1URLA

N-terminal domain of sialoadhesin (mouse) in complex with glycopeptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of Sialoadhesin with a Glycopeptide Ligand
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
molecule keywords SIALOADHESIN
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1urlA00
2I27N 4N0UE 3NIFF 1MCHA 3D85A 5FOBB 2W59A 1FLTX 4FN0A 3NFNA 1NFIB 4KI5C 3D18B 4NQSA 5EU4A 3C5ZA 3QDME 2DICA 5JW5A 4LLDA 4XCNB 1JI1A 4PS4L 3KDMB 3DHJA 3MV7B 3QDGA 3L3KA 3RWGB 3RVUC 1UWGH 2R39A 5GS1A 2Q6WA 1KIRA 5JQ6L 2E7HA 3ZKNC 4LHJB 2VE6B 4I18B 3JWOH 1F4XL 1N64H 4EI5A 2HP4A 1BZ9B 3C87A 3H9SB 1T2QH 2WBJD 2AJVH 5CZVL 5HYJB 5HDQL 5DJAA 3T3MF 2PXYD 4P46A 5K93A 4M02A 4XP4L 2GJZB 3FN9A 3VGHA 4YHZL 4GG8A 4JRXB 4K55A 3GRWH 3RNKB 1UWEH 4MJID 1FFOB 3VA6A 2RJMA 1LK2B 1Q0YL 2MPAH 2VXUH 2F53B 2VLMD 4LRNL 4S0SD 5KSAB 3PGCA 1XGQA 1ZT4B 2ZJSL 3CLEH 3C5ZC 4RMTA 5C0CB 1PY9A 3BKYH 3PDDA 4CN4A 2R0KL 5AZEL 2DQHH 1H3XA 1AGEA 5D71L 4M61B 3CVIL 2MHAB 4YHLL 2ITDB 4UMGA 2W60B 5DGQA 4MAYA 4MJ2A 1CE6A 1NCBH 4G8GD 1OTTD 2JLLA 3IB4A 1E4KA 2GYSA 4X5XB 2HFFB 4P59H 1XF2A 3QIBD 1EXUB 4PGCA 1YMMB 2EIZA 4NN6B 3F6LA 5KVGH 2GJ6E 3P0VL 6FABH 1ZHNB 5DF0A 3PJSB 1BFSA 4NO2A 3D39D 4KJYB 5JIHA 4MA3B 1UA6L 3RL2A 4UOW0 5I16B 1M7IA 1QEWA 3LKSA 4CVZA 3UTQA 4QRSB 4ZSOA 2HN7A 3WIIL 1AQKH 3JWDL 5ID1A 4YR6A 4U6VL 2VXSL 1O7SA 2YWYA 3G08B 1SJXA 1RIUH 3ESUF 3FKUS 4PJXA 5BRZD 1E28A 3VDCA 2ZG3A 1NC2D 1SY6A 1SJEA 3JV6A 1Q9LB 4XBEH 1FZMA 3KPSA 4HC1L 3WS3A 3MGTA 1MHEA 2IBBA 3CFCL 1UXWA 1BJ1H 4Q97A 1EEYA 1DFBL 4NFDA 2NZIA 4PLJD 1HQRA 3T2QA 5CZKA 1A7RL 4LOUD 1S9XB 2HTLD 5T3XL 5GGUA 4MDJA 3GSXB 4LCCA 4X8JA 4JFXB 1YDPB 3VE0B 5FDYA 3FO1A 3MOBH 4NDMB 4ZUVA 4PBWD 4APQB 1UJ3A 5B8CB 2HJFB 2VXTH 3TPUB 5AG9A 2IPKA 4PJ8C 4LU5L 2WBKA 1LDPH 5DK2B 3MJ9L 4RWYL 2B4CL 4WEUD 3VFOB 1AXSA 1JYWA 1T04B 2Q87A 3LIZL 3ZYZA 5C0AA 4PJFA 1WFOA 1KLUA 3FOLA 2NW2B 2IQ9L 1BQHB 1P2CB 1HDMA 4L9LA 1KLFA 1TQCB 1YEFL 3Q6GH 5EU3A 1BHGA 3SQOH 4YHIB 4ZS7L 3T09A 4IJ3B 2GEEA 2IFGA 2V7NA 2DQUL 1VHPA 3H42L 1OWRM 1SEQH 3WLBA 1MI5E 2FL5A 2YPLD 1GGCL 3WFCH 4PJEE 1VCAA 4XAKE 2JIXB 4HWBL 5FYLL 4FQHB 3CXDH 4GJTB 4JZJC 1FDLL 5BS0A 5HHNA 3SDCB 4HXBH 3UJJH 4E0RA 5I74B 2KPNA 3EYOA 1NSNH 4K9EH 1EO7A 3QNYB 2EDTA 1MF2H 4AG4H 5TPWL 3VRJB 1V5JA 5JXED 2ARJQ 1CI5A 2MFNA 2R8SL 1U2HA 2VSCA 5DJYB 3TV3L 4GQ9L 3WL9A 4N1HB 3SO3B 3WHE0 1C7TA 3A67L 3MX0A 2V6HA 4P4KD 5BVJA 2KUTA 1VENA 1PAMA 1HXMA 4WW2A 4B0MM 4Q6IC 3Q48A 5A3ID 1IGTA 4ZOCA 1D5MB 4X98A 4P5MB 1LWRA 2XQBL 2QEJA 4PREA 2LVCA 1XGRA 1H3WM 1CE1H 2E6QA 2YZ1A 2VYRE 2NXYD 4ETQB 2H9GA 1ES0B 1FNSL 4G8EB 3NIDE 3VFTB 2DM3A 2A74B 2FJGA 3MGTB 3RI5F 4JZJA 5F72S 1AQDA 4PRBB 5BOPA 1S5IL 4WTZA 3AMLA 3HNVH 4GSDH 2ZPKH 3DTXA 1WEJH 3WFBL 1MREL 1R0AH 1EUTA 1FORH 3AAZA 5FGBC 1HCFX 2VDLH 4JKPH 3VW3L 2DLHA 4XZUA 5E5RB 4G8GB 3IDXL 4XP5H 1A6UH 4JZJB 1A6VL 3DUSB 3T0AA 5IB1B 2GJ6B 2SEBB 3G08A 3QPXH 2OL3L 4OCRH 3O3EB 1VGEL 4MAYD 1BBJB 1JE6A 5CBEA 3I2CH 2WANA 3VFNB 3K1DA 4HKBA 5I0DA 1IGCL 4XXDB 3KYOB 5HGHB 2JB6B 1UGNA 2YN3A 4JDVA 4YAQB 4I3GA 4WU5B 5GRUL 2BSTA 4OUUA 3LKOB 5GGSA 3MRQB 3VI4F 2ED8A 1WK0A 3V8OA 3RVTD 1YEEH 4YHYB 2X7LB 1MWAB 1EHLL 4B7LA 4FQXB 1PKQA 2NLJB 5D1XC 2Q20A 3SE3A 1U3JA 1W0WB 4Y4FB 4EI6B 1DBKH 5I1DB 2ITDA 3V4VL 1MRCL 1RJZA 2VUOA 2AXJA 5D1QB 4Z6AT 15C8H 3T3PE 2FECI 4PJ5B 5K9QG 4LGSB 4MDIB 4G6JH 4YO0A 4MNQD 4GO6B 1CDYA 2BNQE 3OAUH 1QBBA 3TGXA 2FSEB 5KAQG 1JGLL 1XF4B 3L1OL 4XVTH 2DDQH 1DQDL 4TPRL 1MIEL 3LKRB 2FZ3B 3PWPB 1CD1A 1J0JA 4YHIA 2BX5A 2J8UE 1RSFA 4L4TD 4NQVA 3CDGB 4M8VA 2OX5A 1A6AA 5E6ZA 1VSCA 5J6GA 2OTUB 5JXEC 2IAMC 1E6JH 4XB8A 4LSSH 4UTBH 4R4BB 1JFQH 2ITCA 1AR1C 1VESA 1TZHA 1XGYH 2IQAA 3OAZH 5ITBL 4XP9L 4ZNEA 3LS4L 1CFQB 1YMHB 3B83A 1QLFB 3RVVD 3H2WA 2AEIT 1C1EL 1I8LA 3DVGB 1OT2A 1FO0A 2W92A 3CUPB 5T1DH 4F7MA 4KKNA 1OPGL 2CKBH 3CLFL 1G7PA 4HKXA 4OLWL 4ZUVB 1T0PB 3LQAC 2HT2D 2G2RB 4HJJL 5DRNB 3PE9A 5T1LB 3SKOB 5DXWA 1MHEB 5ALCH 2P5WE 5ICYA 4WFFE 5J13C 4H25A 3BGMA 3L3OA 5E9DE 3QG6A 1VKXB 2H32H 3QCVH 1X4XA 2I5YL 3O3BB 2JCCE 2F58L 1FE8H 1QP1A 5E9DA 2FBJH 1OY3B 4BZ1H 5IB4A 4NO0D 3G5YA 3L5WB 2IEPA 1UXSA 3TO4C 5F8QC 4JAMA 4HMEA 5EORL 4YHOL 4CN6A 4G5ZL 4AMKL 5CUSH 3O0RH 1FFNB 3EZ8A 1I4FA 4J1UB 4KXZI 2BHZA 1KCSH 1YEDB 5I1JH 5L7XL 2J4WL 1OSPH 3N1QC 3QWOA 4HUUA 1I7ZB 2XZCH 1S7QB 3GSNA 2A6JA 3UYPA 2G60H 4CVWA 4DN3L 2BNRA 4JQXA 2B1AL 4PTTB 4Y5YC 4Z7NE 1G9NC 3F58H 5E2VH 3DV4A 1B0RA 4KROB 1EFXB 1A3LH 4XPFL 1HZHL 3L3DA 3QEUB 3WJLA 4IOIB 4F15C 5JHDA 1FSKC 2P5EA 5GSVB 5F7NC 3V6OA 1DN0B 1AC0A 2PF6A 1MI5B 4G5ZH 3BZEB 2VDMH 4X8JB 3MXVH 4X6DF 1INQA 3QIUC 3CDFA 3UYOD 2IAMD 4BH8A 3C08H 1DQJA 5D1ZC 5IGXH 3QRGL 1ORQB 4KJQD 4XVUC 2F5BL 5IFAL 2X4OB 4RAUA 1U3HB 4P5TB 3T4AB 5GGTA 4HGKC 3TBTB 4YHPB 4AIXA 2AJSL 2B1HL 3AUVA 1NCDL 2OL3B 3I6LD 1LILA 2XWBA 3ZDXF 4NO5A 4MD5A 5ELIA 1YY8A 4MWFA 5CHNA 4TQEH 1AP2A 4NBXB 4IDJH 5GSRB 3IJSA 2JELL 3NN8B 4IBLT 3ZYOA 5IR1A 1OAXL 3FQRB 1G7QA 4RAUB 1MNUH 1DL7L 5EZLA 3TJHD 3VFSA 2X1QA 4JANB 3MFFA 2PO6A 3REWA 2KZWA 3C5ZB 3WJLC 2ZNWA 3CZJA 4YDKH 3RZCA 5EO0A 