3VQMA

Small heat shock protein hsp14.0 of c-terminal deletion variant with c-terminal peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
GKELQKRSEELSRGFYELVYPPVDMYEEGGYLVVVADLAGFNKEKIKARVSGQNELIIEAEREITEPGVKYLTQRPKYVRKVIRLPYNVAKDAEISGKYENGVLTIRIPIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small heat shock protein StHsp14.0
publication title Structural studies on the oligomeric transition of a small heat shock protein, StHsp14.0
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Chaperone
total genus 15
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2012-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vqmA00
3L1EA 3IGFA 2XCMC 5DS2A 2WJ7A 3GLAA 4I88A 1GMEA 4JUTA 2Y1ZA 2CG9X 2KMWA 2K8QA 3EUDA 3N3EA 2KLRA 2Y1YA 3AACA 2WJ5A 3Q9PA 1EJFA 3L1GA 2RH0A 4PCKA 3Q9QA 1WGVA 3W1ZA 2N3JA 2O30A 1X5MA 3QORC 1SHSA 2Y22A 4YLBA 3QORA 2JKIS 1WFIA 3J07A 4YDZA 4ZJ9A 2BOLA 3L1FA 2N0KA 4YE0A 4YLCA 4RZKA 3QORB 3AABA 4YL9A 3VQLA 4FEIA 4PBDA 1RL1A 3QORD 4ELDA 3GUFA 4M5TA 4M5SA 5DS1A 2MNWA 3GT6A 4MJHA 5LUMA 4JUSA 3VQMA 1WH0A 2CR0A
chains in the Genus database with same CATH superfamily
1I7TA 3C12A 4RWYH 3ECVA 4ANWA 4NN6B 5B7FA 1ZTMA 3MRCB 2Q2LA 5CJOL 4JHWH 4ZUVA 3O45A 2XIBA 1MZZA 1KPUA 1U6AL 3WO3B 4XN2A 4F3FB 3UAJD 3MUJA 4F9PC 4YL9A 1X7SA 3U4EB 3ZMRA 4LCUA 4AYBA 1OARH 2WP3T 3HOGA 1FWXA 2FYYA 5D1QC 2YUXA 4G9FB 3QUXA 2Y6SD 1GGBH 1D7BA 2X70A 5EU3A 2M1KA 3MBWB 1R3IL 4DKTA 3QH3A 4Y5VC 4AMXA 1S4IA 5F9JA 2D2OA 3D12B 4PRPE 1H19A 3CSYB 1XDTT 1KTLA 3B2UD 1EZVX 4GUCA 1DBJL 3CZGA 4NDMA 4BK5A 4F5CE 2DQIH 4GEJA 5EF0A 3VU1A 2V2WB 3EH4B 1Q94B 2J12B 4M03A 3EJJX 4M6NH 3MROB 4NT6B 3V4UL 3AITA 4ZI8A 1PDKA 4PRBB 4WI2A 3GLEA 4RDQG 2CAKA 3V4PB 2WTRA 3UIZA 3PDGA 1HWHB 4M7KH 3S37L 1SYSA 1B0WA 5DS2A 5T5NF 1OHZA 4LLDA 5EZIH 5EU6B 1U8NA 4QRBA 3BT2L 1JDDA 1DQJA 2WXRA 3G5WA 3O6FA 4DF9A 4NOBA 3JWNH 2ITCB 3FUEA 3X11A 3KPSB 4KKRA 4M6OL 4ELKB 4RA3A 2HT3C 5DHXB 2FSEA 2AQ3A 1A6AA 1AGEB 3BFQG 3I3DA 3SDAB 2WINA 4F8TA 1X5HA 5AKTA 1JYNA 3HN8A 3SZKC 2VSKB 3DX8A 2VH5H 1WT5A 3CCHA 3GMOA 1LP9F 2FB4H 2AERT 3RUGE 3AVEA 4EDXA 1S9WA 5JHBA 1IUZA 4UT7L 2CKNA 1F4YL 4X9IA 2UXFA 1I3RA 3VXMD 2LU3A 2AV7B 1F5WA 1P4IH 3N9GH 1UKSA 4P2OA 4ENED 3HC3H 1N6VA 1S7SB 1AGBA 3KPPA 1YUKB 1B9ZA 3U36B 3N1PC 1U3HB 1J9RA 1XGRB 1KYOK 2BJML 3MRMB 5EZOL 1TTUA 1KJVB 3BISA 1MVUB 3BGMB 4O02A 1WTLA 3LKRB 5I8EB 3ZKQD 3P30H 3N1FC 4H8WH 1CL7L 4Z7VF 3MYZA 3T8VA 1NBCA 2GIYA 3K4DA 3DBXB 4A2MA 4PY8J 3PIQB 4BZ2A 2Z0UA 1K4DA 5CLXA 4QYOB 4I48A 3JVGA 1OKEA 1ACXA 2VJ8A 3M1OA 4QOKA 5FCSH 2X09A 4FNQA 1MHEA 2DYPD 2P5EB 3MV11 1J8HB 1R46A 3UBHA 2TRHA 3H7BB 3HZMA 1U42A 4L4VE 2J57A 3S3CB 1IGML 4LSUH 4IBYA 4HMEA 4ZDHB 4MYWB 2PWEA 3TS8A 4G71B 3CZUB 3EOAB 4KDWA 4PG2A 2FGWH 4GSXA 4M5ZH 4LIQH 3TA4D 3CIQA 3FTZA 1T7ZA 3NMEA 2J6WA 1RURH 2VLJD 5HVFB 1J9CT 3C5XA 4HWZA 4Y9BA 2VC2B 4LLWA 2YJQA 5FS5A 1E9QB 2D7OA 4IBSA 4HU8A 4MYPA 4R26H 1MJ8H 1RUQL 3IDXL 3MA7B 1IC5L 1BIIB 4WW2F 1IM3B 5D7KE 5CD3A 2O5ZL 3TNMA 4FZ8L 1YN6B 1GGIH 5HI4D 4HJIA 1XIWC 3GXFA 1B9KA 1T66C 3T0WA 1N0XH 4JCMA 5DRZB 2Y1YA 3L3JA 3DYPA 1KIRA 5TQ0L 5SWQB 2W0FB 2WM0A 3KS0H 2ATPB 1FAIH 3IRPX 2WXOA 2B3IA 1MW0A 3WDJA 3KWVA 3LQAL 4JREB 1CE6A 5D5MA 2DWEA 4WF7A 3ZTEA 4O2CA 3LRSB 3KGSA 4TUOA 3KVPA 4QXWA 5K39A 1IC4H 2PYEB 3NJKA 5IW3A 2OR8A 5E95B 4HXBL 1OGSA 3QZOA 4H0HB 4BKTC 1JGUH 4XBEH 4BXVA 1EHAA 3INUH 2AK4A 5E8NA 4BFRA 3CFKB 3BEVA 1HL5A 1EUTA 3G9AB 5DRWB 5BJTA 4U6HB 1Z9PA 5C0FA 2VXTL 3RIKA 2N3JA 5BUPA 4OLXH 2RR3A 3IGAB 5IJKC 4DGYH 4IS6B 1F45A 3Q2VA 4XP9H 4TTGA 2X88A 4LPWA 1XGTA 1G9HA 5FXCH 1GYVA 1KYUA 2B0SL 1EHNA 1U8QA 1V3KA 1WS8A 4HXAL 1RP9A 3HFFA 1XSJA 3M88A 3VSQA 3G5ZB 2JVUA 3PWJB 5EWIL 1SEBB 4N2OA 1OAYL 1FNEB 1H0DA 2HTLC 3MRKA 4HUVB 1G5AA 3IAGC 4M3KB 1U91A 2A4EA 5KSBF 2XACC 1EEYA 2LLGA 4Y4HB 1XR8A 4NPYB 3ASWA 1E3ZA 1QWUA 4XPBH 1NLDH 3FRPA 4D7PA 1AE6H 1LTXA 3IJEA 4JN1H 4GUOA 2AV1A 1ETA1 1RZJH 2ZX5A 4G7SB 3UYRL 3ES6B 3EYVA 4LU5L 4A2LA 5C71A 1DJXA 1GMIA 4PU2A 3FTVA 3BHBB 3ZKNC 3ULUE 3VXOB 1X9RA 2UX7A 2BLFA 2HMID 2Y5TA 5F89B 1BFOB 4FQ1H 3RGVB 2YD3A 3CLWA 1U8MB 2R7EB 2L04A 3GXTA 1N64H 4A2GA 4W6XB 3L1OH 4WFHE 2EDHA 2YSSB 3CG8A 5JW4Q 1K2DA 4LPVA 5KJRL 3GM8A 5BO1L 1E4XI 3CFTA 1RUML 4LBAA 4MA7H 1BF8A 3WD5L 4U3XA 1L3WA 1Z5YD 4ALAL 3BPNB 4J3OG 4X6EB 3WXVH 3ZGHA 4X6CB 2NZ9D 1D5MA 1EXGA 1OAJA 3SDXB 1T1ZB 3VH8B 1JPEA 1I85A 4GG6E 2I60H 3UPRA 4U1MA 4FQXC 1G1OA 1UADC 1JVOA 1E2WA 2ZWZA 3DRTA 1O7VA 3QDGB 4HZLA 3T8XB 3NABL 1GOGA 1OGAA 3ZPDA 4DPRA 2E0PA 4Q6KA 3JZYA 2J1YA 5CD5D 4DFIA 3PGCA 1MRFH 4ZMLA 3QIWB 1SF3A 1EBAA 1UB6B 4XBMA 3WO4C 1MEXH 4GW5A 3WJLA 3P9LB 1LEGA 1QQDA 2Q10A 3RL1B 1SVCP 2G2RA 5IOPB 1SXSA 3ABGA 4MJ5A 1IC7L 4A7SA 3VFTA 1SHMA 5I1JH 1M1XA 3KBEA 2A5UA 4GXFA 2JXMA 5BXFA 1E3XA 1R19A 2O5YL 1INDH 1JCVA 4XVUC 3KYAA 3A23A 5DRNA 1WAEA 4NO5B 1NOFA 2DRUA 1TZ8A 1DLFH 1LO0H 1TIUA 3FHQA 1IAMA 1T2QH 5GGSB 4QD2E 1WA0X 3IBEA 1S9KC 1CFVH 3RDJA 3G08B 2J3SA 1P5UC 2X44D 4R84A 2EIDA 4AT6A 2Y0SA 1AP2B 4XC1H 3DOHA 3O0RL 4JFDA 1NMAH 4XXWA 4KRNA 2PTVA 1HSBB 3HI5L 4JM4L 3LTVA 2IPUK 3K80A 1MREL 2CWRA 2DMKA 3IK2A 4G9FA 4DW2H 