4PJGF

Structure of human mr1-ac-6-fp in complex with human mait b-f3-c1 tcr
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
241
structure length
241
Chain Sequence
b'GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSETDPNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 60
structure length 241
sequence length 241
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjgF01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjgF02
5I1CL 3IDGA 2P43B 3HE6B 4F33B 4D3CL 3JWOH 2H9GA 2IPUG 4NQXA 5CP3A 4JFHD 3SY0B 4RFNB 5F89B 3S3SA 4XVTH 1EFXD 3SO3C 2Z91B 4PYHA 3TESA 4UUJA 4XMPH 4Y8AA 3UJJL 1D5MB 1YYLL 4OTXH 1K3ZA 5ISZE 3RWHB 5IF0B 3AB0C 4WDIB 3AU1B 3V7AE 3V0WH 3IAQA 2DQEH 4NUJA 4EKXA 3RY6C 5I16B 5GRZA 1IGTA 2NY0D 5D1XA 4Y5XC 5TF0A 4CMHC 2P24A 3NMEA 3UTOA 3P11H 3C08L 4NHCH 2XA3A 3P4OB 1QR4A 3AC0A 2F53E 2CUMA 5I19H 1QOKA 4LCYB 3MNWA 4L8DB 4OZHB 3SDCB 2XA8L 2WINB 5I73C 1NLBH 5T3XE 1Q0YL 2P8MB 1IM9D 3EOBB 1EFQA 4NCC1 4Y4HC 5KZCB 3V5HA 4ELKA 4XPHL 5DA4A 2FHFA 1ONQA 7FABL 4QXUL 5DD1H 4ZXBB 1T1XA 2HWZH 1ERNA 1B0WA 3G9AB 4PRBA 1IGCH 5IW3A 1DUZB 4XPFH 3FO2B 3STBA 4OFKA 4LARL 3FOLA 2VAJA 5EIIA 2NY6C 3GMNB 2R0ZH 3M45A 1CCZA 4XNUL 3RI5K 3WJLC 3CFKA 1NCCH 3F7VB 4KY1H 1ORSA 1LEGB 4HBQA 5GGVY 1E4WL 1MFEH 5TDPA 1RZFL 5JPMA 4PP2B 1B6DA 4ZFOL 1TJGH 5KJRH 5D6DC 3W2DL 3KPRA 2XICA 4P3CH 4IIQC 2GSGA 1BQHG 3SKOB 3FQUB 5JR1L 2BNQD 1OL0A 3MLTA 2R1WB 4PGJA 5F96L 3ZDYF 2NY5H 4GG6A 3QCUH 2JJWA 5GS2D 2GHWB 4MD4A 3HMWL 3K1DA 4YHKH 5E8PA 4O2EB 4YK4C 3ARSA 3QQ3A 2NYYC 4F8TA 3F7RA 1EBAA 3KLHC 4I1NB 1F4YL 3FQTB 3QPQC 5FKPA 4R97C 4GKZA 4NYLA 1PDKA 3ILPB 5J06A 1RIUL 2QJDA 1DQDL 2ICEA 1G7QA 5KSBA 5J9PB 1G0YR 3B9KB 4FZEH 5CBEB 2YEZB 3CVHL 3QHZL 5CJXC 3U0WL 3BVNA 1A7PH 4JRYD 1P53A 4RGOH 4KMTL 3GHEH 3Q2CA 5JW4M 5MEND 2IFFH 4OZFA 2FJHB 4YDLC 2ERJB 3Q6FB 1TPXC 1BVKB 4OCSH 5GZND 1BZ9A 1CL7H 5EOQH 5T33H 2DQIH 1NC2A 2X7LB 2X10A 3H9HA 4JFFB 1MSPA 1SYVA 2FYYB 3CDFA 3O9WA 5T3ZE 3C8DA 3SCMA 4M5ZH 4XH2B 1UEMA 5DRZA 1NGQL 1VENA 1P1ZA 1EGJA 5A1AA 3CD4A 3TF7C 4XHQA 3B2UC 1N64L 5J6GB 1OTTD 2NY4D 5DVNA 5C0RL 5DJZB 5DQDL 3LKPA 2EEBA 3H3KA 3T2QA 4C56B 1HHKB 1K8IA 5M95B 3VG9B 5EU3A 1IGIL 3MCKB 2VDOL 2IG2L 4OV6F 4JN2A 3RL1B 3VGDA 1RJYB 2NXZB 3B5TA 1KT2B 2IALA 4OQTA 4XC1L 4BFIB 3KR3L 1AI1H 1N7MH 4LVEA 1KLUB 3CDYA 4LL9A 2HH0H 1WCBA 4U7KA 3OKKA 5SWSB 1S9WB 3C60C 4MA1C 3WN5B 2HJKB 3T0WA 4JM4L 1OAZL 1RURL 1YEJL 4HKXB 4Y2OA 3BKYL 1M7IB 1QSEB 2CLZB 3W0WD 4K7FA 1AHWA 5FO7A 1E6OH 1UC6A 5TDOB 3HE7A 3VFWB 1NDGA 3RDTD 1G7PA 5I0DA 3X3GL 1A9EB 2GK0A 4YBQD 2DBLL 3DROB 5IFHL 1CYGA 1I1AA 4Z78B 4JDZB 4M93B 4Y89A 1KPVA 1FYTE 5KSVA 3MRBA 4L8CB 4NO5B 2HG5A 4WWKA 1VKXA 4U1HB 1RMFL 5GRUL 2XPGB 3T65A 4LHJB 3MUY1 5F3BA 1U58B 4NN6B 1R5IA 1QFOA 3O3AB 4WHYG 1OAUL 2IANA 4HUXB 4EOWL 4BQ8A 5TFSH 4N8CL 1UB5A 3S34L 4B0MM 5IMKB 1MI5E 5GISL 3VXMA 2PW2A 3ZHKA 4OLUL 2PTUA 2P8LB 5JOPE 4LCWA 3FAWA 1HILA 3E6HB 4H25A 5L88H 4DFIA 4MLIA 5I30L 2B5IB 3LV3A 3UTZA 4PLOB 3NABL 4R7NB 2APXA 4X6CA 5BO1L 4OCLC 4XCNA 3JVGC 5D1QB 3ME0A 1AY1L 3A67H 3SDAB 2M2DA 1RZJH 4QYOA 2J12B 2AEPH 4FQLH 4XBEL 3VA6A 3TN0C 3BGFC 2GJZA 4HUVB 1MIMH 3S5LA 4NRYA 25C8L 2PR4H 2XTJE 5I15H 5KVGL 4I77H 5DMIH 1EHNA 2D7MA 4UOJA 2AK1H 5HYSB 5FO8A 3MV9E 1P5UA 1DN0A 4JZNB 1QLRA 3RUGE 3W39A 3CLEL 1U8IB 4YC2C 4M3JA 2ZG3A 1GOHA 3VRIB 5KVFH 3E6FA 1KPRA 1QNZH 4G9DA 4N90E 1PD6A 1JTTA 5ELIA 4P2YA 2J5LC 2V2TA 1MJJB 2E27H 4JANA 1NGWB 5K9JL 3G9VA 5C07D 2WWKT 4UV4H 2FD6L 1X7QA 4PS4H 3VH8B 4EI6B 5KBNC 3P30H 2IBZX 5E2VH 2UWEA 5D93B 4O9HH 1RULH 3IJHB 3MNVA 4UT9L 1ADQA 1P4LB 2YZ8A 3MO1B 1IKFL 3GNMH 2OSLB 4HC1H 5GRYA 2CRMA 1A14H 4WNQB 1XCQB 5F71A 5C0JB 3H3PH 3O2DH 5DJ0B 2OR7A 4KV5F 3DX8A 4FQXB 4X5WA 5DRNA 1W8OA 1XIWD 4QEGA 4C59B 4JQIL 3CZFB 4MA8L 5EO0B 3SDYL 4XHJD 5GS0L 1U8HB 3D18A 3TO4B 3LKOA 3DGGA 4UTAL 4A2MA 4ELMF 2V5MA 3QEQE 5DYOA 5FYJU 5EOCJ 4XRCA 4JE4B 5HI4C 5C0IB 1OAYL 4PJCE 5DC0A 4R4ND 3IDIA 1P2CA 1MJ7L 3Q3GA 3NA9L 2ZJSL 4KJYA 5D7JC 1OGTB 1RZIB 3BT2L 4LPYA 2BRRH 3GSUB 3MA7A 4B41A 2XN9D 3STZA 5F1IA 4NQDE 4TVSa 1HHGB 4GRMA 5INCB 1D6EA 1L6ZA 1XGUB 2BNRB 3QDJB 1H9VA 1BIIB 4WENB 5EBLA 3MOAH 4F9PA 1H3PH 1SJVA 1UM4L 1IC1A 3PHQB 3RRQA 3RL2B 4PBWD 3K8MA 1S7SA 1A1MA 2D2OA 4DGIL 2F54E 1RUAH 1K4DA 1JN6B 2ZUUA 1NAMH 1RAMA 3LN4A 1VDGA 1QBLH 1S7RB 4XNYH 3P73A 3FO9A 1HI6B 3QEUB 4OUUA 5HJ3B 4APQD 5D5MA 3MRHB 4WTXA 4PTTB 1AFVH 1IL1A 1RK1B 4MWFA 4Z95L 1FV1B 3OR6B 4WTWA 3WYRA 4J3SA 1B4RA 5ANMB 4NKIH 3U48A 4GW1A 3OTTA 1V8HA 3DVGA 3LH2H 4LPCA 2E7BA 5JZ7C 3C8KB 1VB9A 3U7YL 4GKSB 2BOBA 4ZUUB 3FQNA 3QYCA 2R2HA 3PG2A 5C0BA 1LO2H 4F3FB 1CU4H 5T1MA 5HVFB 4RMSA 2G60H 4MJ5A 4FABH 3TA3A 1S7TB 3FB6B 3FTGA 1T04A 1ZT7B 3HG1A 1AP2B 4ODSH 4XWOC 2ITCB 1AXTL 2AVGA 4GG6F 4XP1H 5B8CB 5EB9A 4NUGL 2J2ZA 3SGJA 4P46C 1I4FA 1UWXH 2KQNA 1MF2H 3LMJH 1GAFH 5J6HA 3ARGD 4U7MA 2V6HA 3STLB 3V6BR 3R8QA 4O5LH 4P2OD 3IDGB 4LRIC 5DHVA 1Z0MA 1CD0A 1RZ8A 2H9GB 4RMWA 1KXVC 3HB3D 1X5XA 4NQXB 4LQ1A 1CFVH 4J2XA 2DMBA 3L5XL 3JTSA 4W68A 5CZKA 1OP5K 3AM8C 3C6LC 4P5TD 3RY5A 2XKUA 5J4MA 4EDWH 1YQ2A 3Q1SL 4LLMA 3EZ8A 4OLWH 