2J88L 3MBEA 1WICA 3EYSL 2XTJE 4MJ5B 5DUPL 5IK3B 4JRYD 5BS0E 4YFDB 1U93A 1XGPB 3M8OL 4JFFD 5D2LE 1JPSH 4NCDA 4OD2A 1BBJA 4QHLA 2JJSA 5L9DL 1HHKB 2R2BA 1NCWL 1FO0H 4M8QB 2Q86B 3FT2B 4P4KB 5DD3L 4P9MH 1EUUA 1QRNA 3KJ4C 4C56B 4QLRA 4ZO9A 2J8UB 1INEL 4MS8D 2VC2L 2ARJA 4GBXB 5BV7B 5DFWH 3HC4H 5IMOB 3MV01 3UTOA 5EBGA 3V2AR 4NN7B 2F54D 4NNXA 4NQEA 5KZCD 1U58B 3BUTA 4QRRE 4GRMA 2NY4C 5FYJE 3M17A 1FFNA 2FO4A 3OZ9H 1U3YA 3E2HB 3GSWA 1ZLUH 4ZUTA 2R0ZH 4N0YH 2QQKH 3WNKA 4OAWA 1G6RH 2BVPB 5D2LA 3ULUE 3B9KC 2HFGH 4PLKC 2D7NA 5C0CD 5SX4I 3C8KB 1MCNA 4G8FA 3NCFB 1A14L 3SO3C 3KPLB 3BHBA 2WQ8A 1RFDH 3NIGE 4Z7OE 3MRNA 2P43B 3WFEL 1RZGB 1G0YR 1XEDA 4MCYB 2VQ1B 4G6AD 2NW2A 2RQ8A 3EOTL 5F96L 1FNEA 3U46B 2DI7A 5JORA 1G6RA 3BKML 3OKLB 1Q0XH 1CCZA 4APQC 4UQ3A 1QSEE 1WBZA 1ZEAH 5IB5A 2J6EL 1F8TL 2Y9RT 4J3VA 2UVFA 2HFTA 4PRHA 5IEKB 4DOHE 1YEJL 5E2WH 2AXGA 2BRQA 4QGTA 4XVJH 3FN0H 3U2SB 5H2BB 3KR3H 3FT4B 1ZHKB 1ZSDB 3GMLB 1RUMH 2DQTH 3HI5H 1W72L 5DFVC 1OT1A 1UADC 5A40E 3O4OC 2WUCH 3PWPD 3IXAA 3KPPA 4ZPTB 1KJMA 3MGOB 3RZCB 1EO8H 2PW1B 1YNTB 4BFBD 5FF6B 4YFLI 2HJLB 3OKMA 2R9HD 2EDXA 3IKCB 1BREA 4IRZL 4CJ1A 4QXGH 5HGAB 3L6FB 4XMLH 5F9JA 1NMAH 3LS5L 3B9KD 3GMPA 3JUZA 3I3DA 4MS8C 5C0AB 1YECH 5CJQL 3GSVB 5DHXB 1HHGB 2MWCA 4ODXA 2X05A 4L8BA 4OFYA 3ROOB 1T7YA 5FOBA 2G5BB 3E6HA 4GT7A 3MRKB 4O51B 4OZ4A 3S37H 2HVKA 5L8JB 1F58L 3JV5A 3RTQD 5E24E 1UQSB 1NL0L 4C54A 3CXHK 2Z91B 4PP1D 3DXAD 4X9GA 3LD8B 1DCLA 5E70A 3GBML 3OPZH 1D5ZB 3X11B 1C08A 4I4WB 2APFA 4NNXB 4HUVB 3HZVB 3PL6A 4KRMB 2HKFL 3LH2L 5IBLC 4HDIA 5EH1A 5C0BA 1OM3H 5DR5L 2CRIA 2NPLX 2DM4A 3IU4H 3K80A 5AUMB 4IRSA 2A0LC 3RY4A 1LP9B 3AS1A 1WAAA 5ISZB 3RAJL 1I9EA 4PYHA 4QY8B 4H5SA 1KB9J 3KPSE 3MUHL 1CGWA 3FL7A 1NC4D 4U7MA 4PJCE 3QH3A 1KJ2B 2NMSA 3QDMA 2VQUA 5CJOH 1BFOB 4UU9B 1ZA3A 1QLRB 4ZFOA 3EIFA 1T1XA 4XT1C 3SBWC 5EWIL 3RVVC 3AS0A 5F9DC 3REVB 1FNFA 1TJHH 4JPWL 3EGSA 1QLEH 3SE4A 2J2ZA 1IKNA 3RX8A 4Y19D 3CFDA 3KR3L 5DJ0B 2PXYA 2AXHA 4M6MH 3RVWC 3FN0L 4R2GD 1SJHA 5TQ2H 3WD5H 3S88L 4NZTL 2DLFL 4N8CH 5A1AA 4H88H 2QQQA 5A43C 3DVNA 3ULSA 4URTB 5IWLA 3NCJH 2B4CH 3SDXF 4NWTL 3TJEL 4XP1L 3RUGE 3VFTA 4U6HA 3V4UL 4BH7A 3L3IA 3O6FB 1JHTA 1Q0XL 5HY9B 2QKIA 3WEXA 5CLWA 1B2WH 2W1NA 4FQIL 5DVKA 2ZSWA 2CJUL 2XG5A 3V6ZB 5DURB 1LO4H 4WCYH 2BY2A 4ODUA 3MCKB 1Z0MA 3SE4C 3DOSA 1SVCP 1U91B 4YXLL 2VQ1A 5CJXC 1HYSD 3SBWA 4F7CA 1EGJH 5DJ8A 3GMOB 4WI6A 4NP4H 1MCWM 1T22B 4PJ9B 4GUPB 3D39A 4NHCL 1HXMB 2B2XH 4X7EC 3S4SA 4DW2H 2F5AL 3F12B 1PFCA 1RJYA 3O9WD 5FDWA 1UQSA 1TVBA 4DQOH 5IROA 5I1HH 5KW9H 4FQ2L 4L8SB 1DLHB 1M6OA 1JWSA 1A6ZA 4KDVA 1YN6B 5A16A 3QNYA 5TDPA 2C1OB 3X13A 4OGYH 3W9EB 2VL5A 4OT1H 6FABL 3G5XA 4HF5L 3D0LA 4X7CC 3TN0D 2AK1L 4Y4FA 3U7YH 4XB7A 4EI6A 4S11A 5EOQL 1PBYA 4Q6YA 3NAAL 4ZUUA 3ZKSD 4FQCH 3HNTL 3TEUA 3ROLB 2HVJB 4RZCB 5HGDB 3BO8B 3EYUL 5B38B 3KXFD 2NY2C 5L6YH 4ONGH 5AUMA 1T89A 1HHHA 4KRLB 1U8NA 2LAAA 2E7LC 4L8CB 1NPUA 3P73A 1ZLWH 3SDAB 5L8LB 2VABA 3RL1A 3ARZA 5FHAH 4YBQC 4GW4A 1T0MB 4OV5B 3QEHB 5KANG 1M7DA 3O8XD 1F11A 2ICEA 2CRMA 1UG9A 2YUWA 2ZUTA 1DTUA 1IAOA 4LLMA 1G0DA 1KB5H 4RBPH 2I60H 2E8ZA 3OV6A 1OHQA 5SWSB 3ULUD 3CX5K 4Y0GA 4K23H 4U7KA 5SWSD 1T0MA 4LSTH 4OZGA 5F3BA 2P45B 4KKBC 4R96A 4D9RE 4IEFB 3RWHB 3PHQA 2XN9E 3VGEA 5T1LD 3D25B 1UWGL 2A77L 2E9JA 3MLRH 3MXVL 1T66C 3K3QA 5D2NE 3L3HB 4M7ZB 4E42A 1DVFB 32C2A 4H1LH 1MJ7L 5AAMA 1IT9L 1F4WL 5GJSH 3BAEL 4BZ2H 2QKIB 2NX5B 4F7EA 5DYOA 3MLUL 1I1YB 4M4RA 3B8SA 4D9LL 4JGUA 1F6AA 4Q9QH 1XH3B 3CSYB 3W0WB 1MCJA 2IGFH 4IRSC 3LKRA 1GZQB 2ZUSA 4YXKL 2H32A 3NA9H 5H2BA 3L3HA 1NGYB 3H9YA 1RUQL 4NO2B 1PQZA 3W2DH 8FABA 1CDHA 5HSFA 4RISH 2Z8WC 3CFDB 4BM7A 1CXHA 4G80B 2AV1A 2BXZA 4L8DA 5DHVB 2A6IB 5ID1B 1BQLL 1IZKA 1LEIA 2V2TA 2X1OA 4Y5YB 3RDTC 1HXYB 1JNLH 4PJEA 4U1JA 2EYSA 4KQ3H 4LSVH 5E56A 2NZ9C 5IBUG 5GIRA 2KH2B 5ESAA 5KSAD 4HKJA 1P1ZA 4EXPX 1J1XH 1NKRA 2C1PB 4J3SA 1NCAL 4GAYB 1ZE3C 1SYSA 3QIUA 4HD9A 4R0LA 2A9ML 4LCCC 4TYUA 4LCUA 1A7OH 4RCAA 5IP4A 4QNPE 4FABH 1Z9MA 4A6YH 4M7ZC 4JPIB 4DCQA 3BKCH 4U1LB 3CH1A 3MFFB 3REWB 3O81A 3QFJE 2X5PA 2GAZB 3GMNA 1B0WA 1AJ7L 1DEEA 4LHUD 5EBWB 4PJIF 4X7SL 5FYJD 4HUKB 4OJFH 3BGFB 1HEZB 2F54E 4TTDC 2AERT 1MQ8A 2VZUA 7FABL 4WHYG 1Q1JL 3D18A 3QPQD 5D1XD 4ZTOH 3CK0L 2B39A 1OWWA 5J4MA 2R2EA 4JKKA 5F7FA 4PJ5A 1ETZA 1BX2A 1P7QA 5GS0C 2FX8H 3RUGA 4UIMA 1KJ3L 5L88L 2AAVA 2VUYA 1T6WA 3QDGB 2XZQH 5TH2A 4XWOC 4ODTL 3MLZL 4JHZA 1FNHA 5DQJA 4ONOA 4OUUB 4OLVL 3DURB 3RVXC 1IAIM 4ZSOE 1VEOA 4WO4D 1INDL 4JZOA 3L5XH 3R4DA 4HBCL 5EZLB 2NY6C 4OF5A 4G42A 1OLLA 3LEYH 4M7LL 4JFOA 4XPGH 3PGDA 5J1TC 3TNNA 5I2IB 4KK9C 1L6XA 5C8JA 2OJZH 3ZL4H 3KNBB 1M4KA 3D39E 4PGJA 1Y6MR 3MA9L 5CS7A 5F7DB 2EXYC 1CICA 1ADQA 4N68A 2AXFB 2Z31B 3QUXC 1ZGLB 5CEXA 1W2KT 8FABB 1ORQA 4FNLL 1YMMA 4GS7B 2EE9A 3MPCA 4G9FA 3BPCA 2O61B 4MNQE 3WO4B 2PN5A 3VFPA 2MCG1 3TO4D 4NKQB 4JVPA 2CMRH 1B4JL 1T1XB 4KTEH 5F9JB 3K81A 3P2TA 4XPHH 4M7JL 3D3VA 4IJ3C 3BGMB 3TC9A 3QEQA 3NZHL 1MAKA 5HYJD 3O2DA 1I8MB 3EO1A 4NJAL 3S4SB 2IG2L 1CVRA 3GSWB 2Z8VC 1PVHA 2NTFB 4FNLH 5DQ9B 4ELMA 3KPPB 4PJGF 1NAKH 