1URLA

N-terminal domain of sialoadhesin (mouse) in complex with glycopeptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/immune system
molecule keywords SIALOADHESIN
publication title Complex of Sialoadhesin with a Glycopeptide Ligand
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1urlA00
4GKZB 3NAAL 1BVKB 3GHEH 1DQMH 1HHGB 3AY4C 4FZ8H 1YEKL 4M03A 4IRSB 4A6YL 3INUH 3RHWK 3BN3B 3MCLL 4XNQA 3W39B 4QYOA 1ZA3A 2YSSB 1HDMA 4OZFG 3ZE0E 4YXLL 1ZT4A 1CE6B 3MUY1 5HHNA 4YX2L 5D5MB 4NNPH 4N9OB 4F7TA 4MJID 1UH2A 5IEHA 1Y0LA 2NY0B 8FABB 3JWOH 3Q0HA 1CG9A 1CZ8L 4QHUB 1D5MB 1RUKH 5SWZE 1W0YT 3QUZD 4LCWE 2P8MB 3TM6A 2JB5L 5DUMH 1NBQA 4QRSA 3S88L 3EFDL 3EFFB 4ACPA 4TSBL 1H8SA 5F3HA 3VG9B 4WFED 1T1ZB 3BPCB 2Z91B 2I60L 3HN3A 5F7WC 4QRRB 1EUTA 4Z7UE 4LAQL 3U82B 4PLJC 1PKQE 4KI5E 3T65A 2A83A 5HHXL 2YA0A 3K74B 4O00A 2VDLH 4HEPG 5E7FA 2V9RA 5D72L 5SWZB 1FLTX 3WFDH 2HLFC 4OGYH 5FM5O 3RUGF 4LLMA 5H94B 2JK5B 4LLYB 2WINB 5D1QB 1U8KA 4POZD 5ENWA 1J1OH 1JI1A 2WBJD 3K4ZA 1F90H 5JHLH 4I77H 3PXHA 3VD7A 5J13B 1T04B 1IC4H 3CC5A 5HGBA 4HUUA 5DJXB 1RZFL 3BSZH 1VCAA 3HMWL 3CD4A 2C3XA 2PO6A 1CFSB 2J3SA 3T0EE 1RU9L 4NO3A 2VDRL 4P5TD 5I30H 4RQQA 1I7TA 1T2JA 4OM0H 5E8PB 1JVKA 2YS4A 4C4KT 5BRZA 4ETQA 1ZT1B 1WIOA 3H9ZA 2QTEA 5T1KA 4HCRA 3RTQD 1DUZA 1FG2B 5D7IE 2DQIL 4M48L 4GQPH 3T0EB 5D2NE 5DUPL 1YNTA 4PJCF 4X6DF 1UJ3C 1OGAB 5DEFA 5GGUA 4HBCH 3AS3A 3HMXA 5IJKA 5DJ8B 1ZLUK 3QDGB 4FN0A 4TNVK 3P30L 5L9DL 5HHOD 1AHWB 1CR9H 4L5FH 4Y8AA 3KLDA 1LDPL 3ARPA 1N5AA 4HKBA 3Q5YA 3OF6A 2JCCB 4OV5A 4ZS7H 1ES0B 1GH7A 1NGZB 4H8WC 2QSQA 1JWSA 2IADB 3WSQH 5DMKA 3P73B 5DHVA 4XAKD 2J4WH 2Q20A 3DUSB 4MJ5A 4XCYB 3EYOA 4KXZI 3T0AA 3MV7A 1JZ5A 3VXME 3VD9A 3JTTB 4LL9A 1QBML 4GG8A 4QRPA 3OKKA 2YPVL 4YIQA 1ZGLM 5AUMB 3ROOA 3S34H 43C9A 4I0PA 2NNAA 3OB8A 4NQXB 5M95B 1E28A 1EGJH 4XC3L 2ICEA 4L8CA 1A4KA 2Q87A 3T8XA 4WO4D 3MROB 1CFTA 3WE6A 3AS0A 3MUGA 3VXMB 4DVRH 4WI2A 4P46B 1J1PL 4OLZL 2NR6D 4WY7L 3BDBA 3IFNL 4YHIA 1JHKH 2OL3H 3P40A 5I1CH 4XP4L 1W0WA 4FABH 1V3JA 4J3SA 2YRLA 1CS6A 2BJMH 4I0CC 4X4XB 5CJ8A 1ZHLB 3ZLQC 1BBDL 1V7NL 4I9WE 1OT2A 3QNYA 3ZKXC 4BFIB 3QUXA 3SCMA 2HKFH 4NN6B 5BQ7A 1CQKA 1N4XL 1AGBA 4KV5E 1TVBA 2BMKB 4ZFZB 4JM2C 4M1DH 1MI5E 1T4KB 4NKDA 2Z8WC 4UNTA 3RVWC 2NX5A 4UIKH 5KAQG 3NABL 4EUPA 3O9WD 1S9WA 4I3RL 4IDJH 4MDJB 3RY6A 1A1NB 4WWKD 5CP7B 3A6CL 1LK3L 4NC2B 2OP4H 2VDKH 4L9LC 2I07A 4JG1L 2OR9L 4S2SA 3PIQA 2E7LA 2NY1C 2VXUL 2VR4A 1MI5B 2GI7A 3HA0A 4MSWA 3MR9B 1KCUH 2A77L 1AC0A 2J5LB 5CSGA 4YR6A 1FORL 4LBEA 2CO6B 4FFWC 5L8KB 5CEZE 4K3DH 1FFOB 1QR4A 3BN9D 3OAUL 4RA0C 5T1DL 5HYJE 4MNGE 1G6RA 3CLFH 4HS3B 5F71A 2ORBL 2HJKA 1GXEA 1W72H 5ANMA 4LU5H 3DV6A 1K4CB 5I76A 3LB6C 1S9XB 4YHLH 4F33A 3DVFA 1R3IL 4U6YA 5A3ID 5AD0A 5EORL 4N5EC 1MVUA 1KFAL 3AM8A 2DD8H 4MNGB 4LIQH 3VDCA 4Y5XC 1K8DB 3I84A 2VDML 1Y6KR 1GGBL 2C1OB 1JK8A 1ZHBB 1FYTD 3C09C 4N68A 1XIWB 1PSKH 2OS7A 5SV3A 4JJ5A 2O61B 4M7ZB 3IB4A 1U36A 4NC1C 3O3UN 4LLDB 2R4RH 2FIKA 5T1LA 3SHSA 3RZCD 2IMMA 3U6RA 3PHOB 4XNMA 2DIJA 5LGHH 5GS0H 1LE9B 2I9LB 5DJYA 1A7OH 4OCYL 1U9KA 5T3XL 2X4UB 5FO8B 1JGEA 3K46A 2JJUA 3HI1A 1HXYB 3SKUD 4DGIH 3CSPA 1EAPA 5IGXH 4KU1A 1NKRA 2VE6B 4Y4KC 4U2ZA 2QKIA 1T2QH 3ZSTA 3LAFA 1UWXK 3KPOA 3EYQC 1OL0A 4EI5B 4GRLD 2BVTA 2YD1A 3W82A 1IGIL 3MRMB 5FM8A 3GJEB 4BH7B 3QI9B 5A1AA 2XKNB 3MLUH 5DSCA 1FE8L 4LCCA 3C6SA 4OTXH 1OTTC 4EBQL 4R4BB 3AREA 1AE6L 1QYGL 1IMHC 2RCSL 1A1MB 4YZFE 4G6AD 1PD6A 4U1KA 2B1HH 2XKSA 4V2BA 2DIAA 4NZRH 5C0AD 4HWZA 1QRNB 2DM7A 5GS2D 3BD3A 2DQGL 2X1OA 1DQQB 1F4WH 4X7TB 3KAAA 4OCSH 1MFCL 1AXSA 1LVEA 3ULVD 4M4RA 4L1HA 2O5XL 3QXDB 5EZIH 1E6JL 4FFZL 5BZWA 4S0TD 4OF7A 3NZHH 3GSNB 4LSSH 3LIZL 5FA4A 2R15A 5B3JE 3MBEC 3VFOA 4KKCD 1CF8L 2Q86B 5EBLB 3LMJL 3QZWA 4Y4HD 5GXBB 4QXWA 4FQJL 4XPTH 3G08B 4LCUB 2QR0B 1IZJA 3G5ZA 3ULSA 1NC2A 1YMHA 1R24B 2X4TA 5D7IA 1LHZA 5DXWA 2XG4A 4JO4L 1A1OB 3QFJD 4NZUH 5D2NA 3VE0A 4L8SB 1NGYA 2GKIA 1TZIA 5CZVL 3LN5B 5JO5B 4AZ8A 1EIBA 2GSIA 3KS0J 1ADQL 4RMUA 5GHWH 2AJUL 4KK5D 3STZA 3VGAC 3O11B 1HH6B 3LKRA 2GK2A 1TCRA 3BKJH 2YD3A 3MYZA 1AGDB 4D3CL 3ULVH 1S7QA 3NGBB 1DL7H 3G04A 3EOAB 2AJ3B 3C8KA 3QIBB 2X1QA 4JKPL 4R4FH 2YKLL 5FF6B 4MA3A 1KCSH 2FIRT 2MCPL 3W9EA 4DGYH 2R39A 2JJSA 5E6YA 5E8DL 1MHPL 3GNML 4TTDD 3BQUC 2YPLE 5IHLB 1CFNB 1MWAA 1AP2B 5FB8A 2AQ3A 1T21A 3HLAA 2AS5M 2VITB 1R5IB 4LNRA 4FQLH 1H15A 3T4YA 3WL9B 3DIFB 1RD6A 3T2QA 1F6AA 3T3MF 5E8OB 1V7ML 4BH8B 4NNXA 3G5YB 3CFDB 2UWEE 1U3JA 4JM2F 1PDKA 2YPLB 4NHUA 5JZ7D 2CDFA 3T0XA 4TRPH 5D7JC 4PRPD 3BP6B 3OAYK 4R8WL 3D2UD 3KS0H 3WJLA 3LKOB 4YUEH 1GOHA 3GJFK 4OCXH 1U91B 4Y19A 1J12A 4IMKC 5FO7A 4PJ9A 5C0EB 1YQVH 1IL1B 4KTDL 2V2WB 2PTTA 2FYYA 3QA3B 3HI6H 5ID1B 2ICCA 1X4XA 3T4AB 2J2ZA 4IOFD 5F7UA 4MNQA 4MZ2A 4QY8A 1IGCH 5IW6B 2AK4E 4KQ4L 4M6OL 3OHXB 5FV2A 3AXLA 1H8OA 3P0VL 3G6AA 3EYUL 2H32A 4PJFB 3U7WL 1P4IL 4Y5YC 1INDH 4Z7WF 4JKMA 1LP9E 3CPLB 5IHUL 4Z9KB 4FTVA 5F1IB 4OM1L 4F57L 5INDA 3SKMB 5I1EH 4XXDA 1YC8A 2VO5A 3DX8A 4U49A 1OHQA 2AK4B 3U9PH 3L3DA 1A6TA 5T5NF 3AU1A 4OKVB 2FATL 2V7HB 1EEQA 1UH3A 1NEZG 