1URLA

N-terminal domain of sialoadhesin (mouse) in complex with glycopeptide
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex of Sialoadhesin with a Glycopeptide Ligand
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
molecule keywords SIALOADHESIN
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1urlA00
4QYOB 2JJTA 3QDAA 1HZHH 4CMHB 1RJZB 1U8HA 5F1IB 2CGRL 2FL5B 5MERB 2DTML 2FATH 4QTHA 5EBMB 2OI9B 4FQXA 2UVEA 1AJ7H 4ZUSB 1CN4A 3HI1A 1MFEH 2GJZB 3CFDA 1GYAA 3QUMA 1QFHA 3CMGA 3I75B 3OKEA 1TDQA 2X89A 3NA9H 4QOKE 1MCPH 4XP4L 1OQXA 4JRXA 3NCMA 3VFTB 3BQUA 1U91B 4KHTH 1YDPB 2EICA 4JDVA 4L4TA 5T1MB 3TH3T 5FM8A 5D2LE 2C5DC 3G6AA 3SDYH 5EO9B 3WFHB 1U8MA 5D70L 5JW4Q 3GSNA 2AK1L 1C5DB 1IBGH 25C8L 4FQPA 5T1LB 1ZKAA 1JZ7A 5JZ7C 1Q9WA 2YD6A 3Q2CA 1IMHC 2OSLB 3BWAB 3C6LC 3MCKB 1UM6H 4LPYA 3IDXL 1Z3GH 2RBLA 4ZOAA 4FFYH 2RR3A 1X5ZA 3DX7B 2CXGA 5DVOA 3V8OA 5HYSA 5JDSB 2AJVH 1A3QA 2EDTA 2VXVL 2ESVA 4HUWA 5L6YL 1U93A 2QEJA 4V1DD 3MNVA 5SWQA 4NQSB 5DUMH 1PG7L 4QCIA 5FM5O 3W0WB 2CDFA 4O00A 4OZHE 1INDH 1HEZA 2N7BA 5D93C 1LGVA 3OXRB 4WUKH 1MPAH 2OTPA 1KULA 4WV1C 5JXED 1KB9J 3HS0A 4JVWA 2KKQA 1T03L 2JTDA 3IU3A 4WFEE 1OSPH 5C0EA 5D6CA 5IBUG 2FBJH 1ACYL 5A40E 3VFSB 3ECBB 3LEYL 1N26A 3FQRA 5GGTH 5CHNA 2GITA 5E5MA 4TSCH 2VLME 3K0WA 3O3AA 5FGCB 1KB5L 3CMOL 3MYJA 1DLHB 3B2UD 1U58A 4MCYB 4N5UA 1HXYB 2BNRE 1N6VA 5F1NB 1IZKA 1JGDA 2K7PA 3NTCL 4YXHL 3RI5K 1IGIL 5CINH 2R39A 3MRLA 5HPMB 4BKLA 2PO6D 4LVNC 1EFXB 4R7NA 2R4RH 3HR6A 3CLEH 4XMKH 3QG6A 5HHOB 5CGTA 2ADGB 4U6TA 3VDAA 4S1QH 1VGKA 3B9EA 3LKRB 4UT9H 5JOPE 4WVRA 5D7IB 4H0GA 2DN7A 1MWAA 4EI5B 3GUTA 4FQQB 3BOVA 4LPXA 1EO7A 4S1RH 1QEWB 5DJ2B 1CG9A 4UU9B 4LARL 5MENB 4LRIA 3BT2H 3D3VD 4OFDA 2LVEA 5GIRB 2VJXA 3RL1B 4L3EB 4M43L 1J10A 5DTFA 5EU6E 4CVZA 5HHPB 1RIVL 4ETQA 4TUOA 2X70B 1NC2A 1IGMH 4ZDHA 1BREA 1P5UA 2EO1A 2R0LH 4QRRE 1HSBB 4KK8C 2GW5A 3P40A 1C5DA 1DQQA 4PGJA 4RGOL 1QUNA 3E2HC 4L4TE 3O2DA 3G6AB 3CCHB 1AXTH 3CFCH 5KVMC 4NQDE 1K2DB 3X13A 2IG2H 2PW2B 3CUPB 4LQFH 1FG9C 1K5NA 4NHUB 1FORH 5DI8B 4DQOL 3HI5H 5AWNL 3IS0X 4JE4B 1I8KB 2C4XA 4XCFL 1UQSB 1TZHB 4ONFH 3G08B 1CXEA 4F7TB 1PYWB 3J7HA 4L4VD 4P5TA 1AE6H 2FD6L 3BD4A 2H2SC 3KLAB 2YK1L 2BOBB 2P5EA 5AZ2H 1XMWA 4M1DL 4G9DA 4JDZA 1RFDL 1VCAA 5F21B 3TH2T 3ZTNH 5KSAB 3MJ8B 5JOEA 4G80A 5TDPA 1IQDA 1I7ZA 2IALA 2AJSH 2Y25A 2FX7L 2QQNH 3RIFK 3MLUL 5C0EB 1QKZH 2J88L 1OB1B 3IDGA 4WW2B 1R3LA 2YA2A 5DHVB 5J9PB 1RZIB 1TETH 2XWJB 1T2XA 2MNUA 3VFGL 3V6OA 3W0WA 1VA9A 3ARFB 2FO4B 4WO4B 5HI3D 3WUZA 2ICCA 1AC6A 5C8JA 4N8PA 4P46B 2X4TA 1YMMB 5EBLA 3GJEB 4Q6IC 1UQSA 3CH1B 3IJHA 3ZDZE 2HRPH 3WNKA 2DIBA 4XP9H 3H9ZA 2A73A 3P77A 4PJHA 4YDIH 3U4EB 4MVBC 5F96H 3W0WD 1Q9WB 4D0CB 3OL2A 4S0SD 5J57B 1AGBB 1DQLL 1NJ9A 3NFPB 4WW2F 1A4KA 1WWWX 5IMOA 3WHE1 4Y2DC 5K59E 2HFEA 4HS3B 5CD3B 3MNWB 3SGKA 1XR9A 2ERJB 3MO1B 1NC4D 2HTKC 5GRVK 3P73B 5KG9B 3D25A 1TFHA 5KVDH 4GW1B 2VLRE 4YE4L 3MRCA 1P4IL 3NABH 1VGEH 4K3EL 4PJHF 4JPIB 5JMRA 2EDBA 5ILTL 4BSJA 3O81A 4X80H 1TVBB 3MFFA 2B1AL 2UWEE 2ZUXA 1WAAF 3QUMB 5JORB 4U49A 3NIGE 1UXWA 4HZAA 1JPFA 4E9LA 1GGYA 1F3JA 4W6YB 1IAIL 1F90L 4IM8A 1ZT4B 3O8XB 4G8IA 5J89A 5I1KL 3IFNL 1T1XB 3NFNB 5I19H 5HYEA 1QR1A 5CJ5A 2VQTA 4NN6C 1MCIA 1BIIA 1YNKH 3SDCC 1Z0NA 5FHBL 1WBYA 4OB5L 1S7TB 1T1WB 3FAXA 3MBEA 1GGIH 3ARQA 4L8SB 4XAWL 3SO3C 5EUOF 3MODH 4JY4A 1N3NA 1Q1JH 4JHAH 1KIPA 1IARB 3JWDL 4PD4K 1I3VA 1X6NA 1LILA 1UJ3A 1KJ3H 1BOYA 4KI5E 3QH3B 1F6AB 4WWKB 4IOFC 3T3PF 3ARBC 3N85L 3DRTB 4G5ZH 4K2UH 4XWGL 2H8PA 7CGTA 2VTFA 3LS4H 4WTWA 3MRIA 4RMTA 3C09C 4X4ME 3HE6A 5EOQH 1G7QA 2FJGB 4XCCL 3T2NL 4NQCB 5GS2H 3RZCA 1EGJA 3G5YA 4UV7H 4OV5A 4QT5B 3ZKXC 2UZIH 4CW1B 5GISL 1OF2A 5AG8A 5HXMA 4X9HA 3OV6A 3CU1A 3B4NA 3HC0B 3K3QA 1WGOA 4LSSH 1BVLB 4ZQKB 2V9TA 4M00A 4UOW1 3O9WA 2HJFB 1F8TL 4TOYL 4O5LL 1TZGH 5E6ID 4Z18A 3MACH 4Z8FL 2V7HA 2YUZA 1BQHG 3BAEL 4D3CL 4F3FA 1KN4L 3BJLA 1Z0MA 4I3RH 3MCLL 4YC2C 3SKNA 1HI6A 1EEZB 3TFKC 5GSVA 3B8YA 1OAZL 3ARFC 5IQ9B 5DMIL 3CDFA 4PJEF 2P42B 4X6DE 4ONFL 3O3BA 3RWHB 3EJYD 3KWWA 3LS5L 4CUCA 2XICA 1A7RL 5F72S 1BQLH 1G7HA 2HJFA 2FJHA 2B0SH 2ZG2A 1WFOA 5DLMH 1QFPA 2OP4H 1Q9KA 1DBAH 2R0ZH 5C09D 5C09E 4FXLA 1JUFB 1ZLWK 2A0LD 5D1QB 3C5ZA 1JNLL 3C60A 4JFDD 1Z2KA 2GFBA 4MXQD 4F7EA 1KC5H 2KBGA 2VAAB 1SBBA 4G42B 1DN2A 4NBYB 3BO8A 3QG7H 3MRGA 4N9OB 2NY0D 3MLWH 1WBXA 3QI9D 2OXHA 2VH5L 1UB5A 4N9GB 4ODSL 2MPAL 2R0WL 2CMRH 5DQJB 1YY9C 3V0VA 1PSKH 5EC2B 3OXSA 1LO4H 2AV7B 4GRMB 3WXVH 1KIQB 2ZOKA 3X12A 4Z77B 4LSVL 4JO4L 2B2XH 5F8RC 4BFBD 1X4XA 1NCBL 1N59B 1NH6A 5E4IA 3VXQA 1RU9L 4NO3A 3SEPA 1Y18B 3V4VH 1IC4L 2I9TB 2BX5A 3GSRA 4YHNA 3QCUH 3QJFB 3LIZL 1NMAL 1CDHA 1QVOA 2X1OA 1JRHL 4X4MA 3MV7D 3WIHH 4W68A 4JKLA 4QWWC 1P7HL 5GRXG 5EZLB 1RULH 5D8JL 1QSEB 5CP3A 4Y1AB 4RZCB 5E99H 2XTJB 4PRNA 3EYOB 1FBIH 2FZ3A 3PHSA 1M6OB 4MA1C 5BO1L 1ZGLM 5CD5D 2X4PA 3HKFA 4BSWA 4D9RD 4R3SA 2AEQL 2P24A 3EOYG 3VWKA 3BGAA 1IT9H 5C2BH 2QLVB 3GJFA 4XNYL 5I75C 3MRCB 3DARA 4U1MA 4Z7VB 5C0AD 3BN9D 3L3GA 