2NXYB 2OS7A 1SEBB 2BVUA 2P47B 3PWVA 5CMAB 4ZQKA 3GB7A 3IDXH 5FCSH 3IYLW 4XNMA 3R0MA 4JVWA 5TFSL 4HCRA 43C9A 5D7JD 3U9PL 2DYPB 5I74C 4YDVA 2VRAA 5IVNA 2JK5A 4R4FL 3SDCC 1G7QB 4LLWA 1UACH 4IMLA 3VMNA 4O51A 1F00I 1TQBB 4J3UA 3ZTNL 3RUGB 2G9HB 2VZ1A 3GSUB 2AJXL 2FGWL 3MA7A 3HZKA 1I85C 2CLVB 4X6CE 4OIBA 1NAKL 2NR6D 4LNVA 5EUOB 5JXAH 3PHSA 5MI0B 2DKUA 1IC4L 4JFHD 1LO3H 5TDOA 4F7TB 1NGWB 3DV6A 3GMLA 5CCKL 2YC1A 2NY6D 2G9HA 2L0DA 3RWIA 4ZNCD 1X5KA 2EXWD 2GT9A 3BZDA 1RULL 1CFNB 3QFJD 2D2OA 4X6BB 1ODAA 3FT3B 1GGYA 5D6CA 4OZFG 5F97E 4JN1H 1Q1JH 4XWOD 2EDDA 4F2MA 1H8SA 4Z0XA 3HRZB 3T0XA 1RJLB 4Y88A 4HIEA 3F8UB 5K9OA 2C4FT 4YX2H 5HYQA 3BEVA 3C60A 2FD6L 4HLZG 4EXKA 1UYWL 1BIIA 4K7PL 4WO4C 3HAEA 4M5ZH 3DGCR 1MLBB 3E8UH 2IBZX 4N0RA 1OGAD 3FFCA 5JR1H 4BK4A 3CZFA 1BVZA 5IM7A 1IGJB 5KVDH 4FXLA 4RMQA 5DS8A 1KTRL 4PBXA 1DE4B 3RU8L 5BCAA 1SEQL 2NX5D 5JHLH 2D0GA 3TN0C 1MIMH 3IT8D 1M1SA 2P4AB 4KGLA 3FJTA 1VGKA 3S35X 3LSOA 4V2BA 2Q1EA 4HX1B 1EO5A 2W91A 5I8EB 2E9BA 3WDJA 3O3DA 1BZ7A 3Q6FA 4EN3C 4R7NB 3BWUC 1X6LA 4QHUB 2WP3T 5AYQA 1CFVH 2EIDA 2GAZA 3O9WC 3VXMB 5H8DA 5TDPB 4DUXA 3KYKL 4YUEL 2BXYA 2R1YB 3BT2L 1BWWA 4EIGB 4NSKB 1RU9L 2Y6SD 5HVHB 3OXRA 1BOGB 4Y8DC 1XIWD 3VG9C 4G8EA 2ZOLA 3AC0A 4LLYA 1JWUA 1AHWA 4JRYE 2XWJB 1WIPA 3TIDB 3VWJA 5I8KL 3ESVF 5IHBA 3I75B 4X4XA 2X4RB 1F45A 4M9PA 4BELD 4PJGE 5F3HB 1G7MA 3JBG7 1Q9OA 1AGFA 4GRLB 4XNZB 5D9SB 1HWGB 4ZYKA 2FNBA 1QLFA 5E8OB 5EO0B 5GISL 2Q7NA 4LLWB 4XX1G 4UV4H 1W72B 2H2SC 4XBEL 4YQXH 1HINL 3CDYA 1HQRB 5ISZD 4O2FB 1A47A 4LSTL 3MRCB 3OB0H 3BQUB 1MQKL 5DMJB 5LGKA 1RIUL 4ZXBC 3FHQA 2K7PA 5JMRA 5DDHA 3TO2B 5E1HB 5DA0B 1FNEB 5E8OA 3ARDB 4OKDA 3G6AA 2LAGB 1MAJA 2X40A 2YD4A 4WWKD 5TDOB 4F7TA 1Y0LB 2CGRL 3A6CH 3S35H 4X4ZA 1CIUA 1J0HA 2WM0A 3CFJA 3SPVB 3QI9C 4KKBD 2ATKA 1LQSR 5C0CE 1R3HA 2BHYA 1U9KA 5CSBA 1JNNH 1CVSC 4Z8FH 1CL7I 4RISL 3RBGA 4M7LT 5IG7A 4FQQB 2ZSVA 5JW5B 3AFLA 1GRWA 2E7BA 4G9FB 3JTSA 1A7QH 4F8TA 5MP6H 5C07A 1MPAL 1XGTA 4NQDB 2HJLA 4AEHH 4LRNH 2W0KA 2B8OT 3DV4B 1QHOA 5GRYA 5IMKA 2NX5E 3ALWA 2WINB 5DEGA 4HULB 4BK5A 1CLZH 2MQ0A 2HJFA 3TPUA 2YWZA 3B5HA 2EDFA 5KSAC 4DW2L 4TTGA 3MCKA 5GS0D 3IFOB 2HT4C 1X5IA 4OGAD 3FTGB 4JFFE 5J7CC 4UBDD 3RGVB 3RWCA 1R3KA 2XT1B 4R26L 1VDGA 2C3XA 2X4QB 5AD0A 1TTUA 1WIUA 2GFBB 1YC8A 5DHVH 2YPVH 1IM3B 2YPLE 3NBNA 1YUHA 2VDKH 2O5YL 4LIQE 5GGVY 1FPTL 3TZVC 1K8IB 4LPWA 4QO1A 4EDWH 4U6HB 2R0LL 4K3JL 3R0NA 1M7DB 4QOKB 4AEHL 4OBRA 1EDQA 1BD2A 4PV8B 1Q9LA 2VWEC 2NY7H 1LEIB 2V2TB 2JJTC 1NDGA 5F7MC 3U36B 3GSNH 4IMKC 4H1LG 5FF6A 2AI0H 3QDJE 4FQIH 3D2UD 1NBYA 1UZ6F 2XICA 5IFJB 1OW0A 4J8RA 1CDCA 4XNXL 3FO0L 1P69B 2G2RA 2HTKD 3RTQA 3STLB 1S9YB 3EJYD 2VL4A 3C60D 3OMZA 5TGBA 2VN7A 4F57H 5C1MB 1BWMA 1T7XA 1SBSL 1MY5A 5IEHB 3D69A 2UYLA 5ICYB 4OZFH 5E9DB 4Z77B 2HKHH 5DLML 3TH4T 3QXVA 3KLHC 4HS8L 3V79C 4BSJA 3IFNL 1KXTB 2AP2A 1NCTA 4XMPH 1QKZL 1QYGL 3RVXD 2XKUA 3EZJB 4C57C 3NH7H 4OLXL 3BFOA 4OGYL 1IAMA 4RSVA 3F7YA 3QUMA 4LEOB 1DQLL 3HE7B 4HV8A 4ZXBD 2PYED 3DROA 3IGAA 2NTSP 1KB5B 4EOWL 5CEZH 2Y23A 2VABB 4XC3L 5JUEL 5DD6B 2J1KA 4NPYB 4WENB 2EXYD 1CT8A 3Q5TA 1UKTA 4F8QA 5IVXE 4RQQB 1BJ1J 3U9UB 3QUYC 4Y2DD 1SYVA 4I2XE 4FFWD 4JDVB 1P5UA 3CFKB 3NACL 3P40A 3ROLA 4JREB 1HN1A 1BX2B 1P7QB 4WHTA 4N5EC 1XF4A 5IVXA 2V7HA 1ADQL 2C3VB 1T0NB 4JFEA 5HHOA 3SE9L 4LCWB 4L3AA 4Y19A 2HH0L 1LGVA 4YJZL 3UAJC 3HRZA 3BIKB 2HKFH 1LO4L 4GAFB 4WCYL 3SDAA 3O2WH 4N0CC 3RL2B 2PXYC 2EDKA 3KS0J 1A0QL 4OLUH 3EOAA 4R7NA 3MLYL 4J6RH 3GK8H 5CP3A 2VLRD 3QIBA 5HHOB 3MRRA 25C8H 2DQEH 3KDMA 2VXQL 5DMIL 1RUPL 2FSEA 1T03L 4HFWB 3EYFB 3FTGA 4S2SA 4PGBA 4QNPF 1KJMB 4Q0XL 3SDYL 4M6ML 5LGHH 4DZBA 4APQD 3GSRB 2E9IA 4N0FA 1UCTA 5FYKD 5C09B 3W9EA 4MB4A 3QXUA 2FR4A 5GRWA 3QA3B 4JPWH 1J1OL 3FFDA 1LK3L 1R3IH 1RIVH 4JHAL 3DX6B 1OQOA 3T8XA 3DXAE 3GSXA 4LCCB 4KK6C 3KYMB 4L9LC 2X7LA 4H0HB 3VI4E 3BE1H 2Z92A 4Z0BL 3WXWH 4OV6F 2HVKB 3N06B 2CK2A 1NJ9A 1RUML 3TZVD 1DBMH 2XI9A 3UJIH 1IE5A 3ZHLA 3DX6A 1BVKB 1VACB 5HDBF 4CBPA 4Q0XH 4P46C 4PRPA 1AFVH 5INCB 3N85H 4QRRD 4DK3A 3ZE2F 1FL3A 2Y36H 2CDEA 1MFCH 4FXKB 3P77B 3O45B 4TNWF 4MD5B 2EC9U 2CLVA 4OLUL 2X1XR 4KUZL 2FJHA 4HAFA 3WNMA 1HEZA 3MACL 4JJ5A 4I0CC 1F58H 3ZMRA 2G5BA 3E6HB 3D0LB 4QTHA 3KPRE 2BVEA 4HS6A 1MCLA 1KCLA 3KHOA 4S0TD 5ISZE 1ADQH 2Z35B 3O11A 4GKZA 4NZRL 3W11D 5IHLB 2PKDA 3EFDL 4OKVA 1J8HA 5ESVB 1OGAE 2QADB 4HDIB 4UAOC 4P2OD 1QSFE 3V95A 2BNQB 2C3VA 5DEGB 3G5VB 4KVNL 4DGVH 4R6UA 1S7QA 3PP4L 4XGZB 1JPTH 5E03A 4PJXF 1N4XL 3HI5L 2JJVA 2XPGB 1JGEA 1P4LA 3OJDA 4MB3A 4OLXH 1A7NL 4ODVH 1K6QL 4JDTL 4YZFE 2YA1A 1YDPA 5I8OL 2ZUQB 4G80A 4KV5F 3UBXA 3MOAH 1NLDL 1YJDL 2J6EA 4DKAA 4PGBB 3DVIA 4Y5YA 4PJAA 1P4IH 3D9AH 3L5HA 1ZS8B 1IGIH 4L3CA 2VTFA 1ZLWK 3I02A 1YYMH 5FV2A 2FH8A 4HIEB 1G9EA 5GGTH 3OQ3B 5D72H 3HZMB 1BZ7B 3RIFK 5EZJB 1DUYA 2V2XA 4HJGB 3NABL 1JPFB 1QBMH 4ZO8A 4K3JH 3CIQA 5IKCB 4X6FB 2RBLA 1S9YA 4A6YB 3DYOA 5JMOC 2ESVB 5BW7A 3FT2A 1WQVT 3QIWA 5MENE 1S7TA 2AJZA 2V9TA 5BQ7B 1RVFL 2VDOH 3MODH 2RB8A 4Y4FD 4V2CB 3QRGH 3JTTA 4NCC1 4FQLH 4QTIH 1WWCA 4NQEE 3SDAC 3KLAB 1AXIB 4LEOA 