2E9JA

Solution structure of the 14th filamin domain from human filamin-b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
GSSGSSGRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 14th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Filamin-B
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2e9jA01
4ODSL 4PJXE 2G2RB 2XA8H 4G6FD 3QIWD 2FIKB 3QQ3B 4DUVA 5LGHL 3JV6A 3O11A 4OIIH 4FTVB 5EZJB 4WHYH 4P5KB 3W9DA 1OLZA 2XTJD 4DZ8A 4YO0B 5EOQL 1N4XL 2E6PA 5IW6B 2AERT 2NR6D 4YNYA 1E6OH 3WFCH 2QSCH 3D1MC 4S2SB 2CLVB 1QOKA 5E8NA 2X4QA 1X5XA 4RFNC 2IAMC 4WWKC 2R0WL 3MRBB 4HK3N 4M43L 4DZBB 2E7HA 4Z7VA 4DAGH 1H5BB 3C2AH 4NJAH 2Y36H 3G04B 3L5XH 3U2SA 5E0QA 4I2XB 4HXAH 3RVXC 4AZ8A 3B9KC 3DX7B 2OS7A 4UILL 4WI5A 4AMKL 4HZLB 5J1SC 2YPLD 4RQQB 4ZXBC 3I2CL 3U2SB 1S8DB 4XHQA 5F8RC 4FMKA 1GGYA 4ODWB 4ZS7L 1J0JA 3MLSH 3C6SB 5CEXA 5JXEC 4IRSC 4QNPE 5GZOD 2VQ1B 1KNOB 4PJBB 1BX2B 1KIQA 3VXTB 4YDJB 5FGBA 5CJOL 2WP3O 4MNQE 1XIWA 1E4WH 5HXMA 2X4NB 4YZFF 2R1WA 3QEHB 4OCWL 5I74C 4LVHC 4QRSA 5DJDA 1G7JB 4TVSa 2ED9A 4DVBB 4J8RA 1NUNB 1FNSH 1PDKA 4JQXA 5JW4R 2BNQE 4R3SB 3VD9A 3X12A 2ZCLH 2CK0H 2XICA 1CTOA 1E4XH 3LH2H 1DQLH 5F7EH 2ZCKL 3BDYH 3QUKA 1AQDB 3NH7H 5AWNL 1F4AA 2VDNH 1YNKH 4M6AA 3M07A 4TOYL 4GO6B 5C0CB 5HYSB 2CJUL 4WO4A 4PJAF 2CQVA 1AJ7L 4OFDA 3L5WB 3NIFE 3JZ7A 1PZUB 3SGJC 3WHXA 1U6AL 2ZPKL 3LN9A 2XPGB 4ZFZA 3ARGB 4HWBH 4PJ5D 2HT2D 3MODH 1XGRA 4AEFA 1ETZB 5FYLD 4QRRA 2VABB 1NCBL 5C08A 3VFVB 1CGSH 3JV6B 4N8CL 3IAQA 4Q7DA 1AH1A 1CIUA 2OL3H 3GIZH 5F9OH 4Y5XC 4ZUVA 5C0RH 2VAJA 5CINH 1NMAL 4WFHE 1YC7A 4E5XB 2XNAB 1VFAB 1JN6A 2EDOA 4FFYH 1TCRA 4OGXL 1T0NA 3THMH 2GKIA 3VFSA 4NHCH 2MKWA 3HUJB 3NCYP 1G7MB 2VL4A 4GW5A 5L6YH 3UZVB 3B8YA 1EO7A 2Y9RT 3GSOB 3AU1B 3FO0L 4OKVB 2WWMC 4YR6A 3REVA 1R3JB 1I4FA 2DQGH 1MNUH 1PLGL 4HMEA 4L4TA 4G7VL 5JXED 4QHKI 2BCKB 4Y4KD 3FQNB 4M62L 2Z8WC 1I4FB 3NACH 4OUUA 4XWOC 4HKBB 5K9JH 4ERSH 2UWEA 1X5FA 5L0QB 2B0SH 1YN7B 1H8SA 4IRSD 3H7BB 4PJBF 4XRCB 5EOTA 1N0XL 4U3CA 1R5VB 1MSPA 4KMLB 5FO8A 4TULL 4ZFFB 2Y7QA 3ZO0A 3PGDB 5F71A 4KI1A 4JG0H 3K4DA 3N85L 5HGAA 5BRZE 4LPVA 2D7PA 1M71B 4NO3B 5EU4B 2VR9A 4LLDA 4PJ9D 4PRIA 3RWFA 2EIDA 5E4EC 1AGDA 2AJXH 1EEQA 4O2FB 2I5YL 4JQIL 2AVGA 1R0AL 1KIUA 3IDXL 1I3GL 5IP4A 4EOWL 5EU7C 4D3CL 2R2EB 5IM7A 1YEKL 5D7JD 5INCB 4MXQC 5DHVH 1JHTB 1S9YA 5ILTH 4YUEH 2H2PC 4X7TB 5IM7B 4LSPL 2YA1A 4RFOL 3V5DA 4ZFGH 3DVFA 4GJTB 4NKDB 4ZFZB 3MFGB 1O7SA 1TNMA 2CIKA 5ELIA 3VXMA 3G6JF 2EE6A 4UU9A 1IEBB 2W07A 1DUZA 1A9EB 1W0VA 4G7VH 3VXSE 4APQB 1LO2L 2ZNXA 5CJOH 1V3MA 3CDFA 3IXTB 1C08A 2R29L 4KDVA 4YBLC 5E2UH 4IIQB 1IEBA 3DSFH 4WWKA 2APFA 1H3UA 2AXFA 1YYML 4CMHC 3TZVB 3UJTL 4U6YA 4G9FE 1CR9L 2APWA 1QP1A 2NY0C 5KW9H 4NHUB 5F7UA 3IXAA 2J5LB 3CDGB 3MOAL 1OAKH 3OPZL 4WFGE 1T83C 2C3HA 4I77H 4NNXA 5I1KL 4HJGA 4GMSH 1P9MC 1VA9A 3D85D 2PO6B 1VCAA 4FQXB 3B5TA 1ZT1B 4S1RL 2O5XH 2QBWA 4G8IA 2HJKA 2R8SH 3F7YA 2XWTB 2ITDA 5EO0A 5GGQH 1NBVH 3TF7C 4GMTL 1DZBA 4HWBL 5HYJB 2JB5H 4MA8L 1MVFA 3MLYH 2GCYB 2W91A 4ZTOL 4Y1AA 1HQRB 1JK8B 2FJFB 5IB2A 3OX8A 3FO2B 3S36H 5IESL 5KVFH 3OKLB 3EGSB 1WWCA 2ESVE 2X4RA 4JCMA 5GGVH 1PKQE 4Y4FB 1IGYB 3BKCH 4KKBD 2FDBP 4OZFB 2I26N 1CXIA 1YMHB 1MLCA 2ZUSA 3U7WH 4L8DB 4UB0L 4R90L 1OM3H 3B6SA 2FH8A 3H9SE 2X70A 3U46A 4LLDB 1DP0A 3T77A 2IG2L 1NGWA 3ARDB 4HHAB 2PCPB 5D9SB 3MV7B 3TVMC 4MJ5B 4ESKA 3DRTB 3BFOA 2X41A 5I16A 3QQ4B 4U1GB 4KRPB 4XBEH 5JPMB 1QQDA 2GT9B 2IAND 2PR4L 2NX5A 5D6CA 1NGPH 1F11B 1V3KA 4MDIA 5IVZA 3MRPB 1QRND 3T2OA 3HPJA 5HGGS 4I0PC 1XH3A 4Y5XA 1UJ3B 2BVUA 1MHPL 4NYLA 1QA9B 2NY4B 2ZCHH 4U0QB 4APQA 4YHLL 3ARPA 4X6FB 1OSPH 4EOWH 1Y6NR 2QR0B 2XG4A 5CJBA 1AXTH 5D2NA 2XTLA 4NUJB 5JXAL 4GUPB 1IVLA 1KJVA 4LSRH 3SDDD 1A1NB 3K1DA 4TVPD 1ZGLB 3WS3B 4HD9A 2HTKD 3SKNA 4OCRL 5ANMA 5JOPD 2PYFA 3WUZA 1E28A 3BKYH 1U8PB 3KJ6H 4WI2A 3RKDC 3U6RA 5HHPA 3KYOA 1R5IA 1T5WA 1IGTA 5HJ3A 1QSEE 4WI8A 4X7FC 4LF3A 1I8LC 1B0WA 3SCMC 5IBTL 2MPAH 2HWZH 4KJPC 3IDNB 3KYOB 3OGOE 2VWEE 5E5MA 2GI7A 2HLFC 3EDJA 1DUYB 4ZUSB 3WBDA 1ZT7B 5C0FB 3DECA 5T3ZL 4S1DD 4DUXA 4FABH 1AY1L 3S34L 4M3JA 1X4XA 4M6NL 4TVPE 3IT8D 4X99A 1ZT7A 1RK1A 4WEUD 5C0FA 3V0AC 1L0YA 4POUB 5L2JB 4EBQL 5MEOB 5HYJD 2CDEA 2HKHL 4KY1H 5FYKU 4Q0XL 1NANI 4M9OA 1A4KA 1HHGB 2YD6A 1D5BB 1EXUA 2YOCA 4OZIB 3DBXB 4XCEB 3ULVL 1JGVL 1BQHG 5CFHA 2QSQA 3GJFA 1MHHA 4C57C 2EDYA 3DXAA 5GGSA 1RUPL 1DE4A 1OT2A 3G6JE 4P2YA 5DVNA 5C0AD 4OAWA 3HZMA 3KDMB 1GCFA 3CK0H 4NN7C 4UT9H 3UDWC 2Q76B 1H15A 4A2LA 4OT1L 2IQ9H 2W60A 3PP4H 4PRNB 2PW2B 1U6AH 3ARVA 4B50A 2CXGA 3RPKA 3QUYC 3B2VL 5TDPB 2H2SC 3RY6A 5IMOB 1HHJA 2PW1B 1CD1A 4LSTH 2BVOB 1M4KA 4XTRD 2J12B 4HIEA 3CC5A 4PV8A 3PWNB 4EI6A 2ZCKH 3ALPA 3BDYL 3D2UB 3IDUA 1IC4L 5I1IH 3L6FA 4S1SH 3A6BH 1YYLL 1I9RH 1QSEB 3N1GC 4HIEB 1J1XH 3WFBL 2V2TA 3VD5A 3TLRA 3LPGA 5GZND 4MZ2A 4KKAD 5DC0A 4JFFE 4QXGH 1LE5B 4WEBL 4MD4A 1YMMA 1U8PA 5HHPB 3U6RB 1FVDA 5JHLL 3MRQA 4MB3A 2IBZY 2GITA 1KFAL 5ERWB 4JM2C 2OL3B 4OLUH 4CNIA 4HIIA 4ZUUA 4F7TB 2IADA 4M7LT 1J1PH 2GFBB 3LQAL 1K2DB 3QI9B 1Z6JT 3DX8B 4JCLA 3REWA 2H26A 1MELA 2R2HA 