3CLEL

Hiv neutralizing monoclonal antibody yz23
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
b'DIVMTQSQKFMSTSVGDRVSISCKASQNVGNIIAWYQQKPGQSPKALIYLASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDLAEYFCQQYSSFPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title HIV neutralizing monoclonal antibody YZ23
rcsb
molecule tags Immune system
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cleL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3cleL01
2YUVA 4MB3A 2BNRB 2ADGB 4MNHA 2HFGL 3CMOH 1MJ8H 4PJ5B 5JPNB 3MBEC 2XY2A 5BJTA 3KYNB 2FBJL 4LHUG 4ZSOA 4Y16C 3NA4A 5DURB 4OCRL 2HVJA 4XP1L 3FT4B 5FFLA 4UQ3B 5F72S 4OB5H 2ZOLA 3S4SB 1AGCA 3T04D 2EE6A 1BFOB 1VGKA 1JTOA 4OIIL 4QTIL 4WRLA 5HVHB 2B39A 4FTVE 1UVQA 3BUTA 3BPCA 2RHEA 1RJYA 3TC9A 5D72L 3JWDH 2D0FA 2P42B 5AG9A 5A2KH 1N59B 3DARA 4Z7QE 3UYOD 4EOWH 4MVBD 5FB8B 2NY0C 2RFXB 3QIBC 3SKMA 4AIZB 2HFTA 1Y6KR 3EJZC 3TBSB 3V5KA 5ACLA 5JA9A 1QZ1A 4HWEL 3GMPA 4I2XB 3TJEH 1Q72L 4HT1H 3H8NA 4JM2F 4E0RB 4IRSA 5FKAB 2J6EH 3V4UH 1TVHA 3C6SB 2CK0L 1PG7X 4U1HB 5EO0A 4YE4H 2ITCA 5E2JA 2ZUUA 2HFEA 3DIFB 4N0YL 2O93L 1Z9SA 3UBXI 4KK5C 4R7DB 4IRZH 1VADA 4POZC 1BBDL 1AGDA 3CX2A 5E6YA 3UP1A 4FXKB 2J8UF 4DGYH 1NSNL 4OM0H 4AQOA 3AMKA 4QXTA 4B7LA 4KROC 1OSZB 2YPKA 3TO4A 3AREC 1RFDH 4GAGL 4PJHE 3HE7B 2AAVA 3KYKL 1FC1A 1MRDH 5KSAC 3JZ7A 2VDOH 4AZ8A 4IOIB 5LGKA 3CXHK 3TVMC 5DK0A 4R97B 4KKBD 3RTQD 3I02A 2VITB 3HS0A 3O6FC 5I1GL 1IGIL 2EDQA 1NFDB 2VLRE 3ZE1F 3GM8A 4LLWB 1L7TL 4HUNB 4UU9A 4M03A 2DICA 2FX9H 5CJ8A 2EKJA 2WBJB 4ZFZA 4WW2F 5GSRA 1WLHA 1CE6B 2Y07L 3ALWA 4EDWL 4F7MB 1E27B 1F13A 1A4KA 3TJHD 5JZ7D 1HQRB 4JFYB 1JGEA 1WWWX 1NMBL 1TJIL 4MNQE 1TETH 5DWUH 4JR9H 2MSPA 1BQUA 3L95B 1KELL 4X80L 4JKWA 5E8PA 2P8LA 5DK3A 5DJ8B 4KVNL 3N85L 3LMJL 3T2QA 1JPFA 3BHBA 4WUUE 1JWUB 4XNZB 2ZP0T 4LBEA 1NMAL 1O0VA 4LEOA 2EKSA 3MJ7A 2AJYH 5FO7A 5L8LB 4JFOB 5BV7H 5I6XC 3FL7A 2G60H 5D71L 4I18B 1SY6L 3WUWG 3FAXA 2NY3D 3HG1D 1UWXK 5F6IC 2VAJA 2R2EA 4X4MA 1UJ3A 1JZ8A 4XPGH 5DQ9B 4Y5YB 5JLZA 2PXYB 4GMSH 3WFCH 1BZ9A 2EXWC 4NKDA 4NZRL 1BMGA 5D93C 1FVCA 1TMCB 3V52L 1KPUA 4YZFF 1YMMA 4HK3J 5HHNB 3WN5B 5HGHB 4XCYA 5C71A 1H9VA 3QQ4B 1I7TB 3GSNH 5SX5H 3RQ3A 3FT2B 4KKAC 4HMDA 4PUBL 4Y4KC 5JUEH 1J9CT 3WNPA 3ALXA 2DQDL 5EUKB 2GITB 2IC2A 4U6HB 2FLBT 4Z7NE 3GSOB 4K3EH 2C4FU 1SBSH 4G8FB 4G9DB 4QHLB 2A6KA 2D4FA 3WDHA 5I1DB 4MNGE 3GM0A 5H37G 3F58H 4JDZA 4UV4L 2H32H 2X4NA 1JGDA 4RFEB 1U93A 3VD4A 2H9GB 3GKWH 3EYSL 4PP1C 3PIQB 1QNZH 3VWJC 1WQVT 2YD7A 1A8JH 4M1GH 4FQLH 3S8WA 1AQKL 3AAZA 4LNRA 3ZDYE 1LE5A 5KANI 1CCZA 3IJYA 3F7YB 5BO1L 5F7YC 3U6RA 5EU6B 1T4KA 2GKIA 2H45A 1ZLSH 4X8XA 4XZUA 4UUJB 4FQIH 3H9YA 2Q76A 1D5ZB 1B0RB 1K8DA 2ZCKH 3EYVB 3CSPA 2W65A 4YGVA 4JZOB 5DUBB 1F3DJ 2EIEA 4JVWA 4ZUUB 3QPQC 5FA4B 5B38A 1ZHNA 3WBDA 3R06B 2VLJD 1MELA 4X4XB 5C8JA 3ARVA 4JPIA 1X5YA 1NCAL 5BMFL 1U2CA 4I3RL 3NIDE 5INDA 2A0LC 5FDWA 2VLMD 2X44D 5E8NB 4YDVB 1RZKC 2EDDA 1FNGB 4YWGH 4MWFB 4ZO7A 3WSQL 4EVNB 1DSFL 2V9RA 3L9RA 4FQ2L 1EBPA 1OVZA 5FXCH 4LCUA 2H6PA 4XNQB 3L7FA 5LWYL 3SY0B 4BQCA 5SWQB 2WNGA 4YO0B 1ZT7B 4S1RH 4HAGA 4YUEH 4WU5A 5GGVY 4BKLA 2I9TA 1YQVH 5ENWA 2V5TA 4GOSA 2X4PB 3JWOH 4JFPA 4HUMB 5C2UB 2JJWA 5D1XD 2DYPA 2KUTA 1AI1L 3EYOA 3KJ4B 4XPAL 3BSZH 3QI9C 4P2OA 5ADPL 1A7RH 5LGHH 2AV1A 1PG7W 3ZZ1A 3EAKA 1ZLUK 2FHCA 1NC2A 4PFEA 3CC5A 4JDTH 2BXYA 5EBMB 4EDXA 4Y19B 4G8GD 3K1KC 5L9DL 4S0TD 3O4LE 2M1KA 3F6IA 1Z0NA 5DC9B 5IQ7L 2NW3B 3VXQB 4D9QE 2VDRL 1U8HA 4ZPVB 5KSBE 1PG7H 5E8OA 4S2SA 4Y4FC 2WWKO 5D1ZA 4GH7B 5I1CH 2EIZB 2YKLL 4KH2A 4GBXA 4JQVC 3RKPA 3RI5F 1U3YA 5INCA 3DRTB 4OGAC 4OIAA 3ZSSA 3CFKA 3TA3A 5C08B 3V8OA 2ZCHL 3MQIA 3EHBD 1HZHL 4GUPA 1KB5H 5T3XH 2BRRL 1L9NA 1LGVA 3EJYD 4RAVB 3UDWA 3D3VB 2E7HA 2ED8A 4JO4H 4MCZA 5EU4B 5JMRA 3T2OA 5HYJB 1ZHLA 7CGTA 1UZ6E 4ZOAA 3R0MA 2E9JA 1DLHB 2IQ9L 2ZNWA 4MJ6A 4PTTA 2O26U 3V0WL 2I07B 4Z95L 2NLJA 4UAOB 4NPYA 1C5BL 5HHXH 5KJRH 1XGRA 1U8LA 1IGYA 4OD2A 3AS3A 1OAZL 3P73A 3EO0A 1CK0L 3KWWA 4NQCB 1XGPA 1OGAB 4LPUA 4NWUL 1CXHA 5E2TL 5DR5L 4TSAL 1JPST 3IDGB 3X14B 2ADIB 1FH5L 4BZ1H 1P4LA 4LF3A 4NQDE 3HFML 1QRNE 2NXYC 1ITBB 5F9DC 4M1CD 1OT1A 1KJMB 1A6AA 3CVHL 2HN7A 2VXVL 4LMQI 1H3UA 5F89B 1LO2H 1XR9A 5ICZA 2IFGA 4H88L 4XCCH 3BXNA 3BIAX 1WZ1L 4FZ8H 5IEKA 1T22A 1U2HA 3CFBA 1KCLA 5C6WH 4KDWA 2VABB 1G84A 4X6DB 1W0VB 4UIMA 3TYGH 4JQXA 1T5XA 1L6XA 3RVWC 4I0CC 4JN2B 2CKNA 3CPLA 5D7JD 1FVEA 3BIKA 3FQUA 2IH3A 2XICA 1CFTB 1CFBA 1N3NA 4GXVH 2VLKA 2A6DA 4HHAA 5DUML 2HJFB 4UT9L 5D70H 1FJ1A 4IJ3B 3QIUC 2R56H 4U6VH 1GRWA 4C56E 4JFXA 5H94B 1ED3B 2GJZA 2JIXA 4PTUA 1RK0B 4JZJB 1RQ5A 2YWYA 2R29H 4L1HA 5GJSH 1FNFA 1SJEB 1DQLL 1RIVH 3KPLA 3B83A 1YPZE 3CU7A 1MWAB 5DD5H 3SKOB 2OL3H 1HYSC 1T1WB 1A9EA 1G7MB 3C08H 2YHGA 3CH1A 2AEIT 2IQAB 2Z93A 3MLUH 4LVOB 4V2BA 5F9OL 3SDCB 4HWBH 2E6PA 3PWNA 4M5YL 1QSVA 4ODUB 3DSFL 5I30H 2FIKA 2XTLA 3LQZA 4PJ8D 3SE9L 2JLLA 1ZVYA 3EYUL 3VFRA 4Z6AT 1FIGL 2X7LA 2G5BA 3DX6B 3IKCA 4HGKC 4OF0A 4D3CH 3QULA 5E56A 5CEZE 1HNFA 2VQ1B 5DTFA 5EPMB 2GFBB 4PJDA 3GBNH 3UZEA 1OCWL 1DUYA 5F3HB 4M7ZB 2B2XL 5IOPB 1XT5A 5DD3H 