1WFTA 1TETH 3P11L 3L3GA 4LRIA 5I1KL 2Y07L 4YE4H 5BZDA 1JRHL 3GGWA 5T5FH 3ZE0F 4U3HA 3O3AA 4AT6A 4P2RE 4QRQA 1IFHH 4AK1A 4RGNE 2ADGA 1KN4L 1GJIA 4NKMA 4HUVA 4Y5VC 2VKWA 3HI1A 5JPMB 1KPUA 1TENA 3VWJB 1I1FB 3V4PL 4OZHB 2X1PA 1OAZH 5D1ZD 4XPFH 5CEYB 1VA9A 4MQXC 5DQ9A 4ELMB 4JKLA 4C55A 4KI5F 3UCRA 2XXMB 3F58L 4JEGB 3ULUH 3KPRD 3MA7B 3R1GH 1EJOL 2WV3A 1JN6B 4I48A 4HMCA 1UT9A 1RMFH 4RIRB 3HI1B 1RI8A 1TQCC 2YUVA 1GGIL 1S5HA 3EDEA 2WAHA 4PJDB 2DOCA 2I9TA 1WT5C 1BM3H 1KELL 2CGRH 3HUJA 1UKSA 4U4BA 5D7LE 2VDQH 4H26A 3MJ8A 2ERJC 4D0DA 1MCPL 1UWXK 1T0NA 4EDXB 3E1F1 2NY4B 3FB6B 1OTUD 5SWSE 4X6CA 3UTSD 1I8IB 2P8LA 3VXSE 2K1MA 1G9NH 5GZOD 1FJ1B 5HYQB 3GJFA 1N3NA 3HUJE 4MA8L 5K9KB 3VXOB 4JFOB 1XMWA 4F9LC 3OKKA 2F74B 4UIKH 2VE6A 5H94A 5IKCA 4OLWH 5FKPB 1CFSA 2ICWA 1ND0A 2CKBL 4QRUB 1E4JA 3L6FA 3VXUD 3EYQC 1N3NB 5DMKB 1C1EH 4FZEL 1IKFH 4ACPA 4GAGH 3TH3T 2X4SA 2OBGA 4K3GA 4TVPH 1A3LL 1AD0A 1H5BA 5BQ7A 4YWGL 2D7MA 3PWNB 4C83B 1OP3H 4F7EB 1JGUH 1Z5LB 3PV7A 4RGMC 2IGFL 2PO6B 5HHOD 4D9LH 1AE6H 1E0OB 4KGJA 3ABZA 3ARSA 3D3VB 4GQPH 4OCMC 4FQPA 4AMKH 3V7AG 4M03A 5GXBB 4JDZA 3BZ4B 4TUJB 5EZJA 3L3GB 5E6IC 1S7RB 4R90H 3MTRA 2HMIC 4G8IA 5FA4A 5BXFB 4I77L 4JLRB 3VWJC 4J3OC 2BFVL 3ULUC 3SKNA 3MCLH 4ZQKB 5DD0L 1PGRB 4JY6A 1CDIA 1RVFH 1HYRC 4M62H 5TQ0H 5D1XA 3P4MA 3DO7B 2EO9A 1EFXA 5JW4M 1L7TH 1H0DA 1O0VA 2XKNB 3JWDC 4UDTA 2BY0A 1FSKB 2VDRL 1MRCH 2XOTA 4ENEC 1ZTXL 3OAYK 1DBKL 3SKUD 2W9EH 3U82B 3VGGA 4DK6A 4QHLB 4HS6B 5FIEA 3QUYD 3GMQB 2X2YA 4HHAA 1BVLA 2YPKB 3U0WH 3OF6A 3STZB 3WYRA 1P6FA 3KLAA 3VJ6A 4NO0B 1OVZA 5E6IA 4DFIA 3PL6C 2EICA 4JQXC 4ONGL 1K9TA 1CU4L 1J8HB 4V1DD 4LLAA 2FHCA 3EYUH 3MJ6A 2XTLA 2CPCA 4I18A 3G5XB 2X89D 3PP3K 3HE7A 4HV8B 5IMOA 3UTSE 1I75A 4WV1B 5D93C 1IC4H 4FQCL 3MRMA 2OL3H 3PQYE 1B0GB 2V9QA 3MO1B 3RWIB 2FATL 2R56L 3EUUA 1Z0NA 5FO7A 1YJDH 3CMOH 4U1IB 1ETZB 2OZ4H 3HA0A 3MJGX 3BZFA 3CCHA 1N4XH 3IRPX 3JZ7A 3F7VB 4UUJA 1BD2B 4PV8A 4BSWB 1T4KA 1DVFA 4ONHA 2WK2A 4N5ED 5D7IA 4NC0B 1QSFA 5GGRA 1MFDL 3IDIB 4F7CB 4LCYB 3U9PH 5GHWL 3U2SA 5JIPA 4J4PC 4I3RL 4E41B 1JZ7A 3BP4A 5F7YC 3GBNH 4NUJB 3KXFB 4OZFA 3T3ME 1JK8B 15C8L 3ZYIA 5IMMB 3BDBA 3WE6A 1RK1A 1FO0B 3CUPA 3T8XB 2WLYA 4JREC 1FN4B 3V4VH 3ARGA 4GAJL 2LU4A 4K3HA 1TZIA 5L2JB 2FCBA 4IDLA 3ET9F 3GMMA 5K59E 4JHWH 2IG2H 2X4RA 4UAOB 5FUCC 5F6HJ 5GS2D 4GMSL 3B9KA 4JFDE 1R6VA 5IBUB 5CMAA 4LAQL 2YA2A 1B2WL 2R8SH 2DKSA 1PX4A 2CO6B 1X5GA 3ARFB 4HIJB 4NWTH 3TJEH 5I73C 3LKSB 2PXYB 3QQ9D 4Y1AE 1INQB 3VXMA 4K9EL 3V5HB 1MJJA 3TIEB 1V05A 4PJ9D 4H20L 4OM0L 1Y6KR 4TTDD 1V3KA 5A3IC 2DM2A 2H32B 4I48B 2Q76B 3HG1D 1LD9B 4KKAD 4WGWB 3UJTH 2NY3B 4XPAH 5T3XE 3MV7D 4F9LA 4Z0BH 3GMNB 1PYWA 1FORL 1ZMYA 5DJDB 5D7IE 3NIDF 4P46D 3H3PH 1CR9L 3L5XL 1MRFL 2BNRB 1FL3B 4HEPG 5I30H 5T3ZD 3S34L 3G5ZB 4GBXA 5J57B 1AIFA 4HKBB 1OQXA 43CAB 1H5BC 1V3JA 2YMXH 4WEBH 4Z7WA 2Y72A 1SJVA 5GGSB 3DROB 4U1MB 4L4VB 5FYJH 1RZKC 1Z6JT 4QHKJ 1JYVA 1T03H 2VXQH 3OKEB 3W82A 1WZKA 3L95B 2AEWA 1ACZA 3MACH 5ABDE 3QFDB 4Z7VB 3PABB 1EVTC 4YNYA 1N5AA 4J6RL 1JV5A 3AGVA 5DQJB 4S1RH 3AREC 5FAAA 1HILB 4MD4A 4JPKH 1Z3GH 4NM8H 4Y19E 4M7KL 3IKKA 4YC2C 1U3ZA 3RNQB 4NJ9L 5DQDL 4HLJA 5I0ZA 4F37F 3L5IA 3WKML 3QFDA 5F7DA 1ZHLB 4XP6L 1G7LA 3REVA 4PJIA 2VITA 5HGBA 4FQXC 3PNWA 5KBNC 1JPFA 2NY2D 3O4LE 5C70A 5BRZA 3KHQA 1BF2A 4PD4K 2OI9B 4N0UB 1F4AA 4JGMA 1IM9A 3BZEA 5JZ7D 3GI8H 2VXSH 4YDLB 5CKAA 4KQ4H 4LQFL 4O58H 1V8HA 4Y5VB 5SWZA 1R3JA 3MV8D 2FGZA 4F37K 1CXFA 2XQYK 1MFAH 3D6GA 4CU6A 1I7UA 3U46A 4X9IA 4IRJA 3QUML 5HD8C 4HW6A 4NYLA 1KC5H 1SEBA 4C56A 5D1QD 1R5VA 5E2UL 2Z8RA 1A7PL 3FQTB 4LOUC 1VEMA 3I75A 5F7WC 3UPRA 1BQHG 2N1KA 4ODSL 2ZUQC 4A6YA 4FQHA 3SDXE 1CF8L 2VXTL 3OR7B 3NZ8B 4JRXE 5D7LD 5L2KB 5T5NF 4YXKH 1JF5A 1F2QA 4B5EA 5E2TL 4L4TE 5ADPH 4FG6D 3V6BR 5JOFB 3OJMB 1FH5H 3SGDI 4WI8A 1NDGB 1K4DB 1N7ML 1HHGA 3KXFE 3QIBC 4U1SB 4PJBB 1P4BH 3BPCB 2O61A 1EZVX 3QHFH 4X4ME 5IHZA 1YPZA 4ELKB 3TA3B 2PCPA 1CXEA 4GKOA 2EECA 4LNRA 4YHZH 1DEEB 4WI5A 3TYGH 5BW7C 3NACH 1GOHA 2A77H 4MSWB 5T3ZE 1MHCA 3IS0X 4MNGE 3LKQA 2X4SB 4MQTB 2EDOA 2A2QT 4PJFB 3C8HA 2I25N 3NTCL 3DECA 3SDDC 3UYRL 3NIGF 2EXWC 2CXKA 1HI6B 5GZOC 4RBPK 3B2VH 2QQLL 4ZO6A 3WJJA 3O6LL 1S7XB 3MNVB 3A6OA 2J8UA 1QUNA 4LLUB 2HWZL 5I1IH 2EC9T 3TN0B 1Q9WA 4HKJB 5D2NB 2BSRB 4KWUA 4Y2DA 4XXDA 1J10A 3MRHB 1T5WB 4Z7VA 4RQQA 5HHQA 4JCLA 1QKZH 4L3EE 1MPAH 3IFNH 2OTWB 3VMPA 1NFDE 3FONA 3VXMD 3ARDC 3IDGB 4NKDB 3PQYB 1EFXD 1U2CA 4P57A 1JGDA 4Q58C 4Z7WF 5L6YL 2H41A 3OKKB 4ZPVB 3FFDB 4Y2DB 5SX5H 1S7WA 1IAIH 1ZHBA 3C6LB 3QJHA 3RWGA 4DOHB 1QOKA 1J7VR 2NY7L 3C8KA 2Q7YA 4W4NA 1QR4A 3ULSB 2FZ3A 1AO7A 4M93B 1MNUL 3MV8E 4Q74A 4LQ1A 4P2RA 4FFVD 4PRAB 4EBQH 1X7QB 2BOBA 3MRRB 4WDIB 3STZA 2GUOB 5D70H 5C92A 1NLBL 4HG4J 1DBBH 1FRGH 35C8L 2I07A 1NCDH 5KSVB 3QQNA 2DN7A 1A4KA 3TESA 3HR6A 4X6DA 5I8CA 5GQBA 1C5CH 4PJFF 1C12B 3NTCH 4PRHB 3WIHL 3WNPA 3RI5K 5FFLA 4AEIL 1R5WB 2YPLB 3CGTA 4R2GC 4MB5A 4V1DE 4OCXL 5FK9B 3P4OB 3LOWA 3KYMA 5EU5A 1YNTA 2FEDD 3TNMA 3NZ8A 2A1WH 4OV5A 4QHNA 5FYKL 3ULVC 3VWKA 3EW3B 3QI9D 1R5IB 5J1AA 2J8HA 4HIHA 4GRWH 1DE4A 