1P84K 3EO0B 4TN9A 5LXGL 3SDAD 3I84A 2E9JA 1LEKB 4G6ML 1ND0B 3MLTA 5BRZB 4KKCC 4UTAH 3IKCA 4KPHL 5CBEB 4OLWL 4TTDD 3QNYB 3KWWB 1F3JB 1FL3B 1WBXA 4NJAL 4PJ9A 4PRID 5ISZD 1OSZB 1T20A 4X98A 4OD2A 4KJYB 4F58L 5B3JE 5E6IC 4Y5YA 1LWRA 3L3OB 1D5IH 2VSCA 3ZHKA 4JY5H 4TVPL 3SDYL 1PSKL 2BSTB 3V7AG 5F93C 4PJCB 2P1YA 1R5WA 3HFML 3RU8H 2BSTA 2CLVA 1PYWA 2VC2L 3EUUA 5F21B 2IG2H 4NUGL 2OSLB 4J12A 1J8KA 1N7ML 1S7XA 3TIDA 3WV0A 2EEAA 4KTDL 3SDXB 3SY0B 4J4PA 1RIHH 4XXDA 4F9PC 1GZQB 4CJ0A 1U8QA 4X8JB 1HHIA 2CKBB 1T7YA 4X7SL 3H3KA 4QF1B 1F3DJ 1JZ2A 1CCZA 1BIIA 3E6FA 1WIPA 3F8UB 3QUYD 3B5HA 1GHFL 3LZFL 5DRZA 2DS4A 3FHAA 4XP4L 5K9QG 5CHNA 4GLRH 4R9HA 4ZNCD 4G5ZH 2Y07H 2CMRH 5DHVB 3O2DH 1CK0H 2V9TA 3ARGA 5AZ2H 3PQYA 2X1WL 4XVJH 2GW5A 2DN7A 4YZFE 5AZEL 3OKMB 4ODXA 2H41A 5MEPA 4X6BA 2H3NB 3KPOA 3ULUD 3GK8L 1JPGA 5E8DH 5EOCJ 1SY6H 4ODXB 3E3QC 4Q9RH 1OTUD 2HJLA 5F96L 4XPHH 4XPBH 2HMID 3B9AA 4M1DL 1P7QD 1NEZB 4WRLA 4LLMA 5F9JB 4HWEL 3GO1L 5FECA 3VFUB 35C8L 1EAPB 1IM9A 3IDIB 3V4PL 3WNOA 1FPTH 3NA9L 4GW5B 2YUWA 3B43A 1T1WA 3IDIA 3RVVD 1IM9D 1XCTA 1LEKA 1WZ1H 4PJFE 5E2WH 5D7IA 4KUZL 2C7UA 1WFUA 3QA3A 2WM0A 5KSUA 4KK5C 1Q9OB 4OCXH 4QRRB 3EOYG 3H9ZA 4ZFGL 3Q6GL 4LAQH 1NQBA 3NPZB 2EIZA 5GIRB 1T1YA 3F7VB 5JZ7D 4CDHA 2JJTC 2VDLL 2WBJA 1P5UA 2EYSB 4MNQA 4NO5B 4YC2C 4ZOCA 4GSDH 4PJCA 4ZFOB 1LO0L 4L3AA 5M94B 1G9MH 4FQQB 4PJXF 5K9QI 3QPXH 3GB7A 3Q5TA 1INEH 3QULA 5CEZL 4MB5A 4F7EB 7FABL 4H1LH 3MUHL 4LCUB 1JVKA 5TQ2H 2DOCA 2V5TA 3LMJL 4M48L 4TYUA 5SWQB 3QFDB 3VJ6B 4QNPF 4UIMB 1BWMA 2VQUA 5J1TC 3KHOA 4RA3A 5JUEH 1ADQA 4FQIH 1JL8A 5ESAA 2AGJL 3MGOB 3DX7A 2BMKB 4GW4B 4RQQA 2LAAA 4MA3B 3ARGC 1S7TA 2UWEB 5FGRA 3I6LD 1FH5L 1EFXD 1UWGL 2A1WL 1CN4A 4PJ7E 2BMKA 4GW4A 5L2KB 1RMFL 4S0SD 1RUML 3VDCA 3MLPA 3P0VL 4R96A 2EIBA 3VXMB 3GSUB 1OGTB 5E00B 1KNOA 4F57L 3BP6B 5EOCL 4L4VB 1FZOA 2KPNA 1OAQL 4MNGB 1CDUA 3PDGA 2F53A 5DD6B 5D71L 1JTPA 3CFJB 3U82B 3ZSTA 1T3FB 2VDOH 4PJIB 4M9PA 4LAJH 4OQTH 2Q8BH 4LSSH 1CVRA 5D8JH 3O3BB 3C08L 4OI9A 2FR4A 3AY4C 3SDAA 1HNFA 5I1HH 3WXWL 4ODTL 2W0FA 1JHTA 1S9YB 5D7SH 4E9LA 3I3EA 5IQ7H 5C07E 4YDLC 1S7QB 3LQAH 2GY7B 1YEFH 1N5YL 3OZ9L 4GRLD 3WUWG 1PD6A 5GQBA 3QUZB 3FFCD 4OFIA 1X4ZA 2JELL 4OD3H 3BE1L 2QHRL 3NCJH 2DYPD 1DUZB 3QUZA 3MV8D 4UT7L 1RVFH 3ARXA 3H2WA 1VFBB 2GK2A 3ULUC 3NZHL 3MRDB 3IVKA 1KELH 1RIVL 2HVKA 4U1JB 4NQEE 3QUMH 3GMLB 2YUVA 2F5AH 3IVKB 3V6ZB 4OFPA 3U4AA 4AM0B 5T5FH 1ZA3A 4XBGA 2ZCHL 3IXAB 2OMNA 4QXUL 5HI4C 4YXLH 4LCYA 5HDQL 2CKNA 5TQ2L 1NH6A 3MA9H 1R24B 4EDWL 2R0ZH 2BNRE 4K7PY 1MHCA 1IC5H 1EDQA 2GTZB 4FZEH 4ZMAT 3N85H 3WXVL 1JWSB 2H9GB 1GAFL 4JY6B 1EJOL 3ULSB 2DQUL 4OT1H 4G8IB 5C0GB 2XIDA 1OAYL 5DO2D 5D1ZD 3MROA 5BXFA 3OZ9H 1X5JA 1ZHKA 2HVJA 4HS8H 1Q9WA 4I1NB 1JHLH 4X8XA 4J7RA 4XP9H 1TETH 1SYVB 1JNHA 1YPZA 4G8GA 1XT5A 2VXSH 1A47A 4FQPA 4XPAL 4MNQD 2HG5A 1KN2L 2SEBB 5MENA 1IGML 3RZWA 4RWHA 5BZDA 2FYYB 3QFJE 4POZD 3BVNA 5IWLC 4X5WB 5FDWB 5I1LA 15C8H 4H0GA 2BJMH 4V1DB 3LKRB 2H32H 5EOTB 3S36L 5IESH 2BFVH 5KVFL 4QRRD 4QXTB 3RTQA 3S96A 3VXQB 2R0KL 1A1OB 1F6LL 1JBJA 5IQ7L 1UH2A 3HE6D 4NC0B 1TVDA 1HQ4A 1PY9A 1JNLH 4C4KO 3GMMA 3K81A 4R97C 1F8TL 4MB4A 1UB5B 1AGDB 4L3EE 4PR5B 1S7SB 3OHXB 1M7DA 4RBPK 5DFVD 4PJXB 2EIEA 4C58B 2P46B 2PYEA 3IU4H 1U8HB 4ZOAA 4KGJA 4BH8A 3G6JA 5GHWL 1MRDH 1A9BB 3BQUD 4P9MH 3QNXB 3SKOA 1UYWL 1TPXC 2X7LA 1ZHBB 5F8QC 3PL6D 3RNKB 1DJSA 3MV9E 4ZUWA 5GS1C 1OAYH 5EU5A 4Z0XA 4HUVB 2OR9L 5HI3D 3LEXA 3FRPA 4JFED 3V52L 4L8SC 1P4LB 2UVFA 5L8LB 4GQPH 3F7RA 5EU3B 5JMOC 4N0CD 1RURL 2VE6B 4FNLH 4X6CA 3ARFA 3FQWB 2MFNA 1I1AB 3QO1B 1E27B 4R4NC 5JUEL 1DQLL 1R3KA 3ZDZF 1FIGH 4U7SA 1AD9A 5F1NB 4HMDA 4HPYH 2JB6A 4AK1A 2R69L 1QSFE 1JWSA 4KK8D 1QSFD 1GGIL 2PXYA 2AJZA 2IC2A 3BKJL 4KUZH 5TE4L 3TP4A 5H35B 1B90A 4JKLA 4XWGL 2WBJD 5T3XL 4QGTA 4DGVL 3L95A 1M6OB 1NL0L 2R1XA 5KVDL 4OJFL 3UTOA 2HRPH 4NBYB 5TF0A 3FJTA 3GSQB 1KB5L 1RZGB 3AB0C 1KPRA 2BVOA 2JCCB 2NR6C 1XF4B 3PGCA 5HYSG 1SY6L 1I8IB 1EV2E 3S96B 5DEGA 5GS0D 3VFGL 3HNTH 5IROA 4LSUL 4WEMB 4X6DF 4DN4H 1V7NL 4L8DA 1FO0L 1XF5B 3GMMB 1MCCA 1GPOL 5DJYB 3BXNA 3FKUS 4Y88A 1C5CL 5SWSB 2AK1L 5HVWA 4HHAA 1MCWM 5EOCH 3OHXA 1CE6A 4XZUA 2WUBH 4QTIL 4QRUA 4MS8D 4MDJB 4TUJB 2FX8H 1BVZA 3P2TA 1JWMB 5C9JB 3P4OB 1IMHC 2HT3C 4ZQKA 4XZUB 1J8HD 4HIIB 2LV4A 2R56L 1LK3L 4PTTB 5IVXB 2OK0L 4RMUA 2OXGA 4JFEE 1OL0A 1FYHB 5IIEB 1H9VA 1RJZB 1SJEB 3QDGA 2J5LC 4Y2OA 3SDDB 1C16A 3CVHH 4ZODA 5CBEA 5FIEA 5KVMC 3L6FB 2M26A 4XP4H 2VDQH 3PF2A 2XZQL 4PJ8A 1J0KA 1HYSC 3LY6A 5KS9E 2XV6B 3CSBA 1T66C 3IDJB 1JGLL 3B9KB 2ZG2A 3KPPA 4L9LC 1T0PB 4L5FH 4OZHB 5KVEL 2D0GA 5CWSA 3IDJA 1GGIH 1MREH 1XF3A 3ZKXB 5ISZA 1A14L 3V6FB 4QCIA 2DQHH 3ZDXF 5JIKA 1UB6B 4XVUC 1A7PL 3ZKXC 1FO0B 3VFOA 4K07A 1G0YR 2ZKHH 4NBZB 3EO0A 4DN3L 3RPIB 3WS6C 5AUMB 2ARJA 3SGJA 43C9A 4ONFH 4Y19D 4YHNB 1OQXA 3C6LB 4XB7A 3RWDA 3FT4A 4ONGH 1X5ZA 3RY5A 3C6LA 2AJSL 3GSQA 4M93C 4DGIL 5C0BB 4OLXH 3RGVC 2R4RH 4LCCA 4UOW0 1XF4A 4XPGL 3DVGB 2LU3A 3S5LA 3MCLL 3P9LB 2I60H 5CJXA 1ACYH 3ZL4L 4JHWH 4YPGB 4BQ9A 1QKZH 5I8OL 3BZ4B 3DYPA 4JRWA 1EJ6A 5B39B 3ZT7A 4U6HA 