2E9JA

Solution structure of the 14th filamin domain from human filamin-b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
GSSGSSGRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 14th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-B
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e9jA01
4KI1A 1S5HB 3DV4B 4XNUL 1UQSA 3T04D 3DX9B 5HGGS 4L8CA 1S9KC 4Y1AA 4Q74A 1F02I 2ED7A 3IDMA 1M7XA 4X5LA 3DRTB 3HE6D 1OTUD 4E42B 3BN3B 1ZK9A 2BOCA 3MV11 3U7YH 2Q76A 3DVGA 4WY7H 1LP9E 4UT6H 1F45A 3BGAA 5IB4B 2FECI 3MV9B 1F4XL 1T7WA 4KI5F 4OIBA 1Q9KA 2H1PL 5DK0B 4F7PB 4YX2H 1CE6B 3ZLQC 1JZ3A 4OZIE 3WFHB 1W72A 2HMIC 2YN5A 5C0DB 1EDQA 1QKZH 3FHAA 4KHXL 3PL6B 4AIXA 1TZHB 3MLXH 2BNUA 5FHBL 3RVUD 2R0ZH 2BMKA 5IHLB 2JJTA 1ZKAA 4D8PB 3GIZH 3OZ9H 3Q0HA 2N1KA 4G8FA 4HD9A 4U4BA 5CJXA 1QFWL 2YBRB 5E7BA 4XBGB 2G9HA 1JWSB 3O11A 5ADOL 4FQ2L 2FH6A 4LDLB 3BX7C 2QR0A 2NY3B 2X4OA 4PJAA 1BJ1J 3MLUL 1A7BA 4ZO8A 1JIBA 4XX1E 3JZ7A 1V7ML 4F9LC 4WU7B 2X7LA 5GQBA 1BFVL 3RJQB 5KANG 1UGNA 1RIUH 2VDKH 2QHRH 2VDOL 4S10A 5E9DE 3RTQA 4YHLL 5JLZA 3NIDE 4PV9A 3MOBL 3OF6A 3VXPB 4PY7A 5TF0A 4U1MB 4CVXB 1FJ1B 4Y5YC 1HI6B 1IGYB 3ZL4L 3U30C 1CBVL 3VFSA 4HIXH 4JQIH 4PBWD 1DBAL 2CK0L 2YD8A 4L8SC 3WD5H 2YPLB 1PGRB 4XMKH 3R06A 3ULVD 4PP2A 3WIIH 1MQ8A 3NGBC 4RMQA 5E94B 4JDZA 1QEWB 5IFAL 5D5MA 5KVMC 3TEUA 1W0WA 4F57L 3T0EC 5MHSE 3B3IB 4KUCD 5BRZA 1RU9H 1K85A 3IFPB 4JANA 2AJYL 3IVKA 1S7SB 4NQCD 1GH7A 5DJXB 2DQFA 1RJZB 1QFWM 1RFDH 4LDOB 1IC4H 1U2CA 4J7RA 2AJVL 1RAMA 4HK0B 4LSSH 4G3YH 4ZAKD 2AI0L 5AZEL 4DWHA 2F74B 2DWEB 4HIIB 3PE9A 3VXUD 2A9ML 1H5BA 1K5NB 4RCAA 1YEKH 4F7TB 5F1IB 1WIOA 2B1HL 4H8WL 3LSOB 1PYWA 4IIQB 3KPSB 3VXOA 4LKXA 1QSZA 4HZAA 4OLWH 3BKYL 2YR3A 32C2B 5SX5K 2HT2D 5JMOC 3S3SA 1UZ8A 1FIGL 4APQC 1VGEH 5DD3L 3LIZH 2DQJL 2G2RB 5D1ZD 4WUUB 2CRMA 3EJJX 3HUJE 1JK8A 3QG6B 3VD7A 2HYMA 4Q9RH 3ZYIA 3G5ZB 3N1GC 4XPAL 5GGSA 4JREC 4S1QL 2YZ1A 4EVNB 3C8KB 2WINA 3G04B 2EDYA 4L4VB 2V9QA 4I0PC 5F21B 3GJEA 3RY6C 1RURH 2OL3L 3BPOB 2P7TB 3PQYD 3CLFH 4RZCB 4MXWH 2WBJB 5CCKH 4RWYL 1H8OA 2CDGA 4GMSH 3BT2L 5DQJB 4I3RH 3V4VH 1Q72L 2P5WD 3RZWA 3IDNB 3KPLA 3OKOB 3HC0A 4P49A 5HI5D 3HR5A 3SCMB 1NFIB 5BRZE 1LNUA 2FD6L 4AM0B 4K7PY 4NQDE 4UBDC 5HJ3B 3WNLA 1IZJA 1OPGL 1IMHC 5L0QB 1CDGA 1BZQK 1QFOA 1S9XA 2IPTH 4GQPH 1VA9A 1WWCA 1AQDB 1N59B 5TF1L 2VH5H 4P2YA 4XNMA 2X1WL 1HSAB 1NANH 4YJZL 5GS1B 3DX9A 2VDQH 4CN6A 2ADIB 4LBEB 1CN4A 3S97C 1RJLA 3ARVA 1Y6NR 2BNRB 4BUHA 1IM3A 3IS0X 5D96C 3THML 3KPRA 4TNVK 2EIDA 2MKWA 4OD2B 4U1IB 2C7UA 2A1WL 3WO4B 2F5BL 1UJ3B 1SJEA 5HGAA 4NQEB 3UC0L 2RR3A 5IGXL 5EOQH 4FNLL 2H32A 5IVXE 3QXAA 3WL9B 3GIZL 5CBAA 5HGDB 1HHKB 4XP4H 4AEHH 4DZ8B 5C6PB 4HJ0C 5FHBH 4G6AC 5BMFH 3O2WL 4GRLB 1WIUA 3DIFB 1Z0NA 3N1PC 4ZPTA 1KIRB 3CFKA 4I9WD 2ED9A 1S8DA 1AIFA 1A6WH 1KPVB 5D1ZB 3U7AA 3DX7B 4LOUC 1EZVX 1S3KH 4MZ2A 5FKPB 5L2KD 2RAMA 5EZOL 4G42A 4YEFA 3O6LL 1UQSB 5KVEH 3LKOA 3OSKA 2DJUA 3QQ9D 3S36X 5IG7A 2I07A 4FXGA 4OZGA 3Q48A 4PJHB 2FH8A 4RFNB 4J3SA 4NRXA 4JFEE 1NANI 4QT5A 5EBWA 4XNUH 5J56B 3AUVA 3QRFM 3UTPD 4KMLB 5C2BL 3ZTJG 3G08A 3WEXA 3GMOA 4NGHH 3ROOA 4HWBH 3FO9A 5E70A 3CZJA 1EO5A 5EU5B 3U1SH 5EC1A 1KXVC 4H0IA 2JIXB 3VXMA 4Y19E 4GT7A 2EO1A 5CJ8A 1BBJB 1T7XA 4LLMB 1MPAL 3X11A 2EE2A 2CIKA 4OCMC 5FKAB 4JFXA 4YHOH 3VWKB 3O6KL 5D6CA 1MRFH 5D7KD 2Z8VC 5KS9A 3DRQB 4YDLB 3D39B 4M3KB 4I0PB 4M8QB 3EYFB 3ZT5A 4FTVA 2NXYC 1T6WA 3ET9F 3JV0A 3NZHL 5FK9A 5MENB 3QUMA 4ZODA 3GKWH 4FXGB 4OZGB 3MX0A 5F7HA 4NQED 3WLBA 2D0FA 2R2HB 1I9EA 1SM3L 3S34L 5ERWA 2EE9A 1T3FA 1CGWA 3QH3B 3IJYA 1QUNA 2EDBA 2L4OA 3RX7A 5I8CB 4NNYA 3MV7A 1QLRA 1S7WA 3EFDH 3I50H 3X14B 3PDOA 2XTJD 5AYUL 1NBQA 3O4LD 3BN9D 2J1KA 4NO0D 5IBTH 4EKXA 3QDHA 3LEVL 5IB1A 3PJSA 1HINH 1T22B 2EDQA 3GMQA 3SE4C 3VMNA 2D7OA 1DBKH 2ZCKH 1MREH 1J0JA 4XNYL 2DL9A 2EC9U 3ZMRA 1JPSL 4FQLL 1B0GB 2Q86B 3REWA 2AK4D 5ENWB 1S9YB 1QSFE 3QUML 3KWWA 5DUBA 2AJZA 1AC0A 1UACL 1U8PB 3GSWA 1TJIH 1NFDE 4CU8A 1JN6A 5DMKA 4X4YA 1WBXA 5HHMB 1VFAB 3JWDC 1KTLA 5GS0L 4WENB 2OL3B 1T66C 3EFFB 5ICXB 4QRRE 1R0AH 4FQHB 4N0CC 5DEGB 3BDYL 5DO2C 1FGVH 5FO8B 4EVNA 4HIJB 1O7SA 2VZOA 5D93C 3EYVB 5GRUH 4YDKH 1A4KB 5CINL 1T1YB 4MLIA 4QHMA 3WFHA 2NYYD 4RAVA 1EEYA 2DYPD 2CLRB 2ICEA 1EO8H 2A6IB 4I0PD 5A2FA 5LGJB 4JHWH 2Q6WB 3EHBD 1NCUA 5HVHC 4KV5F 3O3AB 5T3XD 4YHYB 5C0JB 1N6QL 2BHYA 3P11L 3BO8A 2BHZA 3MNVB 3LKQA 4XVJH 3WKNA 4U1JB 1D9KC 1G7MB 3FQXB 5ENWA 2OJZL 4JHWL 2X4OB 1FN4B 4OZHF 5F8QC 3I9GH 3KXFB 4MLSA 3VG0H 4CADA 3KLSA 5EU6D 4L9LA 5DJDB 2XZCH 4DAGH 1YY9C 1R5WA 1YQVH 4JDTH 4QRPD 5I74B 4JY6B 1BP3B 3HS0B 1WWWX 2NY5H 5IG7B 3EJZC 3RKPA 1FYTD 4Y5VB 5J1AB 4AIOA 2EDRA 2VNCA 1E4WH 1OSZA 2OP4H 2EH8L 4ZDHA 5CP3A 1U92B 2ITDB 4JM2D 3OAZK 1ZS8B 4YQXH 3CJJA 2F53E 2QHLA 2WUCH 5I1DB 3QNXB 4XPBL 5EC2A 5IBUB 4Z77A 4JKPL 4OF3A 5FO9A 2FEEL 2FATH 1OTTC 2YD2A 5T1DH 4RAVB 3QQNA 5F7DB 1EBAA 4JG1L 4NKMB 1ZV5A 4JFPA 4U1GC 3ARGC 4LPTA 5EULV 4N8VA 1CD1B 2X4NA 3MJ9L 1OB1A 4M1CC 1AD9B 3U9PL 1BBJA 2YPKA 1DLFL 3QB7C 2F8OA 3BP4A 3MXWH 4V2BA 3G6JF 3RU8H 3S35H 4MNQA 2MPAL 5C0CD 4U1JA 1M6OA 