1QSFD 1FV1A 2D7TL 2EYSB 3ZDZE 3ZE0E 4LHUA 3QQ4A 3CAFA 5E08L 1X5FA 4FFYL 3X14B 4L4TA 1RU9H 2APBA 3HMWH 3MJ8B 2DQJH 2Q3ZA 5FUZH 3BRFA 1JNNL 4Z8FL 4G7YL 4NZDA 3MYZA 4Y4HB 4DN3H 1XGUA 1A7PH 1NFDF 3SKMA 3HZYB 1KC5L 2DLFH 1OSPL 5DVLA 2L7JA 2OCFD 4F9PC 3S88H 5TQ2L 1KCSL 3GI9H 3M17B 4LKXA 4F7PA 5BJTB 3TA3D 5F8RC 4XZUB 1D5XB 1CBVL 1ITCA 4EJ1C 1FLRH 4KKLD 2DLEA 3RVUD 1SJHB 3HC0A 2K9UA 2KQMA 4P3CL 2ATKB 3RU8H 3TWCL 1NEZA 2E6PA 1AKJD 4G8FB 2FBJL 1C7SA 3QQ3B 1FE8L 4HUMB 1FVDA 4XXCC 4Z7UB 4D8PB 5DSCB 5KSUA 4NQSB 1KPRB 2FX7H 3EJYC 2R23B 3O4LA 3E8UL 4LDOB 1OGTB 3DVFA 3BDYL 4F15B 1CGXA 5GISH 1BFOA 4LKCA 3RPKA 3ZKQD 3KJ4B 2J8OA 1UJ3B 5DI8B 2RR3A 2HFFA 5F1OB 1QRKA 1WBZB 3PG2A 3RY6A 3N9GL 4XRCB 4D0BA 3U1SL 1UM5H 5T3ZH 3VU2A 1QBLH 1CS6A 4KHXL 1MLCA 2VJXA 4G8GE 4XI5C 4JN1L 1JGEB 1YNKL 5IEKA 1ITBB 2BOCA 5TH2B 4YDVB 4LK4A 4ODBD 4MNGB 3RL1B 3QIUB 1GGBL 1KIPA 4Z76B 4GKNB 1QFUH 3GBMH 4KU1A 3K7UA 1A6AB 5D7SH 4I18C 4J3WA 1DSFH 3HE7C 4XBGB 5KSAA 3IXTA 4U0QB 5C0FB 4UUJB 5GS3A 1YECL 5CJQH 5LXGH 5EPMB 4EDXA 2NZ9D 3FMGL 3TBVB 3HCVA 1OOAA 1NMCC 2YD2A 1NGYA 4W70A 4WHYH 2FIKB 3JWNC 5HYJA 5I30L 1BQSA 1KCVH 2P5ED 5HI4D 4R4FH 1DQDH 2AXFA 2OZ4A 3IAQA 3C09B 1EXUA 4PGCB 1BECA 5FEBA 1JCKA 3T2NL 3V52L 5EBMA 5C08B 5AWNL 1W72H 1EERB 4JR9H 3UJTL 1G1YA 1PD6A 3FRUA 5L2KA 4WDIA 3VFOA 4QGYA 4R0LB 5A2KH 4XNYH 4M61A 1RZFL 5IBTL 4Z7OF 3CZFB 2I9LA 4U1GB 4MJ6A 3RPIB 1EHXA 4QRQB 1F4HA 4YK4B 2KBGA 2WUBL 3BXNA 1K3ZA 3JUYA 1CIDA 1I4FB 5LGJA 5GRUH 3DUSA 4TULH 1BVKA 1VACA 3V6OE 1Q38A 2GJ6A 3WFEH 4X7TA 5F1KC 4YLQT 5CCKH 1ACYH 4CMMA 4GOSA 1RZIB 2BSSB 5BO1L 1DANU 5FUOH 2BVQB 3V0VA 4OFIA 4C56D 1X4YA 4DVRL 1NEZB 1OGTA 2R2EB 5GGRY 3MLPA 4WFFD 1E28B 3HMXL 4OIIH 2FJHB 3X3GL 1IQWH 5DSCA 3S4SG 3C9NA 3RKDC 5TGBB 1H8NA 4DGIH 4NBYB 4O2EB 3ZL4L 4I3RH 3OWEA 3MV9A 2YR3A 1WEJL 2YXMA 3WFBH 2NW3A 1RZ7L 4OGXH 5D7IF 4H1LB 1TVDA 3TJHC 4UT7L 4Y89A 3HC4L 4LIQL 5FGBA 2HT3C 2PW2B 3O8XB 4JQVA 3GFUA 1GYAA 4N8PA 3VMOA 3EO0B 1JI2A 3BRDA 2CIIA 2ADIA 3TF7C 3TVMD 4MAYB 3CMOL 4E5XA 4ODTH 2Y5TA 4X5XA 3QUZB 3LQMA 4WFHD 3L3OB 1VKXA 5D5MA 1E4XI 5DD6A 5DVNA 5GSVA 1FL5A 5L9DH 3LB6C 3WNOA 5K9KA 2WBJA 3S36X 5J8OA 4NJAH 4PV9A 3M8OH 5IFHL 1R3JB 1TJIH 3AS2A 4O00A 1CU4H 1KT2B 1FJ1A 5DUPH 3IFLL 3PWUB 2IAMB 3D87B 3NA4A 4WWKC 5EO1B 3QXDA 4GUPA 3RNKA 2CRYA 4U6YA 1WISA 3HR5A 3MR9B 4DKFL 3O6FC 7FABH 1S8DB 2HLFD 4X6DB 2MQCA 3N9GH 1ZTXH 1T4KB 2AJYH 3W11C 2WLZA 4OJFL 3IJYB 2VDRH 2YPLA 1DQQA 3WEXB 5DRWA 3UJJL 3GHEH 4LCWD 5HI4C 2LV4A 4A2LA 1XIWA 3RP1A 4OLEA 4Y5VA 3MA9H 2YZ8A 4PRHD 3GSVA 3QT2A 3RQ3A 2UZYB 5I1GL 2WZPD 1WAAE 1NCNA 3Q6FB 5F9WB 4AENB 1JHLH 2F5BH 1S7SA 1KNOB 2HT4D 5EU6E 3RY5A 2R2CA 3WS6C 4PB9H 1ES0A 1QQDB 3D39B 1J1XL 4JO4H 1P7HL 2ZUYA 2A6KB 1LEKA 4Z7NF 1WT5A 3U9UA 5F7HA 2IQ9H 4IIQA 5T33H 5HYEA 4P4KA 1QO3B 3LEXB 4RGNB 3MC0A 5IV2B 3LN4B 3QDJD 5ESQB 4P5KB 5F7LB 4Y16D 4HKXB 4K71C 3HAEB 4S1SH 2Y4SA 1HZHH 1UH3A 2ICEB 2R29H 3QNZB 3G5ZA 1QA9B 4HMDA 2BSRA 5FUZL 2DQJL 2YRZA 3HB3C 2NY5C 4MA7H 1QVOA 2XFXB 3T65A 4ZUWB 4JM2A 1J05A 3O9WA 1NFKA 2APXA 3CK0H 4NKOB 4ZTOL 2QSVA 3IDIA 2Q8AH 4LBEB 1MCSA 3MBXH 4UIKL 1FNLA 5CUSL 4NQDE 1J0ZA 3L3JB 3DI3B 4FHBD 4I1NB 3MNZB 4NQVB 2D03H 1PLGH 1NBYB 4PD4J 5C07B 1TMCB 2Z4QA 3LZFH 3I85A 2QL1A 4FTVE 4WUUD 3VXSA 5FO7B 1C5CL 4YEEA 3WFHB 3ALXA 2C4XA 1M7XA 1IL1B 4GG6E 2E6JA 4K23L 5FV1L 4PJ8D 4NZJA 4BJLA 5DRZA 1AI1H 1A7OL 2PO6C 5MERB 1DBBL 1X5HA 4OQTH 2VDQL 2L7UA 1W0YT 2A9MH 1YN7B 4OZGF 5EU3B 1BM3L 1KELH 2VLRE 2X4NB 4UT9H 5EOCL 1NCAH 3U79A 2OM5A 1MH5A 3PV6A 3VGAC 2HTLC 1KUMA 4UT6H 3S5LB 5K59F 5J56B 2D9QB 1HSAB 4WU5A 1MCDA 3K2UH 4I0PB 2JJTA 5JHDB 4L29B 1KTDA 3SKOA 4PR5A 5JOPD 4BA8A 4JQIL 5I2IA 1T1ZA 5IMMA 1MWAA 2EH7L 1IAIL 3PDOB 3FQXB 4K9EC 1FYTB 4TUOB 4UB0H 1EEUA 2QSCH 4NUJA 4IM8A 4ALAH 2XN9D 1GC1C 2CDGB 4YPJA 5D71H 1KPVB 2I9LB 5AZEH 2R0KH 4IRJB 3VXME 1JZ6A 1IARB 1C16A 1KN4H 4U3XA 5HDLA 4OCSL 4PLJC 4XRCA 4D0BB 1A3QA 4J8RB 3N1PC 5CD5C 4MCYA 1UKQA 4XWGH 1A6ZB 2GCYA 3ZKXB 1AP2B 3DRTB 1EHNA 2V5YA 1FVCA 3K8MA 4LDEB 5FYKE 5AEAA 1T2QL 1XCQB 3MZTA 3RVWD 3U0TB 1LNUB 5C0IA 1T1YA 2P46B 3FOMA 1H3VA 1I3RA 5I6XB 1ZA6B 3EYFA 4NHCH 4LCIL 1X6NA 5J3HD 2AEPH 2GK0A 4UI2A 3P77A 4MA3A 5F21B 5I16A 2Y06L 5DJ8B 5CBAA 3TBVA 4PP2B 2DQCL 1MCWW 1G7HA 1A6WH 5CEYA 5IW6A 1FP5A 4YHNA 2YD5A 2B0SL 4H0IA 3TYFA 3LDBB 4R3SB 3X3FL 2YKLH 1ONQB 5DRXA 3MRCA 1BIHA 4OZHF 3KJ6L 5HHMD 4TOYL 3QWRD 2CJUH 1TNNA 1XF1A 2Z92B 3SCMD 1IGCH 5DJ6A 2V7HB 1XIWC 5GGTL 3V4UH 3FB6A 1Q9OB 1YYML 1F97A 1PY4A 4OCRL 4HHAB 3MRDB 1U8JA 2NXYC 5DRZB 5F7EL 1I7ZA 3MXWL 2YUZA 3MFGB 3GNML 5B21A 3EBAA 4FTVA 3UDWC 1SMAA 1A6UL 2CLZA 2LABA 3SN6N 3S37X 2WP3O 1UVQB 4E9LA 5HI5D 3DO3A 2R23A 3VFNA 1QLEL 4N9GB 3STBA 2ADIB 1MFBL 1K2DA 4CADB 1YYLH 4LLUA 5EZOL 2CH8A 4KVNH 4FQ2H 4DGVL 1ULVA 5T1KD 2ORBL 1K4CA 2F5AH 4NT6B 3MBEB 3ILQC 1RIHL 4K3DL 1Q94A 1BFVL 2X9YA 2X1WL 4F58H 1WFUA 2XIDA 5DK0A 4CN1A 3I6LE 3WDHA 1XH3A 4QT5A 1IEAA 3QHZL 3BKJH 3AY4C 5E8NB 3BMVA 5DR5H 5ALBL 4XCFL 1YPZE 4ZPVA 2VIRB 4M7KH 1QPXA 3KXFA 4DGYH 2C1PA 4JE4B 4NN5B 4OGAC 4POZD 1RK1B 4GQ9H 3GB7B 1DN0A 1A8JH 3S96B 