4UBDD 5I66A 5JOEA 3SEPA 5J6HA 1OAQH 1RU9H 2D03H 3Q5YA 3MNVA 1TCRA 3B9AA 5JORB 4CMMA 3NZHH 2FCBA 1BAFH 1C16A 4X98B 3KXFB 3PXHA 3JV4A 2YPLB 4PJIA 1UCBL 1S9YA 4P48A 2D3VA 1I3RA 1BJ8A 1H3GA 4NQSA 4XNUL 3HUJF 4ZO6A 4XMLL 3IFLL 4KV5E 5SWZA 3UTTA 5E5UB 1FBIH 5JOFB 5TDNB 5C7XH 1S7VB 2ITDA 5I9QB 3RVVD 1OARL 2WIIB 3KPSA 3MV8E 5IJVB 1XGTA 1EGJA 3LPFA 3BGFB 4ZOCA 5D7LB 4BELD 4K7PL 3BZ4A 2P5WD 5FIEA 1A9BA 3WJLA 5GGRB 3FHQA 4APQC 1TNNA 2EDWA 5EUOF 1A7OL 3KGRA 3UJJL 1EFXB 2R39A 1FAIL 5ADOH 3WS3A 5IR1B 3HI6H 4FQXD 1EHLL 1CD9B 4XCFL 2VH5H 1QHOA 3O8XD 1FZJB 1A1MB 1T7ZA 1Y18B 4Z7VB 12E8H 4LRNH 3ARUA 2LAGB 2P4AB 3OKLA 3E0GA 3ILQD 3JWDC 1U3HA 2JF1A 1QSFB 3WS6C 3PDDA 3EOYG 2UYLA 3PWVA 2HAZA 3QUXB 3LHPL 3OKDB 4P57B 1NC4A 3V0VB 1GZPA 1QYGL 3RA7L 4PRAB 3SE3C 3OBAA 4I77H 1QKZL 4JY5L 4Y4HD 5ANMB 3V4PH 3C2AH 2A74B 1K6QL 4ZNCD 5C86A 1U8PB 2VDKH 4OKDA 1KC5L 1HSAA 3VXME 3NFPB 1J88A 5FDYA 5J8OA 4PRID 3C9NB 3P0GB 4Q2ZB 1MLCA 4AMKL 5EU5A 2YA1A 1AIFA 4ISVA 1X5GA 5EN2B 5FYJL 1CWVA 3S5LB 4PJEB 5F7EL 2J8UE 1ADQL 5F3BB 5DMGD 1A4JA 2CIIB 1DANT 3RNQB 4URTB 5FO8B 1I1YA 1MHPH 1XFPA 3QYCA 3RNKA 1IGMH 4UI2A 1SJHA 2VXUH 4Y2DD 2V17H 3R8QA 1J11A 3RVXC 4YFEA 3JV5A 5IFJB 1R5VB 3U36A 4KUCD 4NJ9H 4CL7A 3ZE1E 3VE0A 5CKAA 4PJ9D 1PKQB 4ERSH 4L3AA 1ZHBA 3PV7A 3MRMA 1LP9F 2R69L 4O2EA 4PRHB 5HHMD 4NCC2 4O5LL 3T4YA 2PCPB 3QUMA 5EOQL 2F5AH 1YJDC 2V5RA 5TDPB 4DN3L 3LIZH 1KT2B 1OTSC 1IQDA 2BHUA 1R3IH 3NN8A 2EEBA 2N7BA 1YUHB 5MP6H 4AEHL 1Z5LA 2RCSH 4X9IA 5GRJH 4KDVA 4PJAF 4OF5A 1EEYA 3RP1A 1IARB 5GS1A 1JHKL 3U79A 3ARDB 5DMJB 1CGTA 3I6GA 4HC1H 1ZLVK 1G7HB 4HXBH 3SDDC 3ZT5A 2IBZX 3MXWH 2YR3A 5DJAA 3EOAB 2FEEL 3MMEA 4HKXB 2AJUL 3KHOA 2IANB 3IFNH 1S7RA 4F7TB 3DXAB 2VXTH 1YNTA 3VH8G 2X5PA 3GSQB 5HSFA 3HCVB 5I8KH 3L3HA 1T20A 1BWWA 4YK4C 1BJ1H 3OHXA 2X10A 1ZT4A 3SJVA 1ORQB 2AW2A 2K7PA 1X44A 3O6LH 3RTQA 4DAGH 4DFIA 2OP4L 2X4TA 4K23L 5HHPB 4JG0L 5AG8A 1NLBL 4UNVA 4OZIB 1EEZB 4YZFE 4WFFD 5CWSA 4PV8B 3VJ6A 1AY1H 3VRJB 3ARZA 3KPNB 1WVZA 3FQTB 3SKNB 3ARGA 2H26A 4ODHH 4LKCA 1CDJA 2YN3A 5C9JA 5TQ0L 3DGGA 4HCRH 1P2CA 3FB8B 5BVPL 4PJXF 1TQBC 4OJFH 4BFBD 4YXKL 1RURH 3G9AB 3LKSA 5CIPH 5JXAH 5MEOB 2DQGL 5IMOA 1KGCD 2AEWA 3MUGA 4PB0L 4YEEA 4U1NA 2YRPA 3WUWA 2FHFA 4CRPA 4LCWB 4X7CC 4GG6A 2EDOA 2XZQH 2JB5H 1T1YB 5I16B 3STZB 3LDBC 1P4BH 2BVPB 2AI0H 4YHNA 5A40E 3GSRB 5H35B 5BZDB 4N9OB 1QACA 1NGYA 3HG1A 3FB6A 4TN9A 5IK3B 2EH8H 4JB9H 2GI7A 1T21B 1N2RB 4CW1B 2C1PB 1G7PA 3PQYB 3TEUA 3TZVC 3AB0B 5I1LB 5E4EB 2XG5A 5C6PB 1IQWL 2EDRA 2YPVL 2DLGA 1CN4A 1E4KA 2NY1D 1DE4A 3ULUL 3ESVF 2YUZA 2HVKB 2JK5A 2Q1EA 4G6FB 1CGSL 3LH2H 3D9AL 1JWMA 1H3TA 2YD4A 2P8MB 3D18A 4FQJL 3SGKA 3JWOC 4JY4A 4PJCA 3BMVA 4K9EH 5FUOH 1C5CL 2OSLB 3P4MA 4JPKH 1JF5A 2IG2L 1I7UB 4HMEA 3MPCA 4EI5B 1LO4H 3QHZL 1I8LC 2CDEB 1F2XK 3IDMA 4ZYKA 3FQWB 3ULVL 5EBWA 3R1GH 1KIRA 2X1WL 1U3ZA 2IBGA 3W0WD 2OQJA 3QO0A 3UYPA 5CSBA 3OAYK 2MOVA 3SDXF 2OMNA 2KPNA 4LSQH 5DEGB 5KG9B 3D39D 1R3KB 4R0LC 4JJHA 3X3GL 3TIEA 4BFIA 3QUKB 3VW3H 4DUVA 3RRQA 1QOKA 4U1SA 3P9LA 1Q9LA 3I2CH 2VOTA 3FOMB 1CF8L 1RZFH 4NT6B 4OZ4B 3RZWA 4NBXB 4OCXH 2QQQA 2OTWB 2F5BH 4LRIC 1UB5A 4XX1G 1FGNH 1I9IH 1ZA6A 3DVFA 4QF1A 3TN0C 4N68A 2DL9A 3V7MA 1CG9B 3ZT7A 2VLJA 3ESUF 1LEIB 1F11A 5B8CB 4UILL 8FABB 4HIJB 4GXUM 1NL0H 1S9VB 3QJFB 4RFNB 3GO1H 5EWIL 2VDLH 2A9NL 3T2NL 4P2RE 5HDQH 4LVHB 1AXSA 3ORJA 5EO9A 1OF2B 1HKLL 5TGBA 3MFGB 3VWKB 1H3PH 4MMXC 4JFHD 2GTZB 3REWB 2PW2A 1UA6L 1P4IH 4YHOH 3QEHA 2A1WL 4OI8A 5CBEB 3B9EA 2DQUH 1D5BA 1GPOH 4XWOD 1PGRB 5CZKA 3OAZK 3B2VL 5LGJB 5D1XA 4Z7WF 4YBLB 2EZ0C 2BSSB 3B3IA 2AJVL 3MYZA 1BBJA 3BP4B 3MJ9A 3GSWB 4JHAH 5GGVL 1TZHA 4N0RA 5GJTH 4JANB 3QG7L 3ZL4L 1A1OB 1G9NC 5KZCB 4NDMA 2GTWB 4PJGF 3SGEI 3IS0X 4G8GA 4KY1L 5CS7A 2X4RB 3FHAA 4KHXH 2ZPKL 4MDIB 5BZWB 4NQUA 4TUOA 3E2HC 4RSVA 1CE1H 4P0DA 4LDLB 2E27L 1T3FB 4FS0A 4JG1H 3PV6B 2P47B 5I74B 1JHTA 1UCTA 4TQEL 2MCG1 4PB9H 2UV3A 5GRYA 1XGUB 4FRWA 5I1JH 2HTLD 3H42L 1RULH 3GGWB 4L8CB 5D7KE 2W0LA 4WVRA 5EIIB 4R4FH 4I9WE 4AG4L 1Y0LB 3FRPA 5D8JH 5FOJA 4X9BA 1GC1L 4ODXA 3WKNA 1NCCL 1S7SB 4KDTC 2R1WB 1R3LA 43CAA 1Q9KA 3PG2A 1IAOA 4G3YH 1DLFL 3AS0A 1NAML 5GS2D 3BKJH 1ND0B 3DUSA 4LHJB 3WIHH 5IUSA 2O5YL 5IVXB 5K9OB 2EICA 1IE5A 3OR7A 4XBPB 3CNKA 5CJQH 1QO3B 2Z0BA 2OZ4A 2R15A 2Q8BH 5HGBA 1YECH 1UKTA 2XN9E 3LS5L 4NO2A 4BSWB 4BFGA 1A6UH 1NCBL 5GZOD 5A43C 2QQNL 4JPWH 1K4CA 2XZZA 5F7WC 3O9WC 4JKMA 5KW9L 1BVLA 2QR0A 1YEDB 2HP4A 1YEIL 4X0KB 1DL7H 3NGBC 5D96B 1U8QB 4TVPD 3IF1B 3D3VD 1LHZA 4RQQA 2R1YB 3PWPE 1MH5A 2CXKA 2V2TB 2MPAL 5EIQA 5D7JA 3UBXA 1GGBH 4QHKJ 3RZCB 1OB1A 2VZSA 1XMWA 5C70A 1JV5A 1V7MH 4GS7B 4YHZH 3X11B 4FFVC 5JQ6L 4LLMB 3QG6B 5CFHA 4M8QB 3ROLB 4MAYB 1T66C 5F8QC 5C0JB 2FSEA 1P5VA 4X83A 5ALBL 2E9IA 3UAJD 3AMLA 1A6ZB 4BSVA 1U8IA 1NFDF 5IMKB 3O3UN 2R0ZH 5E99H 5C0GA 4U0RC 1DQJA 3PABB 5D2LA 2ARJA 5TJWK 2LVCA 3QUYB 3OJVC 3NIGF 1NAMB 1MRFH 2IH1A 3RWIB 4R7NB 2XY1A 4E5XA 1JZ3A 3MBEB 2GJ6E 1QR4A 4Y16B 5DDHA 1WBYA 5HDBF 1C08B 4YHKH 3MREB 2R2BA 5EO1A 5L2KB 4JRYD 1Q0XH 4ZAKC 5JHDB 1BFSA 4PJ8A 3NCBB 4LQFL 2R2HB 4KRLB 4KI5D 5C2BL 2QQLH 4CNIB 