2JJVA 4JPKH 3KPQB 3TO4B 4L29A 1U8JB 5D4QA 3SCMA 3VFRB 1N59B 2LVEA 2P5WE 2VDRL 5D1ZC 5GJTL 1KV3A 1CT8B 1AJ7H 4NRXB 4UQ2B 4U49A 5I8EA 1A6PA 2DICA 3KLDA 4OF5A 4WW2A 1NCWH 4WHDA 4QRRE 1OCWL 3MJ9L 1KJ3H 2G60L 2HKFH 3MNVB 4G6AD 3MGTB 4MAYA 4MQXC 5I8EB 5M95B 3QG6B 4NNYA 3SKJH 5E8PA 2ERJB 15C8L 4WI9A 4N5EC 2DJUA 5ID0A 3SHSA 1D5MA 3D48R 4HC1L 3T4YA 1OY3B 5DUML 1A6AA 1U3JA 2XA8L 5E9DD 5D7LA 4YHYC 5SWZE 2YMXL 3KPOB 3AMLA 4WTZA 3BEVA 1ZA6A 1K4CA 4LHUA 3T4YB 1TQCC 5HDBE 2EYSA 3O6MH 4NO5A 4YO0A 1WFNA 5EWIH 1EIBA 4D0BB 1AFVH 3Q1SH 4R2GD 4JFQA 1MI5E 1QFWM 3SDYH 1JYXA 1GAFH 2AK4B 4B53A 5I66B 3F58L 2YD9A 5HYQA 3DUHA 5HD8C 4YJZL 3BH9B 5H37H 4ZTPH 1CQKA 4UIKH 4UNTA 5TE7H 1VACB 2GAZB 1JFQH 1I7ZB 2H32A 3QHZH 4YFLF 3PABB 3TV3H 4OCSH 4DAGL 5AD0B 5FYKD 5DTFB 1YEIL 3CLEH 3GNML 5EZOL 2F5AL 5INDA 1BQLH 2HKFL 3HUJE 5JIIA 4K94C 4TUKL 2IQAA 4YHKL 1J1PL 3E8UL 5ESQA 5FGBC 1JWUB 2VQ1A 3UAJC 4I18B 2A6IA 3K2UL 3PHQA 4LBEB 2G9HB 4JB9H 4R96B 4P2QB 1M7IA 4UT7H 4MNQB 1Q0XL 1U58B 4ETQB 3AS0A 3HLAA 1BD2B 1WT5A 3HR6A 3QUXC 3HC0B 4LFHD 4WY7L 2XYCA 1K6QL 1XR8B 2EDDA 2PXYC 1T3FA 3HG1A 4EQ3A 3CSGA 2J88L 3MXVH 1Z0MA 4HGWA 4CU7A 3TIDB 2A77L 4LMQE 3KPSA 32C2B 3O4LE 3QUKB 2DQCL 3I3DA 2E27H 5SWZA 4D9RE 5HGBA 2AK4E 1EH9A 4B0MM 1I9JL 2DBJA 1U8NB 3OKDB 5CJQH 3T65B 3JTTB 4WO4B 3TCLA 3V0VB 1T5XA 4HQQL 4QF1A 5FF6A 1LO2H 3HMXA 5DJ6B 3ULUL 2XTJC 2XPGA 3PXJA 4WGWB 1TZHA 3MLUL 4MQXD 4EXKA 3GMQA 2DM4A 3PIQA 4FZ8L 4HH9B 4YHLH 1FG2B 4LVOB 3FQRB 1AHWC 1ETZA 1F58H 2NXYB 3FCTA 3HAEH 4RFNB 1TETL 1EO8L 4N5ED 1VFBA 4MNGA 3VFVA 4X4MA 5IB5B 3UTTD 3ROLB 3OMZA 2EDEA 4XCFL 2NY0B 1OF2A 4M5YL 3MUJA 5ACLA 3M45A 3MNWA 3MFFA 5T1DH 4M3KB 2ZSVB 3VWKD 2EH7L 3GSRB 3SKJL 3WL9A 3WHE1 4PREA 4OV6F 2WMPA 3MNWB 5A2KH 1GGTA 4RX4A 3HUJA 3MV8A 5J57B 2H2SD 4ORGA 3O8XC 3G5XA 5D7JA 2IGFH 3TBTA 4UQ3B 1XGPA 4GMTH 1T22B 4M8QB 5KSAD 4OKVA 3VRLE 4GRLC 1PG7L 2WZPD 4JY6A 1Y18B 4I0KA 4KRPC 1FAIH 1T1WB 3S3SA 3RGVB 2N1KA 3C8KB 5INDB 4RISH 5KVGL 5DI8B 3QAZB 2W92A 5ITBH 2BSSB 4RSVA 1A3RH 3GUTB 3QA3B 4M62H 4HKBA 1SJXA 1FDLH 3CCHB 3F62A 2GSIA 3LS4H 4NQTA 5D2LF 1IGCL 3H8NA 4U1MB 2XFXB 4NZRH 4K3DL 3K4ZA 3WNLA 5KANI 4J3SA 4AG4L 4NRYA 1T1YB 1LEGA 4CAGA 4C56A 4LKXB 1RPQA 3D25A 3KPRB 4I48A 1RK0B 3GZKA 1F3DH 4NBXB 4P3DA 4F80A 4ZFOA 3QUXD 1M71A 4NO3A 5EU4A 3WEXB 1AI1H 3F7PC 4JZOA 1B0GB 1UCBL 5BCAA 1A6UL 1OAKL 1KPVA 2VDMH 4LCUA 5DJZA 5FHAH 4JLRB 32C2A 5SWZB 3MRRA 5DO2C 1U3HA 3IAPA 1QG3A 4HWEH 3RFZC 4FQCL 4I3GA 1TNNA 2ATKB 1G6RH 3T0XA 3T65A 3V8CA 3KPNB 1U3HB 1CTNA 1K5NA 4BSWB 1TJGH 3QEQB 4GRWF 1A9BA 3EJJX 5DK3A 1TZHB 3TYGL 1J8HB 1HZHH 2FEDD 1FVEB 5IHUL 1NEUA 2YRZA 4XVTL 5F7DA 1IAMA 4XH2A 3KLAB 4GH7B 2D7NA 2GEEA 2YUXA 1MPAL 5LWYL 2ZZUT 1QO3A 4LCWD 2Y4SA 3HE7A 2Q87A 4K7FB 1MFBL 1FZOB 2AJVH 4OBSA 1P4LA 3WD5H 4U6YB 1NCDL 4DK3A 3K0WA 3CFJA 4HJ0D 4MD5A 3GSRA 1I1AA 5J9PA 5ICYA 4I3SH 3QHZL 5FM4A 4HBQA 4WW2C 1KCLA 2X4OB 4M6ML 3LRGA 2VZTA 2QADD 3TA3A 3HMWL 4J3XA 2J8HA 1WJ3A 3M17B 1QVOB 1YN6A 5T33H 4JANB 3WHE0 3RU8L 1S7QA 3CXHJ 5KSAC 1MCPH 5HY9B 1WTLA 1FRGL 3CUPB 2XZQH 3OAYK 1GIGL 4QT5A 5KSAB 2DI8A 3VGHA 4MJ2A 4FS0A 5TE6H 3QEQE 1S9VB 5IHLB 3ILQC 5IW1B 2ZG3A 3OAUH 3QT2A 4U1MA 5D6DC 1UACL 3NFPB 2NLJA 5HI3C 2XFXA 5BRZD 3PWPA 3IFOB 4NO2B 2DQIH 4HXAL 3L3HB 5C0EB 4Y4FA 3BH8B 1UEYA 5FGCB 2FX7L 4KZDL 2VH5L 5FV2A 5IUSA 3FTGA 1AD9B 4UAOC 3MV11 1ZSDB 4OCLC 3UTQA 4M8VA 4Y2DD 4TSAL 2A83B 1W72L 1NBZA 3DV4A 3DSFL 3SGEI 2FSEA 1OAZH 3HE6B 2KZWA 3EFFB 2VDRH 3FB6B 3EYOB 4JJ5B 5EUOE 2ATKA 4JHAL 2NY1C 3ZSSA 5FYKL 1SQ2N 5KSVB 4EIZC 4RGMC 5F1SA 1F11A 4MDIB 3TPUB 4RISL 1BEYL 2WV3A 4PGCA 4JR9H 4YEEA 1EHXA 1NSNL 1KG0A 1AGEA 1ERNA 1BBJA 2A74A 1D9KB 4H26A 2BY3A 1U91A 1GIGH 4LQFH 4YNYB 4JKMA 3QDHA 3BP7A 3BZDA 5ANME 2DI7A 4X9FA 2O61A 1MCPL 1NFDA 5CD3A 2NY7H 5DJ8A 1U91B 3RZCD 2XA3A 2K7PA 3WLWD 4PJEA 4ZXBA 2O61B 4MMZC 1IBGH 3FFDA 5BMFH 4P46C 1A6ZB 2ZUQB 1H5BA 4LLUB 1HILA 5CGYD 4G7YL 5B8CB 5ISZE 3CFEA 3PWVB 3VDAA 2W65B 2BXZA 4DCQB 4MD5B 1P4BL 4V1DD 3IKKA 3N06B 5AWNH 4QXUH 2VDLH 5IF0B 4WHCA 1BVLA 3B3IA 2KUTA 1I7RA 4JGJA 1UB5A 2XXCB 3CK0L 4UT9L 1J1OH 3H3PL 5IF0A 3HZKB 1JYNA 2JCCE 3B3IB 4AT6A 4F3FB 3R06B 4R7DA 3AY4A 4IOFD 4YDJA 2Z31D 3VXOA 1FO0A 3V4UH 3C9NB 3QNXA 4UV4H 5F89A 4HW6A 4F58H 3RGHA 3ECBA 4X5LA 3N9GH 5F89B 3FFCA 1NAMH 2OLDA 3X3FL 1SBBA 4HX1A 3GGWB 1A7OH 3OGCA 3X12B 3MZGB 3D0LB 1X4YA 1IE5A 1TTGA 4PUBL 5EO9A 5MEOA 1IEAA 5IG7B 2IPKA 4FQ2H 4JO4H 3ARDC 2DJSA 5FHAL 1NGXA 3EDFA 4D2NA 1G9NC 4X6CB 3HMXH 4KHTL 5A43C 3LEVL 4MAUL 1T21A 2H2PD 1CGXA 3BGMB 5D71H 1QLEL 2B1HL 3KDMA 2F5BL 1NCBH 4Z5RA 5JW4N 2ZOLB 4U6HB 3ULVE 2EXYC 1Z5LA 3LPFA 3VG0H 3FMGL 3S7GA 4R2GB 2MTPA 5FUCC 3VXUB 1AE6H 1WLHA 4HV8A 1U8MB 2AV7A 3L5JA 4HPYL 1UVQB 1IGCH 2PYEE 1FH5H 3GI9L 2EECA 5MI0C 2GJJA 3NIFF 4HXBH 3FZUD 4XAWL 3STZB 3VFGH 5GSVB 1ZHLB 2AEQL 4OSUL 3T1FA 4JKWA 5DUBB 1GGUA 1INQA 2Y23A 5EN2A 2J4WH 5T1LB 12E8H 5T5FL 4XNUH 1G1YA 3VI4F 1OW0A 4GRMA 4LCIH 3SQBA 3QNZA 3WIHH 2NCMA 5DQDH 4HCRA 3PWVA 3PNWA 1CQYA 1IFHH 4AIZA 2PTTA 1INDH 3BSZL 3MLUH 2IBZX 3TO4A 3PNWB 4KRLB 3LHPH 3A0OA 4S1QL 3BXNB 1AHWA 