3CLEL

Hiv neutralizing monoclonal antibody yz23
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVMTQSQKFMSTSVGDRVSISCKASQNVGNIIAWYQQKPGQSPKALIYLASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYSSFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title HIV neutralizing monoclonal antibody YZ23
rcsb
molecule tags Immune system
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cleL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cleL01
3S36H 2AI0H 4KI5F 3VD4A 3OKLA 1R5VB 5MP6H 3IFNL 4FQ2H 1JF1B 1W0WA 2EC9T 4X8JA 4EIZC 5I19H 3HE7D 5KSVA 5D7KD 4EDXB 3QZWB 2H2PC 3D39A 4N68A 5EU6E 1U3JA 1U3HB 5DO2C 1CFQA 1FGNL 4R7DB 2D7PA 4LSTL 2FD6H 1A9BB 3B6SB 4KKBD 2E6QA 1Q9WA 4YXHL 5EU7E 3VDAA 4K94H 1KC5H 4YHIB 4DW2L 4F7PB 2ATPA 4D0CB 2APFA 4JQXC 2FJHA 5IKCA 2VR9A 2RFXB 1OLZA 5E08H 3O3DB 1SJVA 3QXVA 5KANG 5JNYA 1TIUA 4LGRB 1QNZH 4QO1A 4EBQH 4N8VA 5IMMB 1AJ7L 4LP4A 1LK3L 3MNWB 1Z9SA 3VJ6B 4L1HA 4GMTL 3MNZB 4WGVB 4Q2ZA 1MAMH 2P8MB 3AXLA 4JZNA 5F7HA 5KOMC 3BJ91 4OZIA 1WAAA 1EHLH 2XG5A 4WUUA 2Q8BL 5D7JA 4TVPL 5DQ9B 2Y5TA 1RZ8B 4NKOB 2ZG2A 1CLOH 4MA8L 5ENWB 2C3GA 1XF2B 1X4ZA 3MYJB 3L9RA 4XTRC 5C0FA 4O02H 4YO0B 3RNKA 1UYWH 5B4MC 2VC2H 3F7PC 1BX2B 4MAYC 2EDQA 1JMXA 4X5XA 4DKEL 5HYFA 3GSNA 3BAEH 1FC1A 5JO5A 4MJIA 2F74B 2X7LB 3QUZC 3KYMB 5FB8A 5FYLD 4MNHA 3VXPB 3SO5A 1DUYB 1SVCP 3H9SE 4GUPB 3CFDA 5A2FA 1Q8MA 3U9PL 1OGAD 1C1EL 1IM3A 1RUAH 3AS3A 3LMJH 4NQXA 1TZHB 3SKNB 3L7FB 3TEUA 1HH6A 5EC1A 1DANT 2AJXH 2QJDA 2CDEB 5JMRA 3IJYA 4A2LA 4NJAH 4WI4A 4WUKL 5IFJB 2YD1A 5D2LA 2JJSC 1XF3B 2BFVH 1NMBH 5INDB 4U2YA 3ZE1E 4K2UH 2HN7A 4V1DA 3U30B 4UV7L 5IV2A 5TQ0L 4ZUSB 5JR1L 2LABA 1BOGB 2VE6A 4OZGA 4Z9KB 5IB1B 4POUB 2H1PL 1GPOH 2C1PB 5D2LF 4R4NC 2VTFA 3TN0C 1FZOB 1MEXH 1OSZA 4Q6IC 5KVGH 3NABH 3AREC 3IF1A 2ZUSA 3QUXB 3PXHA 1KJMA 1OB1B 4HF5H 4NKMB 3RX8A 1FL3A 3OJDB 1T7VA 1P69B 1RZJH 4WHYH 5E6IA 4BA8A 2BXZA 5CLTA 3KPMA 2BRRL 4Y16D 3VRJA 4FQQB 5D2NC 1WZ1L 2VZ3A 4PJHE 3RX7A 2CIIB 5FF6A 4YHZH 3QXAA 5FAAA 5JORA 3T2NH 1F4YL 4PJ8D 2GUOA 2D3VA 5LCVH 4JO1H 5E4IA 5JHLH 1F3DH 3HNTH 1WSST 4CMHB 5DRNB 3FFDA 3U7WL 4JPKL 2ZOLB 3BKCH 2B1AL 1FCGA 3OKEA 4HPYH 5BMFL 2FBJL 3SCMC 1SYSB 4MB4A 3ULUF 1LHZA 3QJHA 1R3JB 3LY6A 1T7XA 1KJVB 3ZKQD 1YQ2A 3F5WB 3NTCL 3WIFB 1G0XA 1T5XA 1TZGL 1E4KA 3MUGA 1X44A 1PG7L 2FCBA 3LS5H 5KVDL 5DD0H 1QKZL 4HWZA 3VFVA 2NXYC 5AWNH 1EEZA 4HUMB 4U05A 3REWA 5CUSL 4L3CA 3H9SD 2GJ6B 4HS6A 3RL2A 1T20A 1BM3L 4X9HA 4DGYH 5DT1H 1NSNH 2EH8L 2BVQB 1RZ7L 3PIQA 4UT7L 3CLEH 1ZHNB 2UWEF 4K7PY 4QOKB 1TTGA 3IB4A 3UTOA 5J06A 5I8EB 4LDEB 3DV6A 1OSPH 2G75A 2WBJB 4FQ1H 4QHKI 1EFXD 5HI4C 3TYGL 2KDGA 3L3JB 1I3UA 3MNVA 1Q9OA 5FYLH 3MRLB 4PJ9B 3S96B 1ED3B 3U0TA 5JOFB 5CLWA 2IQ9L 2P48B 1HNFA 5GGQH 1AGDB 4LKCB 1RVFL 3KPSE 3GMQB 2YEZA 2P8LB 5HHPA 3LKNA 5HHVH 2P43B 1F6FB 1RIVH 4KI5E 5EA0L 1RFDL 4IRSD 1SMAA 4U33A 1X5YA 1QP1A 1HZHL 1CFSA 5HHNB 1XIWD 1DP0A 2UY7A 3O0RL 3WNMA 3CIQA 1FQ9C 2HG5A 5CJOH 4JEGB 3ARFD 1Q38A 2YPVL 5HGHB 5GPRA 4J3WA 3H0TB 4GRWF 2FYYB 3AB0C 4GRWB 2J88L 2Z92B 3DSFH 4Z7UB 1QRND 2IALA 3VRIA 2QSCH 3RPIB 3VFUB 4GSDL 3L7EA 5D7IA 4H8WH 1YEDB 2O93L 4YFLF 5HI3D 4FZEH 4JY4B 2R0WH 4XCNB 3BSZL 1ZAGA 2O5ZL 3WNLA 3BGAA 4WI8A 1OM3H 1UXWA 5DLML 1CGXA 4QHNB 1S7RA 4F33A 4C83B 5KTEL 3QNZA 4PV8B 1KJ2A 4JQXA 3VRLE 1U36A 2VZVA 3SKJL 4AIZA 3GJEA 2BDNL 1R5IA 5ISZD 1JTOA 1ZS8A 1EO8H 2VOTA 1B90A 3AAZB 4BQCA 3DURB 2D0GA 1K3IA 2HTKC 2J7LA 1I1AC 4U1HA 5MEQA 3O3BB 5J8OA 4P4KB 3BP6A 1R3LA 1X7QA 1JHTB 2DF3A 4NM8H 1ZVSA 1TNMA 3GGWA 4NO2B 5C9JA 3NGBC 1MCKA 2FIRT 3RWFB 2K7PA 4NN5B 1RULH 1ORSB 2GSIA 4K3EL 3OQ3B 3FMGL 2XPGA 4LCWD 3PWNB 1T21A 4JB9L 4FQCL 4BUHA 2XTLA 2AV7B 1FFNA 2Y6SD 1JV5B 3MJ9H 3MRFB 5B38G 4ODHL 3DVNB 3EO1B 5GIRB 4C54A 3O4LD 3QIWA 2EECA 4WCYL 5DK2A 3CFEB 4EEEA 2CMRH 3E1F1 1GGBL 4LSSH 1DQTA 3KPSD 1F4XH 3HNSL 2WIMA 4G6FB 1HSAB 2NPLX 5IMOB 4IHOA 2DQHL 5BV7H 2ADJB 3DX8B 4KI5D 4H26A 4MAYB 1U8NA 4JFOB 2IBZY 2EO1A 1NDGB 1CE1L 3EOBA 3K4DA 2VAAB 4E41B 3T65B 1U2HA 1O7SA 1U3HD 5CHNA 5DJ2B 4XX1E 1ACYH 4O2FA 4XVTL 3ZKSD 5KVEL 3DX6A 5IB3A 4NNXB 4RIRA 4TNWK 5TDPB 3WN5B 2JJSA 4NHCL 2JK5A 2J8HA 5I1CH 4GG6A 4PB9H 4X8XA 5EFIB 4ORGA 2FX7H 1UZ8B 2XWBA 2QQKH 4N90D 3RWEA 1UM6H 4P2RA 4FXKB 1QA9A 3VWJD 1NCUA 5D6CA 5EIIB 5A16B 1H3VA 5TPWH 3S5LB 3BGFB 1IBGH 3MV7B 4Q6IA 1FBIH 3WUZA 4ERSL 5I8CB 4NBZB 3AREA 3K46A 2DTSA 3VG0L 1JNNH 4DAGL 1OTTD 4N1CA 3RVWD 5E94B 2R4SH 3DXAE 4JJ5A 4PJBF 4Z5RA 5IFHH 4PJBB 1A7RH 4XH2B 5EU3A 3FT4B 1JZ7A 4NRYB 4TOYH 4MX7B 2CUHA 1Q94B 3LAFA 5IBUB 1J1PL 1UWXH 5F9WC 1GOGA 1HHGA 3WBDA 2OK0H 4JFEA 4HIJA 2HJFA 2C1OA 1OW0C 3L3IB 1U8KA 5C0AA 4FHBD 5FO7B 5KVFL 2VLRD 1P7KB 3MLWL 4OFKA 5I66B 3MRCB 5D2NB 4HWEH 4L4TB 4TRPH 4P2QB 5C09A 3SCMA 5HYIA 3MXWL 2GYSA 5FGCB 3RX5A 5E7FA 4WO4B 3C5SA 1G9NC 3DRTB 5D1ZC 3NPZB 1GAFH 3NAAL 4Z76B 4PJAA 3CH1A 4XWGH 1KIQA 1FZJB 5BCAA 4JY5L 1KLFA 3WFEH 3TBVA 2ESVB 1N0XL 2GJ6E 1PX3A 1CICA 4JVPA 2A9MH 2CKBA 1J1OH 3PGFH 5KOVC 4FQ2L 5MP6L 5C0DA 4JM2B 2DLFH 1AD9B 3ARZA 3UZEA 4QOKE 3EBAA 2ZCHL 4R4BA 2QLVB 3AM8A 4ELKB 4ODXA 2XKUA 2Y06H 2NTFA 1E28B 4Y5YA 5DS8A 