5T3ZH 4KAQH 4QYAA 5B3SB 5J56B 1FE8H 4JPIA 1QBLL 4OIFA 4L4TD 3CSYA 4UOW1 3F5WB 4U1IA 3GZKA 2V2WA 4JY4B 1ZS8A 1FLRL 4NT6A 3MROA 5T1MB 1ZSDB 1A3LH 4ANVA 4KKLC 5CEZE 5IHZB 4XBGB 2F19H 5J1TC 1N10A 1UCTA 2VITA 5EORL 1A7OL 2X41A 1Z9LA 1SPDA 2VDQL 3ULUL 2CA3A 5C0DB 2JCCB 4TNWF 1F56A 4YO0B 4P23B 5CKGA 4ICWA 2EE0A 4Y16A 4F93B 3KPSA 5GZNC 1R17A 4POYA 2XYCA 2XTJD 2DLEA 4GXVH 3SDAA 1TETH 1S7QB 2NRDA 3UTPE 2PYFB 3D85D 3FHAA 2N4IA 3PL6A 2I27N 3CNKA 4LVNB 1DVXA 4HK3J 5DJ6B 1L3NA 4ZPTA 4MMXB 4FXKC 5BS0E 5L2JB 1ZANL 5CSZB 3TH3T 2YN3A 1ZHKB 3WFHB 3NBNA 4JJ5B 4MTMA 3OKLA 4R97B 4WUUD 2BSCA 2E8ZA 2F53B 4APQA 9PCYA 5D1XB 2XA8H 1VGKA 2DQFA 1X7QB 4ODTL 1AGCA 4UQDA 1TPXC 2LAAA 1S7SA 5I8OH 4FS0A 3LB6D 2P46B 1A7NL 4LGRB 1U3HA 3TT1H 3WIFA 5LDUA 2IO5A 3MRMA 2PKDA 3H9SA 3BGMA 3U46A 3NIDB 5I8EA 5ANMB 5DS8B 4JQVA 2VOTA 4P5MB 5I16A 3DTXA 1HHJA 2H6PB 3PGDB 2YD5A 2V5YA 4X6BB 2V5SA 1UZ6E 2GY5A 2ZNXA 3EBGA 2LV4A 4OV5A 4MZ2A 3LHPL 2P5EA 3QQ4B 3BSGA 4MS8C 1U8LB 1PIFA 3JTSB 5A3ID 3TWCL 2CKBH 5I9QC 5JLZB 2J1KA 1KELL 3V5KA 5JTWA 4ZDHA 1AQKL 5KBNC 4FQ2H 3NIFF 1H5BC 4OIBA 1E4XH 4OLVH 4R2GC 5F7AA 2GUOB 3AT9A 4OCYL 5PAZA 1OP4A 3PWVB 3QJXA 4UINH 5LQBL 4PJ5B 3ILDA 4GFXA 4N2CA 4ONFH 4DGIL 2W38A 2K9FB 2W07A 4G1EB 4POZD 5BCAA 2B2XL 5EU7C 1A9VA 1FL6B 1YCSA 5ABDE 3T4YB 4RETB 2FNBA 1FZOA 1X5FA 4I4WB 4N2LA 3SCMB 1X5IA 2H32B 4QRPA 2P4AB 3MA7A 4XPFH 1BIIA 1PLBA 5CEZL 1I75A 1XAUA 1J0YA 2JJUA 2X4QB 4NWTH 3BKYL 3MLXL 4IDLA 4FRWA 4P8QA 3VXSB 2OCCB 4WWOA 4ABVA 3CPLB 2A3TA 2AQTA 5SWQA 2GSIB 2NY1C 2Z31B 1QHQA 2W0FA 1FCGA 4KTEL 4NN7B 5LN4A 2ATPA 3SPHA 4FFTA 1XR9B 2QQLL 2PO6A 2NY3C 2FRGP 3CFJB 3I74A 3WTTA 2YMXL 3DTDA 5DJ8A 3IXAB 3NJNA 3QNZA 4UDUA 2ADIA 3H85A 3P11L 5B3JF 3H6JA 3NJMA 4YBQC 4HUNB 4UF7C 5IOKA 2IAMA 4J3OH 3QDJE 4WNQB 5L9DH 1U8PB 2LU7A 2YUWA 2F5AH 1MWAH 1NCGA 3BKMH 2VDRH 1I9JL 4C8XA 2D7PA 2R0WL 3MV7E 5FUOH 25C8H 3L1FA 1A2YB 4EMZA 5ALBL 2P5PA 1AGDA 4OIIH 5LAXA 4FQJL 4J4PA 1S5IL 2DD8H 4U1GC 3EUDA 3DVNB 3IF1A 3IGAA 2GIMA 2XZAH 3N85H 4FYRA 1JZJA 4L18A 2WIMA 3D05A 1FYHB 2C26A 2VSMB 3C8DA 4B41A 4EQ3A 4TMPA 1W80A 1CG9B 1QABA 1HHKA 2D3LA 3TBYB 1PBYA 4S1DD 2XV0A 3H7LA 2OMTB 1DUYB 5TGBA 3MLTA 5BPPA 2A6JB 2OMWB 4QRSA 4RDQF 2H7WA 3DETC 1VFUA 3QUXC 4M1DH 1NL0L 2HVKB 2ICWI 4KZEH 4Y4HA 2Z8SA 5IMKB 1T6WA 4DVBB 4NPYA 2CSPA 5GGRY 4OUUB 1EEQA 3EYSL 5E4IA 4RMUA 2DM2A 1WFOA 1NCUA 2IQ9L 4MB4A 1VFAB 1QHPA 1RK1A 1F90H 1Y07A 1OE2A 2LFEA 5AVXB 3MNZA 4BK5C 4LDEB 3TJHD 2AGJL 4X0KB 5GJSH 3CX2A 2A4CA 3ZZQA 2J8UE 1E6OL 1GGCH 1X3DA 2IQAB 3BHBA 5AKRA 2IH1A 4XVJL 3QUYB 2NYYC 3VXOA 3MZTA 4M43H 1AQ8A 3KMDA 4Z78A 3MOAH 3QRGH 3VYOA 3RGVA 3DHMA 1EHLL 1U8MA 2R7EA 2BIIA 2ICEB 2V33A 2V5TA 1DQVA 2OS7A 2HVJB 2WXHA 4LRIA 2WKLA 2YSSA 5IB3B 2HJFA 5EO0B 3D39B 4A2HA 2E4FA 1RZKL 4G5ZH 3GMLB 5E2TH 5C92A 1JNHB 2FEDC 4FA6A 4JY5L 2NLJA 2YRPA 2J6EL 4X6EA 3QFJB 4OZHE 1PLAA 4X6CA 1K9TA 4EDWL 5IWLA 1BM7A 1U0QA 2OZ4A 5D70L 2DQCH 1BSIA 3VH8A 5FYKH 2I9TB 4NQEE 5JNYB 4J3VA 3LIUA 4CSTA 2HRPL 3T8XA 1F6AB 5DYFA 2OTWB 4F33B 2WWMC 4M62H 1YEFL 4X8GA 2QV4A 2QPUA 1IKFL 4KMTL 3QIUC 4FFYH 1M9WA 2XKNA 2X0WA 2IWGA 3HMXH 3LN9A 4HH9A 4JFTA 3IDUA 3TPUB 4AITA 3O4OC 3P9LA 1GJWA 4O5LL 5FB8B 3RL1A 3PV6B 3LJ3A 3QPXH 5IOPA 3IGUA 4C56D 1MFAL 1KWGA 3TGXA 1ORSB 2DH3A 1XX9C 4P2OC 5JYMA 4B27A 3QUMA 4YEEA 3QO0B 4FI6A 4FG2A 4FMFA 1HH6B 1XHHA 2XN9A 3ETSA 4U0QB 4WV1A 4RMTA 1A6WL 3PHOA 3WTYA 1F3RB 2Q76B 3GMQB 2XSKA 3FK3A 4ZUWA 2X4TB 4NO5A 5J8OA 2EDQA 4ZSOB 4FABL 4W9IC 3TIDA 3KJ4B 5HGAB 4WI0A 3EF7A 1P7QD 3ZT6A 5IVOA 4LPUA 2CGRL 3CQFA 4OGYH 1OCZB 4NO3B 3UIYA 4J1UB 4RMBA 2AJUH 3P2TA 4XB7A 5EO1B 5ICZA 3QJQB 3U1SH 1SHWA 2WO4A 3JVGC 1J88A 1T1YB 3C5ZD 5IVZB 5C9JA 3SQOH 4HALA 2YBRB 2VXSH 4I9WE 4PGCA 5ISZA 3QYMA 3VXRB 1PW3A 1RU9L 3AU1B 2GEEA 4KH9A 1FL3B 3BZDA 1ZVNA 1JZ3A 4YSOA 3CZFB 3FFOA 3H6AA 2GB2A 3UDWA 5MENE 4OF6A 2FATH 5IBTH 5B39B 4NM8H 5LKNA 4PP1D 2ZPKL 3EGXA 3QUZD 4PG2C 5DD5H 5AW1B 3EAKA 3BPLB 5DSCA 1J86A 4E41E 5T1MA 5DD1H 4LHUB 1ZSDA 3CVDA 2XY1A 3LV3A 1AXIB 4UV4L 1E4HA 4XBGA 4HJJL 2XN2A 3ZXAC 2XNAB 1N6QH 1EMTL 3ETBJ 3QQ9D 4IDJH 2G75A 3D18A 5A2BA 5C0DA 3QULA 2LHAA 4BRJA 3JZ7A 2OCJA 4JFSA 1FNHA 1CGTA 4PCTA 5TDNB 3TA3C 5C0NC 1UWGH 5JZ7C 1IEBA 5FYJL 1J8KA 4OB5H 1AHMA 3CVCA 3F7VA 1DQDL 5E0QA 4EOWL 5C07E 3K46A 4H25B 4M00A 4M1CD 1UOLA 1VESA 5DJDA 1DVYA 1A9EA 4XTRD 3OJDB 2VZVA 1UXWB 5F88B 1IGCH 4DPBX 1B2WH 5L4FA 2GTQA 3H9YA 4NZ8A 4G3YL 1JNNL 3DO7B 4XOCA 4AG4L 4U0RC 4PUBH 5I30L 2H26B 1EERB 3QJHB 4WTXA 1B2YA 1TQCB 5T1KA 2DWXA 4CGTA 1BCIA 2YD8A 2C3GA 5JA8B 2VR4A 4Q4EA 2MCG1 4XB8A 2Q3ZA 4R7NB 1CF8L 1S5HB 1A4JB 3B9VA 3HE6A 1X7QA 2HLAB 2QGDA 4CDGC 4L29A 4ODVL 4PGBB 3N06B 3FSVA 4UTAH 4NM4H 3WMPA 1S7UB 2WBJB 1BZ7A 2F58L 3HUJF 1YMMA 4FFZH 3RVWD 2AANA 4YLCA 4OD1L 2OI9B 5ESQB 3GIVB 1UZ8B 5BUGA 3B56A 5D96C 3L4VA 2ZNWA 2QADB 4AOFA 4U7SA 3MJ6A 4OQTH 3OGCB 2DICA 1BOYA 5DRXA 5ANMA 2V7HB 3EYUL 1TQVA 5EN2B 5CINL 4CU8A 2WTOA 2YD2A 4P5MA 4X6DE 3U9PL 3TIEB 2ZP9A 4ODXB 5SX5K 1EFQA 2IF7A 1EXHA 4F37F 3VXME 4OLYL 4IBLT 4JCWA 1E9PB 4AYGA 2N56A 2YIHA 3PREA 4UT6L 3T6WA 5J9PA 1H3VA 2YSTA 5GRUH 4C4BA 2VDLL 3EH5B 5JLZA 4XNXL 1L5GB 