ADPL 1I9JL 1CD0A 1N59B 1XL4A 3U2SB 3DBXA 3RWJB 3WNKA 4BD4A 4OJDH 4GFTB 2OTWB 4E9VA 2X87A 2ZYSA 1LEGA 4PRHB 3V4VB 2FWOA 4G6ML 1ZLVK 3UIYA 2ZOOA 3M17B 2CO3A 4GP8B 4JN1H 2L7EA 3ARFB 3BZ4A 2QSTA 3SDCB 3IFLH 1A1MA 2C3XA 4GQZA 4ZFGL 4NZUH 4ZD3L 5LGHL 2P5WB 1T2QL 4Y2DB 1N26A 3RIAF 2IEPA 5I30H 3CHQA 4LOUD 4YHKL 5MEPB 2N1TE 2VZOA 2G9HA 4LE8A 3GRWH 4P2RD 1BZ9A 3KE0A 5JHLA 4M43L 5BZXA 3WU1A 3M1BA 4QAMB 1OCCB 2DMKA 3N5AA 4I1NB 5EEUA 4HFUH 4PJ7F 4GRLC 4CVWA 4KQ4H 3Q1SL 4OZFG 2ZYHA 4ZMTA 4NM8H 1CXEA 5IOPA 1A47A 1S9VB 5CUSH 1N5YH 3UO1L 4L1LA 2AS5M 4C56E 2BH0A 3Q8EA 3BUYB 3QEUA 5AKRA 4EOWH 2HFEB 5I6NA 1E8YA 3VAEA 2X2JA 3WS3A 3TOPA 2ZICA 3Q6GL 4MJ5A 4X6DF 5F6HI 1AJ7H 1TJGL 3DX8A 4PJ8C 4E9QA 3IJHB 4MKMA 3KJ6H 3FQXA 4L4VB 1MHHB 1CFVL 4EBQL 3OMZA 1A6TB 5I1KH 2GB2A 1NBZA 3DO4A 4MCZA 4UZSA 2BY3A 2WTOA 1JRHL 3GBLA 1V3JA 4F8NA 5CHNA 3BPNC 4HALA 1J1PH 5BXFA 2KQMA 2DJMA 3EH4B 1PLBA 1QW8A 2GJ6A 4IK6A 2NY6C 1KJVA 3F12B 4YZFF 5INDB 3X1EA 5DJ6B 1B0RB 5IV2A 1WD8A 3ARFC 4HZLB 3BKYH 4RSYA 3RVXD 2JE8A 4OLWL 5E99L 3WKNA 1CE1L 3A67L 5INCA 2XX1A 3O2WH 4Y2DC 4XN2A 1MWAH 1YVLA 1CFTA 1KGCD 3L5IA 2DZEA 4P2RE 5GSRB 4AMWA 4YBQC 3S35H 2BNRD 2G5RA 3LN5B 1FNLA 4DGWC 1N70A 3BKJH 4J4PA 4PREA 4NEHB 1D2OA 3UMNA 4BQ8A 5JXEA 1J0KA 2HTLD 1CB4A 1OTUD 1L7TL 2BMKB 4K71C 3X11B 1HHJA 2CIKA 4GO8A 2WUCH 3EGDA 3TCXA 5C86A 1JDCA 3KXFE 3ZLQC 4I0PB 3SE8H 5DJ8B 3FRUB 3ZKXB 4L1TA 4OGZA 4Y5VA 3U6XS 3AVEA 4KI5F 4U1MA 4PVNA 5DF0A 3UC0L 5IQ9B 3CSYA 2CALA 2D0FA 5KSAA 2ARWA 2DTSA 2E6JA 5EU4A 3VMOA 4E9RA 5I6PA 3L7FA 3LMJH 3C5JB 1EEYB 1I7TA 2LAAA 1QBAA 1KACB 1WO2A 5F44A 4JFFD 1LO3H 4IOIA 1A4JA 3GXTA 4JFZL 5HBBA 1LEIA 1JI1A 3ESVF 2P47B 3DGCR 5JW3H 4WO0A 2AJXL 4XPGH 5CJ5A 2EDFA 1WFUA 1G9HA 4Z7QF 1XEDA 5HHNA 1IKNC 5EG6C 2X4OA 4XT1C 3U6RA 1JNHA 4Z7OF 4CN1A 5BOPA 2EC9T 1IGIL 4WTZA 1H9VA 4FF9A 3CN2A 5LG6A 2H2PD 