3NCFB 2FD6L 2NXYB 2VXVH 1ORQA 5HDLA 5CD5C 4K94L 1KC5L 4I18B 3GBML 4S2SA 3NVQA 5I1AB 5HHQA 4HUWB 2GCYA 4V1DD 5MHSD 1F6AB 1Y18A 3QUXD 5DRXB 1KOAA 3OX8B 4KJQD 5JPMA 2NY7H 2DL9A 4EBQL 2GI7A 3QQ4B 2HMID 3DXAD 1NLDL 4JG0H 2VZ1A 1JPGB 4NO0A 3TYFA 5H94B 3P30H 3T4AB 1YA5A 1T04B 4L8CB 3ELAT 3MZGB 4LFHG 5GJSH 2C7UB 1MAML 1QLFA 3PQYA 3KPRB 5DUPH 3IT8D 5GRYA 3HR6A 3ZKXC 4NHUA 4QGYA 4GRWE 4BK4A 4Z7UE 4XVSH 3ROLB 2XQYG 2IEPA 3EO9H 2Q87A 5MI0B 3UTTB 5IJVB 3WMSA 3QT2A 4OF0A 1KCVH 1CLOL 1DQMH 1CD9B 2AJYH 1OARH 4ZUVA 1KB5L 1UYWL 3VE0B 5AD0A 3ULUD 4B7LA 3GMMA 1VFBB 3LD8C 5JDJA 2HKFH 4UQ2B 4ZFOA 2WINA 4APQC 4X7CC 2NXZB 1RPQA 4N1EA 3P0GB 5C7XH 4XB7A 1VKXA 3AB0B 3V6BR 3OXSA 2V7HB 2ZPKH 1QSEA 5E8PB 2J3SA 4XPGH 3C9NB 1T22B 4LQFH 3AY4A 3ORJA 4M43H 3MFFB 1RUPH 1RUAL 4ELMA 4XNUH 3LQAH 5KSBF 3PWJA 1D7FA 2LV4A 2XZQH 1QSFB 3NCYP 15C8H 4Z0BH 3V6ZA 4G8GA 2AK4D 4K2UL 3VI3F 5KS9F 4P0DA 4PRNA 2L4OA 5JOPD 2A6IB 4P4RB 4LSVL 4PGCB 4F37K 1GPOL 2OJEB 3JV6B 3VXSB 5GSRA 1UWGL 4GLRH 4LVNC 3RIFF 3TZVA 2G60L 3HZKB 5KVGL 1TPXC 3NABL 5IT2H 3BHBA 4M5ZL 1LO3H 3HFML 3NFSL 3WUWB 4KTDL 3MX0A 3GIVB 4WFGE 4ORZC 4QYOA 1XAUA 3TBTB 4TUJA 2Q6WB 1DLHB 1RZJL 3B9EA 3VWKC 3HS0A 1CT8A 2A77L 4FP8H 4JFQA 4S10A 5DFTA 1WBZB 1K9TA 3GHBL 4HC1A 4UQ3A 1ZWIB 1MCNA 4UT6H 4E41E 4BYHA 3B9KC 1QR1B 2E3VA 4RAUB 3O45A 5CZXD 4HJJH 1JUFA 5HGDB 2VZTA 3CC5A 4JLRB 1DQLH 5DHYB 5F8QC 4J3SA 4HMCA 3T3MF 5LCVL 2PW1A 3HNTL 2PCPA 1MCEA 4PJ7A 5K59E 1FIEA 2YUXA 1X9QA 3BKCL 1QOKA 4HPYL 4FRWA 3VFNB 1QG3A 4XP4H 4YAQA 3BIAX 3P73A 3JWDC 4NQCA 1YZZA 1ONQB 5EN2B 3HN3A 1MCWM 4M5YH 3MV7E 1PYWA 5EBMB 2RCSL 5DO2D 4H0GA 3S37X 4WHYG 3MBEA 5HHXL 3P4NB 1BAFH 1P7QA 4YIQB 5IHLB 3SJVA 3I6LD 3LS5L 3PL6C 1DZBA 4PJBE 4DZBB 5DD0L 2CPCA 4U7MA 7FABH 5IB2A 5IG7B 1T2JA 4HXBL 4Y19D 3D1MC 1D5ZA 4DGYL 3GBLA 3WHE1 5DT1L 1NSNL 4L1DA 3CLEL 4HJ0C 4KDVA 2RHEA 3QIUB 1C08B 3T1FB 5LJYH 4PJCF 3ULUH 4K7FB 1CGUA 3AC0A 2D31B 2NY2C 3F6LA 1Q0YH 4OCSL 3LN5B 5D2NE 3TNNB 1DL7H 4L4TE 4AG4H 1OSPL 4P2QE 1WWBX 4FQ1L 4PB0H 1MJ7H 3M45A 4PG2C 2A73A 3TESA 5FGCE 5FYLL 1ES0B 1CDUA 2R39A 5LGJA 2ZKHH 5J6HA 1CBVL 3N1GC 4NIKB 3SY0B 4AT6B 3AFLA 3IYLW 4XPAH 1X5ZA 4PJXF 3HAEA 5GGQL 4PJXB 1KN4H 4HUXB 4OBRA 1FNGA 2ESVE 2O26U 5D1ZA 4ZG1A 1LO0H 3FAXA 4WFGD 1RIVL 2AV1B 3MO1B 5L88H 4HXAL 3BO8B 3CXHJ 4U1LA 4XTRD 4WJ5A 1OAQH 5B4MD 2ED8A 4XXDB 1IL1B 1MCPH 4AY0A 3OKMA 4MAYD 1NFDF 3BH8A 1NFDB 2YXMA 1MHHB 4E41D 4KHTH 5CJOL 4LAQH 3MROA 2ZSVA 1AO7B 3QO1B 3T1WA 1QEWB 1IQWH 2BJML 3QUZD 4MJ2A 5F97E 4HG4K 5GS1B 1KUMA 1E4XI 3EYSH 3F12A 4K9EL 4RA0C 5ITBH 3BDXA 4JGJA 3PDDA 4EN3C 1NKOA 3ET9F 3TC9A 3U2SA 3BGMA 3TT3H 4RBPK 4H8WL 4GXVL 1XGQB 2R0WL 1KSRA 2ZCLL 5DJAB 3OKNB 2QQNH 1W72A 2D4DA 3IDGA 5E8DH 5DZNA 1TCRA 4HIHB 1QHOA 4XC3H 4X98B 5IQ9A 3VCLB 3HC3L 4YFEA 2XWJA 1CLZH 3EFFB 3L3OB 1YEJH 5DZOA 3BPOC 5CBAA 1Q9KA 4P2RD 2CUIA 5KSAB 5T5FL 1BBJA 3X3GL 3RQ3A 1RJZA 4HSQA 4R4ND 1E6OH 2G9HB 4BQ8A 1T0MA 1RUKL 2DYPD 3TN0D 5EC2B 5HHMB 4F3FB 3KPRE 4GRWH 4X83A 5C0CD 3QEHA 3ARED 5EU6A 3W0WB 2WANA 1NCCH 2VMFA 4IOFC 2DMCA 5JW4N 3CSPA 4OZFB 4UUJA 2HVJA 3U0PB 5GRUL 5DHVA 2B1HH 3UTTE 5F89A 2NY1C 1YMMA 1MCHA 2GSGB 3O3EA 4RDQG 4GG8A 2IAMB 2UVFA 4ZFFB 4Y4FC 3FQXB 3BWAB 4GO6B 5IMLB 2XRAH 4ODVL 1G84A 1VERA 5JZ7C 2W0KA 4Z6AT 2JB6A 2X6MA 2I9LB 4P2QD 1MAKA 2X40A 5E8EB 1JF6A 1FVDB 3EOAB 5IF0B 2OL3H 3ZKXB 5I1LA 3MJ9L 2OMNA 4WO4D 5I75B 3SQOL 3D9AH 4OD3H 4BQ9A 5IROC 5IEKA 5C6TH 3WE6A 3QXUA 3OTTA 4ZOCA 1CIDA 2CMRL 3T04D 1VFAB 4LSSL 1MCIA 1F4XL 3LKQA 3LIZH 4N0UA 3LEYH 3IFPA 2FB4H 4KRLB 5BV7L 3O11A 5K9KA 1R24A 4G7VL 5F3BB 3JWOC 1DVFA 3IDUA 4UMGA 1QSFE 3G08B 4YWGH 2PXYC 3BN9C 4PLOB 5TF0A 1KFAH 2QBWA 5H2BA 4PGDA 2NLJB 3EYUH 5LXGL 2KZ1B 1QVOA 4D0BA 2NXYD 5I1CL 4YBHA 1TJIH 1NAKH 2DWDB 2FIKB 4PB9L 5EU5B 3VXSE 1NEZA 3QFDA 3MRQB 3MRRA 1A6TA 3TO4B 3U4EB 2QQKL 2NY3C 1UM6L 4RQQA 5CKGA 5DDHA 2R0LL 1C5CH 3JV4A 3PP3K 4DVRH 3B9DA 4JY6B 2H9GA 4DUVA 2B39A 3KPPB 2ICCA 1CXLA 2XY1A 1FBIL 4RMWA 3V0WH 2PYFA 1K6QL 4PRHE 1U9KA 1EVUA 2E8ZA 5CGMA 5HI4D 5FYKU 4JHAL 4G7YL 4HKXA 1C7TA 2EXYC 4H20H 1FO0H 1A7RL 1ZVYA 1IEBB 1W0VB 2A6JA 3MXVH 5C0NC 1D9KB 4KDTC 5D9SA 4JN2A 4TOYL 1KGCE 2GJZA 1UFUA 4Y5XA 5DD6B 35C8H 3K1DA 4PY7A 4U1MA 2NY0C 4U6YB 1WBXB 3T3ME 2OM5A 1MWAB 1JWUA 3SE4A 2APVA 4MDIB 5DJ6B 4NM4H 3C09C 1I4FA 2AABL 3T77A 4J4PA 3BPLC 3LS4L 1HHIB 4NO0D 1YEGH 2R4RH 4HWEL 2KBGA 1HQRA 4TRPL 3UBXA 3GMNA 4LRNH 3BJLA 4D2NA 1T1ZA 3EO0B 4OI9A 4YPGA 5I1IH 4CU7A 3Q6GH 3RTQC 4LKXB 3NH7H 4XWGL 5IVZB 3BPNB 4KJWC 3T8XA 3QEGH 2NW2B 2PTVA 1K8DA 2XQYK 3PL6A 1HNGA 2A9ML 1J1OL 5DJDA 3IAGC 5DRZB 4KK6C 4F7MA 1BJ1H 2DLFL 2DN7A 4QXTB 2QSTA 4WFHE 3OKDA 1KEGL 1J86A 1QSED 3ROOA 3EYVA 2Z0BA 1EH9A 4OCRL 4DGIH 2Y06L 4J3XA 3TJEH 1I7TB 1KLGB 4YE4H 1UKSA 1EUTA 3LKRB 1BLNB 2WLZA 4G6ML 5D71H 1I1AD 5IQ7H 3I75A 1HSBA 2BHYA 3VXSD 2QSVA 4F8QA 1HE7A 4Z77B 1XGYL 3KYKH 5AZEL 2FEEI 4K55A 4PJXE 1YYLL 5DA0B 4PJGA 1FG2B 3SBWC 4V2BA 5GGSY 5TJWK 4RGNB 1TQCC 4BM7A 3MOAH 2V2TA 3X11B 5ABDE 5GGVH 3TPUA 3MV8B 3S98A 4LHJB 4MA7H 4OFYD 4RRPG 5L2KA 4PGJA 5BO1H 3ZDYF 3CVHA 3FQWB 1CE6B 2A6KA 4LARH 3VD3A 4OV5A 3IXTA 