3SKJH 3U1SL 5IHUL 1IC5H 3V7AE 4ETYA 4F2MB 3HAEB 1HIML 2X4UB 1CD1B 3MRFA 4G6AD 4S10A 1KACB 4L4VE 1W72A 3QIBB 1OQOA 5C0DA 1OLLA 1K2DB 3V5HB 4CGTA 3BT2H 3UJIH 5E5RB 1UH2A 3PE9A 5D5MB 1QVOB 4F37F 1D9KB 5CJOH 4N0UB 5KVFH 4FA8A 4GLRI 1A6WH 3O2DH 4ODVH 1CDUA 5DHYA 4MXVF 2GSGA 1WIUA 3S37H 2CMRL 4YX2H 1J1OH 3HMXL 4I4WA 4F37K 1VFUA 3TO2A 3SDCD 1WF5A 4XHQA 2BNQD 3DX7B 3CXDL 3CFEB 2BHZA 5T1KA 4KROB 1P7QB 1GGYA 4X4YB 5E2WH 3AREB 3O41A 5C09B 2P45B 5KSAB 1AXTL 3MYJB 1JIBA 4ONFL 5IB3A 3BN9D 4P4KD 1IC1A 2PR4H 4UV7H 3RDTC 1FNEA 1NCTA 4RWHA 43C9A 4FQXA 4W4OA 3O6FB 3O8XA 5ACMA 5C0CD 1UH3A 2NY7H 5B4MD 3CFCL 2DDQL 4PLJD 3MV11 4M3JA 3D85B 4P59H 4GRLC 2WZPD 4ZQKA 3P2TA 4RGOH 5I71B 5JR1H 1P53A 3NA9L 1MQKH 2IAMD 3C87A 2GK0B 3MBXL 2XZCH 4G6JL 4QRRD 4PGBA 3UTOA 1K8IB 2CJUL 1XF2B 3SBWC 1LP9E 1KCSL 4OV5B 1I1RA 4MJIB 2VB5A 5CUSH 5F44A 5TDOA 4KAQH 3ARQA 4XBGA 4Y4HA 5KTEH 1C12A 5EU7C 2WUCH 4PJAE 4PBWD 1GZQA 5D2NA 4D9RD 1H0DA 1ES0B 1CDGA 4GG8A 4PRIA 5D1QC 2ICEB 3C5SB 1CU4L 3ZTJH 1FP5A 4GMTH 5D7SH 2AABL 1MCDA 5BQ7A 3IETA 4G7YH 1FLRL 3HNSH 4M00A 3IFPB 1EK3A 1U6AH 4WI8A 1NFKA 4NNPL 3IKKA 4M4RA 3V2AR 4GRMB 1F4XL 1OAXL 5C0NC 4TUJB 5I6XB 2Z8VC 2UUDK 1S7UB 2JJTA 4OT1L 2VSCA 5CMAB 4AENB 5C0AB 2HT2D 5FM5M 3O6ML 1RZKL 5F6IB 4PS4H 4FG6D 1BEYL 3VD3A 2IGFL 3HC0A 4JGMA 2DIBA 1PQZA 4RIRA 1GGTA 4Y2DA 1BIHA 4RWYH 5FYLL 5ICYA 3R0NA 4QOKD 4P2QB 1V7NH 4LDEB 4IHOA 4DUXA 1AHWC 2L7UA 2V2WB 5EBLA 1PX3A 2BSTB 5GRXG 3CLEL 4LSVH 1BIIA 3FO1A 3PGFH 4L4JA 3T0EE 1R5IB 4Y4KB 2DQEH 4PRDB 3N06B 2UVEA 1U91B 4N90D 2KQNA 4GAYB 5SWSD 4NKIL 3S36H 2VQTA 1PLGH 2XXMB 1FFQA 3LN9A 4WI7A 1ZTXH 1VCAA 3MRBA 3VH8A 4ZXBD 1KIUA 1D6VH 1I9EA 2ADGA 3KDMB 4PJXE 4PJ5A 3HLAA 4M61A 2I26N 3VWJB 2Z4QA 1I1AC 2FGWH 3NCJH 5I15H 5DJ2B 4UQ3A 4ZS6D 2X1QA 1SYVA 1VFAB 2DQIH 2IMMA 3VDAA 4X8JB 3G5ZB 5C0RH 3NACL 1MCBA 4P46D 5I2IB 1VACB 3QRGH 1RVFH 4LGRB 5TE4L 1W0YT 3MTRA 4X6CA 2X05A 1G6RH 3MOQA 4L4TE 4K94C 2AP2A 3SE4C 4TUKH 3WNNA 4PJDF 4OLVL 3K2UL 4HS8H 4M43L 5FB8A 4WEUD 4QHKI 4Y5VC 4AIZA 2YZ8A 4X7SL 4PRHD 4X6DF 3V8CA 4NKOA 4JVUA 1BOGB 4R4BB 5DZNA 3WNKA 4QRSB 2CGRH 1A47A 5FCUL 4N0FB 3B5TA 2GIYA 4ZOBA 1NCWL 2VR9A 3QA3A 2SEBA 4LP4A 2RJMA 4XC1L 3QCUH 1H5BC 4YNYB 1JF6A 3QI9B 5T33H 4R7DA 4JJ5B 5ITFB 1MVUA 5IKCB 4FXKA 1QLFB 4YXHL 3DMMC 3OAUL 4KZDL 1RZIA 2WMPA 4JKPH 2IAND 1X5KA 3B9VA 1AXIB 3BJLA 2OMBA 3CLFL 2NY4C 4MS8D 2X09A 4MZ2A 4XTRC 3SDXE 2UZIH 4ZNEA 1TQCC 4Y4FB 1SBBA 5IBTH 3ETBF 1HQ4A 4GW4A 2DL2A 2Y36H 4IDJL 3MA7A 3QDJB 2RBLA 4O4YL 2VITA 1QSEE 3EOBB 1NCDL 3F62A 3QAZC 2XQBL 3I84A 4Z78B 3VXNA 1U3JA 2F54E 2L7JA 3ILPB 2HT3D 4M3KB 1D7FA 1OSPH 3ZKSD 1GH7A 2ATKB 1E28B 4D9LH 3U2SB 4KMLB 4WHCA 4YDIH 1IBGH 3NAAL 1A3LL 4XMPL 1CD0A 2WBJA 1KCRH 1CE6A 5ISZE 4F7MA 1PD6A 2FJFA 5T3XD 4DUWA 3JV6A 3NFNB 3KHQA 3LKPB 5ETUA 5JIPA 1B2WL 2DWEA 1BM3L 1WICA 3O11B 1B4JH 1ACZA 3GIZH 1RUQL 3CZFA 4TVPL 1YYMH 2Y06L 3L95A 3TBWA 1FO0L 4YFLF 4Z7WE 1IAII 2W9DL 4JFZL 1KPRB 4P5MB 4MA8H 5EU3A 5DC4B 3HN3A 4J4PA 4MCYB 4FZEH 3W0WA 5ALCL 1IL1B 4C83A 4XVTH 2NXYB 1YN7B 1JWUA 4ZTPH 3LEYL 1UWEH 1RUAL 1HHGB 5IROA 1U42A 4PJGE 2EEAA 2HLFC 4BFEA 2AJ3B 2NY5H 1AR1C 3D39A 3QEQB 4JFOA 1X6NA 4HBCL 3H0TB 2R8SH 3MO1B 5IW1B 2W0KA 3DX8B 4JCLA 1L4IA 4WV1C 3VFVB 4I0PC 5JDSB 3BWUC 4L1DA 2B4CC 3TH4T 5DHVH 2BNRE 5DQ9A 1SMOA 3TNNB 1R3JB 3HPLB 1YDPB 4LSPL 4NHCL 2BDNH 3FRUB 1PEWA 2MCPL 3QCVH 2VDQL 3INUL 3BUYB 2FZ3B 3WN5A 2CLVB 3F7RA 2GEEA 4G8EA 3FT2A 8CGTA 2Z91B 4XHJD 1XIWC 3QIUB 5IBUG 2GITA 5IV2B 3GSOA 1MI5B 3T1WA 2NNAA 4WO4B 4Z7VF 4G8FA 3LY6A 3WFHA 3MC0A 3HE6D 4H5SB 1DVFD 4HPOH 4M02A 4XP6L 4P4RA 2WLYA 4I0KA 1I4FB 3PIQA 5ID1B 3FB5A 1U9KA 5HI4D 3VFNB 5LAXB 1JE6A 2G2RA 5JOPD 3N1GC 3MRDB 4I2XE 4F9PA 1FO0B 3FONB 5IB2B 3FQNA 5DLML 4Q6IA 2K7QA 1F6FB 1B0RA 4Q9QH 4JRXB 4HG4K 2OBGA 1IZKA 2HLAB 3WYRA 5FA4A 1WAAA 4ELMB 1DDHA 1O7SA 1I1FB 4HMCA 3R06A 1FNSH 4X4XA 3JWDL 3O45B 2DQCL 3LRSB 2X70B 2DI7A 4Z5RA 3H7LA 4PJEF 4RRPG 1MHHA 1SEBB 1VKXB 4EVNA 2GHWB 3HI1A 4QY8B 2EDJA 2YK1L 4OZHF 2A6JA 1FZOB 4BK4A 4XNQA 4D0CB 3SY0A 3QP3A 3TJEL 4U7MA 1HEZB 4OZGA 4FTVB 4Q9RL 3ZHLA 3V4UL 1UEYA 4PG2A 3VXSB 2CDGB 2V7HB 2X4PA 4YIQA 1FIEA 1BVKB 3U7AA 4YE4L 3MRKB 1SJXA 4S1DC 5DJXA 1B9ZA 4Z8FH 3S96A 1NFDE 5J12C 4IRZL 3T77B 3QCTH 1IT9H 1IVLA 3C60D 4HWUA 2XTJE 4PGEB 4U31A 4DKDC 3O2WH 4IEFB 3RVTD 4KRNA 2BSED 1D3CA 5EBMA 4OM0L 4DGYL 1KENH 3NIGE 4JO3H 3RWGB 4FMKA 4KKLC 5JO5B 4U1LB 2D2OA 2NW3A 4GRWF 1RFDL 5C1MB 4KRPD 3C6LD 1VPOL 5ICXB 2F53D 1KIPA 1XF3A 1J7VR 3ECBB 3HNTH 5HDBE 2VDOL 1TFHA 1WJ3A 1MEXL 4NQVB 2YD1A 1A7NH 4NQXA 3B5GA 2EEDA 4APQB 2YOCA 3NH7H 1QLRA 3KLHC 2CO6B 4RAVA 3D3VA 1G9EA 5HYJA 2VLLA 5SV4A 3L7EB 5E03A 5I76B 4PJHB 1QBBA 5ERWB 4OCWH 5DRWA 1G7LB 3DETC 4KJQD 4YDJB 2FX9L 1YJDL 5DT1H 1ACYL 3IYLW 3O0RL 3VXRE 2PO6D 2J5LC 3QSKB 2YSSA 2X9YA 4XI5D 4PRPD 2HKHL 2JELH 3NMEA 3ZKMD 1TETL 1WTLA 4OZIF 3X14A 1I3GL 5C3TA 1NBYB 4MXVE 5KS9B 3LD8C 1V3KA 2OI9C 5GZNC 4Y5XB 1KJMA 3QUZD 1FZKA 1IILE 2PYFB 3MA9L 4N8CH 5E5MA 2DD8H 3DECA 3VXUD 1A7QH 3VRIB 2G60L 3A6OA 3O6KL 4JFQA 1G0YR 3RWDB 3S9DB 4JRYA 4KTEH 1J1PH 3EYQD 4YDKL 1NCNA 2ZSWB 3WFCL 4JN2A 