4PJ7A 5EU6B 2EYRB 3VG9C 3I6GA 1FLRH 3L3JB 1ACYH 4D2NA 5J1SC 1Z6JT 3QIBC 2EKSB 2YD2A 3VWKD 3KJ6L 2ADFH 4HV8B 4OGAC 4UIKH 3TO2A 4JKPH 1MPAL 1AO7D 1ZWIB 4HH8A 2BJML 2DQCH 3MZTA 3EJZC 5K9QI 4JKKA 4OKVA 1U8PA 4MHHI 4KPHH 4HKBA 2CLZB 4HCRH 4WFGE 3S35X 4H0IA 4RFEA 1NSNH 5F88B 4YUEH 3VWJD 2WP3T 5JPMA 1YMMD 4YR6A 1J0JA 3K8MA 1XCTB 1L0QA 4LPTA 1KLFA 1XH3B 2VL4A 1G9NL 5FA3B 5TPWL 1FLRL 5FO8B 2P49B 3ZHDA 4R4FL 3SGKC 3DROB 4K7FB 3MUY1 1YY8B 1UVQA 1S9XA 3P4LA 1F4WL 2UVFA 2V2XB 3GHEH 5GS3A 3TA3C 2YN5A 4LBEB 3LDBB 2AEQH 5IF0A 3CVHA 1FO0H 3JWOL 5AYUH 2NQCA 3KPMA 4POUB 4QHLB 3GMPB 1NCCH 2Z93A 4J3UA 2HTLD 5TGBA 4B5EA 3FCTA 3ZDYF 3HAEH 4Z0BL 4RMWA 4IRZH 5D8JH 1WZMA 3NCCB 2JB6B 4JFEA 4RDQG 3WIHL 1G7MB 1EIBA 2GTWA 1V5JA 1T4KA 2GK2A 3PGFL 4JFXB 3C8DA 1BFVL 1H15A 3HFML 4JFOB 4PREA 1NMCB 3GSQA 4KJWD 1AJ7L 3HZYB 1NL0H 1A14L 3L6FB 2Y06H 1NGXA 1RU9H 4FMFA 3RWJA 1NGQH 3HNSL 2M26A 2VRAA 3U7YH 3HZYA 3VFMB 1W72H 1YMME 2VQUA 3V95A 2MJWA 5T5FL 3OMZA 1BQSA 4JRXE 3DVFA 4R90H 2XNAA 4N0RA 4LIQH 4N0UB 2JLLA 1CU4H 3VH8B 5DD1L 3RIAF 2AJZB 2W07A 4Q9QH 3ZLQC 3VFWA 1QSZA 1C8PA 4QXGL 3IDIA 3WD5H 4M48H 3VJ6A 4L4VA 5CWSA 5E5RB 1JCKA 4KRPC 1T3FA 3O3DB 3G6DL 3V5HB 1NC2B 1EJOL 2BVUA 1XGYL 2HAZA 4KUZL 3TNNA 3GIVB 4JLRA 2CUMA 2APFA 2ZKHL 5EC2A 4JRWA 3BW9B 1FG2B 3DX6B 5I8KL 2MPAH 3MUHL 3PHOA 4LCWA 3IDMA 1OAUL 2CK2A 3QHFL 3ARBD 1RZKH 5BXFA 2WLYA 3BP4A 3KYOA 4NNYA 1JHLH 3HZMA 4JRYA 3C2AL 4DKAA 3D3VB 1LE9B 1WIOA 4EI5A 3GUTB 3HMXA 1IGTB 3NAAH 1UA6H 3TCLA 4FFVD 4IRSB 4HKBB 1XAUA 3DLQR 4BZ2L 4LSUH 2DQDL 5I1JL 4L4TD 5DJZA 5F9WB 4KAQL 4UAOC 5BRZB 4PGCB 5ACZA 3OKNB 3ULUE 3DBXA 2CIIB 4QRRD 2AJUL 2P8PB 1KJMA 5CGYD 5EU7C 3B6SB 4WEUD 2V6HA 3PDDA 1EFXD 3I6GB 4FZEL 1A9BA 3B43A 4LLUA 3DUSB 2CIKA 5TF1L 4HBQA 5IW6B 1CS6A 1KCLA 4XNZB 4G6KH 2ARJA 3FT4B 3FFCA 5IOPB 2E6PA 3GI9L 1S7UA 4HFWA 5J1AA 3I6LE 3ULUC 4PRPB 5BVPH 1FZKB 5D96B 3D3VE 4N5EC 5MHSE 1A22B 3IF1A 2DD8H 2Z8VC 5D7KE 1J9CT 3SHSA 1Q72H 1R5WA 5LQBL 4NRYB 3Q5YA 1TNMA 3IU4L 4H25A 4XGZA 1QFWM 4WFHE 1ZHLB 1NBYA 2VLJA 3O2VH 1FO0B 4H1LA 1FP5A 4H20H 3QDJE 3EW3B 5IOPA 3MRPA 4QHKJ 1J1PH 2N7AA 3TZVD 1TQCC 1CDCA 1FNLA 1KFAH 3VFOB 3HNVL 2J4WL 4JHAL 5KS9B 3TA3A 4PB0H 1LEKA 1IAOA 2DRUA 3LQZA 4P2CG 1EZVX 2DQUL 3MRIB 1HNFA 3VRJA 2Q3ZA 3BPOB 3BISA 8FABB 1OPGL 3D9AH 5I73B 1SEBB 3P9LB 4TNVF 5DQJA 1X5YA 5JNYB 1T7VA 2XN9B 1T20B 2EDLA 4LSTL 5B3NA 4U0RC 5EUOA 5TE4L 4K7PL 5ISZD 1U8JB 4MJIB 2EIDA 3KPRD 3MRHA 2F54B 1D6EB 5CJQH 2BC4B 1JGUH 3M1BB 4MNHB 3SPVB 4XVSL 1EVUA 1IC5L 1AQDA 4HIJA 1X3DA 3GSNH 2X1PA 2CD0A 4YFDB 4LLVB 5T1MA 2EYTA 4LLYB 1PG7W 5E9DD 2DWDA 1RK1B 3N9GH 3W2DH 2UY7A 5HGHB 1XGYH 1BD2A 1J1XL 1MLBB 2FH6A 4ETYA 4ERSH 1MCCA 4OJFH 3PWPB 1OP9A 5SWSB 1MSPA 2MCG1 1UZ6F 3BH9B 3BDYL 3DJ9A 4UUJB 3V5KB 3O3DA 4ENED 3FQNA 1H5BC 5JZ7D 4XAKE 3KPSE 5MERA 1GPOH 3TBYA 5I0ZA 3BUYA 1NDMB 5D96C 2B4CL 4M6NL 2ICES 5DURB 4XVSH 5CS7A 2XTJD 3QNXA 2D7PA 3D0LB 5EFIB 1R3KB 3LV3A 2CK0H 5KG9A 4JM2B 1CGSL 3QRFM 4OUUB 3FB8B 3O2VL 1IEBA 1CR9L 5EORH 4MAYB 3WJJC 3ROLB 2BVPA 2IPKB 4L4JA 3GZKA 1UGNA 4EJ1C 2OYPA 2R1XA 3RWJB 3MXWH 5F9WC 4NRXB 3KYMB 1EHXA 4MX7A 2E7CA 3O6FC 3QEUB 1BECA 3MGOB 4RDQF 3GEWB 2J6EH 3VH8A 3FMGH 2A83B 1LK2A 5KSVB 2YUVA 5TQ0H 4MX7B 1FV1B 4DGIH 3S3PA 5DC0A 2X9XA 1P7KA 4FQHA 5F93C 1SJXA 1WF5A 4M1CC 4U1IB 5T33H 2VISB 3OKYA 1XGTB 5FOJA 5IBLD 3DUHA 1CGXA 5J6HA 5IVXA 4Q2ZB 1A3LL 3GSOB 4XCEB 5D7JB 1QBBA 1MHHB 2E6JA 3V0WH 1OB1A 2DQDH 3QP3A 4LNVA 4HUVB 4DEPB 2G75A 3TVMC 3TVMD 4TPRH 1SBSL 5GRUH 2UUDH 1V7NL 5I8OH 4JG1L 1MVFA 1LNUA 1ZT7B 3W11D 1KTLA 2IH3A 4ONGH 5AWNH 3C8KA 3R1GH 1E4XL 1FNHA 3BDXA 4ORGA 3TO4C 1LO0H 2I60H 1S9VA 4Y19A 5C09A 1YNTA 3OAUL 1AIFA 3MV9A 4QKXB 2V2XA 2YHGA 3PWLB 1NFIB 3DV6B 1HDMA 4RGNC 3EFFB 4I0PC 4XPAH 4K7FA 4AG4L 2E6QA 4UTAH 5HJ3B 4WUUD 5JQ6H 4ZFFB 1TCRB 4UNTA 1KELL 2P46B 4LLYA 5DHXB 4ZOCA 3SDXE 1BAFH 3M8OH 1AQDB 3TIDB 4AIZB 1W0VA 5DQ9B 3CUPA 5DK3A 2SEBA 3W9DA 5CP7B 3S97C 1YPZB 2ZPKL 3SGJA 2R56H 3QBTB 4X4ZA 1X5JA 1CIUA 5JNYA 5CJOH 4LSDA 4PV9A 5IIEA 1M71B 1YZZA 1A6WH 1MQ8A 3O9WD 3VXMB 2A9NH 5CBAA 4LARH 1W8OA 4O9HH 2I26N 2Z31B 4P2RA 5TDNB 4E5XA 2AKRA 1TLKA 1YEKL 3UYRH 4D0CA 4U2ZA 3TA3B 4ETQB 1RUAH 2XRAL 4GKZB 1ORQA 4LOUD 2Y23A 1IZJA 5GRJL 2OTWA 4P2OB 2BFVH 1G6RH 4NKIH 4BQ8A 2VQ1B 3HB3C 5K9QG 4BSWB 1A7QH 3GSRB 1GOFA 3VXSD 1I7TA 3GSWA 5CCKH 2J12B 2V5RA 1NCUA 2DM3A 2CJUL 4PBVC 4JZNB 4DVRH 2CMRL 1WCBB 3MGTB 3LKRA 5EZLA 2HMIC 3MBXH 2VDQH 4HHAB 1WEJH 3K8LA 2ARWA 2BXZA 1QRNB 3OXSB 1DL7H 5GGUA 5E8DH 1XT5A 5BS0A 1EEUA 4PRPA 3X14A 4NQDD 1EVTC 4N0UE 3BZ4A 5HHQB 1Y18A 3FFCB 5GQBA 1FFQA 1ZTXH 5SWZE 1N59A 1IQDB 2DIJA 3EHBD 3MV01 3H8NA 4M7JH 4ZNEE 1M7IB 1GL4B 4AG4H 4MD0B 3MLRH 4NZTH 2X1QA 4X6CB 3W39A 4JDZB 3L3DA 3JTSA 3O6KL 4U6VL 2XIDA 1J0KA 3WBDA 3O11B 3OPZH 5A2KH 2EIEA 3MLVH 3UC0H 1L4IA 2D4FA 5D4QA 5HVFB 3JVGA 1T83A 3D85A 5I18H 1KTDB 3WE6A 1RQ5A 2CKBL 2DS4A 1MCJA 1XZ0B 1IAII 1OSPL 3FB7A 5D5ME 1K5NB 1RI8A 5DD6A 1I85C 3ZO0A 1II4E 2GTZB 3HI6H 1XIWC 5JIKA 4YPGA 3N1MC 3UPCA 4YUEL 2B5IC 