2E9JA

Solution structure of the 14th filamin domain from human filamin-b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
GSSGSSGRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-B
publication title Solution structure of the 14th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e9jA01
3AS3A 3QPXL 4EJ1C 4GRLB 3C09C 4RAVA 3O6KL 5DHXB 1KB5B 4GS7B 3VFNA 5KVFH 1FHGA 1KN4L 5F6HI 2FEEI 2NY2B 3CD4A 1KG0A 4S2SA 1HXMB 3N50A 3O11A 1TVHB 3VFPA 1R5IB 1ADQA 4NQDA 2GFBA 3BKMH 4FZEL 3T1FB 4X6DB 3HRZA 4B5EA 3NACL 5LCVL 1DQDH 3NA9L 1S7SB 1TPXC 4KK9D 5HBBA 5CJQH 1MPAL 3N1GC 1KB9J 4ELME 1I4FA 4MDJA 1F2QA 1IFHL 2HG5B 4XPGH 3L7FB 3QCUH 2N4IA 3HAEG 4UT9L 4JM2B 4PG9A 5SWSD 3L5HA 3GI9H 3WFBH 3D6GA 2D9QB 2I26N 3ARWA 3BEWA 2ZPKH 4YBHA 4GAGH 2YN3A 1K6QH 3W0WA 4KKLD 1KB5H 5L2KD 2XXCB 3ARFB 5DFVC 1MFDH 3ROLB 2WWMC 2YD7A 1WZLA 4YR6B 2ZSVB 5ICXB 3I02A 4LMQI 1PEWA 4M4PA 4UUJA 1CE1H 1AD0B 4RA0C 2XICA 3BO8A 1LK2B 5H35B 3FB8B 2A0LC 2D7QA 4XZUB 1BIHA 3ETBF 3U7WH 2VLLB 1U42A 2GI7A 4JDTL 4ZS7L 1RZ8A 2EKSA 3H2WA 3KYAA 1WAAE 3IDMA 4YFEA 4BSWA 1DQJB 1WQVT 1VACA 4P2YA 5EUOF 3QT2A 2FZ3B 1F2XK 3PV6B 5TPWL 3DX6B 4FXGB 3WFHB 4QHMB 1Z3GH 4ORGB 1DDHA 1JK8A 1J1PH 2B1AH 1XIWB 1FZMB 4ZUTB 4ZFOA 1DE4B 2PO6A 4Y19A 1B4JL 1U8NA 3X12A 3WKNA 3W39B 4F9PC 4ELMB 4GW5A 4PB0L 3O4OC 5ACZA 4GH7B 4KVCL 4N8PA 1WFUA 5ACMA 1GHFH 3D18B 5EZOH 1F3JA 3RWIA 4UDUB 5D7JD 3TBYA 1RPQA 1NMAL 1YEEH 4QXGL 4M61B 2X4SB 5E6IA 2OQJB 4RAUA 1X5AA 4HPYH 5JW3H 4CRPA 1RULL 1IC4H 1YQVH 2GW5A 4TSAH 1IQWH 4NBZB 1PX4A 4DK3A 2P46B 4PG2A 3H9SE 2FD6L 4WFEE 2BSRB 2FO4A 2R0LL 3QCTH 2AVGA 3IFNL 3RVTD 2Q6WB 1YYMH 5I8EB 1CTNA 4I77L 1J7VR 3MGOB 5D8JH 3QUXA 4HF5H 4HQQL 2Z8VC 2DM4A 5IK3A 2VDNH 1HSBA 1G9EA 5LQBH 1WBYA 1P9MC 4NDMA 4EI5A 3ZE0F 4WEBL 4YHYB 1NEZB 4HX1B 4EBQH 5IB5B 5D5MA 3V9FA 1NGZA 1MELA 5T1DH 1YJDL 1NANH 3MJ9H 2FX8H 4X99B 4ZS6D 4KMLB 4YFDB 3VXPB 3WIIL 1JTTA 5GRUL 1O0VA 1S9YA 5I1HH 1U91A 2YUZA 3REVA 4HFUH 1MAJA 3BT2L 1FO0H 3RIAK 5D1XA 4RMSA 5DVOA 4LCUB 1SEQH 4PP2A 4QYOA 4YC2C 4H1LH 4N0CD 1DBKH 3DRQA 3VMOA 2A1WH 2ADFH 2IJ0C 5FYJH 3FFDB 3CPLB 1D6VH 3RWDB 2NZ9D 3QEQB 2XQYK 5DMKA 4XPTH 3LKNB 4J3VA 9CGTA 3ECBB 2XKNB 4JFFB 1KTLA 4WW1B 2WW8A 3GRWA 2ZUQB 3MUY1 3UPRA 2DM2A 4LLDA 1FNGB 4XBGA 1U9KA 1NBVL 3VXOA 4WUKL 5ERWB 1BMGA 2KBGA 1F45A 2EXYC 4UINH 4YH6A 2X05A 4OKDA 4QRTB 4BKLA 2C1PB 3D85A 5B38B 4GMSH 3H9SD 1J88A 1X44A 3DX8B 4WFED 2B2XH 4XCCH 4FXLA 3VFNB 3QNZB 1YA5A 4D9RE 4PJFF 1B3JA 4MAYA 3MNZB 1MCOH 4X8JB 2FJHA 3DYMA 5I16A 1EEZA 4F8TA 3GB7B 3VFTB 3BIBX 5E03A 3O11B 4IRZL 1KCUL 1KTKE 4P46D 1F42A 3I6LE 3WFCL 2NCMA 1T3FB 4OIAA 4N9GB 1I4FB 5SX4H 3O3EA 2JCCA 1JPFB 1HIML 4PYGA 5DI8B 3FN9A 4JKLA 3LEVH 2FL5B 3C5SA 4OV6F 1D5ZB 1H3VA 4KI1A 2Y06L 1GAFL 4ODBD 3U1SL 2QHRH 3BEWB 1S5IH 4S1SH 3AREC 5KG9B 5CKGA 1IKNA 4GQ9H 4F2MA 1BOYA 3QZWA 4IS6A 3VD9A 1MF2L 3FZUC 2Q87A 1QRNB 3P4NA 4FXKA 2O5XH 3I75B 1NBYA 1Y18A 1P2CA 1ADQH 1FBIH 1Q0XH 4JFZL 1ETZB 5GJSL 4GBXB 4N8CL 2NLJA 3D2UB 3MRRA 3TJHD 3OZ9L 4D0DA 4Z7UB 5EZIH 4B7IA 4KROC 3IDMB 4X7DC 4XNXL 2EDKA 1H0DB 1EO5A 3SE4A 3IDYB 3VXQB 4S1RL 3ZHDA 4XWGL 1UWEH 4JFXA 4PRHA 3FFCE 1JRHH 5CSGA 3ARPA 5L88H 3EDFA 1FAKT 4QWWD 3P3YA 3IU3B 4RX4D 5TDOA 4OQ1A 4NNYA 2MTPA 4OZ4A 3EO9H 1I8KB 3E1F1 4OUOA 3K4AA 3BW9B 4U1GB 2KZWA 2CDEA 2JKXA 1K8IA 3V6FB 5HYEA 3EYQC 4Z8FL 4ZFOB 2E27L 4LPXA 2M26A 3FB6A 5I2IA 1DVFA 4YO0B 5DJZA 3RKPA 2O93L 3IAQA 5EN2B 4CVXA 1JGVL 5EU5A 2ITCA 2PO6C 3HRPA 3U82B 3SPVB 1H15B 5C0IB 1NDGA 3MLRH 1JZ5A 2Q86A 4WNQB 1YNTA 4JREB 3OAZH 2DQDH 2R39A 1YMMD 1P4LB 1D5BB 3MV7D 1NCAL 1BHGA 1CGSH 2DJUA 5CEYB 5ADOH 1OM3L 4CW1B 3OAYH 4RAUB 5C07E 1JF1B 4G8GE 4LLAA 4TPRL 2HVKB 3BYYA 3QNXB 2UUDH 5HDBF 3KYNA 3EFFA 3DVFA 3JUZA 1KJMA 4X4ZA 43CAA 4LDLB 1L7IH 5CFHA 5TH2B 3DX7B 2VITA 4YDVA 3MOAL 1RZGA 2CLZB 1C7TA 3EO0A 3RL2B 5F1KC 5F7DB 2BVOB 1HDMB 4OZGB 2W38A 3DMMA 1Q9KB 4HKBA 4GW1B 4Y5XB 2F8XC 3BP6B 2WP3T 4NCC1 5DUBB 5E8OA 2ATPA 2VLJE 4M6NH 4U3HA 4TTGA 5F6HJ 3K80A 3PL6C 3QUXC 2JF1A 5JIHA 5KVGL 1EBPA 3F6IA 1QSZA 4PRBB 4JCLA 1JZ4A 1HNFA 5GJTL 3RVWD 1A7QL 2DQGL 2V5TA 1Y6NR 1LD9B 2NY4D 4JG1L 4XMKH 1A6VL 5EB9A 3RUGF 1VESA 3VJ6A 1U91B 1VSCA 3LB6D 4JHWH 5T3XE 2P5WE 4V1DE 1FCCA 2X4PA 5AZEL 1TNMA 3LV3B 4Q0XH 1OF2B 4U1HB 4TTDD 3CLFL 3N85L 5E9DE 2OK0H 1ZHBB 2R8SH 1IT9H 1EFXA 1MCSA 6CGTA 2DDQH 2R69H 1QVOA 2PW2B 3GJFA 2DOCA 1OTUC 2UWEA 3KPPA 4PJDE 3RL1B 3RU8L 4A6YL 3OJMB 5D1XC 5DMKB 5DUPH 1K4DA 3KLAB 2XN9E 5HDQH 4UQ3B 1QKZL 2GEEA 1WZ1H 4ZNEA 1CG9B 3C6SA 3CSYA 3DOSA 4ZOCA 2VDRL 2XG5A 1A1OA 2X10A 4G8GD 3HMWH 3MRFA 3CFBA 1HHKA 4XBGB 3WXWH 4XMLL 3U2SA 2FNBA 1VFAA 5ESAB 4NNXB 4R3SA 4HDIA 4F57H 3MO1A 1BLNB 5D93C 3MXWH 2CXGA 5DMYA 5GS1B 4FNLH 2W65A 1AH1A 3GSNB 2PF6A 2FEDC 2V5RA 3FT2A 4J23A 1UACL 3MRQA 3HZKB 3UO1L 5DUML 3G5YB 4EI6A 2X7LB 3ESVF 4PJBF 4ZUWB 3CJJA 2AV1A 1E4JA 5F9OH 4FQIH 4PUBH 2X1QA 3B9AA 5MERB 1G6RB 4MYWB 4MAYC 2AQ3A 4KKAC 1MJUH 5HGBA 4DQOH 2VDQH 3VG0H 3GRWH 3SDAB 5JOPD 1WIOA 5MEOA 3O3EB 1UKTA 3O41A 4AL8H 3MJ8A 1MY7A 4N8VB 4N5EC 5C0FA 5TQ2H 4PJGE 1G9ML 4LQ1A 4Z5RB 4LP4A 3WO4C 3H3KA 