2IQAA 4WUUB 4HIIB 5F9DC 1VFMA 5GRVL 4Z7WF 5LCVH 4HZLA 1Z5LA 5KVMC 5IB3A 1O7VA 5C6PB 1IGTB 3NACL 3HAEG 3F65A 5L0QC 5D1XB 4AEIH 1OB1B 3ZDXF 2P24B 2RCSH 3V4VL 1OGAD 1V7NL 5E56A 1REIA 1IBGL 2OYPA 4ODVL 3VI3F 2N7AA 3C8HA 1JGVL 5DD0H 3MNWB 4Y2DC 1EJOL 2N56A 4JFHE 3L7FB 1MCNA 3QZWA 1KC5H 1FN4B 5FUZL 1RJZA 1R24A 4P4KC 4YE4H 3TYGH 3QQ9C 2J4WH 3V5HB 3NFPA 4K7PH 5DHYA 4ELKB 3Q0HA 1ONQB 4KK6D 2B7DT 2VC2L 5A2IH 3F7PC 1PEZA 1T1XB 1BD2D 4QRRA 2ADFH 4DVBA 5J13B 3QNZA 4BSVA 4PRBB 3W9DA 4HUWA 1I8LA 4N8PA 1VADA 4LHUA 1FFRA 1A3RL 4L8SC 3WDIA 3VWKA 4PJHF 3FOLB 4K3DH 5EIIB 2J88H 3OL2A 4RMUA 3KHOA 1QFUL 2BFVL 1NBZB 3CFKB 2EH7L 5CD3A 1ORSB 1DTUA 3MODH 5TDPB 3B3IA 5JPMB 3VDAA 2XZAL 3U79A 1WICA 4WFHD 3KPRB 3ROLA 2GSGB 1F5WA 3P4NA 2R15A 2H2PC 1RFDH 2HJLB 3MLTB 1U8OB 5E2JA 3ULUF 2CO7B 1NH6A 3MR9A 3RIFF 5ADPH 4GG6B 5J8OA 3EUUA 4E5XB 5E8PB 2P1YA 1VPOL 1ZS8A 2EYSA 3DSFH 3QQ3B 4R4FL 2Z4QB 4Y16A 1SVCP 4D0BB 1I9IL 4U1SA 5C92A 5FKPB 2ZKHL 4GKZB 3THML 4NYLB 1YNTA 2W0LA 2A74A 4ZFOA 3V4UL 4FQIH 5I1KL 2ICEB 1G7QB 4NOBA 3FN0H 3QWOA 1TETL 2RQ8A 1NBVL 4MNHA 1URLA 3BVNB 1I9RH 3MLZL 3D3VD 4JRWA 4Y5YA 1CICD 1BQLL 2PN5A 4JRXD 1JHLL 4PP1C 2CR3A 4KZEL 1JWSB 4M4PA 4EEEA 3DUHA 3BRFA 4OZFB 2BNQE 4JFDA 4N1CA 3EYFA 1BZ9B 2YPLA 5DR5H 1IILE 3RVUC 3L3KA 1NC2B 2WLZA 2FBJL 3H9HB 4K2UH 3G5YB 4MJ6A 3UTQA 2OP4L 1SYVB 1HK6A 2MCG1 4ZD3H 3O9WB 2FEDC 1AE6L 5SWQA 3BKML 1P6FA 3ORJA 3RU8H 5DRZB 1P1ZB 2MTPA 3GSNH 1R3KB 4AYFA 5KG9A 4LDEB 3N50A 3FN9A 3LKPB 3SE9H 3S36X 3GSXB 1LDSA 4JY5L 2E9WA 1MWAL 5HBBA 5EU3B 4DKEH 1OWRM 4JN2B 5MENE 1DANT 4GW4A 3DPBA 4ZOCA 3WNNA 4XX1E 2P5WA 4KHTH 2BY0A 5T5FH 2IALB 3ARBD 4NJAH 1S78C 3OKKB 4WTZA 1NANI 1HNGA 12E8L 2Q6WA 3IDYC 4NQCD 2HTLD 5E8OB 2H1PH 4K7FB 1AHWB 1S9YA 1NGZA 3P0GB 5FO7B 1J0JA 3HE6D 1MREL 3MBEC 1G7PB 1MJ8L 4QRSA 2GK0B 3F58L 3N85H 5HGDA 3CJJA 2PTVA 1EUUA 2VDMH 1I1AB 4RZCA 4OB5L 3UO1H 1OM3H 1EA9C 3QCVH 5LAXA 1R3HA 4PJXF 2HG5B 5GRJH 4XBGA 1VKXB 4DEPB 1MFBL 2DF3A 32C2A 1IAII 3T65B 3B2VH 5F3BB 1QSFA 4R9HA 5AYUL 2ICWI 2JK5A 1R5IB 2IANB 1ZHBB 1JV5A 5I1LB 3Q6GH 1UB5B 4G6AD 5GJTL 3V6OE 1FZMA 3VXNA 5L2KB 3W0WE 4MB4A 1NFKA 1ZE3C 2BVOA 5EC2A 5DJYA 5LGHH 1AGBA 4LCWB 1FORL 3M07A 1WC7A 1HILB 3B9EA 1B4JH 1EEZA 5A40E 4PV9A 3HCVA 4UTBL 1CXFA 2VDPH 4H25B 3SDCD 3UTZB 2DQFA 3FQXB 3CDCA 5KZCD 4P57A 3P4LA 4XCNB 5D96C 1Q9WA 5CEZH 3C9NA 4QNPF 2EDBA 1MIEH 4WEBH 1G6RL 4X5XA 4ZXBD 5K9QG 4B7LA 3QUMH 4QYOB 4JG0H 1RZGA 2YA2A 1NKOA 5CLTA 2GJZB 4M6ML 3S5LB 4NRYB 4OCRL 4PJDA 4TUOA 1D9KA 4HG4J 3WFBH 3LPFA 4HW6A 1TJHH 5FO8B 1DN0B 3W39B 2NQCA 2IAMC 3GI9L 4M7LH 3KJ6L 1NKRA 4KH2A 3E6FB 4LU5L 1A6VL 1J87A 4G9DB 2D7OA 2V2TB 4MJIA 1PKOA 2G5RA 1U3ZA 4RFOL 4G7YH 4BK5A 2X9XA 1KCRH 1T2QL 2JTDA 2J8UF 4UU9A 1X7QB 4QXWA 3WO4C 1DBJL 2AJVH 2UWEB 4S1QH 1CXEA 4E42A 4YZFF 3MNVB 5TQ0H 4ZOAA 5IHUL 3C09B 4MXQC 2JELH 1NUFA 3JBG7 5ALBH 5IROC 1UM5H 2GTZA 1FNGA 2GTWA 2RFXA 3IU3A 4RX4D 5IFAL 5JLZA 3DX8B 4KKBC 4PJ7A 5F7KC 1T03H 5GGQL 5DRNB 5EU6A 4PJXB 4QHKI 4WO4C 1OTUD 5KSAC 4PJEE 4Y8DC 4H5SA 2XZQL 4DGVH 2GFBA 1TTGA 5C07E 3D18B 3K2UL 2HN7A 4RBPK 3LKOB 3DGGB 4HKBA 1TJIH 4JO2H 4Q9RL 4M00A 3HZVA 5JQHC 4YQXL 5DYOB 4LAJH 4XRCB 1FO0B 4OM1H 2JCCA 3OPZL 3VA2C 4JHWL 3IDIB 1P2CB 4FHBD 4J23A 3GBML 4LLAA 4UILL 1SEQH 5I6XB 2XXMB 3U0PA 1MFAL 3QFJA 1CGSH 3MA7B 5GGTL 3IT8D 4TQEH 3STZB 5F1IB 2XWTA 1VEMA 1G9NH 2WBKA 4GRMB 4C56D 1D6EB 2DKUA 1AO7A 4GLRH 3J7HA 4JDTL 5EBLB 3T1WA 3LQAL 1LE5B 5C9KA 4PLJD 4M7JL 1A1MB 2V7NA 5IESH 3DBXA 1JYXA 1WBXA 3VXPA 4ZUSA 5SWSD 1CE6B 3LN4B 4KK8D 1JRHI 4O4YL 1CDCA 4RMTA 3P73B 2VN4A 3DHMA 1T7VA 4NQEE 5D5MB 1VSCA 4RMVA 2XIDA 3TT1H 1RUPH 1IL1B 1A1OA 1W2KT 2GW5A 4MWFB 2XN9E 3FRPG 3ARFD 3HC3L 3FT4A 3SE8H 1KCSH 1DL7H 2FGWL 4WV1B 3SDXA 2XQBL 1WZLA 3DVGB 3OAUL 5GS1A 3QT2A 4XAWH 3MRFA 4XP9H 1MCIA 2BOBB 1X9QA 3FQNB 2R2HB 4DKDC 5C0BB 5T1MB 3CDGB 2Z31D 3I84A 3TA3B 2VZVA 5DO2C 3FTGB 4FQ1L 3HG1B 5HHQA 5ECJE 4S1RL 3HPLA 3LZFL 4K94C 2JJUA 3LRSA 4NO2A 3HUJF 5ID1A 1I4FB 2E8ZA 3DNKA 3MCLH 4ZDHA 4NJ9H 3ZYIA 3CGTA 5J6HB 1XF4A 5F88A 5L2JA 3GHBL 4RMRA 4L5FL 2X4TA 3SBWC 1S5HA 1FE8H 2NZ9C 5DD6A 1RZ8B 5J1TC 1CLZL 2DIAA 2YBRA 2ZPKL 3JTSB 5LXGH 3S88H 4NKQB 3O6FA 2NX5A 4YR6A 2A77L 5ICZA 1MQKH 2OR9L 4H1LA 2COQA 4U05A 4WI8A 2IADA 3MLRH 3JXAA 4GRWB 3QUXA 1FFNA 4MDIB 4LLMB 4XC3H 5JIHA 1C16A 1J1OH 1C5BH 5K9QI 3RVVD 2IQAB 2XQYK 3R1GH 2XI9A 1F00I 5TF1L 2XZCL 1BPVA 1Z5LB 1QFWH 1YEHH 3EJYD 6FABH 5I75C 2F5BL 2NY1C 4DUXA 3WXVH 4DGYH 3X3FH 4G6FD 3B9DA 3UDWA 5LKNA 1RUMH 1UB6B 1FZKA 1OCWH 2Y5TA 4HBCL 4ZFGH 2CUIA 1DANU 3DYPA 5IB2A 1Q8MA 3GKZA 3Q5OA 5B3JE 3QZWB 1N6QH 1W8NA 4XTRD 4UNTA 1RJZB 1KN2H 1R24B 5J12C 4TYUA 3DX6B 3NFPB 3OAZH 5DHYB 3QPXL 3TGXA 1EAPA 3G5ZA 4YXHH 3BQUC 4HGKC 1CTNA 1KB9J 2C4FT 1QYGL 3BIKA 4CADB 4QRRB 2Z92A 2QEJA 4DVBB 5BQ7B 3GJFA 4OFYA 2Y07L 3QNZB 4BSVB 3W9DB 4HUWB 1VADB 3SPVB 1CT8A 4QO1A 3U4BH 1OGAE 3L5HA 3VWKB 1MCRA 3TNNB 1KPUB 1FSKB 2B4CC 3QXAA 2YN5A 3BYTA 2AV1A 3HRPA 3ES6A 5IJKC 1T0PB 1BHGA 5CD3B 1U3JA 1L9MA 3DWTA 3ZYOA 3RIFK 4K9EC 3QIBC 3WIIH 4PGEA 4YHOL 2OK0L 4GH7B 3TO4D 5CS7A 4JFPA 1HYRC 4P99A 4EUPB 3P4NB 