3DNKA 3PV6A 2G75B 5L7XH 3QDAA 1AGEA 5HPMA 3SY0A 3G6DH 4RGNC 2X40A 4HT1H 1Q9WA 1A5FL 4GAGL 5HHVL 3RVUD 2EIBA 4FFVD 3L5IA 3P2TA 3VFTA 2CSPA 1H8NA 1AQDB 3MJ7A 4YO0B 3E0GA 4ZUVB 3WO4C 1LQSR 1KUMA 1HE7A 1IBGH 1YEHH 5DD6A 1RV6X 3HCVB 4AEIL 5A16B 3RPIA 3NIDE 1ZAGA 4KRPC 3EGSB 4DZ8A 1CVSC 3EYSH 1ULVA 1IC1A 4BZ1L 2DMCA 5I1DA 1E4XH 1OGTB 2I5YH 4TVPE 3QUZC 1QQDB 1UB6B 3ILPA 3DX9A 3QQNA 2XZCL 3SE9L 1IGFH 3TC9A 1PG7H 1SEBB 1UCBH 4G6FB 1KG0A 4XNZC 4MXQD 3RFZC 4YK4C 1KCKA 3QPXH 1A14H 2EKSB 1M7IB 5I75B 1Q1JL 4KK9D 9CGTA 2ARJQ 4XMPL 4G3YH 3E6FB 5GS1A 5I17A 5I18L 2APVA 5FXCH 2WZPD 3SN6N 4WW2F 1SYSB 4IRJC 3NH7H 4K07A 4WI8A 3KHOA 3LH2L 2WBJC 2A6IB 3AVEA 5ADOL 3GSUA 3ECBB 3IDMA 3QG6B 4YGVA 4XCEA 1E0OB 4QWWD 5DQ9A 3UJJH 3KJ4B 3WUWG 4YDLB 3I75B 1MPAH 4Q9RH 3H3PH 3QIUB 2R0LL 3SDDA 4RX4A 1F8TH 3VWKD 1VFAA 3IRPX 3U4BL 1XAUA 4GFTB 4X98A 4MMXC 2DQUH 4HWEH 5TQ0L 4LKXA 3VXRE 5F6HI 2ZP0T 4BUHA 3O45B 4PJ8D 1EMTL 1FAIH 3PL6A 4KQ3H 2BHYA 2EIZA 3V9FA 4AEEA 1S8DB 1U8MA 1S9YA 5I15L 1A6ZB 3QRGH 4H20L 5FUZH 4LGPB 5EZOL 4X6CE 3KYMA 1S5IL 4XPFH 3BZ4A 5H35B 1OTSD 4H25A 2CDEB 3BAEL 4BYHA 5D93C 1WAAA 4D0DB 3U9UA 2AP2A 5HGGS 1QLEL 4OLWH 3G5XB 4ZSOE 1SJXA 3WFEH 4GKSB 5CWSB 4BSVA 1U3HC 5BV7H 2FGWH 4JPWL 2Y9RT 3PJSA 2E9IA 2AGJH 4HHAA 5EIQA 1IT9L 2QV2A 1MCOL 3BIKB 1O7SA 1OAUL 4ZSOB 3SO5A 1C1EL 2DN7A 1HN1A 2XNAB 4KC3B 3H9SB 4JPIB 1CXLA 4YFEA 4NO2B 3VXUB 2EDQA 2YR3A 4P9HL 1EH9A 4OUUA 2D4DA 5F96L 2UY7A 1UYWH 2IH3B 4LSTH 2V6HA 5JIHA 4QGYA 2JB6B 4WO4C 1KIPB 2H6PA 1TDQA 4YQXH 5FYKL 3MRQA 4U6TA 5LJYH 3RIFF 5EA0H 2RQ8A 3IKCA 3RVXC 1CICA 4CU6A 1UXWB 2DWEB 5E1AA 1BQLL 1RK1B 5B21A 2FB4H 3IDXH 3OJDB 3MJ9H 5EU7E 1XEDA 1QTYT 4ZTOH 3DHJA 5EO1A 4FZEL 5EUOB 4JO1L 3VFPA 4NHCH 2PW2A 4LVOB 3E2HC 5C0ND 5FCSH 5EULV 3P4LA 1QBAA 3CLEL 3FKUS 1CGSH 1G9NL 2R0KH 1MQKL 4JG0L 3T77B 2VLME 2UWEA 2ZZUT 1X5FA 3H6JA 2XZZA 4YHNA 5HGDB 4JFXA 3IFOA 3W9DA 3UC0H 2YZ1A 5DD5H 4OFDA 3FQWB 2BNQA 4ZUWA 3OKEA 2KH2B 5I1HL 1OLLA 4NKMA 1FFQA 1CVRA 2I26N 4JJHA 4NCC2 3ARBA 3GBML 1N5YL 5E24E 3GI9L 2P44B 2G5BA 1RZIB 3CVIH 3TO4A 1BLNB 1DQJB 5DLMH 1GOFA 4OBSA 3V4VL 4TVSa 1HH9A 1ORSA 4X9HA 1BZ9B 1RJYB 4GMSH 4XVTL 5TDOB 4JY6A 3CCHB 1OCWL 1X5AA 4YDJA 1LP9A 3ZKMD 1SYVB 4ZAKB 3C5SA 1D9KC 3R8QA 4M7JH 2NY2B 1I3RB 3M45A 1YEEH 3ORJA 1TNMA 1IGMH 1QFPA 5CGYC 1NMCC 1SEQL 2Y36L 1KTLB 5DJAA 1ZHNA 2EXWD 1G7MB 1DE4B 2PO6D 1MREH 1AD0B 2F5AL 3CUPB 2VABA 5L2KA 1IAIH 5E5MA 5BRZD 2ILLA 1HZHH 5CILH 2DL9A 5T1KD 3LQZA 3O2DL 4S1DD 2M8XA 4Y16B 5FUOL 1KT2B 1P9MA 5T33L 4LPWA 5KSVB 4GKNA 3TPUB 3DVIA 3FMGL 3LHPH 3STBA 2O5ZL 3H0TB 4D9QE 2WUCL 4JFFA 5C3TA 1INQA 1YN6A 3IDYB 3WS6C 1CU4H 4JDZB 4MLIA 1YJDL 4OD1H 1YC7A 4PJXB 5KSBB 1IGTA 1ZGLB 1PG7X 4DVBB 5I8CA 3HZKA 4RMSA 4M8QB 3TT3H 1N7ML 5E56A 1JGUH 4XP6L 4KZDL 3FFCB 2BX5A 1XGPA 3MRNB 5DQJB 5DC9B 3FT2B 3P0YL 4QHLA 3VG0H 5IT2H 4GRLC 4WNQB 1LEGB 3O4LE 2B1AL 2A6DA 4QXGH 1BFSA 1VACB 4JFED 4Y2DA 4OD3L 4M4PA 4U3HA 2BSSA 1W2KT 4GBXB 5KVFL 1ND0A 2X4PB 3WN5B 3FOMA 1YEGL 3M8OL 1XGRA 1L0XA 4ELMF 3P4OA 3SQOL 4TSAH 3O4LB 3MLVL 1N64L 5E2WH 1JPTL 5DJCB 1CLZH 1S9KC 4GRMA 1X5LA 4D0BA 2IQ9L 5TFSL 1B0GB 3IS1X 1WITA 3O2WH 2GSGB 5C9KA 5L0QC 5TE6H 4U1NA 3VXRA 3QUXD 5KSAC 3SCMD 3C6LC 3R4DA 2CR6A 1RIVL 4XPHL 3ZDYF 1G0YR 2NX5D 4O58H 3X11B 3SDXE 5LVEA 1HK6A 1JF6A 2DI8A 3AAZB 5FECA 4JY4A 4FXKB 5HJ3A 1CXIA 5KTEL 3LS5H 4OLYH 4X4YA 1S7UB 4PBVC 4Z95H 3KYOA 4Z7VA 5C09E 1OF2A 5C6TL 2OI9C 4CMMB 3K2UL 1ZLSL 4P57A 3P11L 4E41E 2OLDA 3V6FA 4A6YA 1V05A 1FH5H 1H5BA 4PV9B 4WEMB 3TFKD 5DR5L 2Y6SC 3DUUB 3WMSA 4KKAC 3TJHD 1HQ4A 2WLZA 3NFPB 2ZUWA 4LDEB 4IEFB 2MTPA 1EXUA 3TBVB 2VDNL 4XP5H 5CGMA 4E41B 3BD5A 2EYTB 3R0MA 2NQCA 2Z31D 3Q1SH 2W0FA 4XNXL 4PJBE 5BO1H 4NWUH 1G9MC 3TNNB 3NACH 2WSKA 1BX2B 3CXDH 2GITB 1GSMA 3REWB 4C56B 1KXVC 3H2WA 1R5WB 1T89A 4Z0BH 1H0DB 2VLJD 4DN3H 2XZAH 5EB9A 5ALBH 5T1LD 4J3UA 3KLAA 5E94A 3GSOA 5DHYA 1T03L 5E1HB 4I0KA 1SHMA 4PJBB 1L7IL 1BVLA 2IAMB 4XT1C 4Z7QF 1G84A 1OAKL 1QFHA 3N50A 2H3NB 5IMLA 3ZHLA 1QVOA 2ED7A 2ENSA 3MCKA 3TBSB 3D0VB 2AEPH 4JAMB 5T5FL 2A74B 3BGFB 1MRCL 5LWYH 3RWJB 3B8YA 4IS6A 4Q6IA 4EUPG 4QRUB 1MCRA 3U7YH 4JREC 3MREA 3FT3B 5EC2A 5EU3B 1LO2L 4G7YL 1L7TL 3F65A 1MEXL 2ADGB 3BO8A 5DRZA 2OTWB 1CE1L 1CXFA 4G6ML 1CL7H 1JMXA 4HIHA 4OGAC 4KDTA 1N0XH 1BMGA 2K7QA 2KZ1B 2NYYC 5FK9B 3V6BR 2DQHH 4QCIB 2PCPA 4XB8A 3TO2A 4F7PB 3N1GC 3QCUL 1OM3H 1OAYH 3ARED 4BSWB 3F5WA 3G6JA 5KG9B 4N90E 5FKAA 5SX4H 1YNKL 3U7AA 1NCCL 5CZXD 1G7QB 5FYJE 4FFVC 5ADPH 4Q2ZA 1FNFA 2ZOKA 3RDTB 3SE3C 1ZVYA 2KDGA 1C5DB 4U4BA 5BVJA 1QLRB 3QPQD 4RWYH 5C8JB 2ESVB 3TN0B 5BXFB 4PJAE 4AENA 3B9KC 1QBLH 2GFBA 1KYOJ 2J88H 1CI5A 3DV4A 1I1YB 4XAWL 1NUFA 2X1WL 5C0RH 5KJRL 2EDOA 3KPRE 3L6FA 4FFYH 2CLZB 3GSWA 4YHKL 4GW5B 4FQHA 5JXEA 2BVPB 2ZNXA 1KELL 4D94A 2AQ2A 2D2OA 2X4RB 1KPUA 1UM4L 3CFEA 3S97C 5MEOB 5BW7A 2XY2A 3P77A 3B6SA 3NBNA 4JHBA 1HHHB 3BZEA 4IJ3C 2P46B 4TPRL 3OKMB 3LV3A 4OZHB 4H1LB 1C08B 1M71A 4HXBL 1F45A 4GRWB 3KPRB 5MI0B 2UUDH 4E5XA 4PG2A 3IAGC 4PR5B 4U0QB 1CGWA 4O51A 4L3CA 1T7WA 4KK9C 2VSCA 1RZGA 2X05A 1YEJH 4HAFA 2CGRH 4Y1AA 