4XNYL 2P5WD 3Q5YA 5FA3A 4V1DB 1A0QH 4F7PB 1IAMA 4X9BA 1OHQA 5JLZB 5E9DD 5E2TH 3PGFH 4HXBH 5FO8B 1ONQA 1EPFA 3KGRA 4JR9H 3KR3H 2PNDA 1QSED 5A1AA 2AV7B 3DVGB 3IDJB 4LEXL 2XTLA 3HPJA 5E94B 3RNQB 3S3JA 1U92A 1YNLL 2XN9B 5GISH 1BP3B 2EYRA 3FQUA 1BD2A 5FHBL 3VFSA 3O3BB 1YEKH 2FECI 1ZE3C 4XB8A 5B3JE 2BMKA 2GSIA 2G60L 3L3JB 3AY4C 4OGAC 1VFBB 4X4YB 2C3HA 3JWOC 1NMBH 1I8MB 3B2VL 4Z7WB 1EMTL 1FNEB 3QG6A 4X5LA 3PXJA 3G9VA 4M1CC 3SE4C 4JLRB 5D1QA 5GGRA 5BJTB 2MPAL 4ZFGL 5FDWA 4GMTL 4JJHA 2Y7QA 4XCYA 3BPNB 1E4KC 2FHCA 5F7KC 5JZ7C 3ALWA 4QHUA 1OTTD 5E08H 4NZUL 5F7YC 1CFQB 2BHYA 1F4YH 3JWOH 1LE5A 3QWRA 4C4KO 3PWPA 2AK1H 5J6HB 2PETA 1ORQB 4PRAA 3MQIA 3MV8A 2LVCA 1UB5A 3F7VA 3PXHA 3QO1A 4YPGA 3RY4A 1VGEH 3Q3GA 3GEWB 4X6CF 4PJCE 1DJSA 1CL7H 4YHNA 5AUMA 5J9PA 2EDXA 2QADD 5C3TA 5A3IC 5JOFA 3CFEA 4DKFL 5GSRB 1G7JA 1JCKA 1R5WA 5M7QA 3K74B 1JJUA 4G8FA 4KRPB 4KUCD 4YDJA 1KEML 1UADC 1DUZA 1T5WB 4C57C 5C2BL 4YLQT 3RVVD 2CGRL 1LP9A 3G5XB 4K07A 5GHWL 4LSDA 1CR9L 2W9LA 4PS4H 5DQ9A 3OAZK 2AJXH 3RGHA 1ES0A 3VI3F 5IUSA 5ID1B 2ESVB 1QR4A 3QPQD 2VL5B 5J13B 4HUXB 1KLUB 1Q8MA 3OAYK 1X4XA 3VH8G 5FGSA 5IHUL 3NFSH 4MD0B 1WK0A 3G9AB 1X5GA 1MLBB 2VRAA 2UUDK 4HK3J 4DTGH 3IF1A 4QOKD 3BH8A 3DMMC 3WEXB 4Z95H 4Y5YA 3AC0A 5CIPA 1N64L 5KSAD 4X0KB 2VWEE 5ANME 2UZIL 3KPSB 4WHCA 1DBAH 3I3BA 1I1AB 4KPHH 5EBLA 3AMKA 2W59A 4L8SA 3MLSL 4H20L 3Q6FB 4ODHL 1XH3B 4U31A 5EORH 4HUVA 4YEFA 3O3UN 2VLKB 4QCIB 1ZK9A 4HH9A 3DIFA 4DN3L 4L8CA 3OAUH 4U6HB 4XI5D 5LJYH 1FYHB 2V2WB 2FX7L 4PJCB 3WS6A 1K4DB 5T5NG 1IM9A 2B0SH 2YUVA 4BQ9A 4OF6A 4F7EA 4W4OA 4IRSD 4WI3A 4K2UH 5IWLA 1OW0A 1FZOA 4EOWH 5DFWH 2F5BL 4NN7B 5J1TC 1FZJA 5C0EA 3GBNL 1F90H 2FEEL 5F7EL 5L6YL 3RGVC 1AXSB 4R3SB 3TIDA 4I13B 1Z0NA 4I2XE 2HJKA 4MJIA 4OGXL 3TZVD 4OFIA 1RZ7H 1TJGH 3OXRB 4NWUH 1U2CA 5C0JA 1GGBH 1CICD 1S7WB 3DETC 3S37H 3Q1SL 2XTJB 1DSFH 3GJFH 3VMNA 3PWNA 4OD2B 3DV6A 1NCWH 4GAJL 4JRYA 2VXUL 4MCZA 4OT1L 1U8HA 3GSWB 4QXTB 4P5KB 1A7PH 5GGVH 3MBED 4OFYA 3HC4L 3ZL4L 3ZZ1A 1V7MH 3MV9B 1DBML 1PKQB 3TO2B 3V4VH 5ANMB 5E1AA 1RUML 4WFHE 3QNYB 5BVJB 4DK6A 3QFDB 4J3TA 5IQ7L 4KJYA 1A7NL 5HY9A 3B4NA 5C0BE 1BIIA 3LQAC 3SCMA 1KPRB 4XCEA 4M48H 4BYHA 2EDFA 3HE7B 1XCTB 3O4LA 4W6YB 1EEYA 1U3HA 2DD8L 3MLZL 1ONQB 4TUOA 1AHWB 4TNVK 4CNIA 3ULSA 3P9LB 1NAMA 4OLZH 4M6MH 4ZO7A 1KULA 2DBLL 4PJIF 1ED3A 3PDOB 1NGQH 3CIQA 2APWA 3NCYS 3KLSA 4ESKA 2VLRA 12E8L 3RTQD 1RUKH 2NY3C 1S7TB 3LQAH 5DJ6A 3ULUF 3K1DA 4H88H 5E95B 1QBML 4PLJD 5CEZE 1FORH 1F6AB 1C1EL 2F58H 1WVZA 4ZTOL 3BWAB 3RKDC 3SKMB 2D31B 4JE4B 4I2XB 4KDVA 1VENA 4GRWH 4LSPH 5IHZA 1RVFL 1CZ8H 4JY5L 3QG6B 3RZCD 1SVZA 2NY1B 1AY1L 5EOQL 2FJGA 3FKUS 1L0QA 4OM0L 4YXHL 1ZLSL 4XB7A 4YHIB 3DXAE 3T0EA 4CN6A 4KH2A 3TA3A 1EUUA 3MRCA 5EWIL 3UYRL 4JJ5A 5EO0B 3HI5L 1IGFH 4XWOC 5TGBB 2Q3ZA 4KI5D 2ORBH 5CWSA 5C09E 5DRWB 1IQDB 3UTSD 4ELKA 3QXAA 2Z35B 3WFEL 2NX5D 4XMPL 4GKZA 5IMKA 4RMQA 4UTAH 2H45A 5CD3A 2JIXB 3HZYA 1WEJH 3P9MA 4HD9A 3Q2CA 3MV8B 1S8DB 1UB5B 4H26B 4YK4C 5GGUA 4X4XB 4P2OA 2IG2H 2FSEA 4HULB 5C0BD 1KPVB 5EA0L 2E6QA 4JGMA 3GBML 3FMGL 1KNOA 5CCKH 3VI4F 5EOCH 4TNWF 3UTPD 1I7UB 2E5EA 3U36B 4LLVB 3O8XC 1NUDA 1RHHA 1SJHA 4HUUB 4U7MA 1S7VB 3D87B 1E28A 4F58L 3EZJB 4KKCC 4MXWH 1G9NH 4EDWL 1HHGB 2I07A 4YWGH 4TVPE 1FGNH 3ULVH 5JW4M 1BQHA 4HWBA 5CEZD 1JNNL 3B8SA 1IJ9A 3NFNB 5D71L 4M4RA 1H3XA 4HWEH 1UVQA 3FO0H 3EHBD 2J2ZA 4MWFB 2YPKB 1DUYA 4K9EL 3S34L 4M8QA 1FCGA 4TRPH 4XNZB 1G7HB 5I8CA 2H8PB 3NIDE 2CH8A 4HS8L 2NY0B 3DUUB 4PY7A 4MNQD 1T0PB 1WCBA 2EDHA 4IOSD 1CXIA 1QEWA 4U1NB 3S98A 3WIHA 3DXAD 4RGOH 2WBJD 5CIPB 5FV2A 1QFHA 4MB3A 3S35X 1U8LB 5IVNA 2A6KA 4RCAA 4HMCA 3SHSA 5IQ9B 4OBRA 5C09B 4XP1H 2JB5L 4Y5YC 4JO3L 4Y2DC 5I66B 2CK0L 1QSFD 5T1LD 3C6LD 4HH9B 3PHOA 4MA7H 5DK2B 2RR3A 4C54A 2GYSA 4ODTL 1CLZL 4NWTH 3PUCA 1P7QD 4UDTB 3JV0A 3MMEB 3Q6GH 3L5XH 1OCWH 4YXKL 5I18H 1F4WH 2X4QB 3LRSA 4H5SB 5EUOE 1EK3A 4O9HH 4PRNA 1UCBH 2O61B 2PN5A 2CUIA 5CIPH 3MLWL 1XGYL 3WS6C 2A9MH 2DQUL 2K3TA 2QSVA 3QXVA 4PJFA 3U0PB 4R4ND 1OB1B 4JPKH 4CMMA 1RZFH 4W4OC 3WNOA 1OW0C 4MJIB 3HPLB 4KHXL 1K3IA 3U7YH 4HIEA 3DVNA 4TVPD 5I1CL 1M6OB 2YA0A 4WTZA 2BNRB 4G9FA 1XR9B 3JV6B 3ARBC 3B2UD 3NCCB 4PJ7E 1WWAX 4YBQD 4L4TE 2H1PH 4U6XA 5DZLA 3QEGL 4HS3B 4LVNC 5MEND 4X7TB 4RWYH 3VD3A 5J6GA 1GGUA 3QRFM 4XP4L 2NNAA 4JFHE 5BS0E 2BRRH 4F15C 5GRJL 2XZAH 4X6EB 3MRMA 4NP4L 3SGEI 2ADGB 3ARXA 3FQNB 1TDQA 4OCRL 3OKKA 4PJ8D 1YMHA 4J4PD 1GGCL 4LSUH 5BXFB 1JPTL 4HIHA 5KSUA 3H7BA 2XY2A 5ETUB 3TO4A 4OBSA 4JFEB 1GIGL 2XQBH 3V0VB 1BPVA 4OSUH 3ARDD 1RD6A 3P73A 3SOBH 3ZKNC 1J5OL 1X6NA 3GJFK 3SGDH 5I17B 1UXWB 4O4YH 4NHUA 4PJHE 4C56A 4UV7H 4FOMA 2PTUA 5JIIA 3T2PA 3CGTA 1NLBH 2F53A 3UTTA 1U3HB 2XZQH 3ZSSA 4X7FC 1AGBB 1MCIA 2AERT 2F15A 4M5ZH 5IVZB 3TBVA 1HEZB 3SCMC 1MEXH 3HN3A 1V05A 4LASH 5DD0L 4JAMA 5IBTH 1N6QH 1G7MA 1T1XA 1ACYL 5D2NC 4DUWA 4U1SA 5IMMA 2NXYB 5EUOB 2VAJA 1LDSA 1X5XA 2V7NA 2ZP0T 5HHNB 4PRIE 1RJZA 1FZKB 3DURA 4KUZH 1PSKH 4EUPG 3TV3L 2ZKHL 3C60D 4NC2B 4FQHB 3JV5A 3OHXA 1I7RA 2VDPL 3G6JE 3MRKB 4XNMB 5C8JA 3MRGB 1TJHH 2HVJA 4F7CB 2ZOKA 3MOBH 1I9RH 