3LN5A 3I9GH 1MVUA 1TZGL 3GSQA 2X1XR 4G5ZH 1B0GB 1P4BL 1PX4A 4LSQL 3RVTD 3UPAA 3OZ9H 3MR9B 3RWJA 1BD2E 1I1YA 5BVPL 4X7SL 3EYUL 1CF8L 1ZS8B 2EYSB 3SDDC 2ZUQB 1GPOH 4Y16B 2XY1A 2HTKC 4EXPX 1XF1A 4U1SB 1YNTB 4NN7B 3VFGH 5E08H 3O11A 2A74B 4KKLD 4ZFOB 3QDJD 4O58H 2CIIA 1CLOH 3QWOB 8FABB 2Y72A 4MNHB 1KJ2L 1YEGH 2D7TH 3VXTA 1RHHA 1G1YA 4JPWH 4Y5YB 4WFHE 3GMOA 1UJTA 5J1SC 4HWUA 1MCKA 2XTLA 4G8GA 2VXSH 4JFDB 3FZUD 3EO9L 3EYFB 3OJDB 2YPLB 4IRSC 3L3KB 4WU5A 1LDPL 1X3DA 4MJ6B 2D0FA 3UTQB 1IC4L 1T2JA 2RR3A 3NIGF 3OKMB 4EI5A 1UACH 4KRNA 2QQLL 2E7CA 5SWQB 3WFDL 3G5VA 2OZ4L 4XCYA 5C0FA 5KG9B 2DQHH 3IFLL 1QPPA 1ZK9A 4UOW1 1ZGLB 3LEVH 1OTSC 3PABA 1JGUH 3RKDC 2WUBL 5CEYA 4I0PA 4JRXE 2HA1A 5E2WH 4E0RA 4GW4B 1T1ZB 2EDXA 4N5EC 2P5WB 1H8OA 3UTSA 3LIZL 1A6AA 3GM8A 3QUYC 1ZHNA 2VDRL 4S1DC 4OD1H 3MJ9L 3VXQB 4KK5C 4PLKD 3QWRA 2Q6WB 4MHHI 3S8WA 2XFXA 3FFCB 2BVUA 2VNCA 1S9YB 4M1GL 5ESQA 1MWAA 4BH7A 1TNNA 3L3IA 4HKZA 1GGYA 1PLGH 3DGCR 2KZWA 4QRSB 1FL6A 5HGDB 4KXZI 2B2XH 2R2CA 1E4XI 2HFTA 4NGHL 4QWWC 2UZYB 4PJ7F 3W11C 4RDQF 5LAXB 1KXTB 4HPOH 4XBGB 4NZTL 3BPOC 32C2B 2NW2A 5T5NF 4FA8A 3PWLA 3TWCL 3ZKXC 4NFCA 4QHMA 5HVWA 3PNWA 5BCAA 1NGXA 1QSFB 2JK5B 3NH7H 4YX2H 3BKJH 1XR9A 1OP9A 2OS7A 4LOUC 3VJ6B 1JV5B 1CR9H 3KPNA 1FZMB 3VXNB 4NQCE 2BVOB 3K4AA 5EC2B 3TO2A 4YHLH 2V5RA 5DJYB 4K3EL 4LRIA 1AGBB 1H5BC 1T2XA 5K9OB 1U8NA 5EWIL 1WC7B 3OKOB 3NCMA 5FM8A 3VE0A 4PV9B 3HCVB 2XOTA 3O0RH 3X11B 4PJFE 4U1NA 2DQFB 2H8PA 2W92A 3KS0J 1IEAA 1BAFL 2I5YH 2V17H 4XMKL 5F7UA 4P57B 3OX8A 5HHMB 1Q9WB 4HDIA 5EU5A 3C9NB 5J3HD 3WL9A 3T0DA 2PO6A 3EDKA 3I02A 5E8NA 1V3MA 2YUWA 2NLJA 1RZGB 2YD7A 1UM6H 1NCWH 2X4UA 3RWGA 3GIZL 1ZOXA 2EXYD 3VFUA 4J3TA 4Y5XB 3T0EA 2P5EA 2GT9A 3T2PA 5IVZA 4TUOB 2AEQL 1BQHA 1D9KB 2IBGA 3EJZD 5I1EH 4TOYL 4LSSH 3JV0A 3ARVA 4Y2DA 3HNSH 3RWDA 4A6YL 5MEOB 4OZHE 1M05A 4X6BA 2AI0L 2VLLA 4LVOC 4ZQKA 3KPRD 2HLAA 4MJIB 3BH9A 3B43A 4QRPA 1JGLH 4K9EL 1QFHA 3VXSA 3IFOA 15C8L 5BW7A 4OM0L 4UU9B 4HH9A 4TUKH 4E42B 3UX9B 2FLRT 1NMCB 5IVXA 1EMTL 3BMVA 3HFMH 3CVIH 3N0PB 4KMLB 5D2NA 2R2BA 1MQ8A 4MS8D 2R4SL 4F8QA 1BGXL 4LRNH 2GTZB 1FNGB 2GTWB 2RFXB 3IU3B 3MLVL 3MREA 5ALCH 4DK3A 1WAAE 2HT4D 5JLZB 3SKNA 2GK2A 3OGCA 5D2LA 4GS7C 4PJ7B 2N1KA 2M26A 1CG9A 3RTQA 5EU6B 3ESUF 1UEYA 2CLVB 3MUGA 4PJ9C 4TUJB 3MRJA 4H5SB 4M02A 5DRWA 4POUB 4MNGB 2GFBB 2WBWB 2HN7B 4M5YL 1CD1B 1NC2D 2EDDA 2OM5A 4PY8J 4X7EC 5ADOH 3SO5A 3KYMA 3VMPA 3WSQL 4YK4B 3O9WD 2JCCB 1EHLH 3SCMD 2EYRA 2MHAB 4Z8FL 2BY2A 4FQCL 2I25N 1YECL 3SKJL 3U0PB 3QFJB 1RJLA 3QJFA 3UC0H 1K3IA 1IKNA 5DLMH 3AREC 5I17A 4YUEL 3EYSL 4HXAL 1AR2A 3V0AC 4Z6AT 3VXOA 3RA7H 1AO7B 3AVEA 4YHZL 3UJTL 3QI9C 1BOYA 3HNTL 3NIFF 4WCYH 1TPXB 3DYOA 3RWIA 1ZV5A 1QKZH 3GBNL 1SBSL 2V7NB 4WRLA 4CL7A 4JHAH 3PDGA 3DBXB 1WBXB 4ZUSB 3VXPB 1FC1A 1RZ7H 3KG5A 2BVTA 3DUUA 3UAJC 2IJ0C 4IRJC 1MEXL 1A7QH 1OLLA 4DKAA 4K07A 2A9MH 4OBSA 5E2UL 2XRAL 3C5ZC 3D25A 5CUSH 4UIMA 4CJ0A 4ERSH 4K71C 4YHML 3HMXH 5H37H 4LNRA 1A1OB 4PB9L 3HE7D 4R26H 4Z7QE 4UAOC 3DXAA 4OKVA 4MAYC 1D7FA 5KVEH 3VDBA 3FT4B 4TNWF 2C26A 1I1AD 2IQ9H 1RK0A 5KANI 3MRPA 3K0WA 5T1DL 1U2HA 2NY7L 4HS3A 3SDXB 1XF2A 5A2FA 4WWKD 1KB5L 4J4PC 2HYMA 1MJUH 3H6JA 4LMQI 3U6RB 2PYFA 2WP3O 3CK0H 1DSFL 5SWSE 5E94A 2IAND 4LEXL 5MP6H 2CSPA 4MCZA 1DVFA 4TTGA 1X5GA 1R3LB 5HHQB 1GGIL 3HPLB 3VXMD 2UY7A 4KDVA 4NO2B 4LCWD 5ID1B 5AZEL 3T0BA 4HEPG 1JZ4A 3I2CL 2VDKL 4YXLL 1U8QA 4HUKB 5F88B 2V5TA 1U8JA 1WTLA 4MZ3A 1XGRA 2X4TB 5C6TL 1S5HB 2WBJC 2VUYA 2MQ0A 3D39A 5DD6B 1KCVL 2YBRB 1WZ1H 2BXZA 4RQQA 1FAIL 3O6FB 3PP3K 5C0EA 2NX5B 1W72H 5F7YC 4XMLL 4BQBA 5ICZB 2GKIA 4H1LB 4FQJL 1IGFH 2IADB 3MUZ1 4M1CC 2C3WA 2P44B 3MA9L 1FFNB 2LVCA 4LSUL 3G04A 4P9ML 3L5IA 4MXVE 1C16B 2VMFA 1CGYA 4OLYH 2DQGL 4X80H 3WD5H 2AGJH 3RGVA 4M43L 2L7UA 2PXYC 4HFUL 4Z77A 3WO3B 3DX9A 4G8FA 4I48A 1ZLWK 3OAYK 4FFWD 2F58L 5JW4Q 2Q76A 3KPTA 3G6DL 4U6HA 1YC7A 3S35H 1FZKB 2Y5TB 4IDLA 4NBZB 1GC1L 1JMXA 4ENEC 5IB2B 1BVZA 1KBGH 4FQ2H 3KPPA 4KRPC 3PGCA 4BQ6A 5F7WC 1XEDA 4PGDA 3LB6C 1A47A 4OLVH 5IBTH 4U3XA 3SKMA 1X5AA 3GMLB 4EXKA 5K93A 1UJ3C 2VXTL 4Z7VA 1CK0L 2JB6B 5KTEH 4OLXL 1EAPB 3JV6A 4K3JL 1KTLA 2X40A 3Q48A 3GKWL 2Z92B 1R5WA 1BFTA 1J0IA 3GJFB 2ZCLH 1JHKL 1NMBH 1ZA6A 1BEYL 4LBEB 1CT8B 5ILTL 1P9MA 3ZL4H 5SWZA 4KTYA 3LKQA 3QXAB 1I7RA 1MHEA 2AV1B 4UIKL 3TFKC 3ES6B 3IXAA 3RBGA 4M6NL 3P40A 1EGJH 5FV2A 2FB4H 4PGEB 3HC0A 5BRZA 3B9AA 3TBVA 5I0ZA 2E7LA 4S1SH 1JWUA 5JUEL 2HT2D 4JFPB 2EDFA 4W4NA 3ZE1F 3LN5B 1MVUB 3GSQB 4X98B 1LWRA 3KPLA 3EW3B 1AGCA 1RUKH 3U83A 4JQXC 4I9WD 2GEEA 4PJAF 1FH5L 1I1YB 3QXDA 2IMMA 3GO1H 2VZUA 4FXGA 1F3RB 1KACB 3KLDA 1EXUB 2C1OA 2ZCKH 2JJVA 1XH3A 2CK0L 3FL7A 4X9FA 4OCXH 2EECA 3BRDA 5I18H 4ZTPH 4BZ1H 1F2XK 2VXUH 4WO4A 4L3EA 3P9LA 4Z7UA 2CIIB 2DQDH 1VERA 1BX2A 3SE4A 4HG4K 1F8TH 3BP4A 3N1PC 1LNUA 3R8BB 2I26N 3H9SA 4PJIA 4JFXA 5DEGA 3GSWA 3VXTB 1RHHB 5JW4N 3L1OL 3GMOB 2DOCA 3BISA 3MLYH 4EVNA 2YPVL 4G8GB 1P6AB 5DK2A 4WI6A 1IAOA 4WU5B 4H88H 4LCCA 4NP4L 4EI5B 4JREB 4KQ4L 4LPVA 4LEOA 1E4XL 1GOFA 3GBLA 1BIHA 2YRPA 4HS8H 3QA3A 4Z7OF 4XCYB 1KJ2A 5C0FB 3GDBA 3DV4A 1II4E 1R0AL 