2XWTB 4KAQH 3KPNB 1VADA 1LNUB 5D2LE 4YDKH 1W0VA 2OJEA 2WWMD 3DO3A 3FRUB 4OCRH 4ZODA 1I9JL 4MAYC 2HA1A 3JUYA 4PD4J 3E3QE 2IPTH 3DURB 3VRLF 3FAWA 3RI5F 1QLFB 3FQUB 4QWWC 2YD8A 2YPKA 1BD2B 4M5YL 1ZEAL 3K81A 1D5ZB 3CVHH 3GKWH 4P4KD 5D2LB 3WS3B 3U2SA 3BXNA 2BRRL 1VKXA 1U95A 3B83A 2B4CL 2BFVH 3B2UD 3LEYL 3UYRH 5HD8D 3MJ6A 5GZND 3THML 3TYFB 4HIJA 5C0DA 3ARGB 5E2UL 4URTB 4AIZA 3GFUA 3UPRA 3CFJB 5E9DE 4R96B 1NGXB 1NBVH 4UQ3B 5EBWB 5C0BB 1TQBC 5C70A 1GGIL 2IWGA 4MD5B 3D48R 1OP3K 5GS3A 1UWEH 5IVXF 1AD9A 3GMRA 1RUPL 4OFKA 4XTRC 2VQUA 4Y19D 3VWJC 1NL0H 3BWAB 1WF5A 1DVFA 4PJ9D 5EZJB 1OD7A 5E9DB 4N0FA 1X5IA 3QUMH 3BFOA 5LBSL 4O02L 2QQNH 4MNQD 4U1JA 2EDFA 2WV3A 2CMRH 1XH3A 3SDXA 3ETBF 5JOFB 3NCBB 3VFRA 1DN0B 4XCCL 2JELH 5KVDL 4FTVD 1TVHB 3WNMA 2HJLA 4HKJB 4NRXA 4WEUD 1FJ1B 4ENED 4OKDA 5DC0A 5C9JB 4K71B 4KJWD 4ONGH 3AC0A 5HDBE 4YHZL 4QTIH 4N1HB 5JW4Q 5EO0A 5FO9B 3T0DA 4P3WA 1A22B 3OKDA 4WUKL 5DURD 3WKML 5D1ZB 1NMAL 1IARB 4CW1A 5ILTH 4RMWA 1U8LB 2H2SD 2Z4QB 3DROA 3LKQB 1KGCD 5ISZA 2W9EH 4ALAH 3EJZD 4FQIL 1U8OB 1HIML 3DBXB 4YC2C 5JDJA 5HY9A 5C07D 4JZJC 4OAWA 2SEBB 1VFMA 4JM4L 2XFXB 5A40E 4JZOB 4LSRL 2H9GB 3QHZH 3QEQB 5AG8A 4X9BA 1FNSH 4RGMC 3Q5TA 4WGVB 4YFLI 5C08D 1X6NA 4MD0B 4P2OA 3N9GL 3WDHA 3W0WE 3ZKND 3X3FL 4X0KB 3GMOB 1I1FA 4W4NA 4X9IA 3ARWA 1A6UL 3I9GH 1MJJB 2XA8L 1UB5B 4YNYB 2ZCLL 3VFGH 4F15C 3TZVA 2CKBH 3QDMD 3B2VL 3QSKB 3X3GH 3FO9A 3W0WB 3NA9H 1FZJB 1RHHB 1QKZH 2F54E 5JXAL 5MENA 3EZ8A 4I18C 4HLZG 4F7CB 2CH8A 3SGEI 3SGJA 4NPYB 1T5WB 3CIQA 5H37G 2K9UA 5D96B 1A6WL 2A73A 4ZYKA 1AR1D 4FG6C 1N6QL 1EERB 2OSLA 3ULUL 1JWUA 4G8GB 2FBOJ 4RX4D 1U8HB 1F6LL 2PO6C 4GUPB 5LQBL 4UUJB 5ETUB 4KK6C 3U36A 1UVQA 5DK3A 4WI9A 1ACYL 4PRIE 3TCLB 4NRYB 5EU5A 4KKLD 1CDUA 3TNMB 5DGQA 1K3ZA 2BOBB 3PL6D 3QHTC 2CLVA 5FUCE 2LAGB 4ZO8A 4NZTH 2HVJB 4NQED 4TUKH 1FFPB 1T6VN 4PGBA 2R1XB 3UROR 4S1DC 1K6QL 1LD9B 1ADQA 1OSZA 1JWMA 1SJHB 1ORQB 4PGEA 4IIQB 4M43H 5F9WB 1WZ1H 2R1WB 1KLUA 1ZOXA 4MA1B 5D70H 1RULL 2HTKC 3QXAB 5CMAA 3FN0L 4FQ1L 1QACA 5IROA 4MA8H 5IMMA 3GHEL 1CD8A 1DQML 35C8H 4K3JH 4XWGH 4FZ8L 4ZS6C 5MEQA 3MOAH 5ICYA 1VESA 1MCQA 1CYGA 1J0YA 4XI5C 4EDXA 2NXYB 4CNIB 3HR6A 3QUYB 5GSVB 1FFNB 3TCXA 3PV7A 4PJHF 1EEYA 4NNPL 2EE6A 3JWDC 4G8EB 2NY4D 3RWFB 3HKFA 5I8KL 3MLTB 3TT1H 2R4SH 4PV8A 5EIIA 4I0PC 4NDMB 2QBWA 2DKUA 3HZYA 1AXTL 3L5WA 3OBAA 4JFDE 4GJTB 3ZDXE 3MNZA 2OMBA 1NUGA 5I8OH 2FHFA 2DRUA 4UQ2B 1FPTH 1Y18B 2VDLL 3CDCA 2VAJA 2EYSA 1KBGL 3CK0H 3OB0K 3WFDL 1J10A 3JV4B 1F42A 4UILH 5DVKA 4X6DB 3UTSA 1FNGB 3QUXC 1FVEB 3IGAA 2W0LA 3DI3B 1BFVH 4XHJC 3EDJA 3KR3L 1KCRH 5IV2A 1F90L 1YMMB 5FA3B 5I8EA 4ORGA 3DO7B 3CZFB 2ARJB 4YDIH 1X5HA 2VLRE 4LRNH 1HOCB 2DBJA 5GZOD 1NBYB 3BSZL 4S1RH 4L4TB 5B22A 5F21B 2C1PB 3QIWA 3LKSB 3HC4H 3LKPA 3PWLB 2YD9A 5IB4B 1T5XB 3MRHA 4QHMA 3MV8B 4OFYD 2E7LC 1LGVA 3Q5OA 4XC1H 4OM0L 4BZ2H 3ARBD 4GAFB 5KS9A 1IEHA 2X4QA 3GB7A 2ATPB 4GMTH 2ZSVA 4NQDB 5J12C 1UXSA 1WIUA 5E6IB 5I1JH 2VLRB 3TO4D 1RZKH 3MUHL 1QFOA 2VYRE 3MGOA 2DF3A 4OB5H 2V7NB 5C2UB 3ROLA 2X1XR 3BH8A 1C8PA 3QCTH 3BW9A 4WVRA 5D5MA 5JOEA 4PRBB 3L5HA 3WO3B 2HKHL 5JOPE 1CR9L 1I85A 3GM0A 2WWKO 3GJFA 1K2DB 5DFVD 4GW4B 4HUXA 4QHUA 5BVPL 1HYSC 4YBLB 2DDQH 3AM8C 2X7LA 4J7RA 5ICZB 3S4SA 4LHUB 2V17H 3PHSA 1IQWH 4FMKA 5BV7B 1A21A 5E95B 1T1ZA 3BPCA 1A7RH 2MSPA 3VXSB 3BP4B 1FCGA 4K3HA 4QRRA 3BUYA 2IQAB 4XP1H 2BDNH 2J4WL 5L2KD 4H26A 1T20B 5CBAA 4XMLH 2E9WA 5KVGH 4PY7A 4HWNA 2NY0C 2GUOB 5GISL 2DQJH 5GRJH 3E6HA 2FSEB 3S34L 3J8F7 3HG1A 3EOBB 1BBJA 1T0MB 1ZHKB 3MRBB 1GC1H 2OZ4L 4FQPA 3O3DA 4M7KH 4JFFD 1KTDA 4ZOCA 5DO2D 4DVRL 1A6AA 3MYJB 1T04A 3NCYS 2XOTA 1H3PH 1JGLL 3OPZH 1MFBL 3BX7C 1LK2A 1BFTA 4YPGB 4FABL 3VRJB 2BJML 2HTLD 1F3RB 3P9WB 3FB7A 5D1QC 1G7LB 5C2BH 7CGTA 1KNOA 3FT4B 5E8PA 1KC5H 25C8H 2YMXL 3QG7L 3VFUA 2GK0B 1BOGA 5LG1A 1J8HB 4Y2DD 2XN9E 4LCCC 3AREC 2F54A 3NCJH 5K59E 2MPAL 3F7QA 4GSDH 4HGMA 1OGAA 3SPVB 4KVNH 3NCCB 1FLRL 3TWCH 1FL3A 1KENL 1S7VA 5TJWK 3QXWA 3ZE2F 3QDGA 3A6BH 3DYPA 5A43C 3QPQC 3VXOB 2X4SB 3TV3H 5EBGA 5CD5C 5HYSB 4PFEA 4F80A 1ES0A 1ZTXH 1ZSDB 1XR8A 2ZUVA 3GRWH 4P9MH 3MRGB 3HUJE 5F44A 5JORB 4ONHA 2XQYK 3RZWA 3Q6FB 4PRIA 4Z76B 1F3DJ 1GPOH 3D5OF 2NXZD 2X4NB 4LU5L 3KDMB 3O3EA 1OP5K 5DJDB 3QQ4B 1MFDH 4ODBD 5J6GB 1FNEB 4U6XB 3OXRB 1A7PH 1YPZE 3GUTA 3HUJB 5H2BB 2DD8L 3L3GA 5D2NC 4LIQL 3VXTB 1BZ7A 1I3GH 4FNLL 4FXGA 2AJZB 2DBLH 2A9NL 1T1XB 1UA6H 2HLAB 1N59A 2MKWA 4MXVE 5K9OA 3QB7C 4XNUH 2P49B 4MA7H 3ARTA 3NPZB 2CK0L 3I50H 1ZT7B 4WFHE 1CLOL 3CX5J 4G42A 4HWBH 1ZA6B 2DYPB 1RZJC 3GMNB 1X44A 4H5SA 5GS0L 5JHDB 5LGHL 5IBTH 2CDGA 3PABB 1MF2H 1INEH 2BY3A 2R2BA 4BFIA 1EVUA 1FHGA 5HHPB 4JFYA 1MY7A 2JJSC 1LO4H 4MJ2A 5DZLA 3SDAA 1VENA 3TH3T 4DGIL 5B39A 5DVOA 5F7FA 3C08H 5A2JH 4MQ7A 5F3BA 1M6OB 3IAQA 4CL7A 2XTJE 1F3DH 1IAKB 1T22B 3TBTB 1K5NB 3K1DA 4JRYA 1T2QL 2DIBA 4LF3A 2BOCA 3F7YA 2NY6C 1IGJA 1UJ3B 2NCMA 2R9HD 3X12B 5IB5B 5KANI 2ZOLA 3KXFA 4S0SD 3WBDA 5F7DA 2XTJB 3MLUL 4CVZA 3M17A 3NCEB 1CD0A 2BNRE 4HH8A 1YEKH 5I1IL 1XT5A 2DM2A 1QNZL 1D5BA 1U8QA 3ARDA 2W65B 3BMWA 4V1DB 4YXLH 2B1HL 3CH8A 