4WUUA 4NRXB 1S7UA 2YPLB 4LHUA 4L4TB 5D7LD 2AJZA 3WHE1 1DTUA 3HNVH 2W9DH 4NNPH 2RQ8A 3TA3B 2DIJA 4JFHD 5BS0D 3RPIA 1NAMH 5BCAA 1KCKA 3X14B 4DKAA 1F8TH 4QHNA 1P1ZB 2IANA 1AGFB 3GO1L 2EDRA 1KYOK 3GI8H 4P4KB 1XF3A 1PLGH 3QJHB 1FE8H 1IARB 3DRTB 5CD5D 3LN4A 4E5XA 5B8CA 1ZTXL 3IDXL 2D0HA 3H9HA 5TQ0H 4FFVD 4L3CA 1G6VK 4NYLB 3DV4B 3SBWA 3WBDA 3MA7A 3MV01 4MJ4A 1P69B 4X7SL 4ODWA 4I0PB 1K4CA 2FGWH 4QRRB 3UJTH 2VN7A 1NGXB 1UKSA 1Y6MR 3DI3B 5IBUG 3LPGA 2B8OT 5DR5H 1FP5A 3SO3B 5F44A 4LLUA 4YAQA 1INDL 1KEGL 4X6FA 3SJVD 4OGYL 3VGAB 5FM5O 3GKWH 4XAWL 1DQLL 3QWOA 2LTQC 4PRIB 5D7KE 4Y5VA 2JELL 4YDIL 4JZNB 2DQTL 1NKOA 3OX8A 4MB4A 1QA9B 5L7XH 1RUQL 4UI2A 2HT3C 5A16A 1MHPH 4L9LA 3QI9A 4ZPTA 1S7XB 3MRBB 3S96A 3QQ4A 4PGEB 4X80H 3RVXC 3OKNA 2DQIH 5C6TH 1NGPL 5ISZB 3BZEB 1QYGH 2ICWA 1KT2B 3HG1A 1QEWB 4M9OA 2QR0B 4ONHA 5T3ZL 5F71A 5EC1A 4KK6D 3GUTB 4GG6E 4IDJL 3ZE2F 4PJXF 4QRQB 5DDHA 4AEIL 2DLEA 1SYVB 2EE9A 1IEBA 2VXTL 3RVUC 3SDDC 2R4SH 5SX5H 3DX9B 4LSRH 3ARFD 1CFSB 4FFZH 3V5DA 5KOMC 1KXTB 4HWBH 1QNZH 4XNQB 4XCFL 1GOGA 3AS0A 2ZNXA 4PJ5A 5DRXA 1A9BB 1IKFL 2J4WL 4BZ2H 2EDOA 1NJ9B 4J1UB 3D48R 4BFBD 4JANA 4UILL 2G9HB 2H2SC 1I85A 3O2VH 4HG4J 4NUJA 3UJJL 4M3JA 3WIHH 4WENB 4G9DB 4F7MA 3CMGA 4PJFB 3QJFB 1ZS8A 3VXSA 4R4FH 4M43H 5JPMB 4PGZA 3M1BB 3TT1L 1OPGL 3WN5B 1RSFA 2K7PA 4U6VL 3C5ZA 4O2CA 5FYJE 3HS0B 1DCLA 3J7HA 5FHAH 3L3GA 5HYJA 3VD5A 4KQ3L 1JL8A 5HGHA 3ZMRA 1BAFL 1I1RA 1IGYA 2EIEA 2ADIB 1W8OA 2WUCL 3VRJA 5KVDL 2G5BA 2NNAB 1VPOH 1CU4L 1MWAA 3O4OB 2HT2C 1JTOA 3A6CL 3IB4A 3WKMH 1F58L 2IFFH 4HUWA 5F96L 3MRMB 5FO7A 1UENA 2AGJH 4OF8A 4YZFF 4XRCB 3D3VE 4ONGL 4RIRB 3QUMB 2M2DA 1WITA 3OKKB 2P24A 4FQXA 5IEKB 1MCQA 1WCQA 1I7ZA 5KVEH 3WFDL 2GJZA 3BIKB 1F00I 1AD9A 5DD5H 4TQEL 4KVNH 3W9DA 5I1GH 4KRMB 4OUUB 1UJ3A 5F9JB 2MQ3A 3P73B 1UM6L 5C0AA 1UG9A 4G5ZH 3K8LA 3TO4C 2C5DC 5TE4H 3VXMA 3FRPA 3R06A 3UTTB 2WBKA 2FECL 3W9EB 3AVEA 4NQCB 1E4WH 1UZ8A 4JAMB 4P57A 4Z0BH 3VFUA 3NPZB 1VERA 4K71C 3GSQB 3T4AA 4FQ1H 4U1SB 2EDLA 4DVRH 1P7HL 2R56H 3S35L 3ZDXF 1AI1L 4K23L 2FR4A 4HXAL 1RJZB 2VZVA 4DW2H 6FABL 4HT1L 4EN3C 4B7LA 1I7RB 2X9WA 1EHNA 3LMJL 1HHHB 2AP2A 2Z8SA 4NQDE 5FYJD 1BF8A 1MRCH 3ES6A 3VE0B 3D25B 4DGVL 1IC7H 4RGNB 2CO7B 5DHYA 4G42A 1A14L 2NY5C 4NPYA 2Z31B 2X4OA 2W60B 4BELD 3ELAT 5JTWA 1KJ2A 3DVIA 4L8DB 3UDWA 4BM7A 4NO0D 4LOUD 4QXUH 3BH9B 2HTKC 1R24A 3FO2B 3LKQB 2I5YH 2HJFA 2X1XR 2CIKB 4JFQB 4X6CA 4XP6L 2I9LA 3W0WE 3G6DH 4PRDA 3D3VD 2ZSWB 3V6ZA 5HYSB 4M9PA 4D8PA 2AKRA 1QRKA 3K2MC 4Z7VA 7CGTA 4E42A 2HTLC 2EYTA 3PP3H 1UM5H 4NC1C 1ULVA 1AO7D 5ILTH 1I9JL 4FMFA 3QEQD 5IW1A 4P2RD 4HJJL 4H0GA 3PIQA 5D2LE 2A83B 1T22B 5IB4B 4Y1AB 1FVCB 2X4UB 5IM7A 3BEVA 4I0CC 3INUL 3V5HA 5LWYL 3E2HB 3NMEA 1RIVL 3W5NA 5FKAB 5E4IA 2NPLX 3CSBA 3IRZA 4PD4J 4PJBE 1CFNA 2J8HA 1P4BL 3NCJL 4LLUB 3GM0A 4PP1D 4XX1E 4BFIB 3U0WH 1CLOL 1J86A 2DB8A 5AWNL 3NOIA 1CGXA 3GMPA 5C08B 2NMSA 1P5VA 1D5IH 1A6WH 3BVNB 3L7EB 4D0CA 2XKUA 2Y5TA 1F4AA 3QISA 5DRZB 4N68A 4NQDD 3MXVL 5C6PB 1CGUA 4HHAB 4ODUA 3HI1A 5F3BB 3S96B 1LO4H 3F7YA 4Y19E 4WCYL 1JHLH 3RUGB 1HQRB 5C3LD 2BOBB 2YS4A 4M5YL 2DQJH 4L9LC 1OOAA 3QI9C 3AREB 1I8LA 1CE6A 3M17A 3N9GL 4RFNC 1NDMA 3GHBH 5T5NF 2WIIA 2XT1B 5MI0B 3T0XA 3QIUA 2MCG1 4EZMA 4ODXB 4JQIL 5BQ7B 2IPUK 4NZJA 4P23A 4GW4B 5IF0B 3W0WD 5INDB 1T5XB 1C16A 1BZ7B 1WV7T 4NO3B 5CUSL 3EOAA 4JQVA 3QEUB 1QPPA 2O5YH 5I1EL 1YEDB 1IGTA 3BP7A 3TEUA 3MRJB 3O6ML 3ZO0A 1TIUA 4ODVL 3MRHB 1B0GB 1J0IA 4KROB 4NUJB 4UB0L 3FONA 2OJZL 5HHOA 3MR9B 4E41E 3SE9H 4YHOL 5SX5K 3BKYH 3F12B 5IVXA 4XPFL 2HT4D 3HI6H 4UNUA 2W1NA 3TWCL 4Y4FA 2DWEA 4ZPVA 4G7YH 4UBDD 1VEPA 4PJBB 5IT2H 4BQBA 2H9GB 1RZKL 2EEBA 4LKCB 4CADB 4H0IA 1S7QA 1WC7B 3OKDA 2P45B 4N1HB 1F3RB 4KXZI 4ZXBB 5T33L 1R3JA 4HLZH 3RIFF 5CP3A 1Z6JT 3C5ZC 1UM4L 4M7LT 3TH2T 4D9QE 1IGYB 4JZJA 1BX2A 1HH9A 4U6YB 4BH7B 1JPGB 1RMFH 3S5LA 5BZDA 2PO6D 3L9RB 4Y19D 3OR7A 4RMUA 1UH2A 4QY8A 5HI5D 3BD3A 4Q9QL 5B39B 4C4KT 4WDIB 4LSQH 1I7ZB 5IMOA 5D96B 3TVMC 5DWUH 3RDTB 4XGZB 1J0JA 2XWJA 3MLVH 5A2JH 4YHKL 5L9DH 2G75B 3F6LA 4XPBH 1QFWI 5I6XC 5JHLL 2VDOH 1CF8H 5CJOL 5C0AB 4PJIA 5HHXL 4MA3A 1CDYA 5EZJA 4NQVB 5E6ID 3SGJA 1ZGLB 2ZCKL 4DZ8A 5MEPA 4NKQB 2X4TB 3P0YH 4MCYB 4PRPA 3MRPA 4X4ME 1HH6A 4LRNL 1MWAH 4XPAH 1W72B 1LEIB 4JGUA 4QRSA 4ETQA 1OAXL 3T4AB 4DZBB 1L6ZA 1GZQA 5I73B 2JB6B 3IXTA 3OJDB 4E41B 1AQDB 2LU3A 5TF1H 5I71C 1UH3A 2VIRA 3QULB 4OB5H 4Q2ZB 3QUXD 4YE4L 1S9VB 1LDPH 1T04A 1MFEL 1T83C 4JB9L 4U1JA 1M7IB 3PWVB 4H8WC 3C2SA 5EO9B 3LS4H 4QNPE 5L2KA 2SEBA 3P4LA 4EI5D 4WO4B 3T0WA 1XCQA 2WK2A 1RURL 5FGCB 1CFTA 1DR9A 2OXGA 2ICEB 2GUOB 3PHQA 5JXAH 2F5AH 4GO6B 4AK1A 4QTHB 3WIFA 3L95A 4LLWA 4EXKA 1MQKL 3H3BC 5I0DA 4JHAH 5EO1B 5CBAA 4M6OH 2EICA 1J0HA 4N0FB 2Z91A 4H8WH 4OZHF 1OSPH 3P0VH 1OTUD 3UDWC 4AH2A 5D1XD 1F4HA 4TULL 1UWGL 4MAUL 1P7KA 3WL9A 1TZGH 4PREA 1KIRA 3IJSB 4XP9H 5I1LA 2ZCLL 2ED7A 4N5UA 1IAIL 5FUOH 1ZV5A 5GGVY 1UCTA 2YPVH 3BISA 4IMLB 1I3VA 4XBEL 5DURD 1T0NA 4XBPB 3PABB 3RBSA 3VGHA 1PQZB 3ILQD 1KJ2H 5D93B 5F97E 1MFCH 2MSPA 2Z0BA 1JFQL 4YDLB 3VXTA 3SDYH 2EZ0C 1BBDL 2FEDD 