2NY7L 1JHKH 4PJGF 4FQHB 1NFDE 4PRHD 1DBMH 2Z35B 3QR2A 4X6BA 2OJZH 3P30L 1AO7E 1U58A 5GJSL 4WTWA 3UPAA 3G6JA 5F21B 5FO9B 5C92A 3UTPD 2X4QA 1OWRM 2VH5H 4XVSL 4JPIB 2YR3A 3MRGB 4G80B 1KCVL 1IAOB 5CEXA 3G6JF 1DQML 4UB0H 3SE3C 1OARL 3P9MB 4NO5B 4ZUUA 3LEVH 5C0JA 3WLBB 2ZUXA 4P23B 1P4LA 1MFCH 1I3RA 3DUUA 2OSLA 2HKFL 4P59H 3MODL 2H3NB 3GMLB 5E03A 4HKBB 4YBQC 4ETQB 1FNEB 3S4SG 5LG1A 5HXMA 4EN3B 3FB8B 1JF1A 3JTSB 2ZPKL 3ARPA 4NQCD 4XPGL 3NZ8B 3WFHA 5HHME 3C2SA 5B3JF 4M43L 1TJGH 1RZKC 4RWYH 3I3BA 3RWIB 3W0WE 3U4BL 1RUPL 4KAQH 3ZKNC 1X5XA 4IM8A 4XNUL 12E8H 3ULVC 4S1QH 4CU8A 1A9BA 3UJJL 4OM0L 3QIUD 2XZQL 1Y6KR 3OR6A 15C8L 1SJEB 4TQEH 2QQLH 3HPJB 4UILH 4G8IB 4D0CA 2VXSH 1KXQE 2MCG1 1NMCC 2ICEB 5FK9B 3G5VB 5MEOB 1VHPA 1KELH 3SDAC 2JIXB 3O3DA 5DTFA 5JLZA 2IADB 2YKLH 4YC2C 5IT2L 3RWDA 5HDOA 5IBLC 1ZVHA 2DM2A 5CSBA 4HULB 4EXPX 5EBWB 1MJUH 3GMRB 4FNLH 5GS0C 1G7IA 4YHYC 1V3JA 1PGRB 3H9HA 2GFBB 5CJXA 2LU7A 3MNZA 4FP8L 4N8VG 2P8MA 4P3DA 2RR3A 5DQJB 4ZD3H 5ANMB 2ED9A 5GRWA 4LSRH 2XWTB 3M1BB 4YZFE 5IVNA 2R69H 4G8EB 4UT6L 1T6WA 1YNTB 4WDIA 3BP4B 4XP5H 4HJJL 1JNHB 2BCKA 4H25A 3UYRL 1RZ8A 1HDMA 2K7QA 4NKOA 3U7AA 1RUQL 4JCMA 2CUMA 4N5UA 5ENWA 1EZVY 3L3DB 3RVVC 1HIML 2BOBA 4PYHA 3HMWL 4Z0XB 3LHPL 2IWGA 4QRRB 1MY5A 5ACLA 2NW3B 5EWIH 5DEGA 1S9KC 4DGVH 3ZZ1A 1VA9A 1MJ8H 1T4KB 1JWSB 2F74A 1W2KT 2X7LA 4DN3H 4JO2L 1MIML 2SEBA 1J5OH 3VXPA 1DUYA 2MCPH 3MUZ1 1WWWX 4U49A 1ZA6A 4HPOH 5J1AB 2APWA 2W59A 1BAFL 4M93C 1FYTA 3KWWA 1TZHA 5F7DA 3SKNA 1MHCB 3L7FA 4Z7NF 3IRZA 7FABL 1IGYB 1XF3A 1ZKAA 5HHMD 4C56D 3QUMH 1A4JB 5FXCH 5INDA 3W0WD 4N8PA 3T2QA 4KDTA 2BSTB 4PJ5B 2GEEA 1BOGA 3CFBB 3KJ4C 4NDMB 1I3GH 5H37H 3RWCB 2C1PA 1GSMA 3MCLH 2CK0H 3NFNA 3VXMA 1NBZA 1DL7L 4AG4L 4WFEE 1ZTXH 5C0BB 4U6TA 3X14B 4PB0L 5CS7A 1MJ7L 1WTGT 4Y4HB 5L6YL 1S7WA 1Z9MA 2H32B 4NNYA 3BMWA 1F6LL 2P5EB 3MRNB 5DUBB 3OJDA 3W39A 3P0VL 2ZKHL 1KEMH 2VABA 3O6FB 3DBXA 1MF2H 1OP3H 5D1QC 1OAUL 2A9NH 3C09B 4XPAL 4X4ZA 4JKKA 3WKMH 1KN4L 2BNRD 4R8WH 3BPLB 3C6LC 1B4RA 1ZA3A 4FQQA 3F8UB 3FFCD 1LO0L 1HINL 4LPCA 3QNXA 3BZDA 3JBG7 3H3PL 3V5KB 4AEFA 4TSCH 2ZUQC 5C0RL 1NAMH 4LRIC 1PZ5B 3OHXA 4APQD 3VG9B 3QDJB 4KHTL 3TIEB 4LAQL 4ZOEA 2ZOLA 3V6OC 1NCBH 1IQWL 4KVCL 4PRIB 5I16B 1RZFH 3EYSL 1SYSA 3ALPA 1PBYA 1PKQA 5LBSL 1JPSH 1R3JA 4F9LC 1TVDA 2JELH 2P24A 3GMOB 1I8LC 1IARB 3TT3L 1RAMA 5EOTA 3H6JA 4KKAC 3DVIA 3THML 1FYHB 2QQNL 3RL1B 1FH5H 2I26N 4GFTB 5IVXF 1RZGA 5TH2B 4RGNE 5IVXB 4XC3L 3MV8E 1FIGH 2ITCB 2Z8SA 4KUZH 3QEUA 5DMGC 1JYNA 5TGBA 4EOWH 3MACH 3ZDYE 4X6EB 2GJ6A 1OHQA 4YNYB 3C08H 4K23L 1G9NH 4JQIH 3CDCA 2BVQA 1UADC 1XGRB 2E6JA 2ZWLT 3BZFB 4L4VA 4QOKA 1D9KD 4HW6A 3DROB 4LCCC 2OTUA 2J6EH 3O6ML 2O61B 1MJJB 4LIQH 1TQCB 5ESVB 4N0YH 1I9RH 1L0QA 2EYSB 2WBJA 2B1HL 4FABH 4JRYB 5ID1B 2F53B 3VWKD 2EKSB 5D7SH 3VW3H 2IPKB 3L3JA 5I2IB 3MRLA 4HBCL 5BQ7A 4PJ9A 1N59A 1CD8A 4NUJA 3IU4H 5HVHB 3QG6B 2XRAL 5F6HI 2VLKB 3B9KD 4XHJC 1AY1H 1AGDA 3OAYK 4YQXH 5IHBA 4HIXL 3TV3L 1S7QB 2OL3L 3QBTB 4W6XB 2VXUL 4UTAH 4GAJL 3P3YA 3D9AL 4OD3L 4HIIB 3CFJA 5HHNA 4N8CH 5C2BL 4OZFH 3LEYL 1RHHB 4PRAA 1KB9K 1R3KB 2L7UA 1C16A 5JIIA 4OTXH 4HFWA 1XCQA 4HGWA 3RPIA 4ZDHA 1ODAA 1KFAL 1YEDA 3SO3B 4PRDA 4XCYB 3IJHB 2BOCB 1MCDA 4JY4A 5DHVH 3PL6D 4RCAA 3SPVA 4M48H 3QI9C 5F7MC 3ZT6A 2HLAB 1N3NB 4JKMA 5JXAH 4JGUA 3MV9A 1BOYA 1LEGA 4ODTH 3ULVF 5ETUB 5BRZB 1N6QL 4JFDB 3DYOA 4ODSH 4M4RA 4LPVA 1C5CL 4G3YL 4HJ0D 1GZPB 5I74B 4X7TA 1HK6A 4K71C 4UTBL 4HK3J 4L8DB 3AAZA 4LVHC 2NMSA 2NY2D 3V0WL 4DK6A 5IEHA 5SX5H 2DIAA 4NKDB 1J8HD 2IF7A 1E6JL 5ANME 4U0RC 4KRPC 3FTGA 2PR4H 5H8DA 3VD9A 3MRPB 4P4KA 3VGHA 2C3WA 3QEQB 1B6UA 4Z7WA 4KZEH 1PW3A 1FO0L 2DTMH 2L7JA 3MXVL 4OLXH 4JAMA 2YZ8A 1TZIB 4O9HH 1R3IH 4YC2B 4JRWA 1KIRB 2DQCL 35C8L 1ORSA 1KG0B 4MA1B 1J7VR 1CQYA 3V5DA 4GQ9H 1SBBA 4Z7WF 3OF6A 3H9YA 3HNVL 4QRRE 4K7PX 3UTSA 4JG1H 3L3KA 1JV5A 1UB6A 4LPTA 2R4RL 2BVYA 3EO1A 5J3HC 1IGJA 3VGAC 2XTJC 5ID0B 3EIFA 2X41A 5D6DC 4YPJA 4P23D 4K8RC 1DQDL 2JJTA 5GZNC 4B5EA 5HY9A 3E3QC 3UZVB 2RB8A 1KTRL 2PTTB 4CDHA 4GBXB 4FFWD 2MNUA 5I1IL 1FJ1B 5HDBF 4EN3D 1FRGH 1SEQH 3Q6GL 2BY1A 3NH7L 25C8L 1ETZB 1RQ5A 4HKZB 5BZWA 5IESL 4WW2C 2VAAA 1K8IB 2QKIB 2ATKB 2DQJH 2YRZA 3IGAA 4JZJB 1I1CA 2HT2C 5B39A 1A6AB 1YNLH 4O51B 5ICXB 4PJ5E 4NNXA 4X6CB 5TDPA 3WN5A 2LU4A 3WJLC 4NNPL 2VN4A 1K2DA 3RZCA 4DGIL 1UZ8A 5D96C 4HCRA 1GOFA 5C0BE 1YMHA 5FOJA 1T3FA 1D6VH 3WDHA 4FXKA 2ZSWB 1HKLH 2P5EE 2VRAA 4YE4L 3TWCH 5CIPA 2J8OA 5A16A 5D71L 4ONOA 3S5LA 3MV7A 2EICA 1U8HA 1D6EB 4IOFD 3KYKL 3GSWB 5HGBB 5E94A 3JWDH 4R7NB 2EDEA 2NY1D 4YHPA 4M7ZC 3MLRH 2ORBH 3TA3C 4EZMA 4OF8A 4XH2A 4MA7L 2QR0A 3BH9A 4Y4FD 3FT4A 3UXFA 4IEFB 4OCYL 5BO1L 2EH7H 4LARL 2VZUA 5FGBC 5JZ7D 3CXDH 4NQDB 3QDJE 4LCIH 2OJZL 5IK3B 4JDZA 3ARBB 3CMGA 4IIQC 1NLBH 4YGAB 1U8OB 5D1QB 3L3IA 5FOBB 4YBLC 4URTB 5LGHH 4PRIE 1ZHBB 3C6LB 1AXTL 4P5TC 5I66A 4L4TA 3HI5H 1Y6NR 4GW1A 5GSVB 3OGOE 5EZLA 1IAII 5IIEA 4AK1A 1I7UA 3KYNB 3LKSA 1LK2A 3DVFA 1A7OH 3C5ZB 4F9LA 3DNKA 3MLUL 4Z76A 2MQCA 3LEVL 1TTUA 5IVXE 3KXFA 3FO0H 1MFCL 1E27B 2PXYD 3BN9D 1BQLL 1QPPA 4P59L 1NGXA 3VH8G 2ESVA 2PNDA 5IFAH 