3D3VD 1ZHNB 3RKDC 4R26L 5EUOA 1A9EA 4GG6E 3BPLC 5GXBB 5L6YL 4U1NB 4AEIL 2X1OA 4PYHA 1F2QA 1U8PA 1VEOA 2XYCA 3WDHA 1RZKH 5JR1H 1ZEAL 5ILTL 4BZYA 3KYAA 4N8CL 3OKNA 3Q5YA 4LPYA 1D5IL 4U6VL 4YDIL 1WBXB 4I48B 1QSEB 3H9SB 4K7PL 2HH0H 3K0WA 4M9OA 1OT2A 5KS9F 1N3NB 1FFPA 1OAUH 1XF5B 3TBVA 3B4NA 4WUUA 5CLTA 4W4NA 1PX4A 1AXSA 5EU7E 3BE1L 2W9DL 3WIFA 2FLBT 3C6LB 2AJXL 3E8UH 4X6BB 1TJHH 1ED3B 1NGZA 2Z31D 5DEFB 3RA7L 1WCQA 3A6BL 3RGVC 5B39A 2GITA 3I75A 1I7TB 5JPNA 4WW2A 5F9JB 5GRJL 4G5ZH 5T3XL 4ZUTB 2FL5A 5TDPB 2BXYA 3JWNC 1AC6A 1BGXH 4HQQL 2H9GA 1INQA 1XF4A 3WFDH 1CLCA 5IESH 3VH8B 7FABH 3MOQA 5C8JB 5HHOB 1FL3B 1VFBB 4HUMB 1NC4A 4U6HA 5FK9B 4X7TB 1RZIB 4KRLB 5A3ID 2K7QA 4LF3B 2VAJA 4P23A 1JTPA 4QY8B 4HX1A 1INDL 1XF3A 4Z0XB 5DI8A 3QUYA 4ZFOB 2WLYA 2QSCL 5DMJB 4WIQA 1TCRB 5I8CA 4M7LT 1FPTL 2NY0C 1MAMH 3ELAT 4E42A 3VJ6A 4OCSH 5DVKA 1Y6KR 5ITBL 4W6XB 2JCCF 3ME0A 3MRLA 1U8HA 4NIKB 5I1KH 1IKFL 4NN5C 3M1BA 5B38B 4JO2H 3QFJB 2H32B 1TZGH 2X4QB 4RNRA 5TPWH 1BFTA 4AMKL 3P40A 3SDYH 3MRMB 1FZJA 2CUMA 3IJHA 3BUTA 2OQJA 4PS4L 5E2VH 3D25A 1EGJH 3HI6H 5KN5A 1ZVSA 4HKBB 1T2QH 4LCYA 5DURB 2YXFA 4K7FA 1FLRH 1Z9SA 4OGXH 1KXTB 4OB5H 5ICZA 2R1YB 2XXMB 3MRPA 4HK3N 4F3FA 5ANME 3I02B 4PJFE 1T0NB 2PYED 3FO1B 4UQ2A 5C0ND 4OKVA 1WCBB 1AO7B 1H5BC 3O3BA 3JV6B 3UO1L 4EDXA 2X4TB 4CKVX 4OCLC 4WCYH 3MRQB 1I4FB 3ZTNH 1AQKH 1NEZA 1MWAH 4OZHA 4YO0B 4X4XA 1FHGA 4J12A 5CUSH 1A4JA 3CSBA 5CJ5A 4UB0H 2I26N 5JHDD 4JVUA 4LP4A 4XGZA 4OSUL 2CJUH 3UJIL 5DMGD 4C59B 3ULUC 4NQSA 3FRPG 3MBEC 1HH6A 4P2RD 5KG9A 1JHLH 2DICA 4IS6A 5A2IH 2F5AL 1YNTB 2IANA 3WUZA 2ERJC 5DJ8A 1B2WL 3P2TA 2OI9C 4BH7B 4TNVF 3BUYB 3V0AC 1KEGH 3E0GA 4KY1L 2BNUB 5A2JH 4PR5B 1YZZA 1EHLH 1CFSB 1IQWL 2ADGA 2CPCA 3CLFL 4TVSa 3SDAA 1LQSR 5I74C 2ZCHH 1FYTB 1RULH 3HKFA 1FCCA 1FDLL 4JDVB 1H0DB 2DDQH 1YNKL 4FTVB 1ZHNA 2HH0L 3B5GA 1NDGB 4LSVL 1G9NC 4D3CH 4YDIH 1ERNA 4LPUA 2X4UB 3WSQH 3CSYB 3ARFD 4XNXL 3W11C 4LSDA 1VACB 5E6IC 1VB9A 5CEYB 1CGUA 3VD4A 1IFHL 4L8CB 2AV1B 1JWUB 3RX8A 3OPZL 5BVJB 4I0CC 1XH3B 4KTYA 4RGND 2DTMH 4MQXC 1WVZA 4MD4B 1AFVL 4O5LH 1Q1JL 3TNNB 3T2NL 3MGTB 4ZNCD 3RU8L 5E08H 5FM5M 5CIPH 2HLAA 2GY5A 3BPCB 5CEXA 3K4DA 2AEPH 3MREA 3PL6A 3D3VA 4OD1L 3T0EA 4O02L 3U9PH 4PD4K 5E94A 2XTJC 3SOBL 1K2DA 3I6GA 5EU4A 5A1AA 4Z76A 5C0CB 4LQFL 1JYWA 4KKCC 3OGCA 2JELH 3AROA 1ES0A 4WHYH 5KAQF 4LSSL 1JWSA 3O11B 1KB5L 1IC4L 2PYEB 5FHAH 4ZUWB 3O6ML 2HN7A 3QI9D 4HWEH 1CCZA 4M3JA 3QYCA 1EMTH 1D9KA 4TPRL 1M05A 1T03H 1D5ZB 4C4KO 4ZO9A 1GCFA 3BQUB 2Y07H 3ESUF 3DLQR 2ADFL 4ZO6A 5BS0D 2QR0B 4UDUA 3BKCH 3CH1B 2FLRT 4DUVA 2B39A 3AAZA 2NY5L 4P48A 1XF1A 5E00B 4WFED 5T3ZE 5INDB 1PYWB 1NCBH 4UZGA 3PWJA 3N1MC 5DA4A 4OKVB 1RUML 5DD5H 3VMPA 4HIXL 4JQIL 4U3HA 3GO1H 2ZSWB 2Z0BA 3AMLA 4K8RH 4E41D 1ED3A 1RJLB 1C12B 3B2VH 1R3JA 4JFFB 1W0WB 4Q58C 1UWXH 2EYRA 3S5LB 5J06A 2GUOA 1EXUA 1QFWI 1DUZA 1G7IA 1BFVH 3WNMA 2BDNH 2FEDC 1V7MH 3P11H 4M43H 4Q97A 2VRAA 1IC1A 5KJRL 3QEHB 1UJ3A 3TCLA 1F4WH 4GH7B 3F8UB 5H37G 4OD3L 3GGWA 3V8CA 1UA6L 3CC5A 4UAOC 3SKJL 3WHE1 4LIQH 2VJXA 4F8TA 1EO8L 1V7NL 4NYLA 4KUCF 2DQTL 3MV7D 3RRQA 4P5KB 2XWBB 1QO3A 2R0ZL 1F13A 2DQHH 2X9WA 3BVNB 3CDFA 3TO4A 3QQ4B 1FFNB 4ODHL 2MFNA 3GJFK 1ZLVH 3TLRA 2H6PB 3IU4L 4JFHE 2QJDA 2DL2A 5B8CB 3ARBB 3CX5K 4PGDB 5DWUL 1NDMB 1VFUA 4WO4C 4GKZA 3RWDA 5K9KA 3NZ8A 5CKGA 3L3OA 5E00A 4XCEB 3RDTA 1YC8A 1NCCH 4NQVA 4ODTL 3LOWA 2PN5A 3MV9D 3MMEB 1XGPB 2EXYC 5GRZA 2GK0B 3MRLB 3OKLB 2YC1B 2WINB 3G04A 2W65A 1CICC 2G2RA 4KQ4L 1FVDB 1QQDA 4F7PA 4PLNC 4OQ1A 4NQTA 1WEJH 1MREL 4OGYL 2F54A 4B7LA 1JGEB 4HC1A 5KSVA 1TDQA 4JFPB 3L3GB 3TIEB 4E0RA 1T1WA 3OWEA 3GGWB 3FQRA 3HZYB 2HMID 2A2QT 4PJEF 1NCTA 1UKTA 3A0OA 3UPAA 3BWUC 4L4TB 4N90E 3CIQA 3ARGD 3MJGX 1ZVSB 3C6LD 3KNBA 2AS5M 3OX8B 1FORH 1XGTA 3T0BA 5HDBF 1P9MC 4WNQA 3RNQA 2R39A 2EDNA 2NX5E 4LKCA 3DUHA 4HPYH 4U6TA 3TPKA 3LKSB 2Z92B 4WTZG 4M00A 1F42A 2B4CL 4JQVC 2YUXA 1Q0XL 4CNIA 5IK3A 5HHQB 3R8BB 2HG5B 1FVCA 1QSEA 3KYNB 3JTSA 2HFEA 4ZS6C 2C1OA 2XKSA 1FYTE 1RV6X 3WLBB 3S4SG 1MCHA 2PXYA 1U42A 2VLLB 4UOJA 1LHZA 3OKLA 3X3FL 4ZUVA 5CFHA 5F8RC 3FT3B 3RWGA 5EZIL 3MLTA 4I0KA 3QQ3A 3UAJD 1A6AA 1UVQB 4BQ8A 4XNZB 2APWA 3NPSB 5HGDA 4HHAA 4OZFH 4QRRA 1FNGA 3BESR 4ODWB 4GW1B 1DUYB 1J86A 1TTGA 1K4DA 5MEQB 1I7RB 2I60H 2VERN 1FGNL 3QULA 5DD6B 1I3VA 2C3GA 1F6LL 5K93A 4DFIA 4OIIL 4HW6A 4JVPA 5BV7H 1QP1A 1CQKA 3UYRL 2QSVA 1T20A 2YSSB 4WWKC 2O26U 4CVWA 3HNSH 1DQJA 1JZ4A 5FYKD 3MCLH 5DJ2A 3VFMB 1G7QB 1TJGL 2E9IA 2DOCA 4Q6IA 2DLIA 5E8NA 3MRBB 3MLRL 3W11D 5IVXB 3PWJB 2HFFB 4FFZH 3CCHA 1JK8B 5CILL 1OM3L 4GRLC 2ILLA 4P57B 4G7YH 4BZ1H 3ULVE 4EI5D 3ARGB 3TV3H 2W65B 4YGVB 4PJIA 4MAUH 1HCVA 3L3KB 5KAQG 2QLVB 3B9VA 4FQXC 1MAJA 1F6AA 4LLMA 2AXGB 2PF6A 4YBQC 4JR9H 1U58A 4RFOH 5ID0A 5IT2L 4LLDB 3ZTJH 1JNLH 2P8MA 4M02A 2CKBL 1X4ZA 1MF2L 1K8DA 2UZIH 1A6UH 5HYSG 1CGSL 1EGJA 5IGXH 2DM4A 1A1MA 3B6SB 1WAAA 3GBMH 3SGDH 1FZJB 5LWYH 4H0HB 4F7EA 4OD3H 1GHFL 1CQYA 4P2QD 4B53A 4OCWL 1KIQA 3OX8A 5C0AA 3O8XB 3RNKA 3BQUA 5SX4H 2VLKE 3V95A 3GJFA 4P2RE 1S7TA 4HKXB 2G5RA 3BVNA 1T4KB 4P2RB 4YHPB 5IHZB 