1G9MH 4WUUB 1ZGLA 4ZUWB 1RIHH 4PGCB 5K9JH 1J86A 1CFTA 1B90A 4YHPA 2VAAB 5EU6E 2F74B 2UY7A 3GSVB 3TT3H 2HJFA 2FO4B 4J3VA 4YHLH 1S7QB 3KYOA 1D5IH 2FWOB 5JUEL 3ZYOA 3IJHB 4WFEE 5H94A 1ULVA 1NKOA 1JYNA 5C0BE 1CFSA 5DA4A 3BAEH 1F90H 4DCQB 1ORSB 4DKFH 3G6AB 1KFAH 3F58L 5C9KA 1EJOH 1UZ8A 4NZDA 3OXSB 1S3KL 1MLBB 3GKWL 3G6DL 4HIEA 4ZUSA 3CVIH 3MODH 5F1KC 1FG2B 4OLWL 4HD9A 1T03H 1HINH 4M1GL 1MWAA 2B0SL 4ELKB 3T0EC 4DZBA 1T1WA 3MLXL 3MX0A 2BHYA 1RZ8B 2Z31C 2K3TA 4G9FD 2ZG3A 3RWJB 4NNXB 2IQAA 5KVDH 1ZLSL 3SDCA 2Q87A 3FJTA 2BNQA 5E6ZA 2ZCKL 3S35L 1I8KB 1MVFA 1WBZA 4Y1AB 3O3AB 3UPAA 5HYSB 5J6GA 2A77L 2R4RH 4XXDB 3OKMB 4YK4B 3K4DA 3OGCB 5CJ5A 3DX6A 1I1CA 2HWZH 1KB9J 1YEKH 2BFVH 1EHXA 2Y72A 1J12A 1I8MB 4CVWA 5IGXH 3TBYA 2YRZA 3V6OE 4JM4L 1RZJC 3V6FB 5F3HA 3PP3H 5IOPA 1U8NB 1UM4H 1YY8B 2FECL 5C0CA 4JPVH 4S1RL 1IM3A 3I6LE 4YUEL 4GJTB 5JORA 2VR4A 2DQJH 3IDXH 3RWFA 1D9KD 4MJ5A 3WCYA 3GMQA 1AQDB 3JWOL 2IAMA 5C08E 2YUWA 1T1XB 3CSGA 1IM9D 4QRRA 3BSZL 1QA9B 1XH3B 1KN2H 3L3JB 1A7RL 1IKFH 3BKCL 3DURA 5LGHL 2HMID 1H15B 4MX7A 1TQBB 5IMMB 5IHZB 1QFWI 2IADA 5FKPB 3SPVB 1AP2A 5JOFA 1BREA 1KXQE 4M6OH 1OQXA 3F12A 1MCHA 2XA8H 1ZVSB 2WIIA 3B2UC 5CGMA 5IJVA 1PG7L 2B1AH 1ZXQA 5E94B 2QEJA 4NQCE 1OGAE 3NZ8B 3M8OH 3LDBB 3VGGA 3QWQB 4PGDB 4JY6B 2QSVA 5C07B 1N26A 3VA2C 1KB5L 5IR1A 1ZT1A 3KVQA 5IIEB 1EEUA 5HHOD 4JO4L 4XC3L 1N5AB 4WTWA 1EGJH 1IEBA 1Y18A 3ULVF 1IKNC 5GGTL 4QRUB 4XP5H 2CKBB 4DEPC 2K9UA 4LLUA 4NUJB 4PJDE 1QRKA 2GUOA 5LBSH 4QOKA 5HHXL 1S78D 5KJRL 4O2FA 4FQHB 4QTHB 1EJ6A 3OKDA 4KPHH 1ZV5A 1VGEH 3V0VA 4X6DE 3H9SE 4MJID 4Z77A 4TNWF 1CI5A 4PRAA 5A2FA 2Z35A 2ESVB 5ANMA 2Y5TA 4F8QA 3LKQA 4G7VL 4O51A 5SWSA 4BZ1L 1G9NL 3ARWA 3DPBA 4HUWB 1INEL 4WI2A 4ZDHA 4XPFL 4I3SH 3OJDA 5EN2A 2HJKB 5CJXC 2BC4B 3VGFA 4XCCL 1LE9B 4R0LB 4FZ8L 2P7TB 5HYQB 4NO5B 1CDIA 5IVXF 2A6IA 3HC4H 1AGEA 5C0AD 4LDOB 4NM4L 4PG9B 4WHYG 5E8DH 4U1JB 3K8LA 3TN0B 4O2CA 4F7EA 3ARFC 3QPXH 3CZJA 4MA7H 1KB5B 4GFTB 3TO4C 1S8DB 2DMBA 2FYYB 5D70L 3VFGL 2CIKA 5CEZL 1OTTC 2R56L 3EFDH 5CJBA 5I0DA 1BP3B 3D0VA 3TM6A 1DBKH 2CSPA 5IFAL 1S9WB 2CDFB 4PRHA 4QXGH 1JWSA 4KHTH 3JTSB 4UQ2B 5KVMC 3AU1B 4JLRB 4FABH 4ZFGL 1KT2A 4HFUH 3EDFA 5DD6A 3RKDD 1XCTA 1RIVL 4XAKE 4AY0A 4R90L 2UZXB 5IM7A 1CVSC 4RGND 4BQ6A 2L0DA 3HI5H 5IB1B 3C08L 2Y5EA 3QFDB 4C56B 1WUNT 1G7HA 2AGJH 4AH2B 4HW6A 4PV9B 1RMFH 4MD5A 5ESVB 4FFWC 4JHBA 4HKXA 4ORGA 3H3PH 4LSTH 2IANA 3PWUB 3S3SA 3OKEA 5I30L 3DXAA 2NY5C 3EO1B 4LOUD 2PW1B 1YPZB 2DB8A 2V7NA 3E2HB 4XVSL 4P5TB 1M6OB 7FABL 1KLGA 3TLRA 4B7IA 1HYRC 4HJ0D 3VDBA 2E9BA 4YXLL 4OCYH 3KLAA 4Z7OF 4NP4H 2PTTB 2OTUB 3BD5A 3D5OF 1I9JH 4NC1E 2GCYA 5FV1L 5FO9B 1I85A 3DBXB 4ZUVA 5HHPA 2XNAB 3MV9D 4J7RA 5DD3L 1TCMA 5CD5D 2YMXH 2BOCA 1RU9L 4JFDD 5D7LE 1EEZA 4GKSA 4K8RC 4PV8A 3PXJA 5BCAA 4XNXH 2W1NA 5EZJB 2X4OB 2X2YA 1A6VH 1UJ3C 4NRZA 3LZFH 3TWCH 5FF6A 3GHBH 1NEZB 1CTOA 1MFAH 2BMKB 2IPTH 3ARBB 3FB8A 4M7JL 4NKMB 4Z7VE 5C0IB 1NBZA 5HPOA 2FJGB 1QSFE 5C7XL 2WP3T 2RQ8A 1OP5H 5GIRB 4IM8A 5KVGH 3STZA 35C8L 1AKJD 3WXWH 1KJ2L 2XTJC 3GJEA 1LEGA 3RX8A 1GL4B 1B0GB 1X7QB 5E6ID 5ADOL 2MHAA 1EV2E 3BGAA 4XNMB 1XR8B 1NANI 3NGBB 1YNLH 3FMGH 5IK3A 1V3MA 4LARH 3LB6D 1N2RA 3KPRE 2HKFH 4S1QL 4LRNL 3S98A 2C1PA 1JGVH 3SHSA 3T08A 4R3SA 3PQYA 3TCLB 4KKCC 2AXHA 1CS6A 5F7DA 5DMIL 4PJEE 1TENA 3IDJA 5A2IH 4YHIB 1T6VN 1MAMH 4OZHE 2ED9A 2VTFA 2OK0L 1I3VA 2PYEB 2X4QA 4H1LG 2DTMH 3ALPA 2P8MA 4I77L 4I5BA 4UTBL 5B39B 4OFKA 4B41A 4WI3A 3HE6A 4U0RB 1DVFA 1ZSDB 2ZG2A 1OTUD 2LU4A 3FQWA 1IAMA 1PKQE 1FYTB 1ZGLM 4G43A 1AO7D 4IOFD 1EVTC 4CDGC 5DEGA 1LK2B 2JTDA 2YN5A 3QJHB 5DGQA 5KG9A 1R3KA 4YPJA 4JM2B 3LN4B 2QADC 4RRPA 3QUKA 1I8IB 5EA0H 4P2OC 3HZYB 4U4BA 4GRWE 1TITA 3FOMA 4NT6A 4OZ4A 2G75B 1BD2D 1ZWIA 4OLUH 4ZAKB 4HS6B 3WLBB 1FE8L 4HPYH 4KGJA 4EBQH 1KJ2B 3MRHA 3MRQA 4LCCA 3REVB 3VFTB 1BQLH 2V17L 2OL3A 3MV7D 4WIQA 3SDAD 1CICC 4KWUA 5F7UA 2J8UB 4NJ9L 1UWGH 4NUGL 5T5FH 2W0FB 1S9VA 5D1ZC 4GBXC 4HWBA 1FV1B 1T6WA 2XKUA 3SGDI 3EJJX 2HH0H 1OF2A 2X40A 3TA3C 4BUGA 3VFSB 5FOBA 4D0DB 3VWKA 4WO4D 5FYJE 1U8KB 3REWA 3LIZL 5I8CB 2C26A 2FH6A 3MACH 3RIAF 5KOMC 2RCSL 4HIHB 1NCUA 3X3FL 4GAJH 5D6DC 3NABL 2ID5A 1FFPB 3A6BH 1DBAH 1YEGH 3K2MC 2E7CA 3WFEL 3PNWB 4HC1L 3C60A 4HXBL 3L3DA 3IJSB 3T0XA 4OZIE 3MXWL 3RIAK 4R8WL 4ODBD 1GSMA 2NCMA 1NDGA 5HGDA 1NDMB 3IFNL 4FNLL 4J2XA 4WW2B 2ZUSA 4CJ1A 5L6YH 4JRXD 4NJAH 1OGTB 2DQFA 4MDIA 5I8KL 2NXZD 5BZWA 4XCEA 3I3BA 1KULA 3MJ9H 2F53A 1MIMH 3K4AA 5DEFB 2R9HD 4N1HB 1F02I 3L3IA 3BZEA 1V5JA 1A14H 4DKAA 5F71A 3AXLB 4LPTA 1E4XI 2MNUA 4DAGL 1G9MC 4LCWE 4LSSH 3GGWA 2VLJE 4L8CA 4HJJL 5FA3B 3BP6A 5EIIA 2PN5A 5I1KH 4OD3H 3DNKA 3HPJB 1AY1L 5FUZL 1CLZH 1CFNB 2NZIA 1QLEL 4MLIA 4GRLB 4RCAA 5IP4A 5HVGB 3IAQA 4ODHL 4OTXH 4JQXC 1TVBA 2PO6A 5F7KC 3U7WL 5IB5B 4HCRL 1WGOA 4G8IB 3RWEB 1AE6H 1JTPA 1F58L 1ND0A 1JF1A 1S9XA 4MJ2A 1J05B 1UXWB 3I75A 4HDIB 5HVWA 4XBPA 5EC2A 4MA3B 2FX8H 1QO3A 3U0TA 2XZQL 2F8OA 4MSWB 2I5YH 1FCCA 5T3ZL 4P23D 2X1PA 5D1QB 1X4XA 3QUZA 1U95A 3ES6A 4MB5A 1J8HB 1EZVY 1IGJB 5DO2C 4R6UA 4APQD 1FPTH 4NO3A 3VXUA 2QKIB 1CLOL 1YEDA 5CKGA 2IPKB 4X0KA 2OZ4H 