2EE2A 4MD4B 5LBSL 2KUTA 1CFNB 4X7CC 1RZIB 1OAZH 2YHGA 3IJHA 1IL1A 4K3DH 5JHDA 3D85D 1FV1B 5CBEA 5K59E 3PP3K 3IJYA 4PRHE 4HZLA 5D4QA 3EDJA 2M1KA 2IALA 2OR9H 3HNSH 4MAYD 1OSZA 2Y5TB 4MA1B 4JO4H 3SQOH 1UWXH 1L7TH 1PDKA 4Z6AT 3V7AE 4OZIF 1GGIL 5AG9A 4ODUB 4G6JH 2D7MA 3ALXA 4P5TA 1B0RB 4N5ED 2VSDA 3QPXH 3HZMB 3VWKB 4AEEA 1SM3L 3O6KH 3OGCA 2IH3B 2OM5A 4G80B 1WUNT 4CDHA 3LN5A 2NQCA 3A0OA 2DI9A 3D69B 1I8LC 2XY1A 3QQ9D 3NACH 4UNTA 5LCVH 4GKNB 1TQBC 2FX9L 3QIUC 1MPAH 1DQTA 1I3RB 4R90L 2FHFA 3KYOB 3B6SA 1WF5A 1J1OL 5GZOC 1IGTB 1ZT4B 3GSOA 4QKXB 1WIPA 2X70B 2X4NB 4UT9H 2WM0A 4KZDL 3BXNA 1JN6A 4LFHD 1CXKA 5EDXA 3RY6A 4POYA 4HIJA 4OGAD 3HAEB 1SEBB 1AGEB 1J87A 3O2WH 3UXFA 4LCCA 4Y4FB 4NQSB 4ZPVB 5LKNA 1XGQA 3GJEB 4O51A 4XPHL 3UYPA 1IBGL 4PRHD 3U30C 1MNUH 3UBXA 3SDXA 5IMLA 1AIFA 3DI2B 1DLFL 2AJVL 4WGVB 5JZ7D 2KDGA 3CCHB 1IAOB 1MCRA 4JDTH 5BZWA 4ZS7H 4DGIH 1A6TB 2VOTA 4LPYA 3NVQA 4JDVA 3R0MA 5IB2B 2XIDA 3QUZA 1DVFD 4BH8A 3L3DB 4P3DB 5B22A 3L1OH 2GSGA 4JZJC 3WSQL 1WICA 5T5FL 3MLTB 4JY4B 1O7VA 4NRZA 5TPWH 4EVNB 4PV9A 3DYOA 2XFXB 4FTVA 5F21B 2MMXA 4WI5A 5IMOB 1CIUA 4HIXH 3CVHB 4F9LA 4YXLH 2N1KA 2UWEE 2B4CL 3VA6A 3C08L 3FOMA 3TLRA 4ZUSA 1JZ3A 1CXHA 1S5HB 3WXVL 1N7ML 2JK5B 4UZGA 2DMCA 3TYFB 1B4JH 3WLBA 1ZOXA 4AEHL 4ZG1A 4KZEH 5CP3H 1T7YA 4ZNEE 2GIYA 3NTCL 5L8JB 2CKBB 1D5XB 4PB0H 1V3LA 4KRPD 4EQ2A 5KSVB 1KENL 4LU5L 3SGJC 2LV4A 5DHVA 5BV7B 2H2PC 3AB0C 5DRNA 4MSWB 2DBJA 2H6PA 1G6RL 1MRFH 3QDJB 5DJ8A 4KK9C 5EZLA 2C1OA 2C4FU 4KV5E 3OJVC 4JFPA 5HJ3B 5FDYA 3W5MA 3FT3A 1T04B 3MA9L 4NSKA 2EDQA 3T3MF 5TDNA 4U1JB 1FIGL 1G0YR 4KTDL 1HI6A 1CI5A 1RULH 1U3ZA 3FQTA 3MOQA 4LLMA 4I5BB 5T3XL 1KACB 4LCIH 3MODL 2QQQA 2FD6H 3BWUC 2X1OA 3IFNH 2YOCA 1XT5A 3GMLB 1CD8A 2BC4A 1X7QA 2IQ9L 4BQCA 3QIBA 4I77H 1YY8B 1C08B 1I1AD 3IETA 4HQQH 1QQDB 3VG9B 1GC1L 1RJYB 1GXEA 5INCB 4GRWE 4WGWB 4JPIB 4A6YA 4XCNA 3QG7L 3TPKA 3ARGB 5EU7C 1JUFA 5CEXB 2IH1B 4IOFD 1EFXD 3D39A 5I1LB 4AM0A 1JNHB 1IGCH 1ZA3A 1NANI 5EPMB 1UZ6F 3JVGA 5GSVB 5E0QA 5SWZE 1R3KB 1DFBL 1NC4B 5GRUH 4KJPD 2NY6C 1CGYA 4PPTA 3IVKB 3VFRA 4JFYB 4Y7MA 1D9KB 3RGVB 3VFOB 3VWJA 5C9JA 4OCXL 3BT2H 2YKLL 4OF3A 3KPTA 3NCBB 3WS3A 3MCLL 3GMOA 3ROOB 4Z7QE 4WEMB 1KJVB 1A02N 1UEYA 3AMLA 5H2BA 3U9PL 2C9AA 5HPMB 1JHTA 1U36A 1EJOL 1I1YA 2ZOLA 2XTJD 1A2YA 2BRQA 4H25A 2GITB 2YD9A 3EUUA 3W82A 3EDDA 1CD1A 1YMMA 4GAYB 4ZO8A 4PJXA 1NBVH 4WUKH 2EECA 3STLA 5F1IB 1FJ1B 1JNJA 3BPCB 3UEZA 1BZ9A 4JEGB 2OL3B 5E4EB 4P5TC 2H3NB 3NFPB 5IHBA 5I15L 2WINB 3VXUE 3FQXB 3PGDA 3V7MA 4NHCL 3T2NL 4LCWB 4IRZH 1KCUH 1UWXK 4R2GC 1KELH 5D7IA 1J0KA 1ZKAA 2NXZC 3KPLB 1CBVH 3L5JA 3WFCH 4R97B 15C8L 2GY7B 1RUAL 5SX4I 2QQNL 3G6AB 1HIMH 2NY3D 1IC5H 5SWZB 2Y06H 3UP1A 1GAFH 1WLHA 3U1SH 1B6DA 1FVDA 1LP9E 3LS5L 1BD2D 3RKDD 2AJ3A 2OTUA 2Z93B 5GS0L 5HVFB 2HFFA 1OGAE 1Q0YL 2ARJB 1MF2H 3SE3A 2W0FB 1XGQB 2N7AA 1TVBA 4P9HL 4ZS6C 1XGRA 1N5AA 3S4SA 1QO3A 3QDGB 1QPXA 3QHTC 5FF6B 2EH7L 1JV5A 1R6VA 5FYKU 5J12C 5IMLB 3EYVA 4LCCC 4XWOD 4JFZH 3NN8B 3SDCA 1HWHB 5D1QD 5GJSH 3JZ7A 4N8CH 1VGKB 1T1YA 5ALCL 5SV3A 1FFNA 1B9ZA 3OZ9H 5KS9A 3KHOA 4N0CC 4XNXH 5I74C 1I8IA 1WISA 4C55A 2NZ9C 1D6EB 3IS1X 4OCYL 4S1RH 4XWGH 1MCCA 1S9XA 3QWRD 1JRHI 3PWPD 4R96A 3U4EB 3I50L 3ULVD 3H0TA 3DNKA 1MUJB 3QUZC 1LE9B 3MV8D 5EFIB 1KIUA 1AKJB 3VXUB 2BNUB 3KPQB 5DYOB 1IEAA 2QEJA 1K5NB 5EH1A 3JTTA 1ODAA 3TCLB 4Z8FH 2E27H 3S3PA 3O8XB 4R7DA 5GZND 2DL2A 1BOGA 4N0UA 4BK5A 4Z77B 1G7LB 4F9LC 2A9NL 5KJRL 1I7TB 4RMTA 1JGVH 2YC1A 1TJIL 3HUJA 4HKXB 1Q72L 5HI3C 3TPUA 1FL5A 2HA1A 2DQFA 4N0YL 3H3PH 3RAJH 1DN2A 1VKXA 2PYEA 1FN4B 2X89A 2A73B 2RCSH 2M8XA 5EOTB 1EAPB 4G7VL 1NCAH 2RFXA 1KSRA 4JFPB 1OGAB 3FT3B 1NC2B 4YNYB 4JFDA 1OM3H 1MJJB 4ELMF 1FC1A 4TPRH 5EUKB 2P8MB 5I1AA 1H3WM 1X5ZA 43C9B 1Q38A 4KMQA 4JRYE 3HCVA 3I6GB 2NY0D 2R0WL 1HXYA 1Y0LA 3WLWC 2CLVB 3MOAH 3LEXA 4FA8A 5T1MA 5GXBB 1YPZE 4UTBH 5F8QC 5DHVH 3RJDA 1CIDA 5GIRA 3WHXA 3VA2C 3EGSB 1T7WA 4IIQA 2FYYB 4ZYKA 4WJ5B 1JUFB 3QIBC 4G6ML 4PBXA 2YBRA 3O4LE 5D2NE 1CK0H 4OM1L 3U0TA 5DJ2A 3TJHC 7FABL 5D1ZB 2J7LA 1AE6H 5ABDE 2VL4A 5GJTH 2J8UA 1A7QH 2DQGH 1BEYL 1QFUL 1WAAF 1A6VH 2BX5A 2VO5A 4R9HA 4R8WL 3KPNB 3VXNA 1C8PA 3VWJB 5F7LB 3CZFB 1IAIM 2PXYA 2VLRE 4QWWC 2ZUYA 5AZEH 1MJ8H 1VB9A 4WI7A 3CLFH 1DEEB 32C2A 2XI9A 3ARBB 3BQUA 1LVEA 4MJID 1SY6A 5GGQH 3RU8H 4A6YH 3T65A 4NQEB 1Q9OB 1AQKL 1VHPA 2F9BT 2OJEA 1IC1A 3HE6B 1GL4B 4I48A 5ICZA 3ZYIA 2K9UA 4PJXB 4XMLH 1O5DT 4JRYD 3QA3A 4WWID 3FOLA 2CQVA 3CFKA 1C5CL 4G8IB 1NL0L 4LP5A 2JJTC 4OFYD 4IM8A 2KQNA 1GGYA 4LLQB 1UACH 3UO1H 5DUMH 4JFED 4PJ9B 5DMIL 4XVJL 3MC0A 1PKOA 5I9QB 3SCMD 2EDYA 3TBSB 4XC3L 3GFUA 1ZHKA 1DQMH 3O4LD 3BDYL 1U3HD 2BNQA 2DWDA 4FQ2L 5C7XL 3OB0H 4DCQA 4M7ZC 4K94L 5EIVA 3WJLA 1F6LL 3EO1A 3PDDA 2FATL 4Y4KB 3KXFA 1AP2B 2GK0A 2VLRD 5FECA 2D03L 2MKLC 3LQZA 1NH6A 2G2RB 1E6JL 1X5KA 3D0VB 1FVEB 3S4SB 1CT8A 1QO3B 4PTTA 3T0AA 5AG8A 1N8ZA 2HFEB 1T0MA 1EVTC 2NY4C 4R4BA 2P1YA 3EYVB 4MNHA 2QHLA 4MX7A 3SDCB 5KZCD 3LB6C 4ZAKA 4M7JL 1LO5A 5FB8A 5DT1L 1ZWIB 3T0ED 3BN9C 2B1HL 1T1YB 3H9YA 5FHBH 3TA3D 4TTDC 4OLVL 3FTGA 2QSQA 1A3RL 