3U48A 1ZE3C 3WS6C 6FABH 1D6EB 3RWCA 2H6PA 3OGOE 5HDQH 4DCQB 2H32H 1Y18A 4LLWB 4I4WA 4Z7VE 4YEEA 5FGBA 2AQ2A 5GZOD 3RI5K 4FS0A 1QNZL 1PLGL 3JTTA 4QXGH 3UTSA 2IPTL 4PGDA 3L6FB 5EN2B 1BOGB 1N64L 3F58L 4IRZH 4NT6A 5C9JA 4Q6IB 2EXYD 5IM7B 3HC3H 4NN7C 1OT1A 4U1LA 3QNYA 5C07A 1HHIA 1I1FA 3VXME 5I73B 1G7HA 3EO9L 3D0VA 5K9QI 1X5LA 1CICD 5ICXA 3GMRA 1I8MA 2MHAB 1J1OH 1OGAE 4PRIA 4PRHA 3HRPA 4MJ6A 2EYSA 1BX2B 1Q72H 1H15B 3W0WB 1NFDB 1WC7B 3C08H 1G0DA 4YFEA 2R23B 3S6CA 1HXYA 4JHAL 3M17B 5DMIH 4XPGH 3SGEH 1WSST 4MJ5B 5EZJB 5FYKH 5GJTL 4LFHD 5IEHA 4MCZA 1Q94A 4FFVD 3HAEG 3V4PH 4BH7A 5MEQA 5CZXC 4KRPC 1WFNA 3E3QE 3QFDB 3BXNA 3QQ4A 4PRBB 4C58B 4HBCL 5HI4C 2O61A 2X6MA 1QBML 4JFEA 4YE4H 3JWDH 1UKSA 4XBGA 3B2UC 5FYKE 4NZUH 1CG9A 4YHKH 5HHMD 4AT6B 5D1ZA 1UZ6F 3WNKA 4YNYB 1UCTA 5T33L 4EDWL 1W0VB 5SWSE 4FQJL 4JB9H 3LIZL 3LPWA 4L4TE 4BZ2L 1KLFA 3WXVH 1HWHB 5IVXF 5J4MA 4B0MM 3ES6A 2NX5B 1H8NA 4FQJH 1FZMA 1OP3H 4BZ2H 4X4MA 5AZ2L 4UDTB 4EDWH 1OD9A 2YC1A 4JY6A 3F6IA 5AWNL 4HC1L 4W6YB 2E27L 3MCKA 2FJGA 4KKLC 1BVKB 1YNKH 1H8SA 2GIYA 2J3SA 1OAYL 3V0WH 1Z3GH 3UBXA 1KEML 4NQCA 3CNKA 4RMVA 1MFEH 4RFEB 1IC5L 5HDLA 1VDGA 1WT5C 4OFIA 1MHCA 1S7RB 3IAQA 4G8GA 4UTBL 5DMIL 4CMMA 5FAAA 1HHJA 1UM6H 2P8MB 5FM5O 1UXSA 3MRGA 3GSRA 1KJ2H 4GMTH 4UUJB 2ZNXA 3TCXA 3ZZ1A 4PJXE 3SGDI 1I7RA 3EOYG 2HRPH 2PXYD 4MYWB 4CU6A 3ZHKA 4FQXB 1TVHB 5FF6A 2E7BA 4POZD 3QO0B 5E1AB 1JHKL 3NCYP 5CUSL 3JWOH 3FOMB 1M6OB 1PLGH 4O2EB 1BVLA 4MNGA 2HJLA 4NQXA 4YDJB 5IROA 2YS4A 2KH2B 1XF3B 4ODXB 4IMLA 5DJDA 4UIMA 2C26A 5F7WC 2GT9A 5F88A 1GPOL 3O4LB 5HVHB 5HHXL 3O2DH 1FV1B 3VRLF 1JMXA 2WMPA 3MLUH 2IQ9H 3V6OE 4UNTA 5CMAA 3MLWH 4JZJA 1DVFB 2UY7A 4WW2C 1KB9K 3IFNH 4AENA 1N5YH 4CUCA 4C56E 1E0OB 1A3RL 3IU3B 4FQ1L 4YBQD 4AK1A 3MNZA 4DTGH 2EICA 3ARGA 3V5HB 2P24A 5T1MA 4NUGH 4S11A 5DK0A 3H8NA 5EC2B 2E9WA 4JO1L 4WHDA 2ATPB 1JGLH 3M45A 1RZJL 3S8WA 1NBZB 3DYMA 2WZPD 1F8TH 3PGDB 1TZHA 3BIAX 5EUOF 3W81A 2PTTB 1YN7A 1JWMB 1PKOA 1F4XH 3PGCA 3QUXC 1VGKB 5A2KH 1CGTA 5KN5B 1JGUL 3P30H 1OVZA 1ORSA 12E8H 2ENSA 4P0DA 3C60B 3QDJA 4PJBA 1J12A 3FQUA 1H9VA 2UWEE 3CFJB 2XKNB 5I17B 3EOBB 5IMMA 5T3ZD 3O4OC 1CXFA 3NABL 3FT4B 1EO7A 2VR5A 3D85B 3QI9A 4XVTH 5D96B 1T5WB 2VIRA 2F9BT 3LDBC 2LAGB 4QRSB 4M7ZB 1CS6A 5BV7L 1UJ3C 3QIBC 2DTSA 2F8VA 5JW4M 1ZWIA 4MWFA 4KKNA 4AM0A 4GRLD 3PXJA 3ZDZE 1BEYH 4LLYB 5E8OA 1A4KA 3VFUB 2OK0H 2OMNA 4GAGH 4P5TD 4RMTA 5HI5C 1EA9C 1C5BL 2CLRA 2ICEB 4FZ8L 4EI6B 1KB5A 4ZAKB 3WE6A 5L2KB 2NW3A 4F37K 3MRGB 5JIKA 2VZ3A 3DTXA 4PLKD 5FGSA 3BZEB 1CL7L 3KLAB 4XMLL 3L5JA 4PJ9C 4Y2DB 2Q87A 4PTUA 3HZMA 1YEFH 5DQ9A 5F96H 1NJ9B 1W8NA 3VFRB 4NC2B 3DO7A 4YWGH 1B6UA 4QTIH 3L7FA 5TGBA 1BLNA 2GK2A 1P4LA 3HNVH 3LKSA 3WUWG 4CVUA 2J2ZA 4PJGB 4LVHB 4F7MB 4TUOB 3IDUA 4NP4L 5DI8B 1VFBA 3SQBA 1G6VK 3QXAB 1UKQA 4NRYA 1NLDH 1QSVA 2PTUA 2GTWB 2VLJE 5T1LA 1HHKA 4DZ8A 4NQDA 4YHIB 5JDJA 1E28B 5C3TA 1UH4A 2AEWA 4U05A 5J6HB 3QFJD 3WKMH 1ZEAH 3CFKB 3MZGB 4X9GA 2YWYA 2AJUH 2IH1A 3P9WB 1BX2A 4S1DD 5I8OH 4G42B 2FR4A 4NRZA 4UTAH 1IGTA 1LEIB 3ARED 3BIKB 4MNQE 3SDCC 2JJUA 1UM6L 2WM0A 2YRPA 3UTTE 4YFLI 3SPVA 3QDGB 3MNZB 3QDMA 3EOAB 5LBSL 3M8OH 3QIWB 4JG0L 4ZFZA 1H3WM 4PJ9A 4HS8L 1BBDL 4HUXA 3TNMB 3VDBA 4ZFGH 1NBZA 3GSRB 2HT4D 5AWNH 5JUEH 5BV7C 5T1DL 5EO0B 1E27A 3L7FB 1KCUL 1CFVH 2Y23A 1G7PB 5JNYA 5D7IB 3BZ4A 3UBXG 3WXVL 3ARBC 3EGSB 2EH8H 1Y0LB 1RIHL 1DE4B 1S9WA 5IBUG 3RWHB 2XKNA 5ADPL 4UNVA 4V1DE 3H9SE 1SJHB 4U1MA 4JFXB 4MJIA 2I25N 4KZEL 4R7DB 2W60A 1FFPB 2J6EL 4L4VE 3O8XD 2V2XA 1ZVHA 4LCCA 3QUXB 3DXAA 3NN8B 2PO6C 2W91A 4ONHA 1AQDA 4UIKL 1F4AA 3W2DL 4PV8A 5HYFA 1JL8A 3PHOB 4Y0GA 1M7IA 1RJYB 1FAIL 1I9JL 1QFUH 5IBLD 1WWAX 4CMMB 4OT1H 4M9PA 1CLZL 4HULB 2OBGA 4GFTB 1ETZB 4Y4KB 3FTGB 3EOAA 4ZSOA 1N4XH 3DGCR 3V6ZA 1MI5D 4GG6B 5EBGA 4FQXD 4FZEH 5ECJE 1KTKE 2RIKA 5ICYA 4PRNB 4DEPB 1JNHA 1JI2A 1KJ2A 4PBXA 4PJ7A 5ITFA 5KSAC 4ODBD 4M7ZC 2ZUQC 1F5WA 1A02N 1CLZH 1CDHA 1J0KA 3GO1L 2P45B 1N64H 5DJCB 1AR1D 3Q3GA 1D5BB 2FRGP 1QYGH 2O5YL 2PTTA 1P4LB 2VQ1B 4PJAE 1J1XH 3NIDF 3DJ9A 4MXQD 1WAAF 3CXHJ 2MQ3A 3ARBA 1FZOA 1NCBL 4HFUH 2J6EH 2P5EA 3IT8D 2ZOKB 5EOTA 5IQ7H 3H9HA 4I2XA 3QDGD 3LD8C 4NC1E 2VXTL 3O0RH 3CFJA 2QV2A 2EDWA 2P8LA 5GGRB 4DN4L 3SO3C 2BZDA 3QXUA 4RA3A 4NM4H 4TUJA 2R1WB 3OJDB 5L8JB 3BGFC 1CFVL 4NQEE 3WS6A 3DVNA 5FA4B 1BWMA 4R4NC 2DRUA 1TQCC 1VCAA 3MFGB 5CGYC 5FOJA 3IXTB 3BQUC 3FO2B 3QUMH 1MF2H 2E6PA 5FGCE 4HXAL 4BK4A 1OL0A 4B5EA 4W81A 1VADA 3GNMH 1GAFL 1GGCH 4NJ9L 3T4YB 1AXIB 5D1QA 2KQMA 3MUGA 1KTLB 5EZJA 3GSNL 1JPST 2P5WB 4Z18A 1YJDC 1KPUB 3MODH 5CJBA 5F1NB 4NO3A 3LVEA 4XPHL 3QUYC 4Z76B 5LCVH 5KZCB 4KK6C 4WEBL 5EU6A 1A2YA 2UUDK 3OKOA 3IDNA 1EEZB 1FC1A 3L7EA 3ULSA 1NJ9A 1PKQE 4JJHA 3EOBA 5IMMB 3H2WA 3QXDB 4MDJB 5EIVA 3C2SA 4D3CL 2V6HA 4PJCE 1OWWA 4LMQE 5HY9B 5E4EB 3OJVC 4JM2A 3KDMB 5B4MD 3PWNA 4Y8DC 3CGTA 1HKLH 1MFAL 1IZKA 1QPXA 1T89C 3S5LA 4NWTH 1NBYB 3H42L 1Q9OB 1PW3A 2QQNL 3HNVL 3E6HB 4GKNA 4XAWL 4ZDHB 1JHTB 1MUJB 1QA9B 2WWMD 4W70A 2FNBA 1FRGL 1PQZA 1TQCB 3OXSA 4BJLA 5TE4L 1MFBL 5DFVC 4HWBA 3K2UL 1NQBA 1OTUC 5EZIH 3S36H 4KJQC 