2XA3A 4NQEE 2J2ZA 1H8SA 5LXGL 4H5SB 2FNBA 4YDLC 2W38A 4I3SL 3VU2A 1YEEL 4UDTB 12E8L 4W4NA 4OQ1A 5F8QC 1AKJD 4YBHA 3DMMA 2ESVB 1KPUA 2G9HA 2P8LA 1L6ZA 2UYLB 3LKPB 3V4PH 2GIYA 3LH2H 3N1GC 4W70A 5DFVD 4ZUUB 5KSUB 5GJSL 1BVKB 4HAGA 2OSLA 4F58L 3ARXA 5AD0B 3BHBA 5IT2L 5C6TH 4P2QB 3EDJA 5HY9A 4OLVL 5KVEH 3MXVH 3D69A 4LDOB 2Z4QA 4D94A 4NHCH 4JFFE 5DEFA 4KK5D 4UDTA 4YFLI 4Z95H 5I1IH 1CVRA 3OZ9L 3BPOC 1NCDH 2E7MA 2GKIA 3SDYL 4U1JA 1BOGA 3QPXH 3NCJH 4MNQA 3KHQA 3I84A 3L3IB 4X5XB 1NGXB 1QRNE 3EDEA 3L6FA 4KHTL 5BV7C 3QDJB 1VPOL 1XF5A 1FYTE 4FQ2L 5KSBB 1YEHH 5I1HH 4TRPL 5GJTL 4O2EB 1X4ZA 3T09A 4Z0XB 1G7MA 4WFED 4BKLB 3SY0A 3KG5A 3LN5B 5FDYA 1XF2B 4GS7C 4LCWE 4NQCA 5HD8C 4XHJC 1K8IB 2BSSB 4NO0A 4WJ5B 5GRJH 3HPLA 2NY3C 3HNTL 3QUYB 4JFHE 4QYOA 4PJ8B 4IBLT 1HZHL 1Q9LA 5E95B 4X4XA 3LCYA 4X0KA 3DIFA 4K55A 3MA9L 4YZFE 4R4NC 2VDKL 3V9FA 3ZDXE 1LEIA 4GKSA 3IDYB 2YRZA 4GW5A 4KGJA 3FQRB 4GKOA 5E94B 4KDVA 3CSBA 2FRGP 2FYYA 1TQBB 2R2EB 5DR5L 2QBWA 3RTQD 4Q74A 2H3NA 3QXWA 3C5SB 5AEAA 4KVCL 3FFDB 2JELH 5BJTB 1OGAB 1MFBL 1JTPA 3GMMA 4PJFE 4YXKL 1N7MH 3ZTJG 1P4IH 1P1ZB 3GSWB 2WM0A 1BIIB 5JORA 1E4WL 5I1EL 1FPTL 1K4DB 5HD8D 4L9DA 4JZNA 2YPLD 4ISVB 3FO1B 5I8EA 4AT6B 1BGXH 4LRIC 4LHUB 5DDHA 4CVUA 2WANA 1VENA 4F2MB 4OM0H 5D1XD 3T0EC 2AXHA 3WNNA 3RKPA 1GGCH 2GT9B 2CQVA 1ZT4A 3O8XA 4WI2A 1DQLH 4OBRA 5JDSA 5HYSB 4LL9A 2J7LA 43CAA 3BAEH 2EDXA 4R7DB 2Q7YB 4JO1L 1Z9SA 1VHPA 3H6JA 1KJ2B 4Y5YC 5CZXC 4OZGF 3WXWH 5IB1A 3G6JE 5GRVL 3IT8D 1MJ8H 1HCFX 1IGFH 4FQJH 3ME0A 2X2YA 4LSSL 5T1LA 3DYOA 4L8BB 5ALBL 1TTUA 2J8UE 1LDPH 3FQUB 4KH2A 4NGHL 4NUGL 1CTNA 4JFFD 3X17A 3WFHA 5EO9A 1FFOB 1ZLSH 3TYFA 4MNQD 4Y8DC 5F9DC 1T22B 1SHMA 4EXPX 5KW9L 3UROR 1H0DB 3UX9B 1I7UA 4PJBA 4IIQA 2D0FA 4P48A 5SX4H 1W8NA 1NQBA 3G5XB 5CKAA 1UEYA 3VFTA 4AIZA 3RGVD 1G7JB 4JFFA 4QHMA 3DV6A 4BK4A 1NFIA 1JF6A 4XWGH 4Z78B 4GLRH 5ICXB 3CAFA 4AIXA 2NY0C 1G84A 4Y19B 3GB7B 2F5AL 4APQA 4C58B 3QJFA 4ZO9A 2FYYB 5ECJE 1GZQB 2C26A 5GGRA 3OKDA 4GXVH 2KL6A 1FYTD 4TTDC 5I2IA 4ORGB 4ODHL 5C92A 4P2RE 4JY6A 1NMCC 3DMMD 2OCFD 4FP8H 2X5PA 3U0PA 2APVA 5I2IB 2W9LA 5DYOA 1BJ8A 3KLDA 5B22A 4KJPC 1RZIA 3NZHH 4EVNA 5IHUL 4M93B 2CDEB 4JZJA 1V05A 2VABA 4WV1A 5IVXB 1XF2A 5K9JH 4IEFB 1JHLL 2IBGA 4PR5A 1H3TA 1BFTA 1HYRC 2X1WL 5FYJL 4Y2DB 5HDQH 7FABH 1NBZA 5FM5M 4TVSa 4P5MB 4HJ0C 3D2UD 1I8IB 3GMOA 2DMKA 3MC0A 4MS8C 4WFFE 4M5YH 3G5XA 4U05A 4UZGA 3RKDC 3TESA 2R23B 3KPOB 3PQYD 2VR5A 5FK9A 4PJBF 4N1HB 4UQ3A 2IQ9H 1CYGA 1GGBL 4HC1L 4LCUA 4QF1A 1FQ9C 4GUPB 2IPKA 4OT1L 3WSQL 1YJDH 5HHME 5FECA 4IRJC 3RPIA 3PABB 5GSRB 1B0GB 5GJTH 1UXSB 2BVOA 2UUDK 1HK6A 4X6DA 1O7VA 2OJEA 1FSKB 3BX7C 1G0XA 2DWEB 3JSSA 3EFDH 4I0KA 4BJLA 1GOGA 2G9HB 4MDJB 1MEXH 2NYYC 1C12A 5F70A 3VXRD 4UILH 4WW1A 5J3HD 1R3KA 4QRTB 5KSAC 1KYOK 5EB9A 4ZDHB 5I8EB 4AT6A 5HYIA 3IS1X 4LVHB 1HWHB 2RJMA 4C55A 5D7IA 3L5IA 2NW3A 5CP3H 5E00A 5DD3H 4DOHB 2EE9A 4FQXC 1IGCL 3GMMB 5CLWA 3FB5B 2ADGA 2YD8A 5EU7E 1RJYA 3NTCH 1DBJH 1OP3K 4N0CD 4DK3A 4XPHL 3MOBH 4QT5A 4TSBH 4CW1A 1CTOA 4OV5B 1FIGL 4HIHB 3IRZA 3F58L 4X7SH 5IK3B 4F15C 1XCQA 2K1MA 2NLJA 1QSEE 4FG6D 3WIIH 4HKXB 1KIRB 4TTGA 4JEGB 3JV4B 3O2WL 4NKDB 1CFSB 5IBLC 3REWB 3FRPA 2FB4L 5KSBF 4XC3H 2YRLA 1HXMB 4NQXB 2X7LB 2XG5A 2NY6B 3UTZB 3RNKB 1A6TB 4HZLB 4OSUL 3NH7L 3SY0B 2CKBH 3RNKA 4KKNA 4S1SH 1INEH 3LN4B 2AJSL 1HIML 1MRFL 5TF0A 1FVEB 4KPHL 5BRZD 1U36A 3WXWL 3UAJD 1F3DH 1LEKB 2ZWLT 4CADA 2BXYA 3KLHC 35C8L 4HLZG 4FP8L 4PTUB 2VLJB 4HXAL 1F4HA 5ADOH 2EIZA 2IBZX 4LSUL 3LQAL 3N1QC 1ZA3B 4JZJC 3KPSB 3IU3B 5C0BE 4OLZL 5AD0A 5C2BL 3FKUS 3RGHA 2AKRB 4H25B 3A6BL 4NZUH 4ZFOA 2IWGA 3RZCC 3RZCD 5E8PA 4CKVX 1MIEL 2ARJB 3S9DB 1UG9A 2VDLH 3VXMA 3E0GA 1LEGA 4NNXB 4WIQA 3VRIA 4WHYG 4Z7VF 4HH9B 1RZKC 3BDBA 3AXLA 2ZKHH 1HINH 5EU4A 1F6LL 4ZXBD 3S98A 5CUSL 4HKXA 1EHLH 1IGYB 4YDJB 4Y4HC 5EIQA 5ALBH 4ZTOL 2DYPB 1LP9B 3TT1L 5CMAA 1JV5B 3QISA 1BBJA 2DM2A 4J12A 5BOZG 3K80A 4ZUSA 4KFZC 4XMKL 5FK9B 1HDMB 5A3ID 1ORSA 3S37X 3MMEA 3QA3A 2NW3B 4WTZG 1LK3L 3QWRD 3GBLA 1F58L 4PRBB 4X6CA 3W39B 1NGWB 4BUGA 4M4RA 4KKLD 4JRXB 1MCWW 1UM4L 4HULB 3IAPA 3C2SA 4WGWB 5DC4B 3Q1SH 2VMFA 5D1XC 2NZIA 3M8OL 3PHOB 4LCWB 3NCYS 3RWIA 2DWEA 3VE0B 2WUBL 5IMKB 3OJMB 5ESQB 4BYHA 3MV11 5A2JH 1NEZG 1QNZL 2RGSA 3MV7A 3CFJA 3MJ7B 1I7RA 5C0RH 3VDBA 35C8H 1RVFH 3WFDH 4NQUA 1LP9F 4LLAA 3IXTA 4Z7UE 1QHPA 4DN3L 5I1LA 3S4SB 2Q76A 4KXZH 4BZ1L 5DUML 5IG7B 12E8H 3AFLA 3TT1H 2VQ1A 4UBDD 1CDUA 5MEQA 4KRPB 1MJUL 4DFHA 2B4CC 4I9WE 4GKNA 5C6WH 1T04A 4O58L 2EXWC 4QHMB 4KROC 1G7LA 4HWNA 4JRYE 1N2RA 4P99A 4NHUA 1W72A 2BOCA 2DMBA 4K8RC 4M7KH 3ARZA 4G6FB 5I1GH 4M3KB 5FO7A 5IG7A 2X4SA 1E4KC 4NRZB 3WIIL 3WCYA 4ZYKA 2P1YA 5HHXH 1HH6B 2AK1H 2YS4A 3RHWK 4N0CC 1NCDL 4YEEA 4CMHC 3MSPA 4QNPF 4DZBA 4Z7UB 2HG5B 3TN0A 3SKOB 1IM9B 2I9LB 1MRDL 2X70A 3WIFA 1U6AH 5GGRB 2EDJA 1KJ2A 3V6ZA 3KPMB 1E4JA 5JPNB 4M7JL 1O5DT 1OARH 3QQ9D 3ZTJH 5C6TL 1MCPL 3B3IA 4M8QB 4APQB 4KXZI 1EFQA 3FTGB 2IAMA 4HF5H 4HBCH 3H9SD 1QSFB 2WQRA 2HT3C 5FA4A 5A2FA 1CICB 3O4LA 