3DETC 4FQCH 1C7SA 1S9XA 4YX2H 5IFAH 2HMIC 2BNRB 1F4WL 3O2VL 1EX0A 1A3LL 3QQ3B 1K3IA 1L9NA 3BH9B 1CZ8H 1MIMH 1YEFL 2NZ9C 4W6YB 1Z9OA 1F4XH 3PWPB 2JB5H 4L8BB 4ENEC 3S88H 4XX1E 2YC1A 1UQSA 1SJVA 4AEHL 5I74B 1DQTA 1CDHA 2BVQA 4LLDA 5F93C 2I60H 4LAQH 3PHOA 5HHXH 3DX6B 1AGFB 2WP3O 1L0YA 1LE9A 4MWFB 4NN7C 5DQDH 2A6KB 5D72H 1IFHL 2H2SC 4MQXD 4NZUL 4LAJH 4YXHH 4H0HB 1RUQH 5FYJU 1NC4B 2EDJA 4M7ZC 3FFDA 3FQXB 4HUVA 1ED3B 2VKWA 5GJSL 1QP1A 2IFGA 3ZKXB 4MCYA 4PLOB 1HEZB 2MKLC 1F00I 2BXYA 3MGAA 2UZIH 3EO1B 4JM2B 5JDSB 5K9QG 1CDBA 2LABA 2AKRB 2NW2B 3RGHA 4W68A 5TGBB 3JV6A 4L3EA 3MNVB 5D7LD 5FCUH 1SJEB 4U1GC 1OQXA 1DL7L 1RZFH 3ZE0F 3HMWH 5IOPB 4NOBA 5DRXB 4DGYL 1RU9H 2VDRH 1I1AD 5GGSB 5ID0A 5BS0B 4L9LB 3FB5B 3VI4E 4AT6B 2VDQH 2NY1B 3IDUA 1KIQB 4K23L 4DFIA 5I6XC 2V2XA 2CRZA 3C8DA 4MDIA 4B53A 2V9QA 2J6EA 2BSTB 1D5XB 5A2LH 1FV1A 5IW1A 3KYNB 2EZ0D 5IB2B 4Z7WB 4M48H 4P23D 4KH2A 2WMPA 3GSVB 5DUPH 2JF1A 3HFML 4Z7UF 1ODAA 4EI5C 4KI5F 2BVOA 3WEXA 4Y1AD 3BZFB 3T2NL 5GS1C 4ZMAT 3CSBA 4CVXB 3P30H 1G7IB 5GRWA 5MHSD 4NQCE 1LDPH 4JQVA 1XGTA 2DQTL 4KVCL 4XZUB 4JFQB 2R69L 4DUXA 2P5WB 1MSPA 1XGUB 4Y5XB 5J6HA 4L4VE 3SDYL 3HI6L 3C09B 4P5KA 4RA3A 1AR1C 2Q86A 3WDJA 3KNBA 5I16B 1OW0A 5CSBA 1JNHB 5IHZB 5DYOB 3SDDC 4ZO7A 2VXSL 3IDJA 2QR0A 3IXAB 1QBMH 1FO0H 2ZKHL 2YPVH 2WP3T 2Q1EA 5DD3L 4KKLC 1IVLA 3PL6C 1OARL 5C71A 5L88L 4PJGE 1HHKB 2CUIA 1R3KA 1QHPA 1NDMB 3O11A 1HH6A 3U9PL 1WICA 3MRIA 1JFQH 1J1PH 4OLZH 4WY7H 4UV4H 1QD0A 3WV0A 1FZKB 3ZTNH 4F9PA 5L7XL 4BFBD 2P8PB 1DVFD 5D7IF 5DJ6A 1WTLA 4Y4KB 2AJ3A 3S36L 5FF6A 4GXUM 4PB9L 3RX5A 2EEBA 5J0BA 4EQ2A 1GZQB 1U0QA 1V7NH 1NAMA 5GGTA 3IAPA 5EZLA 5D7SH 5FGCE 1J5OH 3SKNB 2NW3A 1N4XH 4YFDB 5ECJE 3LOWA 3OKYA 4ZOAA 1CFNA 1IBGL 5EIVA 1BF8A 4YHPA 3NABH 5CIPA 2R2CA 4KXZH 4I3RH 3SQBA 2YA2A 3A6CH 1P2CA 1KEML 1H3TA 3VXQA 4OI7A 1LK3H 3QCVH 5IVNA 1NLDL 4ORZC 3G5YA 5E4EC 3CFDA 4JG1H 1E4XL 4NQVB 4YJZL 3ZYOA 1M05B 1KJMA 2VXUH 3MMEA 3RWEB 3BP6A 2A77H 4R6UA 1IGFL 1PG7L 2DJ4A 1FORH 2R29L 1UCBL 2VLKE 3C60D 4I5BA 5ISZD 3WFHA 4XHQA 2JJTA 4QOKD 4UIMA 4G80A 5T3XD 1CICC 4N8CL 1A14L 3NMEA 2QEJA 3GIZL 1L6XA 2W38A 1ZLVK 1KB5B 1CDGA 3MBEB 3MRRA 3OHXA 3EJYD 4OQTH 1BQHA 5SWSD 1EHXA 2NTFB 4Y89A 2CLRA 1R3IH 3NH7L 4NT6A 5EORH 2OCFD 4U33A 2QLVB 5DVNA 5DMGD 2VDMH 2YK1L 1GGBH 3S98A 1S7SB 2VKXA 3CX2A 4NO5A 2HT3D 1HINL 1FZMB 4KV5F 4U1HA 4P2OD 1MPAL 5D9SB 4N8PA 4Q9RL 3H3PL 1XCTA 1CK0L 4W6WB 1F8TL 4X83A 3VGAB 4FQXD 4M1CD 2B5IC 4HJGB 1Q9LA 4X5LA 3NZ8B 3KLHC 4GKOA 3V0AC 4S1QL 3ARBC 3FO0L 1KJ3H 1FAIL 3REVB 4OCYH 3TZVD 1AQKH 4XCNB 5D6CB 5T3XH 2JTDA 4WUUB 5F9AC 3QRGL 3VCLA 4OZIA 4HC1L 5MEND 3CU7A 3IVKB 4HX1B 3KPTA 3MRKB 4JANB 3QJFA 2VERN 5E03A 3WFBH 4WU7A 3BQUB 4HPOL 4OZFB 1P4LA 2DTSA 5IF0B 1FQ9C 2CO7B 3EGSA 4APQB 1MCKA 1DP0A 4OLWL 4DWHA 4ZUSA 4XP9L 3WFEL 3RWDA 4KRLB 4L8DB 5BV7L 2X89A 3IU4L 2FGWL 4MHHI 5LXGL 4GXVL 4R9HA 2AGJL 1UB6A 4U1MB 1IGIH 1K4DA 3QWRA 4WDIA 4MJ6B 1FE8H 3HZMB 5D7JB 2F53A 4EBQH 3UTQB 1AE6H 2B8OT 3QDHA 1LEIB 1JI2A 3UPAA 1F13A 2RCSH 3MBXL 3I3DA 3L1OL 5DZOA 4NFCA 1LO5A 1P9MC 4J8RA 5F8RC 4MB4A 1NCWH 2NY3D 3AMLA 3MFFA 4LSTL 2DQDL 2JIXD 2DQGH 4WHYG 1V3KA 1U92A 5DO2C 5IR1B 3QH3B 2O5XH 4F8TA 3GSRA 2CRYA 4Y5YB 4HMEA 4NO0D 5EA0L 4KTEL 3RQ3A 4LPUA 1T2XA 4XCFL 4HIEA 1U8PA 3NCMA 3PP3H 3LIZH 3IDXL 4XB7A 4EVNA 4HMCA 4DKDC 2BVEA 2W59A 3LMJH 4NC0B 2DQEH 4ZTOL 2EIEA 2P24B 4FQJH 1RURL 4JQIL 3ZL4L 4RGNB 1S8DA 4JO4H 4IDLA 1IQDA 1VERA 3FJTA 4ZQKA 3H42L 4Y2DC 2FJFA 1EK3A 2IBZY 1S5HB 4MJIE 4G8FA 2FEDD 5H35A 2NY5C 1I8KB 2PYEE 3PDDA 3UC0L 3WO4B 4UAOC 4PRHA 4FQQA 4KJQC 4D3CH 3PDOA 3C9NA 4L4VA 4GKSA 4YZFF 3V5HA 3EO0B 4KRPB 4KJPD 4JKPH 4U1SA 3CVIL 1BJMA 2MCPH 4HBQA 4OZ4A 2PYEB 1V5JA 1IRAY 1MHPH 2CKBB 1I9EA 2FD6L 3GNMH 3QUZB 3DMMA 1DQLL 3UTSD 3ZHKA 1KEGL 4MD4B 2YBRA 4KUZH 1EEUA 4P4RB 1QA9B 3H9SA 3KPLB 1DLHA 4UTBL 3UJIH 1BWMA 4Q9CA 1HCFX 1RZ8B 5IB3B 4XNZB 2ADFL 2W9LA 5B3JF 5IKCB 1A64A 4U1IB 4YK4B 5CBEB 4BKLB 3BEWB 1CFVL 1V7MH 1UGNA 4JEGB 3QEGH 4PJ5A 5JW5A 2OQJB 1H3UA 2CRIA 1KIPA 1NGWB 4DCQB 4X6FA 3F58H 5J9PB 4R8WH 5DA4A 4NKOA 5E8EA 4IRJB 3WIHH 4CAGA 2VISB 1N2RB 1ONQA 2WBJB 4WI4A 3MO1B 4KTDH 5CILL 1IAIM 4ZFGL 4LSVL 4RFNB 4IRZL 5E5UB 1EEZB 4Y4FA 2AV1B 4QXTB 4G43B 1H5BC 2F19L 1KJ2H 1UT9A 4XBEH 1G1YA 3VFMA 4JVWA 1HHIA 4CJ1A 4YDVB 4KQ4H 1PJ9A 4CU8A 3P0VH 3EYVB 1GAFH 4P5TB 2VUOA 3EYUH 5HDOA 1CU4L 3OKNB 1P4IH 3CMGA 5IHUH 4K8RC 4F57H 1VHPA 3GMLB 5EOTA 5HHOE 3UJTH 1JGUL 4OCMC 3QDJB 4QRRD 1T89C 2FATH 2Z35A 2VLKA 5AEAA 5D1XA 3VG0L 5D93B 3MLYL 1AIFA 3BZDA 1YY9D 1P69B 2YN5A 4XAKE 5SWZD 1A5FH 4GAGH 5HHVH 3L9RA 3HC3L 5HHOB 1R3LB 3HG1D 4H8WL 4ODWA 1AKJB 2UWEF 1U3HB 5IM7B 3S5LA 3DRQA 5HTSA 5GGRB 3VXNB 4R3SA 1HWGB 4OCNC 4ZXBA 2NY7L 1H3VA 4OCWL 1MIEH 2WIIA 4ZAKA 4AEIH 4RFOL 4NQTA 3L3OB 1CDYA 1A8JH 4LARL 3H8NA 4LPVA 3RVTC 5J57B 3DYMA 4J4PD 3RNKA 4G9FA 1P53A 4BZ1H 4TTGA 1G7MA 3DX7A 5JW4N 3UAJD 1MCBA 3TP4A 3MSPA 3TGXA 1WZLA 3GMMB 4RFEB 1T7VA 3SE9H 2Z93A 4KDTC 3BOVA 2QHLA 1LP9F 2AAVA 3OKOB 1GCFA 1K8IA 4WO4B 3S37L 4QRQA 4GG6E 1F6FB 5C0CA 3CFBB 3K80A 4Z77A 4Y16A 5AAWA 1L6ZA 