3WUWA 4RX4A 1UXSB 1W0YT 3SPVB 2HKHL 2GJ6A 2MCPL 1LP9B 3IDMB 3K80A 1HYSD 2XQYK 5IKCB 3X3FH 4N5ED 2XT1B 5I16A 2JCCE 5D2NA 5GZNC 2BNQB 2C3VB 4JJ5A 5ACZB 2UVFA 3EJZD 5B8CA 3DGGB 3H42H 4F7MA 4ZUSA 2N7BA 1ZT7B 3ZTNL 1U2HA 4HF5L 2FZ3B 5JDSB 3RVUC 4OTXL 4CDGC 4OLUL 4Q6IC 4I5BB 5GRYA 1H0DA 2LFGA 1EK3A 1BVLB 4MNGB 3ECBB 3MROA 1JJUA 2H8PB 1PG7X 3GSUB 4POZC 2FBJH 4Z5RA 4B7IA 4L3EB 4UINH 1G7QA 1KACB 4OKDA 3UTQB 2VXSH 4OB5L 1HQ4A 3V0VA 1CGVA 2IH1B 1U91A 3OJMB 5EFIB 2X44D 2E7HA 1IGYA 1BAFL 3TBVB 3DX8B 4MNQB 1JGVL 1MNUH 3O9WC 3WIHL 4OI7A 1JRHI 1KTDB 3GK8H 3S3PA 5LJYH 1XGPA 4KTDL 3OB0K 3MGTA 2OCFD 3QUZD 4MXVF 1Z9MA 1EIBA 1QEWA 4AMKH 3WHXA 2NPLX 3CD4A 4YGAB 1NMAH 3GFUA 5J11B 2QQLL 3QIUB 3OTTA 2R0LH 1QBLH 2QSTA 5GISL 4CBPA 3H7LA 3V6ZB 3RNQB 2OTUB 3VXNB 3QEGH 3SDXF 5DVOA 2DBJA 1AP2B 2NY4C 3PXHA 3A67L 3ABZA 3IKCA 5I18L 2DD8H 1G6RA 5EOCH 4RIRB 1U3HA 3UYPA 3IF1A 5CP7B 2ZUVA 5D1XD 4AZ8A 2VXTH 3O0RL 3QUXD 3LKPB 3RWFB 2DI8A 1EFXA 4GO6B 3MBXL 4LLWA 1ZA6A 4PIRF 3OG6B 4M1DL 3BDXA 2IFGA 1QTYT 4R0LB 4X99B 1FVEA 1J1XL 1VERA 1J88A 1HILB 5T5NF 3MSPA 3C2AL 5A2LH 3UTTD 4DEPC 1GJIA 3QJFB 2DQTH 3F7VA 5E8NB 3QG6A 5FO7A 2BVQB 1S7WB 1T80A 2MSPA 4WWKB 2LU7A 1BQSA 3NCJH 2OS7A 4FZEL 4PJIB 2R23A 2ZUQB 1UFUA 1ZMYA 5TH2B 3CMGA 4Y19A 1OTSC 1KN4L 4AYFA 1IEBA 1CXLA 3L95B 1TJHL 4OZHE 3MLPA 2VDLL 1JVKA 1K3IA 2X09A 1FNGB 4L3ED 2Y36L 4ODWA 3CXHK 1RUPH 5IF0B 4ENEC 1KCSH 3W2DH 3VFRA 1P84J 1I8IB 2OI9B 1C16A 4F8QA 4X80L 2HRLA 4QTHB 2Y72A 5IB4A 4MVBC 4LCYB 1J1PH 5HJ3A 4U0RB 4HC1H 4U6VH 3LEXB 2XN9E 3GMPA 1RZKL 1HZHL 4YHPA 5IHZA 2VLKA 3MC0A 5JHDB 3O6FD 4P2OC 3GIVB 5AYQA 5DD3H 5J6GA 5DD0L 4DGYH 2XPGB 5D1QD 2DN7A 3SE4A 1NC2D 3UROR 4LLUA 3VI3F 1LE9A 3VDAA 5ANMB 1MLBB 3O6MH 3UJTL 5T33H 1IGMH 2R15A 3DURA 3FL7A 2JTDA 1KCLA 2AXGA 4TTDD 4WDIA 1G7HB 3BW9B 3KPRD 5DHVA 2XA3A 4L3CB 3MUZ1 4PJAB 1LMKA 3PP4H 1DZBA 5IMOA 4PRHB 3ZHLA 3L1OH 3J7HA 4PRIE 5F6IC 4P2QA 3VG9C 1Q1JH 5F9AC 4JKPH 2WWKT 4WTWA 3K81A 3BD4A 3TBWA 3LRHA 4UTAL 1AGDA 3C08L 1TZIA 4GRLA 3ARRA 3ZSTA 5D9SA 5D8JH 1CFSA 3QUKA 2ZUXA 4TSAL 3S4SB 3FFDA 1AP2A 1RY7B 1ZGLM 1MFNA 4ELKA 2LAAA 3DVIA 2YZ8A 3HZKB 2DQCH 4NQEA 2OM5A 1JZ8A 3MCG1 2J5LC 1OD7A 3GJFB 1BF8A 4UMGA 5ALCH 1M4KA 2CK0H 2BERA 2XZCL 4DAGL 2HA1A 4RRPG 3I2CL 2YA1A 1YN6B 4P5MB 5E5UB 3GDBA 2YWZA 1F3JB 2B5IC 1REIA 4KK8C 3TZVC 4Y5YB 1CLOL 2Y7QA 2GT9B 3OXRB 5HYSA 4O2CA 4LCCC 2Y5TB 2HKFH 3MOAH 4CVZB 1MCWM 2FGWH 1X5HA 1A1NA 4PJCF 1EJOH 1N6QH 5DJAB 1I8MB 2CJUL 1AGBA 3MREB 1T1XA 2GAZA 3NCJL 4WEMB 2HFGL 4MAYD 3UJIH 4UI2A 3CFBA 4UV4H 2B8OT 4ZAKC 4GG6A 1GC1L 4Z8FL 2DS4A 3W0WA 4M6NL 1R3HA 3V6BR 2CKBA 5FCUH 1JNLL 4MD0B 1WITA 4KROD 1ITBB 2V5YA 4Y4FD 3P0YL 5DFTA 1MEXL 5DD6A 1LE5A 3EYSH 4K3JL 3OKKA 3HR6A 4KPHH 4RMWA 1M7DA 4UUJA 3L3HB 3GI8H 1VFOA 1AO7D 2C3HA 3E6FB 3ZDZF 2VQ1A 2EDHA 1WFOA 3RP1A 3HE7B 5CILH 3T1FB 1XCQB 1U8MA 3HZKA 3U7YL 4C83A 4OGXL 4DZBA 1LO5B 2BNRD 3HPLA 2BJMH 4NKOA 3QEGL 2YPLD 1NAMA 3RVTD 1QBLL 3GUTB 1AGEB 2Z31B 5F7LB 1MIEL 3KLHC 3QZWB 2KL6A 3QIUD 5KSUB 4JZJC 4OGAC 1P4IL 3C6LA 4ZMAT 5TPWL 5TE7L 2CRYA 2VR9A 4WFGD 3LS5L 1PFCA 4W68A 1KIPB 4UDUB 4IMKC 2H2SD 4ZYKB 2AABH 5MEPA 1FGNH 1U3HD 1LO3L 4X6CB 4ZAKA 3WE6B 5GIRB 4NUGL 3VXUE 5JQHC 4WW2B 2NY0B 2GCYB 2NW2B 5IROC 2GYSA 1XEDA 4N0RA 1PEZA 1A3RH 1J87A 2W9LA 2MQCA 3DXAD 4UBDD 3GBNH 2IQ9L 5CBAB 1WBZA 3UTTA 3IETA 4NCC2 5C6TL 2DIJA 2QSCH 3FQTA 1G7JB 2EDTA 2GY7B 3U0PB 4WI4A 1GGUA 3IB4A 3VI3E 4QRPA 1YEGL 1K6QL 1IM3B 3EJYD 5KBNC 4R7NB 5MEOA 2E5EA 5K9OB 4PJGA 4A2LA 1ULVA 4M5YH 1V3MA 4U1IA 4HF5H 1KT2A 1ZHKA 2EIZB 5JXEA 1W72B 1FH5H 2PNDA 3CPLA 1DBMH 3RDTB 1CICB 4JY4A 2JB5H 43C9A 2DIBA 3HE6B 4YK4C 5TDOA 2B4CH 5ESAA 2XWBA 25C8H 5BW7A 3PQYE 2ZNWA 3FT2A 2MCPH 2HRPL 1IAMA 5MI0B 2PO6B 1AHWB 5CEZH 2Z91B 1U93B 3GHBL 1KB9J 5FO8A 3O6KH 1AY1H 1A1NB 2Z8SA 5GRJH 3LQAL 4ETQB 4JY5L 4P9HH 1DJSA 1IGCH 3U46A 1KCVH 4XC1H 4GKZB 3NA9H 3ARDD 3GMOB 1MPAH 3OKDA 2G5BA 3IDYB 1GGIL 5HHPB 5DMKB 1XIWD 2X7LB 3GMNA 4OAWA 1L7TH 3SEPA 4RNRB 2Z4QB 5JW3H 4EOWL 2OL3A 1ACZA 4MNQD 3KS0J 4HUXB 3DBXB 4XX1G 1AD0B 3MACL 5DRXB 4FABL 1CXKA 3NCFB 1FJ1A 1IAIH 4FP8L 2NYYC 2P49B 1WEJL 1NC2A 4M93C 4K7PH 3BEWA 1D5XB 1RUQL 3G08B 5DO2D 2MQ0A 4GW5A 5ILTH 2IEPA 1NMBL 4J3XA 1II4E 1UT9A 3HRZA 4AEIH 4NSKB 2EDKA 2QKIB 4E0RB 2DB8A 2AV7B 5K9QG 4WFGE 2FX8L 4EN3A 3VFVA 4AY0A 3O6LH 3MUHL 1GZQB 1D6VH 4NO0B 2IAMB 2MPAH 1TXKA 3AAZB 2M1KA 1A3LH 2GTWA 5J1AA 5CGMA 4JRYD 4WHYG 3OR6B 3S37X 4HK0A 1YEEH 3OXRA 5KSUA 2I5YH 3QWRA 3SGJA 4LVHC 4QRQA 4HXAH 3GSNA 2UY6A 2Z8RA 3MV7B 9CGTA 1KIPA 2EDFA 2W0LA 3MRCA 4X9HA 2YMXH 1V7NH 4DGVH 5BZWA 5JQ6L 1DN0B 1A9BA 2J5LB 3C09B 1UA6H 1I1RA 2W1NA 4KROC 1TZIB 5I19L 3TA3D 3DRTA 3BYYA 5GSRB 4Q2ZB 2GI7A 4EUPB 1R3IH 5F93C 1NH6A 1C8PA 1XT5A 4LL9A 5F89A 2AJ3B 2RQ8A 2HVKB 2NTSP 3EYUL 3MYJB 3AXLA 3QQ3B 5T1KA 3V6OA 5HHOE 3GM8A 4N90D 4NKMA 5TFSH 4JVWA 2AV7A 1KYOK 4K8RC 3BZ4B 4G9FA 4X4ZA 2BY0A 5FXCH 4Z7WF 3UAJC 2XTLA 4XTRC 3O4LE 2AVGA 3KPOB 4WUUD 5I1EH 1ND0A 4PUBL 5DZOA 3QIWD 1KV3A 1NCWH 3MGAA 4DQOL 5I19H 2N56A 2R1XA 4KJPC 5DEGA 2VZ1A 4TN9A 1A9EB 4GMSL 1I1YB 1I75A 4QRQB 4S0TD 