2H32B 4JZOB 2G60H 3H9ZA 4P99A 2GJ6E 5IB1A 5HHVL 1C5DA 5HXMA 1T6WA 5DJAA 4ZSOE 3V0WL 1OAQL 5IW3A 3B2VH 5BRZA 4LF3A 3X17A 5F7NC 4K8RL 1UQSB 3CX5K 4LNRA 4P2OD 4WTXA 4W70A 3RPKA 2MPAH 4ZFGH 2Q7YB 3ARTA 4GMTH 4I0PD 3IGAB 4BSJA 4OF5A 4QRPB 1J8HA 1HQ4B 5IW6A 4OKVA 3JV4B 2XQYG 3TF7C 5L0QB 1WWWX 3MRLA 4WU5B 1JTPA 4MDIB 3LIZH 2DQFB 1FLRL 3BHBB 4LDEB 1EHAA 5CLWA 4MS8D 1A1NB 2NTSP 1Q1JH 2HT3D 4PTUB 3T2QA 1CL7I 3VRIB 4G9FE 4JDZA 4AT6A 1ZLWH 4K3EL 3ZYOA 4DKFH 3BGMB 3VU2A 3CVIL 4J3XA 5KBNC 4QT5B 2Y36H 4MD5B 5JPNA 4I8DA 5JW4R 5DEFA 1N0XL 3PP4L 5C2BH 3RVUD 3LKSA 2ZUSA 3SDDB 1ZHNB 5ESVA 4U1LB 1CR9H 5J0BA 4KRNA 1ZMYA 3SKOA 4BQ6A 3M07A 2YRPA 5DJ0A 3QFJA 4NGHL 3T77A 1G0DA 4U3XA 1I1FA 2GJ6B 3I9GH 3C9NA 4ZSOB 5IR1B 1N0LA 4GG8A 1MCFA 2BDNH 4LK4A 5IHUH 4ZYKB 4AIZA 3KPRB 3QAZC 2GTWA 4C56E 2P7TA 2R1XA 2Q1EA 3BZ4B 1U8PB 3QBTB 1EZVX 3RFZC 3KHQA 2F53E 2C4FT 3X3FL 4IIQC 3PWJB 4QEGA 2BJML 4ETYA 2R2EA 3VH8B 3SQBA 2UYLB 3MREA 2UZIH 1MH5A 1XF5B 3VFWB 5CSZA 4KGJA 1RK0A 2P5EB 4HC1A 3MLSH 4H20H 4ODHH 1AJ7L 1NCBL 5FA4B 4MNGA 1S3KL 4P2QA 1ZHLB 3P77B 5TF0A 3E6FB 3DECA 32C2B 2EYSB 3WCYA 4OZIA 3UTSA 2IAMB 4DN3H 3EYFB 1FG2A 1ZA6A 1BFOA 2NX5A 5J3HD 5CZXD 1FL6B 3QDHA 1Q9LA 3L3IB 2DLGA 2HT2D 1OTTC 3BQUC 3LD8C 4WUUE 5HDOA 4Q6IC 3KPMA 1CQKA 3B9KA 2ARJQ 1OD7A 3O6FB 5KVFL 3FRUB 2F5BH 3L6FB 3GBNH 4X83A 4HKJB 2ZJSL 5F7EH 2IANE 4HW6A 5L6YH 5KTEL 4HIIB 3KYMA 4NC1E 1QACA 2D4FA 4NN5C 1M7DB 3CXDL 3C87A 3T08A 1O7SA 2MQ0A 2YWZA 3NGBC 3Q1SH 4CMHB 1SY6H 5FOBB 4UIMA 3B8YA 4I18B 3GI9L 1R3HA 3EYUH 2EIZA 1A64A 2CIIB 3MNVA 3BYTA 3REWA 3RVVC 4C56D 5MP6L 4GAJH 4K7FA 5ENWB 1R3IL 4GAGL 4IRJA 4OT1H 4OZFA 3UTTD 2ERJC 1FGVL 2F54A 3RWCB 4LKXA 4NQCD 3HC4H 3ZL4H 4OQTL 1DBMH 5D9SB 4QXWA 5E5MB 1Z0MA 4OCSL 2RGSA 2WUBH 2UY6A 5JW4Q 5F9AC 1W0WA 1YDPB 3PQYA 3V6OA 1X9QA 2QBWA 4YHML 5IQ7H 3K46A 1A7NH 4EN3B 2GK0B 2V5MA 4RNRA 4IHOA 5J1AB 2J12B 2EEDA 1JHKH 2FHBA 3NPSB 1MI5A 2D4DA 4GLRH 2RAMA 4GXVL 4NKMA 2FH8A 2PW1B 1UB6A 2DD8H 1WBZA 2J5LC 2YD8A 1N8ZB 3TN0B 3OB0K 5BW7A 1N2RA 4CVZB 4WUUD 5CHNB 2OZ4L 3VDCA 2DBLH 2VYRE 5IG7A 2Z31D 1G7QA 1WWCA 2VR5A 2IF7A 3HG1E 4IDLA 2XYCA 3U46B 1YEFL 1Q9WA 4NKDB 5B3NA 1QBMH 2IAND 1C1EH 4JRXB 4YIQA 4ALAL 4XI5C 4U1IB 2B1AL 4ZTOH 5DQJA 3MLXL 3TBWB 4DWHA 3C2AL 1HWGB 4L4VA 1EV2E 4PJDF 1RVFH 4PJ5E 1VADA 4OM0H 5MEQA 5DO2C 1ZLSH 4YXHH 3QR2A 1C7SA 3UYRH 5EWIH 3HI5H 3WUWG 5IFAH 3MX0A 4P3WA 4XVTL 2V5YA 1ZEAL 3HC0B 4AENB 1CICC 2AI0L 3WFEH 4XMPH 3OXSB 3BP5B 1G7PB 4ZNCD 2C7UA 1U93A 1KBGL 3QH3A 3MJ6A 1U8IB 1XR8A 1IC4L 2ADJA 1YQVL 4UNVA 1ZVYA 3BX7C 5HYJE 4GQPH 4PJAA 4H1LG 3FMGH 5ACLA 3VFVA 2NW2A 1S9WA 4JY6B 1U58B 3QUML 2PR4L 1X5YA 4YUEH 5FKPB 3QI9D 3C8HA 2A6IA 4UOJA 2APXA 2UVEA 4PJGF 3CDYA 4OZHB 2VDNL 3HG1D 3KJ4C 4F58H 4HS6B 1FNSL 4EDWH 3RWEB 5HHPB 4APQA 2Q76B 4EBQL 4FQPA 4UU9B 3VDAA 5KAQG 3C8KA 2BZDA 3EYOA 3P4OA 1ZLWK 1JNNH 5D6CB 5KW9H 1XF2B 5K9KA 5D71H 1MY5A 4TUKL 4JO1L 4K9EH 3S34H 4UQ2A 4WV1C 1YYLL 1BM3H 1MSPA 5HHQA 2P7TB 5I1HL 5DF0A 3MBXH 4PJ5D 1YEJL 3GDBA 5H94B 4W68A 1YC8A 3RTQC 1UH4A 4CBPA 5IJKA 1EIBA 2R2EB 1KIPB 5CLTA 4PLJC 4TSCL 5B3JF 1H3GA 3C5JA 1MH5B 3VFMB 1K2DA 3R0NA 4BSVB 1INQA 1D6VL 2JB5H 4JO3H 4XPTL 1YZZA 2Q3AA 2CK0H 3GMRB 4O5LL 4JN1L 3VXSD 3MGTA 4RRPA 4FQQA 1K9TA 3QIWA 1U8MB 4OZIB 2AK4A 5DJYA 1T7ZA 5ITFB 4L3EA 4ODTH 3O2DL 1T4KB 1QFPA 1CLZH 5E2VL 3QDMB 4UINL 4KI5C 2VH5L 4MZ2A 4KRLB 4NRYB 4YXKH 4F33A 4WHTB 2Z4QB 3WNPA 4JPWH 4XXCA 1MHEA 3QCVL 4IMKC 1GPOL 5EBWB 2IQAB 2B2XL 1OAUL 1KTDB 2C3XA 1XGYH 3MLWH 2DQUH 2IPKB 4KWUA 5IIEB 3CFDA 3IKKA 5LGHH 2V2TA 2IMNA 4HC1H 3BIAX 2YRLA 3TVMB 4KHXH 1JGDB 4FQXD 5FOJA 5I1CH 4PJCF 1A6ZB 4OCMC 4Z7VE 3X3GH 1FYTE 4GRLA 1QTYT 2X4RB 3QEGH 5D7SH 4XP4H 5C0AD 1R3HB 5E6ZA 3UZQA 1AGCB 3REWB 3VXMD 5FUZL 4K7FB 5I8KH 4S1SL 1HXMA 4NP4H 1TVHA 1R5IA 2J3SA 3T1FA 2F54B 2AXFB 4J3WA 4OCRH 1S7SA 3CH1B 1OWWA 1GGCH 4Y16B 1SBSL 4I3GA 2HH0L 2DTMH 1JPTH 2HG5A 2K7QA 3L7FA 4JCMA 1GIGH 5E8PB 1J12A 4JM2A 1TTUA 1J5OH 3SGDI 5C0CE 3TIEB 1MI5B 3V6OC 5HI4C 4XX1G 4NKMB 4L4JA 3ROLA 4YHPA 4YR6A 4WO4D 2ZSVA 3KS0J 3KLHC 1URLA 5DD0H 1KCSH 5IROA 1AD0A 1ACYH 3CC5B 4OZFH 1LK2A 5H35A 3FB8A 3MRIB 1JRHL 1FL3B 3TCXA 5BW7C 2APFA 4FRWA 3IFPB 3VCLB 2EDWA 4JPVL 3TV3H 2ZKHH 2VLLA 2VDPH 3W2DL 4HK3N 2WLZA 3KLDA 3EOYG 4EUPB 4ZUUB 1DQJA 1KJ3L 1FYTB 2FIRT 3ET9F 4DOHB 3T3PE 1FPTL 4OAWA 2FZ3A 4P2CG 3PV6A 5CILL 3DX6A 3WFHA 4Z7NE 1MCHA 2UV3A 2EZ0D 3L3HA 4EQ3A 4ORGA 4KQ4H 1A4JB 4ONOA 2HKFL 3ILPB 1XIWA 5HHOE 3JWDC 1FZMA 5IVXE 3UX9B 4ZUTA 1LEKB 1DE4A 3B2UC 1SYSB 1ZLVH 4L1HA 5I76B 1E6OL 1ZTXH 4JFOB 3W39A 3IDXH 1CDGA 4P4RB 3RIFK 4ELMA 3G08B 1INEL 4B50A 4GKSB 5HHMB 2PTTB 3VXRE 3OKLB 2AEPL 2ADJB 1OQXA 3LKPB 1AGDB 3BPLB 1H8SA 4X7SH 3D18A 4LBEA 1P5UA 4M1DL 1T1ZB 1S9WB 2C3VB 4UDUA 4PJ8C 4J4PC 3MJGX 5AD0B 3L5IA 4M61A 1BVKB 3FQRB 5MHSE 2CR3A 2VTFA 2Z92B 2X4SA 3OPZH 2OQJA 4Q58C 3VWKD 3BGFB 1INDH 5IBUB 5CGYC 1PX3A 5E00B 2IWGA 4XAWH 1NKRA 1OP9A 2JELH 4YDIH 4TOYH 5BOPA 3QIUD 1OAKL 2BSRA 4P23D 5GZOD 4K3JL 2Q6WA 1RUQH 3S7GA 1KXQE 1W72L 4AZ8A 5I8EA 4PJEF 3MGOA 2DMBA 4XMKL 1T1WA 5HHQB 1NGPH 2AEQL 4JHWL 3V5KB 