1EUUA 3T0ED 2P4AB 2KPNA 1Q1JH 1OGAD 2HFEB 4XMPH 3OGCA 2LVCA 4X99A 3QDGD 4NWTH 1UJTA 4P2RA 4GG6B 1A9EA 3FCTB 3PWNA 3E2HB 3RPKA 1HI6B 3IJHB 4M8QA 4TOYH 4U1LB 1FGVL 1JNLL 4Y5VB 3S4SG 2WBKA 3V5KB 1WT5A 1QR1B 3FFCA 2R0LH 1TPXC 3C5ZC 1JYXA 3VFNA 5HYQA 3TIEA 2O5YH 4Z0XB 1OVZA 5F6HJ 1XGYH 5JXEC 1WC7B 4X5WB 1D3CA 5DDHA 3NIDF 3QNZB 5DUBB 2XG5A 3HE7A 4R26H 4LOUC 4XP5L 5BW7C 1VACA 4JFZH 2F5BH 4YLQT 3EAKA 5MP6L 4GO6B 1CL7I 2EECA 2X4PA 3Q1SL 5HYFA 3JVGC 3TVMA 2DKSA 2P8LA 4NWUL 2EZ0C 4PG2C 2FZ3A 4X80L 4O2CA 4X7SL 3BAEH 1FYTE 2XZAL 1QLEH 1P84J 5FYKD 4PJEA 4WHTB 2HFFB 5SX4I 4I4WA 4OQ1A 4I8DA 4MXWH 3BPOC 3ARFA 3FTGB 1NDGB 4J3OC 4CBPA 5DJZB 1I7RA 3HC0A 4JPWH 1JN6B 5KSUA 4BQ6A 3WN5C 1NMCB 3TBYA 1IT9H 4LGRB 1FL5A 3CSYB 1FNAA 1MCOH 5CEXB 4LCYB 1FYTB 2MMXA 4P3DB 2XTLA 2AEPL 1OAUH 3D69A 5GGQL 2VLLA 3ZO0A 1F11A 3SKOB 3X11A 1C1EH 3QO0A 3CDGA 4PTTB 1RJLA 1P7KA 5DRWA 3U7YL 1H3WM 3RZCB 4MJIA 2BCKB 2NZIA 4JRYD 5IG7B 3UYOD 4X9GA 1G7HB 4OZGA 4AM0A 3WIIH 4IBLT 3GEWB 3EHBC 5DWUL 5CKGA 1CL7L 4HDIB 4JN2A 3KXFD 2WM0A 3WIFB 3TPKA 4WW1A 4N8VA 1NANI 5B8CB 2DQHL 3S7GA 2IPKB 1DUYA 1OAYL 2RAMA 3D0LA 1MRFL 1BOYA 1IEBB 4X6CF 4XBPA 3SKJH 4M02A 1BQLH 2Y7QA 2ZG1A 4D9RD 5ADPL 2E6PA 4J1UA 3MJ8A 5I1LB 3RWIB 2ZUXA 4YHOH 2GY7B 4F7MA 1JV5B 3NIFE 3MV11 1KTRL 1YYML 4RWYL 1AXIB 4GRLB 2YXMA 1FN4A 1SQ2N 1GIGH 5C0AE 1QSZA 1FZOA 1G9NH 2J88L 2VZSA 3LDBC 3P4NB 2VNCA 5IVZB 5DS8A 5F70A 2HVKA 1A2YB 4K94C 1B0RA 3ULVE 4F37K 4FFYL 5DTFA 1F3JA 1NCBL 5I1HH 1HHJA 4I3SL 5IBUG 1PZ5B 3H7BA 5F89A 4NJ9L 4WV1A 3HS0A 2BSRA 3GBMH 4JDVB 3H3BC 1MJ7L 4AIOA 3KPSB 1N5YH 1JPFA 4NQUA 3GI9H 1O5DT 4Z5RB 3UTTA 4MVBD 3L7FB 4NCDA 2GTZB 5CSZB 3F7VB 1XF2B 4TN9A 1ITCA 3HAEG 3K4AA 5CUSL 5DI8A 4XVTH 2FWOB 3H3KA 3RL1A 5L0QB 1KB5L 3QFJE 1EGJA 1S7XA 3T0BA 1OCWH 5B39G 1KB9J 5KSAB 3BP7A 3C6LB 4Y88A 1EHNA 2CGRL 4LLQA 3EJYC 4ETYA 4ELKB 4X4MA 3F6LA 4HS6A 5IVXB 3DPBA 1MCEA 3PQYA 4XGZB 2OL3A 1C16B 1WLHA 2Y36H 1S7TA 4QRTB 2FR4B 5DMGC 2EO9A 5F6IB 3X13A 2PYFB 2ZCKH 3WNLA 1WEJL 4TNWK 1T1YB 3AB0C 4QCIA 2C7UB 4LCIH 4UTAH 5CHNA 5HI5C 2YXFA 4PJIA 3ARUA 3CFCH 2IALA 2Q76A 2EXYD 3L95A 2OI9B 4QHNA 1T7XA 2AI0H 3O2DH 1NEZB 5FUOH 4FS0A 4B0MM 5T33H 3STLB 3RHWF 3RDTA 4B7LA 1VEMA 2Z92B 4F3FA 1QRND 1NBVL 1C5DA 2VR5A 1IC5H 3UZQA 5C8JA 4JGUA 2BY1A 1YJDH 2EDDA 1B4JH 1UWEL 1XCQB 3WNNA 3SGJC 3SDCA 1E4KA 1I1YA 1Q94B 1NQBA 1TNNA 2DI9A 2QSCH 2X70B 3HRZA 4PGZA 4PRPE 4KZDH 3GSQA 2GJ6E 4PYGA 2BVPA 3QUML 5IQ9B 3HR5B 1W72A 1NPUA 2QQNL 3ZYIA 3P0YH 5EC1A 3D1MC 2FL5B 1FCCA 3OR6A 3TN0C 4DZBB 4WJ5B 4DUWA 1F4AA 2VRAA 4PRDB 4LHUG 4OD3H 5D4QA 1KF9B 1FBIL 2JELL 3ELAT 5E2JA 3SBWA 1T3FB 4PRPB 3O9WA 4LK4A 2GJ6B 4WWKA 4UU9A 4X6EA 4KHXL 3CSGA 2P42B 3Q6GH 1BM3L 1BFOA 4QTIL 1GYAA 2XWTA 5D7KE 1N64H 3ZE1E 1JPTH 3IDGA 3FRUA 5TFSH 4HV8B 3BRGC 1QSEA 1Y6MR 1Q9KB 3IFPA 4JREB 2IH1B 3QIBD 5EBMA 5IROC 2ZUYA 2VJXA 3GSNH 5FYLL 4LSPL 4UBDC 2AABH 3GIVA 1BD2A 4BELD 2ICWA 1VGKB 3WUWB 4OLXH 4XPHH 4KGJA 3W11C 2ADJA 5I1KL 2P5EB 3HNSL 1Z5LA 5JIIA 1WGOA 2A9ML 3FO2B 3LPWA 3E8UL 3BEVA 5KTEH 5BJTA 1KV3A 2MJWA 5C0BA 2FX8L 4MD5A 3QR2A 4AH2B 3RKDD 3WLBB 4TNVF 2BHZA 1J05A 3OAZH 4K2UL 5KN5B 1LEKA 3NIGE 2R23B 4B5EA 3B9KB 1HSBA 2W60A 2Q6WB 4GAYB 4F58H 3EW3B 3LKNB 3ISWA 2HT2C 5DR5H 4ZNEA 1OWRM 3IJSB 2CKBL 5LAXA 2RIKA 2E27H 4MS8D 2G9HA 3KPMB 1QKZL 2VDNH 4ZPTA 1NBZA 2OR8A 1KTKE 5EOCJ 1VEOA 3ES6A 2ADIA 4IJ3B 4HZLB 3RNQB 1A9BB 3QO1B 3HPJB 3QNXA 1Z0NA 1R3HA 2QQKL 3QEUA 2ATKA 3D85B 5IIEA 4HUWB 3HE6C 1U41A 3U0PB 5D1ZA 3SDXF 4PRAB 4GQ9L 3EDFA 5B4MC 3QIWC 1UKQA 2D7OA 1JHTA 2CR3A 4KJYB 1U8LA 1JRHI 4R2GD 2BZDA 4ISVA 1XF3B 1PY9A 4MAYB 2PUQT 1YEIH 3I02A 3DBXA 3FQRA 4NZTL 5BOPA 2Q7YB 3FQNA 2WIMA 4KI1A 2HJFA 4CN4A 5EUKA 5T5FH 4M43L 5C0AA 5C0FB 2AXJA 1OWWA 5ICXB 1IM9A 4MA8L 1MEXH 35C8L 4K3JL 5BCAA 4JO2L 4OUOA 2X89D 3KPPB 4G6MH 5EOCH 4Z78A 3VMOA 1F58H 3S96B 1TQBB 4JGJA 3QWRD 2FHCA 4G6FD 4Q7DA 4Y4HA 1D6VH 4JHWL 4PJBF 3QCUH 1MNUH 2GHWB 4HK0B 5ERWB 4HS8L 3VWJB 4NRZA 3QFJA 1YNKH 1JRHL 4Z6AT 3G5VB 5FM5M 3BHBB 4PJ7E 3MRFB 3ZKQD 1BQHG 4ZDHA 1M7XA 2DL2A 5DRNA 4TUJA 4BM7A 1TITA 4LKCB 2VIRB 5ESVB 3CH1A 2XPGA 2V2TB 1FPTL 5EDXA 5KJRH 5DK2B 3QIUD 1A0QL 5LGJA 3CK0L 1KLGB 3FB8A 1JGDB 4PJ7B 4F9LA 1QFWM 2ZSWB 4UUJA 3UAJC 2VWEC 5IESL 1UM4H 2YD2A 3F7RA 5ESAA 2BOBA 4TPRH 3D9AL 3VA2C 2LU3A 5J3HD 4TVPH 3RY4A 4YDIL 2BXZA 1SJHA 4YC2B 4S1RL 1G7PA 4ZFFA 4JZJB 2V5TA 4XNQB 4QYOB 1ZA3B 2C5DC 2GCYA 2HFGL 1HDMB 4PRHD 3HC4L 3IDNA 4X5XA 4RMRA 1AI1L 1ZT4B 1EHLH 4HPYL 1ZANL 3D2UA 1YN7A 5HHNB 4X8JA 1OPGL 5IEHB 3B5HA 1Y0LB 1QG3A 1NFIA 3VXPB 5DVLA 1XF4A 2NY5H 4RGMB 3I2CH 1ITBB 1CG9B 5DD0H 4CNIA 3I3BA 4OB5L 4PJAF 3DMMD 3ZZ1A 3RUGA 1ZEAH 1ZLWK 3MLWH 1FFNA 4QRSB 2C3VB 4UT9L 5I1GL 5HI4C 4DQOL 2BRRH 4RNRB 3U4EA 3H9SD 3LRSA 2B4CH 3VXUD 3LZFL 3LEYH 4AIXA 3THMH 3T65B 5HXMA 2A83B 1CT8A 1OSPH 5E2UH 3BE1L 4AMKL 2DDQL 4F15B 4O2EA 2UV3A 4PJ5D 1IQWL 1GGIH 3CJJA 4IOIA 1A7RL 1MHEA 3ARXA 3PDGA 4LLMB 1PYWA 4KROD 1RUPH 2BDNL 2CK2A 2OX5A 5ENWB 3F12A 4ZUTA 4XBGA 5KVGL 4WI6A 3HZVA 4HJJH 5JW3H 2XQBL 1WFUA 5BRZE 3CC5B 5HGBB 4O02H 4RBPK 1LILA 2GJZA 5D2LF 4PJCA 