3MJ7A 4S2SA 1PZBA 4I9XA 1J0KA 4J3OF 2P24A 4JHUA 4PLKD 1GSMA 5TE7H 1WLHA 1FZKB 2GUOA 1BQLL 3JWNC 5HYSB 1YEDB 4GT7A 4K7FA 2OL3B 4U4IA 3O9WA 4NP4L 5CP3H 1BEYH 3T0BA 5IBUB 2GQHA 4NC1E 1MQKL 2P7TB 4KK9D 1DP0A 1PG7W 2KZ1B 4V2BA 4YHZL 2NYZA 5E7BA 5AW5B 3EOYG 3SCMA 2EILB 3SYCA 3TEUA 2H32A 4OJFH 3GBEA 1AG6A 1KGWA 3FT2B 4QAWA 4W4NA 5D7JA 4NO0D 4HUWA 2X4QA 3FUHA 4K8RC 4PTTA 4AI7A 4FFYA 1AYOA 4LLVA 4B9FA 3P0YL 3K6OA 5TE4H 3U0TB 1I85C 3CPLA 3HB3C 4U6VL 1KZYA 3I50L 1LE5A 1MAJA 2GSIA 4MKTA 2VERA 5DC9B 5IGXL 2WYIA 3C5SB 1XR9A 4G2AA 3RE0A 5HVWA 1NMCB 3VI3B 4G6KH 1JNLH 3CFJA 4OFVA 5F96L 4DN4H 2VLJE 4LLYA 4PJXB 4H1LG 5E8EA 3KBPA 1WDAA 2AJZB 3BSZL 3SJVA 4LHQB 1BAWA 1C16A 3HE7B 1VEOA 2YR3A 4ATWA 2CRYA 2IANB 3IDJB 1EV2E 4QXUH 3A4FA 2R0ZH 2YPLB 3DVNA 3WXWL 2GG1A 4GQQA 1Z5LB 1IGJB 3BKJL 3KEHA 4HCRH 3E3QE 5FHBL 4YL4A 3HG1D 1OGPA 4WWKB 3MLSL 2CLRA 4G70B 3ZRCC 1CG9A 4WTZG 5I1KH 2J73A 3IJ7A 3BWUF 5ANHA 5F7HA 5BV7B 2Y23A 3A67H 4TUJB 2V9QA 3JQOB 1PZ5A 3N04A 3ZDZE 4XXWC 3O2DL 2WYZA 3F6IA 1G6RH 2JIXA 2WVSA 5E08H 5PCYA 5C0CA 4NN5B 4ORZC 2ZKYA 2HVKA 4L3AA 2VZ1A 4IIQC 5IMKA 1AQDB 1DN0A 3GZPA 4DVBA 4OF5A 3KG5A 3P77B 4YHOL 1BMGA 5C0BA 4I1RA 1YNTF 3CLEL 1CGXA 3JWOL 3G5XB 3WOVA 1KDJA 4P46B 2XQ0A 4OLZL 2J1XA 5I6MA 3GHPA 3P2DA 2R2CA 4JFEA 4HT1L 5FO7A 5I71B 3K5RA 5GHWL 3B2MA 2NQCA 2WXJA 3QUYA 1V7NH 2BC4B 2LVCA 5DMIH 1SY6L 4HF5H 4KQ4L 5KSUA 1FFPB 5D4QA 4DCQB 4LDOB 3RB5A 5JPMB 3AC0A 5EO0A 3D39A 3MRIB 4DAGL 3GMLA 1EANA 2BCMA 4HQQH 4Y16C 2BP8B 3TNNB 1M7IA 1R5WB 3VXTB 4KJYA 4TSAH 4CGUB 4JM2F 4NNXB 2YZ8A 1J0HA 3LKNB 3QFJA 3FSAA 4UDTA 1HHGB 3BUDA 4W6WB 3ATBA 3PL6C 2I9TA 4NFBA 3N41F 1CT8A 1LP9B 1NGXB 2MCMA 1UENA 4NKOB 1I4FB 4OV6F 4XN7A 3NCEB 1X9LA 4PI2A 2NTFB 5EOCH 5LBGA 3MJ9H 3CFDB 4KC3B 4LSPH 3ELAT 3I9IA 3QWNA 1A3ZA 1WUZA 4M7JL 2HT3D 3TPUA 4WWID 4JFQB 3TYFB 1HKLH 4LFHG 2IPKB 4APQC 5F3BB 2ZCKL 3N44B 1OGTB 3ETBF 2Z1KA 5FB8A 2F0CA 1ZGLM 1WAPA 3PV6A 3BJ91 1NEZG 5AYQA 2KZBA 2D0FA 1LD9A 2EE6A 4DP6X 1IAIM 5IW1A 3QDAA 2ZKXA 1GIGL 4Q14A 5KJ4A 4JDTL 3QI9B 4BSWB 2YXFA 1U3HC 3IJSB 5IJCC 2PW2B 1A5FH 3GSNH 4PG9B 2VZUA 3FTWA 2Q76A 3GMQA 3QEUA 3X17A 1VADB 3K71A 4UBDC 1HX0A 4OH2A 4KROC 4W9EC 1G7LB 3ILQC 2PWHA 5HGAA 5LDSA 4JR9L 4ACTA 1DEDA 4AVHA 1A6PA 2R2HA 3BH8A 3EFDH 3F12B 1SJXA 4HV8A 3T77B 3WFEL 1RZJC 1P7KB 5D7IB 4GW1B 2XTLA 3WNOA 3V55A 4AGMA 1QR4A 1JD7A 3GB7B 1T1YA 4YHPB 5DK2B 1F8TH 3WIAA 3IGLA 2WWOA 3KYOA 2Q8AH 1YQVL 4ZFGL 3P0GB 4E9SA 1NBVH 1KFGA 3BVUA 3OV6A 4AQ1B 5DUMH 5BOZG 3AU1A 4MJ6B 4GNKB 3CZFA 5EDXA 5ETUB 3RI5K 1TMQA 1RZ7L 4Y1AE 2XIIA 1CVRA 2L0DA 4QT5B 4K3EH 5JR1H 3IDMB 3HAEB 2FO1A 1MFEL 1H8LA 1TO5A 3G6DH 1KCLA 4LHUA 2Y9RT 3QRFM 3U6XA 1FVCA 3HPLB 2O6CA 4IOSD 4LLMA 4WW2B 5F71A 4BK4A 1ITCA 1MPAH 1TT6A 4W9JC 4G8GE 5F72S 2W65B 3SBPA 4AEIH 1KEGH 2VSCA 1VCAA 2BFVL 1IAKB 2OSLB 5D5ME 1N2RA 3C09B 5TDNA 2K6WA 4NP9A 1L6PA 2ZAHA 1Q90A 5F0JB 3RY6A 2ZUWA 3CZSA 2DJSA 1K5WA 1D7FA 4L4TE 3V5HB 4MWFB 1CICB 5GS2H 3OPZL 4FTVE 1KIUB 5IVXF 2PO6C 1AGFA 2OTUA 3T08A 5C0IB 1IZJA 5F88A 3PWLB 4OAWB 2AQQA 3HG0A 5IEHB 1S7XB 3BVXA 1OM3L 5J11B 2OR9L 3CBJB 3FCBA 1XIWD 1T5XB 4TSCL 1T66D 2H26A 2IAMC 3QJHA 4HS8L 3E38A 5CP7B 1TFPA 4CNIA 5I73B 2JI1A 4N5EC 3IE9A 4XMVA 2R4RL 4MGXA 3CVHH 4R7NA 2Z7UA 1TU2B 4PN6A 4J4PC 3UJJH 4BUHA 4PGBA 4WZ9A 1JUFA 3K1DA 3NRFA 1N5YL 1P1VA 3TTYA 2WBJA 1S7UA 2XTJE 3NCJH 3WHXA 3D9AH 1PLGH 1UGNA 2BNRE 3NQKA 3MV9A 4K3JH 5GJTH 4CADB 1DFBL 3PU7A 5ESQA 3GIVA 1XEUA 4JO3H 1OHQA 4H1LH 4EXKA 1KTDA 1AYRA 1ROWA 4GP5B 4HHWA 4I0PA 3MMEA 5CN3A 4P2RE 4XX1G 5I75C 1CXIA 4U2ZA 4WUUE 3ESNA 1T0MB 4ODXA 2NNRA 2DOCA 4GRMA 4AEHL 4N5UA 4B9JA 2UZXB 4MLIA 3RIFK 3RIAK 4R8WH 3ZZSA 4QJ3B 1JWSB 1ICTA 4NBYB 5E4EB 4Y4HC 2TRYA 3TZVB 4J2XA 4U1SA 2NX5B 1IAOB 2HG0A 4WVRA 5GGQH 2H2SC 3ZKSD 3T4AC 1A25A 4YLBA 4S1RL 4JMXA 3HI6H 1QPKA 3FAXA 3KWXA 1JPSL 3FU9A 4LT7A 4PYGA 3X3GL 5E2UH 1KEMH 2ITDA 3VQLA 2KL6A 1DTUA 4DQOH 1HEJC 1NKRA 2HTLD 3OXRB 3EDFA 2WBKA 1FZKA 2VLKB 3PDOB 1IGYA 2YKLL 2R69H 4GI9A 3FPYA 5DO2C 1PG7L 1RZGA 5DJ2A 4ENZA 1YEDA 1MIMH 1CE1L 2OL3A 2BNUA 1LEKA 2R83A 4LRIC 3UZVA 5IQOA 3C5JA 5FUZL 3S36L 3LNEA 1GS8A 1KENL 1QTPA 1XCQB 2F8VA 3D0LB 4I5BA 5K9OA 5L7XH 2GYSA 5EZLA 4OI9A 1CYGA 2GJ6A 3VD0A 3H4HA 1OLZA 1PZDA 2PF6A 1UWFA 4PQXA 3LQZB 4ZOEA 4AGOA 1DVSA 2RALA 5IWLC 1PNCA 3GSXA 4HIEA 4QWWD 3U0TA 3BJLA 3HC2A 1HINH 1S78C 4RBPH 3QHZL 2QVKA 4PRID 1FGNH 3RYMA 3CN4A 3C5SA 2R2EB 4U1LA 5EBMB 5E6YA 3VI3A 1EGJH 2FJSA 3L5JA 4Z7UB 2VL5B 3HI1A 4GAGH 5IJVA 5C97A 5FUCC 4ZMPA 3FONB 4PJXA 4FQXD 2AJZA 2AITA 3GIZL 4JRFA 4K9EH 2EH7L 1J5OL 4QRTB 2I25N 1XAKA 2HCZX 2V0AA 5ILTL 4TVPE 1JAEA 4FP8L 4WV1C 1NSNH 1QFHA 2Z0BA 2ZJSH 5LCVL 3ULVD 1C1EH 1BZQK 1C12A 4JRYA 4A6YH 4BM7A 5KVFH 2NW3A 4AQAB 1RZ8B 2W5PA 4FULA 2P45B 4K3DL 1IGJA 2AQRA 1QASA 1QI3A 3DECA 5JO5B 2BMKB 5T5FA 4F7PB 3R4RA 4P9MH 4KNSA 4G9FE 4IW4C 4X7SH 3MCKB 4NQXB 2FYVA 5BW7A 1M42A 4A2FA 1BJ1J 5JYLA 4YSSA 2WTPA 3E6FB 4TUJA 1HIMH 4UTCA 1E8WA 4YK4B 4M3JA 3T2NL 4ATTA 3N1MC 4OLUL 2B59B 4JPQA 4XVUD 1O5DT 1YY8B 3WUZA 3NN8A 5D1ZI 1A7PL 2PPCA 4QXVA 5IT2H 1OTTD 4FFWC 1JXGA 3A6BL 4PJDF 1BV8A 4HIIB 3DUSA 2ZUXA 4BA0A 5A6MA 