5SWSA 2ERJC 4QGYA 2FIKA 5IEKB 1JWUA 1WZKA 1UVQB 1QA9B 3A67L 5DK0B 3MRBA 2IGFL 5FV1L 3QXDA 2VYRE 4PLJD 4HIJB 3O4LB 5C0CB 3D39B 1GPOL 4GBXA 1Q9OB 2VLKE 3VGGA 1EFXA 3EO9H 3LIZH 2JCCF 2PYEB 1ADQA 2Z91B 3VD4A 1SEBA 3UJJL 3ZZ1A 4UINL 1G7PA 2E9WA 4Z7VA 3UZQA 4PJGF 3HPLB 4JO4H 3L3JA 4JGJA 4I18C 1AXIB 5IW1B 1QHOA 5GRWA 3O6FB 1LK2B 4X9GA 2R1WA 4N8VG 5L2KE 4F2MA 5A2IH 4NQED 5E8PB 1IC5H 3QWOA 4QY8A 1GSMA 4XNMB 3BI9X 3B83A 4HMDA 4F57H 1AR2A 1WTGT 3O4OC 1YEJL 4K94H 2PXYB 1U3HC 2QKIA 3H7BB 4R4BA 5C0GA 1X6LA 1OGAA 4MNQB 4I13B 4RZCA 4YBLC 2D7NA 4Y1AA 3ROLA 4PB9L 4N8CH 5I75B 4JM2C 2PTUA 3OBAA 1INQA 1MEXL 3IDNA 1N8ZA 4C4KO 3EGSB 1EXUB 3GSVA 3JV6B 1XGQB 1Q94B 4PB0L 4U6YA 5DZNA 5BZWA 4X8JB 3OAUH 1HYSD 4RRPA 1KIQA 4XP9L 3QDGA 1BZ7A 3MV7E 3RA7H 3ULVL 5ADPL 4KROD 4AEFA 2ENYA 3CDCA 4WI9A 4EQ3A 3RRQA 3STZB 1CFBA 15C8H 4TUKH 1U8QB 3LRGA 4I2XA 4MA7L 1BLNB 2AEPL 1I1AC 3F7VB 5DMIH 4KRNA 4LSQH 4F7EB 3GBMH 5JO5A 2YEZA 4OTXL 1P53A 1BJMA 2FJFB 4ZOBA 4YQXL 3ARGD 1AI1H 4NUGH 3QA3B 3OF6A 5I1CH 1T89C 2DB8A 4Q6YA 1CXLA 1JUFA 2EE3A 3NIGF 1XZ0A 2E7HA 3FB7B 4GRWE 4JFQA 2Y5TA 3SDDC 4EUPA 2VZOA 3GO1L 5D5MA 5HYJE 1VFUA 4UOJA 4OIBA 1WCQA 1DSFH 2PYEE 1EMTH 4P2QA 3TT3L 1F4XL 5I73C 1EO8H 4EI5C 4X5WB 3U36B 5DK2B 2ZSVB 3RUGE 2BNUA 1YYLL 3H3BC 3S35L 1UWXH 4LLDA 1CQYA 1V3LA 2FJHB 3MXWL 3QDME 4RA0C 1PD6A 2DQHL 1S7XB 4MD0A 4ZPVB 3W9EB 1IAOB 4HS6B 3IAQA 2AJYL 1FNFA 4GAGH 4ONOA 4WCYH 4LKXA 4JG1H 3HI5L 3C2AH 5IFJA 2Q8BL 6FABH 2EH7H 2L7UA 5KAQF 3TO4D 1HI6B 4LRNL 4YH6A 3BE1H 5FF6B 1ZHNB 5I30H 3VI3E 3T8XB 2XNAB 3QI9B 4EDWH 4I77H 1C08A 1Z9LA 4POYA 1A1OB 4LAQL 3GK8L 2NX5D 2F53B 3EOAB 3F8UB 5FECB 4XGZB 3T2OA 1DN0A 1LE5A 3MV8A 3TBVB 2CR6A 2H26A 4P5TD 2VWEE 2QKIB 3FQWA 5GS1C 2CRIA 1MF2H 3RVWD 1IEHA 4PREB 4KHXL 1FCGA 1V3JA 2FIRT 3QAZB 4LIQE 4QXGH 5EOCH 3JWOC 3FJTA 1J5OH 4R96A 4ZSOA 3E3QC 3RP1A 4IOIB 4PJDF 3LN4A 1AGFA 2QJDA 1CFVH 3HUJB 4J3XA 5E2WL 1DBJL 1E28A 2Z93B 3WDJA 4DCQB 2IADA 4WY7H 1ZA6A 3NPSC 4PLKD 4S1RL 5E1AB 3VGDA 1C7TA 2X7LA 3HNSH 1HH9A 1VGEL 1V3KA 5C0CA 1D9KD 1YPZA 1A14H 4HLZH 1A5FL 2XWBA 2CRMA 4L8SA 3T0VA 1GC1L 1PEZA 1XCQB 3PWVA 3R0NA 1RHFA 3QXVA 4OLVH 4K8RH 4QOKD 4TYUA 3MLTB 3V7AG 5KVEL 4OZIA 2R69H 3KYOB 3ZKND 1OTUD 3FZUD 1CICA 3IDMB 4OLXH 1OHQA 4ELKB 1S7SA 3U0WH 3AGVA 3SO3B 1J1OH 5IB2B 5KZCB 4YHZH 5F89A 4PTTA 3FQTA 5I66B 3MRNB 3SDCB 3O6FD 5F7HA 4LCYA 3B2UC 2OK0H 2BSRA 4NN6B 2ICWB 3V6ZB 1QYGH 1KOAA 4PJEE 3QDMB 4IRJA 1OVZA 3SGDH 4ZYKB 1FLTX 4MQXD 3V7AE 4NZJA 1HQ4A 3PDGA 1T0NB 3IGAA 1QFUH 3GSXB 1G9MC 4QXTA 3QHZH 1J0IA 2W9EH 3FONA 2NZ9C 3OJDB 5J6HB 2Q8BH 2EC8A 6FABL 3ZL4L 4GKNB 4PJHB 5JMOC 3OPZL 3JV0A 2HH0H 3ZTNL 3ROOB 5HGAA 2PTTA 3DX9A 1NJ9B 3NFPA 1N2RB 1AGBA 3UBXI 3EDFA 1U3ZA 3KNBA 1XGPA 2DQHH 2OLDA 5C8JB 5DUBA 5A16A 4HKJB 3MXVL 3RWGA 5B8CC 3SDXF 4WNQB 4F33B 4BSVB 3S35H 2N1KA 2E5EA 3TJHC 3QFDB 3BFOA 3IXAA 1EO8L 5T3XE 4GAJH 1F3DJ 1J1PL 2L4OA 3Q6GL 5C7XH 4GOSA 2OR9H 3B8SA 3IETA 2UWEA 4QHLA 4Y2DA 2YPVH 3QEQD 3LH2L 3BPCA 5C0BD 5GZND 3V6FB 4Q6IB 4QRQB 4HWZB 4E41D 4DN4H 4RMVA 4XZUA 4MJIE 5TDPB 4G80B 4Q6IA 5H37H 5LQBH 2AJXH 4NP4H 1FE8H 1EHAA 2XN9D 2XN9E 5GS1B 2NY4C 4XH2B 4NGHH 3OKDB 3KLAA 1NUNB 1CI5A 2AEPH 3MJ8A 1CLYL 3NACH 2VDMH 2FR4B 1UZ8A 4OCMC 2DKSA 2PR4L 4R97C 4WUUE 3TF7C 3VRLE 4A6YB 2DLFL 3T0XA 3SGJC 4M7LL 5MP6H 2XTLA 2B2XL 4ZPTB 1RZFH 1HKLL 2BCKA 1OTSD 3LKNB 5HGDA 2LU7A 4RMQA 1DUZA 1VDGA 3QIBB 4TVPE 2QTEA 3X13B 1QNZH 5DJYA 1LP9A 2VDRL 1BOGB 3W0WE 4DK6A 4QLRA 2P5WA 4M5ZL 5EZJA 4NWUL 5KN5A 4PD4J 1SVZA 4HPYH 2YA1A 4NN5C 1KV3A 1JNLH 1PW3A 3D0LA 5EFIA 4TULH 1RJLB 4F57L 5I71B 3BKYL 4CVWA 1N5AA 3K8KA 4M9OA 3TBYB 2VITA 3TPKA 1ACZA 1CFQB 5LCVH 3SDDB 3OKKA 2CLRA 1YEDA 43CAB 5MI0C 5HYJD 5T1DH 5J0BA 4OM1L 3KVQA 4PTTB 5D72H 4X6FA 3ZKNC 2GT9A 3EHBC 5BV7L 5DD5H 5MEOB 1UENA 3QRGL 4TSCL 3GM0A 4RWYL 1JNHB 3GIZH 4L8CB 1RK1A 2NY6C 1MREH 1B9ZA 5LGHL 3P0GB 4UU9A 3TZVC 1YEKH 3TBWA 3UYRL 4OZIE 2ZJSL 1KN2H 1NANI 2PCPB 3LQMA 1YNLH 5D7IE 1KTDA 5I1HL 3TV3L 1D6EA 5C86A 5SX5K 2YZ8A 4MD5A 5F9JB 1MCFA 1B0RB 4GRLC 3VGAC 2QQLL 2ATPA 4C59B 4F15B 1X5FA 4OBSA 1HXMA 1HH9B 5JXEA 1PDKA 4ZOEA 1NUGA 2D7TL 3QJHB 4PUBH 5JOPD 4HS8L 3OZ9H 3EYVB 1J0HA 3AREA 1N3NB 1C5BH 1OW0C 1I1FB 4K3DL 3UTTB 4WJ5A 3FMGL 1M7IA 5T1LD 5EG6C 1N64H 5KS9A 1UEMA 1FE8L 3UTTA 1R5VB 4OCWL 3PWPD 3HG1E 2PXYC 4JREB 1KIRA 1UJ3C 3QDGE 4XPAL 1GC1C 4TUJA 1A7NH 3O3AB 1B2WL 4JB9L 1SQ2N 1S3KL 4WU5A 3VMNA 1I9JL 3FQWB 1CR9H 1FO0L 3HS0B 3JWOH 2UZXB 2RFXA 5EORL 4AZ8A 1J87A 2VLRD 3MRKB 4CU8A 1JVKA 1A6PA 5ANME 2E7LC 3TBVA 3BGFB 4ZXBC 4Y4KA 2XKSA 1SBSH 4R26L 4NRYA 4EZMA 2F54D 2AQ3A 4HWEH 4M7ZB 2QHRH 1C08B 4R4FH 5DGRA 4FABL 1TPXB 4YHPB 1E0OB 1G9NH 2NY4B 1NLDH 4HCRA 4HFWB 4K23L 1JPST 5C0AA 5C07B 3FT4A 1NCWL 4P2OA 2WBJD 3AS1A 3EKCA 4OFYD 5E2TL 3EO1B 4HS6A 3O2WH 3P4OA 2HT3D 3MO1A 4OCXH 3B6SA 1I85A 5KSUA 4NFDA 2C1OA 4RAVA 1EPFA 5DHYB 3LKNA 1J1OL 3PABA 4TVPH 5GSRA 1C5CL 3SE9L 3L95B 3S36H 1YEFH 3U4EA 2Q3AA 4PJFF 2SEBB 1HHGB 4UQ3B 2Q6WB 4CN1A 4CDGC 4Y7MA 2PYED 4TULL 5IFAH 5ABDE 1JHKH 5JW4R 