1MH5B 4V1DE 3U4EA 3CZFB 1Q1JH 4OGYH 3X14A 5EC1B 1L6ZA 4HWZB 4ZD3L 3PWJB 4Y5YC 2FL5B 3VFTB 5GPRA 1DTUA 3MC0A 3CFKB 2NW2B 5EFIB 5LXGH 1HWGB 3I2CH 4YC2B 1DLFH 3UTZA 2Z4QA 4EUPB 5J0BA 4XMPL 5SX5H 3EHBD 1Q0YL 1F3JA 1FL3A 4PYHA 3EO1B 2FD6H 1FHGA 3P0GB 2VLMD 3OKEB 5B3JF 3RVXD 3HZVA 4J4PC 1VADB 4ZUTB 5KANG 4NQSA 3BKMH 2C3VA 4XCNA 4OF3A 2X1PA 4HUNB 4P2QA 1KB9J 5EPMB 5DMIL 2VXSL 3MJ6A 5F96H 3RIFF 5GJSL 3EJZC 1GL4B 1S78C 3INUH 2JKXA 3QPQD 3O6LL 4GMSL 2Z8RA 4GG8B 4JM2D 4HC1A 4N8VG 3ARBB 3TT1H 3SY0A 4KKNA 5F6IB 3TN0A 4DWHA 3CLFH 3E2HC 4IOIA 3WXVH 1MWAA 2BVYA 3A6CH 3C8DA 5ENWB 4A6YH 4EI5D 1IBGL 1IGJB 3DIFA 1U8NA 3OKDA 3E6FB 4EVNA 1G7HA 2NTFA 1DN0A 3PP4L 1CYGA 4OZGF 5ENWA 1NC2A 3ZTJG 1UJ3C 4O4YH 5CEZH 3AROA 4BQ6A 5GGTL 5JO5B 1EMTL 4HH9A 2BX5A 2D7MA 5E2TH 1F4XL 3L5HA 1CG9A 4L3CB 1K3IA 3FCTB 4UIKL 5TE7L 5KTEL 4LMQI 4LP4A 4OGZA 3V2AR 4AL8L 2UY7A 4K71B 3W11C 2DM3A 3RA7H 1N7MH 1KIPA 1X5YA 2GJ6E 1A22B 4PBXA 3MYJB 3CFBA 3RWHB 1EVUA 3PG2A 2HJLB 5E2VL 3SBWC 5I73C 2ITDB 3BPNB 4TNWK 1F6FB 3EZ8A 4BKLB 3LB6C 3G6AB 3LMJH 3DHMA 1I8MA 4LGSB 2MHAB 5I15L 2GHWB 1JRHL 4UV7L 3HCVB 4JDVA 5L9DL 3PWJA 2R15A 3PGFH 5GS2D 2ITCA 4RNRA 2IEPA 5LVEA 4EXPX 1T6WA 1UZ8B 1XR9B 3L5WA 3DYMA 1J88A 1FE8H 2YPVH 2DLFL 4IRSB 5JOFB 4YXKH 1I3RB 2EKSA 2P7TB 5DURB 1MCSA 1UENA 5C07B 1TIUA 3QUML 2N7BA 3QXAA 2GSIB 1IAIH 4JHZA 2F74B 4GAGL 4GKSB 4R0LB 3MRNA 3NCYS 4I8DA 5E9DA 3MRLB 1ZVHA 3BWUC 5A40E 1S78D 3NA9H 4KHTH 2A0LD 4YAQB 3ZL4H 4E5XA 1U0QA 3BD3A 5FHBL 1DQDL 1G1CA 4M1CC 3MRGB 4P57A 4R6UA 5FUOL 4AH2B 4RWYH 5F6HJ 5D7IE 4OV5A 1OQOA 5LJYH 5EZIH 2GY5A 3UTSD 1I1FB 5CIPH 3BPLC 4OM0H 4YK4B 1P84J 5D2NB 5KVDH 4O02L 4PJHF 1BD2E 2BVQA 4U1NB 4WI6A 5JZ7C 4H1LG 1F4YL 3C5JB 1YJDH 1NBYA 5FYJE 3PV6A 2BVQB 4WTZG 4TPRL 3P11H 5E2VH 5ICZB 2Z8VC 2JIXA 1CFVH 3LVEA 4LSDA 2B20A 2L0DA 3Q48A 4OZGA 3QDJA 3UZEA 1S7WA 1JJUA 2QL1A 2V7HB 4OGAC 1MCFA 4YFDB 1YUHB 1HYRC 1OVZA 4RMWA 5I2IB 5HHVH 1MIMH 3GI8H 3FHQA 1F4WL 3QI9C 2IALA 3K1KC 1C12A 2E9BA 2F53D 4PGDA 3OL2A 5L2JA 2K7QA 4L4TD 3B83A 3QEQA 2CDEB 1MI5A 1Q8MA 2R8SL 1MQKL 4JANA 4JFFB 4LLQA 1G9EA 4KKBC 3AS2A 4IRSA 4NKMA 1ZWIA 1K3ZA 1I75A 4AJ0A 1A3QA 5I1JH 2Q3AA 4LU5L 4PRHD 3WNKA 5CMAA 4HPOL 1BECA 4I77L 4LSUH 1CLZL 2X89D 3QB7C 2DKUA 1BWWA 3UTTA 4QKXB 5DA0B 3CVIH 3QDGD 4LEOA 4LEXH 3ROLA 2WUBL 2AXFB 4L8BA 4N0FB 4QTIH 3IFPB 1V05A 2ARJQ 3QJFB 4YWGH 2W60B 1IM3B 1RZJC 2HRLA 1Q9KA 4FFZL 4HLJA 3NN8B 1FYTB 2DF3A 4IRJD 4X4XB 2P5ED 4DGIH 2X4OA 5HHOD 1V7NH 3PXHA 3N9GL 5IJKC 1KJ2L 1VGEH 4Y8DC 4HS6B 4I0PD 2QSTA 2EDBA 4I4WB 4OV5B 2C1PB 8CGTA 1TVBB 1QEWA 2IANE 3U0PB 2P5WA 4MJ6A 2BHZA 4PY8J 5IMLA 1DLFL 3WNPA 1FZJA 3GJFH 5C0GA 5SWZD 5EBWB 4NQEA 5DD5L 1KENH 2KBGA 1FZJB 1KTKE 1J1XL 5C0ND 3VGDA 4W81A 4UAOB 3FO9B 1NBYB 1CS6A 5I71C 3PV6B 3U7AA 4LNVA 4IDLA 2W9EH 4JFEA 2AXGB 5DHYB 3OJMB 5GISL 4DOHB 4Q9CA 3DUUB 4P2OB 3QUMB 3VFWB 2Z91B 4TTGA 1TPXB 3HI6L 4PY7A 1CXEA 5F1KC 5J13B 3D39E 4JRYA 4DVRH 4FTVE 4RAVA 1BQUA 3BUYB 4X4ME 4QOKE 4P2OC 2FWOB 1OB1A 5GRXG 4S0TD 4EDWH 4IJ3C 4JG0L 3DWTA 3D25B 1JP5A 1T7VA 4P3DB 4Z7OF 4N0UB 3SDCD 3N1PC 3VE0A 1YPZE 1WT5C 4G8GE 4K9EC 1QHOA 5B38A 3TT3H 1BOGB 1SYSA 3RRQA 2X6MA 4UTBH 1MAML 2D0FA 5LQBL 3RVUD 3MBEB 4C54A 2ADGB 4PP2B 5H2BB 4ZO6A 1RIVH 1WBXB 3ZE2F 4J6RL 2OK0H 4PTUA 4BH8B 3HZKA 4L8SA 3D85B 1HOCA 3L3OA 5JHLH 2GT9A 4JM4H 2E7LA 2NY3B 1K5NB 5GGVY 4BSWA 4LCWA 1EO8H 1ZWIB 4GAGH 3HPJB 4R4BA 1XCQB 3MX0A 1M7XA 3A6BL 3LS4L 1YEIH 3CU1A 3GNMH 4GRWH 5E5UB 5JOEA 3FFDB 5EA0L 4N9GA 3JV4B 4OCSL 1A5FL 2FRGP 3FRUB 4D0DB 3WUWB 1QO3B 2M8XA 4Z7WB 3IFLL 1Q9LA 3RNQB 2VE6A 3T3MF 3GSWB 1QR1A 3OB8A 4P4KD 3L7FA 2Y36L 3FQWA 5KJRL 1AI1L 4DEPC 4LGRB 1IT9H 4M5ZL 3TVMB 3F58H 3BAEH 2UUDK 2X4PB 3MXWH 4JO1H 2M2DA 3QCVL 1BP3B 3G5VB 1S8DA 4DTGH 1CZ8L 5CHNB 1TVBA 1K6QH 2QEJA 2C4FU 3O4OB 5HHOE 2X4PA 1MEXL 4L1DA 3TA3B 4S1QH 4BK5A 1P1ZA 4Z95L 1L7IL 1QVOA 3C5SB 5C0NC 4CVXA 1KIQB 3P9MA 4JKPH 4CGTA 3NABH 3ECBB 1U8MA 5F1IB 5HYEA 2QLVB 2FGWL 4R26H 1L0QA 1Q94A 4GAJH 5KBNC 2FX9L 3MA9L 5ACZB 5L7XL 4TUKH 4KKAC 1EMTH 1LDPL 3BYYA 4JN1H 3ROOB 2Z0BA 4DVBA 1FYTE 4NN5B 1UM4L 1BFTA 3HC4L 2VLKB 1YEGL 3GSNL 2CDFA 5J6HB 7FABH 4A6YL 3ZE0F 5EZLA 2EE9A 2EDFA 5DGRA 1MCWW 1T21B 4HT1H 3GSVB 1GGBL 1XF5A 2D7QA 4Y7MA 3DXAE 4EDXA 4YDVB 2OI9B 1MHHB 4WDIA 5EH1A 1VKXA 3IU3B 2PTTB 4Z7UE 2ADGA 4PP2A 5TFSH 2UZXB 3MNZB 2CDGA 3QIWC 3ULVF 2APBA 1Z0NA 4XAKE 2LTQB 2JLLA 1FCCA 5CLTA 5C9JA 2B1HH 3KHQA 1KELL 1JNNL 1NCNA 5EC1A 5BO1L 1BBDL 2C9AA 2NY0D 4MCYB 2WBJB 3NACL 5J1AB 2FL5A 2ADJA 4DKDC 3RVWD 2I07A 4ODUA 1H3TA 4Z95H 5DUBA 5DJCA 3SBWA 3BD5A 5EIQA 3UTZB 3FQTB 5D6DA 5TDPA 4ZO7A 2G75A 4JRXD 4FQJH 3E8UH 3MLYL 5CIPB 5DRNB 4KK8C 5DSCA 5GS0C 1VSCA 4NHCL 1P4IL 2ZNWA 3L7FB 1MFAL 1QSEA 4QRQB 1HILB 2PTUA 3B9KA 3KPPB 3OAYH 4KQ4H 3V4UL 4ZTPL 4Q6YA 3STLB 2VKXA 4P4KB 4Y1AE 5TPWH 5D70H 1S7TB 1PEZA 5KVEH 3BESR 5E6YA 1I9EA 2X10A 4E0RA 4LSPH 1ORSB 4WUUA 4OFYD 1OGTA 1RIUL 2DQDH 3O4LA 5BS0A 1AXSB 3BT2L 3BEWB 4H1LA 4RMSA 2H1PH 1GHFH 4CU6A 5FO8B 2NY2C 4F7PB 4FG6D 1YECH 3FT4B 4EIGB 3E6HB 3QUXB 4I9WD 2R29H 5DT1L 2VLJB 4Z7WF 2FO4B 5EORL 4AEHL 