2PO6B 4P3CH 4NO3B 3SDAC 4RQQB 1I7TB 3G9VA 1AY1H 4XCCH 1I4FA 5KVDH 3BP5A 1H3PL 3OPZL 4ETQB 4NUJA 1U93A 3EJJX 3UEZA 5T1KB 1HYRC 3QP3A 4NM8L 1CFQB 3L7EA 4HF5H 4EEEA 2C1PA 1DUZB 4WUKH 4FRWA 2I27N 4EN3A 2EDBA 4NP4L 1PBYA 1YNTB 2AVGA 4HH9B 3WKMH 5ITFA 5D1XD 4C58B 1KPVA 4NZDA 5GGUB 3S3JA 2CUHA 1XGQA 4NQDA 3QFDB 2H2PD 4K8RH 4Q74A 2BC4A 4PB0H 4FQIH 4ODUA 4M6NH 1HIMH 1N5AB 4HKBB 2E7CA 2V7NA 4OV5B 4GSDL 4ZFOB 3ARDC 4JM4H 4ZXBD 1JWSB 2APBA 4ZAKD 4LSRH 5DMKB 4DFHA 3RL2A 3KJ6L 2NY2D 2IBZX 1HILA 4MJ5B 3EYOB 2FJGA 3MV7B 2HT4D 2QADD 3MLZL 3PE9A 5E6IC 4BQBA 2AJYL 2DLTA 1A7QL 4GG8B 1ZTXL 4QRPB 4YIQB 2PNDA 4NGHL 3GRWL 3ULUD 4W70A 4P9ML 3ROOB 43C9B 3DRTA 3I6KA 2YEZA 4I0PB 1CBVL 3N9GH 2MNUA 3X3FH 1TFHA 1E28B 3VWKA 4L8CB 2ICEB 5DF0A 1A4KB 3V0VA 4HGKC 3T8XB 1A6UH 3OX8A 4JRXA 1CFTB 3WE6B 3MUGB 2XA8H 1I8LC 2VAAA 5C0CD 1ZVHA 4PJ8A 5HDBF 2ZCLH 1RFDL 5MERA 4Y16D 1DJSA 2EICA 3ZMRA 1MCWM 3B2VH 4KK8D 4BZYA 2NX5E 2APWA 2VQTA 5JXAH 4RGOL 3ZTJG 2RJMA 4XNUL 4P2RD 3QNYB 5T3ZD 2C3GA 3QUXB 4NNYB 3MRLA 5BQ7B 3I50L 4OGXL 1AGBB 3MNWA 1TVBB 1A6WH 4N0UE 4NKDB 2NX5B 4U2YA 2ZNWA 1N6QH 3FFCD 4X4ZA 1DFBL 4EUPB 4OI9A 1S9WB 5IBTL 1HKFA 1DEEB 3CZJA 1MF2L 1H3XA 5CJQL 3MJ9A 4KPHL 2XZQH 3TESA 3L3IA 3VRIA 1ACYH 2I07B 3RWHA 1MJUL 1J9CT 3C08L 3PIQB 4S2SB 5ANME 2AXFA 4MSWB 2YRPA 3AY4A 4ZNCD 4GBXD 5J12B 2EXYC 4YR6B 4LBEB 3S5LG 3RY5A 3TVMD 3KLSA 1G6RB 2W1NA 4E42A 5BOZG 3O4LD 2HJKB 5JR1L 5ANMB 1RAMA 3U0TA 3VXOA 1RULH 3FONA 4C4KO 1MELA 3DV6B 3FN0H 1YDPA 4FQ1H 2VLJE 5I76B 3ARFD 3SGEH 1U3YA 4JQVC 1CGXA 4F33B 1PQZA 4O2FA 2KBGA 5AD0B 4N0CD 1XMWA 4G9DA 1G9ML 3RRQA 2D9QB 3AFLA 4PRNA 1JK8B 1N6VA 3WXVL 5CD3A 1OW0C 3QHFL 4JJ5B 2F74A 5DJDA 4FQCL 5IFAL 3JTSA 3DHMA 5I8KH 2FIKB 2Y5EA 5T1LB 2FHBA 5H2BA 5EU6A 4N1EA 4OIIH 3U6RB 2Y07L 4XNMB 5HDLA 2F58L 4OF6A 3SJVA 1MIML 1F4XL 5DJYB 1OTUD 3KG5A 1AXTH 4MZ3A 1SBBA 1MLBA 1ZLUH 1R3JA 5GJTH 4F9PC 2VL5A 5JHDA 2VZUA 1HXMA 4A2MA 1RJCA 4J6RL 5DQDL 1KBGH 5CP3H 3VJ6A 4XVSH 5J89A 4LCWB 2HP4A 2QKIB 1T83A 4YXHL 1HQRA 2GEEA 5ACZA 5IP4A 1RUQL 3KPOB 1FVCA 3V4UL 4Z7UB 4M3JA 1PKQB 1KPRA 3KR3H 4G5ZH 2UZIL 1XFPA 4AYFA 4HULB 1X7QA 1T1WA 1N6UA 3C6SB 4LCCB 5FCUL 1JZ3A 4IMLA 4U3CA 3AREB 1FFRA 3JZ7A 4C56D 2R0WH 2DS4A 2RB8A 3BJLA 1CLYL 4QTHA 5IFJA 3ILQC 2H26A 4G7VL 4U1KB 1RQ5A 4P48A 2G2RA 3DTXA 4JB9H 2VDQL 3DSNA 4DK6A 1DN2A 2IAMD 3UTTD 1G9EA 2NPLX 1AXSB 2JJTC 4K94H 4HJ0D 1U6AH 3ZT7A 5BZWB 4D9LH 4M00A 3PWUA 3ZDXF 3KWWB 1MCDA 4MNHA 1WBZA 5FA4B 2Y06L 4R7NA 3O0RL 2HKHH 3VFOB 2PW1A 2XTJC 3LSOA 3QZWB 1FVDA 3BKCL 3PQYD 3FZUD 3T1WA 5GRVL 3G5ZB 5BVPH 3BDXA 3ULSB 1NC2B 2V9TA 2X4TB 5D7IB 3VH8A 4L8BA 2D7TH 1OLZA 5D2NB 3VE0B 3GMPB 1S78C 1NGYB 4WTXA 1TZIB 4EQ3A 2GSIB 4N8VG 3ABZA 3STZB 2ZUQC 5JQHC 3LKRB 1ROWA 1TCRB 5GISH 1FO0L 3MV9A 1A4JA 3W2DH 3TYGL 4JFEA 1S7QB 2YD4A 2DKMA 3RDTD 3G04B 4YBHA 1ED3A 2OZ4H 3C8KB 4W4OA 5I74C 3RVVD 4MA3B 3TH4T 1BIHA 3W9EB 2ITCA 2ESVD 3ARYA 3UYPA 1JFQL 2ERJC 2AKRA 4KGLA 4UV4L 2MOVA 3SDCD 2H41A 4Y8DC 5TGBA 3UZVB 3ZTNL 1JGLH 1MFBH 5EH1A 3S6CA 1MWAB 1JUFA 5IOPA 5FB8B 1T21B 3HLAB 4MGXA 5TDPA 4LNRB 4Y19E 1WWWX 3QEHA 43CAA 6FABL 2NY6B 4X7EC 5D7SL 1J5OL 2EDXA 4M9PA 2YMXH 3QG7H 4NNXB 2EYRA 3MACL 1IZKA 4MNQE 4NHUB 1F2XK 2CDFB 2J7LA 2DAVA 4WTZA 2BSTA 3I85A 4GW1A 5IB2A 4PIRF 4Y19B 2MPAH 4PLKC 3OJ2C 3ZHDA 5FO7B 4PJ9B 3QCVL 4JKWA 1XR9A 1FLRH 2PTTB 2FYYB 4FTVE 1KENH 4Z7OE 2VDOH 4MNQB 4QY8B 4N0UA 3EBAA 4MX7A 1Y6NR 1QSED 5C0JA 3AXLB 5GQBA 5FYJH 1UM5L 1X4ZA 1YY8A 5F1NA 2HN7A 3G6AB 5GS0D 2H32B 5D71L 3BVNB 1UWXH 4FTVB 1TQCC 2FRGP 1BD2D 5INDB 3S3SA 4XXDB 3DX8B 3CAFA 3L3DB 4OQTL 1UWGH 5C07E 1A6TB 4Q9QH 2D3VA 3AU1B 5DURB 4U31A 4H1LH 3PV6B 4GRWH 3SY0B 5HYJB 3ARGD 4NN7B 2Z31A 1Q9WB 3WLWC 4FNLH 5C0BD 1GHFL 2A9NH 5I2IA 4JQXA 3VFTB 4CU7A 1FNLA 3MJ7B 4DEPB 2VLJA 2CK0H 4Q58C 1EPFA 1CLOH 3WHXA 2F8OA 4Y4KA 3U0WL 5ACLA 4KKNA 5K59F 3GMQA 5DD6B 3CDYA 1O7VA 1KJ3L 3HB3D 3RPIB 4K3EL 4GLRI 4U1GB 1AQKL 1JBJA 3K0WA 4DZ8B 3AS2A 1MHCB 3GO1L 2ICES 5I1DB 1E4JA 2OXGA 5MEPA 5EU4A 3DMMC 1HKLL 3ILPB 4WW2A 3BESR 3DX9B 4XNYL 3WFBL 2YN3A 3HUJF 3BKYL 5I6XB 2Y23A 5IMKA 1WTGT 2A38A 4I1NB 1QZ1A 3F6IA 5D1ZD 1RK0A 4M62H 4NYLA 1YPZF 2NLJA 3V4PH 1NJ9A 5GS1B 5I17B 2YUWA 2R56L 4CADB 4B41A 3QT2A 2MFNA 4KROC 5I1IH 2DQCH 2LTQC 4EI6A 1QNZH 1FDLL 3V5DA 4MXVF 1WWBX 4J2XA 3GSUB 1WSST 3O8XA 4YGVB 4WHCA 4XCEB 4Y4FC 2GQHA 3PP4H 3V6ZA 1TETL 3S35L 3D39A 3P9LA 4NQEE 3WHE0 3UTZA 1NCWL 1RUAL 3SDDB 1VFAB 3QEQD 4DW2H 3O2VH 1IM9D 1A3LH 2C4FU 3L3HA 1WAAE 4LKXB 2C26A 4YBQC 5GGSY 1S7SA 1YEFH 1SBSL 4OF5A 1MJ8L 3KPQA 3PL6B 4HCRL 2XQYG 3NFNA 1U8MB 5D9SA 1T66C 4AEHH 1OQOA 1S9YB 1VSCA 3DYOA 5AZEL 3O6KL 3KYMB 4N9GA 2DQEL 3HMXL 3BZ4B 3CVHA 4H25B 2A1WL 1LDSA 3OAYH 3U9UB 3OZ9L 1IFHH 4QGTA 1IAOA 3IU3A 3P4MA 3NFSL 5D6CA 2H2PC 2GAZA 3W0WD 1EFQA 4ZFOL 1P7QB 3P3YA 2OMNA 5EO9A 5GJSH 4HX1A 3MRKA 3PJSB 4X7CC 2H8PA 3UBXA 4HHAB 3V0WL 3OXSB 4ZXBC 5JQ6H 3BGAA 3JWDL 5JNYB 1ZMYA 2M1KA 3AMKA 2L4OA 4L8DA 4ZPVA 2XT1B 4G8GD 2ZWLT 3F8UB 1U8NA 4OUUB 2N7BA 3QUMA 4LLVA 4G6JL 5GRUH 1V3LA 3ULUC 5FKPA 5GSRA 5E4EB 2HWZH 4HEME 4MJ6A 4E0RA 4K23H 4P4KA 