1RZ8A 1OP5H 1F6AB 1A6UL 1ZHBA 4KK9C 3BZFB 3MBEA 4Z78A 5C0AD 3BIBX 4MMXC 4UIKH 4OAWB 4H8WC 4IDJL 1TETH 2BSED 3JV4A 3W39B 4MQ7A 4UT9L 1ACYL 3K1KC 1G9EA 1HQRA 1RPQA 1I3RA 4KAQH 5DVLA 3HG1D 3D18B 2AEPL 4F9LA 4X8JB 3HZYA 3FCTB 4QYOB 4QHNA 3T3ME 2AEIT 1TTFA 4LDEB 5ADPH 5D2LB 3BP5B 1NGZB 5DK2A 4WRLA 4OZFA 1X6NA 3OPZH 1SYVB 4V2CB 2IQAA 1KCUH 1UACH 2HWZL 1SY6H 3TJEH 2QTEA 2BSTB 4MJIB 1NMBH 2HJFA 2C3XA 3KPRE 4QY8A 2H26B 3MLYH 1ZOXA 1S9WB 1I8KA 4HUVB 1XGQB 3PHOA 4FP8H 2J8UF 4M4PA 5GGVY 4WW1A 2VUYA 2PYFA 1QRNB 2YOCA 3EHBC 4K55A 3S9DB 3X12B 4OQTL 4XVSH 3FTGA 4PJ8C 2NZ9D 4CU7A 2ZZUT 3KPSE 5E8OB 2R4SH 3C5ZB 3VGBA 1EHLL 2XZQL 1MRDL 4APQD 2CIIA 4ZQKA 4M7KL 1XIWC 3MRCB 2E7CA 2NW2A 5F72S 3NA9L 3M1BB 5D1ZC 2X9YA 5E2UL 1XCTB 2NY4B 2ICWB 5L7XH 2CUIA 4KVCH 4OZ4B 4D9LH 2OXHA 3CU7A 1RZJC 5GZOC 4ODUA 4YK4B 2OQJB 1QO3B 3QZWG 1U8NB 2JB5L 4QHLB 1NLDL 1S7VB 5F89B 3T3MF 5MI0C 3MFFA 1DBML 2FZ3A 3MYJA 4NN6B 1EEUA 2Z93B 2ZPKL 1FNFA 4WCYL 4F80A 2FWOB 5C0AE 1OQXA 1J8HD 1KPRA 1XGRB 4M5YL 3V7AG 2DIAA 5GGRA 5BQ7A 4W4OC 4JY4B 4YHLH 5T1LB 3FRUA 1GOGA 1WF5A 5TQ2H 1WAAE 4LLAA 3PHQA 2OTPA 4MD5B 3CFDA 3MRHA 4GXUM 1OB1B 4O2CB 5C0EB 5HHVL 1FLRL 4U3XA 5F7KC 2FIKA 5F1OB 3CSPA 2MMXA 3P4MB 4URTB 4L8BA 2EXWC 2OMBA 3OJDA 1EGJL 5C0NC 1BJ1H 4Y88A 3GMNB 3B2UD 1LO3H 3HI5H 2BY1A 1UADC 3WIFB 1BVZA 3U1SL 4XGZB 4XT1C 1T0NA 4UQ2B 1N7ML 3SDXB 3LV3B 4TULL 4F9PC 4XRCA 2VKWA 3JV6A 4XHJC 1K3ZA 3NPZB 1QBBA 2L7UA 4V1DD 5ESQB 1V5JA 1O7VA 3H9SA 1ZHLB 5F70A 4QOKA 5BJTA 1CDUA 5DMGC 1KENH 4HCRL 2PCPB 4GXVH 2X1XR 5ITBH 4YBHA 4OCSL 1T04A 5E8PB 2ZUWA 2ATKA 5FF6B 3HTLX 1EEZA 4JPKL 3DMMD 4HJ0D 1MELA 2ZWLT 1NC4B 2HJKB 4DOHE 3HA0A 2HJLB 3BPNC 3EDFA 2HLFD 1C5CL 2B0SL 1INDH 2KDGA 1A6WL 1T66D 4IMLB 2W60B 1HILA 4TULH 4MD5A 1RZJH 4HMEA 2IBBA 3LKNA 2X70A 2VITA 1DQDL 2IG2L 3Q5OA 5E1AA 1NAML 3QXWA 1RJYA 3HPJB 3TA3B 4Z7NE 4FQ1H 1XF2B 5EOQL 1EX0A 2IADA 3UC0H 2Q8AH 2DQEH 3OAYK 4ZYKA 1NDGA 3WFZA 1T0MB 2BOBB 4ONFH 2QQQA 5FYLE 4JHBA 3P0GB 4MHHI 1KN2L 3T3PF 1H3PL 5ABDE 1XCTA 5DR5L 1J8HB 3H6JA 4G6KH 4NBZB 1DEDA 4Y4HA 3TVMC 4CGTA 4M6OH 2CQVA 1XFPA 1CD8A 4OM0L 3FMGH 2SEBB 5IJVA 5HXMA 3CX5J 5I1LB 2HVKA 3U2SB 3C60C 3BKML 2QL1A 2YPVH 2HTLD 4UNUA 3VRIB 3IETB 3U7WL 2NX5D 3RPKA 4HGWA 2HT2C 3P0VL 2V5SA 1A0QH 3DX6A 3F7PC 3MROB 3S37H 3JWOL 1ORSB 4U1GB 5D7JA 1MFCL 1P2CA 1ZLUH 3SJVE 4JKMA 3STLA 2H41A 1BIHA 1B4JH 2IANE 2XNAB 3KPOA 4NKIL 2WWKO 3QUZB 1VFMA 2GFBA 3EYOB 5D7IE 2R1WA 2X05A 5E8EA 4LSQH 3V4VL 4YXLL 5F3HA 4TPRH 4S0SD 2EEBA 5GS2D 4V1DB 3QHFH 1FNLA 3SKUD 4NJAH 4UDTA 5C0JA 4JN2B 3KPTA 4PJ8D 2XZQH 5KSBB 4NZDA 2X4TA 2GSGB 2R4SL 3P3YA 4X6DF 4TUKL 2F19H 1UG9A 1MFEL 1RURL 1DL7L 2BVPB 2NR6C 1A1OA 5CGYD 4O00A 3LQZB 1OY3B 2DQIH 2Z8WC 2DM3A 3SDCB 4CADB 4R0LC 2C4XA 1LK3L 3ULUL 1S9XB 1EHXA 4O2FA 5DC0A 1F11A 4RQQB 3BGMA 2DLEA 5I8KL 4Y2DA 5DRXA 3WL9A 5EWIL 2P44B 1C12A 5E1HB 5DRZB 3QCVH 5GS0C 1RIVL 2XY2A 3O8XA 3RNKB 3SE3C 1FIGH 3ULSB 1DBBH 2FB4H 4XWGH 1YEHL 4TSBH 1IFHH 4LAQH 2OP4L 5TGBB 5DHYB 3W9EB 1E4KC 4N9GA 2NXYB 1RJCA 4XNXH 3CFCL 4H88L 4KV5E 1OLZA 4X99A 5HYJB 2X89D 4LK4A 2R29L 5K9KB 3P9LB 4KAQL 4QGTA 5FUCE 4HWUA 3MPCA 4IM8A 1IM9D 1XGRA 3RUGB 1LEKA 4U0RC 4ZOEA 3SO5A 1KLUB 3NFPB 4X7SL 43CAA 1EERB 1RUPL 2APXA 4G80B 1FFNA 1JPGA 4PJ9D 3VGAB 3VXTA 5KVFL 1XR9B 2VITB 2YD9A 4JRXA 5CJQH 5B3NA 4H26B 3QRGH 1BQLL 1EVTC 4DQOH 1DTUA 1RU9L 3SDAD 2DBLH 3VGHA 3C8DA 2FO1A 1CT8B 2LABA 3P4NA 5IJKA 2DM7A 3L5HA 3MMEA 4GRMA 3FQRB 1AO7E 3T0DA 5C3LD 1OAQH 3QFDA 1VEMA 3CVIH 2NLJA 4HH9A 3ARFA 4QXGL 3ILPB 2YD7A 1YEJH 5JOEA 1U3JA 3VRIA 5GGTH 2X4SA 5C0CE 5C0RL 1I9IL 1I8LC 5BOPA 3T8XB 3UDWC 3MRNA 3ARSA 1QRNE 3MOBH 1YY8A 3OG4B 5T5NG 2NY2B 5EUKA 5L0QC 2AQ1A 3D39A 1V3JA 4WGVB 4PJDB 5HI3D 3ZKSD 3MRHB 3CFDB 3C60A 2L0DA 2Q7NA 4JFHD 3RGVB 3PWVA 5JOFA 1WFUA 1V3LA 4P3DB 4RMUA 2W59A 5DXWA 5IIEA 1N5AA 4LVOB 4LEXL 4XH2B 3MZTA 4M48H 1ZTXL 1QPPA 2UZIL 4G80A 2X42A 4XTRD 2P4AB 5AD0B 2EH7H 5ERWB 1DR9A 2APBA 4PV8B 2J4WH 1CK0L 4OF0A 3TYFB 4Z7WA 3VH8A 2D03L 2EXWD 3E1F1 1KFAH 5FOBB 5SWSA 4KDTA 3QP3A 4OI9A 5FYJL 8FABA 4XVUD 2BRQA 4I8DA 4G7YL 4BZ1L 4Q6YA 4XAKD 1T6VN 3OR7A 4JO2L 4WI9A 5LXGH 1QHOA 4JFZH 5MENA 3N0PB 5I1KL 1JPTH 1PSKL 4U0QB 4XPTL 3TN0C 3P4LA 1QOKA 1MCCA 2AK1H 4G8EB 5D1XB 1U8QB 4FTVD 2YKLH 3RWGB 3LD8B 5TDNB 1RUQH 1SEBB 2EYRB 3QUKB 4LSPL 3REWB 2FHBA 3TT3L 3S7GA 2NY4D 2BOCB 1GXEA 3PWLA 3C8KA 3U4AA 3MLVL 4D9QD 5C0IA 5IB5B 4PB9H 2VL5A 5DUBB 5IWLC 3VFMA 1Q9KB 3LKNB 4ZXBA 4PGZA 3CLEH 3STZB 4N0FB 3KPNB 1Q9LB 4JFOA 1NBVL 3DECA 2R2CA 5GHWH 4XCNB 2BVQA 2CH8A 2CRZA 5T1KD 3X12A 1RK0A 2C3WA 4JY5H 4P9HL 4WV1C 3W0WD 4GG6F 4WU7A 3PIQB 3MUY1 1DQJB 5IUSA 5ACMA 1CDIA 4N0YH 2Z35B 4Y2OA 5TE4H 4YIQB 4YHOL 1IGTB 2J8UA 4Y4FA 25C8L 5J89A 1OW0A 3T4YA 2J88H 2WBJD 2XQBL 1WZKA 3A6BH 2E3VA 3VGFA 4QCIB 5E7FA 4QHKJ 3RVXC 3ZDYF 2Z31C 1R3HB 3SDDB 4HEME 3RGVD 3VFNA 3U0WH 3PV7A 5GGUA 1HSAA 5GS1A 1S7VA 5CSZB 3MV9A 3KYOA 4IRSA 5DHVH 4PBVC 1GYAA 4ZTOH 1CE6A 5KVGH 4Z6AT 1EZVY 3BJLA 3TT3H 1FNEB 4KUZL 4TVPL 4BSWA 5GSVA 1G84A 2Q8BL 1U3YA 5JR1L 2WV3A 5DJXA 1F3DJ 4XAKE 3D0LB 4E41B 3HZVA 5IFJB 1D5MA 