4K94L 5FYKH 1U8QA 1N5YL 2EH8L 1KBGH 3LQAH 2R1YA 1JNJA 3DRQA 3RVUC 4HS3B 5BRZB 4OQTH 2XXCB 5JW4M 5F6HJ 2HT4D 2MTPA 4WJ5A 2OYPA 3U30B 3DJ9A 2NW2A 5F88B 1S7TB 4XVJL 4YPGA 4LLMA 3QG6A 2WWMC 1AJ7H 3ROLA 1AHWB 1XF5B 4RISH 1JJUA 5ESQB 4UNTA 2VLRD 1ZLVH 2EYRB 1BJ1J 1K3IA 1LEKB 15C8L 3KPQA 3QDME 4Y88A 1LO4L 3ZTJG 1RZ7L 1WC7A 1WISA 1NBVL 3U0PA 1TTUA 4TYUA 1OW0A 3B8YA 5TH2B 3R1GL 3ZKND 3LVEA 2FL5A 1ZA3A 2A83A 3P4NB 1EAPB 4L8DB 4W6WB 1BOYA 1I1AB 4MNQD 5HD8C 4Q6YA 3T2PA 1C08A 3L1OH 4G9FA 1W8NA 3BZDA 3PL6D 3I2CL 1VENA 1YEEL 1RZFL 2ZNXA 5ACZB 5HGAA 2F5BL 1FL3A 5DJ0B 4P9HH 1FGNL 1XZ0B 1I9IL 3VFMB 2FX7H 4D2NA 1FGVL 1KCVH 4DVBA 1CXLA 2DQHH 5ID0B 1RSFA 3M17B 1QQDA 4I48B 3OV6A 4K3GA 4F2MA 2G9HB 1R3HB 3NOIA 2Y4SA 2VDLL 3QIWD 1YYLH 4KTDH 3ULVE 3WJLC 1T04A 5HDQL 1Z6JT 3MCLL 4Y5VB 4TPRH 3E6FA 5GS0D 1H3PL 4HWZA 1P4IL 3D1MC 4YHOL 4WHTB 3GHEH 1D9KA 2DQUL 5FGCE 5TF0A 3F5WB 4X6BB 4CN6A 1QTYT 1IM9A 3W82A 3WLWD 1U3HC 2H3NA 4OFYD 1MF2L 1W72H 4ZD3H 4JHAL 4UTAL 5GJTL 4P2RB 4PP2B 4EN3D 4FQQA 2XPGA 1JK8B 3D0LB 5DQJB 4OIBA 1HHIB 1OD7A 3DX7A 2DBLH 2RGSA 3DMMB 2VRAA 3HRZA 4TOYH 4S1SH 3RGVD 1PZ5A 1NJ9A 4KHXL 4U3CA 4O58H 1CE1L 4X4YA 5FGRA 2B4CL 2NY4B 3OR6B 3MOAL 2CR6A 1FL6B 4JG1L 3OXRA 4UIKL 4EQ2A 1Y6NR 3M1BB 4KK9D 4P3DB 4AT6A 5IVXE 5CIPA 4PB9L 4ENED 1RULL 5DF0A 3QAZB 4GKNA 4W6YB 5HHOA 5HHQB 4XGZB 4R4FL 3G6JB 4HFWB 5E2VL 1D6EA 3EYFA 3X13B 5D8JL 1SYSB 4F7PB 1CT8B 5J11C 3C5ZB 4ELMF 3ARPA 3S88L 4M6AA 4K2UL 2ZOKA 1HN1A 5F1NB 3B5HA 4K3DL 4OLZL 1HHKA 4G3YL 3L5WB 5IESL 3P4LA 4I8DA 3VFPA 3U48A 4PJFA 4MJIA 3VXTB 4Q0XH 4OZFH 3FKUS 4U1MB 3EDJA 2BNUB 5CINL 1NLDL 2B20A 1TNMA 4HK0B 4JFFB 4MVBC 4EI6A 1J0YA 1KSRA 3EO9H 2GT9B 4PD4K 3GI9H 4HJGB 3C5SA 3VFUA 1F8TH 1CXEA 2YD8A 4TULL 5F9WC 1FG9C 1N4XH 5DRXB 3N9GH 3OWEA 3L3KA 3FTGB 4JEGB 4F7CB 2ICWB 4GRMA 5GS1C 1P9MA 4TUJA 1S7UA 2BVOB 2IFFH 5HYEA 5CMAA 5D4QA 3O4LD 4WV1B 3PGDB 2P5WE 4I0PB 3K8MA 5C0AA 4KI5F 3T0WA 1SEQL 4P5KA 3BD4A 2XN9B 1KTLB 1DQQA 1MAJA 1GGBL 2XRAH 1WIPA 4Z7OE 1ZS8B 2NY6D 4NYLB 1HWGB 2R1XB 4G6ML 1V7ML 3OAZH 3VFOA 4YHZL 4RFOH 4P2QA 4X9GA 5DMKB 5L2KE 2DM2A 4NN5C 4OAWA 5JHDE 3GMRA 1R5IA 1XIWB 1CL7L 5EFIB 2R0ZL 3I3EA 4F58L 5TFSH 1PYWA 4KKBC 4BJLA 3RTQC 4XPBL 3MJ8B 2VQUA 3UTQA 3DSNA 1J0JA 4N1CA 1F4YH 1DBMH 3CDGB 4LKXB 4OFIA 4G42B 1IC7H 3OKNB 2HG5B 2GAZA 2BY0A 4DW2H 3CUPB 1U92A 2ATPA 1MFNA 3LEXA 3VWJA 4AK1A 2JJVA 1ETZB 5DJ2A 2ZJSH 4YHKL 4JN1L 1VFAA 1BZ7A 2BVQA 4LASL 4EUPB 1Q0XL 3TJHC 3LPGA 4XB8A 3FFDA 4NQDD 4Y0GA 1VACA 1QRND 2W9LA 2YXFA 3OJ2C 5KS9F 1A0QL 2OR9L 3HUJB 1KJ3H 2GJ6B 2NTSP 4WU7A 4JFEB 1E4WL 2NY2D 3LAFA 1A6TB 1MFEH 4LLAA 4WI6A 2EE9A 1FSKC 1OP3K 3K81A 1EFQA 3MV9A 3G9VA 4J23A 1F3JB 4GT7A 4ACPA 1YEFH 5F7FA 3BT2L 3O4OC 1BOGA 2J88H 2WINB 5C09E 5IBLD 4QRSA 2NY3C 2Q86B 5I8EA 3ARXA 2FD6H 5EUOB 3FFCB 4RA0C 1A6WL 4CN1A 4U3HA 4ODVL 4P3CH 1BGXL 4L8BB 5H8DA 4KZEH 2DJ4A 3S37L 1TLKA 4YX2L 4Z0XB 2UVFA 3J8F7 5EC1B 1FC2D 1LO5B 4YNYA 2H1PH 2WV3A 3TFKD 5D9SB 1J1OL 2ZUWA 5J12B 4L4VB 1YQ2A 1A1NB 4DGVH 3QHFH 3P9MB 4CVZB 4XP9L 4YDLC 5I18H 5FGBA 1MFBH 4UT6H 1BFVL 2BVUA 2YC1B 3SGKC 3WL9A 4P5TD 1XGQB 3HHRB 3HC3H 2F19H 4N9GA 1AKJA 2AXJA 1UQSB 5CZXD 3DVNB 1N8ZB 3HZMA 4X99A 4LCYA 1PKOA 3CDCA 1R0AH 5EORH 5E6IA 3ULSB 2PR4L 4IRJB 4UV7L 3WIHA 3EOBA 4OBRA 2DI9A 2VXQH 4H1LA 4Z78A 2ZSVA 2FBJH 1UG9A 5IJKC 2XYCA 2JCCB 4MD4A 4JKKA 4OCRH 4P59L 2ATKA 5CEXB 4YHML 3QNXB 4RGOL 4YBQD 1E28A 5JR1L 3ABZA 3U2SA 3MLWH 1MQKL 5IMLB 1VEOA 1NC2D 2XWJA 2XZCL 3OKYA 5EG6C 4QTIH 2J5LB 3ARBD 3G5XB 2XKSA 1WWBX 3NFNA 3LKPA 4OKVB 4KAQL 5D72H 3O11A 4WFGE 4HGWB 2WUCL 4BQ9A 5E8EA 3QEUB 4MDJB 1KTDB 3FO0H 3K1DA 1KPRA 2VL5A 2Q6WB 3AVEA 3BPNC 3LN5A 1ROWA 1T0PB 1MUJB 3LD8B 1IL1A 4Z7UB 2OI9B 4HWEH 3CFDA 4GMTL 5D7SL 5JNYA 3QDGB 1AO7A 2AJ3A 5FAAA 1Q94B 3QEQA 4YGAB 1RUMH 5I1EL 5D1XC 5AD0A 4MQXD 5IW1A 5L0QB 1M7IA 4WI4A 3GIVA 1AGFB 2X9XA 4DK6A 5SX5K 3VFVA 2DM7A 1I7ZB 1K9TA 2DMKA 1CVRA 1KV3A 3MV8D 3TNNA 1RZJL 4QRPB 2E7LA 5CCKH 3HPLA 5DJYA 4RWYL 1YNKL 2VKWA 2FR4A 1DUZA 3MV7A 1NSNH 2EH7H 3SDAA 5I1IL 1RV6X 5FK9A 1G7QB 4L3EB 5IVOA 3VRLF 3EKCA 4XCNA 1GAFH 3PGFL 4U2ZA 2ADFH 4WEMB 4MZ3A 4R2GD 2QBWA 1AD9A 1N64L 4HIXH 1WWAX 1QP1A 4WO4A 3S36L 3EHBC 2EYSA 4BH7A 4NBYB 4H5SA 3EJYC 5I1GH 3UEZA 1QUNA 1XF4B 3PDOB 3DTXB 1D6VL 2MJWA 1CBVH 4K71C 1I4FA 2YA0A 4GKZA 2DMCA 4F33B 2FGWL 3NCJL 5DFVD 5I15L 3T0EB 4DTGL 3BFOA 4MXQD 5K9QI 3QQ3A 4JM2D 3MRDA 2Z31B 5FYLE 3Q6FB 4XX1E 3FONA 5IB2A 4UT7H 2UWEB 2Y07H 1D5MB 1WBXB 4N5UA 2DKMA 3VXMD 2XACC 2P24A 1IAIM 1RVFL 4JRXA 1T0MB 4QO1A 2HLAA 4HUKB 4L3CB 5JTWA 2GW5A 3O2DA 4RGMC 4D8PB 1TJIH 2CLRA 5A16B 4WWKD 5ESAA 4UDTB 4RBPK 4E9LA 1UB6B 2W60A 5SX4I 3VD5A 5LJYH 4X80H 5E1AB 1IGTA 4WHDA 4M1CC 3VXPA 3N85H 2JB6B 3LMJH 3S6CA 3ZTNL 1UGNA 3MLSH 1RUKL 4RX4D 3T65B 4DK3A 1KJVB 4PJBB 2AKRB 1FZOA 4D0CA 1NMAH 2ERJC 5DS8A 1IAKB 5F7LB 4RZCB 2ICWI 4FTVA 2CGRL 1EBAA 4XAWH 2R23A 5D71H 5MHSE 1GOHA 1INQB 4V1DB 1JNLH 3QDJE 4NZUH 4U6YA 2ICCA 2ZUTA 3UJTL 3BH9B 5D7JC 3QCUL 3WD5H 3VGHA 3UTSB 3U7YH 5T33L 4L9LB 3UROR 4NZRH 4X9FA 3KNBB 4PGEA 5CD3B 5F1OB 1HILB 3CH8A 3G5YA 1M05A 2UUDH 4JKPL 4YEFA 3B6SB 2R0KH 