5IQ9A 1A7RH 3QDJE 1DP0A 2YA1A 2ZUWA 5FGBA 4NC1C 3UROR 3D2UA 5CZXD 1HYSC 3MOBH 1FJ1A 3PABB 4XNXL 5JHLL 5GGVL 3QISA 4DAGH 1NGPH 3K7UA 5CEYB 1FGVL 5C0BD 3EYQD 4ZUWA 5JW3H 2HRPH 4E0RB 4F7TA 3QXUA 1WEJH 1D5BA 5ETUA 4WHTA 1MH5B 3TA3D 2VDLH 4OSUH 3UTSB 2DQUH 3HG1D 1I3GH 2OZ4A 1A6AB 4JKLA 1ZHNB 5D6CB 3WS6C 3KXFA 4DK6A 4KAQL 1ZTXL 4KDWA 3ISWA 2JJSC 2DM4A 1ZWIA 1YNLH 1GHFL 1MFNA 5ESQB 3PGFH 1OVZA 1MWAB 1RD6A 2EDRA 5ANME 4HJGA 1IARB 2GJ6B 3FB8A 3L3IB 1P7QA 4HKZB 1NLDH 1FL6B 2R0LL 4Z9KB 1JNLL 4KI5D 4BSJA 4P9HL 2WLYA 3INUL 4OFIA 3V8OA 2J8OA 5J1AA 3HAEA 2MQCA 1LHZA 4LIQL 3G6JA 4KROB 4LLDA 1K6QH 5JO5A 2C4XA 1KJVA 2NW2B 5DA0B 4PJAB 2DB8A 4QHMB 3PNWB 1NGXB 2CJUL 2X4NA 3TJEH 2SEBA 1LK2A 1IM3A 3RZCA 2DM3A 1A64A 3DARA 3A6CH 4I18C 3KPNB 2F8VA 3MTRA 4LGSB 5D7IE 1ED3A 3KYKL 3R0MA 1GL4B 3SBWA 1OW0A 5M94B 1KELH 4L4TA 1ADQH 1U8NB 3O6ML 1K4CA 3OSKA 1MELA 5L8JB 4ODTL 3RBSA 4DW2H 1U91A 1CFTA 1FBIL 1M71A 4U1NB 2H8PB 1QUNA 4POZC 1IEAB 3KYOA 4PG9B 3WNKA 2NR6D 4X9IA 1GGCL 3OX8B 5EOCH 5INDA 3EO0A 5EU5B 5AWNL 3ZKMC 3ZKNC 4U49A 3WL9B 2PO6B 2DDQH 3I02B 3T8XB 4NM4H 4ZNCD 2X4UB 1ACYH 3VFUB 4I3RH 4LHUD 2P5EB 2GT9B 2AXFA 4CVZA 1WIOA 2WWMD 5IVZB 3VWKD 1Z3GL 1BQHB 2WAHA 4P2QD 4YWGH 2D9QB 3DVNA 5JW4R 2DQTH 1YN7B 2K7PA 2R0WH 4Y2DB 1IE5A 2HT3D 3RWDB 1LMKA 3V52H 4X6BB 4GAGL 2Z93A 2VLLB 1UWEL 2GCYB 2Q86A 4P4KB 4ZQKB 2YOCA 2HLAB 1F3JA 3GB7A 3BH9B 1QVOA 1U6AH 4ONFH 4XX1G 4QRPB 3VGBA 1MRFL 2CMRL 4Y5VC 3VXSB 4GSDL 3IFOB 2LAGB 1G7HA 1I85C 4HH9B 1I8MB 5IVXB 4Y16D 4P5KB 5D2NB 2R2BB 1UZ6E 3QIWC 3BEVB 1DQMH 4TSCH 5GSRB 2FH8A 3SN6N 1YYMH 4BYHA 4XCFH 4XPBL 5AZ2L 3SKNB 4N0UA 1CL7I 3QIBA 3OGCB 4UB0H 5D2LB 4XVUC 1GGBH 1FLRH 1L7TH 1CG9B 5D1ZD 2Y1VA 2NMSA 2LVEA 2VH5L 3KPRE 4BH8B 1NAKH 4WW2A 5C0DA 4DTGH 3MUGB 3GEWB 2XTJC 4F7PA 5DRWB 4JFDD 5E00A 1ORQB 4QT5A 4GMSL 1LO3L 2YPLD 5ACLA 3B83A 3WDHA 4GG6E 2EDWA 3KYMB 2R29H 2EC9U 3PP4H 5GGSA 4JKPL 3SDDA 2DD8L 4WU7A 1AGEA 1QRKA 1D6VL 3VFOA 2F19L 2FECI 3CCHA 2M8XA 1KB9K 4JCMA 3W5MA 1RJLB 3QJFB 4NQTA 5KSBE 5F9WC 1YZZA 1D5ZA 5I17B 3DETD 3EYOB 5GS3A 5JNYA 2ZSVA 3VXOB 5GRVK 3NBNA 3ILQD 1NGYB 4FFVC 3BPLC 1CFBA 1WFOA 5EBWA 3RWIB 2P5WD 4R0LA 3S4SG 3JV4A 2YMXH 5DK0A 5DHVH 5F7LB 5IWLC 1HINL 1MCOL 4XAKD 4WI9A 3DUUB 4XVJL 4M62L 4TNWK 1RIVL 3SGKA 3ZDXE 1EZVX 1KG0A 4OZGF 4YHNB 4UIMB 4RCAA 4LNRB 3BDYH 2ID5A 4NNPL 2YC1B 5TE4H 3DXAB 1C5CH 2C7UB 1XZ0A 4K8RD 1JBJA 5I1CH 3SOBL 4M9PA 1RK0B 3MRPB 5HDBE 4GW5A 1JYWA 2UVEA 3IS0X 2EH8H 1XF2B 4HS3B 3AXLA 1S7UA 4MXWH 3FHQA 1NBYA 5GZOD 2FCBA 2PYFB 2BY1A 1QSFD 3QH3A 3EFFA 5E94B 3MGAA 3UJJH 2YD6A 3ZLQC 4MCZB 1DVFB 3DMMC 4DOHE 4J3UA 2MCPL 1J0ZA 4KKAC 4JB9L 1WWAX 2EO1A 3OKLA 3C2AL 3BN3B 3UP1A 5AYQA 4FP8H 4QOKA 4JO4L 1AQKL 1I3RA 5FB8B 1SM3H 1KB5A 4HIXL 1U8QB 4MQXC 1U8JB 1WBYA 1C5DA 1XGRB 4N0FB 3BD3A 4QRUA 4HWEH 3D39B 4LCIL 1QZ1A 2H3NA 2XA8H 4Z7UF 1PG7H 5HHMD 1Q0YH 1M7DA 5C0EB 2Z35A 2X1PA 3QJHA 2R9HC 4K94H 4ZNEA 3BXNA 1S7WA 1A7BA 3QFDB 1LQSR 2IANE 4NM8H 5B21A 5B38G 2NY5C 3UCRA 3VXME 5EA0H 1D9KD 3RGVB 4Z77B 4LCWE 4RGNB 1YPZE 3DX9B 4G8FB 4I48B 1C12A 4NZUL 1FIGL 2Q76B 3A6OA 2F8OA 4JAMA 4U6HB 2PCPA 1N8ZA 2QSVA 1T89C 1JPGA 2R56H 3MROA 3IRPX 2DLIA 5CSGA 2P4AB 3NPSC 3DO3A 2Y06H 3D48R 4MJID 4X6CE 5E1HB 3KPPB 3U36A 2BCKA 3PGCB 4OFVA 2D0HA 3RP1A 4PGDB 2IPUK 3DLQR 1JPTL 1NUDA 3SKMB 1FZJA 3L3DA 5FCSH 4NNYA 4TNVF 1ES0A 1BFVL 3JV6B 5JXAL 4KVCH 5EUOA 1F4WH 3FMGL 1KTLB 1JFQL 2AJ3A 3WNPA 1IVLA 1R5WB 1L7IH 4JN1L 1MRCH 1U3HA 1ZA6B 3WFEL 1BWMA 4UI2A 3ARUA 5IHZA 1ZGLM 5DZLA 1RIUH 5SWZB 1QQDA 3OKNA 1DQDH 3UPRA 3LKQB 5EU6D 1I7RB 4KUCD 3IXAB 5C2BL 3KJ4C 3T1FA 3MC0A 3ARWA 4NZRL 3HC0B 5BRZB 3KWWB 2E9JA 3TBVB 1A3LH 2BSED 1BOGA 3WO4B 1JWUB 2NY2B 1NCTA 1CE1L 1G7LA 2UWEE 3G6JF 1J5OH 3QP3A 5I1DA 2MPAH 2YHGA 4LSVL 1AGCB 5F7MC 2F8XC 4DUWA 1UA6H 4OV5A 2B4CH 3QXDB 3ARPA 4FXGB 4XP4H 3QFJD 3HC4L 1RU9H 5K59E 1XH3B 4HJ0D 4ZS7L 4YGVA 1A6UH 5E1AB 5GS0D 4XP5H 2FH6A 1AO7D 3BJ91 2R23A 3U9UA 4WO4B 1JK8B 4L3EB 1OQXA 2BK8A 3P9LB 4Z7UB 4DWHA 3BP4B 1PBYA 1LNUB 1QFPA 3H9SB 4PJIB 4JFXB 5DEGB 5DQ9A 5FUOH 3L6FA 3GSWB 4YEEA 2Q7NA 2VDOH 2X9YA 4EBQH 5DTFA 3WFHA 3JWOL 2NY0C 3FRPA 3CU1A 4EVNB 1H15A 1HN1A 3EFDH 3E0GA 4QTHA 4K8RH 4ZPVA 5DK2B 1IAOB 2BVYA 5F1OB 3QBTB 5ICXA 5DD3H 4HJJH 3B2UD 2VTFA 4LCCB 1KEML 3U0TA 2WSKA 5DD5H 4XI5D 4XMPL 3NPZB 3UPCA 4OTXL 4LEOB 1JRHH 2FLBT 2D31A 1QFWM 3QA3B 3EOTH 3V79C 1MLCA 2DQEL 3ALWA 1KJ2B 4FQPA 4WI7A 4U1LA 2XYCA 1C1EH 3DV4B 3QI9A 5IQ9B 4YNYA 1XGYH 5L8LB 2VXVH 5IFHH 1Y0LB 3UBXG 3D2UB 4PJGA 3P11L 1FJ1B 3QUZA 4NHCL 1NQBA 4LSTH 3D69A 3D5OF 4OD3H 1QTYT 4YO0A 3BZ4A 4U6YB 2NZIA 5DUBA 2MFNA 4F7TB 1D5BB 5ETUB 4WHTB 1NLBL 4NT6B 5I71B 1T7WA 4OGZA 2X4RA 3C5ZA 5D5ME 3V9FA 2OTWA 4AH2B 1RZJC 3MV7B 1QSZA 3KXFB 1IAMA 1X6NA 4PJ5A 3T4AA 2W65A 1ZWIB 4C57C 4Q7DA 5DD1L 4NKMA 4Y7MA 2WUCH 2HWZL 4G6JL 3CMGA 2XV6B 3FB8B 1IGCL 1P7QB 2C5DC 1Q9LA 5F9AC 3UZEA 1J86A 5JIIA 3O6FD 5IK3B 5ITBH 2IH3A 5C0BE 2R8SH 4KQ3H 2R0ZL 1X5JA 4PJBF 3HAEB 2BVQA 5GGRY 4BELD 3KPQA 3DTXA 3G6JB 3LD8C 4LLDB 2EKSA 1NCCL 3QUXD 4KY1L 1MFEL 3DURA 4ZAKA 5JO5B 1KJVB 2APWA 3HG1E 1TJGL 3QO1A 5TPWH 5KJRL 