5I1HL 3UTZB 5C9JB 3T4AA 4JPWL 3OKYA 2Y06L 1PSKH 4TNWF 5E2TH 1P69B 5J12C 3P77A 3RWJA 3JTSB 2YRZA 3S35L 3HMXH 1R3KB 4JQXA 4PRHD 4ONOA 2V5TA 1QHPA 4H1LG 5HHNB 4TQEL 1CI5A 4JPVH 3B9KB 1GAFH 3JUZA 1HCFX 2D03H 4KQ4H 1N0XL 2HTKD 4AEHL 5B3JF 2VDNH 4BSJA 5DUMH 2EH7L 1BFOA 4X9IA 1PD6A 3HAEA 4JFFE 3G6JB 4NHCL 4JKLA 5D2LE 3T08A 4L8SA 2BVEA 3IDYC 1X5FA 3K46A 1BD2E 1NGYA 2VLJD 1IRAY 2PXYB 4R7NA 3D39E 4FG6D 4GAYA 3HLAA 4FQCL 3BAEH 3C6SA 3KYKL 4U7SA 3UPRA 4R6UA 5DK3A 2VDQL 4HFUL 1D5XA 5IFHL 3MRNB 4MDIA 4NRYB 5DZNA 3T0XA 5LGHH 1Q94B 2A83A 5I16B 5E6ZA 1ROWA 4FXLA 1V3KA 5JZ7C 5DQJA 4GKSB 4HAFA 1OCWH 1QLFB 1YMHA 1FCGA 4M5ZL 8CGTA 1GC1H 4Z8FH 1P7KB 5J8OA 1IVLA 4M93B 1HYSC 1TCMA 5FUOH 4MA1B 4KHTL 4X8XA 3TO4C 2FJGB 2FD6H 2WIIB 2YA2A 2H45A 3G6JE 4B41A 1CT8A 1JYNA 1FAKT 1M05B 3HC4L 4P57A 2DYPA 1BMGA 1F4HA 4I0PA 1DQQB 4LVNB 5C08B 5I1GL 1BJMA 4JO3H 1I9JH 1QFUL 1I1AB 2CO6B 3D9AH 2AQ3A 1B4RA 3OKNB 1OP9A 3QPXL 2JE8A 1U95A 1CFNB 1YPZE 1L0QA 3OB0H 3C09C 5I1CL 4S1QH 2DQCL 2YPLE 2K9UA 3SKOB 5CSZA 3DARA 3BDYH 1N59A 3BKCL 3PGFH 1CU4H 4Y4FC 1FL6B 4XCCL 4G8EA 4H88H 5ETUA 1XCQA 1SJEB 1WZMA 3U0TB 2AJ3A 2CRIA 5KW9L 1CTOA 4X4ME 3MRKB 1EMTL 4RZCA 3C5ZD 1ZLWH 3TH3T 4QXTB 5JOFB 4HWEL 4XMPH 2H26A 1VENA 1CWVA 4OLZL 4ORGB 2VXVH 1J9CT 1LO4H 3QWRD 5I8KH 4HX1B 1IAOB 1XZ0B 2DQFB 5F6IB 3IAGC 3KJ4C 1JPSH 4TVPE 3D2UA 3SE8L 3VWJB 5C07B 2XA8H 3SHSA 1U3HB 4HS8H 4RGOH 5C0FA 1MQKL 3QAZC 4MA1C 3TO4B 1VKXB 4TUKH 1RK0B 1T4KA 1IGML 2XXCB 3TN0B 1BZ7A 2VXVL 1DQQA 3RVVD 5IVZB 5EORL 1FVEB 4KDVA 4RGNC 3LEVH 4XP5H 5D1XC 3LH2H 4HCRA 4Z95L 3WUWB 5JW5B 4LSQL 2BK8A 3L95A 4P9ML 4YDVB 4NPYB 3E2HB 3O6FB 3ILQC 2AJUL 4KFZC 4Z7UA 5IW3A 3PGDA 4OCXL 3QDGE 1F2XK 5IKCA 4WHTA 5IFAH 3TZVB 1RK1A 2CMRH 4PJDF 3WIIL 4D0DB 4BELD 5FGRA 1SM3H 2VABA 3MRJA 2P24B 1P5VA 3QPXH 1J0IA 4UILL 3GMPB 2LTQB 3CAFA 4N0FA 5ICZB 3LS4H 4JO3L 4OJFH 4QHUB 5C09E 5EIIA 4HJJL 1T1WB 2VDKL 2GJJA 2H3NA 3S88L 2R1XB 1VSCA 2NX5A 5E5MA 1HSBB 3O3BB 4XB7A 1KN2H 2VTFA 2X4RB 4OSUH 2JB6A 4KHTH 4ENED 4JREB 3NIFF 5C0FB 1Z9OA 1ADQA 2DQEL 4WU5B 5D72H 1EJ6A 4JO4L 2J8HA 1FSKC 2A74B 2WW8A 4Y89A 1WZ1L 2OK0L 2G60H 2EZ0D 4MA8L 4HV8A 2HG5A 3V4UH 1BFOB 1A8JH 5HHOD 2FEDD 4N1CA 2IF7A 3D5OF 3KR3L 4XP9H 2VO5A 4FG6C 3BAEL 2BP3A 4HT1L 3MCKB 2X4SB 3TJHD 4FQIH 2XWJA 4K07A 4LLYA 1RUKL 3KXFD 4HS6A 4JPKH 2HJFB 2B5IB 2YD1A 3A67H 5C07D 1CFQA 3RPIA 3WCYA 2KKQA 4TUOA 4ELMB 1NGWA 4PJDA 4M6AA 5FO9B 4F15B 3E3QC 2FWOA 2AEQH 4M03A 5GISH 5JZ7D 4NN6C 2R0LL 4ZNEE 3GBLA 4R4FL 1YPZF 2P48B 3AU1B 5DLML 2IFFL 1K9TA 1L0XA 4PLKC 2BSRB 1NBYA 1TPXC 4JPIA 1ZLSL 1HSBA 4N0CD 3UCRA 4PYGA 1TQBB 4KTDH 1IKFH 4NRZB 2X89A 4RGNE 2RB8A 2AEQL 1VKXA 3WO4C 2VAAA 1Q38A 2NY6B 5HBBA 5D7SL 4QNPF 2AKRA 4JLRB 4LEOA 4FQHA 3NFSL 5HTSA 4ZNEA 5CWSA 2F53A 5DD1H 3QJHA 1TIUA 5D5MF 3O2DL 4NO2B 1ES0B 3VWJC 3BMWA 1JN6B 3EDKA 1A14H 4HJGA 1JV5A 1NUNB 2XWJB 2D7TH 4Y4HC 1NMCC 3U0WL 1P1ZB 3ALXA 4MA8H 2VDRH 4KKAD 4YGVA 4Q9BA 4C83B 4JO4H 4UOW0 3KJ6H 2GJ6E 4I77H 5FA3B 3EAKA 2CLVB 1KPRB 3K8LA 2XZAH 3FN3A 3K8MA 1EEYB 4F15C 5EBLB 4H1LB 3DX8A 4K8RD 5EIQA 4Z7OE 3TWCL 3AY4C 1MVUA 4PJHE 4LVNC 3NN8A 3DXAB 4ONHB 2QSQA 4KKCD 3HE6C 3WIHA 4JN2A 2H2PC 4UT7L 4G8IA 1XZ0A 5C09D 4QRSA 2HT4C 1ZA3B 4M7KH 5IEKA 3BRFA 5FV1L 4WU5A 2QQNH 5IK3B 3FRPA 5AG8A 2GUOB 4P2RA 4XVSL 2W9DH 5DVMA 3N1QC 4S1RL 4PP1C 3EO0A 1IQDB 1S7QA 5F7NC 4ZG1A 5ICYB 1F3RB 2ICWJ 4X98B 5D70L 3DMMB 1X7QA 1I7ZA 2ITCA 3SDXA 4ZFOA 3BH9A 1RVFL 5K59F 3AFLA 1E6JL 4AIZA 4N1EA 3MLYL 5IW6B 5J1SC 4Q9QH 1NUDA 3LHPH 5JXED 4YDVA 1ZHLA 1MH5B 4KTEH 5DK2B 5I1DA 4NZJA 4Y5VA 3C5SA 3PWUB 5IOPB 5DRWB 2HWZH 2VDML 5DJYA 4LPCA 4XP5L 1DUZB 4ZSOB 3G5VB 3AM8C 1K8IB 4OLWL 2ZOKA 3H7BA 1GSMA 3FZUD 4K71B 4YHKL 1MQKH 4QRTB 1BIIB 1U3HC 2KQNA 2A9MH 4M7LH 3JWDL 43CAB 1QBMH 1ACYH 2FDBP 5DJ0B 3MNVA 1DP0A 1YMMD 5I66A 1JPGB 2R2BB 2FATL 5JA8B 4LARL 5J3HD 4OCNC 3DUSA 4ELMF 3BP4B 3RFZC 3VFPB 1C5DB 2XN9B 1A3QA 2NZ9C 4WI7A 2EDXA 1PEWA 2ZSVA 1N2RA 5KW9H 1MCPH 1A22B 2QQKL 5AAMA 1N3NA 4DOHB 4XCCH 1KPUA 5I1EL 2BNQE 3WFEL 4L8SB 4KWUA 3R1GL 1IEAB 3RY4A 1DQLH 4F58L 1I8IA 1ZS8A 4JGMA 5TFSL 3SGKA 4O4YL 1YEJL 1MWAA 2P5WE 4XWOC 4M7JH 3RGHA 2FR4B 1MCKA 2OR9L 1LD9A 1FVDA 1ITCA 3CVIL 5C09B 1YYLL 1BECA 3QDMB 4J1UA 4OFYA 4TRPL 2XG4A 5HY9A 3NIGF 5F1NA 3WFEH 4C54A 4MSWB 3HC4H 1MHCB 1S7RA 4G8GB 2Q20A 4PJ8A 1AD9A 5L2KE 3RWHA 1MCPL 1E4XI 1I7UB 4RSVA 4DZBB 1KGCE 4RISL 5DJ8B 1SJHA 4O58L 1JTOA 1SBSL 2UYLB 1GHFH 2GFBB 2NY1C 3B9EA 3EYOA 4PJFB 2C1OB 2COQA 4KZDH 5HHOA 1LO2H 2NY0D 1S7TB 3LKRB 2YMXL 1RZIA 1KYOJ 3O4OB 2RGSA 4FQPA 3KXFA 4JR9L 3MLXL 3TBTB 4YDKL 1TMCB 2Z92A 4Y2DD 3AGVA 4A2MA 4RGMC 2W0FB 1GZQA 4NO0A 4WV1A 4MHHG 5DRNA 3CDCA 4NOBA 3TV3L 1A6AB 1UVQA 1LP9A 4X5XB 1U9KA 2PTVA 1A7OH 4QLRA 3VWJD 1Q9OA 5BJTB 4FFZL 1MLCA 1UCBL 4DGIH 5ITFB 2FX8H 4U1SB 4XWGL 1G6RL 1TJIL 1EFXD 1TCRA 3D3VE 3QCVL 2ITDA 5CSBA 5T1KB 2Q1EA 1HYRC 5DUPL 4POUB 3WV0A 5F7EL 3T09A 3Q3GB 1RVFH 3HNSL 1N0XH 3F7QA 1NL0L 3V5HA 5IB5A 3VW3H 3DMMC 2NCMA 4JPVL 1IAIL 4JFDD 4WJ5A 3SY0A 4Z0BL 1BBDH 2NY2C 2XFXA 1MIML 2F19L 3ARDB 2R0WH 3MRIB 1HHGB 5SWZA 1KBGL 1F00I 1T2JA 