4OLYL 2HMIC 1DLHB 4PRPE 3FL7A 4HV8B 1NEZA 4HX1A 5T3ZH 5IB5A 4IDJH 3C60C 2GTZB 4AEIH 2R8SL 3FO9B 2VXTH 1TNNA 2BXYA 5HHOD 4X99A 2WWKT 3NH7H 5IJKC 3VXPA 4PLKC 1MCWM 4XTRD 4Y4FD 3MGTB 4HUMB 4XCFH 4FQQB 2I60L 1FH5L 5L2KE 2J4WH 1MLCB 4BJLA 3BE1L 5DSCB 4LCUA 1TQCB 4UILH 3UC0L 3GIVB 4F57L 3DO3A 3QIWC 4LAQL 5AEAA 2FLRT 2E6PA 1V7NL 2CMRL 3CPLA 3FFDA 5EU6B 3RWDA 3QEQA 5CZKA 1B6UA 1TZIB 3ZHLA 4CDGC 2F19L 3LKNA 5CD5C 2VJXA 2B5IC 5AYUH 1YN6B 3K81A 3RWFB 2XKNA 4JFFA 5EU7E 5MHSD 4WW1A 3NBNA 5I75C 4XXCC 3IXAB 3TT1H 1OPGH 5J11C 3QRGL 1CDBA 4U6VH 4FQIL 1LHZA 4PUBL 1FNGA 5ERWA 3FAWA 3SKNB 5DS8B 2AXJA 4M7LL 1U3JA 1KYOJ 3O0RL 2AJUL 3RNKB 4QRTA 2C1PA 2OP4L 5B38A 4U6TA 1J8KA 3DX8A 4LSTL 4CU8A 3CK0L 3QNZA 2ZUUA 2WUCH 3QZWG 5KVDH 1L6XA 3MNZA 4X8JA 4GRLC 5F9DC 5I8OL 3A6CH 3F62A 4J8RB 1F58H 3GB7A 5F96H 3VFTA 1M4KA 2P48B 4GS7C 2H2PD 4LVOB 3GZKA 1E4XL 4ONGH 2XPGB 4PRPD 4Y2OA 2NY2C 4LFHG 1T3FA 1KPUB 4N9GA 1NSNL 2E8ZA 3WFDH 4HXBL 3LEYL 4NO5B 1JPFA 3E8UH 4TQEH 5DI8A 3UPAA 2JTDA 4MZ3A 2FL5A 4DAGL 5SWSB 3QYCA 3LDBB 1D5ZA 1UM6H 3STZB 3N1FC 5IJVB 5T1KA 3H8NA 3NIDF 2EC8A 5KG9A 4Q9RL 4RFOH 1SJEB 4JM2C 5C86A 4KK6C 4YHPB 1Q94A 35C8L 1QRNA 3I75A 3TT3L 4WW2F 5EOCJ 3ARFC 3V7AG 5I1IH 1J05B 2G5RA 3S35H 1B2WL 1AI1H 4K23H 3HR5B 4OLXL 3RIAF 5SV4A 4E0RA 1ETZA 1JWUB 1U0QA 1NBZB 4GBXA 3GK8L 5F89B 6FABH 3D2UA 4P3CH 3S36H 3TNMB 5E1HB 3LMJH 4Z7UA 4DGVH 1H0DA 5LGJB 2QKIB 5GS3A 4P0DA 2NY6D 3VXQA 3LSOB 1A14H 1JYXA 5E08L 1F4YL 4F7TB 4NM4L 4OAWB 3IU3A 1Z9MA 2X09A 3RWGA 3KDMB 3UROR 3L3HB 1PG7X 2YD6A 1I8KA 3EDKA 4XVSL 4NFCA 3WE6B 3BW9A 4XP6H 3V6FA 1CL7L 3CX2A 3UTZB 2DKUA 5CGMA 4PGBB 4PJ7F 4K3HA 4YO0A 1XIWC 1CLCA 5JHDD 5EN2A 4C83B 1EUTA 2VXSL 1I9JH 3SDXE 4HJJH 3MYJB 4ZFZB 3SPVA 1H15A 4OI7A 5C0IA 4LBEB 4CN4A 4WNQA 2VISB 1P4LA 3INUH 3OR6B 5LWYH 1D5BA 1RIVH 5D7JB 4P5TD 4HPOL 1U3YA 5CEYA 1RK1B 1ZLVK 3CVHL 3UTQB 5TE6H 4CW1A 2AS5M 1P4BH 1JF1A 1CLOH 1T2QH 1N59B 2HVKA 1FFOB 1JE6A 4X6BA 3QNXA 5AWNH 4R2GD 4WHYH 1ZT1B 2NXZD 4LGRB 4MA8L 1HINH 4FTVE 2V7HB 4R0LB 4PJHF 2E7LC 2CKBL 5CSBA 2ID5A 5TH2A 3DX7A 3ULUL 4BFGA 3SO5A 2CLZA 3MXVH 3BAEH 3UZEA 5ID0B 3FB7B 5DD1L 3RL2A 5F7DA 3WJJA 4WCYH 1T1WB 5BV7L 2BVOA 1HDMA 2XACC 4OZGA 4NC0B 5E2WH 1Q9KA 4GW1A 4Y5XA 2IGFL 3BP6A 4RGMB 4M5YH 5EORL 5DUBA 3B5HA 5K9JL 4U1KB 2MNUA 1CWVA 3WFZA 3N9GH 4HK0B 1J0ZA 1QSVA 4KGLA 4JQIH 3CSPA 3OAUL 4PRBA 3UAJC 4YHYC 1NMCB 3G6JF 1LD9A 3AM8A 2OR7A 5DXWA 3OQ3B 4C58B 4PGCA 5I1EH 2L7JA 1V3MA 4LOUC 3LV3A 4ODVH 1OF2A 1CCZA 4U1HA 3CSGA 1JWSB 3L3OA 3TH3T 3S88L 1ZHBA 4WWKB 3L3KB 2PW2A 2VLMD 3CZJA 4UB0H 1EHLL 2YK1H 2OJZH 3RL1A 5D6DC 1U8KA 4YHOH 3KLAA 4U0RB 3THML 3TWCH 4UQ3A 3QO0B 3QUZD 1CG9A 2IBZX 1A6UL 1FG9C 4HUKB 1OT2A 5FV1L 2OI9B 3IYLW 3RQ3A 1RZKH 4XHQA 1F3DH 2AJYL 2FGZA 3O45B 5ESAA 4NNXA 1XF1A 4FTVD 2ZUQC 1BLNA 4LPUA 2BSTB 1EA9C 3D39E 5GS1A 1UM4H 4M8VA 3H9SB 3GSNA 1A7PL 3HLAB 4HJ0D 1H5BB 5FO9B 3V4VL 2YUWA 3HZKA 3G5YA 2X7LA 4PP1C 3CXHK 4ZUWA 5DC0A 5HI3D 3PWLB 3BOVA 2JJUA 4Q9QH 3RA7L 4P46B 5MERA 4LCYA 1G6RA 5FYLL 1BJMA 3RHWK 3PWUB 3TYGL 1J1XL 4F8QA 5JUEL 3DO7B 3SDAA 1T66D 3T1WA 4O02L 2W0PA 3K0WA 2D7TL 4N8VA 4YHKH 1JF5A 2XWTB 5JHLH 5CJOH 3DSNA 1FNAA 5T1KB 5HHXH 4KDTA 2P8LB 4Z5RA 1NGQL 3IFLL 5E5RB 2PYFB 1OLZA 2OL3L 4NKIL 2ZCKH 5DMGD 3QHFH 4XXDB 3WLWD 1RUKL 4V1DA 1YMME 4OJFL 1Q94B 4D9LL 3MV7E 4F7PA 4LRNH 2FH6A 4H88L 1N26A 5JLZA 5ITBL 1PVHA 4ZO9A 4GG6F 3DSFH 3IAPA 3UTOA 1CGTA 2F8VA 1OAXH 5FO8A 5DEZA 4LGPB 5JORB 1NGYB 2AV7A 3DVGA 3IDJA 4LSPL 2CLRB 1H3PH 5E94A 3RNQA 2R4RL 3ARYA 2OCFD 4YGAB 1CLYL 3JTSB 4E0RB 2XN9A 3QIBD 4YQXH 4YE4H 1IGJB 2R29L 3O3BA 1MFEH 4JB9H 5DMJB 4R7NB 2OMNA 1CDCA 2V5SA 5D7IE 1IGFL 3L3JA 1YECL 2VABB 1RURH 4LPTA 1NFIA 1ZT7B 4PB9L 3D39D 1VFBA 3AFLA 4HCRL 4L9DA 3UMTA 4X7EC 4X4YA 3FT4B 5K9QI 2HT4C 1I8MA 4Z7WA 1FNEA 3MNWB 4UBDC 3RWGB 4MQ7B 3BDBA 5LXGL 4JLRA 1OGTB 1WEJL 2VSCA 2DQCL 2VXVL 3VWJD 5BJTA 1QG3A 2IG2L 4ZDHB 4CJ0A 4OD1H 1BVZA 1RIHL 1NGWB 4TULH 3BSZH 4ONFL 4MAUH 5E8NB 2NTFB 4U1GC 4DVBB 1CFQA 5EOCL 1H8OA 5IFHL 2ZCLH 1IAIH 4Q9CA 5JO5B 1HSAB 4HUNB 5J6HA 1ORQA 3NCYP 3DUSA 4YEEA 5HI5C 4PJGA 3KNBB 5KAQF 3AU1B 3SGKA 4CU7A 3WMSA 1PGRB 3HE6D 3NABL 1KTRL 4YWGL 1A1MB 5KS9E 3PNWB 5KSBE 3MV7B 5DK0B 3V2AR 1BBDH 5LBSH 5GSRA 3SY0B 4JREC 4YPJA 1XZ0B 1A47A 2YSSB 1DBJL 3SN6N 1TCRB 4X6BB 3EFDL 3MROB 4RFEB 3HA0A 5I1KH 1QUNA 1S7RB 1T5WA 5E6IC 5C0GB 3LH2H 4UOW1 2AXGB 3G5XA 3RP1A 1LNUB 2O26U 2YXMA 3FCTB 5ID1A 2ESVA 2DLFH 4C59B 2VL5A 1IGML 5C0DB 1CN4A 1ZGLM 1TETL 4PG2C 4HUXA 4N0UE 1KLUA 2ATKA 1SM3H 1LO3L 3FFCB 4MD0A 1MLBA 5BVPL 3HUJE 1E27B 3WEXA 5JOPE 4XH2B 4Y5XC 5CP7B 3ZE1E 5BMFL 5HYIA 4EI5C 3EBAA 4X0KA 2VDMH 3DARA 3Q6GL 3L5XL 3KPSA 2FJFB 1K3ZA 5TDPB 1F4WL 1LO0L 1I1AA 2FX9H 4PGCB 4JFDE 4U1MB 5KN5A 3RI5K 1UCBL 3Q6FA 1XH3A 4R90H 4X9FA 1J1OH 3BN9D 2VLKA 2DKSA 1RUPL 3AM8C 4QCIA 4KZDH 3L3OB 4JPKL 3SDCD 1W0VB 3O3DB 4OGZA 3IDUA 2XWBB 4U6HA 1VFOA 3U9UB 1QSEE 2V2WA 1U8KB 1E0OB 4ZUVB 1PG7L 4PJCA 4U49A 2VE6B 2CJUL 5FEBA 3BUYB 3LQMA 5KSBB 2VZ3A 5DJXB 2CRZA 1QLEL 4XPHH 5C07B 2W0LA 1IBGH 4G8GB 2IPTL 3I6KB 1QP1A 1X5LA 1AXSA 4ERSL 