1A7NH 4KUZL 4DKFL 4APQC 3R06A 1IGYA 2H6PB 3UJIL 4IMKA 3IFLL 2J8HA 3O41B 3LCYA 3IKCB 4HXAL 4O9HL 1VB9A 3HFMH 1CICB 5E1AB 3VGBA 4XPBH 3QEGL 3T2NH 3L5XH 2EC9U 1YZZA 5IBLD 1CIUA 4QHKJ 3F58L 5EO1B 3MLXH 2DQTH 1EFXA 2BNQE 4KVCH 3VFPB 3WIHL 3MV01 2R69H 4Y5YA 1KOAA 2PW2B 4ODVL 2D03L 4NKIL 4C83A 3SDYH 4UMGA 2NXYD 5IUSA 5JMOC 1KJ2L 3QUYD 2UWEB 1W8NA 2ARWA 4XBEL 4OI8A 1NGQL 2VXSH 5E99H 4YHNB 4JFXB 3IFOB 3W9DB 5B38A 3EOTL 5TF1L 2BNQB 4ZUWB 5IB1A 2B5IB 2ZKHH 1GAFL 3HE7C 5DD3H 1TVDA 4NKMB 3M1BA 1I7ZA 1OARH 5L88H 4YH6A 3ARBB 1RJZA 1FL6A 3VI4F 2G5BB 3UJTL 3HPLA 3TO4B 5KVEL 4NBYB 1M7DA 3JWOC 1HH9B 1ORSB 2JJVA 3WDIA 4JY6B 2IPUK 4YDJB 1LP9B 3C87A 4NUGH 1QEWB 2FJHA 3S36H 2CXGA 3C5SB 2B2XH 4RCAA 2P43B 4PGDA 5L2KE 4PB9H 3ARFC 5EFIA 5EWIL 2CKBA 3I6GA 1G7JA 2IMNA 4OLUL 1ZHNB 5DJAB 5C07A 4M61A 4MD4A 5I66A 2WAHA 1MIEL 2GY5A 1YMMD 4LQFL 2EDWA 3Q3GB 1I7UA 2VABB 1RZ8A 5L2KB 5E5MB 3RGVA 4JFFE 1IC7H 1KEMH 3BYTA 2ZUUA 1QUNA 3LQZB 1NLDH 4L4TD 3HAEH 4XVUD 4EN3D 3MRPA 5C08A 4KTYA 1NGWA 4U6HA 5GGVH 3MV8D 3QUKA 2GIYA 4H0GA 2Z9TA 1T0NA 4NQDD 2R29H 4PJGF 4JGMA 1INQB 1YN6B 1MCIA 4P2QA 1IGTB 2FX9L 3FB6A 2QSVA 4N8CH 3HZKB 3QDMA 3JV0A 3GBNL 1Q9OB 3GIZH 1JPSH 3FO1A 5BZDA 4ELMA 1AO7A 4POZC 1JHLL 4KRMB 4NWTL 4QHLB 4E9LA 3SOBH 1PLGL 5J11C 3JBG7 2YK1H 4RFNC 4TOYL 2A6DB 1MFNA 1HINH 3F62A 4Y2DB 4QT5A 3VXSD 1ND0B 3B3IA 1CK0H 3P9MA 1DDHA 3FOMB 2O5YL 1BAFL 1XGYL 4JRXD 1X4YA 4P5TC 2COQA 4UAOB 3P4OB 4R26L 3QXUA 4S1QH 3PG2A 4WV1C 3FO0H 2M2DA 4JFZL 2F5BL 5FEBA 4GRMB 4K7PL 4D0BB 3TA3A 3DVNA 4NQEA 2V5MA 3RTQC 2V5SA 4HC1H 3KGRA 4HJ0C 5L2JA 1M1SA 3MC0A 3QXVA 4U1NB 3LS4H 1NFDE 5DMJB 3VXRB 4RMVA 4HPOH 2O26U 1CDIA 3GKZA 4XP9H 2YD6A 4Z7VE 4MXWL 3IU4H 2IBGA 2A6JA 4AG4L 5FECB 5LXGH 4X6CB 5HDQL 4JY4B 4GXVH 2AK1H 5HJ3B 2EC8A 2K1MA 4NJAL 2PXYA 1VFUA 4X4YB 3KYOB 1J8HD 4DN4L 4F2MA 4RIRA 1R0AL 1RZJL 3MBXH 3L1OH 4P57B 2D0GA 3VD3A 3MGTA 2HG5A 3V6FB 4A6YB 1XZ0A 4I2XA 2XYCA 1H5BB 3PF2A 4U7MA 3WIIL 3S8WA 2DQDH 4AK1A 1EJOL 2E7HA 1GZPA 3RVVC 4OF3A 3QJHA 1HQ4B 4AL8L 5CFHA 5IJVB 4U1LA 1EXUB 1GL4B 2NR6C 2OYPA 3SDCC 1E4KC 4PJDE 4YHML 1F02I 3B4NA 4KTEH 4PGCA 4XCFH 3SKJL 5CCKH 1C7TA 2W0FB 1JNJA 4NN5C 3UO1L 4Z0XA 2VUYA 5F9OL 1JYNA 3FRPA 5KW9L 4UT7H 3RWCB 3GM8A 4YHOL 2IG2L 1RURH 6CGTA 4JQIH 4ZUUA 3ZL4H 2XRAH 2RBLA 4JZNA 5EU6D 3PNWA 4Y5VC 5E94B 3WJJA 1GIGL 3OKLA 5DHYB 4D8PB 3H42H 4QKXB 4GH7B 3SJVD 4BQ9A 3O9WC 1BVLB 2HLFD 4WWKC 5DT1L 1QHOA 3PHQA 1BGXH 1B3JA 3O3BA 5IMLB 2CRMA 1QVOB 3MCKB 32C2A 3V8CA 3LN4B 4DKAA 4KUCF 4OFYA 1D9KA 1N8ZA 3IJYA 3FTGA 1NDGA 5JHDD 3L3KB 4IS6B 2OBGA 4Q6IB 1V3MA 5EOQH 3PGDA 3MREB 5EC2B 3V6OE 4WWID 3G6JE 1YYLL 2YOCA 3BN9C 5E0QA 2D31A 2FD6H 3MRJA 5DRZB 3BO8B 3X14A 1PG7W 1DQLH 1W8OA 4DUVA 1KEGH 4JDTL 2AW2A 3RWGA 4HIHB 3SKOA 8CGTA 5CEZL 4UTBH 3G9AB 3TO2B 2PCPB 3J7HA 2ADFH 2LU7A 2X6MA 1MAJA 5A3IC 3F5WB 3G6JB 4N1CA 2W92A 1CFVH 5IFHL 3S36X 5FKAB 4HDIA 2ZCKL 2AEQH 2UYLB 2K7PA 2L7UA 2B7DT 4Q2ZB 4NCC1 2ZOKB 4MLSA 3VW3L 1EZVY 3WS6A 2Q8BL 4LCIL 4MB5A 4UTAL 3MZGB 3GZKA 3PGFH 5BVJB 2EDRA 3CFCL 3SGKC 2J8UE 2AXGA 3RZCC 4ZFGH 5GGRY 1U8IA 4AENB 1NGPH 2UZXB 4LSVH 5DEGA 2AI0L 4IRZH 2GFBB 4OLEA 5T1MB 2F19H 3DV4B 4TUOA 4V1DD 1TPXB 3C5ZB 1UC6A 3L6FB 5SX5H 2FLBT 1X5ZA 1RIUL 1IC5L 4FQHB 5B8CC 1KPUB 1B4JL 3CFEB 5F7EL 4Y1AE 1Z0MA 3P77B 1VDGA 5DZNA 3B6SB 3PWPD 1E27A 5MHSE 1A2YA 3LV3B 3GRWA 2QSCL 4XRCA 1Q8MA 1M71B 1OAXH 5E00A 5F9JA 3BPNC 4OF0A 1Q0XH 4E5XB 3QWOA 2H1PH 4O51B 2MQCA 3MLYH 4M1GL 2DLHA 1RZGB 4NOFA 4KHTL 4Y1AB 1XF1A 3MV9D 1VADB 3HC3H 1RUMH 3D87B 5F88B 2VMFA 3BPOB 4H8WH 1W0VB 2OJEB 3F7VA 2FWOA 2NTSP 3Q6GL 4K9EC 3VMNA 2EDHA 2NY7H 4G6AC 4OCWH 4LSUL 3NN8A 5I1AA 4JM2D 4RFOH 4LARH 2YPKB 1WCBA 2MWCA 1FAKT 3U2SB 3BXNB 1C16A 2BVUA 4OD2B 4HWBA 2E3VA 4CMHC 1U95B 1VKXB 5KAQF 3ULVC 3BT2H 4AEFA 2ZJSH 4YHYC 5TDNA 3GSNL 1B4RA 4HIJB 5BS0D 5C0DB 2AABL 3RIAK 5HVWA 2NY1D 4KKCC 4OLXL 3S37H 3NPSB 5DD1L 3TH2T 4Y4HC 4FFWD 3QXTA 2QHRH 1JCKA 1PVHA 1AD9B 1CLCA 5IEKA 1MFAH 1B6UA 5F6IC 5CJBA 3JUZA 4UDUA 3O6FA 1NFDA 4N0FB 4HQQL 4ERSL 1U8JA 4LPTA 3U46A 4WENB 5C7XH 3LB6D 4KK5C 1MCNA 5IWLA 1ZV5A 1XH3B 3SDXB 4N5ED 2P5WD 3MRDA 3VFRB 1FGVH 1JNLH 3VH8G 1NCDH 3GHBL 3BJ91 5FHAL 3LDBB 4F58L 4GT7A 3B9EA 5IQ9A 3ESUF 5ISZE 4F9LC 2E27L 4QOKE 5E2TL 5C09B 1YEDA 4YWGL 3QBTB 3OKDB 4QNPE 2I9TB 4TTDC 1JF5A 1KULA 5MP6H 3V7AG 4CW1B 4PP1D 5SWSE 5FGBC 5ISZB 1GGCL 3PWJA 4X80H 4UT6L 4X7SH 1DTUA 2RFXB 5HY9B 4GG6F 4WEBH 2VR9A 5TQ2H 1CGUA 4OAWB 4PJDA 3CFKA 5E8NA 2XWJB 1S3KL 4Y4KD 5JZ7C 4RDQG 2DQFA 1NFKA 1KN4H 4ZTPH 5BMFL 1N3NA 4ODHL 3EYQD 1I8IA 5DK0A 1YEIL 5F7MC 5HHMD 5I71C 2P5EA 4ODSL 5GGQH 2MQ0A 4IOFC 2IEPA 3AB0B 4J12A 3EDEA 1ZKAA 4WTZG 5CGTA 5MENE 1I1FB 1MLCA 3BDYH 3MRCA 2WLYA 2XKUA 5HGHA 1G0XA 4RAVA 1RVFL 2L0DA 1AJ7H 3TZVB 5DWUH 5EOCL 1F58L 3FO9B 5E6ZA 4WTWA 5MENB 4QF1A 2R23A 1D6VL 2VXTL 2Y5TA 3V6OA 1MNUL 4HLJA 2P7TA 1MRFH 4GAYA 5JMRA 2A73B 3O8XD 1XF5A 4ZYKB 3RVUC 4JFPA 4J3XA 3TBWB 4EOWH 3MBED 3D39D 3A0OA 2OSLB 5JLZA 1JWUB 4UOW0 4PP2B 5A2IH 1YYMH 3U36B 5SWQA 5E4IA 2AV7A 1UVQB 4W81A 5J1AB 4HZLA 4Q0XL 2EDNA 5EU5B 5D7LA 3K8LA 2CLVB 