1U0QA 4GO9A 3SPJA 1NIAA 4MXWH 4ZFOB 1J05A 1RP9A 5EF2A 4FQ2L 5E51A 4LAQL 2XG5B 1ZY9A 1RULL 2LAGB 1I3UA 1KEMH 2NX5D 3EJYC 1IV8A 2R2CA 2Q5BA 3BT0A 1O7DC 3BUQA 3LKPB 5DQJA 2CA3A 3GSWB 1W72B 3WUWG 3NCMA 1Z0MA 1TNNA 3UTTB 1HJCA 4DKDC 3SCMA 4A39A 4BKSC 4PJAF 1EZVY 1II4E 4AM0Q 4OCYH 3DTXA 4UT9L 2WYHA 2RIKA 4HCRL 2PR4H 5IW3A 4PW3A 1RUQH 1L3WA 4FYRA 3D0VB 4PJHF 5BZZA 3REVA 3JWDC 5LNGA 2DDQL 4HBQA 2UZIL 4NJAL 1G4RA 1N68A 1S7QA 2D7NA 4HZ1A 5D8JH 4F8LA 4KTYA 5BOZG 3FFOA 1C08B 1YNTF 2XV6B 4I0PC 2ENQA 3ZKXC 1OT1A 3TBTA 4J8RA 3QWNA 2FX8L 2VDLB 3SPIA 4BQ9A 5TK2A 5FHAL 2VB5A 4K7FB 1MI5E 5E6RB 2ZNXA 1O7VA 2V2WB 2VDRH 4N2FA 2GJ6E 3WNIA 3MRDA 3TV3H 4JQIH 4HG4J 4HSAC 3AW5A 4RGNB 1CYWA 4YDVA 4F1SA 1JGUH 3KLQA 4XBEH 2J43A 1BBJB 1JSYA 5CINL 4AG4L 3SDXE 1FO0L 3VD4A 4W4OC 1FZJB 2M83A 4KKZA 4ABQA 1G9EA 1WBZB 2F7RA 4RNRA 5AKVA 3UJTL 2YRBA 1KBKA 2XU9A 1A4KA 1SN2A 5CO1A 4ENEC 2DM2A 2OULB 1JYVA 2OAAA 3WEAA 4UZGA 1IAOB 1X9UA 4A63A 3MV8E 3ISRA 1BXUA 3O45A 4AEFA 4W9IC 1QW9A 2OK0H 2PP7A 2ITFA 5ALBL 3T0DA 4U1LA 2DTML 1C5BH 3O4OB 3OAZH 1KCUH 1X6NA 3GSQA 4PFEA 1CDJA 1NC2D 3W5MA 3GI9H 4OJFH 1QTSA 2ICCA 1ND0A 3D5OF 1BAGA 4PLJC 4R4FL 4LSUH 1H0DA 2KLTA 4A2MA 2ICWB 2O6CA 3U0WL 4JRFA 4PPTA 4NHUA 2EXSA 2ITCB 2X5PA 3O0RL 1BQUA 1PY9A 4TF4A 4N0FB 1JMXA 1UGNA 4CL7A 3V52H 2E27H 3J07A 2V9UA 1FV1A 1M2VA 2HVJB 4BSVA 2X4PB 4UILH 5FO7A 3HG2A 1IM9A 4OSUH 3U7YH 4L1BA 1PYWA 1U4FA 4ETYA 2ZSWB 5EDXA 1FP5A 4B5EA 1J8KA 2XTSA 4LESA 5F9AC 4YHML 4EI5A 4AW7A 3D51A 5HDOA 3AB0B 3VXQA 3DDGA 3QQ4A 2IDQA 4Q56A 5IW1A 5LJYH 3BSHA 4Y4KA 4M8RA 1JWSB 4TPRL 5FLVA 2UY7A 1DVSA 3L4UA 4IHOA 2EDKA 2F54A 2EVIA 3WIFB 3NN8B 1ZSDB 4AL8H 2BRQA 4XVUC 2WVTA 3D18A 1W80A 2P26A 4W70A 4RGNC 1J0YA 1IO4C 4N2MA 5B7MA 4LBAA 3HMXL 2VZVA 4H40A 2GFBB 3T6XA 1BVNP 2AJYL 1D5XB 5MEOB 4W9EC 2GK2A 1RZQA 5C9JB 5FFGA 3VA6A 4L2LA 3N04A 5C7XH 