3HB3D 1XF1A 4WEBL 1G7IA 4PUBH 5JO5A 1WT5A 4KJYB 3OMZA 1LDPH 3MRIA 3B9KD 4P23A 2UZIL 1MHEA 1WK0A 5IBTL 1HXMA 5J56B 3CK0L 4J3WA 1HHHA 4DGIH 5DRNB 1Z2KA 4NQVA 4UV4H 4ZTOL 5DI8B 5A2LH 5T1LD 4APQA 5C0EA 1W0WA 4H20H 1NUDA 1LMKA 2F15A 4QT5B 5BJTB 2EC9T 3DV4A 1E4JA 4ZSOB 5A2JH 3GUTB 4PJHA 3RPIB 1P7KA 5CHNA 3HR5A 4L5FL 2YBRA 4HQQL 1AGCB 1J5OH 4DEPB 3WS6A 5EULV 4PJ8C 1MSPA 3I50H 1VGKB 1EERB 4LLYB 2XI9A 3FCTB 4JGUA 4M62L 2MQ3A 4AEIL 2VLRA 1RJYB 4AL8H 3WUZA 3GIZL 3SE3A 1YYML 1OAYL 3BPLC 3IDNA 3MUY1 2P8PA 3U46B 5E7FA 2C7UA 4LPWA 4RAUA 3WSQH 4MHHI 2LV4A 1DSFH 3QZWG 3P4OA 4FQ2H 4UBDC 2LU7A 3V5KB 4FZEL 1PX4A 4F3FA 4E41E 4Y5XA 2ICES 4ZTPL 2EECA 1UWEL 4QRQB 1DBBH 2NY5L 3W9DA 4GSDL 1MI5E 4MNQA 2R8SL 1VDGA 4PR5A 3PL6A 1AI1H 4KVCL 3RWDA 1X9QA 1CL7I 4XPAH 2BVYA 3KPMA 1VADB 1AGDB 4ZFFA 4WUUA 4ZUWA 3DLQR 3QCVL 4M93C 5LVEA 1MCWM 1WEJH 3MFFB 4TVPE 3RVVC 3ARFB 2DLIA 1KN4H 2YUXA 4QXTB 2FO4A 4FQPA 2YPKB 5IQ7H 1T7YA 3TO4B 4KU1A 4DWHA 3Q0HA 2VDRH 2FWOA 3QIWA 4ELME 5JW4N 1TZIA 1ORSA 2ZCHH 1TTGA 3I02B 3HS0B 4FQXC 4HPOL 4W4OC 3G6AA 1NGZA 3OXSA 2OXGA 3O8XC 1NEUA 3QNZA 2BRRH 1G6RA 2E8ZA 2P5EE 2Y25A 4ORZC 2VNCA 3DYPA 3ILQC 3BVNA 5I1HL 4U6TA 4ELKA 1KPVB 4OFYA 2BY1A 1RZ8A 4UU9B 4ZFOB 4Z95H 3O3DB 4PY8I 3TNMB 4EN3A 1C5BH 1MFCH 4NNXA 4ZFZB 3BQUD 3VXSE 2ZUVA 1WCBB 4GQ9H 4MNGA 5T1DL 3RGVA 5GHWL 4Q97A 4Q9QL 3O3AA 4XXCA 1JGEB 1MWAH 4YBHA 1DEDA 4Y4HC 4XXDA 1NUNB 5E2TH 5DR5H 5D2NC 4WUKH 2WAHA 4CMHC 5BOPA 1FH5H 1DN0B 5E8PB 2P8LB 1MY7A 4KI5E 4A6YA 1JPFB 1YMHB 4L9DA 3NPSB 4WI5A 5EZIL 3MNZA 2VXVH 4LBEB 4LEOB 2IPUK 4MJ4A 3MJ7B 5EOTB 5FO7B 5DMGC 4H88H 4D0BB 1SHMA 4YC2C 1LK3L 3LKOA 5JXED 5DEZA 2CRZA 1JUFA 3N0PB 2R2EB 4LK4A 1UJ3B 4X9HA 3S97C 2R0LL 4Y2DC 1BZ9B 4HIIA 3QCTL 3IXAA 4DKEH 1FVCB 1KPUB 1TIUA 2JE8A 1YMMB 2A38A 3W2DL 3T1FA 3O2WL 4QHNB 4XCYB 4PJ9C 4JO3L 2N7AA 3BW9A 4DZ8B 2WP3O 3SJVD 1IFHL 1PW3A 1ZVSA 5GSVA 3ZYJA 5BXFA 2GQHA 3QO1A 4OLEA 3L5IA 2D9CA 1MRCL 3HZKA 2A6KB 1WIOA 3O3EA 2XTJB 4JDZB 4KMQA 2X4NB 1JGDB 1TTFA 1U93B 3NH7L 5IHLB 3MUZ1 1OWRM 1C7SA 5IIEA 4F80A 3AAZB 1WV7T 3O4LA 3ARGD 3WXVL 5KS9E 1LE5B 3MLVL 4Q9CA 1F6LL 2OCFD 4JZNB 3IJYB 5KSBA 4OCWL 2Z8SA 3C5ZD 4QRUA 2CKBA 1NGWB 3TPUA 3GB7A 3TIDA 4NUJA 4XZUB 5F9OH 4KMTH 5DT1L 2OJZH 1K8DB 4ZS7H 2W65B 4YGVB 5C0CE 4QTHA 3VFWB 1EA9C 3EYUH 4NCC1 5B38B 5HI5D 5D7KD 5C8JB 4UDUA 1VERA 4JPIB 4I9WD 4F57H 1KG0B 5DHVA 5FDWB 3P0VH 3GRWA 3MSPA 3SGEH 3R4DA 1EPFA 5K9QG 3FN9A 4HUWA 4ONHB 4LCUB 3VXRB 1UEMA 3L7FB 5LCVH 4LFHD 4BZ2H 3MNWB 4BKLB 3FQRA 2I9TB 2BC4A 4ZUTA 1IGCL 4N8CL 3GJFB 2DD8L 4JFPB 1LE9A 2DYPB 1QFWM 5HYQA 2PNDA 1F45A 1IEHA 3EYOB 4NO5A 4UINH 1L9MA 1YEJH 4OUUB 4P2OB 3CFJB 4NQDA 3BH8B 2AV1B 1QRNA 3G04B 3RWCA 1G9ML 1T5WA 1RIHL 1RY7B 5K9JL 1VHPA 3BKMH 3EUUA 3ZYZA 4U1JA 4EDXB 3EW3B 5HXMA 4HV8A 5FECA 3T8XA 4W70A 2FEDD 1IZJA 2VUOA 1CICB 2FGZA 3TT3L 4M7KL 4WY7L 2I27N 1OARH 1U8HB 1D5IL 3RPKA 2C3VB 2Z8WC 2AXGA 4S2SB 5E8OB 5D1ZB 2FLRT 4Y1AE 4FFYH 1S9WA 3PWPD 1FL5B 5INCB 1JYWA 3JTSA 4UQ2A 1F90L 3AU1A 4DKFL 1A7OH 3UJJH 1EJOL 1PEZA 1FAIH 1Q1JH 4GUPB 4LSRH 4U2YA 4BA8A 4XVUD 1IRAY 4NRYA 4ZPTA 4OM1H 3MODL 4HAFA 1T03L 1HINL 4XMKL 5ITBH 1ZHLB 1QBLH 4N90E 4C56A 2NLJB 4NPYB 4YAQA 2NY1C 5C0BB 4B0MM 5ESVA 5KVDL 2BSRA 3OB0H 1HDMA 1CR9L 1U8LB 1IGYB 3LHPH 4OD2B 3EO0B 3PWUA 4QHUB 3KWWB 1QYGH 3B43A 3RA7H 5KSVA 3BRDA 1YPZA 1QKZH 4P5TA 1M6OA 2W9EL 3JUZA 2GJ6D 1K6QH 2EIBA 1YEKL 4MAUH 1P6AB 4LF3B 3TCXA 4XT1C 3C09C 5IGXL 1YZZA 1UENA 5AZ2L 1AD0A 2Z8RA 5IF0A 5IROC 3ROOA 3SCMD 3QXAA 1UM4L 4JPVL 5ICZB 1XR9B 5T5NG 3MRLA 4OLYH 5F7EH 4BH8A 1ADQH 3BXNB 4B5EA 1DEEA 1T22B 3CFBB 2VWEC 5EZJA 5HJ3A 1D5XB 3VRLE 25C8L 3E1F1 5C07E 3U9PH 5C6TH 2BOBA 4OFDA 5JHLH 1T5XB 1NEZA 2QHLA 2AQ1A 1KN2L 3CPLB 3ARBA 4HWNA 3BIKB 3FQUB 4NKMA 2IH3B 3PHQB 3N50A 1N3NB 1JVKA 1BQHB 1YY9C 3SO3C 1FJ1B 4M6OL 4G5ZL 2R4SL 2DAVA 2MKLC 4HBQA 4KK6D 3S7GA 5DJCA 4JFXB 3V7AG 4FXGA 2IJ0C 2GJZB 2JIXB 4PTUB 2R69H 1MCCA 1UM5H 2AXFA 3CIQA 3OSKA 1P1ZB 4IS6A 1KEGH 1Q0YH 3OX8A 4K7FB 1LD9B 3DVIA 3VMNA 3WIIH 4XWOC 5K93A 3RI5K 1W8OA 2ESVE 4AEHH 1KXVC 4A2MA 1X7QA 3KPLB 5MEQA 4IRJD 3U0WH 2XWTB 1ZHKA 4ZG1A 1XR8A 1JHKH 1A9EB 1QR1A 4NHUB 3MV8A 5J9PB 3CH1B 3QEGH 4G6KH 4F9PC 5CP3A 3CXHJ 4Q6IC 4NRXB 5LBSL 3T09A 4Y8DC 5F7MC 3FRPG 3LQZB 3MLTA 4YHIA 4KPHL 1VGEL 1Q9WA 2H8PB 4GLRH 5EZLA 3VFRB 5FYKD 2X7LB 2HFFA 2G5BB 3IKCB 2EXYD 2WLZA 4OLXH 4PPTA 3QULB 4LCIH 5AUMA 5B39A 3G6JF 4P49A 2HTLC 1V05A 4L8SB 4XP4H 5DTFB 3OPZL 4Z76B 4TSBL 4PJDB 2EE3A 2OP4H 2DN7A 5HBBA 2Q3AA 1DUYB 3RAJL 5T3XE 5E7BA 1BX2A 4B53A 5KSUB 5HHVH 5J6HB 1HH9A 5AZEL 1IGFH 4PG2C 2Q7YA 3H9SB 4LLDB 5F93C 1R5WB 3IAPA 3C8KA 3QB7C 3QJHA 3IVKA 4JM2A 4C58B 4JAMB 5EZOH 4AEFA 4PJIB 1I8IA 1S9YB 4AYFA 1J1XL 1T2JA 5TQ0H 1C8PA 1FFNA 3VXMA 1KYOK 5BVPH 1MCQA 5TF1H 2O61A 4AEEA 2DQGH 4M7LH 4PB0H 5SWZB 1RIUH 3UTTB 3QWOA 4WWKA 1I7RA 2W07A 2ITDB 3CX5J 4MA7L 2J8UA 1TZGL 3AY4A 3W9EA 3UBXG 5GZOC 4XPHH 3BZ4B 4M9OA 3VCLA 4RX4A 4X6FA 1A9BB 4QXGL 3EOTH 2EE2A 3EDEA 1MHCA 2P49B 4PJ7F 3LSOB 3WS3B 1JHLL 2E7MA 5CLWA 1UT9A 3CAFA 5F1IA 5DJDB 2QSCH 3OKLB 1T1ZA 1K5NA 3PNWA 3QUML 3WKML 3BDYH 3IJSA 3MROB 1JNHA 