4GG8B 4JRXA 2XPGA 4LCWE 5D8JH 5C6TL 5FYJU 5E94B 5ESQA 4AG4L 4MX7B 4G9FE 3DX7B 3VWKB 1BFTA 1OTSD 1YQVH 5FKPA 2CXGA 4PJBF 1F3RB 5CD3B 3O41B 2A38A 4NYLB 4JO3H 2GJJA 2OTUA 2AGJL 3BKJL 3MNVA 5LGJB 3OKOA 4RFEB 5CINH 4KK8D 1GZQA 5C08A 1AGEB 5IIEB 4TNVK 5HYSG 4PG9B 1EEYB 1DBML 5HGAA 1KBGH 1TJHL 2ZOKB 3FRUB 5IW1B 3WXWL 1Y6NR 2ZG1A 1IEHA 1YY8B 2UYLB 5IJVB 3BOVA 4WY7H 5EU4B 5EOTA 1F4YH 3CFBB 3J8F7 5DD5L 1DDHA 3H42H 1JZ2A 1MY7A 4RZCA 3KVQA 2BNQD 4XPAL 4AY0A 1KULA 5C0FA 4H8WC 1EJ6A 3Q1SL 2CIKA 2AGJH 1U95A 4BUHA 1UFUA 2IH1B 4NOBA 2G5RA 1YQVL 3UZQA 1OM3L 4ODHH 1LO2L 2O26U 2VZSA 4FQXA 4KH2A 1EIBA 4IOFC 3F12A 2BMKA 4LU5H 4K7FB 3DO7A 2A9NH 5KG9B 4LLDB 4XCNA 4YEFA 3UC0L 2BY3A 4DFHA 5CEZD 3B9VA 4QY8A 3PGCB 5CJXA 4UDTB 3K46A 4GMSH 3DURA 2O5ZH 3VRLF 1C8PA 4EZMA 3X17A 5F71A 3PWPE 4JHWL 1CQYA 3BHBB 4RA0C 5FXCH 3ZE2E 5HVGB 1HQ4B 1A14H 1T83C 5H35A 2D9CA 2HT2C 2NW3B 5EO9A 3KYAA 5J12B 2YBRB 1KIPB 3QHZH 3DRQB 4P5KA 4NDMA 1NMAL 2A6IA 2YD7A 3CFCH 3LS5H 3U7WH 2PW2A 2HT3D 4P2RD 2JIXA 4HC1H 3L9RB 4MQXD 4DJMA 1UZ8A 2HLFC 3FQRA 5IB5B 1I9JH 4PUBH 4HPYH 4NO3A 1DQTA 5GHWH 4JM2D 1IEAB 3T2PA 5F6IB 4S2SB 3OBAA 4KZEL 4JGJA 1DJSA 3CSYA 3HNSL 4LRIC 4XH2B 2BCKB 5I15L 2HLAB 5CFHA 4JQVC 3MRNB 4Z7QF 1U8PA 4PTUB 3AB0B 4NSKA 2VC2H 5LWYL 4RMSA 1QYGH 5K9JL 2BVQA 3KPTA 3V0VB 3O41A 3JVGA 1KCRL 2VXVH 4L4JA 3VFRA 3PGDB 2DJ4A 2H9GB 4C58B 4PJ5D 3T4AA 5IIEA 2AK4D 3PWLB 3T4YA 4PJIE 2ZUVA 3S6CA 5I1LB 1GXEA 1I8IA 1NUFA 3NPSC 2QSCL 2YUXA 3T0ED 3EYSH 3O3DB 5IF0A 5T1MB 2AS5M 4UU9A 3T77A 4MDJB 4YDKL 1RZJH 1X5XA 5T1KB 2FR4B 3LKPB 1UH2A 2ED7A 4KRNA 1BPVA 4DCQB 2N7BA 4NQUA 2MPAL 1Q0YH 2R0LH 3F7RA 3BIBX 5K33A 5F7UA 2O5YH 3SGKA 5AYUH 5MEPB 3MREA 5EN2A 5F6IC 1NAMA 1OAUL 5C09E 2Q86A 2GY7B 1D9KD 3HB3D 4KMLB 4R8WH 5KS9A 1N2RA 3ZT7A 4JFFA 4GG6A 3O3EA 1U93B 4MJIE 5IFAH 2LVEA 3NIFE 4JM4H 1ZV5A 5J06A 3CDCA 1HKLH 4LFHG 1S9VA 4FZ8L 1K2DB 1L9NA 2VLLA 3D85D 1EVUA 1JP5A 3KGRA 1CLZL 5IQ7H 3MRKA 4OZ4B 4KTYA 4OKVB 5C7XH 2AV7B 1LD9A 5I1CH 4HPOH 2BRRL 5IMLB 1ZKAA 4FQJL 1KJ2A 1S7WB 1ZHBB 4QXWA 4GMTL 2GCYB 5KSBF 5AZ2H 1SM3L 1U8JB 2EKJA 3CMGA 1IGFL 4NQEB 3CVHB 4OUOA 1QSZA 4RWHA 4JPVL 5E1AB 2VQTA 3U0TA 5ID0B 3LQZA 3BGAA 7CGTA 4PRAA 4ALAL 1OAYL 3NCCB 5L2JA 2EEAA 4LPVA 4JFPB 5JO5A 3ZKXC 5KVMC 5HHQB 2EH7H 3IXAB 2CKBB 4K7PX 2EC8A 4FQ1L 5C0CA 5FKAB 3VXUA 1H3UA 1XCTA 2J4WH 4NGHH 5DD1L 3V7MA 5F9AC 5KSBE 1H3TA 2UWEF 4H8WL 5HGGS 1DL7H 3HAEG 5EFIA 1FYTA 4R96B 3O0RL 5BZDB 4MXQD 1FAIL 1JGDB 3VDAA 2AEQL 2LTQC 3KPOA 4ERSH 4HK3J 1S3KL 5LAXA 5IHUL 5HJ3B 2VLKA 3SCMA 1MAML 1NGXB 4IOIA 3I9GH 1AI1L 5CZXC 1N8ZA 2OJEA 1U8KB 1XGTB 2F58H 2JCCA 3QAZB 3V5DB 1MFEL 4E5XB 4KMTH 3GMRB 5DZOA 1WITA 5ACMA 1YY9D 1HINH 3CFEB 3LKNA 3VRJA 3C08L 2Y7QB 1KENH 2F19L 4YR6B 5GJTL 5IHUH 2P7TB 5AG8A 1WF5A 1S3KH 3QWQB 1FG2A 3MGOA 2AJYL 3JSSA 4YPGB 3G04A 4C4KO 3TBTA 4JG1L 5EIIB 4EUPA 1RJYB 1BEYL 3GSUA 3RWCB 1WVZA 2DL2A 1I3UA 1JPGB 3QNXB 1YEIL 4I8DA 4MA7L 5FYKU 1A64A 1A9BA 2EDRA 1CDBA 3CC5A 3MRJA 4LLQA 4ZNEE 3BQUD 4P2QB 5IHZB 1N2RB 3KYKH 4YUEH 2NY3D 5J1SC 3RKDD 3U6RA 2HJKA 2BDNL 3LRSB 1V7ML 4K3EL 5F89A 4NRYB 3P0YH 1I7UB 5MEPA 1AGDA 1YEHH 4JPVH 3C6LC 1BVLB 4NUGH 4ZTPL 1NH6A 1DQMH 5HGHA 1J11A 2PTTB 4GMTH 2DQFA 2A73B 4NN7C 4FQJH 1YNLL 1NBZA 3OAZK 1IFHL 1DR9A 4JY6B 5IQ9A 5DFVD 1FVEA 5T5FL 3HZVA 1ZLVH 3UXFA 4S10A 4EN3A 3TT1L 2DD8L 1GOFA 1MIML 1HSAA 1TETL 1MIEH 4PP2A 3X11A 2EH8L 5IB1A 1X3DA 1CICC 4HUUB 1MCKA 4XVTL 5K9QI 4TNWK 1N6UA 2H8PB 4J1UA 4PJCA 1FIGH 2EKSA 2VISB 2NY6B 1I1AA 1X5LA 4R8WL 4JHBA 3WBDA 1IQWL 3F7YB 3QUMB 3C6LA 4JN2B 3L3KB 5AYUL 3FT3A 5MHSD 1IM9B 2GI7A 4M43H 3BVNA 3ZT5A 1AHWC 4TSBL 2Y1VA 2BCKA 1A1OB 3KWWA 1ZA3B 1OPGH 1U41A 2PYEE 4IIQC 5IESL 3IJYA 5DMGD 1SVZA 1CDUA 1M7IB 1QEWB 4CVZB 1TFHA 1UCBH 2VLKB 2HG5A 3C5JB 5FHBH 4U1NB 2NY1C 3V8CA 5GGQH 4KKLC 3V6OC 1CLYH 3WO4C 3WXVH 1GPOL 1F2XK 1IC7L 3JXAA 1OTSC 3RWEB 2OSLB 3VDBA 3IVKB 5J9PB 1S7UA 3CX2A 1NGXA 2H2SD 5DS8B 1IGIL 1RZFH 5IBTH 3QPXL 5C71A 2QHRH 3BH8A 5SWSA 3E0GA 1NLDH 1NBVH 4QHMA 4NC1E 3BGFC 1NBQA 3ELAT 4M93C 3OKNB 2AJXH 2FGWH 4JDTH 1MVFA 5J11B 3GDBA 3L95A 4PJHB 1WWBX 2X41A 3O3AB 3VW3H 1R3KB 3DPBA 3SJVB 4HCRL 1YN7A 1B4RA 4HXAL 3LKOA 4HH8A 4GXVL 5FK9A 2PCPB 4FMFA 3ZTJH 3DX8B 2A6DA 3UROR 3B9AA 1M05A 5IBLD 2AK4B 1KEGH 4MXWH 5JA8B 1KCVL 4BFIA 3LKQB 4OSUL 5HYJE 4ZOBA 5CAYB 4YGAB 3KPQB 3OGCA 2WINA 3ZHKA 3ARYA 1C08B 2KZ1B 3LEVH 4IOFD 3MGAA 4HEME 4HFUH 4RAHA 5F1NB 3ARFA 4HIJA 3IFPA 5E6ID 5FUOL 5C0BE 1EHLH 1UVQA 2LE9A 4KKCC 3H3BC 3VH8B 2EDEA 4KJPD 3QUXB 4S1DC 3KAAA 2AJUH 3MREB 5EN2B 5MI0C 2M1KA 2ADGB 4R4NC 1KOAA 5IESH 1JZ5A 3BUYA 1YNKH 4HGWA 5TPWH 1TJGH 1UB6A 4PJHE 1QBLL 1ZLUK 1LO2H 1I8KA 3D2UA 5DWUH 5I19H 1NSNL 5DJZA 2DYPA 3L7FA 4P4KC 5KOVC 5IV2A 4JJHA 4PJ7E 4HWNA 4HXBL 5MEOB 1A6VH 2IWGA 1E4XH 1P9MA 2CDFB 3QJFB 2IPKB 1P4LB 3OJDB 2FLRT 4LVEA 2HJKB 3LRSA 3HRPA 4XHJC 5DMGC 3BE1L 4QRRA 1TCRA 2UZIH 5DD5H 5F88B 1F4YL 3QXAA 4P3CH 5DJYA 2EH8H 4P9HH 4U1GC 2IF7A 2BJMH 3CVHH 4O4YH 2DTML 2Z0BA 2QADC 3DHMA 1A22B 1B90A 2Q6WB 2H2PC 3O6FA 3PWNA 4C83A 4OLVH 5D9SA 4WWKB 3V5DA 3ZSSA 3MV9B 4HWBA 5JORB 