3DARA 3D85A 3N1FC 4XVJL 1NCBH 5JPMB 2HRPH 1I1AA 4I3SH 1OSZB 2J8UA 4EN3C 1A02N 1JWMB 4PJAB 4NJ9H 4PGEB 1JPGB 2YUVA 1MJ7H 1OP3H 5GRZA 4WU5B 4PJHA 1KLUB 4S11A 1FO0A 4RMTA 3PGCA 5CMAB 1NANH 4ZD3L 2CIKA 3F7PC 4WUUD 1J8KA 1KACB 4TVPL 5IMMB 4MXQC 5CUSH 1WK0A 1X3DA 1KB5H 4P23A 1KJVB 2UZYB 5DJ2A 1QSFA 5ICYB 4M6AA 2OTPA 4EDXB 1KLFA 1U3ZA 2RGSA 1EHLL 1GGTA 1EEYB 4L3AA 3QULA 1A3RH 4LSQH 1HSAA 1MRDH 3O6LL 2D4FA 1WEJH 5GRYA 3MA7A 3NIFF 3U48A 3T1FB 2NY5L 3I2CL 4LRIA 5EIIB 3ZYJA 5DD0L 4HWUA 5A2KH 3MLWL 5D7JD 4BK4A 3VWKC 4PG9A 4PS4L 2QQLH 3HZYB 1RZ7H 3L5WB 4HK0A 4WHDA 3VA6A 3VWJA 3MUZ1 3UTSE 3ULVF 4PJ8C 3MNZB 1E6OL 3N1MC 4N0RA 3IF1B 4GS7C 1OSPL 3MRFA 2EYSB 1ETZB 3MA9H 4D0CA 5CJXA 5TH2A 4M93B 2PR4H 3DGGA 4OZFH 2QQQA 5JA9A 2G5RA 4H0IA 1OTSC 5K9QI 1EFXD 1OB1B 3IGAB 2V2TA 2PF6A 3S37X 1FIEA 5IV2B 1QPXA 4HJJL 5KS9E 5FYLD 5EN2A 5I8EB 5JW3L 4P59L 1JGDA 3OL2A 1S9VA 4ONOA 3LQAC 4G8IA 1F4HA 3HE6B 3QZWG 5HHQA 4OQTA 3QIWB 4RGND 5D8JL 4P3CL 3IXTA 3LKPB 4DAGL 3MRHB 3GGWA 1AY1L 4QHMB 1FBIH 5KS9B 5D5ME 2X4QB 1MH5A 3GB7B 2ZSVB 4KHXH 1UXSB 5IK3A 2P47B 1BM3H 4JZJA 3UBXG 4HF5L 3MGOB 1QOKA 1TZGL 4JPKH 4LPCA 3ROLB 1BVZA 1ZVSB 1NCUA 3OR7B 3BH8B 3UDWA 3BW9B 4KRPD 2CIIB 5EPMB 4QRRE 4WI3A 1FGNL 3C60A 4K8RL 4HK3J 2VZOA 2OTUA 4PB0L 4RAHA 5FYLH 1YUHB 2PYED 3VXPA 4QOKA 3GJFB 4LSPH 4M6NL 4HUXB 4RZCA 4XMKL 3VFVA 2X7LB 3S4SB 2C3VA 3HG1E 1MCHA 1NCTA 5I1KH 4RNRA 3C2AL 1E4WL 3HNSH 4WFGD 5SWSA 3BUYB 2A9MH 1OD9A 1S7WA 4H26B 3E8UH 5ELIA 5GPRA 3RGVD 5CBAB 4PY7B 3VFSA 5C0NC 4HKZB 4UNUA 3E6HB 2FX8H 3HG1B 3BGMA 1BBJB 4R0LA 1NAKH 4YPJA 2YA1A 4I18A 4IRJD 2VWEE 1B2WL 4FQXA 4K2UH 1BIIA 3O3DB 1KTDB 1HCVA 3O6ML 4P2QD 2B0SH 1TTFA 1A6AB 4ODTL 3MCG1 2EDTA 5TE4L 4M7LH 2A2QT 4HKXA 4LEXL 4L9DA 1LK2B 1FNHA 3IDIA 3ZE1F 4LEOA 1T83C 1X5JA 2GTWA 5B38G 5ABDE 1IKNA 1QO3A 1BP3B 1C5CL 1AO7D 3FB7B 3LRHA 3MUJA 1OGAE 1KNOB 4TULH 4JLRA 2ZPKL 3ZKMC 3QDGE 3VFUB 1WBXA 2JE8A 1BOGB 4NQSA 4NM4L 5IQ7L 5HGAA 1F4YH 1CFQA 3QDJD 2QQKH 1SMAA 1SMOA 2JCCE 1GVIA 2F54B 2EXWC 4HH9A 4R7DA 3A6OA 4GQ9H 1D6EA 1MFEH 2XZQL 3TIDA 1FL3B 3CXHK 1S7VB 2XXMB 3CFIC 1IEAA 3QFDA 2EE2A 4X7DC 1JTOA 2VQ1A 1UKTA 3W81A 1YNLH 1FRGH 3AUVA 1AKJD 2X4OA 1U3HD 3TA3D 4R97C 3C5JA 1IM3A 3S3PA 3OB0H 1XR8B 3GSXA 4ZFOA 3LEXB 4ONHB 2IJ0C 1LO0H 1TZHA 3NIGF 1T7YA 5E7BA 4PRIB 2IANA 2JIXA 5K9KB 5IJKC 3O3EB 3VGFA 4PREB 4JO2H 4NO0A 4HUKB 5FYKE 3GUTB 2ITDA 3L3GB 1VFBA 3RBSA 3ET9F 1BZ7B 2PXYD 5DJ0B 4FXGB 2VOTA 1DLFH 1N59B 4JHWH 5K9OB 1RY7B 5INCA 3D18A 2HFTA 2JJWA 4HS8H 5IBUB 3RVXD 1FP5A 2XACC 4G42B 1JRHH 4OIIL 2DICA 4H5SB 4P0DA 2CDGB 2IBBA 1J1XH 5ITBH 3BRDA 3DXAA 4W4OC 4Z8FL 1FYHB 4JRYE 1NCAL 1WUNT 2R2BB 3HAEB 4NNYA 1CN4A 4JFYB 4MB3A 3SDAB 5B39B 3WIHA 4OT1L 5GJTL 3DI2B 3KXFE 4KKBD 4MQ7B 3D3VA 5F3BB 3X17A 1A0QH 1RI8A 4XVSL 1DEEA 3V52H 2W9DH 3FOLA 2YRZA 5IESH 4JRYB 1KJ2A 4QO1A 3WXWH 2R2HA 4UDTA 3H9HA 2IC2A 3K7UA 4LF3B 2OK0H 2R2EA 4NBZB 2BOCB 3KYAA 3F7YB 4JFDB 4D9RE 3SCMC 1IGJB 1JF1A 2ZOLB 1X5GA 3D9AH 3KXFB 4G5ZL 2AJVL 2ENYA 4LMQE 4LLUA 5F7DB 4CVZB 2ICWJ 3GK8L 3M17B 1LE5A 2IF7A 3RY6C 5JPNA 1KIRA 2Z0BA 2FDBP 1D5BB 2R0WL 2XWBA 1U8QB 2BERA 2HFGH 3ARDB 1CD1A 1AI1H 3W5NA 4GKZA 4XWOD 4HPYH 1D9KD 1BVKA 1ZANH 4JB9L 5JUEL 1HHGA 4IRSA 3WHE1 5J7CC 5CGYD 4PJ7F 1OPGH 4TSCH 3W39A 5ALCL 2YSSA 4K94L 3SGDI 1U6AL 4DKEL 2E9JA 3TFKC 4HFWB 4D9LL 4UT9H 2YC1B 5I1GH 1CE6A 1UQSB 4DQOH 3TJHC 2BVQB 2PTVA 3LZFH 1DBBL 8FABA 1MCJA 2VXVH 1GJIA 4CVUA 3BE1H 1D5MA 2DTML 4AMKH 2P8MA 2Z31C 4PP1C 2D7TL 4L3EE 3EFFA 4JQXC 2Z91A 3FFDB 4HUVB 2FH8A 4MCYB 2APTA 2DMBA 2X1PA 3UTOA 3A67L 5SWZA 1X9QA 2XQBH 4HD9A 4LCWA 4PY8I 3W2DL 3JV6B 4L3EB 1SY6H 5K9JL 3MODL 3FRPG 2JK5A 4LLYA 5H94A 2WINA 5D1QA 2EDEA 4Z7UA 2RR3A 1PKQA 5ID0B 1QRNE 1OP5H 4LGSB 4WW2C 4J4PA 5DJXA 2V2XB 4MDIB 1WV7T 4NM8H 1CFSA 5IW1B 1FV1B 1WFOA 2AJSL 4NP4H 3ME0A 3K8MA 1JYWA 3KPSD 1UADC 3Q48A 2BVOB 4M9OA 3WEXB 5C6PB 4JFOB 3OG6B 5E2VL 4JR9L 1JYVA 1ZT1A 5F1OB 3SO3C 1XGTB 2HYMA 1FG2A 3KHQA 1DQDH 1X5XA 3T0EA 3RJQB 4PTUB 3O8XC 5CZXC 5KSAD 5J6HB 3O81A 3KWWA 1QFUL 3C6LD 4P5KB 5DJ8A 3KNBB 2VDOL 3KJ6H 2MHAB 1AHWA 4X6BB 4M6ML 5CEYB 5IMOB 2XN9B 3MLZH 3IDJB 2FX7H 1VFOA 2AJYH 1IKFL 2JCCA 1A7QH 5FYJL 1NGZA 1TJIH 4CN1A 4NGHH 3GMPA 2IADA 4K9EH 1CBVH 3P73A 1R3KB 3DUSA 4GOSA 4XCYA 4EDWH 3JTTA 5GS2H 3MRIB 1PAMA 3PWVB 1UWGL 4JPVL 4Q9QL 5AUMA 1RFDH 2V5YA 3WFZA 4XH2B 5DJ6B 3VGHA 4NQXA 2PTUA 2Y6SD 3O6FD 3QAZC 4S10A 3ARZA 5JW4R 4KKAD 1T6WA 3MOBH 3MROA 4RGOH 3VXMA 1NAMB 5EZLB 4P46A 2NW3B 1RIHL 4JO3H 4OGXH 1WJ3A 1YPZB 2C9AA 5J1TC 1CTNA 4LHJB 4FOMA 4LPXA 4YHPB 5CIPB 1DFBH 2WWMC 4X4XA 1ZHLA 4DK3A 1EZVX 2F15A 1P2CB 5CJQH 3V79C 4KPHH 3VXQB 3WNKA 4C54A 4B7IA 2X5PA 2BMKA 4ZFZA 2J12B 2AXHA 1MJUH 2UVFA 1T4KA 4UB0L 1KJMB 3MMEB 2F9BT 4P4KC 4CDHA 4JHAL 2YUZA 3GBLA 2GJ6D 1A1NA 4MDJA 3JSSA 1P1ZB 3NVQA 5CP7A 4RDQF 3B2UC 4PJFE 5F7LB 1C12B 4I5BB 3WFHB 4KY1H 5HD8C 5GZNC 3D6GA 4UIMB 4G80B 1MI5A 4OLVH 5KOVC 5JR1H 3MR9A 4C55A 4M62L 3V4PL 3MRRB 1BQHB 2CLRB 1D5IL 2DQCL 1FFOA 3WJLC 3BVNA 4NT6B 4J3TA 1G9MH 4HS3A 4PJ9C 1J0HA 1EJ6A 1P4BL 5D7KD 4OGAD 4W6XB 4NO5B 3WXVH 1J0IA 3PP4L