4P3CL 2MQ3A 3T2NL 2X4NB 1LK2B 3PWNA 4XBEH 3I6GA 3RPKA 1IM3B 4M7KH 3WHE0 3RZCB 4NOFA 3OXRA 5CMAA 5FOBA 4ZOEA 2NY5L 25C8H 3QCUL 4ONHA 5IMMA 1CTOA 4RMQA 4YHKL 5C0CA 1WWBX 4ZSOA 2JB5H 4QRQB 5EC1A 5GZNC 3PWUB 3IKCA 4PD4K 1K4CB 4HIEA 3BWUC 3K8KA 1U91B 1IMHC 4KI5E 1M71B 4ISVA 4YGAB 3KYOB 4RRPG 5FCUH 4FZEL 4JZOA 4CN1A 2CUHA 4GRWE 5F72S 4G80A 5INDB 1BBJA 1A7PL 4HHAA 4RGOL 1CXKA 2H2SD 2P46B 1MCDA 1OTTC 2NY4C 3GHEL 3MUJA 1JZ2A 3VXRA 1G7JA 2IFFL 4IMKC 4N8VG 4OFYD 3T2OA 4J6RH 1CL7L 5EOQL 5T33L 5A43C 1KEGH 4CVXA 1U36A 4HMCA 2AXFB 5FM5O 4CVZB 1F42A 3FJTA 3DVNB 1ACZA 1I7TB 3EYVA 4LFHD 1KTKE 1FNAA 2DJUA 3VGGA 2Q86B 5CAYB 1UH3A 2DL9A 5IIEA 2CH8A 5J12B 1KNOA 3LY6A 1F3JB 2EE6A 3GB7B 4JLRA 4MA8H 3V6OC 1QVOB 1QA9B 4XNZC 2FECL 3MLPA 3BQUB 3BGMA 5JMRA 1G7HB 3RDTC 4YBQC 5E4IA 2CRYA 1F45A 4A6YB 1AI1L 1N7ML 4XCCH 2AK4A 2I27N 2HH0L 2ZJSH 3NTCH 2ITDB 4P2QE 3MRGA 1FQ9C 1FFPA 1AC6A 5CJQH 4N0UB 1FVDA 3QIBB 3BP6A 1E6OL 2VERN 1EK3A 4QF1A 1RPQA 5CZVH 2L0DA 3D85A 3P77A 1UM4H 3MOQA 1MFDH 3LRGA 3WS3A 4G8GD 4F7PB 1YJDH 5E00B 3BIAX 1L0YA 4LKXA 4QT5B 4JQVA 1A02N 4DGIH 2F53A 3LAFA 1X44A 4EI5D 1MY7A 3SDDB 4WU7B 4C4KO 1AGEB 3K1KC 1E6JH 3PV7A 4GT7A 1WT5A 3VFOB 1T0NA 1KUMA 1NL0H 3CCHB 2MSPA 4U6VH 2DS4A 2OCFD 4Z95H 4BFBD 5TFSL 5F9JA 1JL8A 1N5YH 4EIZC 1D5ZB 1IGJA 4XWGH 5JNYB 1UH2A 4Q6IA 4JVUA 5BMFL 5FV1L 2XY2A 1ITBB 3CC5A 3L3HA 4I0PD 2CKBA 3UBXI 3LKNA 5L88L 5EBWB 4JFDE 3U7YH 3GJEB 2YPLE 3MLWH 3UTSD 3JV4B 4D8PA 1F4HA 1I3VA 5DK0B 3V2AR 4G3YH 1NFDA 4LAQH 2DQJH 3E3QE 4PRNA 4OCNC 2CLRA 2DICA 1T6VN 3LCYA 5K9KA 3QWRD 5CINH 5IVOA 3MNZA 1KG0B 3A67L 4H1LH 4X4ZA 5EUOF 1RZJL 2V9RA 1EO8H 1YMMA 2AEPL 4FQLL 1N0XH 3RVXD 4KUZH 4BSWA 1TQBB 1MIML 3KPMA 4YBLC 2PR4L 5I15L 1XZ0B 4I77L 5DMIL 2Q7YA 3ZSSA 2AK1L 4GW5B 2QADD 2BP3A 4NZJA 1Z0NA 4KROD 1R3IH 1TQCB 3T77A 1KTDA 3AXLB 2P5WE 2V9QA 5KVFL 1S7UB 4JFZH 3AU1A 1NBYB 1S8DA 3LPGA 1QNZL 4M8QA 3VG0L 4XAKE 3QH3B 3QIUA 1HKLH 1Z9MA 3EFFB 2E27L 3LKSA 2X70B 3GZKA 4LSDA 4UV4L 4F7MA 4R6UA 4ZUTA 1ZT4A 3TVMA 4PS4L 1NDMA 1EZVY 3BHBA 1QPXA 4UINH 1J10A 3OKLB 4X6DA 3P30L 5E2VL 4O9HL 5B4MD 4XHJC 1RULL 5DUMH 2PUQT 4LCYA 4M3KB 3NACH 4QOKB 1I3RB 2WINA 1N26A 3GNML 4HC1L 1KB5B 1TDQA 4V2BA 4S0SD 4LLVA 1A14L 3O6KH 1WBYB 3GJFH 1C5DB 3O2DL 4KGJA 4QRUB 4R4NC 2H3NB 5FKAA 2BHZA 3BPOB 1JIBA 1UCTA 5CILH 5JDSA 4NDMA 1M7DB 4BKLA 3M1BA 4R3SA 3ZKXB 3V5DA 3SQBA 4DZBA 2PO6D 1QSFE 3BXNB 1S7WB 5CJ8A 3NGBC 2UZXB 3BZFA 3T09A 3FO2A 4I18A 5HSFA 1KLFA 1WUNT 3T0ED 2P5ED 3FQRA 1D3CA 2VL4A 3C5JA 5C09D 4U3HA 4HGMA 1VESA 2GJJA 4RGMC 4Y2DD 3KNBB 2NPLX 5F7EL 1RVFH 1U3YA 4JAMB 3ZE2E 2PCPB 1N8ZB 4N0YH 3HR6A 1DJSA 1JPGB 5JOEA 2BRRL 3MROB 1LE9A 1MRDH 3BOVA 1RUQH 3QG6A 2AEWA 4TNVK 5AAWA 4QRPD 5HHME 3U36B 2BCKB 4TSAH 3VXSD 1QBAA 3RHWF 3MOAL 3NOIA 1H3PL 1XGPA 4HLZH 1FZJB 3L3DB 3BUYA 3NA4A 1AKJA 4IS6A 5I2IA 4P0DA 3AY4A 4NNYB 1ES0B 5EUOB 1T7ZA 4AG4H 1AIFA 1RUAL 3ILPA 4PJDE 1NAML 1LP9F 3ALPA 2ZG2A 4UQ2A 1VPOH 1U3HB 3MV01 4YHYB 4XNYL 1UWGH 3B9KA 4KI1A 5IHZB 2E7HA 2VQ1B 4YDJA 2FBOJ 4LVOB 1AFVL 2J8HA 3SEPA 3OKNB 5C1MB 5FDYA 3K8LA 2HMID 3RTQD 3QNYA 3ULVD 4MJIE 1TETH 5CSBA 1MPAH 4UZGA 4CU7A 2YA0A 4LQFH 5JTWA 5ERWA 4JR9H 4LPXA 4NKIL 4NQVB 1Q72H 3KAAA 3NIDF 2B0SH 4X4YA 4JFFA 1BOGB 1JHLH 2EIZA 4RDQG 5HHOD 3WXWH 2AP2A 3LH2L 1CGXA 1G7LB 3ARGC 2E5EA 2Q8AH 5I1DB 4P2OC 1A9BA 1LO2L 5FGSA 4K55A 2FBJH 1CU4L 4OV5B 4GLRI 5I8KH 1KN4L 3HB3C 3W81A 2G60L 4FABL 3SGDH 2LAAA 4X7CC 3GGWB 4L9LC 3QUKA 3WCYA 4P5TC 4ODSL 4YGVB 3P2TA 4GS7B 5IG7B 4XP1L 1SVZA 2RB8A 3PDDA 2R23B 5EU6E 1MF2L 4GAJH 2Y23A 1D5XA 3LMJL 1FG2A 1GAFL 4XXDA 1Q94A 1I3UA 4CMMA 4BFIA 3L6FB 2OJZH 4O5LL 1KLUA 4L3AA 5DTFB 4D9QD 4TRPH 3WDJA 1CFVL 1H15B 5T3XH 3ULUL 4QTHB 2JCCE 4ZPVB 1QSEA 1BMGA 1BJMA 2NY3B 5CIPH 1TZIA 5ICXB 4YHIA 3U0TB 1ZVHA 5GIRA 5E5UB 4OLWL 2D31B 1D5IH 2FX8H 4Z78A 1PAMA 5LCVL 4U1LB 1AO7E 1JI1A 3QI9B 1ITCA 4YNYB 3KS0H 4KK6C 4AEIL 1GZPA 2A0LD 1B9ZA 2VLMD 2RCSL 2XPGA 4Y19E 3QUZB 3D69B 5IW1B 1HQRB 1U58A 4U7SA 3MXVH 5IWLA 4F9LC 3EGSA 4YO0B 5DD0L 2XG5A 3BZ4B 5LG1A 5DUBB 5D7LE 1HOCA 1KC5L 2H32H 4FQQB 2Z8VC 1DVFD 2G5BA 5DFVD 4YE4L 3C5ZB 2OTWB 4K71B 3DO7B 2J4WL 2B1HH 4K7PL 4GRLA 4PJ5B 1ZLUK 3T4AB 1SJHA 3VFSA 2O61A 4NKMB 5L9DH 2C3XA 4L1HA 2ADFL 4MNQA 3TH2T 4V1DA 3D39D 1Q9LB 4WHDA 3SDXE 1G7IB 1XF3A 1J12A 4Y4FD 2FIRT 4K3DL 1ZMYA 2J88L 2IH3B 2Y9RT 3SDAA 4E9LA 2BVQB 3BD5A 1QFWI 3DTXB 2DQCH 2EKSB 1EIBA 3MODL 3DURB 4ZAKB 2E3VA 1I9JH 1WCQA 3GRWA 3L3GA 3QO1B 1A4JA 4XP6H 3RGVD 2AW2A 3PWNB 4U1GB 1UG9A 4RGND 1RFDL 1W0VA 3OXRB 5CMAB 1KLGB 5GPRA 5FOBB 1YEDB 5ADPL 4ONHB 1CICC 1YNKH 3VXUA 4KDTC 3VRIA 4D94A 1ZANH 2UUDH 5T3ZH 1OARH 3DVFA 4ZSOB 4I0KA 3DSFL 4K3HA 5EC1B 1OHQA 1OD7A 3AS2A 3IKCB 1NGWA 3KGRA 3BSZH 2M1KA 4HIEB 3KJ6H 5FYJL 4ISVB 5HGHA 4FQIL 4PYGA 1C7SA 3FN0L 4JZOB 4G80B 1T2QH 1BBJB 1I9RL 2ZUVA 4S11A 3ULVH 5E6IA 3VXRB 4WNQA 5C0JA 1G7JB 2A6DA 4U0RC 2PF6A 1DR9A 2ADGA 5DR5L 3HPJA 4FQXA 4CVXB 4K2UL 5CSZA 3EO1B 5SWZD 4ACPA 4EDXA 1T5WA 2V5YA 1UYWH 5E7BA 4KRPB 3ARBC 3RU8L 5IGXL 3EYVB 3GSNL 1G9NC 2UV3A 5BRZD 3H7BA 4XVSH 1CXLA 1UJ3B 5IIEB 1KNOB 2NY2D 3KPSA 4JLRB 1AJ7H 