1BFOA 2KQNA 4F15C 4YXLL 4UTBL 2CRZA 2AV1A 1MAKA 1DBAL 1CG9B 3A67L 4NPYB 2HFTA 1LP9E 3KGRA 5B3NA 3MBEC 25C8L 1UGNA 3O2DA 1A14H 2FGWH 1NC2D 4Z8FH 3RVVC 4ZPVA 4KFZC 5EO1B 4Y19B 4MAYC 5B39A 3FL7A 3H9SA 4P2QE 4XI5D 1PKQB 1S7XB 2BNRB 4G43A 4G6KH 3L5IA 1I8MB 2DTSA 5T1LD 1J9CT 1MRFH 1PKQA 1RUAH 1WWAX 4QHMA 4NRZA 1G7HB 3TCXA 4MCYA 4PJ5A 3LQAC 4M61A 3SGKA 1UZ8A 4DGYL 3RVWC 4MA7H 3VXPB 5C2BH 3D3VD 1IAIM 1NFIB 2LE9A 4NSKA 4WENB 5MEQA 3WFDH 1KB5A 3LRSA 2YD3A 3QR2A 3JVGA 5EA0H 1H3WM 3LN5A 2FECI 2R0WH 3C5ZA 1RZFH 3CZJA 5BZWB 1T04B 2XZCH 4HAGA 4YHML 4WEBH 1MQKH 4DKFL 4P9HH 5I6XC 3MQIA 4OFVA 4G9FB 4GBXD 2IH1A 3NAAL 3SQOL 3PL6B 3L7EB 1ZLSL 2DTML 1D5XA 1KBGH 5F6IC 5DWUH 4RZCB 2GYSA 4DN4L 3C09C 4E0RB 3BPOB 1HH6A 1OPGL 2NMSA 3HNTL 3AGVA 1AD0A 2M1KA 5KVGH 1HINH 3HNVH 4Y1AB 5JA9A 3AREB 1AXSA 2GUOB 4U1KB 3PABA 4YX2H 5D5MB 4HEPG 4J3VA 4G42A 1CGYA 1G7IA 3HKFA 3QUXA 1HIMH 3MV7D 3MUGA 1WBZB 5GS2H 2FO4A 2ZUUA 2YXFA 5I9QB 2FHBA 2KQMA 2BRRH 3SOBL 3SKMA 4P4RA 1M7IB 1G7PB 5EUOB 4Y4KB 3RWGB 4S10A 2MKLC 2FJGB 1WEJL 2XY1A 2NZ9D 1FNLA 3I75A 5TDNA 1Y6KR 1WVZA 4OCNC 4X7EC 4HFUL 3WSQL 1UG9A 2JIXD 2D7OA 3SQOH 2P8PB 2G5BB 5ILTL 1MLBA 3JWDL 4IIQC 3VI4E 3JV5A 3WE6A 3Q3GB 2OR8A 1C08B 3D9AH 1QA9A 3RZCB 4UIMA 5MHSE 1C12B 5EG6C 3G5ZB 2PO6C 4LL9A 3DV6B 4KGLA 5CJQL 1Y0LB 4N8VB 1YY8B 1WZLA 4GAFB 4XP5L 5HGDA 1LO5A 3T4AA 5C0RL 3AS3A 1OP5H 5DMGD 1R3KB 3CDYA 4BFIA 5FUOH 1AO7E 2IPTH 4PJBA 5JO5A 5F9AC 1OTSD 2MPAL 3VXTA 1LE9B 2UZIL 1RUQH 3VW3H 1YNTA 3GJFK 1UM5L 4OD1L 3QEQD 3HI5H 2AJZB 1T1ZB 3F12B 2HJKB 1C5CH 4BZ1L 3QZWG 1KLUB 4IMLA 2AJSH 4J8RB 2JK5B 4HIHA 1EGJH 5K9OB 2R23B 4HG4K 3LPWA 2OJZH 3NN8A 5GS3A 3GBNH 4DW2H 1H3PH 4P3WA 2EDLA 2VERN 5E6ID 5L8KB 1Z9MA 4LCCC 5GGUA 1UKTA 1ONQB 3RY6C 2ED8A 2WWKO 4GQ9L 3JWDH 3U0PA 5E4EB 2DRUA 5ETUA 3SE4C 4KVCH 4JPWH 5C6TH 4NQDE 3ZHLA 5L7XH 3B6SB 4E41D 5CD5D 5SV3A 5E95B 4HKXA 3T0EA 4MGXA 1S5HB 4FXGB 4YE4H 5T3XH 4K2UL 1JF6A 5D9SA 5DDHB 5FM5M 4H20H 3VWJA 4JQVC 4JFOA 3TBWB 3TWCH 4NT6A 5TDOA 4R8WL 2NQCA 3H9YA 3CSPA 4UNVA 4LKXA 3C60C 3KPMB 2DKMA 4UDTB 4RAVB 2YZ8A 4L8CA 2O5ZL 4JRYD 3MRKB 3ULUH 1FIGL 4LNRA 4XNUL 1ZA3B 4XBGB 4JO3H 1JI1A 2BNQA 4OZHE 1OARL 1X5HA 4GW1A 4LDLB 2EO9A 2VAAB 4XMKH 1U93A 1R24A 1BOGA 1ITCA 1SYSB 4GW1B 1UM4H 3Q6FB 3AMKA 5EBWA 4JN1L 1EHLL 2X1QA 4KZEL 1CDIA 4IJ3B 4L8SB 4FFWD 5GGQL 1Y0LA 4N8VA 4PPTA 1BJ1H 5BXFB 5BV7H 4JFEB 1E28B 2XN9D 4I2XE 2Z91A 3WS6A 1MJ7H 1NGYA 1P5VA 4ZAKC 2DIAA 3IU4L 3RIAF 5E70A 2X4QB 4ODSH 4XPAH 1RJLB 1QFWL 4Y4FD 5KG9A 3MRQB 3QIBB 4XMPH 2I9TA 3NFNB 4NZUH 2R1YA 4P5TB 1EEYB 1T1ZA 2W9DH 3F12A 1FAIL 4Z7VB 4XNZC 4EN3B 3PGDA 1RJLA 4OZGB 4F33B 1UXSB 4WCYH 4F7TA 3GSWA 2Q7YB 1QR1B 3R1GL 1KIRA 3SJVB 1RZKC 5I0DA 4L3EB 3KNBB 3OB0K 5H2BA 4FOMA 3WJLC 1IC7L 1FLTX 4CADA 1TVHA 1LO3H 4XBEL 3VXSB 2BC4B 3Q5OA 4PJDB 4NWUL 4PJXA 1OSZA 4Y16B 4KTEL 2NXZD 1C5DA 4LCWB 4YQXL 1AR1C 4EI5A 5E6IB 4BZ2L 4NKIL 1E6OL 4XCEA 3WFCL 4DN3H 4U7KA 5KZCB 4JFFA 4TNWF 1A2YA 4RRPG 1QR4A 3VRIA 5LG1A 3R8BB 1H0DB 2YA0A 5IKCB 4R3SA 4XC3L 3ARFD 2VZVA 4B5EA 4HJ0C 3FB5A 1JGVH 4IIQA 5KN5A 5JDJA 5FGCE 4UDTA 1AQDA 3J7HA 1SJVA 2W1NA 4PV9A 4NRXA 5C7XL 2NY4C 4H25B 5DD0H 5CZVH 5EU3A 3V52H 1U8IB 5DEFA 4MCZB 3OV6A 2ARWA 1SEBA 5EZLB 4B7LA 1KJ3L 3L9RA 5HDQH 4MXVF 4XCCL 1E27A 1F00I 3MGTA 4MAYB 1U93B 2BSRB 2AK4D 4LEXL 1IGIH 3L3GA 1INEL 1U41A 3T3PF 4WDIB 5D8JL 3FB6A 5ID0B 2AJ3B 3DX6A 1GVIA 2VLLA 2ADIA 5GSRB 5ACMA 5FEBA 5HHNA 4HXBL 5I8KH 5C09A 1MJ7L 2DLHA 3I6KB 4LOUD 5A2LH 5C08E 2VUOA 4J3WA 1RUQL 2I27N 1QSVA 4LAQL 5C0IA 4H26B 5J1AA 3MV9D 1HNGA 1ZVSA 2ADJB 5CP7A 4PP1C 4RMTA 1MFEL 5TH2A 1NFDB 5CD3B 2VL5B 4XPGH 3DETD 5AG8A 3WCYA 4C56D 4P5MA 2WANA 4P99A 2XI9A 3MUZ1 5F9JA 3IRZA 4V2CB 4P3CL 5DRNA 3DGCR 1IM9B 5IV2B 3TV3L 1F4WH 1RZ8B 2VLRB 1JFQL 2BY1A 4EDXB 3ZYOA 4XPTL 2EDTA 5GGRY 4NDMA 5IV2A 2OBGA 3G04A 4DGYH 5B8CC 5B38B 1T1XB 3T0EC 4KI5E 5EBLA 5HI5C 2OQJB 1QSED 3I02B 5KSUB 4P23D 4JFYA 1KCVL 3OKKA 2HTKC 4L9DA 3O8XB 2Q86B 4AT6B 4WFGD 2CD0A 2G2RA 3TPKA 4Y16A 3MJ8B 4HH8A 5E94A 4NJ9L 1MJJB 1EJOH 4U0RC 4X7DC 3S88L 4L5FL 1UWGH 1ZGLP 2EXWC 4PB9L 5J06A 4X6CF 2ED7A 4DQOL 2CO6B 4W70A 4YE4L 1FGNH 4TSCH 5IIEA 5BVJA 1OTSC 5ADOH 3NCFB 4R4BB 1C16B 4PJ7B 5L2KE 2YSSA 1QNZL 3FAWA 4NN5C 4M93B 3L1OL 5JDSA 3UXFA 2XG5A 1CDJA 1U8QB 4X8JA 3SEPA 4Q2ZB 4HIXH 1RZJL 5A3IC 4M48H 3EYUL 4NQDB 1T7WA 1K8IA 1MHEB 3GBNL 4NPYA 3JTTA 5DEFB 1MPAH 1RIHL 1K4DB 3T0VA 1NGZA 3SKNB 1VEMA 3O3EB 2D03H 2MCPL 4ELKA 2WW8A 5C0AE 3VXMD 5DD1L 2JB5L 1BQHB 3MPCA 4C4KT 1JYWA 4DKFH 2PKDA 5F6HI 1J0HA 3O4LB 3BEWA 4Y5VC 1BF2A 2AV7B 5C09B 2ARJB 3BJLA 2GTWB 3DROA 5FYKH 4CUCA 5D2LA 1E4XI 1PW3A 5F97E 4IHOB 5E99H 4M7KL 2DQGL 3MCKA 1MCOH 4OQTL 4XNZB 4EN3C 5E9DE 5HSFA 5FXCH 2A6DB 5JW4M 5JQHC 3AFLA 4O9HH 4RGOL 3NOIA 1WTGT 3SDAB 3T2NH 3IJHA 2MQ3A 3QNZB 1BREA 1XCTB 2PO6A 3OQ3B 3RDTD 5F3HB 1MFCH 4XPHL 4FFYL 3P9LA 3SDAC 1WICA 1T1XA 3F7YB 1QUNA 4PGJA 1MY5A 5HGHA 5D7KE 3KYMB 2Z93A 2GJ6B 2X09A 1A3RL 5F9OL 4HUUA 5FUZH 4WWID 5KSBB 3ZZ1A 2Q76A 3KR3H 3O6KL 2HFGL 2BXYA 4HLZH 1UWEL 3BDXA 3EGSA 3PE9A 3MLWL 3P4NB 4N5UA 4M7LH 3VRLF 4TPRH 2FJHB 2DM2A 