4O58L 3B5TA 4R5XA 3L48A 4Q9RL 3P77A 4CMMB 5IV2B 3UDWC 5FO8A 5D7HA 5AW4B 1YEJH 4P46A 4LF3A 2V37A 1NGZA 4NGHL 3LZOA 5EU6E 4X9BA 4KTYA 5SV3A 3L3KB 2FJGA 3W39A 3B37A 3PNWA 2BC4A 4GRWH 2HLEB 3KPSE 4WDIB 4JFUA 2OCFD 3MOBH 4LEBA 5I1EH 1ZGLA 1MCQA 5B4MC 4IBVA 1A4KB 1CXEA 4HCGA 3JWDH 1HDMA 5L8KB 3N43F 5A2JH 5JPMA 3OAYK 1ADQL 4IK7A 4JKNA 4FXGB 2VZOA 3LS4L 5E1HB 1OAQL 4F57H 3L7FA 2BXYA 1BREA 5MP6L 5GXBB 4K23H 1J0IA 3MTXA 3NT0A 4KKLD 4B95C 3LKNA 1P1ZA 2C9RA 4J3OC 3OSVA 1B0IA 3AS0A 4LVNC 4N3UA 3OKDB 3L95B 4IBQA 2HVBA 3FU7B 2APVA 3HC4H 4JDVB 1BQKA 3ZVVA 2C3HA 4NNYA 3DUHA 4HX1A 1OPGL 2NTFA 2DH2A 4GMTH 1ROCA 3B7UX 3CFDA 1KBKA 4DN3H 3OTTA 2WVTA 5GZND 3LVTA 2EIZB 1QEWB 1BQSA 4JFQA 1DHKA 5IKCB 3L6FB 2XQYG 2D73A 4PJ8A 1OCWL 4XHJC 1DJHA 3AACA 4XMKH 1KBBA 3HE6C 3PG2A 5E6ZA 4Q97A 4NQDD 1NCHA 1NICA 5G4NA 3GI8L 1ET7A 2YD6A 3FFCA 2XUWA 2XZQL 2A6KB 3K6IA 1OCRB 2HFFA 3QI9A 1O0VA 1PLCA 4ZPVA 4G6FD 2OLDA 3L8QA 4FL4C 2F1BA 3KBHE 4D9LH 3HRPA 1JS4A 4TVPL 4DNLA 5E5LA 2P5EE 3VXNA 1J8HE 5ALCL 1MVYA 2QTVA 4PR5B 3S7GA 3GSVB 5HYQB 3H2QA 4APXA 5EPMB 3NGBC 3F12A 1L4IA 1RKRA 3VJ6B 5D7IA 1L0YA 3AT0A 2B77A 4IEFA 3TFBA 3GB7A 1G9NH 5DK2A 3V4VA 2C3WA 4KJWC 4ODWB 3QEHB 4UV7H 5BUAA 5F2FA 5AZ2H 2FX8H 1H3TA 3MCLL 4G42A 4OD3L 2W9EL 4FKEA 2YAEA 4TL4A 3VTMA 2W9DL 5GGTA 4MB5A 3MTRA 4RSVA 2AXGB 5DWPA 2NQDA 3HNTL 2VT0A 4P5TD 1LMKA 3CN0A 3RAJL 2V17L 5GRJH 2EVJA 4QT5A 4RDBA 3BWUC 4JQIA 4OF3A 2XVGA 3IDMA 3HAEA 1FYTB 4M8QB 4WY7L 3NPSB 4MS8D 4AJWA 3V4PL 3O9WC 3X1GA 3LH9A 3ZE2B 2BRRL 5FYLH 1W0YT 2BSEA 4URKA 3TEZA 3ARXA 4XH2B 1LK2B 5DK0B 2QPEB 3CFEA 2HH0H 3SZ6A 3TO4D 2CM6A 3SCMC 4R2GD 5D7JC 2NR6A 1OW0A 4A7GA 2UZIL 2RCSH 1UACH 5C7XL 1EGJA 4LQ1A 2F7RA 5CGYC 4N86A 2FT7A 4AE1A 4N2FA 1B4JL 1AHKA 3A6CL 3PFQA 2FIRT 3VGAC 7FABL 1ZT1A 4BUQA 4MWFA 2HJLA 4IOIA 2PYEE 1AO7D 2XFXB 4P5SA 1SLWA 4P2QA 5DYOB 2FHFA 2MEJB 4KRMB 4MBRA 4V1DD 5C0IA 1IT9L 5JXAL 2EC9T 5DQJA 3LEYH 4M5YH 4WWPA 3VAEA 3HCVB 1S7XA 3NIGF 4YGVB 1QSVA 4ZX4A 4GSDL 1IGFH 5L6YH 1KJ3H 1T5XA 3HN5A 2L7EA 3L4YA 2C3XA 1I8KB 1LK3L 3WNIA 5CP7A 4BFJA 4XE5B 2CPUA 4OUOA 1DBKH 1WUNT 2NYKA 1A65A 1SFHA 4FMVA 3MJ8B 3H2PA 3PRZA 1IKFH 1TU2A 4Z7OB 3DX0A 4GSQA 1RK0B 3ESPA 4JL1A 4EQ2A 2P8LB 2QQQA 4NXSA 1MKFA 1XCWA 4GKNA 4NSKA 1JTTA 1PZCA 1E5UI 1TZAA 4GI8A 2Q6WA 3SE9L 5AB0A 4LOFA 3WTSA 3GUTB 4YHKH 2BW4A 1UVQB 2PR4L 3ZSSA 3CN2A 3M86A 4NIKB 3KLHC 4IBUA 3AGWA 3IDYB 5FM5O 3UAEA 2HKFH 2R29H 1RAMA 2VRQA 4FHKA 1TR7A 3WEXA 4K94C 4MDRA 1RIHL 2XV6B 3ZL2A 4IU3A 4DK3A 4DP1X 2UZXA 2H6OA 3PHQB 1TJHL 3VM7A 1JWSA 2KC0A 1O9VA 3TZVA 4HJUA 3T0VA 2F6AA 4W9FC 2NX5A 1IAOA 1N26A 1RJLB 1KTKE 1H3WM 1HXMA 1BWMA 2H45A 3BFWA 4JN2B 1BYPA 1WK0A 4L8BB 1J05B 1X44A 2Z6FA 4DEUA 5DHYB 3FKUS 4UILH 2WXMA 1AD9A 1A4CA 2E46A 4NERA 3DETD 1CJYA 2CO1A 2QGBA 3A4DA 2BSBA 1THCA 4BZ1L 3R7QA 4JRXB 2VLKA 2X38A 1ONQB 3C2SA 2RACA 3WV0A 3G5YB 1UFUA 4HH8A 4XAKD 3DV4B 4X6CE 2YRBA 3EGDB 4MAUH 1M7UA 1G4MA 5A40E 3LZRA 1RK7A 3SDXE 1MFUA 2CUAA 4TSBH 5JOPD 3NZHL 3OAZH 1URZA 5GS0L 4MDIA 3QG6B 3QDGE 1XBDA 3LZFH 4XHQA 5FEBA 5E1AB 2NYYD 5A2AA 2KPNA 3ROOA 5C0RH 3GI9L 1JMXA 1WO2A 3BVWA 2NY0B 1OOWA 1IE4A 2R4SH 2ZOUA 3QT2A 4LDCA 1ZHBB 2VMCA 3UGXA 3NEOA 1JXKA 1X5GA 3RY5A 2DQEL 4B53A 4NZTH 1M9SA 2E7BA 3V52L 1QSZA 1T0OA 5B1AB 5D7LB 1O6SB 5H37G 2FEDD 1CD9B 2UZYA 3JSSA 4UTBA 4HC1A 4Z7UA 3VG9B 5TE6H 2VL5A 1BXAA 2YAMA 1BZDA 1EBPA 3WTXA 1PZ2A 1NFDB 3GRWH 1ZLEA 3FONA 2WCGA 4Y2DB 4WEUD 1L0PA 1V7ML 4GO6B 1ZIBA 5EIIG 2WWMD 3KNBA 3LNIA 4QRTA 2XQBL 5D2LB 3RX7A 3QIUD 2FJFA 3KH4A 2P52A 4GRWF 4XO5A 1EIBA 1EZVY 5SWZB 4S10A 4MAZA 2BHFA 4A55A 1CN4A 3DSFL 2GBUA 5KS9B 2BMKA 4N9GB 3QXDB 3FT4B 4MQ7B 5I18L 1E65A 1WIPA 2CHZA 2MQGA 3C8KB 4NQXA 4LSSL 3RBSA 4DSYA 2YAHA 1FRGH 2JF1A 2YPKB 4UT9A 5BVJA 5JORA 3E6FA 1P7HL 3B3BA 1MELA 2OR7A 4NJ9H 3ZDXF 4F27A 4LOEA 4M3HA 4OFYA 3AM8A 3O6KL 4DUVA 5BZZA 1ORQA 5D2NA 2OMYA 3VFMB 1QKZH 3E1ZA 4NRYA 1ND0B 4QHNA 4WAFA 3TX4A 2ZONA 5MHSD 3B1TA 1YJDL 2YXVA 3NAAH 2P3YA 1USZA 3GBLA 5EULV 4CMMA 1ZT4A 4Y5YA 2CCWA 5IV2A 2RQEA 3X14B 5I66B 2ZXWB 1W6WA 5FW6A 4C83A 1A6VH 5CJQL 3W56A 1G9MH 1FNGB 2EDJA 1RD6A 4QOKD 1E6JH 2JCCE 3CMOL 3ERXA 1PMYA 5CIPB 2ID5A 1KBGH 2FQDA 4ZJ9A 3WN6A 3BKCH 5JIKA 4BWTA 4S0HA 3MBEB 1NDMB 1SMDA 1O7DE 1A4KA 3RX9A 2DM7A 4BCYA 4YXKH 1UH4A 1F3DH 4W81A 5D7SH 4O2EA 5CBEB 4KY1L 2G4EA 4RQQA 2Z65C 3OKOA 2JSFA 4O4YL 3MKGA 5J6HB 4HGKC 3RY6C 3GEWB 2APTA 3MSPA 2IFFH 2AZUA 2QT6A 4ODHL 3UADA 5BNXD 2Z7WA 3SO3C 4DZBB 2HG5A 1F4XH 1QOKA 1DBMH 2F53E 2QKIA 3L95A 1H3UA 2VO5A 4GLRI 4JAMB 1ODUA 4YE4L 3FU7A 1FNLA 5D1XE 3O8XB 5K1JA 1AANA 2L7UA 4P9HH 2VDPH 2H3NA 1I9RH 3TA3D 1WCBA 3ZL4L 5C0ND 4UZUA 1F3JB 2EYRB 1YYML 3M1CA 3MNMA 4F24A 2EUZA 1ETZB 1CFSA 2XBZA 3CSGA 4JFXB 5DT1L 1G6VK 4DOHB 3NIDE 1DBBL 5ANME 2XN1A 3O4LD 1SM3H 1WIOA 4IIZA 4Y19D 1P84J 2R29A 4QR7A 1F4WL 4UOW0 4GG8A 3MLPA 3V7AG 2HWZH 3HR5B 1XGZA 3NCCB 3P02A 5AOJA 4AL8L 3VFNB 1MJ7H 4I0PC 1QHOA 4GBXA 3PPSA 2RTTA 5EA0L 2A6IB 1RIVL 1J5CA 1SFDA 4PR5A 1LGVA 4HIXH 3D0AA 2XPZA 5IQNA 3W5NA 5EPMA 3QQ3B 1OWRM 5FGCB 2X6VA 5F7EH 2KPWA 1LO4H 1FI8C 2E9JA 1HXKA 5G4MA 4XNUL 4PJGF 4UANA 2EXTA 4CW1B 2CO3A 3MBXL 1ZLSH 