1BF2A 1MI5A 2JJVA 2VITA 2ZG3A 3CPLA 3QCTH 3IDNB 1U93B 3RA7H 5EZJB 5FA4B 4JM2A 1CD1B 1AD9A 4LGPB 3CVHH 1CDJA 2VDOH 4KY1L 2A1WH 3OG6B 1S7TB 4JHZA 2NY3D 4RWYL 1H3WM 5EOCL 3KS0J 4KAQL 4MD5B 4R97B 1E28A 1EO7A 3WLWC 12E8L 4OUUB 2HRLA 4JRYE 3MRKB 3TBWB 3PHOB 5GRVL 2PW2B 3KNBB 3FT3B 1AGFA 3WHXB 4TQEL 4I18A 2W1NA 1DQJB 4UILL 1MVUB 2VXSL 2VLKE 3BQUB 1IC5H 3ES6A 4TSAL 5C0BD 3L6FA 1A9EB 2EIZA 5C0ND 4MZ3A 5JIPA 5DRXA 1KELL 4JM4H 2P5ED 3O2VH 4IMKC 2AXGB 2NY0D 2NY6C 3CFKA 1V8HA 1MLBB 5DC0A 3W5NA 1A0QH 3QULB 4F9PA 3QQ4A 3SKMA 1MJUL 4NQVB 5T3ZE 3GJFA 5SWZB 5H94A 4QHMB 1T04A 4L8CA 2J5LB 4EIGB 2DD8H 1F11B 2KUTA 3WD5L 4LSRL 4XI5C 3WSQH 2QEJA 4XP5L 3BIKA 1H0DA 3ZHLA 3BW9A 3RTQD 2DQFB 1X5FA 1CD0A 2V2XB 3ZT5A 3KYAA 4KJWD 1AR2A 3TT1H 4GKNA 3VE0A 4G9DB 1VFBA 3KPOB 4RMTA 5EWIL 3ULVE 5BRZE 4JFDE 4KK6D 4G6JH 1MJ8L 3DGCR 4XNQB 4O58H 1YPZF 2ITDB 4DN3L 2V7HA 1J5OL 3CNKA 4E5XB 5E8PA 1CGYA 2EDLA 1IFHL 4ZPVB 4HPOL 3MFFA 3RKDC 2YPKB 3QI9B 1IKNC 3RUGB 4BSWB 3HG1B 4C55A 1KPRA 2XYCA 2X1XR 3K80A 3QEQE 4JJHA 2XQBL 4Q0XH 1B88A 1E4JA 1HI6A 1LP9A 3B2UC 3QQNA 1XH3B 1ZSDA 1AH1A 3SDXF 3DV4B 5JW3H 4N9GA 4MQXD 3SDXB 1I8MB 3QUML 4GH7B 4RFOL 2OX5A 4P5KB 1VACB 4I2XB 3QFJA 4LVHB 3K3QA 4ZTOL 5FO8A 1RD6A 2VDMH 4LLUA 1QTYT 2CIKB 3JWOH 3DO3A 1JGEA 1I3GL 5EO1B 4U0RB 32C2A 4Y4KC 3MCLL 2CK0L 3VA2C 4CVZB 2XA8L 4MWFB 1ZTXL 5E00B 2R1YA 4RA3A 1A4KB 1JPFB 4KROB 3HC0B 3W82A 1WWCA 3OXRA 1DLHA 1KEML 3QJFB 3O2DH 5D6DA 1OVZA 1FGVL 1JCKA 5HDBE 3GSOA 2A9NL 5D7LB 3H7BB 3S6CA 3WKML 2FR4A 4ZTPH 4R8WL 2X4UB 3V95A 3DRQB 4RAUA 1WUNT 1E0OB 4PPTA 5HGDA 3VGAB 2XTJB 4H5SA 4RFNC 5T3ZD 2AVGA 1MLCB 4X6CE 4U1NA 2HKHH 1IAKB 4TSCL 1NAML 5C0EA 4YBQD 1BMGA 3WIHA 4I4WB 1OT1A 4U3XA 4QTIL 4TUOB 4YDIL 4PJDA 1NCBL 5DJYB 3TFKD 5F6HJ 1L6XA 1NMAH 4WW2F 5BVJB 1JPSL 3BE1H 3WFCL 2JELL 5C0GB 3BP7B 1S7UB 3MC0A 4S1RH 1BGXH 4NBXB 5EZOH 2FECL 4IJ3C 5EBMA 2YD7A 4HS3B 4PJDF 4P99A 3ZKND 4NUGL 1IGIH 3P4NA 4YHMH 3ULVD 5GS2D 2WWKT 1FH5L 4JFDD 5BRZD 3IDXH 2DLEA 3D48R 4A2MA 2B0SH 3EDEA 5FKPA 3RP1A 4DZBA 1WIPA 4LOUC 4QRTA 1FIGL 1IGFH 2V7NB 4KUZL 1T03H 1G6RA 4CU6A 1XEDA 3X12A 3VD5A 3C08L 4NQDE 4BQBA 3SDAD 1Z5LB 3V9FA 4PG9A 3BX7C 4KVNH 3T1FA 5F88A 5DURB 3S37H 1U8MB 5IBLD 2J6EL 3WL9B 3LN5A 1NCDH 4IIQA 4QT5B 3DPBA 4N0YL 1I9RL 2QL1A 4NRXA 5GS0D 1KLUA 1U91B 1OAYH 4RX4D 4FABL 2Z93B 4O4YH 2V9QA 1HCVA 3B5HA 4LASH 3VW3L 1ES0A 1NGPH 4P5TA 3PWVA 2EEBA 2X4SA 2OR9L 4EVNB 3SY0A 4AT6A 1RJYB 3K2UH 1EGJA 4GXUN 3STLA 3GBNL 3VFSB 3G6AB 4ZNEA 2DDQL 4LBEB 5I9QC 1WC7B 3E6FA 4YQXL 2D0FA 3ZDZF 2FL5A 4F57H 3OF6D 5TDOA 5B22A 5GGRY 3VA6A 4D8PB 1BEYH 43CAA 4D3CH 4UTAL 3REVB 1MIEH 4IDJH 3UTSD 2AV1A 3E6HB 1J0IA 3RVVD 4DUWA 3UPRB 2VKXA 4XXDA 5EORH 1VCAA 3SGDI 5I1GH 4QHUB 2CRIA 3RVXC 4GRLA 4WI6A 5HYQB 1MHHA 3EYFA 3U6RA 4XBEH 1IC1A 4JRXB 4ONHA 1AO7A 3QO1A 1FP5A 2G2RA 1ZT7B 1QEWA 5D1XA 4OTXL 4WV1C 2OI9C 5M94B 4JFPB 4X7SL 4Z78A 5C86A 5HI5C 1KTDB 1XGQA 1I3VA 4UU9B 5DR5H 5C0IA 5DJAA 2IG2L 1MRDH 1AGEB 1H5BB 1EXUB 4W4OC 4HIHA 4RMQA 3N9GH 1KN2L 4JE4B 4X98A 1FNLA 3VCLA 3FOMB 5JXAL 1T0PB 4FTVA 4AH2A 1A21A 2PO6C 3GRWH 3GNMH 1LE5B 1Z0NA 5KSAA 4KHXH 4RZCA 4O2CA 5SWZE 1UJ3C 1JRHI 4OD1H 4MNGB 3DGGB 1FDLH 1OAKH 1S3KL 5A2IH 3CSYB 2XFXB 4L29B 4KZEL 1FL5A 3HE6B 2NY6B 3A6CL 1T1WA 2GSGA 1UA6H 4O9HL 2WQ8A 5D1QD 2X2YA 2X70B 1M7XA 2IAMA 2ID5A 4MJ6A 3N1MC 3C6LD 1AHWA 3BWAA 5IMLA 2WNGA 4P5MB 2NX5B 4GQ9L 4FQXC 4X0KA 4PY8J 5GS2H 2AERT 2I9LA 1IAIM 3WFDL 1TITA 4JG1L 1E4XH 3SGJA 1FVDA 2Z31B 2IQAB 1KACB 1J05B 5INCB 4U1JB 3C5ZD 4NT6B 2DWEA 1VFOA 1GHFH 5E70A 2Y36L 3DX7A 3HC4H 3PWUA 1VFAA 5M95B 4HD9A 4HDIA 3HG1E 1DBJH 4HWUA 1FRGL 1KPUB 3EJJX 2R2EA 1BD2A 2DJ4A 5E5MB 1CU4H 5F3BA 1HQ4A 3C6SA 2NNAB 4HZAA 3RDTC 1MWAL 2ZOKB 5H35A 2EIEA 3SDXE 2XNAB 4KKAD 5GS0H 2DQJL 5ICZA 3L5JA 4KK5D 1G7JA 3VD7A 3QDAA 4PTTB 5F6IC 4I2XE 1MI5D 5TE6H 4WWKC 2DJUA 3S35X 5L2JB 4BJLA 3JXAA 5DMGD 5T1KB 1ZLSL 2DWDA 4I9WD 5TF1H 5EU5A 1UWEL 2FO4B 3B3IA 3MRQA 1FVEB 3TO4A 1JWMB 1D6VL 4OCXH 1V05A 2GY7B 3JV0A 1H8NA 3WFZA 3TWCL 2VIRA 4YXKH 5LQBH 4LCUB 3EGSA 4EQ3A 5D7LE 1AQDB 1N4XL 1PAMA 3JWDL 1EVTC 5CJBA 1Q72H 3L5XL 1ROWA 3PWPB 43C9A 2ORBL 1W0VA 5EO0A 5D5MA 2YN3A 2XTJE 2R1WB 3P9WB 1GGCL 2EH7L 2X9XA 1AD0B 2AW2A 5DD6A 4XHJD 1WBXA 4KQ4H 3E3QE 4MDIA 5EIVA 4YK4C 2FGZA 2KKQA 4LCIL 1NLBL 4OQTA 4HMEA 3PDGA 2X44D 2FDBP 1UZ6F 3GM0A 1NUFA 3VXUB 1L9NA 5TDNB 3HZMA 5HHOA 1T1XB 1EERB 4PRBA 3D0LB 3NCJH 1OD9A 1SVZA 3SDDC 3QXWA 3UDWA 3Q3GB 4DKFL 4RFNB 1PLGH 2H6PB 1A7OL 3UBXG 4BFEA 5IM7B 2CDGB 5CIPH 4LKXA 5IVZA 1JGUH 3HUJA 1MFNA 5CEZD 1KPVA 2IGFH 3JTTA 2NW2A 3FB6B 1QD0A 4PJFF 4NBYB 2NY4B 1CFNA 3TCLB 3SE8H 3WO4B 3WS3A 4QGTA 3QI9D 3RA7L 5HJ3A 4Q9CA 3QDMB 3HG1D 2J1KA 5KG9A 2P8PA 2XY2A 4FFZL 3MRMB 1U8QB 2HT4C 3HUJF 3VGDA 3B2VL 5E2TH 2VDOL 1OP5H 2A1WL 1K4CB 2X1PA 3CU1A 2C3HA 3TM6A 5B38B 2PUQT 4LLQB 3STZB 1KLGA 3UROR 2HJLA 4JANB 4KRPD 4JCLA 1P5UA 1YC7A 3D3VA 4Z77A 2OTWB 5DI8A 1IC5L 1DCLA 3DOSA 2FZ3B 4CMMB 5IMKB 1FG2A 1U42A 2CD0A 2M26A 5JPNB 5SWQB 1S7SA 4BFGA 4JM4L 3MV8A 3O2VL 3FQWA 1CE6A 2QHRH 3QO0A 1A0QL 2VUYA 5ADOH 2W65A 2Y7QB 2R0ZH 4OIIH 3ARXA 4YXLL 1AGBB 3RIFK 