3CVHB 1J0IA 3FO2A 2ZUQC 2UYLB 3PWVB 1FN4A 2YPVH 2C1OA 3ULUH 5GGSA 3H3PL 1NDMA 4LHUB 4WW2A 4X5WA 1NC4B 3ELAT 3UAJC 1GZPB 1NH6A 1OGTA 4ZMAT 1CGVA 2FB4H 3B9KA 5DEFA 1C5CH 4OCYL 5GGQH 2IG2H 1HSAB 2KQMA 4U0QB 4HX1A 2JKXA 4NP4L 5J1AA 5T1LA 5DQDL 3AXLA 3L6FA 1MLCB 3I9GH 4JE4B 4N8VG 3ZSTA 1AIFB 4M48H 2IALB 5IVZA 5J11B 4OCNC 3QZWA 4L4TD 1I1YB 3QQ9D 3LZFL 3TWCL 1NGQL 2AQ3A 4KI5C 3GHBL 1JGUH 3RNKB 1MFAL 1SJHB 2C3XA 1G0XA 4Z9KB 3MUJA 5T1KD 3JTTA 4LAJH 1UXWA 3ZDXF 4U33A 5FM8A 4UILH 1CFVL 2AJZA 4G6AC 4MA3A 1ZHBB 2YD6A 3WFZA 4MSWA 2A9NH 3T2NH 2YRLA 3MRMB 3PF2A 5GPRA 1FZMA 4LL9A 1HSBA 4Y8AA 3T4YB 1LO0H 6FABL 3QUMB 1N0XL 2PYEE 3WXWL 1IQDB 5F9WB 3NN8B 1Z5LB 4NQED 1IGJA 1N6QH 1CLYL 2QJDA 5TE6H 5D7IF 1EEYB 3B2VH 1FDLH 4TTDD 2IPKA 2XG4A 5GS1B 1YNLL 4LARL 1I9RH 3I6GB 4U6XB 1JGVL 4WNQA 4HS3A 3AM8A 3BWAA 1FYTE 3QG7H 3SDCC 1VESA 3W5NA 4KJPD 4LU5L 2O5XL 4N0CD 3UTPE 4ALAL 2XQYK 3PWLA 4KK8D 4OZFG 1IEAB 2LQRA 4HKBA 1QSED 2ZKHL 2O5ZL 4NN5B 3L3HB 1T20B 4WGWB 2ADJA 5KANG 2IEPA 2E27H 2F54D 3OHXB 2JJSA 3KPRB 3BN9C 4P4KC 2MFNA 2NX5E 2VE6B 4TQEH 1LEKA 3WEXB 2JCCF 1PSKH 3N1PC 4PRPE 2X4TB 4M7ZC 3BN3B 5DMYA 3G5VB 1NGPH 4X7FC 5D6CB 2C4FT 5B4MC 4OZHB 4PLJC 5ISZD 3C5JA 4E42B 4L8DA 5CWSB 5JIHA 3ME0A 1ONQB 4OV6F 2IAMC 1G7JA 1MCIA 2H26B 4LKCB 4AIOA 2OLDA 5EA0L 5C9JB 1HHJB 2AK4E 3BQUA 2EDXA 3DGGB 4OLUL 1NAMH 4NIKB 2WBKA 3L5HA 5DJ0A 2XA3A 3LKSB 1OL0A 4EBQL 5IMOB 3PJSA 3VFMA 1BQLL 3F8UB 4O02L 5TPWH 1ITCA 1CFQA 3WUWB 4Z7UF 3VG9B 2Y6SD 1Q9OA 3L5XL 4LP5A 3QH3A 4CU8A 4I48A 2CUHA 2DBJA 2WK2A 1LVEA 2G9HA 4GG6B 1UWGL 3IFOA 2VDPL 5GISH 5T5FL 1JRHL 1FSKB 4FFZH 3RUGA 4GRWB 1BHGA 1NCBH 5HPMA 2FDBP 2QQNH 2EC9U 2BNRD 4OQ1A 3WFDH 2D0HA 4PJ5D 4YHNB 4XNYL 4HH9A 3DUHA 3O4OB 5DURD 5JXEA 3HAEH 2BCKB 2NY3B 3MOBH 2HT2C 3HG1B 3FB6B 2Q8AH 3P77A 1J0HA 3F5WA 4GAJL 1C7TA 4HUUB 2V2XA 2F58H 2UY6A 4FG6C 5DZLA 1IAIH 1DBAL 1G7PB 5CZVH 2Z92B 4P2RA 4LSDA 1M4KA 5HYIA 4FP8L 1GIGH 1DE4B 5DQJA 3DGCR 3MLRH 5JQ6H 5BV7C 3BOVA 5KN5A 3GNML 4FFWD 4N5ED 4YDLB 1WFNA 1A2YB 5L6YL 1JZ6A 5ALBH 3TYFA 3S4SG 3MJ9L 5HI3D 1J8KA 3D18B 2V5MA 4JY4B 2WM0A 1A14L 3IDMB 4ZXBC 4ZYKB 2EC8A 4TTGA 2B5IC 1KIRB 5EU7E 2LVEA 2OQJB 3QO0B 5FV2A 4HF5H 3DROA 2UWEF 4XPTH 2LABA 2H2SD 4LSUL 4ZS6C 3ZE2F 3X13A 5I1KL 4RNRA 5HYFA 4BUHA 4OD3L 2VKXA 3C5ZA 4NM8L 4K8RD 3IXTB 5A3ID 3UYRH 1CLZL 4U1SB 1J8HE 1JN6B 1F42A 1Q9LB 3IB4A 3M07A 4P46C 1QG3A 4IIQA 4OTXL 3HKFA 2EYTA 5LQBH 1XGYH 1T0NA 4KQ4H 4LQFH 3BE1H 5ELIA 5L88L 1ZA6B 4QF1B 1KEML 4X7TB 2BZDA 2VLJB 1QEWA 4U1KB 3V9FA 5BRZE 1F11B 3HE7D 2IF7A 4PJBF 4M1DL 1DQDH 1VFBB 2YWZA 4PGJA 2GT9A 1FORL 1J87A 5DUPL 3P30H 4FQ1H 1AXSB 2NYYD 5TGBB 5GGUB 5KAQF 3BYTA 5DJ6A 3LKRB 5IB4A 3FTGA 2X1XR 1VFOA 1FPTL 5E0QA 2ICWA 4PY7A 5D1XB 2OZ4L 1KBGL 3LQAL 4WHYH 4HKJA 2CMRH 3PGDA 1PZUB 1BBJB 2WBJD 5MERA 1TZHB 2AV7A 3WDIA 1GGUA 3HMXH 4C4KT 1KTLA 4LIQH 1S7XA 4NDMB 1X5AA 3FOLB 3MRCA 4J3UA 4NYLA 2R1XA 5HHOE 1UXSA 1JPGA 3CXDH 3LV3A 3DYOA 1AJ7L 5DMKA 4RISL 4EQ3A 1HOCA 4TUOB 1TJHH 1UJTA 5T3ZE 3I6KA 3PWPA 4NZJA 4J4PD 6CGTA 1HH6A 1AXTH 2C3HA 4YFLI 3MJ8A 3PUCA 1I85C 5KOVC 1MCWW 4TSCL 2FATH 4G42A 1LQSR 4Q9BA 2HG5A 3P40A 4K71B 4OD1H 4U1IA 3CFCH 3MRPB 1A5FH 4ODXB 3LQMA 2VZ1A 3DI3B 2LFGA 3AS1A 2CUMA 4QXUL 2PXYD 1GGIH 4RDQG 4EUPA 3QDMB 1YEHL 2RR3A 2Z9TA 1KCSH 3S37X 4M6ML 3RX5A 4ONOA 4DQOL 2FX7L 1KCVL 4RGMB 2D7TL 4QGYA 1GVIA 1T2QH 2I9LB 3ZT6A 2GJ6A 4O9HH 3V4VH 5C0FA 3KYAA 3OR7B 1A6TA 3DV6A 2ARJQ 5HGBB 1BLNB 2V5YA 1YYLL 4W81A 3SCMA 3DYMA 3BMWA 3QDAA 1K4CB 4X5XB 2VIRA 4TPRL 1NMCC 9CGTA 2N56A 1FLRH 3EGSA 1Q38A 1KLFA 1NGXA 1RJZB 2QR0B 3NIFF 1OPGL 3H9HA 5CSZB 5E9DE 4OT1H 1NUFA 1U8MA 4RQQB 3SQOH 3TH2T 5EU6D 1MH5B 3WJJA 1N7ML 1W72L 5D7JB 4WFED 3V5DA 3G6JE 3GMLA 4L4VA 5KVEL 1OB1B 4UB0L 1A1NA 1O7VA 4TOYL 4CVZA 4DOHB 4RGNE 3NCCB 4S1SL 4XHJC 1CGWA 2FSEB 5FGCB 2VISB 3CLEH 4CU7A 4BSVB 4O58L 1U8IB 2YC1A 3U9UA 2VZ3A 3HE6C 4J6RL 1SM3L 1DVFC 1UQSA 1DQJB 1N8ZA 5AWNL 1RJLB 2ARJB 3EFFA 2GSIA 4FXLA 4NOBA 4JFFE 4IRJA 2IH1B 1PBYA 1MIEH 5HI4C 4PRNA 3P0YL 2E6JA 3VDCA 2PKDA 32C2A 5K59F 2OXHA 5DDHB 1N6UA 3NCYP 2R2BB 5EO1B 3QNXA 1WZMA 4F15C 2APXA 5IMLA 4Q58C 3NACH 2XFXA 4Y19D 4JFDE 4H1LH 2AEQH 4LCCC 3H2WA 3OKKA 3E6HA 5DD0H 4PJ7E 4OKVA 4OCLC 3I6LD 4XBEL 2WQRA 1P69B 4OF3A 5FCSH 1K4DA 3BPLB 4OQTA 3F7VA 3VGBA 1KTDA 1EXUA 5C08D 1S5HA 3GI9L 2Q6WA 1F8TL 1LP9A 1N4XL 1RUPH 3N9GL 5CGYD 1RHHA 5HYJD 1ZGLP 3S36X 3SKUD 4UOW0 1NCWH 5DHYB 2IFFL 4NCDA 2GSGB 5AAWA 3PHOA 5JIKA 1JGLH 4PJAA 2E7BA 3UC0H 1WFUA 3TBVA 3HZVA 3C60C 3PP4H 1B88A 4UOW1 2D7NA 3RVTC 4I4WB 3TO2B 4NQCD 1OGAD 4JHWH 5JDJA 4OCSH 3V0AC 3RBSA 4KZDH 2VDNL 3P11H 3RL1A 4JQIH 1XCQA 1G7QA 4KRPC 3BEWA 3C6LC 2XKNA 4Q74A 3STBA 3ET9F 3O41B 4QKXB 5LG1A 2P5WB 4PRBB 1U8OA 1A22B 4IDJH 5IB3B 3HUJE 3PGCA 4JFEE 4O4YH 1FNEB 1NCDH 4FQXB 1QFWH 1XF4A 2OX5A 5EOCH 3PDOA 2XQBH 1H8NA 1IC7L 3LEVH 5IT2H 3O8XB 4DW2L 3BRFA 1MCKA 3O3BA 1RPQA 3H9SD 4JDVA 4KJQC 3ZDXE 3T0EA 2ZJSL 3FN0H 2I60H 1JRHI 4R4ND 3GMMA 1A3LH 2NR6D 4XMPH 2RAMA 2PO6C 2VERN 3Q6FA 3UTZA 4N8VA 4PGBB 4XI5C 1BPVA 2COQA 5EUOE 3FFCE 4CVXB 3S34L 3ZKMC 5CBAA 5HVFB 5J13C 1T0MA 4KRMB 4L3CA 5MEPB 