2MCPH 5KZCD 2CO7B 4MCZB 3FOLA 3QEHA 4PJ5E 4YUEL 1P6WA 4AZ8B 2NY5H 3T0EA 3MNWB 4OZGA 4ZO8A 1AS6A 4KNTA 2ODHA 5HHOD 1B6DA 1M6UA 4MNHB 1IBDA 4ELDA 1MWAB 4XMWA 3FQXB 4HFWA 2ZAGA 5DUPH 5FAAA 4L5FE 1L9SA 4N0YH 2WKOA 2OP4L 4ZS7H 3VRJB 2ZWNA 5DJAB 1FYTA 4X9HA 3QXAA 1PGRB 3VXSE 5AVTB 2QHRH 3L9BA 3SHSA 1ZJAA 3VX1A 3OHXB 4IBZA 1XGUB 1LK2A 2A4ZA 5DVKA 1FIGH 4HOZA 3FCUB 4KTDH 2HT4C 1OSYA 1RUPH 1BF5A 4C58B 3U30B 1E7UA 4MB1A 4GFTB 2KUTA 5H94B 2H2PC 4G8FB 2VXUL 3JYBA 1PF3A 2WXLA 3WAKA 2IG2L 4LCWA 4QNPF 4JB9H 1QUNB 1AY1H 2HN7A 5CLTA 4TF4A 4KZDH 5LUMA 5EU4B 1HYSC 1B3JA 2DI9A 3QDMA 2KI6A 5DYOA 3O3EA 5AW0B 2ISDA 2O6DA 1LILA 3HRZB 1PZ3A 3AQXA 2WSDA 1VFMA 2BVYA 1E7VA 1IX2A 3FF8A 4OCSH 4YGVA 3DVGB 3OX8B 5CJ5A 3N6YA 4XNDA 3PAVA 4A2EA 3C87A 1I8KA 3RZCB 4GQZA 3HB3D 1BOGB 3EJPA 3KDMB 4HIJB 1OGAD 2OMZA 3FQYA 5M94B 3KPLB 3SPVB 3RX5A 4LSTH 4NRXB 3OJVC 4L9LB 1I1YB 2WNKA 5H37H 2ZG1A 2ZIDA 1XZ0B 5F7BA 1KLUB 5FO2A 4I88A 2AXHA 2BVQA 4JG1H 1YVLA 2QMKA 3L4TA 4HK0B 5E6UB 3WUWA 2VMJA 1TLKA 1ZLVH 4JZOA 3TVMB 1L9NA 4GQ9L 1AXTH 4WKZB 5BW7C 1INQB 3RA7H 3LSOB 4N2EA 1ACZA 1KLGB 1NDGA 3FF7A 5CCKL 1PYWB 1U8CA 2BY1A 4XN8A 5EC1A 4JFWA 4NKIH 4XNYH 1IM9B 4JANB 2F5BH 1DEEA 3O6LH 3PJLA 4N2IA 1JSYA 4TPRH 3MODH 3TASA 5DJ0B 1NCBL 3BAWA 1YNTB 4EO5A 2YEQA 1E8ZA 4YFLI 1J11A 1KYDA 4JN2A 2OTPA 2ED8A 1NCNA 4JFDD 4JFYA 2E6JA 4FDWA 2R8SH 1I8AA 4JFFA 3D39E 4D8PB 1FZMB 4UMSA 2IOOA 1TZIA 1JGVL 5DVLA 1UCBL 3MKKA 2RQ8A 1JXFA 4E2OA 3VDAA 1CF1A 3TV3H 4FKKA 3G3LA 3LKQB 3ZDYB 5AVYB 1KN4H 3DV4A 3QFJE 2F08A 3OHMB 4L5FL 4S1SH 1HI6B 3GF8A 4GLRH 4MD0B 3Q2LA 3QG6A 5I74B 3D51A 5HHMD 1M3IA 1NA8A 4YDVA 4JM2B 4DGVL 4U33A 2FHBA 4GRLA 4HUMB 2G60L 5FCUL 4AQOA 3V79C 1AZRA 1NPNA 1W0VB 3DXAD 1TZHB 4JO1L 1FBIH 2XG4B 4F80A 1ZA6A 3DJTA 3TBWA 5I1CL 1A3RL 1YEEL 1F58L 3GPEA 4HWBH 3KPOB 1A1MA 1H3PL 5AOIA 2NSMA 5JQIB 4Y16D 2EXWC 1JRHI 1J1XH 2XKSA 1CTMA 1EJ6A 4R0LA 4FQIH 4UIMA 3VTAA 4Z7WB 3DYOA 4P0DA 4WQOA 5DXWA 2VDKH 1EEZA 1MLBA 3HBGA 3PL6D 4GKZB 2R0KH 4PJ8C 1I1FB 2X40A 3H4FA 3U83A 4ZQKB 3L45A 3FQRB 4ZSOE 3KJ6H 3E8UH 1TTBA 4U3CA 2WQAA 1EX0A 2YAPA 4KK8C 5D2LA 4JJOA 2VO8A 1XF3A 3ESUF 4MA3B 4NQVB 2ZSVB 1AR1D 5SWZA 3ZTCC 4APQD 1I8LA 1FO0B 2WWKO 2YQBA 1AS8A 5J13B 3B1UA 4Y4FA 3UTTA 1HQRA 4M9PA 3QXDA 1FGVL 5E8DH 5E1QA 1N5YH 1T80A 1DJGA 4TS6A 4H0GA 3VXRE 3U2JA 1KDIA 1VSCA 1RIUL 3DSNB 2YPKA 2AMUA 3L4ZA 3TH4T 3BZFA 1JHKH 4EN3B 3RFZB 5CFAA 1OB0A 5DU7A 2EP6A 4X5XB 3IKKA 2VXQL 2Y22A 3D25B 5HGGS 3ZHLA 3I6GB 3MJWA 3H9SD 4UBDD 4KROD 5IFHH 5CLYA 3ILQD 1D5ZB 2O1AA 3K0WA 3VFMA 3MXWL 1UWXH 1ESOA 1ND0A 4PGZA 4DKEH 4XOAA 3ULVE 2AEOA 4K7PL 2Y72A 4XPGL 3X14A 5I66A 3GPSA 2N59A 7PAZA 5JPNC 2NY4B 1EHKB 1TJXA 4YQXH 5HGDB 5DFVC 3AS3A 5F3FA 4X4MA 1KJ2H 3LNHA 1A1OB 4XP4L 3X1FA 4JRLA 5CIPA 4HGMA 2IH9A 3MGOB 3FJTA 2EIJB 1QSFA 2CU9A 4DEPC 1V8HA 4PFEA 4YHYB 2X12A 2OXGB 3MBEA 1NDMA 2ESVA 3ESMA 5CJBA 2PPEA 1SN0A 3IAPA 2ICWB 1MCLA 1N0LA 4GW4A 1OW0C 1F86A 3CC1A 1NOAA 2WZ5A 1BD2D 4MAYC 2B14A 4TLTA 2FBRA 3PQYA 5AW9B 3C09C 2O61B 4YFDB 2AW2A 4LMQI 2WP3O 1JPST 2XTSA 3NVQA 4HBQA 5IVXB 4B0MM 4YDKL 4UAHA 4ZMOA 4DZBA 4HEME 5T33H 1MF2L 3KYNB 4JAMA 5DZLA 4QRPD 3CH8A 3HHRB 3O8XA 4IRZH 4UMGA 3ARTA 4GAYB 4W9HC 4WHYG 4UNUA 3RWFB 3ULSB 3KCPB 2ERJB 3EO1B 1F3JA 3JVFC 3KLSA 1WWWX 1QW8A 1RSFA 5DO8A 5FWQA 3N40F 3QCTH 2PP9A 3HC0B 4F8OA 5B8CC 4DH2A 1A6TB 1IGTB 2VGLM 5I1GH 1VPOH 1DDHA 1VAHA 4RFNB 1NCJA 2PO6D 3WKQA 4MA1B 4Z3GA 1RJYA 1NBZB 4JL2A 3QHFH 3Q0HA 3RFRA 3US1A 4ZMQA 2NNFA 3ETTA 5EIIA 4YNYA 2EDRA 2IAMD 4MCMA 4Z1PA 2WB7A 1KNOB 1X4XA 3S88H 3QZWG 1VACB 4LRNL 2H0FA 4N5ED 2FBJH 3VI4B 1UM5H 4CA4A 2BIMA 4CC0A 1T3FB 1XCTB 1G7MB 3TBTB 1KPVA 1HOCB 3APDA 3ZTJG 2FTAA 5J89A 1ZHNA 4J4PD 4Y5XC 4P3CH 4ELMB 1Q9LB 5KW9L 3BEWA 4NBZB 2E9GA 2FIKA 1MH5A 3HR6A 4F7CA 3FFDB 4RH4A 2BOCA 3GBDA 4UM8B 3L08A 4BV1A 2PPAA 5J5EA 1SOQA 2J8HA 4CW1A 3VWJB 4HS3B 5JUEH 5LNDA 3Q8BA 4WW1B 2FSDA 3CHQA 5F9AC 1UFGA 2O5NA 5D7LD 1YRKA 2WGNB 4JDZB 4ZUSB 3D06A 4AZ8A 1MCWW 5CGBA 3MNWA 2QQKH 1IGIL 2WQ8A 2BCKA 3JWDC 2ZXAA 2E7MA 3SBQA 3EJZC 4WI9A 4MNHA 3GSOA 4IJ3C 3ML9A 1S9YB 2BP5M 3MA9L 1L7IL 3FU8A 3ULVL 4Y4KB 1LDPH 4B9CA 1ZVSA 4WSKA 5LGYA 3GJFA 3G04A 3NUKA 4R4BB 3AW5A 2XJLA 1H9DA 1VA9A 1Y0LA 2DLIA 2GBTA 4MZIA 5I26A 3Q05A 1QSEB 3GXUB 3F64A 3FPXA 1BIHA 1KIQB 1UH3A 5DR5H 3WY3A 2J8OA 1JGLL 4MNQB 1C08A 2HRLA 4M7ZC 3VI3E 1JRHH 3EOTH 5DO2D 1OZUA 5H94A 4MD5B 4G8FA 2WCSA 5LAPA 2HKHL 3WDIA 1OSZB 3BI9X 5TF1H 5LJYH 5FW7A 1MJUH 4M48H 5IMOB 1QUNA 3TYGH 3WFCH 4AYDC 5GGRB 1OT4A 4PJXE 1MCPH 3OR6B 2F54D 2P80A 1J7VR 3SE6A 3FH5A 2DLFL 5E1IA 4RFOL 1IB5A 1S3KL 5DQDL 2K7PA 3KL0A 1Z32X 2VABB 1KT2A 1NCWH 3HRZA 5KOVC 5EZJA 2AP2A 3ABMB 4JPSA 1PEWA 3VGDA 1TFHA 1R0AL 3IU3A 3HBQA 3SYOA 2IANE 3OX8A 4LSVH 2P43B 3GXMA 2X4SA 2YPLE 4N8CH 4EPSA 5IHBA 3FCTA 3VXUB 2X3CA 3F00A 3REWA 1OTUC 3P73A 3PY9A 1QNZL 3UAAA 3MUUA 1AS7A 3KPLA 2R1WA 3SPVA 1N8OE 3MFGB 5D6CB 2FZ3A 2EIMB 4IGBC 5FOBB 4XP1H 4L3ED 2EDWA 4ODUA 2E7HA 5CLZA 4Y2LA 5KBMA 3RWJB 3H0TA 2YWZA 1EAPA 1KLUA 2P49B 32C2A 3SPIA 4IHBA 1QFUL 4PLOB 3CIAA 3EZ8A 5E2WL 4HK0A 4ZODA 3DDGA 4XXDB 4ZRGA 4JY6B 2E7DA 5IY5B 1AKJB 3QE5A 5FYKU 1N8ZB 