1ECZA 1QAWA 4FFZH 5KYUB 1YCSA 2IBZY 4DIXA 1ZK9A 2VW7A 2Z31A 3CZUB 3F01A 5DZVA 4ZS7L 4ATWA 2DW5A 1BZ7B 1EV2E 3LS4H 6PCYA 2IMNA 2G5UA 3IGAA 3I84A 1AXSA 3PP3H 1AG6A 3JWOL 4FI7A 4FX5A 5F6HJ 3E8UL 1XCTB 1QQDB 3LRSB 3UBHA 5JTWA 3P77A 2IFFH 1GHFL 5GGSB 1RZKL 4G6AD 5L8KB 2Z64C 4LP8A 4NCC1 4W9GC 5I16B 2E9BA 1K5NA 2P9RA 3KCWA 1KY6A 5EZIH 4XPAL 5TDOB 4NHCH 3QQ9D 3TO4B 3JBG7 2I7SA 1FGVL 3L3OA 3PF2A 4O51A 1SVCP 4QPEA 3MYJA 5BVPL 2O5NA 1JXKA 2E56A 2CG9X 3LCYA 4KTDH 1IBBA 1UA6L 3HPJB 3TN0C 3LZNA 3ATFA 4IGBD 4JQXC 2WWMD 3UP1A 4F7CA 1JGVH 3FT1A 2QPDB 1BQHB 3BAKA 5FW6A 1MJUL 1DDTA 2FBRA 2YGPA 5D5MF 4WNJA 4XPHH 4L3EB 4M5ZH 1Y6NR 1WD9A 2DQGH 2F68X 5T3XD 4DFHA 5I19L 1RZJC 3W81A 1RSFA 1OXYA 2NXZC 2WXMA 1Z2KA 3NJMA 4HFWA 2YOCA 4FZEL 4N20A 5DHMC 3P9WB 5KVGE 5KYNA 2FO4A 2ZYIA 3QBTB 5C97A 4GBXA 1HSBA 4QY8A 4PD4J 4C4KT 4FQJH 4YUEL 3T0EC 3K72A 4G42B 3VFUA 5FC9A 1TQUA 1CDGA 4D9LH 4JKNA 1NMBL 3OPZH 4OV5B 5IG7B 5LAPA 2XWDA 3CZFB 2VQ1A 2FUTA 3BWUF 1BPLB 1KEGH 1G9MH 1N6VA 3O6FD 4BUGA 4HC1H 1RPQA 4OF6A 5H35A 1NFKA 4NUGL 4N0UB 3O9WA 1XGYH 4L8SC 5GS2D 1TQBB 1QO3B 2VERN 1RP8A 1AMXA 2CDFA 2YPLD 3OKOA 3QE5A 4YPGA 3ZKQD 4OZHE 1EHXA 3T0WA 3ROOB 3PJLA 3QC6X 5EB9A 1GAFH 5C0AE 4FXGC 5ICZB 4JPVH 3TO4C 2QZQA 3MCLH 4RZCA 2B5IB 4F8TA 2OJEA 2GI0A 4HAKA 3L7EB 5E2WH 4WU5A 4YSUA 3AS2A 3BJLA 3QQNA 3INUL 4CADB 1HAWA 1ZPUA 4F7PB 2YN5A 4FQPA 3DO3A 3ZDZF 2DI8A 1R24B 2CO7A 4RBPK 2X4UB 4U1HB 3W11D 3D0AA 1E8WA 5FO9B 3KCPA 1OSYA 3EKCA 3TWCH 1XIWB 1HH9B 4MD0A 1USZA 3NGBC 5TDNA 3VXOB 4KKAC 4NN7B 3I75B 1QI3A 2J4WH 4B9JA 1AY1L 2VDNH 5JNYA 1U42A 3CFEA 2OL3L 3UCQA 1N9PA 3LHPH 1DBML 1TITA 2CM5A 3C6SB 3L5JA 1F3DH 1P4UA 3OJDB 3SDAD 4NOBA 2OZNA 5B1AB 3TF7C 2I69A 2RQEA 1GGBL 4QRPE 3FQ4A 2AVGA 3IDGA 3KPRE 5D7JA 2EACA 3UZVA 3PQYE 4NYLB 1MVFA 4G11A 1XCQA 3WFEL 4LHUA 2J44A 3RVUC 2MMXA 3Q8CA 2LE9A 4PGEA 