2D7MA 4D8PA 1BM3H 4PJXA 3VG0L 4Y4HB 3RY6C 1T7WA 5A16A 1MFDH 1KJ3L 2NY0B 1RUQH 1JPTH 4QRTA 1CXFA 2Y06H 5D2NB 1GZQB 5D7IE 3MLZH 4CMHB 1QBAA 2FEEI 5DJZA 4Z18A 2X4SB 1BD2E 1S7WA 5E1AA 4GG8B 4PRIB 4LQ1A 3D2UB 1RHFA 3QUZC 1UYWL 5ALCH 5CSGA 1UADC 3O2VH 3D25A 3LEYH 3T65A 5BQ7B 3LS4H 1YEFL 5JW4R 2J88L 2XWBB 1E0OB 4GW1B 4R26H 4YC2B 2FD6L 3GJFK 4HULB 3EYQC 4L4TA 4KZEL 1GGCL 1RJCA 1MOEA 4ODSL 1GCFA 4LGPB 1PQZB 2H1PL 4RIRB 4LEXH 4Y2DB 4L9LA 1T2XA 2P46B 3RL2B 3Q5OA 2JCCE 1PY9A 2VDQH 1EZVX 3G08A 3INUH 4I1NB 5M7QA 3MRGA 4DGVL 5IQ9A 4IHOB 3IU4H 2GJJA 5EBLB 3B6SA 3W39B 3CMGA 2OR8A 4PJ9B 4J8RA 4LHUD 1MFBL 1BIIB 3QXDA 4UT6L 1CGXA 4KJYA 4XAKD 3FT3A 1TXKA 2VSDA 3TVMB 3EIFA 5HHMB 4WTXA 2D0GA 4F9LA 2F19L 4MD0A 5HGGS 3LKNA 1X3DA 4GO6B 3GSUA 1OW0C 4NQEA 2NZ9D 1CIDA 3MRBB 3VH8B 4OZFA 2VXSL 4HUXA 2BY2A 2VXQL 3HLAB 4HKZB 4M61B 4QT5A 3KXFD 2BVEA 2YPLD 3QDHA 2Z4QB 2DI8A 4ETQA 3L3GB 3GUTA 4Z7UE 2V6HA 1FVDA 3RPIA 1SYVB 3SDXA 1IKNA 3QDGE 3MLWL 5JPMB 5DLMH 2APVA 4PREB 2YS4A 3C2SA 3Q3GA 3CCHA 3KPPB 1OY3B 4YR6B 3QT2A 1G1CA 4HZLA 1KNOA 1QSEA 4LLYA 3BGMA 1JP5A 2NPLX 3BP7A 3FCTA 2EDHA 2VZUA 4QWWD 4X6CB 3FZUD 4NWTH 3FO9A 3L3OA 4WFHD 2F54A 4L29B 4ZODA 4QRPE 5HY9B 3UMTA 2EDKA 4HSQA 5D7LD 5E2UH 2DQCH 3IRZA 5SV3A 1RK1A 1DBJL 3U46A 5I17A 4NNYA 1RZGA 2BJMH 3FO0L 3T3MF 4WDIB 3TBTA 4KJWD 3BRGC 2D31A 2DTSA 3KLDA 2YK1H 2Y7QA 4L3EE 4U49A 3H3BC 3RWHB 5E08L 1EFXD 1FFOA 5ECJE 4CADA 2EIDA 2BP3A 5ISZA 5I1AA 4NKOB 1F4WL 3DHMA 4QRQA 4YFDB 4N8PA 1D9KC 4Q9RH 1RUML 5CJXA 1UKSA 2VMFA 1OP3H 4NN6C 4WW1A 1QSFD 3QA3B 2SEBB 5D93B 2HMIC 4Z7WA 3W11D 4QHMB 3QUXD 5CCKL 3MRRB 1KLUA 1MVUB 4P2YA 5BS0E 1YC7A 1RZIB 2EH7L 3WE6A 3MFFA 4LLVA 4PJGA 4Y2OA 3ARFA 5F9JB 4XH2A 2UWEE 1GAFL 2FNBA 1VPOH 3ZE2E 5HDOA 2ADFL 3U4EB 1HQ4B 4GW4B 2BNRA 3KPRD 4HIXL 5JPNA 3MA7B 3SOBL 1MEXH 3KYNA 2R0WL 1SQ2N 4P3WA 5DSCB 3FT4A 3VXNB 1A64A 3QFJE 1CBVL 3S4SA 3MLYH 1KPVA 5DHXB 1VFMA 5I71C 4PJBE 5GS0H 4JO1H 2MMXA 4ZFOA 4IMKA 3O3DA 1BFOA 3TNMA 4LPCA 1DFBH 1S78C 1YJDH 1ACYH 2NY1B 4EIZC 4UT7L 3O0RH 2BERA 3GMNB 2FJFB 1WCBA 4V1DE 3S5LG 3UPCA 2HKHH 1N59A 3JV6B 3PP3K 5ETUB 2DWEB 1NANH 2J3SA 2RFXA 3K74B 3CZFB 4BZYA 3UTSE 5IFHL 5ILTH 3THMH 5FYKU 1I3GH 3TBSA 3TBWB 4X7DC 4DJMA 1DN0A 4I2XA 5EU3B 3C09B 4E0RA 5EDXA 1YMHA 3W0WB 5FKAA 4C83B 2APWA 3MLSL 4PJIF 3BEVB 5MENE 1MCOH 3C6SA 1UC6A 4U1HA 5MI0C 1NKRA 3MA9H 5EOTA 4KXZI 3DIFA 3D39B 1P9MC 2A73B 1INDL 1ZLWK 4D0BA 1MNUH 5BW7C 3ARDD 4K9EC 4XAWL 3O6KH 3CX5K 1JNLL 4NZUL 3AGVA 3IDYC 4A6YH 3A6CL 4YDKH 1HXYB 3WD5L 1LNUB 4HEME 3U7YL 1PVHA 4ZSOE 5J3HD 3DXAD 1OSZA 5F97E 1I3UA 3HE7A 1HI6B 5FYJD 4QHNA 5IG7B 2VZOA 2R0KL 4DZ8A 3NFSH 4G8EB 4F8TA 3SO3B 1EVUA 3T4AB 1M1SA 3KG5A 4IOIA 3NCMA 4H0HB 1LDPL 2C3WA 5H2BB 2NNAB 3VGEA 4FQCH 2KKQA 4DVRH 3WFHB 1NFDA 1DANU 3RKDC 4DGIL 4XRCB 1L0QA 4LLWA 4P4RB 1S3KH 3G6DH 4H20L 1F6AB 4RGNC 1FFRA 4JHZA 4OLWH 3WHXB 3LRHA 3TH3T 3UZVB 1HNGA 2B0SH 1O5DT 3FB5B 1R24B 4Y89A 3MLXH 4ZOEA 1DN2A 4JZNA 2G2RB 1OHQA 3DOSA 1E27A 3SGDH 1J5OL 1NGWA 3KPTA 1TPXC 1HQRA 3FQNB 4JFYA 4Q6IB 5J57B 2QHRH 3S35H 1UACH 3I50L 1MCNA 3VFWA 1T83C 2MWCA 3BPOC 4LOUC 2A77H 4Y7MA 1DDHB 4HJ0C 4LCWD 4AL8L 2HTKC 2LTQC 5DJ8A 3NIFE 2CKBH 3SDYL 1KG0A 4Z5RB 1ZEAH 4OGXH 2J8HA 1MHHB 2B8OT 3HI1B 4JM4H 5CD5C 2A6JB 4HLZH 4ONHA 3OZ9L 3VXRA 3LRGA 1MCRA 4I18A 4XWGL 1DBBL 4RAHA 4OZGB 1MJUL 3MNWA 4RBPH 2QQKH 4Y5YA 3GJFA 2PXYA 3B9DA 4YIQB 3PQYD 1CDCA 3BJ91 4IMLB 3GRWH 2V9QA 5DJXB 3S96B 4OUUA 3CFJA 5HHNA 5HGHA 1E4XH 3BH8A 3BKCH 3G04A 3QQ4A 1I7TA 4PGZA 4G6FD 4E41B 5GRVL 1MPAH 4HUVB 1L6ZA 1WEJL 5FGBC 5EUKA 3KR3H 4U6HA 1KN4L 1CICA 2CUIA 1Z3GH 1F4AA 3GBMH 5TQ2H 4G9DA 4QHLA 3RUGF 3KYMB 1NQBA 2C3VA 5I1DA 4UMGA 4EI5D 1KIPB 1XF3B 5K59E 1GHFH 4RFEA 2H9GA 3ZDZF 1FL5A 4H25B 1EUTA 3CMOL 1MJ8L 5E6IC 2FHBA 4ONGH 4NQXB 1B0WA 5F8RC 1QLRB 1J0KA 2GYSA 3GSXB 1EEQA 3BZFB 3CFIC 3MLPA 4C57C 3F7YA 4OB5L 3LB6C 3K80A 3PHSA 5EU6A 4XC3H 2VLLB 4PLKD 3HRPA 4UUJA 2W38A 5D6DA 5E00B 3ZE0F 3GMOB 5GGTH 1D5ZA 2VDMH 3EYVA 5DRWB 4JZOA 2VZVA 5DUBA 1S9KC 5J06A 4ZUUA 1MFCL 5C0BA 2CXGA 3QWRA 2ZUQB 3JVGC 5M94B 3QDMD 2YSSB 4GQ9L 4QHUA 4LLQB 4X4ME 1MWAL 5E8NA 1SY6A 3DX9B 3EZJB 4YDVA 5J0BA 4EOWL 2P5EB 1JFQH 1FNGA 4MWFA 4WUKL 3IRPX 1YA5A 2FO1A 4G7VH 1YMME 5SWQA 1E6JH 1OTUC 1G9NH 3VWKD 4YO0A 1ZT7A 3ZKXC 2VN7A 4HT1L 2J6EL 1INEH 2D7QA 3ULUD 3A0OA 4XPFH 5DVNA 1FZKB 4IOFC 4GXUN 2PUQT 4GKOA 5E5MB 5J1TC 4JFQB 3JUYA 1VA9A 1D5XA 4JRYB 1REIA 2X41A 4NN7C 2M26A 5KZCD 1OP5K 4NM4H 3K4ZA 2E7LC 4Y19A 4GG6F 1OM3H 3V6OA 2DLFH 5FUCE 1ZGLB 3ULVD 4DKEL 3SDAC 3PHQA 3VXQA 4ZPVA 4YHPB 3BDBA 1MRDL 2EIZA 2Q3ZA 1BQHA 2FJHB 3VFGH 5J4MA 1QPXA 3DRTA 3KYOB 5CEZH 1ERNA 1FNLA 1QFHA 5C08A 2EO1A 5IFAH 4WO4C 3BD3A 4JRWA 1CFSB 1P1ZA 1KOAA 5EU4A 4ZFGH 4K7FA 1LD9A 1UZ8B 1DQMH 4HIEB 4ZUSB 2XWTA 4OSUH 4R90H 1DLHA 1UKQA 2I07A 1KCKA 3EZ8A 2OM5A 4DZBB 5DD1H 4NHUA 5J9PA 4ODWB 5J1SC 1OD9A 4NQCA 3MZGB 1OGAA 4NRXA 4KMTL 2BNQB 4PJCF 2LE9A 2OJZL 2EDBA 5DWUL 4ZS7L 4JR9L 4XB7A 5L7XH 1WBZB 2NXZC 4P99A 3IDGA 5J6GB 5GQBA 2ADIA 2C3GA 1A7BA 2H8PA 2R9HC 4XVSH 1L7IH 7FABH 4KQ3H 1P5UA 5CP3H 4F57L 4YXLH 2M8XA 4P4KB 1U58B 1C1EH 3P0VL