2HTLC 3SE9L 5C0IA 1HZHH 3PIQA 3JSSA 4ZO7A 4WGVB 3BGMB 3HE6C 2LU3A 3RX8A 4DKEL 4AJ0A 5BZWA 5HTSA 3D9AH 1HEZA 3WFZA 3OGOE 4KHTL 5T5FL 4RFNC 1K85A 4NJAL 2BNRA 3W5NA 3WLWD 3BWAA 3MRGB 5E6YA 4XXCA 1FFPB 4FXKB 4L3ED 4WO4D 2YKLH 2X1WL 5EZOL 1ZLSH 3RL2A 5JA9A 4PGZA 1FVDB 2H1PL 4NN5C 3U46A 3H9SD 1V3KA 2OL3H 2DKMA 3RWEA 4JDTH 1H8SA 3MLSL 4QF1B 1WSST 2F5AH 1JN6A 4EQ3A 5GRWA 5I1GH 2YUZA 3D85B 1N59A 3P77B 3A0OA 4G6AC 5FFLA 3N85L 3ARZA 3WS3B 3K46A 43C9A 1KIQB 1YN6A 2VDML 1PSKH 2DLHA 3FO0H 3OKDA 4AEFA 1FNLA 1OM3L 5HJ3A 2F53B 3QCVL 5EIVA 2LABA 5DVMA 5GRJL 4AY0A 2VQUA 1KGCD 3SJVA 3FCTA 4QKXB 1JF1A 3B2VL 1T0NB 5TJWK 3LN9A 3IU4L 3TC9A 3Q6GL 2QKIA 5DGQA 1DEEA 1IGJB 1GRWA 3C8KA 5BV7B 3D2UD 4Q6IB 4PB0H 4GXUN 5LGHL 3L95B 1B4JL 3LKNB 5H37G 2VDPL 2VR5A 4G8GE 1HH6A 5GRXG 1WWWX 1ZT7A 3PHOA 5DJCA 4D8PB 1OF2A 5EZLA 2V7HA 1EVUA 3LEXB 1NFDB 3KXFD 1AR1D 4PRNB 3RWFA 2CLRB 4FFZH 4JKKA 5CEZL 5TQ2H 1IM9A 3MNZB 3T3ME 4MX7A 4WEBL 4OD2A 3QUML 1TVHA 5CJOH 2EYTA 4JG0L 1YMMB 4OGAD 1P7QD 3MRNA 1ZLVK 3CSGA 4BSWB 3KPMB 3KPOA 1DBKH 4J3VA 5DFWH 5HYEA 3GHBH 2Q7YB 4IOIA 4ELMA 4PRHA 1TJHL 4PGBB 4K3GA 3CPLA 5E95B 1N3NA 4M7LL 3HR5B 3T77B 1KTDB 5DO2D 1CQKA 3ETBF 3UTSE 4WUUA 4HIIA 1S8DB 1SQ2N 4M8QB 3QIUB 2DJ4A 5DMKB 3PV6B 3LKSB 4G7YL 2Z9TA 5CKGA 1KCRL 4F7MB 3RZCD 2OJEB 1OB1A 4ZUTB 1ZT4B 3TVMB 1NDMB 1TVDA 3BHBB 1OTUC 4X6DB 1FCCA 2AJVL 3IDMA 4MYWB 4S1QL 4XZUA 4BZYA 1OPGL 1MAMH 5E8DH 4L4TD 5TQ0L 2F5BH 3WKMH 2AJZA 3MRCA 3L7FA 1FN4A 2JELL 1AGFA 5ALBL 4LLVB 1R5VB 1UM5L 2VKWA 3MRRA 1UT9A 4G6KL 4KWUA 5GJSH 2NXYB 5FKAB 2FSEA 5JDSB 4NDMB 4BKLB 2WM0A 1T03L 3M1BB 1GJIA 4R3SB 3V5DB 2RIKA 3I75A 4DZBB 1OP3K 4XPGH 1T83A 1YQVH 3KLSA 4P2RE 1H3XA 3BZFB 4I18B 3VW3L 5LBSH 2YD4A 1QYGH 4HC1A 1TJIL 3LSOA 4JO2L 4C83A 3FQRB 4F7CA 1Q9OB 3C5JB 4PLJC 3CSPA 1PGRB 4CJ1A 4OM1L 2F15A 3P0YH 1NBZA 1I75A 3RHWK 2YN3A 1SEQL 4OIIL 3HI1A 2A2QT 4QGYA 4OFDA 3WN5C 1LE9B 4KK8C 1CGSL 5CCKH 3QG6B 2MNUA 4FRWA 4UT6L 4W4OA 5F6HI 4YDKH 1G9NL 2HJLA 1U8OA 3H9YA 5AAMA 2OK0H 4E5XA 1XGPB 3BUYB 3ARFC 4IS6B 1AKJB 4JVPA 5I2IB 1S7QA 2Z4QA 4D0BA 5ENWA 5IESL 1UKQA 1MCBA 2P5EE 3T0EE 1GGTA 1AIFB 4LCUA 5C0AD 1FFQA 4CN6A 5C09E 2CXGA 4UQ2B 2HKHL 5JMOC 5DJXA 2R69H 4FNLH 1YY8A 4NN6C 3QIBD 4UT7H 4YDJB 4PRAA 2Z31C 1N2RA 3QNYB 1JWSA 4PJCF 1J18A 5A16A 3MZTA 3O6LH 3U30C 4QRPE 5ERWB 3VXSE 3LQMA 4Z7WA 1MHHA 1KCSL 1U0QA 4Y88A 4X4YB 3G5YA 1DL7L 2APBA 1NAMA 3K2MC 2EIZB 4QHNA 4XAWL 3SDDD 4XP9L 5JQ6H 2B5IC 5IVXE 1A9BB 2HTKD 3PQYA 2DLFH 1CBVH 1R3KA 6CGTA 5D2NE 5IB4A 2FIKA 1IAIM 1WTGT 3ZTJH 4PJ8A 2B39A 3S4SA 1INEH 2BDNH 5CD5D 3U2SB 3QUKB 3GSXA 4QXTB 1NCAH 5D2LE 3C6SA 4IM8A 4X0KB 3IFLH 3PUCA 2C1PB 2GQHA 2EZ0D 3NVQA 3VGAC 1J8HD 3WJJC 3ULVE 3V6FA 3MCLL 3WUWG 1IGMH 4NJ9L 1D5XB 3F6IA 1FG2B 3U9PH 4XXDB 1Q94B 4CMMB 2KH2B 2D03H 1FE8L 5EO9A 5HHOE 5C08A 3OG6B 4RISL 5LXGL 3S88L 4NRZA 4PJHA 5E8OA 3CFIC 1MQKL 4M7LT 1YY9D 1TZIB 3HAEH 3MLRL 4YHIB 2GUOB 1X4XA 1F58L 1A4KA 4XC3L 4XTRC 5F9WB 1J1OL 2ARWA 4FXLA 1C5BL 4HXBH 5GIRB 5FYKU 2A38A 1OAKH 3ZE0E 5D93C 2CRIA 5HY9A 1KJMB 1QFWL 4HLJA 3VGHA 6FABL 3CLFH 4JDVA 4JPVH 4HCRH 1Q1JH 1GZPB 3WXVL 4Y1AA 3X3FL 3K4DA 1RUML 1OCWL 1P7KA 3EGSB 4G43A 4ZFGL 4D9QE 3N9GH 3BKCH 4YFEA 1ZHBA 1HOCB 4NZTH 5I1LA 1N6QL 5SX5H 1QACA 1CDHA 5F44A 4ZFZB 5L2KA 3S5LG 1KN2L 5TE6H 2G5BB 4LLYA 3GIVA 4GG8B 1I8KA 3EHBC 1DN2A 2J1KA 1P84K 4GRLB 1V7MH 4QOKD 1F97A 4YXHL 1SJHB 3VFSB 5FYKD 4HH8A 2O61B 1IGYA 2VAAA 2VKXA 2A9NH 1X5ZA 4MVBD 3FQXA 3W11D 1ZXQA 4MNQB 4UOW0 4PJCB 4V1DB 2HLFD 3CSYA 4QTIH 3RVTC 5B38A 2F9BT 2VLME 3U4BL 1XF3B 1WJ3A 4R96A 1L6XA 3PWPA 4WVRA 4JZJA 1BAFH 5KW9L 4LLWA 1I8IA 1WZKA 4LOUD 2D0GA 4D0DA 3WIIL 3DMMB 4X9BA 3IVKA 4KKLC 1GIGH 3L3GB 3PL6A 1A4JB 4KPHH 1XF5A 2OTUA 3GI8H 1FHGA 4M48H 3H42H 4G5ZL 1W0VB 4UNVA 3OZ9L 2Z8RA 4WHCA 5H35A 5GS2H 3VXUB 1NEUA 1S3KH 4B50A 4GMTH 1PEWA 4F7EA 2DMCA 2CQVA 3FZUC 3D39E 1GPOL 1G0XA 3O3DB 4NQEA 4FG6C 1Z2KA 1S7XA 1JYVA 3VFGL 5E08L 5BVJA 4LSRH 5HGHB 2ZOLA 5DVLA 1A6WH 4O58L 1CDUA 4BJLA 1CIDA 1CLOL 1HHJA 1KIPB 2NTFA 4Z0XA 15C8H 1YEGL 2D7TL 3VMOA 4JPWL 5E6IB 1F6FB 2A6DB 2VXSL 3BAEH 4RGNE 1U3HD 2ADGB 2FZ3A 2VZOA 2QQKH 3HPJB 1U8KA 5IB5A 4Q9BA 4XPTH 5KSUA 5MEPB 1UXWB 2R4SH 5CSZB 5GSVA 5DWUH 1BGXH 4PJXA 1UACL 4EDXB 5TH2A 1T5WB 3QEHA 4OI7A 4F58H 4JHZA 1F4XH 5HI5D 4PG2A 1WFUA 5EH1A 1CGUA 5B8CC 2DQHL 3VWJC 3H7BB 3HA0A 2YRZA 2JJTC 3OR7A 4G9FA 4I4WA 1WK0A 3KPSB 4AMKH 4MAUH 3LEVL 4Z7VE 1FO0A 4HUUA 4O2CA 3B8SA 1FC2D 3PIQB 1JGUL 3GMMA 3GUTA 5DJ8A 1EEUA 1U95A 5BZWB 1V05A 5E2WL 3F7QA 4JGUA 3E1F1 4EIGB 1HEZB 1MCLA 2WV3A 2J6EH 3MGOA 4PTUB 3BX7C 3GSNA 1AH1A 4J1UB 1E4KA 5SWZE 3BWAB 3WEXA 1LE5A 4OD1L 4PBXA 1OSZA 1KCUH 1N5AA 3U46B 4GAYA 5BRZE 4YHZH 1G9MC 3RWEB 2ZG1A 1NCBH 1S7VA 5D70H 4L1DA 1DCLA 1CE6A 1N59B 2D7NA 4OZIA 5JOFA 1BBDH 2B2XL 3CUPA 43C9B 3GBNH 1B90A 1YN6B 1A3QA 3OKDB 4P23A 2NY3D 2EKJA 3ESVF 1F3DH 3BPCA 4WFGD 2O26U 4HPOL 4WUKH 2ILLA 4EZMA 1TVBA 4L9LA 2VDQH 4G42A 3SJVB 3FCTB 1JF1B 1HH9A 1P7HL 5ID0B 3NH7L 4YX2L 1E0OB 3KHQA 4U31A 4YHMH 4Q2ZA 3BKJL 1FRGH 1KCKA 5JORA 4WV1A 4L3EE 1CR9L 2QKIB 1J1XH 1DEEB 1BVLA 5J3HC 4HV8A 2P45B 2J8UA 