3CU1A 3B3IA 3N06B 2HN7B 3ILQC 5D2LF 3OXRA 2B4CC 4HMEA 4JN2B 2DQEL 4RQQB 4M1GL 1S7WA 2J8UE 4L29B 3CU7A 5EIIB 3M8OL 3OKEA 5GS1C 1V5JA 1B90A 3SOBL 3WSQH 4OD2A 1A3QA 5DTFB 4LCYB 5IOPB 2VLJB 4O4YL 2LABA 4G8EB 3TH4T 1IM3B 5E8EB 3GSWA 4QXTA 4P5KA 2PYED 2X89D 2B4CH 3MV9A 1PKQA 3C08H 3TO2A 5ANMA 1N6QL 4M03A 3WXVH 3SDAC 3MLYL 3QNYA 5BVJA 4JGJA 1MCJA 3QFDA 4AEHH 3FQWB 4UAOC 4JFDD 1FC2D 3DYPA 2CSPA 3GSNH 3NTCH 1CXEA 4M00A 2P5WB 2VMFA 2R9HD 1U6AH 1KPRA 3DJ9A 4YX2L 4LU5H 3HE7A 4KDTC 4XP5L 1XCTA 5E9DB 3T8XB 2AW2A 3HB3C 1IKNC 4MJ6B 1AHWA 1G6RH 1QSEB 3QQ9C 3P9LA 4PJDB 2J1KA 1TJHL 1EDQA 1NCCL 4HWZB 3PDOA 1Z5LB 5BOZG 1MFBL 3MA9H 2W9DL 1FIGH 4NBXB 4KTDH 5IV2B 1S7TA 4LSSL 1UGNA 5JQ6L 5DGRA 3KPRD 1F6AA 1F8TL 3J8F7 1NFIB 1GYAA 2IPUG 3BWAA 3SKMA 2D31A 5T3XH 5DZOA 4I2XA 4LHQB 3MODH 4ODSL 4KY1L 4NO2A 5IGXL 1TCMA 3MACL 4QOKE 5LAXB 2IQ9H 3GSXB 4D3CL 3KXFE 4YHIA 4S11A 3DBXB 3ZKQD 4URTB 2DYPB 2WAHA 4ZFFB 1GC1H 1WBXB 2PXYD 5EIQA 2EIBA 5EO0A 4W81A 1I1CA 4X5WB 5TGBA 1WFTA 5DRWA 3GHEL 3BQUD 1IQDA 1FFRA 2E3VA 4LSVL 5D5MF 2Z35A 4Q6IB 1ITCA 2VDKH 3BPNC 4UT6L 3O9WB 1H3UA 1BQHG 2JIXA 3DUSB 4KU1A 1F4XL 1DVFC 4PJGB 2XNAB 4H26A 1S8DA 4PGDB 4X4XA 5CJBA 1KPVA 2QADB 4OCXH 2YKLH 3EJYD 2X9YA 4DKEL 2Y23A 2Q8AH 3SGKC 3MCLH 2FWOB 3B83A 1I7UA 4MXQC 3U36A 4LLVA 3U9PH 4HUUA 5DJDB 5JXEA 5BRZE 1S7VA 2FRGP 1EJOH 1L9NA 2DQIL 5C6TL 3P40A 1J18A 1YNKL 4OI8A 1HHGA 5FYJU 5D70L 4KRPC 5DLML 4ZQKB 3TGXA 2DICA 5J89A 1MCEA 1BQLH 3NFNA 2QQKL 2V9RA 3K2UL 2BNQD 3D9AH 4MWFA 2YPKA 1RHFA 2ATKB 4LSRL 1G7HA 2H8PA 4FFZL 5J13C 1A21A 3DUUA 4PV8B 5I15H 4FFYH 4ZD3L 5JW5B 4U1NA 3H7LA 1KC5L 3KXFD 4TUJB 1OAYL 4NHCH 3T2NH 4N90E 4QNPF 2VZSA 5IFJB 5DJCB 5KSAB 1U8LA 5B21A 5GS0C 3IS0X 5CGTA 3O2VL 5IQ9A 5C09A 5KN5B 1LILA 4P9HC 1RUAH 3R1GL 5I66A 2QQNH 1CXFA 1NFDE 2JCCF 1IILE 2BHZA 2XA8L 4WTZG 5CS7A 3SKJL 3KYKH 4OF0A 4G43B 1I1AC 4ISVB 5DK2A 3D0LB 1QLRB 4ZAKD 1RFDL 1BVLA 1A7OL 3LS5H 5D72L 3IDGB 3CNKA 4UDTA 5FHAL 3MMEA 3N1MC 5GS0H 1G7IB 4S1QL 2X4QA 4IOFC 1B88A 2CK2A 3OWEA 3QFJE 4H5SA 2HJLB 4LDOB 2O61A 3G04A 4IRSB 2NY7H 2AQ1A 5DO2D 4P9HH 1XGUB 2D2OA 1BF2A 5IESL 3U0PA 3HZVB 1ZSDB 5BRZD 1OB1A 4KJPC 3U6RB 1ACZA 1WZMA 3B3IB 2VDLL 3AROA 4I4WA 3HPLA 5F3HB 3DTXB 2BVPB 3TZVB 1M6OA 2J6EA 2BNRA 1XR9A 3JV6A 2IADB 5E99H 4O58L 2GK2A 1B0WA 3WNMA 1G84A 2W0KA 2ZCHH 3FO1B 4HS3A 2Y6SD 4X7TA 3OKEB 5DD5L 1J8HD 4KVNL 4P59L 4YDKL 3KG5A 2DIBA 4OCYH 3G5ZB 1LEGB 4KK8D 1QD0A 5K59F 1A7RH 4G5ZL 4MNGE 3I50H 5E70A 3BD5A 2XTJC 4KI5E 1EXUA 4X6EA 3QEHB 2ADGA 3UTSE 4ZTPL 3FQNA 5F6IB 1R0AL 2NX5E 3RWJB 4N90D 3MBEB 1E4WL 5ESQA 3UBXI 1HK6A 5BXFA 1FDLL 5F88B 5ETUA 4WW2A 5H37H 4JFEA 3T4YB 4FQ1L 3RBGA 3V0VA 3IDIB 1J9CT 4LPWA 2QJDA 2R56L 2A9NH 3OGOE 4I3SL 4Y4HB 5I17A 5CJ8A 1UXWA 1NFDB 3UJIL 5EU4B 5EBMB 4Z9KB 4LHUG 3F5WB 1BFVL 1AGBA 3UTPE 4N0YH 1U8OB 5IVZA 1HEZA 4PJEE 1MRCL 5A2LH 3V6BR 5F7HA 2FIKB 1IZKA 1T03L 3HE7C 3QFJD 4WV1B 4Y8AA 3OG4B 5EUOA 3CDGB 1AHWC 5HHNA 1FZKA 4KMTH 1HN1A 1L9MA 3GMMA 3MCG1 4DUXA 4JHBA 4FQHA 2I5YL 2R0WH 3TFKC 1M71B 3MRKA 3T0VA 3G6DL 3QSKB 4XNMA 1BFTA 3MRGA 4NO2B 3SEPA 4F7CA 4PLOB 4PJ7A 1NBQA 3RZCB 4OD3L 4NRXA 2YPLA 1DEDA 4MNQE 4L4TA 4BQ8A 1YEIL 4LEOB 5F7MC 2NY5L 3PQYE 1EHXA 3V6OE 4KDWA 3O3AB 4HJGB 2FB4L 5E2JA 4LVHB 3CLEL 1X5JA 4P2QD 3DROB 3X14A 5GGTA 1P1ZA 1AGFA 5D1QC 4G6MH 1NFKA 1KGCD 3IFOB 4P4KA 4PR5B 4FABL 3QJHA 1FSKB 4V2CB 3DRTA 5L2JB 1QSFE 1FLTX 4FG6D 3VGEA 2BVTA 3K4DA 1BEYH 3HFML 2IBGA 1A22B 1YC7A 1QFUH 2BVQB 4NYLA 3U0WL 3DV4A 3B9KD 4R8WH 1G9NC 3VMPA 3ULVC 4OCLC 5C0BB 1HILB 4I0PA 1HKLL 4QRRA 1NGXA 1UEMA 1C12B 2I9TB 3QWQB 3I3EA 4PJEB 1CVSC 4L4VE 1LO4L 2UWEF 5DD3L 5GZNC 3LKOB 1AQKH 2P8PB 1BBJB 1R3LB 1QR1A 2YMXL 2QV2A 2MHAB 1MIEL 8FABB 2IBBA 4I3RL 5JXEC 4PRIA 5EU3B 4OQTA 4RA3A 4JZNA 3H42H 1T21B 3D1MC 3VFGL 3EYSH 1MHCB 4NM8L 4IRJD 4HLZG 5MENE 4NOFA 1RJLB 1QA9A 1ZGLP 4Z0XA 2VUOA 4WI2A 2F54D 3GNML 1PZ5A 4LL9A 1S7XA 3MRBA 3MRDA 1NL0H 4PGEA 4NKOB 4K94C 5ISZA 3BZEA 5DD6B 4KV5F 4CU6A 1KT2A 3PQYD 4QRUB 5HI4D 2QR0A 4XNZC 2JJVA 5DMIH 3DXAB 2UVFA 1T20B 3GUTA 2WBJB 2YN5A 4QRQA 2NY0C 3KLHD 1SYVA 4XC3H 3ZDZE 4PJAE 4M7KH 4EEEA 1MI5D 2OZ4A 1T89A 3DX9A 3BDYH 3NCFB 1CFSA 2YD2A 4XNQA 4K94H 5GGSA 1QSFB 4JHZA 5T1LB 3C6LB 3ZHKA 1EBAA 2APBA 1A9BA 4L8SC 2FATH 1BVLB 3DLQR 1NJ9A 1YEGH 4J1UA 4HFWB 1P7QB 2G9HA 1HNGA 4GRWF 2V17L 4F3FB 1EO8H 1XF4B 3ZTJH 1PJ9A 3VRLE 4WU7B 1E6JH 3G04B 5CINH 4G9DA 4A2MA 5F9WC 4NJAH 3QJFA 4L4VD 1BGXH 5JPMA 2BOCA 3M1BA 3WN5A 5IBLD 3I84A 4I4WB 5IWLC 4M7JH 3HS0A 5DT1H 2B1HH 1JNLH 4UOW0 4RDQG 2BY1A 4OLVH 1AFVL 5JR1L 1A3RH 2A6JB 5D7LE 3FRPG 3MZTA 5HHVH 2ADIA 5K9QG 5MENB 3MLVL 4Z7QF 1SVCP 2ZUWA 3V0WH 4XPBL 4L1DA 2DI8A 1FFPB 4OFVA 5CMAB 1EXUB 4DFHA 5DQDL 4K8RH 3A67L 1GVIA 4XRCA 3RWHA 1GZPB 4L3EE 4RIRA 3QUMA 3E3QC 5FYKL 1SQ2N 1ZVSB 5ESQB 4RZCA 1U8JB 5IEKA 1MWAL 3BIKA 4WW2B 4DGYL 4OUUA 2F74B 2O5ZL 5F9JA 3ARDB 4Q97A 2J6EH 5T3ZD 1ZANH 5CGYD 3FN3A 3X13B 2Y07L 2C3WA 4HGWB 3W9EA 3LS4L 1FLRH 2VQ1B 4NQCA 4APQD 3BP4B 1A9EB 5A2FA 2R2HB 5I1DB 4HKZB 3GSQA 1KCVH 4K3EH 1U3HC 3SJVE 3CVIH 4EDXB 3ORJA 1NLDH 2HMID 2PCPA 4F37K 5GRYA 