4LEXL 4NNYB 1KB9K 1N6QL 4HPYL 3QULB 3VI4E 3QIBA 2QL1A 1UM5H 1OLZA 2Y9RT 5AG9A 3RX8A 3DWTA 4JFOA 1M7DB 2A74A 4OLXL 1ZEAL 3DETC 4E0RB 4PR5B 3P30L 3HI1B 5E1HB 4A2MA 1DBAL 2XZCH 3ZDZF 6CGTA 1WFNA 4K7PY 5F3BA 1CD0A 3VXRB 4FG6C 2XXMB 3IDIB 4LPWA 1UB6A 2WWMD 3MA7A 1CLOL 5F9OH 4LEOB 4Y4FC 1QSFD 2BFVL 2RCSH 5DF0A 2XRAH 2CLVA 4L8DB 1G1YA 4P4KA 4YFEA 2ZSWB 3L9RA 5IVXF 4MD4B 1QRNA 2E7LA 1EK3A 1BJ1J 4LSPH 2H45A 2ZZUT 1N8ZB 3AREC 4FN0A 5D7JC 3SO5A 1YY8A 4F7TA 1RHHA 3ZT6A 2VSCA 2UWEB 4IIQB 5F7EL 4FQHB 5E7BA 1J5OL 4ZAKA 2JJTC 3DUUA 1KT2B 2F53D 1DQJB 1KC5L 4RFEB 3ES6B 2LTQC 5DMGD 5CJBA 5EH1A 2AJYH 4G8EA 2A77L 4GKZA 1XGPB 3CX5K 4G9FA 1SY6A 4LP4A 2P48B 1PG7X 3MFGB 3ZHLA 4F37F 2HJKB 2ESVE 2WAHA 4NYLB 4X8XA 4ZAKD 5IIEB 4MAYC 4OUUA 3UTSE 2EH7L 3L3GB 1XGUB 4PJ7B 1PZ5B 3GMQB 4P9MH 4G8EB 4RAUB 3P77B 3PGCA 4EDXB 2B7DT 4WU7A 4I18A 3DROA 1P4BH 4P46C 4WEBL 3CFKB 2X4PB 1H3WM 5L8KB 4P4KD 3THML 3AU1A 4OI9A 1NMBL 5DZOA 3MCLH 3T2PA 3MRBB 4Y4KB 1P7QA 2XWTA 1BBDH 1S9YB 5JIPA 2XFXA 4FRWA 1RUPH 1JWUB 3G04B 5KOMC 1WC7A 4O5LH 4KC3B 1CXFA 3T0EE 4OKVB 4G8GE 3AM8C 3MLZL 4M48L 4FTVB 5I9QB 4G6KL 4YO0B 3E8UH 3HAEG 4RFNB 3BP7A 3JWDC 3O6ML 3L5XH 1IAIH 2BMKA 1UYWH 2EYTB 2XI9A 4GBXD 2AK4B 3CC5B 4M43H 5T1KA 1BM3L 4Z76A 1A8JH 1IM9A 2I9LA 3FO9B 2AP2A 1AGFB 2W1NA 3MLSH 3AB0C 4PJ8A 3X12B 4Z77A 4OV6F 5EULV 3GBML 1F4YL 1W72L 2FECI 4XCCH 5FYLD 2JJUA 5I1JH 2XN9A 2BSSA 1FC2D 3BPNC 3QEHA 1M7DA 2A74B 1F97A 5AZEH 4N0YH 1TZHA 4AQ1B 3UZEA 3WEXB 1MFNA 4Z0XA 1N6QH 5CJXC 4MB3A 4YZFF 4YGVA 3RY4A 2PYFA 1JNNL 3I02A 4GH7B 5KANG 1ZGLA 2RHEA 2NYYD 4X5XA 1OAUH 5IKCA 1IGIH 3OXRA 2NX5A 2FCBA 4PJ9B 5KVGL 3F7YA 3S36L 3A0OA 4KJYA 4HEME 5MEPB 3RJQB 3T65A 1L6XA 2R1XB 1MCOL 1ES0A 3D69B 3IDUA 1R3JA 5JW3H 2DMCA 3O41A 5B8CA 3MBEC 2ZOKB 1IEBB 3LKSB 3BRFA 3CDYA 3WFCL 1GZPB 1I1YB 2MKWA 2P8LB 2MQ0A 5TQ2L 1NCWH 5IESL 4CVZB 5JW5B 1T5WB 2WWKO 3QUYD 4PP2B 5HI5D 5J6GB 4FQ2H 3NFSL 1MCSA 4PLOB 1D5BA 3CX2A 4RQQA 4TVPL 4TSAL 4KTEH 3WKML 1K4CA 3BUTA 4D8PB 5D5MB 2N4IA 5IV2A 5MENA 2E27H 5DJ2A 1QEWA 2R1YB 1IEAA 1KJMB 3CDGA 2BNUB 3D18A 1A21A 3GNML 5BRZA 4XVTL 1RZJL 2VAJA 1RSFA 5EU5A 5DA0B 3O11A 4ODHH 5HGBA 3Q48A 4I48A 1NFDF 1IGTA 4MQXC 5D1ZA 1QD0A 1IEAB 3MRLB 1N64L 5EBMA 4MJ2A 3P0YH 3HZMB 4JRYB 5B4MD 2ZG1A 2WIMA 3JTSB 4YIQA 2VXTH 3RUGB 3SBWC 1W0WA 4HFUH 2NY7H 1FN4B 4C56B 2IG2L 4LCIH 4OZFA 3MJ9A 3MREB 4HGKC 5FGBC 2DBLL 5CHNB 4ODBD 5DS8A 3VRJB 4XXDA 4CRPA 4RBPH 3FRUB 4DUXA 4KK9C 4J8RA 1LDPL 1IGML 5D93B 4KJQD 3NZ8A 3Q6FB 4FQXD 3IXAB 2Y7QA 4XNMA 3ARWA 4JVUA 3U46B 5MEOA 2BJMH 2NY3D 3SDCD 5IKCB 2OL3L 5DUBB 5A16B 4YEFA 5IW1A 4UIKL 4O51B 3VFMA 2F5BH 3I02B 1UH4A 1FL6B 1PSKL 2MOVA 5E6ZA 3L5JA 4XRCB 4ODXA 4BZ2H 1H8OA 1G7PB 1CZ8L 4Q0XL 4X99A 2P5WD 3LRHA 3FN0H 4PV9B 2J8HA 5A3IC 2IANA 3AS3A 4JFXA 4M4PA 3ZYJA 4QY8B 2X9YA 4X5LA 2VKWA 4XX1E 3O2DL 3W9DB 5C07E 1EZVY 3D39A 4BH8B 4XX1G 3Q1SL 1W0VB 4PJCA 1FNSH 4PGEB 4B7IA 4OF7A 1FJ1B 3TO4B 2P8PA 3PGDA 1RULL 3BMWA 3ARGC 5HBBA 3L7FB 2AS5M 5HGDB 5HJ3A 3TIDA 3WMSA 4JFYA 5I66A 3BZEB 3R8BB 1LO3H 3S36X 3P11H 4MZ3A 1EUTA 3G04A 3WLBB 1CXKA 2QV2A 5HI4D 2OI9C 5IROC 2NW2B 5D2NB 1JF5A 1RUAL 5HDBF 4P46A 4QTHB 3PHQA 4M7LT 3EO0B 1DR9A 3QHTC 5H94A 3MUGB 4NP4L 2VB5A 1VFBA 4NWTH 5E7FA 2DJSA 4TOYH 2I07A 1O7SA 3V6OE 2Q8AH 2RAMA 2NY1D 1A02N 4FXKA 2DI7A 2EE6A 4N8VB 4LGRB 1N4XH 2VERN 1ZT1A 2OJEB 4PJCF 3HCVA 4DZ8A 4UT7L 5D7JA 1I3GH 4G7YL 1W72B 3DPBA 3LPWA 5IMLA 3Q6GH 4NM8L 2H9GB 5FYLE 5ID0A 3IDXH 4NC0B 2UZIL 1D3CA 5KSAA 3HUJA 3SKOA 2HG5A 1T04B 4M1GL 3QUZB 4LVOC 2GHWB 4BA8A 1MJ7L 2AJZA 4GUPA 5HYJA 4AEIL 3IKCA 4OLUH 4QRUA 1PAMA 4PJAF 1P7KB 4HWBH 1MI5E 4HFUL 3BGMB 2IBZY 1CE6A 4BQ9A 2YUXA 2NY2D 2VO5A 5HGAB 3CIQA 2E8YA 3S3JA 1GH7A 1WFTA 1DE4B 5DQDH 2XACC 1OP5K 4JANA 3CFJB 5ESVB 1V3MA 3T4YA 2NY3B 3MODL 4ZNCD 4JM2A 5GGVY 5ESQA 3FFCE 5INCA 1MIML 4X9FA 1QQDA 3ABZA 5IHLB 1MFEL 4L1HA 2I9TA 2B39A 3UJIL 5I18L 4NC1C 3OQ3B 5FO9A 4PLJC 1TZGL 2ED9A 4NZRL 3IVKA 1P4LB 2W9EL 4BZ1H 4BH7B 2L7JA 1CDIA 4GRMA 3FT3A 3SGEI 1EEYA 2P5EB 3I2CL 3G6JF 3DI3B 3NFSH 2V2TB 1NAML 4HQQH 1FAIL 1BD2B 1QYGL 3H2WA 5D7LA 4WHCA 4ZS7L 3WFCH 1JFQL 1TJGH 1JPSH 4ZD3H 2WUBH 4IJ3C 4F8TA 1IBGL 1MLBA 4NO5A 2HJLA 2C4FT 1FIEA 4G5ZL 2GQHA 4LU5H 4MNGA 2NR6C 1CGSH 1U8JA 3ILPB 4QRSA 3PQYE 1UM4H 4XPHH 3FO2A 3L5WA 5L9DH 5DJCB 2HKHL 3KDMA 1I3RB 3T1WA 1YPZF 3O0RH 4LF3B 4MYWB 8FABA 2C1OB 3KXFD 3TLRA 5E2WH 3BMVA 3WDIA 5J7CC 1YEGH 3L1OL 4D0BA 1NGYB 5FHBH 4JFED 3EO1A 1XIWB 5JHDB 1BVZA 4KDWA 4WDIB 4HK0B 3QDGB 2YD7A 3O3BB 4Z7WB 1LVEA 3PP4H 4JY5H 3QUXC 1DLHA 3AXLB 2BDNL 3BEWA 4PJDA 5IBTH 3VXUD 4Y4KC 2XPGA 5SV3A 1T21B 4P59L 3QQ9C 3WS6A 1H3PL 3Q3GB 1EXUA 3JV6A 4PJ5D 2NXYC 4KZDH 4GRWF 4ZFOB 2M8XA 2FGWL 4RX4D 1KYOJ 4XVJL 2IAMC 1AKJB 1P1ZA 2BDNH 4P2YA 3MRKA 3JWNC 1KPRA 5CBEB 2PXYA 5I30L 3UJTH 4OI8A 2QADD 1KGCE 3RVXC 5DGQA 3CFEA 4X7TA 2CDFB 1Y6KR 3S34L 2MWCA 5DS8B 1OAQL 4CGTA 4Z7WF 3VXQB 4G6JL 4NQXA 1QPXA 3PXHA 4X0KB 1G7QB 4OIIL 5CIPB 2DOCA 1MCRA 4KKAD 3RUGA 3W5MA 3H0TB 1MUJA 4LLDB 4K3GA 1A9BB 1XIWA 2YPLA 