4WKZA 2Q7YB 1X6NA 4ACPA 3LSOA 1E3FA 2XN9D 3KPNB 2BVUA 3MLZL 5E9NA 1KLGA 5H4YA 3F85A 1P7BA 3VFGL 2X2IA 2GTWA 2ZOWA 3AM8C 5JDJA 1U3NA 5DMGC 3NZ8A 4F92B 5D9SA 4QXGH 2WZPA 4PRHB 3FSWA 5D2NC 5FFGA 2RFXB 2WN2A 2X4PB 4BGDA 3F58L 1QLRB 1KIPB 1MNUH 2HAZA 5I0VA 1CK0L 4Y5YC 43CAA 3KYKH 3WMQA 2GIXA 3K72A 4N90E 1LLAA 1KGCE 1WFJA 1QO3A 2QVTA 3QK0A 1BQ5A 4LPYA 4ONHB 3FU5A 5EEXA 3D87B 3VCLA 3HG5A 2HFEB 1B90A 1FNAA 4D8PA 5CEYB 4FFWD 1AAJA 5ISZD 5HHPB 1I8IB 4HFUL 3FT0A 3BP7B 4YXLL 4XE0A 3QIBB 2F7PA 3ALXA 3ASNB 3K7UA 3BDYH 2NY7H 3ESOA 1AZBA 1LP9E 3IDNB 3TESA 4FQCL 2PWGA 2BVOB 3D1MC 3EHBB 3CFQA 4MD0A 5CLWA 2Z91A 2H1PH 4XWGL 3OXSB 4YSRA 3RKDC 3GMPB 3A47A 5F7YC 4PB9L 3GS0A 1W0VA 4YSDA 5G5DA 2J72A 1TZHA 1ZHLB 1NC2B 2LW3A 5B4MD 3ZHNA 5C0AA 4N2HA 1Q1JL 4HKBB 2QKIC 3BD5A 4MZ3A 5TJWK 3DIVA 4YC2B 3U79A 1G7PB 4HBCL 5HHNB 3KPOA 5TPWH 5MEPA 2ALWA 4Z9KB 2XWTB 3V6BR 2CE6A 3CC5B 3JV6A 2XZCH 1YEGL 4WO4B 3QXWA 4Z7WA 2I5YL 4J3OD 1JWUA 4QHKJ 3TTSA 3GHBL 1UXSB 4L1BA 1MFDH 3IS0X 4XI5C 1FFOB 1JK9B 1I1FA 2RMNA 3DMMB 3CBRA 4M7LL 1J1PL 2AEPH 4R5VA 4ZQKA 1WRFA 3UACA 3FQRA 2WXFA 5C08B 1NAML 1R24B 5I6PA 1FH5H 3LOWA 4GSDH 3I9GH 1MFNA 4HEPG 1SLXA 3NP3A 4S0TD 5LGKA 5B1BB 1MRCL 3GXDA 1EO8L 2ZSVA 4KVNL 5T1KD 5D7IE 5AOKA 1FO0A 3SKUD 3QPQD 4HJEA 4ETQB 3QJTB 4GBXC 2BX5A 2B08A 2BM3A 3NK4A 4XHJD 5BV7L 3BP4A 3FQTB 3HE6D 4LNRA 2W92A 2Y07L 4QCIB 1IBYA 3JV0A 4NWUL 3Q7JA 4EBQH 5L2KB 2P42B 3FZUC 4NZRL 2A9DA 4MNGA 4NHCL 1WWBX 3IXTA 4PWHA 5KVEE 1BBDL 1YMMD 2ZUVA 1QFWL 3MRFB 3FMGH 3SOBL 3T04D 1NIFA 1U8HB 4BFIB 1I1AB 4WO0A 4X5XA 4XMLH 2A38A 4NQCD 1Y18A 3IMVA 4D3CL 5JXEA 1YNKH 1UM4H 4IRJB 3SYAA 2NY6D 3UBXG 3T0EC 2OYPA 5T3XE 3MGTA 5I1HH 3Q2WA 3A4EA 3RJQB 5DS1A 4XNZC 1HHHB 3UC0L 5AQ0A 5IMLB 3AG3B 4WFED 4KJWD 4Z7QB 3U4BH 2GJJA 1RQ5A 4KVCH 2CJUH 4QTHB 4PVMA 3RU8L 4L05A 3VXQA 1BG9A 1D9KA 4D0BA 4JHAL 2OXGA 1ZTXE 4HDIA 1ZWIB 1HU8A 4PCYA 1ED3B 1R75A 1CLOH 4UYPA 3G6JB 1OAUH 2ZOKB 4Q9QH 1G87A 4XCCH 4RCAA 2I7SA 1VEMA 3FN3A 3TN0B 2O61A 3O9WD 3GNMH 1WC7A 2XX0A 3I02B 4TNVF 3SBWA 4AXWA 2AQ1A 5DMYA 4YFLF 2CZNA 1NGPL 2JQAA 2WLZA 2ZZUT 3BSHA 3CLFH 4RAUB 5FYKD 5ID1B 1AZNA 3MLYH 2MHAB 3WN5B 1ANUA 1I7RB 2ZE0A 3ROLA 5T1JA 5D7JD 4F15B 5AOLA 4G7VH 1TYEB 1UZGA 3CXHJ 5TD4A 3HMWH 1ZV9A 4IU2B 5IK3B 3RWFA 5B38G 3PUUA 5CGYD 3ULSA 4POUB 3EO1A 3ZT7A 3VE0B 2UY6B 2K6ZA 5I2IA 2WLNA 2WXQA 4YN3A 1GGUA 5IW6A 3T6ZA 1BM3L 5J3HC 2OSWA 1SDDB 4KDTC 2O72A 1SN2A 3HW7A 4HSQA 5BVPL 3EO9H 1M2OA 2VUKA 2K78A 5CUSH 4GMSL 3ARDB 5DJCB 4AC2A 4U6XA 4RX4A 2OYKA 3ECWA 1T7VA 1KNOA 2OMXB 1I7ZB 1VACA 2PMZA 3SJVD 2Y2WA 4M4PA 4Y1TA 1XCTA 1G7MA 3FB8B 1GC1C 1HOCA 3DIFA 4R90L 4TULL 5EUOA 2YPVH 2ZX9A 3VVVA 1V55B 2NX5E 3BIBX 4JM2D 5HD8C 1P6FA 4ELMA 1Q9LA 2W80C 3LH2L 4JG0L 4RVBA 4U4BA 3WY4A 5MI0C 1NANI 3HZYB 4CN1A 3FFDA 4LP8A 1R3HB 1T4WA 2UWEF 3QUKA 4K4KA 3VWJA 2WXKA 4WEMB 43C9A 2J1ZA 4NUQA 2CXGA 2H1XA 3LIZL 2D0GA 3O4LE 4YHNA 4N28A 5FR3A 5D72H 3ILPB 1U41A 3BDXA 4JZJB 1KCSH 1CD1A 5ADPL 4EI6B 1Q9OA 2EDXA 4HPOH 4ODSH 3GMRB 5C0CD 2BWQA 3II2A 1D6EB 1RZQA 3NACH 4NPKA 4KXDA 2QVIA 3KYMA 3US9A 2ZYHA 2IGFH 5BRZB 4Y4KA 3UTSD 1MIEL 1FJ1A 4G7QB 1SBBA 2IXQB 5C0BD 4JRWA 1CGSH 1MHCA 1NDTA 4R4BA 2V8LA 1HAUA 4MJJA 1SJMA 5K69A 4JFED 1BZOA 3L3DB 3ZSTA 3VYPA 1JZFA 1CBVL 1QSEA 5DC2A 2CIKA 1DVQA 3WJJA 4MNQA 5J6GA 4HJ0C 2ZSWB 4OCRL 4GRLC 4MD5A 1ZTXL 1XD1A 4Z7UE 2G4GA 1I9IL 2MQ3A 1R5IB 5I1AB 4WJKB 4JVPA 1E67A 2YEZB 3RP1A 1DANU 4XMUA 4HUXA 5K9KA 2AQNA 2YD7A 3SPGA 3D6GA 5GGRA 4OT1L 1IQDB 1RSYA 2R0LH 3LMJH 5E2VL 3VG9C 4R0LC 3ARRA 3HTLX 4U1JB 1HXYA 4LCIL 3KLKA 5EFIB 1T22B 3VXUA 3X12B 3AGVA 2BY3A 4AJVA 3MRRA 2NY4D 2CR6A 1CXLA 4JNXA 2X4NB 1UD5A 1GGYA 5D6CA 4B9GA 3C6LB 1B0GB 1VIWA 2MOQA 4KK6D 4M4RB 4M6MH 3I9AA 5FOBA 2CLZA 2MTAA 9CGTA 2DYRB 3OD3A 2L7JA 3RWJA 4MS6A 2W1NA 5A2KH 1I8LC 2EEFA 1CDCA 1JV2B 5SWSB 2YN5A 3IFLL 1RERA 4XAWH 3QEQD 4Y4FC 3SKNB 3T71A 4G1MA 4PRPA 3V0HA 4NYLA 2HRHA 2ZOLB 5C1MB 3QZWA 2J43A 2VDOL 1AKJA 1WCQA 3EJTA 4F5CA 2Q7YA 3IM1A 3WFBH 4I89A 3JV4A 3ZDXB 4M56A 4ZMNA 3FUMA 5E94B 4KI1A 4PP2A 2D03H 4PLJC 3FT3A 5HI5C 4KH2A 2SODB 3G6AB 1PFCA 2QVFB 1SQ2N 2EDYA 4I0CC 5C09B 4K5LA 4MKMA 1TTRA 5KVGL 2X9XA 2X4PA 3AQDA 3DV6A 1VFOA 1K72A 1DQQA 4XP6H 4XNBA 5IROA 1QLRA 1KIPA 3W9DA 2F61A 4UQ9A 4N4YB 4Q89A 1ZLVK 4XVSL 4DK6A 2YXMA 3MRQB 4GAJL 4LLAA 4YBLB 3IJYB 3QFDB 5DMJB 3TCLB 1BMWA 2LT9A 4PJFF 3MUZ1 2EXSA 1QI5A 3FC8A 5FC9A 3F05A 2JFCA 4EUPB 1CPUA 5CEYA 4RWYL 1T20A 1OP9A 2G5BA 1SEQH 2WLLB 4RAVA 2F8XC 1WHOA 3GRGA 4FLQA 5HHPA 2C9QA 1I8IA 4ZTPH 1O5PA 2KS0A 4JHWL 3QIBA 3RUGA 2DWDB 1DSWA 1NM9A 3GTVA 4KXBA 4AZUA 3IDNA 2GJZB 3MCG1 2EH8H 4XVTH 5D71H 2PR9A 3DYMA 4UI2A 1Q4NX 5B1KA 2VQUA 1AD0B 3SIKA 1BJMA 1OARL 2X0UA 5GRXG 3U6RB 3VA6A 2DQDH 2Y36H 1ZHLA 1NC2A 3QJZA 4PWKA 1GGBL 3GRBA 1DL7H 2R2BB 3AMKA 3FSZA 2CGZA 3UG4A 5KSAB 5HHNA 3ZU8A 3II3A 2XWTA 5CAYB 5LXGH 5AENA 1BECA 2DQIL 2EC8A 1KN2H 3G5VB 3GJFK 4M6NL 4L3CB 4XP5H 1ZLWH 1CYXA 5DJXB 3RVUC 3WYRA 5HHVH 1FFOA 1JK9A 3DX6B 3DMMA 3KPRB 5DK3A 4OF8A 4W93A 5C08A 1DQLH 2WZAA 5JW4R 2IWKA 2Q86B 1NCCH 4ZOBA 2IMMA 2NNAA 3SY0A 3NFNB 4M7KL 2WK2A 4G59C 1JV5B 4ZS6C 1JP5A 3EG9B 5EZIL 