3H9SE 4PJIE 5ABDE 4YHLL 2X44D 4WFED 1NC4A 3QUZD 5J13C 2AABH 5HD8D 2EXYC 3CDGA 3O8XA 3RWCA 2X4PA 5I9QB 5FYKH 3PGDA 4KZDH 3O0RL 4KK9D 3L7EA 1HH6B 2NW3A 4H0GA 3PHOB 5DJCB 5HYIA 1NMAH 1OF2B 2Q87A 2I5YL 2V17L 5EZLB 2V7HB 4JHBA 4X7DC 3JTTA 4LEXH 3RWFB 2BVPB 1KGCE 4PJ5D 5EUKA 4Y0GA 1IM9B 3UJIH 1M6OA 4MX7B 4OD2B 1H3UA 4M61A 1O0VA 1TVHB 2EYTB 3U1SH 3QNXA 1UM6L 3MBXH 1NCWL 1GVIA 3MRNB 1YDPA 3KPOB 4DN3H 2XKSA 2BMKA 4IOIB 4ELMB 5I1EL 2BSRA 3ARDA 4LSSL 4PRHB 2VZ1A 3HNSL 3CPLB 4MDIA 1N3NB 1OAQH 1HHIA 4HSQA 4ZAKD 4MS8C 4IHOA 3QHTC 1J1PH 1HQ4B 2HT4C 4TVPD 3KXFE 2FHCA 4Y4KC 1JGLL 2I07A 2YXFA 1YEEH 4LHUG 3IETB 1DBMH 5FDWA 3WHXB 4RRPA 1UB6A 4TUKL 3X14A 2JE8A 3IDMB 1BJ1H 2BNQB 4Q6YA 1H3WM 1YMHA 2AQ3A 4XZUB 5C0CD 4KRLB 4IDJH 3FB5A 2VR4A 4J7RA 2AJZB 3HFML 3CVIL 3MRCB 3WFCH 5LWYH 1PFCA 1AGFB 3AS3A 4IOFD 4N8VA 4LRNL 3S3JA 2KQMA 3MRRB 3DX7B 3O9WC 3SCMC 3HI5H 3BPNB 3DX6A 3SQOH 3G6JE 1GZQA 5LQBH 2FSEB 3U4EA 2AQ2A 2D4DA 4K7PX 3TBTA 3I75B 3F62A 4CADA 3ZHLA 5BQ7A 3VXRD 2I60H 1DLHA 1I7ZB 5ITFB 3SPVA 3F5WB 1TENA 1K8DA 3O45B 4DN4H 2AJUH 5CGTA 4C83B 3LSOB 1F90H 5ADOL 1JNHA 3TNNA 1KPUA 4F7CB 5D8JH 3VRLE 2AJXH 5KS9A 2W9DH 4N0CD 3GFUA 1EHLL 4L4TE 3MYJA 4ENED 2Q20A 3HS0A 3HI1B 4YDIH 4CU8A 4GBXC 1DQLL 3UC0L 2X9WA 4EUPA 5DLML 4NKOA 5FOJA 1B0GA 4OBRA 1AHWC 3FB7A 3RA7L 4U1JA 4P59H 2NY4B 4MZ2A 5I74B 3U7WH 3HLAA 3HE7C 4UNUA 4WCYL 3HUJA 4EQ2A 1S7QB 2FO4A 3QG7H 1I1AC 2XWBB 3GSRA 5ENWB 5AG9A 4HUMB 5EBMA 4JHAL 2MKLC 4NSKA 3TIDA 4LCUB 2AK4D 1J11A 5FHAH 1VGKA 1RZ7L 5EULV 4PJEF 4C54A 2ICCA 4MQ7A 4WWKC 5I66A 5J89A 1PZUB 4ZO6A 1HIMH 1A7QL 5DJXB 4LSPH 8FABA 5IKCA 1TTUA 2X09A 3QEGH 2A9ML 1YEFH 1YY8B 1ZHKA 5CUSL 4PRAB 4ERSL 2JIXA 4F2MA 3HMXL 1OP3H 1N2RB 4R26L 4KJPD 5SV4A 3D85D 3M8OH 5A16B 1JTOA 3OJDA 1PZ5A 5KVEL 4I3SH 4YBHA 2IQ9L 5IMOA 4Z7WB 1MHHB 3TZVA 2F53D 1GCFA 2DI7A 3Q5TA 1NAMB 1IC5H 1S5IH 3OKMA 3V7MA 4QHNB 4PJFA 2YD1A 5L7XH 1MJUL 3CVHA 3PQYB 5IEKA 3CK0L 4CW1A 5C0AE 5IB4B 2FIKB 5GHWH 4ODHH 5KVDH 1ZGLA 4RSVA 4PJ8B 3B8YA 5MP6L 5ESAA 3S4SB 2G2RB 4N0UE 4WI2A 3C6SB 2PTTA 1RIHH 4JRYE 3SE3A 4NPYA 4BM7A 1FGNH 4TSBH 3IXTA 3V6FB 1T1ZA 4O02H 4KKNA 2ATPA 1BZ7A 3FFDA 1Z9OA 5JHLH 3RZWA 3VD3A 2E6QA 5EO9B 2OR8A 5IEHB 3TCLA 3BH8B 5C08B 1WZ1L 3VXQA 2VSCA 3LVEA 4HMDA 4NRZB 1W72L 4PJHB 3FFCA 4R4BA 2BSTA 3S37H 1IGFL 4DVRH 1X5FA 5FGCE 3SKUD 1YMMD 1A4KB 3ZDZE 3S37X 4EN3A 4OLYL 4X80L 3WD5L 4HK0A 1HYSD 1NCDH 2AGJL 3WKNA 4TVPH 3H0TA 5HY9B 4CDGC 3V8CA 1J8HE 4UV7H 4BFGA 4JDVB 4OF8A 4Y1AB 3C09C 3FONA 4P9HH 1PW3A 2GI7A 2XG4A 3QDMA 1JMZA 3QRGH 1P7KB 4G43B 3D6GA 2YWZA 3QIUD 1KBGL 4FQ2L 3VJ6A 3EDJA 5I1HH 4OLVL 3TVMD 2CJUH 4LLYB 4OF7A 3GIVB 4PJEB 4QGTA 1MAJA 1RY7B 5I8EA 1I8KB 3PDOA 4K23H 5K9OA 3OKOA 3RI5F 3J8F7 3AMLA 3X11A 2W9EH 1N4XH 1IGYB 2VAAB 2HT2C 2YK1H 1YA5A 3OMZA 1IT9H 5IQ7H 2ZCLL 1NMBL 1KOAA 3CSYB 1JJUA 5B38B 2NXYD 3BZDA 5AD0B 3ZL4L 5I6XC 4R96B 1NEZG 3PWPB 2VLKA 4JZJB 3MRQB 4LLWB 1I8IB 3RY6A 1JZ5A 4OZIF 4D0DB 2LE9A 1EGJL 2FB4L 4Y5XA 3EOYG 4YFDB 2R0KH 3IVKB 3PL6B 3DRTB 3DV6B 4S1SL 3MLXH 4F9PC 1XF5B 2OTUB 4ALAL 1E28A 5B3JF 1F4AA 3OJVC 1CD9B 5FUCE 5A3ID 3FHAA 3QAZC 4PR5A 4QOKE 5CBAA 5MEOA 2FR4A 1RUKL 5FYKE 1CXIA 5H35B 5IP4A 1A22B 5HHXH 3D0LA 5I1JH 3GO1L 4F7EB 3ARRA 4Y4HA 2CPCA 3LOWA 2HFEA 2EDNA 4FN0A 4NQEB 4OCXL 2Z8SA 1S7XB 2MMXA 3WIFB 5EORL 1UWEH 5I18L 4BZ1L 5BVJB 2VXUL 2ZOLB 2GIYA 1PVHA 4ZNEE 3L5WA 3E8UL 3QDGA 4IOSD 2DQDL 1LEIA 1F8TL 1AKJD 1HHJB 2ESVA 2NTFB 4Z7NE 4Z0XB 5MI0C 2R4RL 4IRZH 3LS4L 4LLQB 4HX1A 3MLYL 2QL1A 2VDNH 3DIFA 5CZXC 3WJLA 1WVZA 2AJYH 4YPGB 3GMQA 2FZ3B 3B9KD 3ZTNH 4R8WH 2Y4SA 1M4KA 1U8KB 5IB5B 5DI8A 5KSUB 4H88L 5D6DA 5GSVB 4IIQA 2CLVA 2FX9H 5TH2B 3TA3C 3QEHB 4JY4B 4TUJA 4HS8L 5DC9B 4HF5H 4MNGA 1J0YA 2W60A 1X4YA 3WIHH 3SGEH 1CD1A 4G8IA 5EPMA 1A7RL 3MV8A 3HI6H 2ZOKA 4JFFD 4X5LA 3SGJC 3OR7B 4G9FB 4I4WB 4RWYL 3ARFA 3VFNA 5BV7H 4D9LH 1VGEH 2DIJA 4O2CB 4HUUB 3ARYA 3MOBL 2MHAA 3GMMB 3GUTB 5DJ8B 4DAGL 1NGPL 1U95B 1IFHH 2HRPL 2CKBH 4FQHB 5F7DA 1CLYL 1WEJL 4PREA 4KI5C 4BK4A 2VDLL 3MGOB 2VZ3A 4OSUL 4LGPB 2DQUL 2DL2A 5CJXA 1I3GL 5B3NA 3GSNB 4HAFA 1BF8A 4FTVA 2Z31A 3WEXB 5F9OH 5LGJA 2YSSA 1EEYA 5IR1A 1OSZB 1YNLL 2NXZD 1N5AB 5CGYD 4J3WA 3PGFL 4GAYB 1OAXH 1S7VB 1HCFX 4LVHC 1EHXA 1NLDL 3O41A 2ADJA 4OZIB 5E4EC 5JOFB 4Q74A 3PXJA 4OT1H 3CUPB 1TZHB 2E6JA 2WQ8A 1YEKL 4JG1H 4P23B 1QSED 2OI9C 4MDJA 5IT2H 4ODUA 1FZOA 3O3BB 1JZ3A 3BPCB 4KU1A 4R2GB 5DMGC 1K6QL 2XWJA 1TVBB 4L9LB 1HXYA 1RZKH 1T22A 4G42B 2KBGA 1HH9B 3TJEL 1SJEA 4KJQD 4Q2ZB 2NR6C 1PY4A 1FPTH 5JORB 5KS9F 4FFVD 1U41A 1T20A 3A6CL 1BVLB 4HV8B 1JVKA 2J8UB 3U6RA 1NC4B 4M6OH 2VR9A 4TTDD 1KELL 3O8XB 1ADQL 1I8LC 4H1LG 3C60A 4YLQT 2X4PB 3RWCB 1MCPH 3PGDB 3VMNA 2K1MA 4I3GA 1OGAB 4DW2L 4AQOA 3MV11 3L7EB 1SYSA 3VWKC 2NW3B 1R3LA 2APTA 5IJVA 4MHHG 2JF1A 2HT3C 1AXSA 4HWBL 2LU7A 5E2TH 1WFTA 4WFGE 3JTTB 1INDH 2J7LA 5EOCL 4GRLD 1DUYA 2FWOA 5EUKB 1SY6L 1M6OB 3NCCB 4M61B 2DDQL 1EV2E 1NCUA 4NM4L 3QNXB 3LKRB 4MNQD 7CGTA 4V1DD 1ETZA 2UZIH 3LS5L 4I3RL 1JZ6A 1YDPB 4HIXH 4M1DL 4PJGE 5D1QD 4WFEE 2FATL 2BMKB 4YWGL 1J05B 2BSRB 3ARDB 3SDAD 3QWQB 2DQTL 2R0WL 4UMGA 