3OB8A 3DMMC 4JRXE 3HMXL 5J3HD 5LAXB 3B5GA 1EV2E 2XTJD 3CK0H 4M61A 4XVUC 3WSQL 4K8RD 2R29H 4OAWB 5GZND 4U6HB 4X4YB 3VXOB 1MFBH 2BMKB 1BWMA 4JPIA 3P0YH 4NRZB 4XCEB 3K7UA 1BQSA 5KJRH 4TNVF 3B4NA 1IAOA 5C9KA 3DTXA 4U1IA 5FV2A 4X7FC 3QQ3A 4ETQA 2HT2D 2PYEB 4PGZA 4W4OA 4G6JL 4WV1B 2OI9B 3GSRA 3MR9B 4PYGA 4F7TA 4XGZB 3JTSA 4KXZI 1XF1A 3D2UB 2D0HA 4OGXL 4EI5A 1S9WB 5ACZB 1AP2A 3NZ8A 4MNGE 3S3JA 5MENB 2PO6A 4ZPTB 1P2CB 2IH3B 2P4AB 4MXVF 2CGRL 1WGOA 3ULSA 1HHHB 2XKSA 4P2OC 3GJFH 3LEXA 4J1UB 4Q0XL 4Q7DA 1L7IH 5CINL 4JPWL 3FO9B 2B5IB 4YUEH 2AKRB 1LD9A 5J13B 2JLLA 3BEWA 4OI7A 3P77A 4X6FB 3SKUD 5DURD 3HPJA 2NX5E 3GK8H 3L3HA 2P7TB 4G8IA 5DF0A 4UNTA 1UJ3B 2VDML 3TA3D 1PY4A 2BNQB 3G5VA 5FYKD 5MEOA 3EOYG 1HOCB 3JWOL 4DFHA 1IM9D 3UC0H 2JIXA 1DDHB 1CVSC 2ZG1A 4FQXA 2IADA 5CEZH 3BDYH 3GO1H 5FDWB 3RY6C 4Z7OF 4XZUA 2ENYA 1WCQA 2LVEA 5L7XH 4OZHA 1MUJA 2CLVB 3GMRA 4XRCB 6CGTA 3WIIH 1N6UA 3VDBA 3O2DL 4PD4J 1I85A 5DHXB 4P5TD 2WW8A 3DVGA 4ZTPL 2XWTA 3M1BA 4AM0A 2ADIB 1AIFB 4F7EB 3GKZA 5ITFB 3GMPB 4OZHF 1YNTA 1A22B 5E8NA 3TBYA 3MA9L 5I71B 2DLIA 2J8UF 2YD3A 4Z7VF 1RK1A 4L9LC 3HI1B 4Z95H 4Z7VB 4R96A 1EEUA 3BXNB 2E27L 2X4PB 2JCCB 4JREC 4P57A 3OKKB 3DO7B 4HAGA 2C5DC 4Z0XA 4YGVB 4QRRA 3HPLA 2VSCA 1G7HA 3LCYA 4MS8C 1X5LA 5AUMB 2X4NB 2EZ0C 3HLAB 1NMAL 4S0TD 4GRMA 1T4KA 3VXTB 4ZUWB 3MSPA 1PEZA 4C58B 4PGBB 1D5BB 1BGXL 5EZOL 1ZT1B 1CQKA 3LRSB 3CDYA 4WWKB 1I1RA 3FQRB 5J1AA 1FPTH 4FFVC 3WLWD 1IGIL 3IDIA 4YHML 2BNUA 2OR8A 1FFPB 3IDXL 3T0EC 2YD6A 3PWPE 2R2HB 3U36B 1MHCA 4QEGA 1IGFL 5JOEA 1T03L 4K8RH 1FVCA 1SJHA 4C59B 2BY0A 4UIKH 4G9FD 3MMEA 3IETA 1KULA 4GW4A 4FTVD 1JIBA 3AROA 4ALAH 1OY3B 4Y2DC 4PJ5A 3VMNA 4AYFA 1PD6A 5FHAH 4P46B 2NY6D 4KVNL 3VXUE 3RWCA 3R06B 3S37L 4U6XB 5DJ0A 2P44B 1NCDL 4GAYB 5CILH 5EOQL 5J12B 1OAYL 2HRPL 4O4YL 2BSSA 2H32A 5EBLB 3MRNA 4LASL 5DUBA 1CLCA 1IJ9A 3O6FA 3SDDA 2ADFH 4XI5D 3K2UL 4FZ8H 4UV4H 2GKIA 3EDFA 2MFNA 4QTHB 5B8CB 2F5BH 1IC4H 1SEBB 4F57L 2XV6B 5DJCB 1BEYL 2DQIL 4RFEB 3EDDA 1MIEL 4IDJL 5AZ2L 1OF2A 3QDME 3PHQB 4M1DH 4XPTH 1BZ9B 1G6RH 1IILE 5EORL 3V5KA 1X5JA 2AGJH 2LFGA 3BVNA 1PZ5A 4OGYL 2OBGA 4M6MH 3QDJA 5DSCA 1CFVH 3TIEA 5FYKH 1TQBB 3TNMB 5CMAA 1JP5A 4F58H 4YDLC 2F19L 1EHXA 2I5YL 5FUOH 5HPOA 3R1GH 3OAUL 1F3JB 5T1LB 3RKDD 3VFMB 5DR5L 3I02B 1BREA 3OAZH 5TE7H 5I1JH 4PRPA 5CCKL 1MRDL 2KL6A 4JHBA 5SWSB 3B2UD 1S7VA 2H26B 3CCHB 5GGTH 4ENEC 5TH2A 1A7NH 4R2GB 3U0WH 3DARA 3TVMC 1LWRA 4HHAA 3SGKC 3I9GH 4X6EA 2WBKA 5DZLA 5T3ZL 3GRWL 4X5WB 1K4DA 3PWPD 4I1NB 5DJZB 1UVQA 1XGRA 1F13A 4Y4KD 3WXVH 4OD1L 1AXIB 4C57C 2O61A 1MJJA 1P4BH 1UKTA 3DMMA 4YDJB 1AE6H 2EYSA 4JRYA 2F53A 3IXAA 1JZ4A 1UA6L 5JHDA 3UCRA 5C08D 3V6FB 1RZKL 3HE7B 4BFBD 5F1NA 3QUYC 4M6OH 3VXUD 4N0FB 3QG6A 4LVOB 3BRFA 2BVTA 2VLKA 3ULVL 3QIBA 3HA0A 4LU5H 3LOWA 2Q7NA 3SE9H 1QQDA 3RU8H 1PVHA 2FGWH 2PYEE 1IGMH 1JK8B 1A5FH 1XCTA 4LF3A 1G0YR 3KDMB 4Y1AA 5JW4Q 2WUBL 1GH7A 4HIIA 5HHOD 1GHFL 4CGTA 3UEZA 1KT2A 4I0PC 3HC4L 4ZFGH 5MENE 2H8PB 1JGVH 3ZTNH 3FCTB 2N7AA 2HFEB 3CXHK 4MXVE 1DBJL 4C4KT 3GSVB 3P9LB 5FCUH 4DEPB 1FLTX 1CU4L 2PKDA 4TN9A 3MLZH 1GCFA 2OZ4H 3T0DA 3CD4A 1YY8A 2NQCA 5GS0L 5I17B 1NC2D 4IRJC 4OLEA 4BFIB 4ZYKA 4ZUTB 4XCYA 2BOCA 4LSUH 3BP5A 5GRXG 5TE6L 3GM8A 4R4FH 4LOUD 4X99A 3R0MA 5DYOB 2BNQE 1OWWA 4UIMA 5EUOF 4G42B 2V5RA 1P53A 3A6BH 1XR9A 5TF1L 4HUVB 2LQRA 4PS4H 4BH7B 2F54A 5EPMA 2UUDH 4P2OB 4I0KA 4OCXL 3P4MB 4G8FB 1S9XB 5HVGB 2DQUH 3STBA 4NC1E 4L8DA 1C8PA 4YXKL 5LQBL 4MQ7B 1G7MB 3MRPA 1Q72L 3CMOH 3PGDB 1MQKL 4N0CC 2AP2A 3QEQA 3PE9A 4QRUB 4WHDA 2VLJD 3U46B 4KU1A 1PX4A 4ZXBA 3VXRA 1CXEA 1TZIA 4HZLB 2F8XC 3ARDC 5FECB 3I6KB 4Z7VE 4ODUB 1MFDH 5J9PA 1G1YA 1KG0A 2JCCE 3NMEA 1OOAA 1B4JH 1OGAB 2XZZA 4KMQA 4X80H 2E9WA 1U8PA 1ZK9A 5D70H 5E6YA 1SBSH 3CDGB 3RVXD 3NIFF 3NCJL 4V2CB 4WHTB 1EAPA 2OCFD 4DZ8A 4L9LB 1PLGL 3KVQA 4DTGH 4RAVB 2A6DB 2PTTA 4GBXA 1I8KA 4LDOB 1FJ1A 1FE8H 4BZ2H 1EEYB 5C3LD 1ADQL 1LEIA 5F1KC 2DKMA 3D2UD 2IGFL 5HI5D 2DM7A 1K8IA 3L3GA 2QKIA 4K7PH 4RDQF 1MCBA 1DBAH 2CLZA 2IPTL 1IC7H 1J9CT 3L5IA 4X6CA 3BD5A 5FV1L 3D0VA 4EI6B 5C07B 1QBLH 1T0NB 5B39G 4JFXB 3OJVC 3T0EB 4Y16B 3LB6C 1HHKB 2HLFC 2XZCL 4A6YA 1CI5A 5FUCE 4XP6H 3EYOA 2CLRB 4L3EB 4AENA 2VDKH 5CJ5A 1V3MA 4RGMB 3KPQB 1L0XA 3RPKA 1PQZA 1OAZL 1T5WA 3TCXA 5D7JC 1EX0A 1JN6A 2C4XA 4OT1H 5HSFA 5HGBA 4OF5A 1VPOH 4Y2DB 3T0WA 1BVKB 1DFBH 1FN4B 5C70A 1U6AL 3DX9A 1TNNA 4R7NA 1X3DA 4Z7QF 2AQ1A 3V4PH 1ADQA 3Q5YA 2QHRL 2YZ1A 3MJ8B 2R0ZL 3LDBC 4NQDA 4OIIL 1S9YA 5BS0D 4CW1A 1P7HL 3ARBA 3DJ9A 4R0LB 1U8OA 5FOBA 3X13A 3BRGC 1D5MA 4RBPH 1A3QA 2R29L 3UJIL 4HIEB 1N0LA 1T80A 3HRZB 1CLYH 2ARJB 3MREB 3KYNA 3ZTJH 4LSPH 4NO3A 2IFFL 5SWSE 4R9HA 1H3UA 1EUUA 3RDTD 5JIKA 4L8BA 1J12A 5CEYB 1G7PB 3DIFB 1DLFL 5C3TA 3IFLH 4YDLB 1F2QA 5DFWH 4WWKD 1EFXB 2XN9B 5HYJB 4OCNC 5E99H 5EZJA 3WDJA 3NCBB 3TVMA 2RQ8A 1CD1A 2FEEL 3E0GA 3FO2B 5E6IC 1A6VL 4X6DF 1C12A 1ZMYA 4X6DB 4KJPC 4OCLC 4K3DH 1L7IL 3KLAB 3RGHA 4X4XB 4HQQH 4YUEL 3E2HC 4AEEA 3LZFH 3PHOA 1T83C 2PW2A 4LHUA 3KNBA 1XIWB 1YYML 1A7PL 4QRPA 3O6KH 1DQJA 4NN7C 3GK8L 5F1SA 3BQUA 2M8XA 1A9EA 3BT2H 3QUYA 3MLXL 3ARFB 