4W6XB 2D0HA 3MPCA 1YYMH 4I0CC 1MVUB 3ARGA 3P4MB 3ARDA 5F9JA 5H2BB 4JFHD 3UTZA 2DQTH 4G42A 3QIUC 3F5WA 3UTPE 3BRGC 4D9QE 1M4KA 3CFCL 3T1FB 4L8SC 3JV4A 3REWA 5I17A 2E9IA 4GXVL 4D9LH 4RGOH 1JMZA 4QCIB 5DSCA 4XC1L 2YXFA 1VFBB 3U82B 3H3PL 5FDWB 1FZJA 1D5BB 2QQNL 3TJEL 4ZS6C 2VLKD 4OAWB 3BW9A 5F7EH 1WAAA 3T08A 1JPFB 4Y16D 3I3BA 4OFIA 4ZODA 2I24N 1I4FA 4PGBA 3VXOA 3GMNB 1EERB 4XC1H 5JW4N 3F65A 2APWA 3HB3D 4JO1H 1N5AB 2BNRA 1RK0A 4LLMB 1UCTA 3LKSA 1ZE3C 4EIGB 1H9VA 2UYLA 3VJ6B 2JCCB 2O61B 4MJ6A 3DVIA 4KQ3L 1FNEA 1MQKL 4MXVF 3BVNA 5IGXL 4OM0L 4UT9L 3LS4L 4PGEA 3IDNB 4Y1AE 4RGNB 5CD3A 4DVBA 1MFCL 4PLKC 1I9RH 3QEQE 2HVKB 2LFGA 1KPVB 1KJ3L 3ZDXF 2R2BA 5E2VL 1I8IA 4GMSL 3WYRA 4JANB 2H32H 2R9HC 4OF6A 3EBAA 4YGVB 1P7QD 3KR3L 1HQRA 3UDWC 1A1MB 3GJEA 4NFCA 4A6YA 4KDTC 3CNKA 2V17L 4B50A 2DLEA 4GG8A 3S4SA 1WUNT 2G5BA 4OT1H 2IPTL 1NDGB 3BSZL 4IHOA 5DO2D 3HE6B 2EIBA 1OGTB 1GIGL 4M02A 3TM6A 2JB6A 3IFNH 2Q86A 4FOMA 2XWJA 1T2QH 3HN3A 3C6SB 4P49A 3D2UA 4XP1H 1HN1A 5IMMA 4PJXB 4JJ5A 1MJJB 1OL0A 3JBG7 5CLTA 1FYTA 4DGVL 2DTSA 5BS0B 3S5LA 1CFTB 1J8HB 5ICXA 4XPFH 1T1WA 3AS2A 4JFPB 3U9UA 5F7NC 5EU3A 1TMCB 1T1ZA 4PRHB 3NZHL 3V4UL 1FZMA 2QQQA 4YR6B 4U1NB 3VXNB 1R5IA 3LEVL 4LQ1A 5DVLA 4G8IB 1UM6L 5F88A 3LRSB 4XCYB 2IAMB 2WBKA 5CINL 3RAJL 1ORQB 3PV7A 1N5YL 4LLWA 3PXJA 1KCRL 3VD9A 5HGBB 1ZK9A 3L7FA 4IRJD 1J11A 1PKOA 4DZBB 2R2CA 3SCMC 3V2AR 3K2UL 1K2DA 4POZC 4GW1A 5DJ0A 4I3SH 3TYFB 1A4JB 1F4WH 2EE2A 3LB6D 3IDJA 2EDFA 1TTFA 2X4SB 5DRNA 1KCKA 4A2LA 5GGRY 2FBJL 1FVDB 3ES6A 4PRNB 2BY3A 2LU3A 1ZSDA 3MCG1 3FO1A 1S78D 3CXDH 1MFAH 2AXJA 3FQTB 4DAGL 4UMGA 4YHYB 3SN6N 2D7TH 4PJ9D 1JL8A 3VXTA 2X9WA 5IB2A 4KQ4H 5BMFH 4NM4H 5IB5B 3PL6C 5L8LB 5TF1H 2JB5L 1D6VL 1MHPL 1FL5B 3EOBA 4AY0A 3N50A 1MI5B 1URLA 4HUUA 2AJVL 4NWTL 4D0DA 3BQUD 5I71C 1D9KB 5DC9B 3U9UB 3HG1A 4NO3B 4NN5B 3I9GL 3VXSE 1V7MH 1FVEA 1ZHKA 5DHVA 1FFPB 3PF2A 4S2SA 1R24A 3WIHA 4XXDB 1ZGLB 1LO3L 4PYGA 3V7MA 5HHOE 4YXKH 1N5YH 4KKLC 4O2EA 3D2UB 3PL6D 5BQ7A 2IJ0C 4R2GD 3MBXL 2VAAA 3GSOA 3LN9A 3K81A 5F1NA 1QBLH 3JV5A 4RFNC 3OHXB 2ZOLA 3O45A 4MJID 1U58B 4PP1C 4AEIH 3EJZD 1OGTA 1HHHA 3MV9D 3NA9L 2GFBB 4KUZH 4W6WB 4UTBH 5LJYH 3C5ZB 3LN5A 4OFKA 1SJEB 5FYKL 5TH2B 4WUUA 2A6DA 1DL7L 3CGTA 1HQRB 4B53A 5TE7H 4NWUH 4L9LC 2HT2C 3MV8B 4GMTH 3MNZA 3BP7B 3QDJA 2DYPA 2IQAB 4MA8L 4OGYH 3MRFA 4N1EA 4WFHD 1D5IH 1RUKH 3DETD 4U6XA 3QXAA 4PJIA 4MAYA 5FF6A 1AXSB 1G7HB 4JPKH 3REVB 1S7QA 4AIOA 1NBVH 4NQSA 3FQXA 1EEZA 3QUZC 4WW1B 4MVBD 1U8NB 4KKCD 1FNEB 3S96A 5HDOA 3SJVB 1IAKB 5DMGC 3FQXB 2FX8L 4KUCF 1TJIH 5IQ7H 5DJ8A 5J6GA 5KSBE 5I8CB 1AGCA 4Z95L 1NCTA 5BZDA 2XOTA 4TUOB 2V7HB 2ZSVA 1X5LA 2A2QT 3HA0A 3CSYA 3CLEL 1UJTA 5T3ZH 2AJXL 2VXSL 5IM7A 4OQTL 1WAAE 1T7ZA 4Y4HD 2NY5H 2ARJQ 3WUWB 1U41A 4EUPH 1KPUB 2F19H 1VACA 1AFVL 3FOLB 2D7OA 3ZKMC 1U8MB 1MFCH 4IIQC 3UYOD 4Y5YA 4PTUA 4K3HA 1JK8B 4JN1H 2YPVL 1E4XH 3QT2A 2PTVA 1NKOA 2A9ML 2Y36L 2Y1VA 5DD6B 1F5WA 5GRUL 5C0DA 1TTGA 2YMXL 1U2CA 2ZNXA 4KTDL 3BZFA 1YY9D 3WN5B 5TPWH 4PFEA 2EDYA 5ERWA 2EEDA 1BQHA 2O5ZH 2P45B 1MCQA 3ARGB 3L5XL 3O6MH 1A3LH 3H42L 1R24B 4PJGE 4ONGL 3O8XC 1HXYA 4HXBL 4UIMB 1CDBA 4P3CH 4HCRL 3MLVL 1V7NH 4R2GB 1ND0A 3RTQB 5T33L 1JYXA 1YUHA 2IF7A 2Q1EA 4X7SL 5ICZA 3WKMH 2PCPA 1QR1B 1FZOB 4Z76B 1D5XA 3QXUA 5DA4A 4NKOA 5JW4M 3GKWL 4FTVA 4DGYL 3CFBB 3VI4F 5L7XH 1ZTXL 2C1PA 4WO4D 4WEBH 1ZHLA 3PWUB 3B9KB 3VXTB 3ARFD 5D2NE 4KGLA 4NJAH 4HG4K 4X83A 4NQEB 5TDNA 4WHYH 4YFLF 2VOTA 3MX0A 1DQDH 2R1WB 2H2SD 3SDXB 3RY6A 4NT6A 3Q3GA 5IFHH 4HUWB 4DVRL 3IDJB 4CL7A 2KQNA 1DBML 1CGTA 3OR6B 3TYGL 1RD6A 5CIPH 1CD9B 3WFBL 4HK0A 3BWAA 1A7BA 4XVTH 4LAJH 4CU6A 4E41A 1AC0A 2H6PB 4X6DF 2BVEA 4LCCC 4HGWB 4WO4C 2BVQA 2IAMD 3R0MA 5JOFB 5DJYB 2A73B 4G8GA 3GSNB 5IVZB 1HHKA 3DGGB 3KLHD 4JHBA 4ZPTA 4MNQE 4QRSB 4GQ9L 4KK6C 4XMLH 3QI9C 2I27N 1A6WL 5DQ9A 1DANU 1K6QH 4MWFB 3L3KA 1LDSA 1PKQE 4JHWL 2OZ4H 1R3LB 1GIGH 4EN3B 5DFVC 1CFTA 1OW0A 4OZIF 1RHHB 1T0MB 1KELH 1J1XH 2WP3O 4PJXA 1A7OL 4AL8L 4GW5B 1BBDL 4YDVA 5IJKC 2FL5A 3GIVA 3AMLA 4RNRB 1L0XA 4GRLD 1DLFH 1ZS8B 1ZAGA 5EOTB 3GSNL 5CWSB 7FABL 3FB6A 1MRCH 1S7RA 2AEIT 4DW2H 5E2VH 3ZKSD 1TENA 2VZVA 1JF1A 3GM8A 5EUKB 1JZ3A 1R5VA 1K8IA 4KDTA 1P69B 4UB0L 3CX5J 4JKMA 5ICZB 4KMLB 3DXAE 2JJSC 4NDMB 3MGOA 2E3VA 2YPLE 5INCB 3RWGB 4U1SB 4U6HB 4OCSL 1I8KA 1J05A 3C5JB 1FYHB 4Y5XA 1S78C 5A2LH 4RISL 3HNVH 3PQYA 5D1XA 3NVQA 1NGZB 1F4XH 3OG4B 3SE4C 3ZSSA 3FB8A 1RZ7H 4JPVH 3BZFB 3WN5A 1O0VA 4PJDE 5CSBA 2BHUA 5E6IC 1T0NA 1M1SA 2Z4QB 1YQVL 1CGYA 1L9MA 1KBGL 3KYMA 2G60L 2WZPD 4AEHH 2KUTA 3FCTB 4PJ7E 5TGBB 2ZUQB 1FH5H 1PVHA 1EA9C 3FAWA 5F7MC 4K23H 5IMLB 1NKRA 4FFVC 1AGEB 1HSBA 2AJUH 3H9SA 5KW9H 2ICWA 5IMKA 5C0IA 3U30C 2GSIB 4IDLA 4PY8I 4JCMA 2HWZL 1RIHH 5KSAD 5D1QC 4YBLB 5C0IB 2HKFL 4EN3C 1OSZA 1U3HB 3NIFE 4QXWA 3VFNA 1X5KA 1ZVSA 2BNQD 5F71A 5BZDB 4EIZC 3ARTA 4FQQA 5EBGA 3VG0L 1XF4B 3DVNB 4NQDB 3TCXA 4MQ7A 4OD1H 5C0JA 3H7LA 4P5KB 2W91A 1RZKL 1KF9B 5K9KB 4AENB 2F9BT 3CPLB 4Y4FD 3MV8D 4M6NH 5D5MF 3D85B 5JDJA 2H3NB 