3PHSA 3GZOA 4ISVA 3GINA 4M6AA 1NANH 4XCEB 4L4VA 3EBHA 5DTFB 3ALPA 3HPJB 4HLEA 1XF2B 1A9BB 4I18B 2DN7A 2CRZA 4TN9A 3MV01 3V0VB 2AJVH 1Q9WB 3R18A 5L2KA 4EKXA 3VUAA 3LKPA 4X99B 3PF2A 2AJYH 2VH5L 4MSWA 1WAAA 2A6DB 2VYRE 4KKBC 3MV9D 2LTQC 3MRFA 2CR3A 1AACA 2FB4L 3RUGF 3PWPB 4DPAX 1KJMB 5C70A 4BFIA 1TEGA 1I1AA 1ECZA 4L8SC 4I0PD 2ORBH 4HK3N 1N19A 1FYTE 1CDBA 1J5IA 2Y7QB 1A64A 3BUYB 2QKSA 3EBIA 3IE4A 4P05A 2EAEA 3ZE2E 2Q5BA 1P4IL 2ZXQA 1Z1WA 3QORB 3N9GL 3HBPA 4LB8A 5ESAB 3ZYJA 3LRGA 3HC3L 4ZFZB 3RPIA 3QFGA 2G2PA 3MGAA 1L6XA 2O6EA 2C1PA 2GBAA 3QRLA 3KWWA 4D9QE 3CSBA 4WSJA 2WPGA 1YG9A 2QFPA 3ARBB 2WY3B 4FQHB 4QTHA 3GMMB 2Y1ZA 1ZY9A 1CD0A 2BSRB 3VGEA 4QJ5B 4KUZH 3ISWA 2HTKC 3P30L 1ZWIA 4JCLA 5FM8A 1I7UA 4HJGA 4H8WL 1F02I 4PCKA 3GLZA 2K3TA 3SPJA 3C9NB 5F9OH 1TNNA 1U21A 4PWFA 2V3DA 2B3RA 4BK8A 3WJMB 5B3JE 2Q9OA 4HGWB 5J57B 4RRPM 5AG8A 4ZX6A 2UY7A 4PY7B 1JF5A 3RHWF 3TEWA 3WLBA 4EZMA 1KB3A 2XWEA 5BQ7B 4CKVX 5ID1A 2HT4D 3VWKA 1I7RA 4RFEA 1NUDA 2X2HA 2GJ6D 3HRZC 3H55A 4LSUL 4FGMA 2H2PD 4IU2A 4YH6A 4N8VG 4Z7OE 2WZ0A 4UAOC 1K5NA 1EH9A 4UIKH 5BZXA 2GT9B 1QLEH 5A16B 4PJEB 4DQAA 2C5DC 2FGWL 4M5ZL 2VR8A 4LIQL 3ARGC 1F58H 3BPOC 1HYSD 5INCB 4JHVA 3NH7H 1FHGA 1BD2E 1IBGH 1RURL 1I3GH 4LKCB 1SDDA 3QUGA 2A83B 5K33A 1J5HA 4CDHA 1WQVT 3FO9B 4NKMA 3I6LE 5GS1B 1SOKA 4OCXL 3X13B 2OW7A 1ES0B 4W4OA 1AC6A 4R26L 4HEPA 1MJ8L 4PV8B 1BX2B 3PDDA 5DJCA 2R9HC 5I76B 1YC7A 1I7ZA 1GGIL 2FD6H 2NY2B 3DO3A 3F8UB 4EI5B 3NFSH 4QRRB 5JOFB 3GKWH 3U2IA 2AK1H 1I8MA 1N0XL 4E9WA 3LNGA 1MOEA 4WNSA 1AQMA 5ITFA 1CLZH 4MMZB 2Y5QA 4PRNB 2C4XA 2DKMA 3V6ZA 1FAIL 4DVRH 4JRYD 4DWHA 1KXVC 1JZEA 2VDMH 5IZ7A 3HZYA 5FM4A 1ZV2A 2HFTA 3C2AH 4CC4A 5F1KC 2XVKA 4WJ5B 4AV4A 1KXHA 4ZQTA 4JRXE 3LH8A 3W0WB 1OD7A 4PBWD 5FOJA 1IC4L 3ZQXA 1YPZB 1DFXA 2W59A 4U05A 3W2DH 4U3HA 1JGUL 4XBEL 2F1EA 4CRPA 4TNVK 3INUL 3UBXA 2VN5A 2EDEA 2DWSA 2IPUG 1B4RA 2IH8A 5CKAA 1S9XB 1D5IH 3L7EB 2FQGA 3Q9QA 4N2GA 3GMRA 3DRQA 4TM9A 1D6EA 4NQSB 4S0SD 1OXYA 3GYRA 1JGEA 1QX1A 2J4WH 2CO6B 4GG6A 4OLXL 4MJID 4AENA 4DGYL 4ZFFB 3OMZA 3BWAA 4TQEH 4XP9L 2YLKA 4XCYB 1QYGH 1PAMA 3M7FB 3B7SA 3L3DA 2P5WB 3A22A 3MV8D 4NC0B 5T3ZE 4FC3E 3B8SA 3GLAA 5D7LE 3TBVB 4WK4B 2E75C 5IFAH 5DD6B 2VR3A 5I1AA 3P4OB 1NFDE 2I85A 3V10A 2D7QA 3U7AA 8PAZA 3GBNH 1NLDL 4XPBL 4HOMA 2BP0B 1CFQA 5MEOA 2Z92B 1A4AA 1WIUA 2H5UA 1AE6L 2PCPB 3MRNA 1WWCA 4JN1L 2OSXA 4M5SA 1IKNA 1RZJL 3RDTA 4A68A 1QR1B 2B5IC 4IRSB 1T4KB 5D2LE 3GSQB 1NPJA 5SWZE 3SGKA 5B38A 4HJ1A 1XSIA 2YFOA 2J2ZA 5EFIA 3X12A 5KS9E 4ZMYA 2LQRA 4FQ1L 3T2LA 3ABLB 3IETB 1JZ7A 2JK5A 1N64L 3C6LA 3L1OL 3SDCB 5EOQH 2RA1A 3A4AA 3BQUB 4MA7L 3UCRA 3AT8A 3IWVA 4P48A 1CUOA 5LG6A 4R7DB 5EOTB 4PJ8D 5J13C 4EZKA 2RD0A 3WXVL 4J3UA 3V6OE 1YMHB 2ZOLA 3WFDH 4GG6F 3FFCD 2I60L 3ARFA 4KO5A 4KK8D 5K93A 3U0PB 1C5DB 3T6XA 1ID5I 3IMTA 4QPEA 5I6XB 3FXIC 3H3PH 5I5JA 5ADOH 2XU9A 1MRFL 2Q8BH 4OJCA 4LSRH 2YBGA 4X4ME 1MEXL 2VDPB 5AAWA 5C09A 1OV8A 3VRLE 4UQ3B 1JHTB 3D33A 1OF2B 5FHAH 2P8MA 3R7RA 1CGVA 2EDTA 3DOIA 5DHVH 3H2WA 3MRQA 5FO9B 3IJYA 1VZHA 3TCLA 3IRCA 5I1JL 4LKXB 1S7VB 2A7BA 1WTGT 4EUPA 1NC4A 2WXGA 3AY4A 1INDL 2WLLA 4L1DA 1GH7A 1XGPB 4OKVA 1DLHA 4JZNA 4AGLA 1UWYA 1DLFL 1D9KC 1DQMH 1LO0L 4OZFG 1AHWC 1T2QL 5BS0A 3T3MB 4ABWA 1CFVL 2E3VA 1HYRC 5DFVD 1QVOB 1YUHB 4H8PA 1JF1A 2VERN 4XC1L 4OZIB 1KGXA 2M83A 1BQHA 1NMAL 4LOUC 1AD0A 3L3HA 3SBWC 5A43C 2DAVA 1G9EA 3U6RA 3SOTA 2E9WA 2YC1B 1RVFH 3EJYC 4DW2L 4IOFC 3PNRB 3M45A 1OAZH 1PJ9A 2APBA 2V3EA 4KAQL 5T3ZL 1P9MA 2L7QA 3MRGB 2HX7A 4NZFA 1SYVB 1FE8L 1S8DA 4XNQA 1LDSA 4HSAC 4MAYD 5T1LD 2VUYA 4DOHE 3S2AA 4QHUA 4RZCA 3KH3A 1D2OA 1SJVA 3EFFB 4E0RB 3G5VA 4RMVA 1ZRUA 1EEUA 1YEIH 3B7RL 4N24A 4P2QD 5CCGE 4QEGA 1KY7A 3ZO0A 2XXGA 5I8KH 1A3LL 2X42A 3DX6A 3K8LA 2EYTB 1G7IB 1IBHA 3KPRA 3B9KC 3S3DB 3VXMB 3STLB 2F19L 2X3AA 3L3GA 2CDEA 3ALWA 3OZ9H 3CGTA 4L2LA 2ADFH 2MSPA 3VNZA 4BBWA 5AL0A 3LQMA 1S3RA 3EG9A 1I8UA 2GSMB 2PLTA 3IMBA 3UTZB 5I24A 5FGCE 5KG9B 1L0QA 2WZ6A 4DP2X 2CLVA 3L4XA 5DTFA 1TQTA 4UOQA 1DJYA 1IL1A 2J5WA 1XF2A 2KZKA 2OX5B 4I18A 4GXVL 4DKDC 1ETJA 1TETL 3TT3H 4I3GA 4XCNB 4MZRA 1NCDH 5F6IB 5CNHA 4QF1B 2XETA 1OK8A 2A6DA 4GO9A 2CUIA 1E5BA 2O4EA 4N2KA 4FCHA 3PWPA 1KJMA 3JXAA 5KYYA 1GHFL 4RRPA 2J6EA 2XWXA 1L0XA 3SDDA 1G0XA 5KYUB 2RJMA 2JKTM 3VG0H 1JOIA 1JGDA 2DYPB 1BWWA 2Y7QA 3BUYA 4B7IA 2NXYD 2XBDA 4M93C 3HEIB 1IILE 2XA8L 3QORA 3CFBA 2P8PB 4I1PA 1FZJB 4ZFZA 4L1LA 5I8OL 2CO4A 2AC0A 4FNPA 4JKLA 4Y4KC 3R06A 1A6ZB 3TT1L 1SZNA 3KLAA 2Z35B 1X5AA 2BSRA 4OFIA 4TYUA 2VLJB 3WI9A 3EJZD 3U1PA 3DPDA 5IB5A 1W72H 3RQ3A 3HS8A 3HN3A 4PMEA 3ZGIA 1JTOA 2P48B 3QDJA 3S4SB 3MRPA 3WJMA 3D3VD 1FFQA 2VKWA 1HH9B 1UZ6F 3QAZB 1HZLA 3MV7A 4L48A 2FEEL 1WVZA 5TDOB 1PX4A 5BQ7A 1B88A 4CMHC 2XDHA 1CBJA 5EO9B 4NB7A 2CKBL 3CBKB 2PXYA 5IB1A 5DZPA 1WZ1H 8FABB 1TITA 1RUAH 2WLIB 4FQ2L 1E5ZA 1E4XL 2JB6B 4OLVL 2GT9A 2MCAA 1XB3A 1GRWA 1WZLA 1ZT7B 2X5PA 4PWJA 4UINL 4UM9D 5I5MA 4KO7A 4ONFL 5F6HI 3IU4H 4Z0XA 2A83A 4X8XA 1J1OH 1LNUB 4P3DA 3FO9A 3TBBA 5GS1A 4LBEB 3GMNB 3WIIH 4NUPA 3MVSA 3OZLA 4NUMA 3D8MA 1W9XA 4PS3A 2X4UB 5AW3B 4XPFL 5AOZA 2QSCH 1REIA 3S35X 4ADIA 4UZGA 3I75A 