1PSKH 3UC0L 2VLLB 1BVZA 2AXGA 3BDYL 1IAIH 1MLBA 1QRNB 1RIHH 3HCVA 4NPYA 3QULA 5EU4A 5I8KH 5L7XL 3VGFA 1KXVC 3WNPA 3WIIL 3VFWB 5IW1B 4XHQA 5SWZA 1KNOB 4QHMA 5FA3B 5FCSH 5HYSA 4FQJH 4MD0B 1NJ9B 5GRJH 1E4KC 2GITB 2VXQH 1IEAB 4XPHH 1P1ZB 4FQPA 2R0KL 3RI5K 2FLRT 5A1AA 3SDCB 5KW9H 4HT1H 1QFUH 2FATL 3WEXB 3O8XA 3QB7C 5ISZB 4MNQD 4Z95L 3AVEA 2VKWA 4I77H 1HHJA 1I9JH 3MJGX 4OFVA 4FXGA 1N5AA 3KPOA 4DN4H 3PJSB 5GJTH 1UEYA 2DMKA 2FJFA 4XNQA 5CZVL 4IMLA 1MH5A 2HT4D 5K9JL 5SWSD 3DUSB 3LPWA 4MCZB 1ITBB 4YDKL 3T2OA 3RNQA 4CVXB 2Y07L 3AMKA 2R2BA 3Q0HA 4XBGB 1R0AL 4LCWB 5F9OH 2CR3A 4LMQE 3RUGA 4D9LH 3TP4A 5IW3A 1JNJA 4JDVB 4HV8B 1GC1C 3FO1B 1SY6L 1DN0B 3LKOA 4K8RL 4UIKL 1XH3A 5FYLE 3O4LB 4L8SB 3UTZB 1I8MA 2Y23A 3D69B 2RJMA 3UX9B 1OGAE 1VACA 3VFPB 3WHE0 4POYA 4WI2A 3RBSA 3KR3H 2XKNB 1I1FB 1I75A 2EE2A 3C60C 5FHAL 2CIKA 5AYQA 1A1OA 5GGSA 3ARVA 3ZO0A 3S4SB 3OG4B 4CVZA 5CILL 4MWFA 5FM5M 2HVKB 3O41A 1OAXH 3ARDB 3DMMD 3HC0A 1EMTH 1KENH 3IJSB 3OKLB 5CSGA 5DD3H 2ADFL 4XVUD 4M8QA 4BH8B 2PTUA 4FZ8L 1W0WB 1P84J 2YA1A 4X8JB 4U4BA 1BPVA 5D7LA 2F5BL 2A74A 3BDBA 1NC4A 2X4UA 4J8RA 1IC4L 4WEMB 3D39B 3RGVC 5FHBL 5F72S 1LO4H 5GISH 5DK0A 3VWJB 4LDLB 1CFQB 1GRWA 4ONGH 1A6UH 4YDVA 3I50L 1MLCA 4XPTL 3KLSA 3I6GA 1DEEA 1RHFA 3N1FC 1IAKA 2AGJL 5C07E 2YBRA 1Q9WB 2BVEA 3T0EE 4S1SL 1CFVL 2X89A 1FLRH 5ALCH 5FYKL 3L5WA 5BW7A 2AAVA 2O5YH 1CDHA 5E6ZA 2FJHB 2XG4A 4L3EE 5IKCB 3TH2T 5FUOL 2AQ3A 3R1GL 3BP7A 5JNYB 4ONFH 1F5WA 3QCVH 4P2OD 4N8VB 5GGTL 1A7NL 1ZANH 1JGDA 2V7NA 4HUUB 2VLRB 5IBTH 4Z7QE 3U0WL 4EUPH 4Q2ZB 1A1MB 3WNKA 1D5IL 4YHLL 4JZNB 2F54D 4OZIF 5DJ8A 1WAAF 4OLWH 3QIWC 3LSOB 5D7JB 5CJ8A 2Y5TB 3WXVL 1UKQA 3ZL4H 4LPXA 4P9MH 3NN8B 2CKNA 4PJEA 3L9RB 3L1OH 1YQVL 5C0FB 1QFHA 5IB4A 3RNKB 2EYTB 1X5GA 1AE6L 3OL2A 1YEKH 3RJDA 4X5XB 4U3CA 4FMFA 3WJJC 1UH2A 2DQEH 5JO5B 3RAJH 3V2AR 4EVNA 1RJYA 4MB5A 2Q76A 5FB8B 3O4OC 4XXCA 4BZYA 3VFSA 3L95A 5F9JB 1U8LB 4LBEA 4U1SB 3CFDB 1WC7A 4JFFD 1NL0L 3G9VA 1BP3B 2VL5A 3RU8L 2FGWL 1N7ML 1IM3B 1IGML 2YC1B 3TIDA 5ICYA 4D8PA 4NQXB 1QACA 3REVA 2XN9E 5HYJE 3A67H 3E6HA 4WU5A 1HH6B 4LSQL 5EC1B 3CFCL 3EJZC 4WNQB 3MLTA 3IJYB 2CDFA 4ZFGL 5IGXL 5D2LB 4MS8D 4R3SB 3IFOB 2CRYA 3OSKA 3ZTNL 2EZ0D 2HN7B 4V1DB 4JRXA 4UBDC 4X6DE 5IV2B 5FCUL 3TO2A 4OZGF 1ITCA 1J11A 3IAQA 2GTWB 4OZGB 4HLZH 3ZKMC 1ZLUH 1M71A 3MLZL 2OZ4L 4KPHH 5C07D 4K3GA 4UOJA 3LN9A 1CGWA 1OSZB 3T0ED 4LSUL 4UU9A 3DXAB 4K3JH 3QG7H 1KJMB 1AGEA 3QH3A 1H5BA 1T83A 1MCJA 1EXUA 4KMLB 1FL3B 2IANA 4L3ED 4M7LH 2Z91A 3MCG1 5E6IB 3FOMA 1XR8A 3EFDH 3HZVB 1ZHLB 1M6OA 1NGQH 2PETA 4NN6B 4M7JH 4NZUH 1QRNE 4L3AA 2WQRA 4Y2DD 4MB3A 2Y9RT 1LE5A 1A2YA 2DQUL 5FF6B 5GHWH 3MOBL 1LEKA 2GIYA 2OLDA 5ESQB 1LMKA 5JORB 2GUOB 2QV2A 4NQEA 5DMIH 1A14L 3CSYA 1H3GA 2XFXA 1K5NA 4M1GH 1CDGA 3HE6A 1G7LA 5T1DH 1XZ0A 5ISZE 3SGDH 1CICC 4I5BA 2VO5A 2X70A 1MFDL 1LE9B 1BZ7A 3FN0H 3GI9H 2NX5A 4P5MA 2W07A 2FEDC 5E2VH 1RURH 4M6NH 1M7DB 3FOLA 1DE4A 2IQAA 4ISVB 3AM8C 5D70L 1J05A 1P4IH 3LV3A 1HXYB 2ILLA 4HX1B 3Q2CA 4OCWL 4Y5YC 3H7LA 5INCA 1J0YA 4NT6A 4RMSA 3FAWA 1CDCA 2UWEB 3VFVB 1E4WH 4JN1H 3REWB 4KC3B 4MQTB 2AK4B 4L3CB 4DTGL 2AXFA 4LCWE 1T20B 2G5RA 5ERWA 1OP5K 1CTNA 1XF4A 3EDJA 2V5YA 1YECH 1FE8L 3NIGF 4JDTH 2XN9D 4BZ2L 5HYJD 5E5MA 2EDXA 3NCCB 2Z8VC 2NNAA 3ARQA 3O4LE 2EO9A 1PEWA 2XNAA 3IDYB 1ND0B 3DV6B 2Q3AA 1BFVL 1L6ZA 2G75B 4I3RH 4ENED 4HWBH 1JRHH 3V5HB 5L2JA 1S78C 3TVMD 1Q9OB 2Y25A 5CSZB 3U0TB 5DQDH 1Z9LA 3C60A 1F4HA 2ZNWA 4XP6L 1XF5A 1JWMA 2MQ3A 3OJ2C 2YEZB 1HXMA 2VDKL 5I15H 3D85D 4MVBC 2VXTH 3GSXA 2GK0A 1RU9H 2D7TL 4OT1L 3O9WA 3G9AB 4ODBD 3QISA 4LHQB 1VPOL 1CFSB 4TULH 2ZNXA 2RAMA 1DFBL 1VDGA 2E9JA 4QRPD 2DS4A 2UZIL 3D39E 1PG7W 4N90E 4XNZC 3S35H 3I85A 1RZIA 3S8WA 3WXWH 3MLVL 4UAOC 3JWNC 5I6XC 5E1AA 2EE9A 1AD0A 3RGVA 1CN4A 4GS7C 3FB7A 2WWMC 4K07A 3FRUB 3QHFH 1F8TH 3VRIB 5D7IF 2F58H 3L7EB 5D7IB 3VFOA 4AL8H 2BK8A 1TXKA 2ADGA 3SDCD 5J6GA 3AY4C 1WLHA 2AEWA 1J0KA 2OL3B 5TDNA 3BKJH 1D5XB 2ARWA 2W0FB 1S7RB 4F33B 4I0PD 3O3AB 4Y19B 3Q3GA 2P5WA 3QWRA 5AAMA 1CLYL 1CR9L 4LSPL 2H6PA 4QNPF 4OQ1A 4XNMB 4AIZB 2CRMA 3GJEB 4DCQA 5IM7A 1R5IB 1S5IL 1ZT4A 2CDGA 1XGUB 1JI2A 2VLRE 3PGCB 4IRJD 3GJFK 3IDMA 3IFLL 1T2QH 4U1HB 3I3DA 5MEQB 3FB6A 3TCLA 2OTPA 2A38A 3BP6B 3TZVC 3UBXI 3X3FH 1R3LB 1X7QB 4X5LA 3QRGH 1WAAE 1ZVSB 5E99L 3QDMA 5C9JB 3GGWB 4GT7A 1G7QB 1F4WL 1HH9B 4QCIB 4RWHA 5JUEL 4KZDH 3MBXH 4HH9A 3ZHKA 5FM5O 1QUNA 4UDTB 1RSFA 1T21B 2YK1H 1CFTB 1FFNB 4PLJD 2YMXH 1MRCH 3ZTJG 3OAYH 1I7ZA 1RI8A 3EYQC 3QIWB 5DK2B 4D9QE 4N0CD 4OD2B 2C4FU 1AQKH 2FZ3A 4LK4A 3WJJA 5JPNA 5DMYA 2QADC 3ARDD 3QUZB 1BQHA 1CK0H 1DQQB 1L7TH 2YPLA 1L4IA 1FO0B 3N85H 4H26B 4XCFH 1IAIL 3ZSSA 1C5DA 1B2WL 1RIHL 5D93C 4TPRH 5I8KL 3EOBB 5D2LE 3Q6FB 2WUCH 4QXGH 5DVMA 1MRFH 3D39D 1CDBA 4V1DE 5MHSE 1FL6B 3DX6B 3C8KA 3MBEC 1YNKL 4NGHH 5IB3B 5GRJL 3WDIA 4OZGE 2VXQL 2VR5A 4XPHL 3B43A 4GG6F 1YN7B 4DOHB 4GG6B 4OB5H 4U6HA 4X4YA 3MGOB 1JFQH 4U0QB 4ORGB 4HT1L 1QFUL 1GIGH 4XCEA 1K85A 3D25A 3OZ9L 3QXTA 3QHZH 4P2RB 1QA9B 3MCKA 5D6CB 5AYUH 2ZCKL 3KGRA 2DYPB 1NGZB 3TN0B 3C8DA 4Q6IB 5TE4H 2F5AH 5C0CB 3AREB 5T1MB 7CGTA 2C9AA 