2F54A 3V52L 5I16B 1JV5A 1RUMH 1NAMB 4ZUTB 2CDGB 4MNGE 3JXAA 4PB9H 2GJ6B 3QEGL 2VLMD 1JGDB 3BDYH 4XMPL 4LEXH 4Y5XB 5FKPB 4XP5H 1E6JL 4QHUB 4R7NB 5F3HB 5DJXB 2R4SH 3HZVB 4NQVB 1AO7E 1CVSC 3K4AA 2FR4A 2BC4A 4F9LC 4FS0A 1JMXA 3ULSB 4ZSOB 3QEQB 4Q9CA 3KYAA 1E6OL 4XXCA 3BT2L 5E2UL 3CLFL 3L3OA 1S7WA 3ARUA 4JKWA 3EYOA 4HHAA 5FYKH 5BQ7B 4XRCA 4GW4A 2RCSL 5GGTA 3KPNB 2DL2A 2VLJD 4P57A 3EYUL 2FSEA 3VD3A 3QPQC 1WFUA 4QOKA 4X98B 3HE7D 3SDAD 4ZUWB 1BFSA 1IKFL 3MRPB 4PLNC 1C16A 2XZCL 4HKZA 4WWKC 3QDGD 1T66C 2B20A 3UTTE 1PLGL 4JO3L 1FO0A 2A6JA 3CVHH 4H8WC 4I9WD 5JHDD 3FO0L 5EBWA 3QO1B 3CU7A 1RUQH 5AYUL 4O2FB 4PJ5B 3A67H 3UXFA 1LWRA 1G9ML 1QFWH 1UWGL 2Q87A 1EO5A 2CIIA 1NAKL 3GHEL 5FGSA 3ULVC 4P23D 1J88A 3Q5OA 4JJHA 4RGNE 1IE5A 2YZ1A 2V5YA 3IU4H 2RQ8A 1RJLA 1Z9MA 4XPGH 1F3RB 4I4WB 2F15A 5LG1A 4RA3A 3VRLF 4NUJB 5DJDB 1L0YA 1FVDA 5ACMA 4WWKD 1U8IB 2ZCHH 5IHZA 1INDL 1U8KA 1BD2D 2L0DA 1A4JA 5HHXL 1AD0A 5BXFB 5DT1L 4JM2F 2FJFA 4NZRH 1DEEB 4FZEH 3UPRA 3CH8A 4NCC1 5L6YH 5EU5B 3SCMA 1HSAA 2XT1B 3CD4A 1FDLL 4U1KA 5JR1H 4JLRB 2QSTA 4QTIL 3IFLL 1YNTB 1NLDL 4V1DB 1ADQH 1S5HA 4X6BA 4O58H 2MFNA 1A6ZA 4XAKD 4HUXB 2VXUL 3P4NA 4DJMA 3R8QA 3UTQB 1OAXH 3NPSB 4J4PA 2LU4A 4HUVA 3VW3H 4EKXA 2R0KH 4NZDA 3HUJF 5E9DB 5GSVB 1AR1C 5FKAA 3RQ3A 3LD8B 3KPRA 4HWBL 4EUPG 1RVFL 4PG9B 1BF2A 4PRHD 4QGTA 3RVUC 4PS4L 1J8HA 1KCUH 3P9WB 3QCTL 5FYJD 4AYFA 5CCKL 1P6AB 2DQJH 3MUJA 1OAYL 1BPVA 2OL3B 3KPRE 4P4RA 1EJOH 3LKOB 3QUXD 1AHWC 3WV0A 5HHMD 3RU8L 3OF6D 3FT2A 2G5RA 2NX5B 2F8OA 4G6FD 1DQTA 1A3RH 4W81A 1JIBA 4M5ZH 2B1HL 5L88H 3OAZK 1KTRL 3SKUD 3OAYK 4IHOB 4NRXA 2G5BB 5CEZE 5E24E 4GXUN 4XI5D 2C3HA 1JGEB 4LIQL 2GJ6E 2XY2A 2HTKD 3WNPA 2EDOA 4N0FB 2JKXA 2IEPA 5GRYA 4ZAKC 1A7QL 2H26B 3CZFB 3GSQB 1F6AA 4M7LH 4PJCE 2Z91A 4GMTL 1WJ3A 3MZGB 1G9MH 1QFWL 1RZ8A 3RWFB 4N90D 3S37L 2V7NB 1HQ4B 5IB4A 3KPRB 4X6EA 3RU8H 1IRAY 1MNUL 3MUGA 3KJ4B 5FA3A 3UTOA 2W92A 5DJ8B 2AK4A 3CC5A 1X5XA 5T1KB 1WV7T 2A9NL 4Y19D 1T83C 4RGND 5EA0L 1QPPA 2DLIA 1QSVA 1L7TH 4LCYB 5D7KD 1M05B 3CFIC 3VGAB 2H1PH 4OD1L 2R0WH 2X4UA 3BH9A 1AXSA 2OP4L 1RK0B 4NBXB 3BKYH 4JDTH 4U6XB 4K3JH 4X6CF 3MV9B 4OQTA 5I1DB 2DICA 3TZVB 1MAMH 4KQ3H 2GAZA 2XTJE 4Y16B 3MR9A 5JQ6L 2YBRB 2BNQB 2VDRH 1E4XI 4MNHA 4JFQB 3SPVA 1RZGB 1OAZH 2RIKA 5D7SL 2I25N 5GGSY 4L8BA 4NUJA 1DDHB 5MI0B 3MRJA 1U8PB 5FUOL 3GGWA 3RVVC 4HX1B 3NN8A 1KLGA 1KUMA 1YA5A 5BVJB 4Q2ZA 1ZXQA 1RURH 2DLGA 1CDYA 3RKDD 1HIMH 2DLFH 1BFOB 1SM3H 4G6ML 5TJWK 1Z5LB 3ARDB 1FL6A 2VXVH 2JIXB 2W60A 3BPNB 1ZLVH 2IBBA 1IKNC 3EZJB 1VESA 1NMBH 3G6JB 4ZG1A 1HHJB 4X7CC 8CGTA 4H1LB 4Z8FH 3PIQB 3T2NH 3MLYL 3ALXA 3BXNA 3C6LD 4ZAKB 4CJ0A 3RL2A 5EOQL 1L7IH 1F8TH 3CK0H 4EOWL 2FX9H 4HWUA 3RVVD 3T0WA 2VXTL 3BPLC 4G43A 2F53A 3EOAA 1LE5B 2VNCA 4TSBL 1HNGA 1RUQL 5BCAA 5E94A 1FSKC 4G43B 4HSQA 5C2UB 2O93L 1YN6B 4ODWA 3F12B 4B7LA 4ZXBA 2FLBT 3IDGB 4UV7L 3EDDA 3MREA 4LKCA 4YAQA 1VFAB 4GG6A 3VFUB 1IGCH 1IJ9A 1KJVA 3VGFA 4OB5H 1FFNB 2QSQA 1RZJH 1ZSDB 3LEVH 3QWOB 3S34H 4LCCB 2F58L 5DUPL 3RDTD 1YNKL 2GCYB 4FNLL 3RUGF 5DRXA 1QFOA 1A5FH 4HUXA 1S7XA 3N85H 3PDOB 4AEEA 5CGMA 3QDJD 3LHPL 4C4KT 4Z7WA 4PGZA 3L7EB 2HVJA 1PYWA 2LAGB 1EAPB 3VD5A 1J8KA 3W2DL 1NGYA 3BKCH 3BIKB 2YKLH 3L3IA 3D18B 4RISH 2DWDB 1CFVL 5CMAB 1YMHB 5IHZB 4PIRF 3GJFK 1DFBH 1JWSA 4M93C 3ZE1E 4KMQA 1W2KT 2A6KB 1E6JH 2DJ4A 5FUCE 3OG6B 4MNGB 4RQQB 1MH5B 2Y07L 4BFGA 4ERSL 5L2KA 1TJHL 1T20A 4HIEA 4BZYA 5HHNB 3TZVA 2O5YL 2V17H 3C9NA 5JW5A 1DBMH 3UYPA 3X3FH 2AGJH 1U8QA 4I2XB 4HJGA 2X4RB 4K9EL 3RBSA 3RX7A 1DQDL 1MY7A 1DP0A 4JFZH 1QRKA 2FLRT 1GC1H 4K7PH 2HFGL 3INUL 1CGVA 5B38G 3HC0A 1P84J 1I9RL 5MEPA 3EYQC 3RPKA 4MHHG 3FT3B 4X8JA 4KJYB 1VEMA 5B39A 4MGXA 3TN0B 5HDLA 1K3ZA 4MA3B 5GZOC 2P7TB 1X44A 4O4YL 2F8XC 1T2JA 3DYMA 4KK8D 3ZKMD 3VD7A 2YKLL 2FEEL 1KFAL 1FNAA 5L8JB 2VZSA 1FH5L 2A1WH 3UP1A 4YHIB 4PY7B 3QG6B 3CSPA 4NC2B 2AABL 1PZUB 3O4LE 2COQA 5I15L 3VXUE 3GSUB 1LO2H 5IEHB 3TIEB 4PRIB 3SGEH 1KENL 2GYSA 3K4DA 3WUWG 1CE6B 1MIMH 4S0TD 2E9JA 1S7TA 4NO2B 1T1YA 5I1LB 4OTXH 1CFSA 3U9PL 2NR6D 4NKMA 4LBEA 5HHVL 2J88H 4JRXD 1BWWA 4NNPL 4P2QE 5GPRA 3BE1L 3QQNA 4U1LA 3GMNA 4GBXB 3TCLB 2NTSP 5FO8A 3CK0L 5FKAB 4DQOH 2V9QA 1AQKH 2OM5A 5IJVA 5DWUL 4UV4L 2AEWA 2YOCA 4N8VA 2NNAB 3AU1B 4EBQH 2XG4A 1AD9A 4ELMA 2K9UA 2F74A 3P4NB 4XAWH 2CO6B 5DJAB 1D5MB 2W65B 5INDA 4BELD 1S5HB 2CLZA 3QUYC 1T0PB 3PGCB 1BGXL 4EDXA 3C5ZC 4KWUA 1CDGA 1I3UA 1FNGB 2FIKB 1JTOA 5SX4I 5IEKA 2ITCB 2Q7NA 3D85D 1JJUA 1ZWIA 4PGDB 5JIHA 4F9LA 5J11C 3DGGA 2NW2A 5D2NA 1ROWA 3BPLB 2Z0BA 2E8ZA 2CR3A 3MCKA 5LAXB 1Q0YL 2VITB 4JFEE 3H42H 1M71A 3OKMA 4KI5C 4M7KL 5E8OA 4Q9QL 2OTUA 1F02I 2VIRA 4JFYB 3BZEA 3QPQD 3TGXA 4WRLA 2EZ0D 2VKXA 5CP7A 2DDQL 5IB3B 4R90L 3CH1A 3IJHB 4XNXH 3X3GH 2J8UB 3D25B 4X80L 2W0FA 1CXHA 3TVMA 1H3PH 4HH9A 1NLBH 2P5WB 3MOQA 5IBTL 1FVCA 4MA7H 3GHBL 1LEGB 3U1SH 1IQWL 5IMOB 1DUZB 5HVHC 5D72L 3DO7A 3EO9L 1JZ8A 2GSGA 2OQJA 3WL9B 3NBNA 2FH8A 1SYSA 1MI5D 3OKEB 4EI5D 1OQOA 1D7FA 5E6IB 3BZDA 3PV6A 1PJ9A 2GTWB 4Q7DA 5EBWB 4CDHA 3T0BA 