3WHXA 1BBDL 4JO3L 3MLSL 5M7QA 1L0XA 1U42A 1HILA 2NYYD 2XWTA 2DQEL 4G7YH 5SWZD 4EVNA 2A74A 3SOBL 3RRQA 2BOBB 5EPMA 1FZJA 2F74A 4WTZG 1ED3B 5C0EB 5I9QB 4XAWH 1MWAL 4QXTA 1VFBA 3L7EB 1BEYH 3C5SB 4MDIA 2JK5B 5LKNA 5ICZB 5IT2H 1F90L 4ZFZA 4P3DB 4BFIB 3IFOA 4LP5A 5SX4H 3CH1B 2OR7A 1CK0H 4HSQA 3AVEA 1XR8B 4PRNA 2VLRA 5JA9A 2BERA 4KDTA 3PWUA 3MNWB 2VR9A 3C60C 5D2LF 5ID0A 5C0DA 1G6RB 1D6EB 1I1AD 1NFDA 4PGEA 3TBYA 3CDGA 4PJXE 3WFDH 3BPOC 2NTFA 1CTOA 4FABL 4ONFL 3TWCH 4LGRB 3VXTB 3LB6D 5EIQA 1MAMH 2MQ3A 1N6VA 1DQLH 5GRVK 5FO8A 4D2NA 3IDNB 2GUOA 3NGBB 4KRPB 4Z9KB 4HJ0C 2RCSL 4G8IB 2YEZB 5FA4B 3S9DB 3CFBA 1QRNE 4FS0A 2D0HA 3QZWA 1NCCL 5FM5O 3T0EB 4JY5L 4HK3N 1DLFL 1JGVH 4NZUL 5A16B 3O2DL 3NFNB 3MLTB 3CVIH 3MJ7B 1S9WA 4S1QH 3HMWL 1U8MB 1RPQA 3KS0H 5CHNB 5DTFB 3QZWB 3KJ6H 3GUTA 1KCUH 2PR4H 3FONB 1WZLA 3H3KA 4OTXL 2YKLL 4CNIA 3BYTA 1CGTA 1MRDL 4KKAC 1IC5L 4HT1H 5IQ7L 5I1IL 1DANT 1S7UB 3GEWB 2DLTA 4I9WE 3MRDA 3O6LH 4NOFA 3VXOA 4NRZA 1Q9WB 2H45A 2ILLA 2AXGB 4PJ9C 3VI3F 4JM4L 1ZT7A 2J5LC 1T20B 5H94B 4FTVB 2ITCB 1VFUA 4N0FB 4ZFFA 3MROB 3BPOB 1KT2A 1W8OA 1B0GA 3MO1A 1ZANL 35C8H 2I60L 2XA8H 4I3SH 5C0GB 3LQZB 3WIIH 1BOGA 5FCUH 3VXRD 4GW1A 3B4NA 2V2XB 3DGGB 2IFFL 3EHBD 1LE9A 1WSST 4EBQL 5KSVA 2XWJA 5JIIA 4Y4HC 3HZMA 5EBMB 1RUAL 3BX7C 3FQWA 1P4BL 1C12A 4XAKD 4I2XB 3HAEH 3ECBA 2FIRT 1U0QA 2ZP0T 4J23A 2BVYA 1G9ML 2BNUB 4YHLH 2YHGA 2P5WB 5H35B 2ZKHL 5C0JA 1CG9B 1DLFH 1JGVL 3PIQA 4NZUH 2NXZD 4F80A 2WWKT 4D9QE 1YEGL 1MLBA 2P49B 3DX8A 1I9IH 5H37G 1JWSB 2RCSH 3FQTA 3VXQA 4Y19B 1KYOK 4UT6L 4MJ5A 3GIVA 1T21A 3O3UN 4RGMB 1GH7A 3FO2B 4C59B 1J5OH 4IHOA 5EG6C 2BSSA 4L8DB 1ZT1A 1AR2A 5I18H 1T80A 4Z7UF 5KW9L 3WO3B 5SWZB 1SMOA 2IH1A 4DQOL 1LO0L 5DC4B 5IR1B 4Q9BA 1F4XH 1N64L 3DX7A 3K8LA 3QG7L 2YK1H 2HFEB 4EEEA 3DX9B 4TUKH 5B8CC 2CKBA 4JO1L 4FFZH 4HT1L 3QIWB 1IC5H 4NJ9H 1D6VL 4JY4B 3MMEA 3DXAB 3TT3L 1KXQE 1I8KB 3D2UB 5I8KH 1PYWB 5CP3H 3RNQA 2XACC 3C6SB 4R7DB 3WS3B 5KJRH 1QTYT 1IRAY 4LASL 5E2TH 3GBLA 5IB3A 4AH2B 4EUPH 2VDNL 5I1EH 1E4WL 3HE6A 5C6WH 4Y5XB 4WUUB 3MMEB 1E6OH 3BW9B 3T3PF 3O2DH 1KB9K 1CFTB 2WIMA 5B39A 4XC1L 5BZWA 1XFPA 3H9SD 5E2UH 3SQBA 5HVFB 2COQA 1KGCD 4K8RD 2DQDL 2ZG2A 3RIFF 2XXCB 1BBDH 4LARL 4N5UA 2Z31C 3QUMH 4ODWB 1N5YL 3Q0HA 5FGSA 1WFNA 2F8XC 4Z7QE 1MFAL 2EKSB 1NC2A 5IOPB 4P2QD 3UTTB 4JFDA 5C2BL 1MHPH 1P7KA 1T2JA 2BJML 3CVHL 4O4YL 4WUKL 5HHPB 5EC1A 3G6AB 1U8NB 1EPFA 5EWIH 4OGZA 4ZD3L 4L8CA 4JM2B 1NGPL 1T6VN 3BD5A 1RJZB 3BUYB 1FBIH 1JHLL 3TFKD 3MV9E 1S5HB 2Z8SA 4AQ1B 4LLVA 5DEZA 1XGQB 1ZT4A 3RWDB 4CU7A 3WUWA 4M5ZL 4QF1A 3SCMC 4X99B 3ZKMC 3WN5A 4XP6H 4PTTA 4DTGL 5KTEL 2Z93B 5HYFA 5DQDH 3IU4L 1KXVC 5ACZA 1QSFB 5GGRB 2EZ0C 1JRHI 2YRLA 4U1SA 1A4KB 1U6AH 3MRFA 4NM4L 4KUCF 2P24A 4JRWA 2X9WA 4KJYA 5LG1A 4MVBD 4LNRB 3IDMA 1BGXH 2JTDA 4OF8A 4LAQH 5ENWB 5JLZB 5HI5C 3UPAA 3VD7A 3EGSB 3E3QC 4LEXH 4WEMB 1U8HB 3FRPG 1NC4A 1HNGA 3OG6B 4LDLB 1AD9B 3FOMB 3RWJA 5TF1L 4NC2B 4XCFH 5ALBH 5FDWB 4FFVC 4GAJH 1OD9A 3MLSH 2Z31D 3PWJA 5FYJL 1H8OA 1KJVA 4BKLA 3UPRB 2GJ6D 3CJJA 4XMLL 1GIGH 3SDDB 4X7TB 4QXGL 1N0XH 2Y5EA 2W07A 3GBNL 5KN5B 4OCNC 5F9WC 5DRXB 5SWQB 1UACL 4Y4HA 3OXSB 5T1MA 1I1CA 1CR9H 1GSMA 2E8YA 3GMQA 2G75A 5DJCA 4QHKI 5CLTA 3H9SE 5D7KD 2GSGA 1JIBA 1KCKA 5EZOH 2R1WA 4GFTB 1YYLL 4U1NA 5B38A 4XPBH 5E00B 2ESVE 2XG4A 5JW4Q 4IOSD 2NXZB 5SWQA 1MEXH 4OM0H 3LV3A 5FKAA 2ADFH 4DVRH 3CC5B 3V7AE 1J8KA 3DTXB 4HGWB 1PG7H 3QDHA 2D0FA 4W6WB 2DS4A 4MD4B 2ADJB 2V2WB 4F2MB 3HUJF 1R3LB 1AGBA 2H2PD 2CO7B 1TJGL 3FQUA 2DM7A 4RNRB 2V7NB 4WWKA 5FHBL 4M7JH 2AJUL 1DBJH 5C9JA 1JNHB 3TCXA 4AYFA 2WMPA 4TOYH 1UB5B 4L3CB 4KPHH 4TSAH 5J6HA 1RFDL 4XHJD 2ICWI 3X3FH 3CFJB 1QD0A 1XF5B 1I85A 3INUH 3CFEA 3LKNB 4WI7A 4GBXD 3OGCB 3VFUB 3NPSB 4QF1B 2XRAH 3IAGC 2H8PA 1I8LC 4QCIB 1CE6B 1OP9A 3FAXA 5B8CA 4GH7B 1L7IL 4GW5B 4OFDA 5ACZB 3AB0C 1QFHA 1IVLA 4QHNB 5DD0H 3ARTA 4R97C 4X99A 1PKQB 2NLJA 5C07D 1I3VA 4HK0A 5DJXA 2IPTL 3LEYL 4AIZB 4MQSB 4X0KB 1GVIA 4UQ2A 1UM6L 5DZNA 5GRJH 3TM6A 5BXFA 3M1BB 5BV7H 3LRHA 2F9BT 3T0BA 1AO7E 1YNLH 2DQIL 1NBVL 1CLOH 5EC2A 4P4RB 5C08E 1SJEB 4XI5D 1U8QA 3PP3H 4NQTA 1J12A 5LXGL 4UDUA 4Y7MA 4KUCD 5CBAB 4K3EH 3OKMB 3N1MC 4X8XA 5D7SL 3C9NB 5J12C 1ZVSB 5L8KB 3G04B 1OF2A 4M1GH 4OI7A 5INDB 2CQVA 4JFYA 2J12B 4LVHC 1K8IA 2RFXA 1KN2H 3QG6B 3U36A 4J4PA 4MNQA 4JG0H 4K71B 4P49A 4IS6B 1AQDB 4PRBA 5CILH 3IDJB 3QO0B 4MQ7B 2ICWB 4WFED 2C26A 5DJ0A 5GJTH 1MUJB 3DWTA 3N50A 4OQTL 3GSQB 4QYOB 4U6XA 3SJVD 5CD5D 1K3IA 2BC4B 5FO8B 4PJAB 2EYTB 1QR1A 1FGNL 4NKIL 3BKCL 5EBLA 4X6DE 1KPVA 2CLZB 4DKDC 2BFVH 3CPLB 4KROD 4U1MA 5I66B 5A2FA 3QDGE 5D7LA 4Y4KA 2IAMA 5GRXG 1NAMB 1L4IA 3TT1H 1FZOA 2O93L 4G43B 1JMZA 3FZUD 4ORGA 3MBXL 5JO5B 4Z0XB 1LO5B 3JTSB 4LSPH 1XF5A 2LFGA 2X09A 1OAKL 3AS3A 4L1HA 2K7QA 1BQLH 3PL6B 4ISVB 3KPNA 5D6DC 3R1GL 4E0RB 3CSPA 4K94H 1UWXH 3MV11 4UINH 1CWVA 2Q8BL 5LVEA 4I9WD 3GIZH 4GAGL 4XNQB 5DFTA 5KSBB 2C5DC 4I0KA 3PNWB 4NNYA 5AZ2L 4OLYL 4LCWA 4X4YB 3QEQE 1N0LA 4KFZC 5FYKH 1MI5D 2C1OA 4JO4L 5GRVL 4M1CC 1F4WH 1JNJA 5EORH 4OCXH 2IADB 2Y07H 4YE4L 4JFXA 3GJFK 1NGZA 4HWEL 3P11H 