2F74A 1HOCB 5D6CB 4OM1H 3WFBH 5LKNA 5D7LB 3VDCA 5HYIA 2VXUH 2D0GA 4DKEL 4IDLA 3DI2B 3T0WA 4G8IB 5BO1H 3T1WA 3LQAH 4DN3L 4C56B 4Z7WB 1KULA 4L3EA 4E41E 3MV8E 4X0KA 2BC4B 1W2KT 3IFOB 4K7FB 1UH3A 1DEEB 4OFDA 4I3SL 2P8LB 2R0KL 4NKDA 1MCJA 5KS9E 1HI6A 1MJ7H 3ZE1E 4R2GC 1VEPA 4NP4H 1J10A 1MCNA 1T21B 4MCYA 1JCKA 1A0QL 1LP9F 2V7NA 3TVMD 4PG9B 1E6OH 1U6AH 4ISVB 4BA8A 2FX9H 2W9EL 3D1MC 1C1EH 3C60D 2FJHA 3BHBA 4NKQB 5FEBA 3NH7L 1MJ7L 1FNSL 4FTVE 4OM0H 4NQSB 3OAZH 2B1AL 5DRWA 3ZE2E 3QCTH 5I30H 4AL8H 5D1QB 3RIAK 3P73A 15C8L 3WDIA 4FXKB 1DVFC 4PJ8B 3VXRD 3WMSA 1D5MB 4KQ3H 1F58H 5E2WL 4PREA 5E9DA 5JO5A 2A6JB 4HUVA 4ERSH 2BSSA 3GSXB 5CEZE 4LRNL 4Y4KD 5GRWA 2NY7L 3MQIA 3FFCE 1G6RB 5IEKB 5C08E 1RUAH 2G9HB 4P5KA 3ULVF 2IAND 4JDVA 3BWAB 1A6VH 2R0WL 1GGBL 4EN3C 3RAJH 2V7HB 3LS5H 4U6HB 1ZLVK 3V6OC 2VZUA 4MA3A 3PIQA 3NPSC 4QRRD 5I2IA 5C2BH 2B0SH 2EC9T 1RHFA 3DX7A 2BNRE 4BM7A 2VQTA 4HLZG 3JTTB 1DEEA 1KGCD 3PWNB 5DJ6B 2IBGA 2C9AA 4MCZB 3KGRA 5JW4Q 1UXWA 2VDPH 3MTRA 3K4AA 1WTGT 4GXVL 1NGXB 4ZTPL 1NCCL 4JKWA 5EU3B 4R2GB 2ORBH 1YEIH 3PWLB 4QXWA 5MEOB 2OZ4L 4K71C 3H0TB 2X41A 2JCCB 1Z5LB 4XP9L 4JAMB 5JIIA 3D87B 1X6LA 3P9LA 3U79A 4GBXC 4HAGA 2EC8A 1N7MH 3IFPA 4BFGA 2GW5A 1CICA 3MA7A 4P46C 2Y6SC 2G60L 4KKBC 3PF2A 1U8NA 4KJYA 5KSAA 1JWMA 1MCOH 5I71B 3V0VB 4L4TA 2NQCA 3WNNA 2CIKB 4KZDL 1G1CA 2F5BH 3MJ7A 1JYVA 4ZUWA 1F4WL 4LPXA 1TNNA 3NTCL 4L4JA 1FBIL 3VU2A 5J12B 3BSZL 5LQBL 5HI4D 1U8OA 2ESVA 1G0XA 1R5VA 2FGWL 1CDBA 5D7IA 3ECBA 3QIBD 4HLZH 5TQ2L 4JFYB 1XMWA 2LQRA 3LV3A 1IEAA 2CLZB 3BZFA 5FYLH 5GGUB 4K8RL 5C6WH 2VH5L 3IXAA 1YECL 4PJEA 4RFNC 1CFBA 4P5TC 2OR9H 5I75B 3DOSA 3H9ZA 4ZS7H 3M07A 1WWBX 5JMRA 2E8ZA 1NEZB 1CF8L 1SJXA 3O3DB 5HYEA 1JHKH 2JK5B 1OAQL 5H8DA 1OPGH 2Q3AA 1J0YA 1XR8A 2CO7B 2F8XC 1LK2B 4YPGA 4KXZH 2N4IA 5MERB 4KI5E 2ZG2A 5HYQB 1XGYL 2O5XL 1QLRB 2V9RA 1AGFB 1WIPA 4TSAH 3UTSD 3ZE2F 1TVBA 4RGMB 3RZCC 3QRGL 6CGTA 4CN4A 3RL1A 4QRRB 4CRPA 1BREA 5IMKA 2DKUA 3WXWL 2PCPA 1I9RH 4A6YH 3OL2A 3DETC 3RL2A 3BP7A 4RX4D 1YQ2A 1A7PL 3D2UB 1D5ZA 3HC0B 4KK5C 2X1PA 4KK8D 3TZVD 5E4EC 3TPUB 4QKXB 5ISZE 4ZPVA 2JLLA 5EOCJ 1EAPB 1ZSDA 4S1SL 2DQUH 2V2WB 1YJDH 2ESVB 3MLZH 5K9JL 4CJ0A 2R2HA 2FJFA 4YHZH 5AZ2H 4O5LL 1YMMB 1X7QB 5DS8A 4LAQL 2VN4A 4EUPA 5EO1A 3IAPA 2DLHA 3NZ8B 4DGYL 2IGFH 1EAJA 5EU6E 1G9MC 4X4YB 4LSUL 2A6DB 3F7VB 4NKDB 3TO2B 3DV6B 5T3ZL 3WNPA 4ODUB 4J4PA 5K9JH 2PKDA 2DQUL 4I9WE 3FO0H 4GW4A 5HYJE 3ROOB 4K3DL 3KPQA 2Z93A 3C5JB 4OV5A 1YYML 3V5KB 1TVBB 1OAZL 1BIIA 4LGSB 1RFDL 1IQWH 1HOCA 1HXMA 2PYEA 3K3QA 4GRWB 4EI5B 35C8H 3QEUB 1I1AD 1T5WA 4YXLH 3OAUH 2BSSB 2VZVA 2K3TA 4HSQA 5HHME 1FFRA 3HNTL 5FKPA 5BOZG 4R3SB 4HPOL 4WUUE 3SDDD 1N2RB 2VLME 1OTTD 3CVHH 1OCWL 2V7HA 4JFYA 3F58H 4IRZL 1ZGLB 4KI5D 1I3RB 1P84K 4OFVA 2V9TA 4P2QB 4DK6A 4JM2F 1AQKL 4WHCA 3U7WH 1S7XA 2H2SC 3DO3A 5DYOB 5FYLL 5L8LB 5IFHH 5M94B 2YPVL 3ROLA 2PW2B 4MMZC 3HUJF 2QHRL 3N06B 5CZVH 3WNOA 4HKJB 1MHPH 1LD9B 1R3IL 4G9DB 2F54B 5DEZA 5KTEH 5CD3B 4KJWC 5LQBH 5LGJA 4OGAD 4OCWH 1FBIH 4WI3A 4ONFL 2OTWB 4FQ2H 3L3IA 1OARH 3B3IA 2VC2L 4PG2A 4JRXD 2FO4A 5JQ6H 3Q1SL 2X4PB 4NHCH 3IFLH 3MRKA 1OGTA 3KLAA 3STBA 1NAMH 5M7QA 3UP1A 3U4BH 3SJVD 1DVFD 1N8ZB 4MXQC 3VMOA 4RFOL 5C0BB 1J5OL 2QQLH 5DQ9B 1FO0L 1K4DB 5FECA 2WIMA 4MAUL 5E95B 1ZLSH 2XACC 1R24B 1KJVB 4LMQI 1S9VA 2VWEC 2DQDL 2RJMA 1C5CH 1L7IH 1XIWA 1WUNT 3H9YA 1D6VL 4XCYA 4NPYA 1ZVYA 5TDOB 1X3DA 3TT1L 4LEOB 1YMMA 5EPMB 1CZ8H 3INUH 5FYJD 2DKSA 1NGXA 3GSOB 1U91B 5EFIA 4NDMA 5CGTA 2Y25A 2Y5TA 4ZUVB 4P23D 1GOHA 3BKJL 1MHHA 1I3GH 2R69L 2HT3D 1UM4L 3I3DA 5EA0L 3QUYD 5JOPD 5CD3A 1A7RH 4XBPB 1JGEA 2VABB 4F2MA 3QIWA 3KYMB 3QNZB 3L3IB 5JW3L 2A83B 1WZ1H 3O3EA 1L7TL 4PJIF 1IBGH 1IKNA 2ADJB 2D7NA 1CDYA 4LRNH 1AGCA 5ID0B 3WN5B 5F7YC 5HSFA 2ICES 3OF6D 1HIML 1U8LA 2DMKA 4BUGA 4LGPB 1S7SA 2F15A 3OKKB 4G5ZL 3CXDL 1BHGA 3MV8B 2X40A 1FRGH 1I85A 1KJVA 5DQDH 1LDPL 5TE6H 5GHWL 5AAWA 3VFVB 3LS4L 4OJFL 3LKOB 2BY3A 3KHQA 1JP5A 4XZUB 4MS8C 1NGPH 3LSOA 2PETA 1UWGL 1G9MH 5AG9A 4A6YB 2V2XB 4WW2F 1YEGH 2DJSA 3PHSA 1OAUL 4MCYB 3V7MA 5F6HI 4HUUA 3CSGA 1RD6A 4NT6B 1NC4D 4LHUB 5C0BD 3WBDA 3N9GH 2DMCA 5L7XL 4G9DA 4OF7A 3VG9B 2UWEB 3D0VB 2P46B 4QWWC 4M6ML 3MLTB 2PO6D 1NGQH 3SKMA 2VXQH 1FSKB 1MRDH 3ZT6A 1NGWB 4F7EB 3QA3A 4AQOA 5I76A 3S35X 2H9GB 1KIQB 1ZT4B 2OR7A 3L5XL 4NZTL 1QRND 4XCFH 4KMQA 4ZOAA 4WWKD 4PRPE 1P4IH 5LAXB 5HGHB 3TPUA 3TN0D 3O3UN 4CMHB 3EIFA 1NL0H 2V2WA 1MVUB 5FDWB 1RI8A 1HHHA 4J4PD 3SDDC 2Q3ZA 5IVZA 4H26A 1SY6L 1D3CA 3LPFA 4XMPL 4XPBH 4Z7WE 1KT2B 1ZHKB 2EIZA 4PRAA 3ULUD 1UEMA 3K2MC 2I07B 3DI3B 5DJ6A 3RVVC 4XXCC 5A43C 5IR1B 3EO1A 1QLEH 4F3FB 1BVKA 3GZKA 1XF5A 1F3DH 3HE7D 4X8JA 2O93L 4G43B 1ZT1A 2DLTA 3X3GL 3WYRA 3CX2A 5FGBC 3EYSL 4K3JH 4D0DA 3ILQD 1MHHB 2Z35A 2BFVL 3MRQA 2O5YH 4XC3H 1TETL 3C8HA 3MBEB 4Z78B 3FB6B 3LY6A 5FYJU 4PRPD 2XZZA 3RDTC 2ESVE 2QKIA 4K9EL 3HCVB 3ARTA 2BVUA 3ZE0E 2HFGH 5DHXB 4XVJL 2X9XA 4NO3B 3WJJA 3DBXA 4IOFC 5EG6C 3VXSD 2YPKB 3BH8B 3IJSA 3P77B 4JFFD 3RWJB 1AGDB 4P46D 1TVHA 3CDGB 1ZLWK 1KG0B 3L3DA 1R3KA 1JE6A 1KCRH 3MOAL 2YD4A 3AREC 3SDCD 3TYGL 