3C2SA 4OB5L 1C8PA 1YEKH 1YMHA 1PSKH 2PF6A 4HK0B 2PNDA 1A6WH 3L1OH 2A6KB 4Y2DB 2I07B 4ODUB 4BUHA 3RY4A 3EYVA 1HHJB 2X70B 3U46B 1JYVA 1KB5B 3LRSB 1JN6B 4NQDD 1IRAY 3FQTA 1EGJL 2Z35B 2CJUH 4I0PB 1LQSR 2EDWA 3HZVB 1YDPA 3LN4B 1DQTA 3DRTA 3RVUC 1YEGH 1ED3B 2GQHA 5DSCB 3EW3B 4B7IA 2W59A 3R4DA 1BM3L 5EPMA 3MGOA 1FL6A 3ES6B 4LQFL 4BYHA 3PQYD 3P9WB 3ARGD 2BK8A 5DC9B 5GRUH 3BZFB 5INCA 4U6TA 3C87A 5IVZB 2HH0H 1MUJB 1BEYH 5D93C 3KYNA 4LDEB 4X7TA 1IZJA 4XC1H 4CN1A 3LKNA 5C0CE 5D2LE 1ZLVK 2P8PA 3TNNB 4AQ1B 1AQKL 4NC1C 4LSRL 4NJ9H 2AABH 2GUOA 2P8MB 4U1KA 5IJVA 1I3VA 4KC3B 1MFAH 3D6GA 3QIWB 1URLA 5K59E 1A9EA 3OWEA 2DM7A 5C0AB 3WLWC 3NCCB 1FC2D 2J8UE 3P73A 2GTWA 3DROB 5DRWA 4K8RD 2ZWLT 4U6XA 4O9HL 4RGOH 5AD0A 2HAZA 2IAMB 5HGAB 1T2JA 5A3ID 4WI7A 5D7IF 1PEWA 5I1HL 3NCBB 4PJ7F 1PBYA 5FM5O 3MXVL 4Q9RL 4F2MB 1U3HC 2DLEA 2R9HD 4JE4B 2JTDA 1OT1A 5T3ZH 4OZIE 5LGKA 1T66D 4BFIB 4OGYL 3SO3B 3CX5K 1NCUA 4RAUB 4F2MA 2FJGA 3KJ4B 4LARH 4LLAA 5D7KD 4G6KL 1XIWD 2FLBT 5IB4B 1FL5B 1P7KB 3VGEA 1Z2KA 1DBJH 1HHKB 1WISA 4HUWA 1KJMA 4RAUA 3WIFA 3QIBD 3TBVA 4HBCL 1N6UA 3ZKND 2DBLL 1FRGH 2D4DA 1HHKA 4M7ZB 1EHNA 1LP9F 1M05A 1YQVH 2XWTA 4HGWB 5CAYB 1FJ1B 12E8L 2MQ0A 3OJVC 2CGRH 1G0XA 4F7MA 4HUXA 2MWCA 1YY8A 4N0CC 3DURB 1FBIL 4ODVL 4XNMB 3KPLA 3MO1A 4HKXB 2EZ0D 1NFDF 4LVEA 5HHME 1F2XK 1QBLH 2NY3D 1A21A 2VWEC 4JRXA 5GRJL 1AE6L 4YK4C 2GTZA 1JE6A 5FYLE 3ULUF 1NJ9B 1UM6H 4R26L 1JHKL 3FB8A 2OJEA 1SJHB 4NM8H 1RFDL 2X1OA 4YFLI 1HH9A 2F5BH 3IDGA 3UYRL 2ESVA 3HI6H 4PB9H 4QRPD 3SE3C 3V6BR 3SDXE 1J10A 1QLEH 1QLRA 1T03H 2YKLH 2Q1EA 3BPCB 5C0CD 2PXYB 1FSKC 3QDMD 4K2UH 4Z7WE 5HPMA 2EXYD 4HLZG 5K9OA 2R23A 1WQVT 4BUGA 5C0BE 4EUPG 5I75C 3HI5L 4QHLB 3PJSB 2R2BA 1W8NA 1NEZA 2CR6A 4NC1E 1OHQA 4OLZH 4UTAL 3LKNB 2DMCA 2GCYA 4Z7UA 5DD5H 3HRZB 4ALAH 2WQRA 4KHXL 2E7MA 4UB0H 1JK8A 2FJFA 1KN4H 1XH3B 4Y5XB 4XBPA 2ICWA 2PN5A 4ORGB 2CH8A 4UILH 1H3PL 4R4FL 3KJ4C 1T22A 3L3KB 3DNKA 1X5LA 3GFUA 4XVSL 1IQDB 2CUMA 1I9JH 3VWJB 3T77B 1OSPL 3O3AA 5JPNA 1TLKA 4XC1L 4U05A 3MV7A 4YDIL 1M7DB 2QTEA 4WW1A 4U2ZA 1JNNH 5I16B 5JQ6H 4UINH 5I76B 2YEZA 5SWSA 3KPMA 1NGQH 4K3DH 5ANMB 2AEWA 3KPRD 1G7QA 2QADC 3B9VA 3D39A 4JRYE 5D96C 1Q1JL 1DBMH 3NFNA 5D6CB 4G6AC 1K2DA 3QI9A 5AZEH 2NY5C 2P5EE 3D39B 4G3YH 3QIBC 4MVBC 4JGUA 1N3NB 3VA6A 1J0IA 3O3UN 3N1FC 4HUVA 1KIRB 4DJMA 1B4JH 4JO3L 1EA9C 4Z7VE 4HX1B 3KWWA 3JWOH 4NWTL 1T0MB 1T7ZA 4KAQL 3D0LA 3UEZA 5FK9B 2NPLX 3JTSB 1QBLL 1L0XA 3D5OF 4Z7VF 3EDEA 5IBLD 4MQSB 5I6XB 1SVZA 4L4JA 1E4KA 2NY6D 3BMVA 3OXRA 2RCSH 4OIAA 3RX5A 3ZT5A 1V7ML 1OARH 1Q38A 2CPCA 2QQNH 3MRFA 4ZAKD 4HWNA 2ILLA 3DBXA 3EJZD 5E00A 2VDKL 4QRTA 3IDGB 3BE1H 2KL6A 1QRNB 3CDCA 4HJJH 2F53B 4YUEL 5DD6A 1YNTB 3UBXI 4Z7OE 2GIYA 1U95A 1VPOH 1P4IH 1EEZB 1CZ8H 4NN6C 1NFDE 3ZDZE 1FYTA 1U95B 3KVQA 4DOHE 5GGSY 2JK5A 4OGXH 4XXCA 3A6CL 4NOBA 3NIDF 1RJYB 4O58H 5J9PB 3PDOB 3VXRB 5FAAA 4I4WA 1RZGA 3UYPA 3QO0B 3R8QA 1MOEA 4LFHG 3QFJA 5E8OA 3MLRH 5I75B 3DI2B 1CR9H 4RGNC 1A4KB 4PV8B 4EI6B 1YPZF 3I6KA 3O0RL 1HI6A 4ERSL 3GJFB 3HNSL 2E7BA 1NKOA 4KH2A 4XMLH 5HTSA 3BUTA 2NY1D 1BJ1J 3DUUA 4P2OA 43CAA 2CLZA 4FXKB 3T3ME 2Z92B 5T1KB 2MCPH 2V7NB 4MHHG 4BQ8A 3VXRD 4MXWH 3U9UA 1AXTL 1WZMA 3QYCA 1MCKA 4MCZA 4YGVB 4I3SL 2F54A 4UDUA 4MA7L 4RMQA 5F7EL 1XF2B 1IC4H 2J8UF 3CAFA 3GMPA 4FQLL 2GJZB 4NDMB 4M6OL 3IDXH 3LSOB 4KRPD 2ADFL 3EO1A 5E8PB 5FCSH 3ZE2E 2GJZA 4Y4HD 4PJGA 1CICB 4PLOB 4J4PD 3STBA 2DD8H 3D85A 3F5WA 3F7VA 3GBLA 4XWGH 4K8RC 1JIBA 1CE1H 4D9LH 5TE6L 4GKNA 2D0HA 1YMMD 4OD2B 5C0IB 1AO7D 1IARB 4DZ8B 3EYFB 5EWIL 3FT3B 1HDMB 4HJJL 2VL5A 1BGXL 1QFWI 25C8H 5E2JA 4PIRF 4JR9L 3RVTC 3DRQB 3CX2A 4PG2A 1IZKA 4NCDA 2C3WA 4YX2L 4MYWB 4P2RB 4G6FB 4EKXA 4M1CD 3QCTH 5MHSD 3UJJH 2Y5EA 4DKEH 2IADB 3BN9D 4N1CA 3MACH 1MCEA 5C0JA 1CFQB 5H37G 4XXDB 1FZKB 1K8IB 1MHEA 5EBLB 3TVMA 5CP3A 1ND0A 5HHMD 4RBPH 3U36A 4FFZH 3SPVB 2B2XH 2DQDL 4BQCA 3H42H 1ZS8A 1J5OH 2VTFA 5K59F 4PJ9B 2MMXA 3GHBH 3X11B 4PJDA 3UBXG 5K9JL 3QDJE 4FMFA 4LPUA 1DBML 3X3GH 1AIFB 4HKJB 4MNHA 2H8PB 3NCEB 4PJIA 4KJQD 3TYFB 4K3EH 2VXTL 3HRPA 3L3IB 1YA5A 3LEXB 1ODAA 3FOLB 2XKUA 1IGFH 3W0WE 4AMKH 4XP5H 1CT8A 4UQ2A 3FB5B 3WKMH 4F8QA 5D5MF 5EO9B 2AEPH 5I18L 4P49A 1NPUA 2BERA 5FO9A 4M43H 3GKWH 5FKPB 2B4CH 5GRVL 1QLFB 3KPSE 5EIIB 5F9DC 3V0VA 4X6EB 5CSZA 5LKNA 2OL3L 2EKSB 3GIZL 1KB5H 4KXZH 4PJFB 4JFPA 1TENA 1TZGH 1E0OB 2C7UB 1F42A 3QXAB 3W2DL 3VXUD 2VDKH 1JPSH 5KSBA 2DQJH 1Z5LB 1DBAH 3QAZC 2JJUA 3OKMA 2QQLH 3GMLA 3O11B 4GAYA 4NFBA 1YQ2A 2DWEB 5C08D 1TXKA 4M00A 5EIVA 4Y4HA 3BSZH 5IJKA 1A3LH 5DUPH 3OB0H 5C70A 2DWEA 5C92A 3VCLB 5GRVK 2AJYH 1VEOA 3WL9B 1IGFL 2J6EH 3RDTC 4Y16C 5FFLA 2H32B 2CK0L 5HHQA 4XNXH 5CUSL 1KXTB 4MWFB 1NMCC 5DTFA 3SE9L 3IFLH 4N1EA 2IBBA 1U42A 2VMFA 5ESQB 4K8RL 4HUUB 4W4NA 3C5JA 2BDNL 4NGHL 4KQ4L 1WFOA 3GHBL 5KOMC 4BK4A 4G6JL 1YY9D 3C6SA 5CEXB 4X5XA 5D5ME 1NLDL 1JZ7A 3W9EA 5DMIH 5I71B 1RIUH 2DBLH 1UKSA 4YHKH 4HWZA 2P8MA 3RP1A 1SBSL 3W9EB 3DARA 4Y19E 3RTQB 3SDDA 1YNLL 1BZ9A 3PHOB 2Z4QB 2VLJA 4F7EA 2J8OA 3D3VA 4PGZA 3DLQR 1A4JA 1O0VA 5LQBH 1J0ZA 1KN4L 6FABL 3JSSA 3VG9C 2AV1B 