4JKPH 1UATA 4NWTL 1OTUD 5J12C 5CCHE 4X4YB 4QRRA 4X4XB 2CIIA 5E6RB 2J8UA 1SRDA 4IGBD 5FLUA 4MMZA 3MLUH 5J06A 2MJWA 1U8OB 4GKSA 3QRBA 1B3IA 1E2ZA 1T89A 4M7LT 2WLYA 3AAZB 1A7QH 5K5YA 3RL2A 1MW2A 2IBGA 3L9EA 3SKMA 1RHHB 1OALA 4BQ8A 1OWWA 5IROC 1KB9K 3W0WA 4HKZA 5E23A 5DEGA 2EADA 5L9DL 4K2UH 4YDLB 3ZDYE 2F5AL 2GI7A 1KCRH 2VDKB 1MWAL 3BKML 4HJSA 3MRLA 2VDRL 1HHIB 3LQAC 4ORGB 1H6UA 5FUOL 3RGHA 25C8L 4OFYD 4N0UB 4OIIL 1S9XA 2F9BT 4ZW7A 1BXVA 2DD8L 3B2XA 3DJRA 2DQTH 5EBWA 1GZPB 5BZDA 4NQEA 3MR9A 4OM1H 3ME0B 2XZAL 3N85L 4G9DA 3QIBC 4XCYA 4KPHH 1U95B 4LSQH 5F1NB 1HKFA 4DFHA 5KYWB 2C9XA 3EH3B 3DUUA 1PZSA 1BLNB 1U58B 2EDOA 3D48R 1BFSA 4KJPC 2APSA 2Z9TA 1LQSR 5KSVB 3AZUA 1LO3H 4HWUA 3S5LB 4P4RB 1A7RH 3TURA 3UC2A 4M1DL 3ZZLA 4Z7WE 1WS7A 1JG9A 2OMNA 4YSTA 4KGLA 3BRFA 4KZEL 3RVVD 3Q5YA 2XY2A 2DZEA 3K6SA 3Q5TA 4OZFH 1XH1A 1KB5H 3SGEI 4ZMAT 1F90L 1OY3B 4GINA 1WICA 4TQPA 4HAKA 2ZP0T 1WBYB 5GJSL 4QRUA 5GGVY 1ZA3B 2WOBA 1BVZA 3GSQA 3MLRH 3F04A 1GGCL 3FRPG 5ESVB 1AFVH 4QO1A 1VENA 4UT6A 3KLQA 2FT8A 1S7TB 3M1BB 4AC4A 2NDGA 4M43L 1KJ2B 1MRDH 1F13A 3MOAL 3QRGL 4JPVH 5DWUH 2J5LB 5K1VA 1UB5B 2EVHA 1MFCH 2MRYA 3BYTA 5CR8A 5LGJB 3HS0A 1Z9SA 1I3VA 3AG2B 1T1WB 1BBJB 4G5ZL 4P5KA 5D1ZD 5E2TL 1BVKA 3GXPA 4JHBA 4LZKA 5EOTA 4XI5D 1OIOA 4JFPB 4OZHF 5MENA 3NDZE 2VISB 1YMHA 3FQ1A 2XXMB 4U1HB 2DQCL 5FYKL 4U1NA 3OC5A 1E27B 3QR2A 7TAAA 1F00I 2Z1PA 2KYIA 3UAJA 3GFUA 4E41A 5IP4A 3ILEA 4M62L 4OM0H 1I1AC 2F2HA 3NK3A 5A2FA 3CUPA 2XG5B 5F7LB 3NOIA 1LE9B 5EOQL 3M7OA 4FFYL 5DHMC 3HMXL 4GBXD 3CK0H 3BGAA 4NFDA 4HZ1A 1M7DB 1Q72H 3FZUD 3QPXL 5I6LA 3CZNA 3MNVA 4P5RA 4NI3A 1LMIA 5FWRA 1ASOA 3MDJA 5D55A 3BP5A 1F6LL 2C9VA 5C07A 4FMKA 1ECYA 2VLLA 3CWGA 1R3KB 3MRDB 1NJ9A 3T0ED 1UM6H 3BD3A 3RURA 5I5IA 5IVXE 3BSZA 2JTYA 1CU4H 2ZUQC 4TNGA 4L2YA 4OGYL 3VB8A 5JIPA 3L3OB 4EI5D 4Q4IA 2AJUL 2CHDA 4FQQA 3ZE0F 3U1SL 2X1PA 4CKQA 3Q8AA 4FLRA 3SBRA 3SQOL 2YC1A 3P3UA 4KX7A 2VXSL 4YHLH 4AKPA 3MRGA 3N42B 3VWKC 1SYVA 4PY8I 3IT8D 3FUNA 3FTXA 4F15C 3D85B 1MCRA 4H20H 1YYCA 4MCYA 3O2DA 4OVUA 2FATL 5EHFA 4LCWD 5IBTL 4NM8L 4B60A 4O02H 1KGIA 5BOJA 2COVD 4AMKH 5DD5L 2FUTA 3EFFA 5DVPA 1OQXA 2FJHA 5DEFB 4ERSH 3DK2A 3D07A 3QDMD 5A2IH 3ARED 5DD1L 3CFUA 4WFFE 4WUUB 3R4DA 4U3SA 4X6DA 1ZLUK 3S97C 1T6BX 3VI4E 4X5PA 1JK8A 1G7IA 4BZ2H 3VXMA 1ZMYA 1JZ2A 2WD0A 4ZXBC 3UGEA 4ZMXA 2MNJB 1N6QL 3AXLB 4W4OC 4IDJL 4PJIB 4JFHE 5E6IA 4MMYB 2NXZC 3PLYA 4ELME 3ATDA 5LVEA 3LX9A 1X5KA 3QCVH 1XH3B 2OBGA 4LSDA 3OR7B 4DO6A 4JLRB 4N26A 4D9RD 1UWGL 2I69A 1N5AB 4OB5L 1ZLWK 5J3HD 3W1ZA 1SY6A 3KL3A 4W9GC 4U2YA 4XCNA 2L4OA 2C7UB 3LPWA 4PJCF 4UQIM 3ULUC 3IFNH 3U4AA 1IGCL 4GB9A 1B2WL 3JTTB 4CC4C 2FDBP 3B5HA 1WBXB 5FK9B 1W15A 3BESR 5K9JH 4PREA 4I77H 4OKDA 5JW4M 4PUBL 1SLUA 2YGNA 5KYUA 3ZQ9A 2DM4A 3ZR6A 2F74B 2VZSA 5GRYA 4XGZB 2GCYB 4G8EB 4PJHB 4S11A 5HD8D 4LPCA 4OCWH 2JE8A 1FL5A 1NEPA 4BFOA 2R1XB 2JB5H 2R15A 1BHGA 1BEXA 3LRMA 3LKSB 3T09A 2HPOA 4LQFH 3UMNA 1S9VA 4PJBF 4JVWA 4PJAB 5I0WA 4UTAL 1QSEE 4NM4L 3V9EA 2R56H 4MNQE 3QCUH 4ZTEA 3VFSB 4FFZL 3G7TA 3WBDA 4LARH 1A6ZA 1XXDC 1FORH 1D7DA 4EKJA 2BDNH 2AZAA 4LPXA 4UNTA 2Z35A 1CZ8H 3VSVA 4OQTL 2VLJA 2X53A 4NUJB 4ZAKA 5FECB 4OZFA 1RJZA 4X6DF 5ICXB 1MCCA 5CHNA 1KB5A 5EBLA 3SGEH 2YAOA 2KLRA 4NI6A 4F1SA 4EVNA 5IQ7H 4L8DB 2WMPB 1FN4B 5TDOA 1H8NA 2XPGB 4GIOA 4YHIB 4FXLA 5GRUL 3VXUE 3L2LA 4E9LA 3C6SB 2CK0H 3UXFA 5SX4I 2UZPA 1UEYA 4NRZB 3SEPA 4KJQD 3QO1B 4HJ0D 1IKNC 1WFUA 3RDTC 4GRLD 4LESA 4HUUA 4OW6A 5TE7L 3SGKC 2M2DA 3D69A 3UERA 4N20A 5EC2B 2XLLA 1ZT7A 1CLCA 3VA2C 5J1AB 4QHLB 1H15A 1GW6A 1UQSB 5H2BB 1JPTH 1BEYL 4N1CA 2FVNA 3K4AA 4LBEA 3MACH 4WNJA 1VGEH 3QZBA 4OJFL 2FWOA 2FJUB 2K4WA 1O9ZA 3NJHA 1XF4A 1R5VB 3CXDH 4PRHE 1QRND 3QVAA 4X4XA 3X3FH 5BMFH 4GS7B 5TE4L 3ARFC 5HXMA 1C5CH 1T2XA 3TBSB 4G5AA 3AWGA 3QNYA 2E27H 1U8OA 2CPCA 4G6KL 1JNLL 2HYMA 4FZEH 1K8IB 3Q3GA 4Y4FD 4KUCF 5AAWC 3UTTD 4DN4L 2AS5M 1P2CA 2WO2B 1T1XA 2ILLA 4N0FB 5GISH 5JDSB 1XSOA 4PJFB 3PE9A 4WUKH 3R1GH 1EFXA 3QQDB 4ORGA 5DC4B 1E43A 5HI5D 3RWIB 4KXZI 1EJOH 4V33A 4K8RH 2OMUA 3R0MA 5CM1A 4Z77A 3A3YB 4QXUL 2R0ZL 2K8QA 4I2XB 4ZK8A 4G43B 4R96B 1DCEA 3ME0A 3PABA 4HCRL 3RNKA 2DIBA 2BSTA 5EB9A 1XF5B 5DZOA 5ENWA 1HFUA 5K9QG 1K8DA 2X6BA 3EJCA 1LEIB 5SX5H 2Q87A 1SDYA 2OJEB 5I1KL 5HHXH 1U95A 1D5BB 3A67L 3ZDZF 1F11A 3T8MA 3BZ4B 4Z3IA 1X7TA 1G6RL 1MDAA 3DGGB 3ZYOA 3LXUX 1QSFD 5E08L 3S5LA 2HUEA 2ESVD 4LXFA 1BGXH 3RNQB 5HYJD 4IBWA 1ZVYA 3S8WA 3B6SB 4OGZA 4AYMC 4NAJA 2OYMA 5C08E 3K6NA 5GGVH 3PQYD 1UC6A 1B4LA 4PTUB 5FDYA 4R4FH 1WBYA 4NLAA 1BA9A 5C8JB 1MUJA 4HKXB 4RAHA 1TEYA 3M1BA 2WLMA 1V7NL 5K9QI 5DMIL 3ATAA 2YD4A 5BZWA 4HF5L 4ZFOB 1UB5A 4HS6B 4C56B 2MNUA 3BYYA 3OF6D 5L2KE 4HZAA 1GY2A 4YXHH 4L0YA 3FQ4A 5LGJA 4WTWA 1FG2B 3IKCB 1WAAE 2NUTB 1T1WA 2Y5EA 3MLWH 4LEOB 5EIVA 1IBZA 4HQQL 1T03H 3RVUD 5CWSA 3FO1B 3FULA 1JPGA 1KZQA 4TSAL 4I18C 4Y1AA 4OCXH 4LGPB 2B39A 1Z0NA 3DJSA 1BQRA 2CUHA 3UYPB 4ZS6D 1CFNB 1P7QB 2GSGB 2JI3A 1RZKC 3V7MA 3GWJA 3VH8G 3EO0B 5EOCL 3EDKA 3WSQH 3MJ9L 3OAWA 4ADJA 4LSPL 2WXIA 3FYEB 4E5XG 3R8QA 3SDDC 3C5ZB 1HKLL 4Z7QE 2IALB 3AB0B 3ZW3A 5IESH 4P4KA 4G8GA 3MREA 4RSYA 3B2VH