2IQAB 2B20A 4XB8A 1DANT 5AD0A 4ZFOL 3FB5B 4M5ZH 1EFXB 1S8DB 4GAJL 2VZTA 1T0PB 2ID5A 2XY1A 4FQXA 4MNHB 2R8SL 4PJGE 3D0LA 3VH8G 4X7SH 1G0YR 4YBLC 1YDPB 5E6IB 2BFVH 5E4IA 5DRNB 4HUKB 3W9DB 3EDJA 3R1GH 3VI4F 2R29H 2J8UE 2Y7QB 1I1FB 5CZKA 2QQKH 4R96A 2VE6B 2YUZA 2B7DT 2GK0A 2KZ1B 4NC1C 1JWUA 1BPVA 1FV1A 1IM9B 4NCDA 4ORZC 5I8EB 1FIEA 1NFDA 2IC2A 2CSPA 4YAQA 1I1CA 4QRTA 3IDJB 4N0UA 5BRZB 1NCAH 1YNTA 1FLTX 1DQTA 4LASL 3RL1B 5F9JA 4XBPA 3SO3B 4LCWD 3ULUH 1KSRA 4Q2ZA 4GKOA 5EO9B 4ODVH 3MRDB 5MHSD 4WUKH 1DBKL 5CD5D 1P6AB 4UV7H 3O6FC 1CG9B 4P2OD 3T2NH 5IB3A 3QDJB 3TA3C 3UJTH 3TVMB 1WICA 4JPWH 5B39G 4IMKA 4NJAL 3ARUA 1NGQL 4LF3A 4P23B 5GGQH 3RIFK 4KROB 5AYUH 3TGXA 5KVDL 1P7KA 3HUJB 4NKIH 2E6JA 3HS0A 2XKUA 3CH1A 1CYGA 1OOAA 1JNJA 4ZTOL 3EFFA 3U82B 1FDLH 4OZHB 1MCQA 3VXNA 4P59H 1FFOB 1UWGH 3IU3A 2CUHA 3NZHH 1FL5A 5DT1H 1RZ8B 2P5EE 1A7NL 1YUHB 3RQ3A 5FA3A 5GSVB 2A6IA 3T3PE 3MV8D 3REVB 1INEH 1CFNA 2A9NH 3OMZA 3U36A 3VD3A 3CXDH 3HZMB 1H3PH 3QBTB 3TWCH 4H1LA 1JHLL 2XG5A 5L2KA 3J8F7 5EB9A 4C4KT 4XHJD 3MRMA 5E8DH 5FYLD 3PP3H 1C5BH 4LU5L 3HPJA 3TA3A 2AXHA 4GAGL 1DQDH 2RCSH 3FB5A 5FUZH 3C2AH 4F7CB 1E4KA 5D7IF 4KC3B 1BEYL 3MJ9A 4IJ3B 4QXUH 3ULVH 2GJ6D 1HEZA 2YUVA 4PB9L 3BJ91 3TBTA 3NCCB 1IQDA 2R69H 5TH2A 5HYSB 1GIGH 4Y16D 4WEUD 1MHEB 1VACA 2Y4SA 4L3EE 4LHUA 1W8OA 1RHHA 2V17H 4GLRI 4H20H 5EOCL 4LLQB 4KI5C 4WFHE 2ICWI 1RZFH 1IGIH 3TZVA 5HPMB 3K74B 1EXUB 4NFBA 4XI5D 4EBQL 3PWPA 1LVEA 3RJDA 1AGBB 1J0HA 4L29B 4G43A 4U1SA 4JFDA 4LPVA 3QCUL 4KGLA 3L3KA 1JGUH 4GS7C 2AK4A 2AXFB 3BI9X 3IKKA 4JFZL 3CC5B 3RDTD 5BCAA 5CKAA 1GZPA 4WI2A 4Q0XL 4PTUB 4U6YA 1F8TL 4TNWK 1UH2A 4XXDA 2HVJA 5E8EB 2JJVA 3L3GA 4D8PA 3LMJH 3PHQB 3F6LA 1MIEH 4Y5XB 1QLFA 5F7UA 2W0KA 3U4BL 1A6TB 1D9KB 2Z9TA 4DTGL 3Q1SH 3MJ7B 1YEDA 4DUWA 3DURB 2BJML 5H2BA 5D2LF 1BF2A 1XIWB 2FGZA 4QRUA 2KZWA 2ZCLH 1RZFL 1NMCB 3PQYA 3TP4A 4NQDB 5C92A 3UJJH 3THMH 5BQ7B 4AJ0A 5KSBE 1I3UA 4Q9CA 5HHXH 4HT1H 5IMOB 1GIGL 5H35A 2NNAB 1U8KA 5EPMA 3KR3H 3EZJB 4KPHL 2NR6D 4U1HB 1DQML 4QF1B 3EYVA 1I9IH 2JB6B 5GJSH 4EZMA 1L6ZA 5GGTL 1NKRA 3QHZH 5FYKU 1FNEA 2VLLA 5KSVB 5C09A 4PRIB 5D72L 4UU9B 3GI9H 3SDCA 4UV4L 5E8PA 2IPUK 3BP6A 4O2FB 1UM5L 1GOFA 2JCCA 5D2NE 1Q0YH 1EEQA 4Z9KB 4D9LL 4EIGB 3S36L 5T3XH 1AJ7L 2HJKA 4HWNA 5CIPA 3CDGA 4JRYB 4L8DB 3LN4B 1DN2A 2HKFL 3B9KD 3GJFH 4HJJH 2MKLC 1BM3L 4N8VB 1CL7I 4YC2C 5CCKL 2O61B 5HHNA 3X13A 4QOKD 4Y8AA 5FGCB 4HGMA 4KVNL 3TJHC 2X10A 2BVTA 4P4KC 5BV7B 1MCSA 2VAAB 1OAYH 3V0WL 4HS3B 3P4NB 1TFHA 2VLJB 3T2OA 2CMRL 2V2TB 5TQ0H 2FJFB 3ES6B 1IARB 4N8CH 4H25B 3CFCH 1F90H 3BEVB 4G6JH 5FA4A 2CKBB 2DQJH 2NLJB 4HH9B 3DVGB 4I2XB 5GGQL 4HK3J 1U92A 3HUJA 4NCC1 4EDXB 2KPNA 1T2XA 2FB4L 3NMEA 2VYRE 3ZDXE 4YHZL 4L29A 2NTFA 1CLYL 1HNGA 4UU9A 4MDIB 3MLZL 3V6FA 3MYZA 3UPCA 3MA7B 4LHQB 4P46A 4WUKL 1A5FL 4NZUL 5IB1B 4GRMB 3SDXE 4YE4L 3T77B 1U8MB 3SDAC 3QDJD 3SE8H 1QBAA 5AZEH 3JV4B 3W39A 5C70A 2GITB 3JXAA 1A7PH 5E5RB 2SEBA 5FYKL 5GJTH 4W4OA 4RDQF 4XPGL 1JGDA 2E6QA 1D5BA 3TH2T 3QHFL 4LKCB 3O2VH 3QDAA 3O45A 4HIEA 4RAUB 4F57H 4ELME 3O41B 3L7EB 1XGYH 3FOMA 1OLLA 1DE4A 4X6DB 2BVPA 5B22A 1A6ZB 3NACH 4P3DA 1HEZB 1MFCH 2BCKB 4PJ5E 1MCEA 3VD5A 1U3ZA 3OKEA 3UTSB 3D9AL 3L5WB 2VDLH 1FL5B 3EYUH 5E6YA 3BKMH 1AGFA 3Q6GL 4NFDA 3VFOB 4CJ1A 2NTFB 2V5RA 3U0PA 3LRSB 5INCB 4G6KL 1XR8B 5GPRA 2B4CC 1UWEL 4JZOA 2IAMC 5GSRA 5HYQA 3UYOD 5HYJA 1G7LB 2XN9D 3BH9B 5JW4R 3EUUA 1EBPA 4QRPE 1EUTA 5E9DB 5JO5B 1U8IB 1PBYA 3ZDYE 3F7YA 3HI1A 3FB7A 4MJ5A 4BKLB 2MWCA 1MCOL 5C0BA 3ARZA 3B5HA 3F12A 3V7AE 1AXTH 2R2BA 3IGAA 4XC3L 4ZPTB 5LGHL 1G7JA 2C3VA 1KELH 4JJ5B 5ACZA 1VGKA 4Y4KC 2DAVA 2EIEA 4R8WL 1FGVL 1K8IA 4FFWD 1JPFB 5JOPE 4YXHL 4YIQA 2XOTA 4XHQA 3SE9H 4YX2L 3SGEI 4KXZI 1R0AL 1UYWH 3MLSL 4ZPVB 1T7YA 4WFFD 5GS0H 4F9PA 3STZA 4R3SA 4U1LB 3WS3B 4YR6A 5I18H 2Y5EA 1MJJB 1MY5A 4Y16C 2VDPL 3FFCD 3FZUC 4NDMB 3JV5A 1DANU 4U7KA 1JUFA 5A16A 3ARDC 1KJ3L 1KENL 4HCRH 3P9MA 4LIQE 5SWZD 1J8HE 2EDOA 5DUML 4U1KA 3QWQB 2A6DA 5GGVH 3T2PA 4IEFB 4L5FH 3VFWA 4PJAF 4OCRH 4HMDA 4L3CA 5MENE 3ISWA 3UBXI 4JGUA 4OCYH 4NZRL 1N6UA 2ZUTA 1BFSA 3QPQC 4DKFL 1T83C 3T4AB 3RVWC 4HXBL 1HHJB 2DLFL 1FNAA 3H3BC 1B0WA 4KQ3L 4XH2A 3DRQA 2FX7H 3IF1B 5HHVH 3EFDL 5C08D 4PR5A 1T04B 1NCDH 3MRPB 3GSUA 3G9VA 1KIRA 4LHUD 4TVPH 3DPBA 5H35B 3UTQA 4ZUUB 5GGTA 1T89A 3FHQA 4GQ9L 5T5FL 1PDKA 3HAEB 3NH7H 4EUPG 4OBSA 5SV4A 4AEEA 3G5YB 1IKNC 3GKWL 2FX9L 4MZ3A 2ZPKH 5BXFB 5F71A 3ROLB 2VLJA 2EYTB 1F3JA 1NGPL 1U0QA 5FO7B 2NXYD 4HKJA 3FKUS 2WWMC 3K8KA 3BEVA 2I9TA 2XQBH 2ERJB 4RFEA 7CGTA 1YEFL 1NAKL 3X14A 1NCNA 5BVJA 2HKHH 3GSNB 5SWSB 3ALPA 3SJVA 4XNQB 4BQCA 3K2UH 4DN3H 1IL1A 1MCFA 4JRYA 2P42B 4LNVA 4LRIC 1MJ8H 3BN9C 1CVRA 3TIEA 4Y4HB 5D1QC 3KLHD 3RZCD 2AW2A 4NO5B 1BJ8A 5I1IH 3F5WA 1KPVA 2K7PA 1Q9LA 1HKLL 1U8QA 4AG4L 2F58H 3QAZB 3MLVH 1QSFA 4TTDC 3RWFA 4Z7OF 3VW3L 4OF6A 4P2CG 1HH9B 3FN9A 1Y18B 2YKLL 2BC4A 1ZHBB 1TTUA 3T0ED 5ANMA 3L3OB 2AK1L 1KLGB 3RWIB 1MHEA 1DFBL 1VFAA 3KYNA 4KJPD 3EBAA 3RUGF 5GS0D 5JHDA 3QUZC 1UCBH 4QHKI 1MRCH 3FT4A 2V7NB 3BW9A 3BPNB 5LCVL 3VXSB 1S3KL 3EJYC 3BPCA 1P1ZA