2BNUB 3KXFA 1FAKT 4JM2A 5IFJB 3UBXA 3O4LD 5IWLA 2FR4B 1FLRL 2J2ZA 2BNUA 1MI5B 1MJ8L 4K94H 3JUZA 2HFFA 1NGZB 1CGVA 2A9NH 2FATH 4NKMB 1CE1L 2FEDC 1CF8H 1S7UA 2DLTA 1RULL 3VGFA 4X4YB 5CD5C 3IXTA 4M5YH 1OAXL 1B2WL 1S7UB 2XZAL 5FB8B 3EJYC 4AL8H 3BO8B 4PG2C 3RPIA 2YHGA 3MJ7A 3SGKC 3P73B 5DRWB 4PJ5B 5K9KA 3NH7L 1UA6H 2OZ4L 5DQ9A 3VXUE 2NZIA 3GIVA 1JZ4A 2BNQD 5IK3B 4F7MB 5I1EH 1NUGA 3U7WL 4A6YB 1CLYL 1S3KL 1NAMB 3RWCB 4OIBA 1P53A 5DQ9B 1QNZH 3DSNA 4G80B 4M4PA 4JDTH 3U83A 3V5HA 3HZYB 1U8LB 2G5RA 1TCRB 2AEPL 2CR3A 1QEWB 2X4TA 4HDIB 3KLSA 4MA8H 4UT6L 1D3CA 2WSKA 1PY4A 1G9NH 2P24B 4D0CB 3MSPA 3C8KA 3O6FB 1AGCB 1R3JA 5IHZB 3H0TB 3QWRA 4JVUA 2K3TA 3L95B 4XB8A 1T2QL 1B0RA 3KYMA 1N6VA 4YHIB 2IFGA 5DMJB 3O3DA 4FFWC 3GBMH 4MX7B 2AXGA 3H3BC 2EICA 1RZ7L 4NRYB 1WZ1L 1SYVA 2VXUL 1WUNT 2X4RB 3OR7A 3ZYIA 1KXVC 4CW1B 3QDJD 3NFPA 3DMMC 4YHIA 1L4IA 3A6OA 3GM0A 3L5XL 2Q8BL 2JCCA 1R6VA 2F58L 2RAMA 3BYTA 1JZ3A 3ZDYF 1ZTXH 5DEGB 2B2XL 3QCVH 1D9KD 3OKNA 4J3UA 2A6KA 3LQMA 3DX9A 3D3VB 2CUHA 1AKJB 4KKCD 3SO3C 2ZUQC 2WWMD 1A1OA 4IRJB 5D1ZA 2D7TL 5T1MA 1XF1A 4PR5A 3WIIL 2YUZA 1DBBH 4UBDC 4QHLA 1YY9C 4G9DB 4H8WL 1CGSL 2B5IB 2X9WA 3BZFA 1PAMA 2XTJB 1ZLUK 4NYLB 5E24E 3NPSC 1IAKB 4PGCB 1WITA 1R3HA 3NZ8A 1BBJB 2A74B 3RX7A 3QUZD 1G9MC 5CJ5A 4YDLB 4OLXL 1LO4H 3BVNB 3OBAA 5FDWA 2VJXA 3C5ZD 3W81A 2IPUG 3VXRE 4GKZA 4N0YH 1A0QL 1GC1C 1OWRM 1A6ZA 1MWAL 3KPSD 4IRZL 3BIBX 3KXFD 4OB5H 5CP3H 3GI9H 4OLEA 3O6LH 2P42B 3DVIA 3QO1A 3PHQB 5KS9A 3HFMH 4HWUA 3M17A 1B2WH 3NZHH 1BLNA 1S7RA 3ARZA 3GRWA 1DUYA 4MVBD 3DO7A 4F3FA 1FL5A 1P7KA 5T1KD 3EDKA 4ISVA 4BZ1H 4QGYA 4ZDHA 1B6UA 3WIFB 3ILQD 3GMRA 1HWHB 4BH7A 3QQNA 1I85C 2PO6D 4H5SA 1FGVL 2FNBA 1N5YH 1U2HA 4LOUC 1WWWX 2L7UA 5GGUB 1WK0A 4OZGE 1EUTA 1G6RL 1FJ1A 3FFCB 3K8LA 3SDCA 3VFMB 4XPFH 4EN3D 1KJ2B 4F7CB 3SE3A 1CU4L 4PGDB 2FX7H 3GDBA 1VFOA 3FTGB 4JPIA 4OJFH 3U1SL 1N6QH 2DL9A 4KJPD 3H9HA 1RUAL 1S5HA 3QPQC 4MXQD 3FONB 3MRJA 1VGEL 3U0TA 1YNLH 3KPLB 4Z78A 1L9MA 1D9KC 2A83A 2R56H 1H8OA 5LBSH 1HSAB 3HE6A 3SGDH 3ARDA 3IDYB 4HCRH 4YIQA 4S1DC 4JJ5A 4RGMB 3S4SG 1T6VN 5TGBA 4MXVE 3WO4C 1NJ9A 5D96B 1J5OL 5HHOA 4RFOH 4PJHA 4UNUA 5JR1L 2AK1H 1MRCH 4QOKA 1J1OL 4LEOB 1YYLH 2V17H 3GSXA 3VXNA 2D03L 3BPCA 3RA7L 2QJDA 4PRBA 3O81A 2W38A 4Z77B 3MMEB 3G6DH 1R0AH 2UZYB 4QOKD 1KTLB 4PRBB 4U33A 1IKNA 5I1CH 3GMPB 3MMEA 1RJZA 1SJEA 3QDGB 4UQ3A 3T1FB 4UOW1 3CVHA 3I6GA 4MJIE 5FA4B 4U6VH 2HJFA 5IMLB 3R0NA 5IFHL 1WIOA 5DC4B 3W82A 2W65A 1H5BC 1ZA6B 4QHUB 1A1MA 1FFOA 1L6XA 1SHMA 4D94A 2DQFA 1UYWH 1J11A 2E5EA 1VGKB 2QADB 1LD9A 3EFDH 1YJDL 2CLZB 3KR3L 4FXKA 1HINL 4FN0A 2X4UB 1A1MB 2VIRA 2GITB 3BZEA 5C3LD 1ORQB 3MBXL 1T5WB 4LLVB 3W2DH 1BLNB 1TJGL 3KPRA 5GJSH 1CFVL 4KVCL 2ZUXA 3C9NA 3KPRE 2GSGA 3QEGH 2FWOA 4RWYL 3NGBC 2V2WB 5BS0B 4U0RB 5KZCD 4ODBD 5C0JB 4PLNC 3VFOB 2X4SB 5IMKA 4N0UA 1HCVA 2VDML 4OM1L 5AUMA 2HT4C 4Y4HC 1KPVB 1YEDB 3D0VA 2OYPA 1G6RB 4YPJA 3MBEA 4YHNA 3DVNB 1H8NA 1TVHB 3SDXF 3RJDA 3FQUA 4UUJA 5FK9A 4FQXD 2FIKA 3QQ3A 4X9HA 4EI5B 3V79C 3LKOA 1A7BA 3H9HB 3P77B 3RKDD 3CNKA 3QWOB 4IDJL 4XP6H 1OP3H 5HD8D 1A2YB 3GKZA 2P8LA 5IW6A 1RUKH 4MAYD 5DYOB 1CLZH 4OLVH 3RIAK 1J8HE 4H0HB 4X9IA 2ZOLA 1N5AA 4P2RA 1MY7A 5CZKA 2OI9C 4Z9KB 3U79A 4PJHB 2EC9T 3QJHA 4LLWB 2DQEL 1ZT4A 4O5LL 4UMGA 2XT1B 4KK6D 4D0DA 1Q0YH 1GXEA 3DMMB 5DURD 1MWAB 3NA4A 1HEZA 3TM6A 1C5BH 4YBLB 4QY8B 5IEHB 1F13A 1LK2A 2AXHA 3ZDYE 4GXVL 2MSPA 3KAAA 4L4VE 2ZCLL 1DN0B 5E4IA 3F6LA 3IJSA 4XMKL 3WNNA 3B2UD 3QCTL 2BNRD 1CL7H 5FUZL 5IBUG 3DVGA 5B22A 3PWNA 2IANB 4OLYL 2UWEE 2PR4H 4ZNEA 5JOPE 5E03A 2X5PA 4JEGB 2EDHA 1D5MB 2BRRL 2HLFD 5FA3A 1KIPB 3S98A 4HS3B 2BOBB 2E8YA 1UZ6F 3IGAA 1ES0A 2NXYC 2LQRA 3ROOA 4Y89A 2RBLA 5C0EA 1U8JA 3SCMB 3VFRA 1XZ0A 3AREC 5I19H 4M6NH 4FQCH 1CFSA 4HUKB 3KYKH 2F19L 5IEKA 4KZDH 1V3LA 3RGVD 5C0DB 3UTPE 2EDRA 4N68A 5I66A 4DEPB 2Z31C 4M8QA 4DUWA 2V2WA 4BZYA 1CFTA 4QO1A 3S97C 1OD7A 4G6MH 4ONOA 4NQCD 2HKHH 4KY1L 1CD9B 4LVNC 3FT2A 3P4MB 1DEEB 2A2QT 2FLRT 2IAMD 2V2XA 5FM8A 4GS7C 1C5BL 1ZHNA 1FFNA 1RZIB 5JOFA 5T3XD 5IQ9A 4MNGE 3OKKB 4G8EB 3HB3C 2F58H 1VADA 2NY1B 2R2CA 4ZUTA 5C07A 1A7QH 1FCGA 3ME0A 5J13C 2EDJA 1FVCA 1OP3K 3LKOB 2EYRB 3F5WB 5I1AB 1BF8A 4I18A 4PYGA 4GKNB 4IBLT 3QFJD 1CXLA 2WINB 2V5MA 5DYOA 1HDMA 3E2HB 3ARBA 3RX8A 4AENA 3NTCL 4WV1C 4JO4L 4OKDA 3VRJA 3PHOA 2AK4A 5JORB 1XR8A 4YAQA 1AGFA 2QV2A 5HYQB 2O93L 1C1EL 4KK6C 5ALBH 1NC4B 3IYLW 4P46B 3VRJB 3UJTH 1YEEH 4AIOA 4LSTL 1GZQA 1AGFB 1NAML 2D9CA 3TH4T 3UJIL 5IMMB 5I19L 3SKUD 4P2QD 1JUFB 1CDBA 5IHBA 5CEZD 1LDSA 1PX4A 3S88H 2NY6C 3JXAA 4ONFL 1FVEA 1L7TH 1S9KC 2UVEA 4L3CA 1KF9B 4U1IA 4YHPB 3PIQB 4YLQT 3KLAA 4JZJA 5FB8A 3VMNA 5B21A 5KAQF 3X11A 4PJ8C 4TRPH 5MEPB 1MWAH 4PRHE 5KTEH 3L3JA 2HT2C 1LO3L 1MF2L 2DIJA 3TFKC 4HKZA 3OKYA 2P45B 1YECL 1FFPA 3KXFB 3BMWA 1XZ0B 3VI3F 5IFHH 4KI5D 5IT2L 5IEKB 2W0LA 4Z76B 4L4VD 1G6VK 1F6AA 5E8EB 3L3DA 2C26A 4R90H 1HSBB 2A9MH 1CFTB 6FABH 5JHDD 1CGTA 1F6AB 5FF6B 4S1RH 3K8MA 2WIIB 5HY9A 4D0CA 5L8JB 1DVFD 2AQ3A 5EIIA 3WIHA 2LABA 2CIIB 2IJ0C 3LV3B 3MZTA 3OPZH 3MRDA 4LU5H 3S5LG 4RGNE 2JJTA 3VWKB 