1T89A 2CO2A 5ADOL 1NC4D 3X12B 3J27A 2O5XL 4QWWC 1Y1UA 2R0ZH 1TZGL 2VXQH 3A6OA 4U6XA 1T4WA 1TQBC 3T04D 3ZTNH 4N0RA 4ISVB 3THML 2V8LA 1Z9MA 3UFIA 3AWFA 1KULA 5E8OA 4PBWD 5ID0A 4JY6A 4GIAA 4KDTC 4Y19A 4UQCA 3QPXH 4XE0A 3HE7A 3D8MA 4PRDB 3V8OA 1U33A 3MFFA 4JO1L 5FYLD 1NAKL 4M7KL 4QNPF 4P23A 4H88H 3NA4A 2Q76A 2Z91A 2YAHA 3LNDA 4G9FD 4G80B 3LSOB 1FIGH 1ZXQA 2XN9A 5BRPA 4S11A 5SX5K 3UX9B 2ADFH 3GZQA 2QQLL 4UTAL 4Z0XB 4QLWA 5BMFL 1W0VB 5HI5D 4AV0A 1B4JL 3V0JA 1XIWC 1G7LA 5DEZA 1W91A 1DQLL 1XTLA 1SHXA 1G7IA 1Q0XL 2VXVL 3FAWA 1O75A 3NCEB 3ZO0A 4YHZL 4F92B 2AHIA 4NN7C 1K4DB 3WE6A 1LO0H 2G3MA 3ALXA 3KGUA 2HJLA 3P9MB 2MNUA 1KCRH 3ARDB 1ORQB 3S96A 2AGJL 1YJDH 4IS6B 3K8KA 5DHYA 2IXQA 2XRAH 4KZDH 3LV3B 1ZA3A 2CKNA 3WY1A 2GK0A 2NYYD 1KYUA 4LVHC 2GEEA 4Z3EA 2CK0L 1CGUA 2VJ8A 4U0QB 5C07E 3GHEL 5CP3H 4OD1L 4RGOH 2YAFA 1U8LA 3WFDH 2J8UA 4HCIA 2OCCB 5BW7A 1T5KA 4G6FB 5AYUL 4XCYA 2VT0A 3UIZA 2EIBA 4ICXA 5AOZA 3MLPA 2DLFL 1UHVA 3D3VB 4LEXH 4LSSH 5LNEA 4Z7WF 1RHHA 5F88A 1U2CA 2DYPB 5F3BA 3NUKA 1W6LA 1LE9B 4POZD 2KC0A 5GRJH 1P1ZB 2IFGA 4FP8H 4WSKA 3QK0A 2CNYA 2A6JA 4OAWB 3FOMA 1HDMA 5C0CD 4ZYKA 4QHMA 4ONGL 4K8RD 5IBTH 5FS5A 4G9FE 3SPVB 2OP4H 3TEZA 3LN4B 1AD9A 5TGBA 3VVVA 1KIPB 3TJEH 2YKKA 3O3EB 4UMGA 4H25A 5T5NF 4FJ6A 5KW9L 1KPVA 1GIGH 3UP6A 1LO4H 3WG7B 4DH2A 2H32B 4NQSB 4JRYA 3FMGL 3MLUL 4LGSB 5DHVH 1CT8A 4J2XA 4JNXA 1BEXA 1VB9A 1NPUA 1BFOB 2ITDB 3BYTA 4WW1B 1CO1A 1A1OB 1RIVL 4XNUL 2EYSB 5C6TH 3P11L 2P28B 3FU9A 1GMIA 1T83A 4ZTOL 2BOCB 4O2EA 5LBSA 1QNZH 5I1AB 3FT4A 3D25A 2DMCA 1A1NB 4WKZA 5CKGA 3E1F1 1I8UA 3LNGA 4HCGA 1IGYA 3LZQA 4IW4C 2WAHA 5BZDB 5E2UH 3T5WA 3IDJB 1KBWA 2EIZA 2VDQL 4MFHA 4P59H 4Q8BA 5E8NB 1ZHKB 5B38B 1JV5B 3BWSA 1UZ8B 4IOFC 3WTXA 3DRQB 3VD5A 2MKLC 4LLVA 3SYPA 3PDGA 2F18A 1NH6A 1Q94B 1Z5LA 1TQWA 1WFMA 3BZ5A 3KH3A 4LLDA 4NKQB 4NDMA 4DKAA 3N42F 