4FMKA 3WDJA 1P9MA 3GMMB 2EKJA 1RU9L 3MJ7B 2BVYA 3V4UL 4X5XB 3C60B 1N0XH 3PP4H 4ZOAA 3V4PL 5I30H 1HHHA 3P0VL 1LP9F 4X6DE 3VE0A 2HRLA 3D25A 1PYWB 4PLKD 4PJ7B 3MUJA 5K9OB 1TZGL 3WD5L 2Z31A 4NGHH 2W60A 5D7LB 4UT7L 4H0HB 2YPVL 4NT6B 4L8DA 3PJSB 3F58H 3U7AA 3O2DA 2V2XB 3CDCA 4P5MB 5BS0B 3BH9A 1R5VB 3G5VB 3FO2A 3LKQA 1A6PA 1OT1A 2CIKA 4JFQA 5FK9B 3T0EC 3QIWD 1HOCA 3TA3C 2AK4D 2LAAA 2ZSWA 4L3ED 1KJ2L 1IGIL 3X3FH 3BKCH 5HYSA 2H41A 3QUYB 3DGGB 5GRWA 2BJMH 3LKRB 3T04D 1OAZL 1HHIB 4P4KC 4MHHI 5F1NB 2R1WB 5I75B 4L8BB 3MYZA 1KIQB 1ND0A 1MCKA 1AJ7H 1NCBH 2CD0A 2EH8H 3AAZB 2OR8A 1S3KH 1KCRL 2A83A 1T22A 5IB4A 4PJHB 1DZBA 5B4MC 4FZ8H 4Y1AA 3ZYZA 1P84K 1FVCA 2X4UA 4JO4L 4P2OC 3C09B 2R1YB 3QQNA 5C92A 5FKAA 4I0PC 3IDNA 3S8WA 5GGTH 4LNVA 2DM3A 5DEGB 4GRLD 4BFIA 1QR1B 4Q7DA 3SJVB 3SO3C 5C08A 2J8OA 4K7PX 3CX5J 3BVNA 3L7EA 2NY2D 1JIBA 1TPXB 2ZJSH 5KTEH 5DRZA 3VGAC 4MS8C 4Z0XB 2A77L 4FP8L 4HHAA 5CJ5A 5F3BA 1PZ5B 3G6JB 4Z76B 3MRDB 4UV4L 1K8DB 4XAKE 1TXKA 3GMNB 3LRHA 3O6LL 3RUGA 3CXDH 1HQRA 2GAZB 4Y0GA 2BOBA 1N3NB 3AUVA 5C0ND 3BD4A 2EDDA 5FM4A 4AMKL 3AREA 4JM2D 1WWBX 3NCEB 2X5PA 1MJ7L 2R0KL 5MP6H 4ODXA 5BQ7A 1R3IH 4GW4A 5INDA 5IF0A 1FGVH 1T5XA 1BZ7A 4NO3A 3O2WL 3PGCB 4NZRL 3QEUA 4OQTH 3K3QA 5GGSB 4JO2L 4OCSH 2EDBA 1T89C 1YEDA 1YPZF 4W6WB 4NQXB 3MRJA 3OF6A 4YHMH 4AIOA 1KUMA 1U8QB 1MNUL 3TBTA 3S5LG 2C3GA 4GRMB 1MOEA 3MRHA 1B0GA 3TJEL 5D2LA 2ZWLT 4QHLB 2VKWA 4GLRI 3ZKXC 4X8XA 3B43A 4GXVH 3MR9A 4AG4L 1PAMA 4DGIL 3F12A 4RSVA 4YHZL 4PJBA 3FHAA 3P4MB 2BOCB 4B41A 2OZ4H 5HVGB 1XEDA 2XKSA 2H9GA 3L1OL 1HYSD 4LKCA 4CADA 4X9IA 5AZ2L 1MHHB 1WC7A 1YEFH 4CVWA 4ZXBA 1JYNA 3WN5C 3CH8A 4HIXL 1ORSB 1XIWD 4YXLL 5J3HC 4ALAH 4UIKL 2E7MA 5EC2B 2OTWB 3ZLQC 4U6YA 4BH7A 5CZXC 1JPGA 3MLXH 3C2AH 4XAKD 3L9RA 2A74B 3OKOB 1JVKA 5EG6C 4NZTH 2MCPL 4KZEL 1YUHB 4O2FA 3MUHL 2MWCA 3RWHB 1XGTB 2XXMB 1L0YA 2R23B 5B39A 4OIBA 2A6DB 4OV5B 1DN0B 3CUPB 2BY2A 4RZCB 4WDIA 3MSPA 4GG6B 3EZ8A 2D0GA 1U95B 3CAFA 2XV6B 4HWUA 3HNTL 4XVTH 4FN0A 2VXQL 4OTXL 3RDTA 4XGZA 1AO7E 2XRAH 2C26A 4JRWA 3QEQE 1M05B 1MRFL 2G75A 3QUKA 4P2RE 1ZEAH 5C0RL 3LZFH 1I3GL 2AI0H 3V52L 3WUWB 4JFFE 4NQVA 1IAKB 2H26B 3KPOB 1ZGLA 1KBGH 5K93A 2X4TA 1TTGA 4MCYA 2BCKB 5EULV 4OCWL 2QQLL 4QF1B 3V79C 1LEIA 1W72A 4YBLC 1A6AB 1A5FL 5TFSL 1ZXQA 4DZBA 5E8DL 4LCIL 2JB6A 3QUMH 2PR4H 3OJDA 2FDBP 4E41A 2PCPB 1AQDA 3S6CA 3QXDB 1FO0B 4KAQL 2YEZA 3QULA 4Q2ZA 1S9VA 1YEHL 4HMDA 3PL6A 4H1LB 3ARQA 1CYGA 5EO9A 1M7IA 3PWVA 1MAKA 4D0BB 1MVUB 4WO4A 1FNSH 3GMQB 3UAJD 4K3GA 1SHMA 2ICEA 2GUOA 4HEME 3BZFB 3MCKB 2WV3A 4QTHA 3OKMB 1IGCL 2CDFB 4CKVX 4U3CA 4MXVE 4TUKH 2LU7A 5EO1A 3EOBB 4JO1H 4RGNC 4NO0B 4CL7A 1YYLH 2Z31C 2J88H 5HVHC 1CDJA 4N0FA 4Y89A 4YC2B 1YEJH 1M1SA 1HOCB 2HLAB 2CDGB 3D3VB 1LK3L 4O2EB 5JDSB 4TSCH 3UYOD 1QRNE 1D5MA 4WWKD 5HYQB 3IJSA 3TP4A 4MJ5B 5IEHB 1T7VA 2OLDA 5A40E 3NZ8B 4IMLA 1AO7B 5ICYB 5F72S 2VAAB 1ND0B 4P2RB 4ENEC 5CJXA 5B8CC 4XBPA 4YGVB 4JFFD 5DVKA 3PABA 3JBG7 4JN1H 4O5LH 1PQZA 2BFVH 2HKHL 3HMXL 3SBWC 4AJ0A 4Z7UE 3O2DH 3R8QA 4X4MA 5E2VH 4MD4A 3IDNB 1RZIA 2VH5H 1FV1A 4RAVB 3E2HC 3QCVH 1GPOH 2GHWB 3OTTA 1ZVHA 4MQXC 1OAUH 1CXLA 1OY3B 4Z7OE 4D94A 4OLUL 1KG0B 4QTIH 3ZTNH 2X41A 4S2SB 3VFPB 4QGYA 1JGLL 1KELL 4NQDB 2GFBB 1B0RA 3HRZB 1CBVL 4Y5VC 3NCMA 3HZMA 4R26L 3IU4L 1MCPH 3VWKA 4MDJB 4Y88A 2IH3A 4PG9B 1IC5L 4G80A 4X9HA 5T1KD 2AJSL 5FUZH 4KHTL 3D69A 3W0WB 3UBXG 4GKNA 5MI0C 3I02B 5CAYB 1SBSH 1QRND 2HH0H 1I3RA 3CFJA 3KYOA 4UUJB 2VC2H 4LQFL 4MVBD 4POZC 1G1CA 1ZT4A 2B7DT 3BO8B 1NUFA 2X70A 2X4NA 3TBTB 3FB5A 3ESUF 1TENA 1BJ1H 3HC3L 4GBXD 5D2LB 3AY4A 3D2UD 4GOSA 3HAEA 1RZ8B 1SEBA 2EKSB 1AGEA 2APVA 1I85C 4WFGE 4NQSA 3GJEA 4OZGE 4BSWB 3EJZD 4MJ2A 1PBYA 4KC3B 1VACB 5SWQA 5ELIA 1IE5A 5KVMC 2NYYD 4YHLL 4NJ9H 4IEFB 4D9RD 5D5ME 3BESR 5ADPL 1E4KA 4JPVH 4OLWL 3CCHA 1DDHB 1JK8B 1IAOA 3T2OA 2WBWB 5JIKA 1A6TA 1S78C 3W2DH 5HTSA 2D9CA 3I6LD 4ZXBC 5J56B 2PO6B 4Y19B 5IB2A 1U8NB 3X12B 4WY7L 1KJ3H 3L3DA 4O2FB 4P3DA 25C8L 3MLTA 4GW5B 3NAAH 4JY4A 1FPTH 5ACZB 4EVNA 2MOVA 5CILH 2Q8BL 2XFXA 5BO1L 1FRGL 3CVHA 4RISL 3H3PL 3RAJL 2HKFH 1F3JB 3QUKB 1QBLL 2P42B 4FQXC 4K7PL 3RWIB 2RCSL 1S5HA 3TBYB 2JK5A 3TYFA 5JMRA 5D96C 1E6OH 3RDTC 5E6IB 4IBLT 1UJ3C 2CKBA 4BZ1H 4OLEA 1D5XA 1INEH 2VZOA 2AAVA 5KSVA 2AEPH 4FHBD 3F7RA 1I9IH 4J6RL 4M1DH 4MSWA 4FQCH 3QDJA 3N1QC 3H6JA 2FO4B 4GT7A 4HEPG 4G6AC 4WFGD 5HJ3A 2YEZB 4UTBL 2HFGL 2R0ZH 3PL6B 1BZQK 3QUXB 5I73C 5J7CC 4P49A 5IK3B 1HSBB 5FCUH 3FFCD 1WBYB 4NDMB 4EI5B 4LVEA 3VD7A 1VFMA 2YD3A 4I5BA 3W11D 5D5MB 1CK0L 2JCCE 1NGZB 1OAKH 4WO4C 1AE6L 4K3JH 1MAMH 1OP5H 3MV11 3GMLA 1W72H 4KJQD 4FQJH 1YY8A 5FM8A 1C08A 1SJVA 1S9YB 1QQDA 1RJYA 2AEQH 3GIZL 5INCA 3REVB 4OLYH 4JPIA 4XHJC 3ARGA 1JGEA 1MJ8L 5D1XB 5CEXA 1UYWL 4KKBD 5DC9B 1D5MB 2IH1A 4HGMA 4PP2B 3LHPL 4QYOB 5GRVK 3DRQB 1JNHA 2KPNA 5EPMA 4P48A 5GGQL 5GSVA 1R3KA 5F7UA 4GSDL 1NC4A 5DURB 1DL7L 3IVKA 2OS7A 3AXLA 4JFYA 1D9KA 3RGVA 3V8OA 3VFOA 1KTLB 2D7PA 1MFAL 2NR6D 2I60H 1FH5H 5C07D 5FAAA 3UPRB 5CJXC 3FN0L 4LLDB 3BE1H 5JMOC 3VXOB 4OCNC 4FQLH 3ROOA 3UC0H 1M7XA 1KJVA 4BKLB 4LAQH 2YD4A