3VXUA 3CFDA 1IGIL 3MCG1 4LRIA 1U3ZA 2EYRA 5AEAA 1AP2B 3WJJC 1JV5B 4AM0A 1OF2B 2J6EL 4POYA 4QLRA 2XZCL 4OF8A 1KGCD 3HC3H 3T2QA 1N2RB 3BIKB 4PJFF 1BQLL 3MFFB 3U48A 2HT3D 4PJIE 5C7XH 3O2WL 3QULB 2OXHA 2Z35A 1O5DT 1U8KB 1NFIA 3BQUA 1VFAA 4FQIL 5F9WB 1GC1L 4F8TA 1J18A 3ZKMC 1Q72L 1PX3A 3TBTB 2QQLL 3QFDA 3EYOA 3IB4A 3VJ6A 3TT3L 2NY5L 4U1SB 2CK2A 3MROB 4ALAL 4OUOA 5EB9A 3MLVH 2HT4D 1J05B 2BHYA 3MTRA 3UX9B 4AIXA 5DI8A 3VH8G 5CGMA 1KG0B 1MI5D 4WGVB 3V0WH 1D9KA 4NWUH 1A6TB 4E41B 1J8HA 4FFVD 3C60A 4LSQL 2P47B 2XXMB 1HKLL 5DJ2B 5CILL 3TYGH 3RHWF 3UROR 3BP6A 1ZLWK 3T3PE 3W11D 1S7WB 3LZFH 4HULB 4FQ1L 2IH3B 2EYTA 4WI4A 5D5MA 5TF1H 2Z31A 1GGCL 3M8OH 3ZDXE 4L9LB 2AKRA 3UC0H 3OKEA 3BRDA 2YBRB 3RBSA 2XKSA 1AGBA 1I7RB 1WAAE 4PRIB 3RWFB 4PS4L 5GJTH 5ICYB 3O45A 3PUCA 2DI9A 3G6JB 1FZMA 4P23C 3NCJL 4NNPL 1CICC 4EQ2A 3C8HA 3TNMA 4PGEA 3RL1B 2ZOKA 1T83A 5DVKA 2HFFB 3MV9B 3GMRB 2L4OA 1ZGLM 2Y06L 3UDWA 1KEGL 3LEVH 4J1UB 3C08H 3EDDA 4I5BB 1C7SA 5I1JL 5IW1A 4FP8H 5H94A 4PRPB 4XNQB 1A5FH 5E1HB 1X5KA 3IFOA 3VA2C 4GUPA 3FRUA 3QDGE 3V6ZA 3LB6D 1UACH 3DV6A 5D93B 1MCHA 1N8ZB 2E9WA 1OP9A 3W5NA 2FH6A 3LCYA 1NLBH 3ZKQD 2YN3A 5B39G 3TN0C 4DGVH 4JG1L 2VH5H 4AG4H 3HPLA 4P59L 5ADPL 3Q5YA 4YIQB 2VYRE 4CKVX 2A1WH 3F7QA 5DFWH 4UV4L 3EKCA 3EFFA 1J05A 5E7FA 3DXAD 3HR5B 3FO9A 3W0WA 3E0GA 1FIEA 2RCSL 5I8CB 1CFNA 5DHYA 1S9VA 3UP1A 1JNHB 1YPZB 4G8GB 5CP7B 3SDCB 3VFMA 2C1OA 4F7CA 1KT2A 1HXYA 1NCDH 2N7AA 3T08A 2NTSP 2PYED 4C56E 1XGTB 4FQ1H 4I9WE 5BZDB 1DBKL 4WFFE 1KULA 3OKLA 2HJFB 4WW2F 4N8PA 2NY3C 4PD4J 4ZXBB 4YH6A 1IQDA 1E4WL 4OLWH 4JAMA 4L9LA 1L9NA 1ZSDA 4MJ4A 1U3YA 5D1QC 3UYOD 3CXDL 1UCTA 1QACA 4IM8A 2OQJA 1JTOA 2J88H 4IOSD 3IS0X 1NGQL 3ARSA 3ARRA 1I8KA 3RWJB 1HOCB 4GAJL 1ORQA 2FEEL 3ZE1E 1R3LA 5GHWH 1RUPH 4O51B 4OCRH 1SMAA 4JO2L 5E56A 3I50H 2VISA 3OKOB 1L7IH 4WHYG 1KTLA 4LNRB 5LBSL 4PJAB 4CBPA 3QG7H 2NX5B 1TTUA 2XWBA 1QSFA 4O2EA 3HNSH 2X4SA 4Q6IA 2YD1A 4JRXE 4WU7A 1NUDA 5GGTA 1YEDA 3V5KA 2ZUWA 5J4MA 5KAQG 1RV6X 3QUYA 3ZTNL 3D2UA 3BP5A 1NMCB 2G75B 5HYJE 2BOCB 1X6LA 4JQXC 4ZSOE 5EOQH 4U1LA 3AAZA 4U1NA 5D7LD 2XRAL 1AY1H 3IDMB 1QPXA 4H88L 4GKZB 1I7UA 1VGKA 2BRQA 3RQ3A 1RD6A 3E1F1 3IRPX 1WEJH 4E42B 5ISZB 3CMOH 1MCIA 2A6JA 4HGMA 4GRWB 5L88L 1P1ZB 3KG5A 2NNAB 4ZUUB 3O6ML 1FNAA 2R1YB 4P5TA 1ZT4B 4MA1B 3MLVL 3QIUC 4EN3A 1JTTA 2VXVH 2NNAA 1YUHA 5BS0D 2CSPA 1OTUC 4BQBA 5I2IA 4ZDHB 3D0VB 4CN4A 5HBBA 1DQML 5FV1L 4JPVL 4NQCA 3IKCB 1GC1H 1M6OA 2FB4L 4IHOA 4QHNA 5EORH 4L3EA 4AEHH 3U4BL 1T89C 5C0BA 5SWSD 3UC0L 3MCKB 2P43B 1T20B 4X98B 5GSVA 4KJYA 4APQC 1IEAB 5BV7B 3BWAB 1IKNC 2J8UA 1WV7T 4G9FD 5C9KA 3LKQB 2BC4A 4LLQB 2AJYL 1D6EB 1S5IH 5E6IA 2XZAH 4JAMB 4P23A 4WFFD 3C6LD 3DO3A 5GRZA 4HBCH 2ORBL 4Z78B 1D5IL 4CRPA 1CXHA 1RZFL 5BJTA 3HS0A 1F4YH 4ZPVB 1TJIH 4BKLA 3QJHB 4LLWA 4TSBL 5IKCA 4XMLL 4Q9QH 3IGAB 2WBJC 1ULVA 1I8KB 3RKPA 3P0YH 2XACC 1TJHH 4JDZA 2Q8AL 4MDJA 1ZVYA 2BNRA 1HEZB 4G43B 3VW3L 2OCFD 1D7FA 1EERB 2F54B 4LK4A 3P4NA 4O51A 3HAEG 4HEME 2A77H 1AR2A 1IT9L 3MLRL 2JJSC 3EYSL 3LKSA 2XWBB 2Q3ZA 2ZP0T 4RX4D 3VFTA 4HS6A 5DRZB 3SJVE 1KCUH 1FV1B 2NW2A 2C1PA 4R4ND 4BFGA 4PRIE 1N64H 4QTHA 5EN2B 1MF2H 2EEDA 5D1XA 1PZ5B 1FPTL 5F3BA 4U4BA 1YDPB 4OM1H 2XQYG 1NEZG 3U30C 3HHRB 4OFKA 4NQEB 1G7LA 5GSRA 3ZKSD 1GYAA 3ESVF 1WBYA 1LEIA 1UXWA 1S5IL 2R69H 4GBXC 3JUYA 4LKCA 5F7HA 2DQHL 3MCLH 5A2IH 2WINA 3GK8H 5E8DL 5IOPA 1XGUB 5AAMA 1P6FA 3EOTH 5DA4A 5I30H 4G9FA 5LGJA 2IH1B 3RL2B 4Z18A 4JRYB 2DYPB 3ARED 3U4EB 2R4RL 3MRBA 5J8OA 3CH1B 4JB9L 1ZLVH 3U9PH 1YEHH 1OTTC 2DAVA 5F44A 2GSGB 5DMYA 3VXME 1JMZA 4LDOB 5D7IB 3KXFE 4F9PA 5IT2H 3AUVA 2V5SA 1IGJA 3V6OE 5DR5L 3K80A 1N0XH 1I7TB 1W0YT 5D1QA 2EIZB 4YEFA 4C55A 4JREB 5LAXB 1BFSA 2FX9H 5GGVL 2VR5A 3G9AB 5GZOC 1DL7H 5D1QB 3BJ91 2YPLB 4G8FB 1YC8A 1HXMA 1RVFL 5FYJD 1KSRA 2CUIA 3QDJB 3RWGA 2X4NA 3HG1B 3TBVB 1JGDB 1KENL 3H9SB 3TYFA 4GFTB 3BN9C 5EUKA 3HG1E 3D87B 1XGQB 2YRPA 4P9HL 1DQJA 3CFBB 1T7XA 4JHBA 1QYGL 1PYWB 2O5XL 1NC4A 1MCNA 4P46A 1UQSA 5SWQA 3VFPA 1EGJA 2VDPH 1KCRH 1XGQA 1FFPB 4NM4H 3WXWH 1QBAA 3SDXA 5JNYB 5F7FA 3VFPB 4NQDA 3VFNB 4WW2B 5FKPA 1DDHA 4F9LC 1ITBB 3G5ZA 4H88H 4JFDE 3MOQA 2W9LA 3KYKL 5JNYA 1I1AD 4LLYB 1LK2B 1EBAA 2EDNA 3T0AA 3D2UD 1TDQA 5DJXA 3QG6A 4NCC2 1AC0A 4NNYB 1FFRA 2NXZB 4QTHB 4Y2DC 1YEJH 4JFFD 4LLYA 1IL1A 3P0YL 4NC2B 5BW7C 4MXWL 4KU1A 3KJ6L 2EE3A 1A6AB 4XCYA 1I1CA 5KSBF 2KZ1B 4PFEA 4NQVA 4KJQC 3K46A 3TFKD 3T04D 2ORBH 5JXAH 3BI9X 3QIUA 1B4RA 2Y07L 1QPPA 4Z8FL 1SY6A 3IJYA 4P48A 4HIJA 3FN9A 3EYUH 4KV5E 2VDNL 1IQWL 1AD0B 4LPWA 3RWIA 3CMGA 3RI5K 3HA0A 4WV1A 4YXKL 5TF1L 1BM3H 3CH1A 4XBPB 4MJ6B 1P7QA 3MLWH 2PETA 1SEQH 1MHPH 4RNRB 2AXJA 5D72H 3VDBA 4P57B 3WDIA 2XN9B 3RGVA 4X80H 4U1HB 4BSVB 1A02N 1MREL 1RJCA 3TIEA 3I3BA 1RULH 2EEBA 2YPKA 3QRFM 2QHRH 1I1YA 2IQAB 5JA8B 3CFDB 1Q9OA 1G84A 1KYOJ 1RUKL 4U1JA 5DD3L 2ZKHL 3OJDB 5CEYA 3EYQC 4I48B 1HXMB 3C60D 5C09E 4YFEA 1HIML 3I75B 2HFGH 4J23A 1MFDH 5GGRA 4D9RD 1OM3L 4LASH 5TPWL 2OMBA 1JGDA 2FBJL 5CJ8A 3EOBB 4R97B 4XPTH 5ESVA 2ZSWB 1II4E 2W0KA 2DWDB 1CGWA 4XT1C 3BGFC 4S2SA 2X89A 4ZO9A 1BFVL