3Q1SL 2FHFA 4DN4L 2ICWI 2X89D 3V4UH 1FNAA 3GHEL 4JJ5B 3MR9A 4MQSB 5GJTL 4Z5RB 1FCCA 1UCBL 3RVUC 3LB6D 2HLFD 3ULUE 5MENA 3QAZC 4ZPTA 4OLVH 2HH0H 1HHGB 5E2UH 5GGUA 4D9LL 4JFEB 2QHLA 4HIJB 4W6WB 5JQ6L 1L9MA 2C1OB 1CL7L 4J1UA 1IT9H 1VSCA 1QLRA 4WUUD 1IGCH 3MRIB 5EBGA 2D9QB 1JBJA 5D7JD 2AKRA 1WZLA 1UH3A 2LAGB 3ARTA 2V9RA 4X6FA 3LKPB 2P7TA 5C09B 3SCMB 3KR3L 3S36L 2AI0L 3C5SB 2AJSH 3VH8B 3VXNA 3QA3A 3KHOA 5I19L 4PJAF 4MJID 4PJAB 3CH1B 5FDWA 4POZD 1KIQB 3PXJA 2UWEE 3S34H 2XZAH 1OAXL 4LLWA 4D9QD 1YN6A 2AK4E 3VFTB 3VGGA 2CLVA 1CICB 4Y5VC 3ZYZA 4ZNCD 5JOPE 1EMTL 5DD3L 4OLYH 3HTLX 4P48A 1S7XA 4OFIA 3NIGE 2Z9TA 2ZZUT 5E56A 1G9EA 1EJ6A 4NKQB 2ADIA 4YX2H 1Z3GH 4F7EA 4IS6B 4W68A 1LO4L 3BZEB 1OTSC 2VWEC 4KXZH 2GTZA 4ONGL 4OZ4B 3QDGA 4JQVC 5D72H 5E9DA 2EDJA 4LLMB 1WITA 3OAZK 2WWKO 5E08L 3CZFB 3OKKA 1QLEH 4R90H 4S2SB 1FLRL 1QNZL 2KPNA 5ALCL 3GUTA 2O5YL 3WS6C 5F7FA 3M8OH 4DVBB 5HHQB 2GCYB 2FSEA 3VXTA 1QBAA 3EZ8A 4PGBA 1TJHH 1WV7T 4ONFL 1F3DJ 1ZT1A 3OPZH 5E6ID 1AKJA 3KLDA 3LRSA 3QCVL 5JPMB 4K9EC 1ERNA 4KJPD 5EU7C 1HILB 1EHLL 2ZP0T 4E0RB 1ZANL 4NO0B 4RAHA 1JYWA 4XPBH 3C5JB 5IBTL 3KJ6H 4D0DA 2OXHA 3PQYB 1QLFB 3FQNA 2BC4A 4NHUB 4O02L 3RZWA 2LTQC 2VC2L 5GQBA 5D7IE 1A64A 2COQA 1UG9A 1JPTH 1MHEA 4KQ3H 3BAEL 2K3TA 4P46A 3V8CA 3I6LE 1ZHKB 1WJ3A 4AMKH 3CSGA 1FORH 2AJZB 4ZAKA 1O5DT 3R06A 3NBNA 3OGCA 4U6XA 3H8NA 4XNZB 3H3BC 4GAYA 2X4RA 3F62A 1MY7A 5BXFB 4Y19E 5BZDB 5J0BA 3KLHC 1YEKL 4ZFOB 1BFOA 1LILA 1ZGLM 1M05B 5I6XB 1DVFC 3LMJL 3F65A 4M7KH 1VKXB 2DQEL 3RAJL 3IFNH 1UCTA 1IKFH 2DI9A 5KSBB 2AJXL 1QSEB 5B8CA 1R3HA 4NJAL 2BFVL 1NMBL 3H42H 5FGSA 4ELMF 3M07A 4EUPG 2VJXA 4ELMB 1I8IA 2VLME 2RGSA 5KS9B 2NYYC 4GW5A 3ARWA 3PWJB 4LSTH 3VGBA 1BZ9A 1I1AB 1FFOA 3K1KC 1FAKT 2K1MA 1KB5A 2V17H 1MEXL 2GHWB 3V6ZB 2W92A 5TQ2H 3T3PF 1Y0LA 3NGBB 4M4PA 4PRNB 3ARGC 3GSNH 2UUDK 4HF5L 5C2UB 1JYXA 4WIQA 5GSRB 5T1LA 3TZVB 2RBLA 4H1LA 3VFMA 2IC2A 4PRHB 1EDQA 3ARUA 4Y5XC 1LVEA 2WBWB 1UT9A 2EDWA 3CCHA 4JFYA 4QYOB 3SE4C 3RBGA 4YHZL 4IRZH 2NY5C 4GMTH 2X1WL 1VFUA 3QXDA 3T2NL 1CT8B 1A1NA 4FQIH 4J4PC 3EFDL 4RMRA 4ETYA 1PDKA 5I73C 1NGQL 4JO1L 1C7SA 4M7JL 5IUSA 4KWUA 3ALWA 5JHLL 1YEHH 1T89A 1OGTB 3QUMB 3U83A 4I48B 1VB9A 3C60D 3EDKA 1JTPA 4X5WA 1NBYA 5DJZA 2Q8BH 1WCBA 1P5VA 1U95A 3CC5B 3AU1B 4X7DC 2PW1B 4HFUH 4DOHE 4GG6E 4PJ7F 1JMZA 2H2PD 2PCPB 2QADB 4DKAA 2VL4A 4PJ7B 4O2EB 4HLZG 4M1GL 1HYSC 4DKEH 4BKLA 1RK0A 4P2RE 4OKDA 3P73B 4NQCB 3HE7A 4N0FA 5AWNL 3FN0L 3GI9L 4H0IA 3RGVD 5C0CE 3U9PH 4M6NL 1C1EH 1N26A 1P7QB 2HTLC 3SJVB 4Y8AA 4I13B 3GIZH 1E4WL 4JN1L 2ARJQ 2DI7A 4PJCB 4OFDA 1NAMB 2H8PA 1EAJA 3BYTA 4JFEE 1R5WB 4WI3A 1YECL 2Y4SA 3GSVA 4JVWA 2VLMD 4UT9H 5TQ0H 3UTQA 5JR1H 3HR5B 2WP3T 4H0HB 3NCYS 4BSVB 5F9WB 5AG9A 2G5BB 4XP9H 2VDRH 5A2KH 4BFIA 2F8OA 2Q86B 4ZUTA 4I3RL 5DK3A 5C09E 4HWBL 4YR6B 5DYOA 4XC1H 1MOEA 5HHVL 3BUYB 3JVGC 2EDFA 1H3TA 1SYVB 4BH7A 3WV0A 4ZQKA 4FA8A 4Z8FH 4PJAE 3MRJA 1FAIH 2BRRH 3QIWD 1FNGB 1ZLWK 4G8FA 5D1ZB 5I15L 3HKFA 1HN1A 5E0QA 4YFLI 1MVFA 1F4YH 3TH3T 4RGOH 1KB9J 4HKJA 4PJIA 3OKMB 1QO3B 4MQ7A 4Y5VA 3DSFL 1G7MA 2QSCL 3S35L 4FZEL 3V0VA 3WXWL 3W9DB 2ZSVB 2NZ9C 4MSWB 4HZLA 1OM3L 3D6GA 2YPLD 2XXMB 2DRUA 3F12B 1IZJA 4E42B 5SX4H 4ODUA 3S7GA 1LQSR 3MRDA 1I7RA 3QHFL 1F8TL 3U2SB 3FB5A 3NIDF 3BGMB 1OGAA 1GC1H 3PWLA 4AL8L 4JQVA 4WTXA 5MEPA 3NTCH 3V7AG 3PDOA 1MCOH 4D9RE 4XVJH 1W72B 3IDGB 1PG7H 3EJZD 5I76B 1EO8L 1TCRB 5CWSB 4HK0B 3CDGA 5IQ9B 5GGRA 4PREB 1ZGLA 4C56B 2XWJB 3WS6A 1S5HA 8FABB 4WHTA 5CUSH 3NFPA 4UBDD 4RAVA 4TSBH 4Q74A 5FKAA 3PUCA 3JZ7A 4GMSH 4NM8L 3B5TA 2VQ1A 3CX5K 3ZKMD 5CBAB 1Q9KB 3VFGH 1RJZB 3FRPA 1T0MB 2ERJC 3P2TA 3PQYE 3DHJA 1RULL 4TNVK 4HGKC 5DD5H 5CBEB 1OTTC 3X3FL 2HVJB 3QRGL 4OM1H 5DHVB 4JFED 3PHSA 5F89B 1YMMB 3BPCA 1NFIA 3TYGH 5C8JB 4EI6A 3TBSB 1T0NA 3EAKA 5C0AD 2BNRB 2DBLH 1KJ2H 5CJXC 4KZDL 3MBXL 2IQ9H 3LN4A 4QRSB 1M4KA 3FFCB 2JB6B 1YUHB 2Q7YB 2YK1L 2CLRA 1CYGA 2A83A 4U1KB 5FGRA 5C09D 3SCMD 5I1LB 4PJ8A 2YMXL 2ICWJ 1MRCL 1G9MC 3KAAA 1RFDH 3LD8B 5KSBE 1EHAA 1QSEE 4APQB 4HK3N 1HZHH 3FONA 3WE6B 6FABH 3G5ZB 3O0RH 1JZ5A 4N0UB 1CK0L 5DEFA 1KTLA 1L7TL 3RKPA 4DK3A 1CICD 4ELME 1ACYL 3VI3E 5KS9E 3N85L 2VDQH 3MRHB 4XP1H 5IR1B 3DLQR 5K33A 3O11B 1R24B 4U3HA 1AGCA 2WUCL 5F1IB 2J88H 1YJDC 2FX7L 3DUHA 2P42B 1BJMA 1MRFL 4R0LA 4PGDB 5KN5A 1QVOB 1RJLB 4J2XA 4D0BB 4NCC1 3MJ9A 5TPWL 1IBGL 4OB5L 4DQOH 2V2WB 3H9SA 1JFQL 2E8YA 3QFDB 1JNNL 2BXYA 3ARGA 2HYMA 1GIGL 5DVLA 2R4SL 3QHZL 1FV1B 5DDHB 3JV4B 2Z8WC 3F7VA 5IFHL 5AYUL 4D9RD 2H9GB 4LVNB 1N8ZB 1TPXB 5TE4L 3U9UA 3UTPE 4JKWA 5CEYA 2OK0L 2NR6C 3N06B 2DIBA 3VWKB 4HKXB 1S78D 2A6JB 3Q5OA 3SKOB 4LCYA 1UXSB 1DUZA 5T3XD 1EEQA 1UC6A 3O3UN 1CWVA 1N0XH 4Y5XB 3FO2A 1IGTA 4PY7B 2HH0L 3B9KB 3PQYD 3F7YB 4KJQC 4U1MB 1JWUB 5E2UL 1AKJD 1YY9C 3FMGH 2HA1A 4PJ7E 3D18B 1I4FB 4FQCH 4GKZA 1A6WH 1IT9L 3MLPA 1IGCL 4DWHA 4J3UA 4X4XA 2HMIC 5I73B 4IRSA 1GAFL 1OT2A 4NQCE 2R23A 4XT1C 4ODHH 3H3KA 1HQRB 3WFEL 3UBXB 1B0RA 5HGGS 1T1ZB 4LHUG 4PJHA 3PGFL 5T33H 4MDJB 4XMKH 2AJSL 2DL2A 4CMHC 4YPGB 3SJVE 1B0GA 2DQHH 1K3ZA 3KG5A 2WWMD 2BZDA 3BEVA 1QRNA 2XZAL 4GKOA 3T8XB 4PJCE 