4W6WB 3JWDH 3NCFB 5D7SH 4Y16C 1AD9A 1P4IH 2BXYA 3V52L 1HHIB 3OB0K 4MGXA 1KJ3H 2QSTA 4NN7C 4OF6A 4IHOB 4MJ4A 1C7TA 4Q9QH 3QUMB 2D7PA 3CXDH 4JJ5A 1CDJA 5EU7E 3TYFA 1U6AL 3CU7A 4ONFL 3V4PH 2I07B 1TXKA 4PJFF 3ZZ1A 3MACH 4PJ5E 1T21A 5D1ZC 5FDWB 4Y5YC 2R2EA 4MQXD 3VXUD 4M7ZB 5HHVH 3X14B 4UDUB 4JEGB 2OMNA 1YMHB 1H3TA 3FB5B 3JVGA 2QSCH 4NO3A 2R39A 4LFHG 4ORGB 1DQML 1DQJA 3O4OB 4TSCL 3E3QC 1A7OH 2ADIA 4N8VB 2OX5A 5E5MA 3GMLA 1YYML 4Z0BH 2HVJA 2JB6A 3LHPL 1GZQB 3TN0A 4UB0L 4OCYH 1IQWL 3NZ8A 1GGBL 1M7XA 4JPIB 1FLRL 3U4EB 2BX5A 1L7TL 5T1LA 3WMSA 3L9RA 2ATKA 3KDMA 3TBTB 5E6ID 4DTGL 1QO3A 1NAKL 1DLHB 4TVPE 3DETC 1JE6A 1UWXK 4LBEA 4NWUH 4OZHF 1K8DB 3ILQC 1OP5H 4FQXD 3O81A 1UGNA 4N9GA 1JNHB 1EBPA 2IGFH 5DUPH 1RV6X 2LTQC 5KS9B 1GH7A 3PP4L 4CNIA 5C0CE 4ZSOE 4HLZG 3MYJB 4O00A 1X6LA 4OUOA 5L6YH 3QHFL 1KULA 3T08A 1JNJA 2E8YA 3HS0B 3X12A 3V95A 5FGRA 2DWDB 2VRAA 5KOMC 1UKSA 1HDMA 3KPSD 5F97E 4NKOB 2EIEA 2BNUA 3V0VA 4X98A 5JDJA 3FB7B 4U1JB 2EXWD 2X05A 5HDLA 3HLAB 4K7PY 4J12A 3VI4E 3HUJB 5E0QA 1WAAF 1BM3H 1EXUA 4IJ3B 2FO4B 4K8RC 2YUXA 3GSRB 4U1IA 3BP5A 4KJWD 2YMXL 5EBMB 4NSKB 2HRLA 3TIDB 1VGKB 3BP7A 4AQ1B 2BNRD 2X42A 2IMNA 5I66B 4MQ7B 1DEDA 1BLNB 2JLLA 3QQNA 5GZOC 5IKCB 4G6MH 3X17A 1ZHKB 1QBMH 3VWJA 2JIXB 4PPTA 4F2MB 3BDYL 4KHXH 4OI9A 5TE4L 4ZFFB 1EJ6A 2BHUA 1H8NA 2VZSA 1P69B 1C5CL 1AQDA 1PZ5B 3O2WH 3VFTA 1WV7T 1PKQA 4U0QB 3V7AG 5IMOB 3TZVB 3D0VA 5D7JA 3GK8H 1JPFA 3UYRH 5IBLD 3DJ9A 2EH8L 4PJFB 1KENL 4BZ2H 3CVHB 4MXWL 4JM2C 3SJVD 5IEKB 2AK4E 3MJ8B 4CW1B 4MA7H 1KEMH 3HMXA 1PJ9A 1ZSDA 5ESAB 2IEPA 4Q0XH 4F80A 1IAIL 2OLDA 4NN5B 2O5YH 4NQSA 1A7NH 1QLFA 2PTTB 4NPYB 3D3VE 4AIXA 3OF6A 1B2WH 3A6BL 3CFCH 4FP8L 4NFBA 4FS0A 3IXTB 3DSNA 1SM3L 2QQNH 1MH5A 1RI8A 2ATPB 2WZPD 2NCMA 2HKFL 1U8PA 1BZ7B 1D9KC 3FFDB 4CGTA 2DLTA 4HWEL 4TN9A 5D6CA 4Z7QF 4HZAA 1TIUA 3TCLB 1PG7L 1DBAL 1CN4A 4D0CA 2DIBA 2DTSA 4HQQH 2NNAA 2XNAA 3I50H 4K94L 4R4BB 2BSTB 4YXKH 2VO5A 3CSBA 2I24N 2GJ6A 3FOMB 3MRMB 5KANG 4OQ1A 4NM8L 5EG6C 4AIOA 4EN3B 4LPWA 3GRWH 3OXSA 4HK0B 5EA0L 4G6JH 3H0TB 5E6ZA 1VCAA 4PRHD 5I1IH 1NMCC 3S97C 3FT3B 4CVWA 2GSIA 4MJ2A 2VLJA 5HYQB 3VFVA 3FONB 3K74B 5FYLD 4PJAA 1W72A 1CZ8H 3QDMB 3P9MB 2R56L 4WUUD 3NZHH 2Y06L 2WWKO 1NFDE 4P46A 1NSNH 5D1XD 3QDAA 5H94A 3T2NH 4LMQE 4X6EA 2DAVA 2VB5A 4P4RA 3FO1A 1YMME 3PDOB 5I8EB 1MHPH 3P0VH 4OF3A 4KVCL 1F4WL 2VQTA 4NC1E 5I8OH 1LK3H 3AM8A 3C6LA 1L7IL 5CEXA 1MRCL 3SO3B 4PG9A 2VABA 4MXVF 4Z5RA 5JW5A 3AB0B 3RAJH 1RHFA 5C2UB 4FFYH 4O51A 2VLKB 1T1YA 3T8XA 4Y4KA 4HJ0C 1Y6MR 2A6KB 5GS0C 2HJFB 4CVUA 4CMHB 1HKFA 1SHMA 1A3LL 5AG8A 2YD3A 5SX4H 3TV3H 4X6DE 1DFBH 2W38A 1E28B 1YN7A 1J5OL 1EUTA 2FL5A 5CBAB 4PR5B 2MPAL 2FR4B 4BUGA 3FAXA 4GJTB 5I73B 3LDBC 1UA6L 3D0LB 2GCYA 2B4CL 4P4KA 1G6RA 3WUZA 2DWEB 1LO0L 3IDXL 4XP4L 4HT1H 4DZ8A 4Y4HB 1RU9L 3EAKA 1N6UA 5DJ2A 2HFEB 2QSQA 5D72H 1A6UL 1Z6JT 4XP5L 4OGYH 1T0MA 2G9HA 4XI5C 5FM5M 3L5WB 3QDGB 1LEIB 1I8MA 2Y6SD 2ESVB 4KKCC 5FUOL 1YJDC 4ZS6D 2CO6B 5BZDA 1DBBH 4L8SA 4P5KA 4NWTL 3BEVA 1FG9C 2NY6B 4EBQL 5GSRA 4HX1B 2ED9A 3EFDL 1KFAL 3DIFB 5GS1C 4RIRA 4K8RL 1IEHA 4RNRA 3GMQB 3HNVH 5BS0A 3NCYP 5DD3L 1LO4H 5DI8B 4GBXA 4HJJL 3MMEA 5JXEC 2AXJA 1W0WB 4ORZC 5DD5L 4IIQB 1F6LL 4BH8A 3WHE1 1JRHL 1F11B 4OGXH 5HYFA 2PYEA 4OF0A 3EOTL 3MJ6A 1ORQA 2W60B 4OIBA 4G8IB 1C1EL 5EPMB 1RJCA 4PIRF 2O5ZH 3EDDA 3MV8B 1JF5A 1XGYL 2ZOKB 4X6FA 1MHCB 2OXHA 3ARFB 3VFNB 3SGDI 2AJSH 2VXVL 5IOPB 1U8MA 2IPTL 4Q97A 4LSTL 4R97B 2VWEE 3PQYD 4OD3L 4LASH 3BUTA 3WUWA 1FNHA 5F7DB 1R3JA 1T3FA 5HYJA 4LDLB 4GKNA 4PJ8D 1LO5A 4PREB 3O6FC 5DC4B 3EYOA 3HKFA 1T66D 3NFSL 5FF6A 3B6SA 3QUXC 4FTVB 5GGUA 4I2XA 2Z31B 1NGYA 3ABZA 5LGJB 2YSSB 5M7QA 1EEYB 5IR1B 4YDLB 3U30B 4MA3A 5GGRA 5E8EB 5BMFH 2WUCL 4H8WH 1AGDA 1YPZA 4X9HA 4ZTOH 4JFFE 5CP3H 3O41B 4OCWH 2ADJB 5LVEA 4JO3L 5C08D 5GGTA 2YR3A 3UDWC 5ITBL 1CFSA 2R8SL 4MDJB 4KQ3L 4YHNA 4ODUB 1FZOB 4PD4J 2W0KA 2YC1A 3EDEA 5FYLH 1Q0XH 2XWJB 1HXYB 1T22B 4RBPH 2C7UA 5TPWL 4C56E 5IM7A 4J3XA 1G9MH 5TE7H 2N4IA 1SJEB 4LHQB 3VGAB 5I1AA 3OHXA 4M7KL 1T20B 2A1WH 1KYOJ 2H2SC 1U93A 3UEZA 3ULUD 4Y1AD 1ZEAH 1NJ9A 1XFPA 2JB5L 3C60B 4MA1B 4WY7H 4GQ9L 3MYZA 2FJGB 3NCJL 2VXQH 3MGTA 4G6FB 2E9BA 4N9OB 1SYSB 1QSEE 5L2KD 3IDNA 5IJVB 4WJ5A 4FZ8H 1T4KA 2HFFA 3VG0H 2XT1B 1FCGA 5FCUL 3MBEA 2FX7H 3OQ3B 1AXSB 3RVWD 4AENB 1WISA 1DUYB 1TITA 2FWOB 5FB8A 1KIRA 2Y36H 2O5XL 1JGDA 5MERA 2I9LA 5JA8B 4N0FA 4J6RL 4PRPA 1ETZB 3ZSTA 1DLFH 1KEGL 5E99H 3ZDYE 3BRGC 5C0ND 3QCTL 2CGRH 4XPAH 3PWPD 4N0RA 3QFDA 3ZKQD 1KF9B 4HWBA 1AD9B 5D9SA 1OT2A 5D7IF 4X7TB 3MFFA 1NUNB 2DYPA 8CGTA 5F7NC 1UH4A 1SY6A 2ZUSA 5C8JA 3LPWA 3REVA 3IDUA 3PL6D 4JJ5B 1FYHB 2D3VA 3TYFB 2EC9T 5DDHA 5C7XH 4YIQA 1U42A 4RAUA 3NAAH 1EERB 1T21B 2YZ1A 1Y6NR 5J56B 3H7LA 3QQ4A 2R2EB 4NZDA 5FO9A 2QHRH 4HS6A 4PY8I 4MNQE 4LPUA 4V1DE 5DF0A 3S35X 3UXFA 5F7EH 4NO3B 1JWMA 4XCCL 1K5NA 4NQED 1FNEA 2QTEA 2R1XB 3NTCL 4X9GA 1DQJB 1FP5A 9CGTA 2QQQA 4CU6A 2ADIB 4EI5C 4JREC 5E5MB 1EH9A 5CJQL 2HVJB 3UYPA 3ZT7A 3IFPA 3TN0B 3BGFB 3NZ8B 3CMOH 4OZGA 2L4OA 5T1LB 3L9RB 4X99A 2ATKB 3KDMB 5CZVL 3ULSA 1QO3B 2UVFA 4OZFH 3BESR</