4PFEA 3HPJA 3B3IB 4YDJA 5HI3D 1DVFC 3QCUL 1OARL 5ACLA 2ZCKL 2DMBA 3WIHH 5D6DA 3B6SA 4KKCD 5DK3A 1CL7H 3NFSL 2MKLC 3MRBA 5ANMB 1AXSB 2I5YH 4OD3L 2FJFB 5B4MD 1PKOA 1G84A 1ND0B 1PZ5B 3WSQL 1CD9B 1U91A 3QQ4B 3BZ4A 1G7JB 4TUJA 4WW2F 3DVNB 2VLKE 1CFBA 5DTFA 3PWLA 3T4YB 3MRJB 1S7TB 2AEQH 3QDJA 3L3IB 1FAIH 5E4EB 4MNHA 5ILTL 2R9HC 4OFVA 1GGIH 2X70A 1N26A 1Q8MA 2OMNA 3ILPA 4KY1H 3VXRE 1HXYA 4PJEB 4NO5B 1N59B 2E5EA 5FYLE 5T1DL 4LSUL 4P99A 2C3WA 2C9AA 2HLAA 4M1DL 4G3YH 3PJSA 2DIJA 4ZODA 4PLOB 5FB8A 1OAYH 1LMKA 4PJ7A 1A6TB 4PTUA 2DBJA 1DP0A 2N56A 3HC0B 1FZKB 1ZGLA 5MERA 1J86A 5SX5K 3SGJC 2RAMA 4BFGA 1N5AB 2QR0B 3AMKA 3GRWA 2AK1H 3ME0A 3MOAL 4R2GB 5E5MA 2DQIH 3P4NA 5DO2D 5I8OH 1MCFA 1K6QH 4U1LA 1LP9F 2NY3C 1IGYA 3E6FB 4PG2C 1U8LA 1JRHH 3ULVL 1IC1A 4OCWL 3OX8A 4F3FB 1FZOB 2CK0L 2QQLH 5J13B 2FECL 1LP9A 4W4OC 2NY5H 3I50H 1K5NA 1YMMD 3DRQA 3ZKMD 3FQXA 1XT5A 3LPWA 5C0BB 3PQYA 4DGIL 3F5WB 2X44D 4CDHA 4OIIL 3HMXH 2WIIB 1EGJL 2APVA 4QXTB 1JVKA 3GJEA 3GHBH 4KVCL 1RV6X 1P9MC 3RWFB 1MVUB 5ICZA 2NY0D 2W0FA 4P2OA 4U1KA 2WW8A 4PRIE 3ARBA 1XR8A 4NWUH 2ICWJ 1W0VB 3QCTH 5I66A 1JF1B 1A21A 3JWOC 4ODWA 1S7XA 1OP3K 3SGJA 5ADPL 4KUZH 4Z78A 5FM8A 1LHZA 5CSGA 5D72L 2AJZB 5GS0L 4WHCA 5D2NA 5B4MC 1HNFA 3OKDA 3I2CL 1AKJA 3BPLB 3VA2C 2ZUWA 3VD9A 1D7FA 3MLWL 1I3RB 2GTWA 3VXNB 3WHXB 3JV0A 2M8XA 3C2AL 2E7CA 1P4IL 3D9AL 4P2CG 5DUML 1ORSB 2FB4L 3B9KB 2HG5B 3C5JA 3BPLC 4HIXL 2K3TA 2D3VA 4XP5L 2ZCHH 2P1YA 2ESVD 3PHQB 1AGCB 3BYYA 2VL5B 2XTJD 4PY8I 4RFNB 5C0GA 3D3VD 3V52H 4KQ4L 4LQFH 3H7BA 4JM2C 5MEQA 4LVHB 5DMYA 4BZYA 2X70B 1LK3H 4NQXB 4HH9B 4Q2ZA 3SY0A 4EQ2A 3RKPA 5EO9B 4OB5L 1FNSH 2IADA 4X6EB 2JB5H 5CINL 4PJGB 1ZGLM 4TRPL 3O4OB 3P73B 4RMWA 3ZLQC 3GKWH 1HK6A 1AHWB 3TIDA 5TF1H 5EUOE 2VLJD 1Z3GL 4P23A 25C8L 5ANMA 1H3GA 5DVOA 2CD0A 4AL8H 1TQBC 1GGUA 3ARUA 3L7FB 2DMKA 1KNOA 3BH9B 3HS0B 3W39A 1QFUL 3UC0H 1MFCL 2R15A 3S37L 3THMH 4X5WA 2UUDH 1Q72L 5TE4H 3LVEA 1OL0A 4U05A 5D7JC 4UOJA 2BVPA 3BH9A 1AC6A 1MHHB 3HS0A 5C0ND 3Q1SH 1UJ3C 2JB5L 3LD8C 4XNQA 4GW1B 2YMXL 4WEBL 5L2KE 2DIBA 3O6KL 1FFRA 3VFVB 4QWWC 1NUDA 2VN4A 4WGVB 5F93C 2GK0B 3S34H 4F58L 1BFVH 2ZCLL 1RIHH 4K3DH 5IB2B 3H3PL 4XC3H 5JUEH 5KZCB 3FAWA 3R06B 2EIEA 5D96B 1LEGA 3TBSA 1JMXA 2EDLA 2DQUH 1SHMA 1RIVL 4M6NH 5CBEB 2QV2A 3B9DA 5DURD 2BOCB 3CNKA 3SQOL 3HMXA 4XBPB 1JV5B 4YDLC 3IDYB 3DI2B 3MJ9A 1F5WA 4X80L 1MCBA 5F7EH 1YEJH 3JV4A 4ELMF 4I13B 2MKWA 1F8TH 4XC1H 5HYIA 4DZBB 3UTSA 3MRPB 5FA3A 3DMMA 5ICXB 1TIUA 3ARQA 3O2VH 3O4LB 4F57L 4LVOC 2NX5A 2P5WD 3MRLB 4NQDD 4FFYH 1G7LB 3AM8A 3MOBL 4JN2A 4JANA 2QSTA 1FCCA 4UDUB 5HPOA 1JWMB 2OR8A 3FQWB 3ZZ1A 2P24B 3EO9L 1H5BB 3V5KA 3NGBC 4KRPC 1S7VB 3UO1H 2YOCA 5I76A 4XCYB 4FFZL 4KK8C 2YPVL 3SO5A 2FEDC 3TVMA 1Q94B 3D1MC 4AEIH 3VRIB 1X5AA 5HXMA 1URLA 1RZ8B 3B43A 3DBXB 3WUWB 4LPXA 4HS3A 1A1MB 1NBZB 1DBAH 4PREB 1SBBA 1IGML 1FFPB 2YPKA 2GW5A 3OHXA 4EN3B 4K07A 1H9VA 3AM8C 2O5XH 1WWWX 8CGTA 4L4TB 1SQ2N 4OZHA 1EFQA 4LCUB 1J5OL 3UDWA 2Z9TA 3KLSA 3U6RB 1F3JB 4O9HH 5E8PA 3F7QA 5D7JB 3FHAA 1I9IL 3MXWH 5JXEA 4XVSL 4YHMH 3O11B 4GKZB 4NKOA 5MP6L 2HKHL 5DLMH 2GSIB 4PRHE 4OBSA 5D7LB 5L2KD 1NCWH 2R4RH 2IAND 4PJAE 1NC2B 5IOPA 2EDYA 3KPMA 3MSPA 3LRGA 4D9RD 2C7UA 4F33A 1QBAA 1JHKL 2R1XA 4LF3A 5BRZB 4G3YL 3S5LG 1HH6A 4LSUH 4BSWA 2PTUA 2EYTA 1QR1B 5KVFL 3U0WL 5JZ7C 3LN4A 3S3PA 3MUZ1 3OF6D 2FL5B 5C0NC 3ROOA 2GTZA 5C8JB 4YBHA 3GSOA 1A2YA 2RHEA 5JW4R 3H9SA 4KRPD 4OZIE 2B0SH 3PHOB 4EDWL 4CVXB 2NY2B 4IDJL 2DQCH 1D5IL 4H1LA 3IXTB 4XP4H 2GIYA 3TP4A 3N0PB 4YFLF 3ORJA 3EFFB 2X4TB 2UY7A 1PSKH 5HDQH 4HUXB 1KFAL 5T5NG 1BQHA 1I3GH 5I71C 3MCLL 5HBBA 3S97C 3FT4A 1NFIA 4E41D 3L3JA 1HKFA 3LHPH 5BMFH 2ZCKH 1OARH 2AQ3A 1QFWL 1UEMA 3WL9B 2VLKD 3B5GA 4XWGL 4H5SB 3DVGA 3TYGL 1QFWM 2ZSWB 4BFEA 2MHAA 4GS7C 1DVFD 5E94A 3TZVA 2F53D 3QHFL 3HFMH 1AY1H 3QXTA 1T89C 5EUKA 4LSDA 2DRUA 5FO9B 12E8H 2AKRB 2WQRA 1FH5L 1IEBB 2DB8A 4ONHB 4U6YB 3RX7A 3WKNA 4OF0A 4RAVA 2W9LA 4QYOA 2EEBA 4JZNB 2OYPA 2X4UA 4PRDA 1T21B 5HDBE 3TNMB 5E2VL 1UC6A 4JY5H 2G60L 4QT5B 3HPLB 1BMGA 1MCEA 1NCCH 4JQIH 1FFPA 3NCYP 4PJIB 2OK0L 3QO1A 3G9VA 1YN6A 1D9KA 5I8CB 2AV7A 1S7SB 4Q6IA 3SE3C 4Z5RA 1U8HA 1ZVSA 1VADA 3WNNA 1IKNC 1TVHB 3U4EB 4QTHB 2JF1A 4MWFB 2NCMA 3P9LB 4ONFH 3I6GA 4MXVE 4KDWA 4HQQH 3QUKB 1R3HB 3WFDL 5ERWA 5JR1L 4UILL 1MCPH 1X5YA 1SYSB 5DGRA 2RGSA 1X5JA 4K7PH 3RBSA 2BSTB 4QRTA 4LFHD 4PG9A 1TZGL 5KANI 4L4VD 4X4MA 3WMSA 4HJJH 5HHVL 4NQDA 1CT8B 2RIKA 4YH6A 4JPKL 2PYEA 1T04A 2G75B 1RMFL 2W0LA 3MYJA 3OHXB 4NQCE 4CDGC 1B6DA 3GUTB 1BQUA 2A83B 2CKNA 3BT2H 2Q3AA 3SOBH 5ITBH 3NOIA 2DWEA 3CCHB 3EYVA 5C0AE 1KIQA 4ZYKB 4E41E 5I6XC 4AEFA 2B5IC 4PRPE 5JXAL 4FP8L 4JFED 5D7IB 3QWOB 3BEWB 1QG3A 1QNZH 4LMQE 5E7BA 3MRLA 4B50A 3WFHA 1CLOL 4E42B 3OJVC 1WCQA 1LE5B 1FIEA 4HJGA 1VB9A 4RNRA 2D7OA 1GZPB 2DWDA 3AXLB 5I1KH 4UT7H 4PB9L 4DZ8B 1UXSB 3H8NA 1JN6A 2DDQL 3FCTA 1W8NA 1YMME 2UZIL 5KVDL 3KLDA 1WWAX 1XIWB 2J5LB 3UTSB 5BRZE 4N0CD 4M4PA 3Q2CA 2OXHA 4XXCA 2VOTA 5J11C 3FO9B 5I1GH 4PY8J 5JOFA 1MCRA 2VERN 1OP5H 4N8VG 3L9RA 4L5FL 5DWUL 5I19L 3QH3B 4K8RC 4DKFH 2CLRB 3ARBC