1CE1H 2AEQH 1K8DB 2YD5A 1T7WA 1IQDB 3PL6B 5IW1A 4XVTH 2VXVL 3O6LH 2EE3A 4F7MB 4HAFA 1ZEAH 3FT2A 1QHPA 2HTKD 1LNUA 1Z3GL 5HYSG 1X6LA 3ROOB 4M7LT 2A0LC 4XBPA 1GZQA 1JTTA 5L8JB 4PBWD 5IWLC 3WEXA 1J0HA 3G5XA 4G8GD 5ISZA 5CD3A 2MSPA 1BECA 2NY2B 2B20A 1QFWI 3Q48A 1XMWA 3AS2A 3E8UH 1J8HB 1QLEL 3BIBX 3I75B 1HSBB 3TZVD 3I3EA 1D3CA 2WMPA 3JVGA 4PJGB 2CKBH 4JG0L 5E2WH 2AJVH 2WBJC 4CVXA 5L2KB 5DUPL 3CVHB 3VMOA 3IVKA 2ICWA 2A6KB 4M8VA 5J11C 1J1PH 4LCWA 4PJ9C 3DHMA 1MCQA 4PP2A 4LIQE 3EO9L 1HWGB 2XIDA 3FO1A 4XPBL 3KJ6L 1U58B 4HH8A 1NUDA 2AJYL 3G6JB 2BSRA 3QCUH 3EYQD 3O4LA 5JDSA 4NC2B 3D69A 2XACC 2BVOA 2EC8A 3KPSA 2QADD 3NIDE 1XT5A 1MCFA 1JPTL 1ULVA 3W9EA 4KQ3L 5C7XL 5CEXB 3T0XA 1R5VA 4Z18A 2KQMA 1FORL 4ZUUB 2YS4A 5C0JB 1P4LB 4QHLB 3BI9X 1I3RB 2HVKA 4LQFL 4C56E 3NCEB 4EDXA 1FZMB 3QZWA 3ZYIA 2JTDA 1U3HA 2EKJA 4M7KL 3MBED 3IJSA 3ZHDA 1P7QD 1DBKH 3LQAL 4R7DA 5T3XH 1IKFL 4LEOB 1JZ8A 4BH8A 3QHTC 3B6SA 3SJVD 1J18A 5I18H 3B9AA 3WFHB 4Z0BL 3H42L 4NCDA 3BPOB 2ZCHH 4YHIA 1ZLUK 4F7PA 4PD4K 3VWJA 2VISB 5J56B 2D7QA 3AS1A 3P11H 4XAKE 1U3ZA 3B83A 4ACPA 2RFXA 1YMME 1FNFA 3OR6B 2V17L 2VZSA 2I25N 2BNRE 5TQ2L 3GBMH 1LO3L 1U3YA 2NY1B 1OCWH 3FFCE 3WNNA 5IMMA 3GSNL 2ERJB 1N64H 1TVBB 1LGVA 3MNWA 3RVUD 3VJ6A 4Y4FB 4P4KC 5DTFB 5JLZB 5ELIA 5JA8B 4YHNB 2MPAH 3VRLF 4NN5C 3RWDB 5F7YC 1G7IB 1NLDH 2H45A 4IRZL 2OQJB 4N0UE 3H9HB 5D1ZD 5DQ9A 1DQLL 4HUUA 2VLRA 2XI9A 4FQIL 4WEBH 1A1MA 5JW5B 1XF2A 3RWHB 4P3DB 3MYJA 2VQTA 1X4YA 1BFTA 1YEHL 4YO0A 3INUH 5DC9B 1NUNB 4CNIB 1BX2A 4WDIB 5HTSA 3LSOA 2MWCA 2BCKB 4H25B 4XP4L 4K3HA 4TTGA 4ZO7A 2JJTC 1HDMB 1CXKA 3NN8A 4HFUL 2PXYB 3KYMA 4M5YL 2BOBB 3FKUS 1KB5H 3GSUB 5F3HB 2EYTA 4GUPA 1CGVA 1HKFA 5DEGB 1QSZA 1CS6A 4C4KO 5CD5D 3F6IA 2VUOA 3ABZA 2SEBB 2CDEA 3GDBA 4DJMA 2NY3B 4H1LH 4HC1H 5F9JA 1U8LA 5IFJA 4U1SA 1OTSD 3WN5C 1ZA6B 3KYOB 2YC1A 1FYTB 3ZE0F 3RZCC 5E8OB 3KWWB 4ZUSA 3KPNB 5F7DB 3GIZL 4WNQA 5IB1A 4NKIH 3ULUL 4LPYA 4KV5F 5IJKA 2IFGA 1Q0YL 2HWZH 5EUKB 4R3SA 1FZOA 3IFOA 2DAVA 3BGFC 5EU6D 3BKYH 3IDJB 2FECI 3QUXA 4UT9L 2CO7B 2EDYA 5JIHA 1OB1A 4LSVH 3RI5F 2GTWA 4NKMA 4XAKD 3C8HA 2NY0B 1YMMD 4JFZH 4KK9C 4XP9L 2VDRL 1UWGH 3NFNB 3VXMB 1NBZB 2G60H 4FQLH 3DXAA 4M5ZH 3HFMH 4NQTA 3NFSH 3KPLB 4KTDH 1S7WB 4XC1L 4NNYB 2CIIA 5CJQH 1V3KA 3J8F7 3W39B 5L88L 2VABB 3DBXB 3HRPA 1OAQL 2A77H 3W81A 1MCPL 1UACH 1ZHLA 3HZVA 4Z8FL 4QKXB 1DEDA 3GHBH 1FAIL 1F4AA 3K81A 1NDMB 1ZA3B 2DIJA 5DRNA 2APTA 3RTQB 1WIUA 3QNXB 5I30H 5ESQA 5ITBL 4RGOL 4CVUA 4WO4C 4MJ5B 3KLHD 4KI1A 1KJVA 3OHXB 2AK1H 1DVFD 4ZODA 3F5WA 4XWOC 3BOVA 3RHWK 3WIFA 4X9GA 5E8DL 1VFMA 1BF8A 1PKQB 5FM4A 4J3VA 2P24B 1LE9A 5IWLA 1J8HE 1CLZL 1GC1L 2BY2A 2NTSP 2XT1B 3HAEH 4JM2C 5EOTB 2RCSH 1YEJL 4F2MB 2NYYD 5HHXH 1MCOL 1WZKA 4XVJL 1M7DA 4PJGE 4ISVA 4HX1A 2V9TA 1HXYA 1RZGB 3SGEI 1E6OL 1ZHNA 3QEUB 2UWEA 5L2KE 3CU7A 5TGBB 5I8EA 2AK4A 4HXBH 1NCCL 3RFZC 4TSBL 3ARGD 3LPGA 2YWYA 4GMSL 1J88A 4I18C 3VFGL 3B9VA 5EB9A 2YUZA 4L4VB 3S96A 3G6JE 1ED3A 5JOFA 2OTUB 4OCSH 1ND0A 2IBGA 2ZJSH 1NCTA 5DD5L 3RY5A 1ZXQA 4LKCA 4OM1L 3GMQA 4HLJA 1UM4H 1W72H 2P8LA 3V5HA 4F9PC 1A6PA 5J11B 4J4PD 5KAQG 4JO3H 5BQ7B 1N59B 4Q97A 5CSZA 1CBVH 4NUJB 2DBLL 1KJ2L 1NEUA 4ZS7H 5C6TL 4EKXA 1FZKB 2R56H 1NBVH 3HZYB 5IOPB 3LIZL 5B3JE 5ECJE 2ZUWA 5I0ZA 2EDOA 1BJ1J 4CADB 4WWID 4ZO6A 2FB4L 4HXAH 5MI0C 5HGHA 3H0TA 3CFJB 2FYYA 6FABL 2Q1EA 4YWGL 2Z92A 4Z7UA 3B8SA 3VFUA 1HYSD 5DC4B 4AEIH 1TETH 4G43B 3EYUL 3CUPB 4PRAB 4XCNA 3ETBF 2VDQL 1C16B 2XXCB 4XP1L 3FQUB 5I1HH 2BJMH 2NXZC 4K9EH 4E9LA 4QHNA 1TJIL 1NAKL 4HFWB 5L8LB 4C83A 3MZTA 4PV8A 2HFGH 4Z7UF 3FRUA 1S8DB 1XCQB 4GQPH 4HGWB 4ZDHB 1CXFA 2HTLD 2UZXB 1BHGA 4GXVH 4PRDB 5K9QG 3U82B 2CXGA 2ZCLH 3SPVB 3VDCA 2Y5EA 4DVRL 3OB0H 2OL3A 1D5XA 1X5KA 2W0FA 5CP7B 1QFWM 4DQOL 3O3AA 4DFIA 3DURA 3MV9B 3HC3H 4Y19A 1LEGB 5B3NA 4OF3A 1NMCB 3O3BA 1MSPA 3SDAB 2XA3A 4XNMA 1JHTA 1U8JB 4X7TB 4H20L 4NO2A 5GXBB 4W4NA 1XGUA 5T5FH 3X3GH 3JUZA 3RWFA 3L5HA 5IEHB 3PGCA 1RUKH 1ZGLP 5L2KD 3SDYH 3FTGB 3ZMRA 1TFHA 5DEZA 4YHYB 4NM4L 1MAJA 2XICA 3PWNA 2WIIB 5GRUH 1DJSA 4Z7WB 3PP4H 2R2CA 2AV7A 2C3VB 1ZE3C 4JAMB 2MMXA 3UO1H 4WU7B 3NA4A 4N0RA 5CGYC 1YEGL 3MRFA 4CRPA 1G7QA 3DVNA 5GIRA 1HH9A 4QCIA 2EIBA 4ODVH 3CFEA 3V5DB 4LRNL 4UDTA 1KCUH 3GB7B 1A6WL 3ZYJA 1CFTA 3UTSB 3L3KB 5C6WH 5CZKA 1UB6B 1HSAA 5IMOA 2ADJA 3DX8A 3SQOH 4MAYA 1IGJB 4JFOA 4Z7NE 5EOCJ 1NDGA 3QEGL 1P6AB 4NQUA 4OD2A 4CJ1A 4E41A 3T65A 1CVRA 4P2CG 2NZ9D 5HY9B 5T33L 4XMKL 3QUZA 1FYTE 1DQQA 5DJ2A 3ZE0E 1FO0A 3PV6B 2EEDA 1JZ6A 4G7VH 1BQHG 5BZWB 4M93B 2AEQL 4KV5E 5EFIA 3Q6FA 1VEMA 2NY5H 3GI8H 3IGAB 1XFPA 2DLGA 4H88H 4KRMB 2MHAB 2EYRB 1FL6A 3EKCA 5B39B 3O6LL 5LXGH 3TJEL 5EIIA 1EFQA 3VGEA 1ZEAL 4PY8I 4NYLB 1YN7A 5IQ7L 5K59F 5I8CA 1K2DB 3N1QC 3ISWA 3MGOA 3RZCB 2JE8A 3VXME 4ZSOB 5CAYB 1YMHB 1T3FB 3QWQB 4YLQT 3KJ4B 2R0LH 2I60H 3LH2H 3MOAL 4PJBA 3K4ZA 5GGVL 1AC0A 2DYPA 1NGZA 5CIPB 3TN0A 3E8UL 4JKPH 4NRYA 4MX7A 5C0CA 5T1MA 1U8HB 1Q94A 3QIUC 3VMPA 1JHKL 1K6QH 5DVOA 1WFNA 1DBML 2CKBL 4YHPB 4JHAH 5E2WL 3CSBA 5BOPA 4G7YH 2AJVL 1Q0XH 2QR0B 3BH9B 5FO7A 1INDH 4WI7A 1P7KA 1VGEH 3MRCA 4LLVB 5D2NA 2VH5L 4AIOA