1AGEB 3UYPB 2KERA 4R0LC 2VOTA 5DMGD 1RURL 1MH5B 1OP3K 5J06A 3HI6L 2XN9E 1NOAA 2EO1A 1JDAA 2IQAA 1C5CL 2F15A 4OFYA 5CEYA 5ICUA 2JKTM 5I23A 1NBVL 5C0CE 4UV4H 1MJ8L 5E4AA 3R19A 2LLLA 1R3IL 1V7MH 2WKOA 3QUYA 4I13B 4MSWB 3POCA 4UOZA 3NJVA 2QHRH 1CGTA 2O6PA 3GSNH 1H3VA 1MW2A 3MCKB 4RX4D 5LAXA 1O6SA 1EA9C 2X7LA 4JMXA 2VO8A 3A4EA 4XHJC 4NLHA 1QG3A 1RZGA 4OD2B 2UX7A 1ZIBA 2AITA 4HOWA 4S1RH 5H2BA 4AYEC 1A8JH 4ACPA 2LV4A 3MREB 3P3RA 3ARBD 4QOKD 3T1WA 4HJEA 4HJIA 1INQB 2CHWA 2GVYA 1HZHH 4X6FA 4PS8A 3JTTB 1RZ7L 3IDXH 1FNEB 1XMEB 3DX4A 1IAKB 3WY3A 1VFMA 2VISB 4L4TD 3PL6B 2F5AH 3OKYA 2NUPB 1F11A 1FO0B 3GBNH 3O11A 2H5UA 1DJGA 1JK8A 2W80C 4CNIB 5DEFB 2K45A 1FI8C 2EDTA 5LCVH 1WAAF 3WHE0 3BZFB 3UBXI 3KLAB 2VLRE 3GZOA 1IC4L 1KJMA 5EFIB 4GYBA 2FZ3A 4DGVL 4GW5A 4P9HH 5EU6D 5KSVA 5DD1H 3QJUB 4YHOL 5SWZA 1FNGA 3IMSA 5FUOL 3ULSB 4JM2D 1I85C 4FGMA 3OHXA 3BIAX 2DIBA 2Y7QB 3KM2A 3QIUA 5JHDE 1YUHB 3FFDB 3HBGA 4PJCA 4PJIF 5HJ3B 4LPCA 1EZLA 3HLAB 2LABA 3IFOA 3C6LA 3TCLA 3MI6A 2H1PL 4G83A 3HOGA 4AK1A 1MFCL 2BNUA 2F6AA 2GHZA 2JFCA 4MS8C 1T7YA 5HI4D 4U6VH 5EIIB 1OY3B 2PWFA 5DI8A 5KSUB 3ZY7A 3RY6A 5E1AB 4FTVB 1DQML 3MRPB 4F2MB 4Z7IA 3SJVD 1NLBL 4OIIL 3PWNB 5D7HA 5I66A 2V5SA 3RBSA 3OR7B 1X5HA 1XGQB 5AD0B 2V7NB 1VCBC 3PJSA 3CFJA 2Q8AH 1JGIA 3C8DA 5E5UB 5SV4A 1SQMA 1JHKH 4WFEE 1JZEA 3NQKA 4M1GH 5EC1B 5EUKB 1SLVA 1T5WA 2NZIA 4QOKE 5DYOB 5JUEL 3S98A 4E41D 2A73B 2X9ZA 1PZ3A 2VJ0A 4UM9D 1ILUA 1DUYA 3GEWB 3IXTA 1QRND 2XXGA 1KDIA 4PS4L 3MRCA 2DN7A 1INDL 3ECBA 1XAUA 4JRXA 3V0WH 1IU1A 2NY4D 3HAEA 3LZOA 3V7MA 5EIVA 3IETA 3VXUA 1QSEE 2H1XA 3TA4D 3KM1A 1UQSB 1YMMA 5CLZA 2WW8A 5G4NA 4Z7AA 2EEDA 3GRGA 3KG5A 4MKTA 5JR1L 4MA8L 2D73A 4M93B 3EGXA 1HSAB 1U6AH 2XI9A 4HGMA 4HLZG 2Y6TE 3QXVA 2EDNA 4AXWA 3BVNA 3BZDA 1MAJA 4IU2B 1OARL 4PR5B 3DV6B 4U1JB 2YLKA 3LRGA 1OTSD 4M1DL 5CNHA 4PV8B 3MA9L