4MAUH 3SE8L 4L8DA 5T3ZL 1R0AL 2EYSB 5FCSH 1S8DB 4G6AD 3RVXD 3RZWA 3E2HB 4O51A 4HKZB 3MA7B 2YN3A 1BWMA 2JCCE 5F1IA 3U0PB 5IQ7L 2P4AB 3NOIA 4KZEH 3HZKA 4IOSD 4P9HC 5EIIB 43C9A 4EI6A 2AV7A 3UEZA 3MTRA 3LMJL 2OBGA 1AY1L 5FHAH 2BRQA 1CE1H 2KQMA 1JZ4A 3HAEB 4P9HH 4Z7QE 3OTTA 3K1KC 4IRZL 4Z6AT 3VE0A 1DVFB 2JE8A 3VFRA 3MLPA 4YXLH 5F7LB 1I7ZB 2IALB 4DKEL 1QTYT 4OGYL 2XQYG 5GJSH 1EBAA 2O5XH 4HZLA 4Y5VA 3O6LH 4MWFA 4NOFA 5C0BA 3ESVF 4NC1E 5KSVA 2HLFC 3QFDA 1HWGB 2C3VB 1I7UB 4PJBB 4WNQA 4F33A 3QEUA 1EHLL 4YIQB 2J5LB 3QUMH 3LEYH 5IJKA 3IFOA 2HJLB 3G08A 5F1OB 5IVZA 3QNZA 5C9KA 1WT5C 1QLFA 3QIWB 2O5ZL 5C0FA 5GS0H 3EYQD 2PTTB 2DBLH 3HMWH 1QG3A 4ZUTA 1JRHI 5F6IB 2BVPB 1QBLL 4PS4H 2XQYK 4HGWA 2EKSA 2PETA 3DHJA 2AK4E 3I50L 3P4OB 4QXTB 3U4BL 4YLQT 2Y36H 3IGAB 5SX5H 4MQ7B 1KG0A 5CSZB 4OLZH 1BX2B 1EHNA 3EYSL 3SKNB 2FEEI 2ADFL 4IRJB 4NT6B 1EV2E 2GCYA 3OKLB 4HBCL 4JFDE 4ONHA 3RIAK 4PRDB 3IFLH 3S5LG 1NC4A 1XFPA 5I74B 4JM4H 1KJ2H 1B6DA 1JRHH 1QQDB 5M94B 3PP3H 1PBYA 3F12A 1NMAH 1AGEA 4HIIB 2C1PB 3DSFH 3I6KB 2PUQT 1WBZA 5I76B 3MLXL 5ICYA 2YUWA 4ZUVB 3H9HA 4PJAE 2XQBH 2YC1A 5HPMA 4LLVA 1MFAL 1I1RA 2P43B 4YXLL 5HTSA 3DIFB 4LNRA 1CT8B 5KTEL 1JI2A 2QSCH 2DLHA 4JPKL 4PRAA 5ISZB 3WXVL 5GS0L 1T2QL 4XPGL 5DRZB 3KPOA 4JQIL 1CICD 4HJJH 3QUYA 3FHQA 4MJIA 3C6LB 5EZIH 1C7SA 4MA8H 5MHSD 5K9OB 4JR9H 4QXUL 1BZQK 3IJSB 1IC4H 2WW8A 3ISWA 1UWGH 2X4QA 2MSPA 2O5XL 2VZ1A 3RY6C 1A6TA 3U0WL 5ID1A 5KSBA 4RWHA 3FO0H 5CUSH 5CJXA 2D0GA 1GJIA 5E70A 4LP5A 5IW3A 4ZFOL 1HINL 3KR3H 1DTUA 3TBWB 2GJ6D 3FFCD 2R69L 4GMSH 3MYJB 2X6MA 4QEGA 3LMJH 1JNHA 5D71L 1PY4A 5FYLH 4HIHA 3FO9A 4FQIL 5JLZB 4NPYB 4R8WH 3A6BH 3VH8G 3FOLA 2WIIA 1IGJA 3U1SL 1BD2E 2FHBA 4ZUVA 1T0MA 5TE6H 1MQKH 2EYSA 2UZYB 4X9BA 5E0QA 1CFQA 1R0AH 3HMXH 1I9IL 4J3TA 2VL5B 4L3CA 1CXIA 5E6IA 5E00B 1C1EL 5CD5C 1A6VL 1NFDE 1TVBA 3MFFB 5E9DE 5L2JA 4XTRC 3P3YA 1T03H 4LGPB 2XWTB 3DO7B 2X4UB 2PNDA 1MCBA 2CRYA 4PJEA 3S96B 5L0QB 4R0LA 3U4AA 2VE6A 4G3YL 1LO5A 5KN5B 1F45A 3A6OA 2IAND 4N90E 5DRNB 1PG7H 3HC3H 4Q97A 3QDHA 5C0CE 4P5TC 1A0QL 3REVA 3VGEA 2PR4H 3ARVA 4X6EB 3FQUA 3TNMA 1LHZA 3O9WB 5CKGA 3VXMD 4WU7B 3T0EB 5JOFA 4HAFA 3V0WL 3ULVE 1K8DB 2VWEC 1RV6X 3THMH 4D3CH 5HDQL 1BHGA 3NPZB 2HJKA 1VEOA 2Z35B 2VLJE 4XBEH 1P4BL 4KI5D 1IILE 3QNZB 25C8H 4IOFD 4JDVB 4L4TB 5JHLH 4P9ML 5IHUH 3IDYC 2EDDA 2WK2A 3PWJA 4ODVH 5DJAA 3OHXA 3BN3B 4J3SA 2YEZB 1X7QB 3TFKD 4L9LB 3R4DA 2MHAA 4C56D 3ZE2F 1MWAH 1QLRA 4P4RB 2IPUG 2NMSA 1XGRA 5CEZH 3QUXB 4UV4H 1DVFA 1DSFL 1FL3A 3MBEB 1S5IL 5CILH 1JI1A 2HH0L 1ITCA 2MHAB 1KLUB 1KIUA 3ZL4H 1A7PL 4RSVA 4PJXF 3PP3K 1RZ7L 1WIPA 2H32B 3UTQA 4UIMA 4KTEL 1CFNB 2GK0A 4KZDL 1FL3B 2B4CH 3ULUD 3B2VL 3ZE0E 4GG8B 1UH2A 1UKSA 3U30B 4V1DA 5ERWB 1YJDL 2B1AH 2ADJA 3GKZA 4XHJD 1NANH 2GUOA 2HT4C 2IQ9L 5HDBE 2WUCL 4YBQC 3ULVH 3ZMRA 2APTA 5CBAB 4G3YH 3NIDF 2HFGH 3INUH 5T3ZE 2D03L 4CN6A 2CKBA 3MOAH 1OCWL 3F58H 2QQKL 1U8KB 2ZUSA 2M1KA 3WFEH 4KI1A 5FGCE 3G5ZB 4P23B 2V5TA 5LGJB 1XR9B 4J23A 4MQTB 4MA3A 2ESVD 1DBBH 4YHYC 1K4CB 4Z7VE 4D8PA 2KPNA 2HLAB 4CNIA 1DZBA 5I6XC 1A4KB 1U95A 4YDIL 5HY9B 4PBWD 5DD3L 2PYEA 1OCWH 3MOAL 5IM7B 2XZAH 5FCUH 3QIWD 1CF8H 3RL1A 1PQZB 2V5MA 3OR7A 5GIRA 2ZCKL 2Z92A 2NY4D 3LRSA 4XCYA 3UJTL 4MXVE 1FGVH 1YC8A 4K9EH 2KZWA 1KSRA 2EDQA 4Z7OE 1FZMB 1FAIH 4LHUA 5DDHB 5DD0L 1NGPH 3WJJA 2FBOJ 3B9KD 4Y5VC 3VFGH 1MWAB 3WFEL 2CO7B 3I2CH 1TZIB 2PW1B 1C16B 2FDBP 1AD9B 1DQMH 1H3VA 4HWBA 3LHPH 5IHBA 4U4BA 4QOKB 4X98A 2AXFB 3S5LB 2Z9TA 2P5ED 3BN9C 1MJJA 1NEZA 1MELA 1QLEH 3EOTH 1RUPL 3H3PH 5D2LB 2RFXB 5TH2A 4U1HB 1MVUA 4YWGH 1H8NA 4PJ5E 4UDUA 2CKNA 2AJ3B 1SJHB 4OZGA 5M7QA 3QQ3A 3GK8H 4CMMB 5CEYA 5FUZL 4XHQA 3VWKB 1DBKH 1UACH 5ALCL 2O26U 3PDOA 1OP3H 3U2SA 4P5TB 1KNOB 4ODVL 2DQTL 5E5MB 4Y4KD 2A83A 5ITFA 3ULUL 2FZ3B 2D9CA 4ORZC 3VWJC 3DX8A 3DSFL 2BOCB 5JXAL 4NJAL 3TIEA 3VFSA 4GAGL 3KLSA 1MCHA 3UTTD 1KEGL 3X14B 5DI8A 1MAKA 4O2CA 2HFFA 1EEQA 3U6RB 3I6KA 4HIIA 4MXWL 5MEQB 4JZOB 4KU1A 4U7MA 3GJFH 3MROA 5KANI 4XXCC 1U93B 2WWMC 3HTLX 2DBJA 4Y4FB 1MI5A 4HUUB 1WICA 3D1MC 5ICYB 5KS9F 4HXBH 1AR1D 2DLTA 2ITDB 3IJYA 4PV8B 3MLYH 4LQFL 2Y4SA 1AO7A 2LE9A 3WNMA 4WDIA 2BY1A 1AI1L 5GGSB 3RWDA 4APQC 1OAKH 5B4MC 4PRID 5DTFB 4OLEA 1TVDA 1A1NB 5F6HI 3MA9H 3VWJA 2PF6A 4XBPA 2EDKA 4LMQI 4PRPE 4PRDA 3DMMB 4NYLA 2YXMA 5B39G 3SDDA 4MQSB 1T7YA 4JGUA 1LD9B 2Y5TB 4RWYH 1G0YR 4XB7A 3G5ZA 4HIEB 3P11L 3UMTA 4G8GD 2F53E 2X1XR 1RIVH 5J56B 1BZ9B 4S1QL 1OGAE 3RTQC 4OM1H 1VFOA 5IWLC 1ORSB 4ODUB 1AFVH 2EH8H 5F44A 1TIUA 5JO5B 1JWSB 3VMOA 5E4EC 4J4PC 2H1PL 2BNQA 2HN7A 4FMKA 1Q9KB 1FNSL 4MCZB 1C1EH 1MJ7H 2A6IB 4IDJL 4KROB 1GHFL 2ED8A 4TNWK 3WN5C 3KWWB 3WO3B 2XZZA 1U0QA 3HC4L 5GS2D 1A2YB 3VXNA 1F2XK 4JDTL 1MHCA 5ENWA 1E4WH 3L9RB 3H9SE 5FYLL 3S6CA 1AP2A 3QIUB 1T1ZB 4PRHA 1P4LA 2V9RA 1M7XA 4PJGA 1JGVH 3EGSA 4J1UA 5EA0H 5IT2H 5E56A 1UB6B 3BZ4B 5HHQA 5DR5H 2OXGA 3E6FA 2DQFA 5DJ6A 3ARBA 1CLZL 3VXRA 4EXKA 5GGUB 1NBYB 4MB5A 4ZFZA 3BGFC 4ZXBB 4RNRA 5E6YA 4E0RA 1KB5H 3CMOH 4Q58C 1IQWH 3PV6B 1A3RL 5F7KC 4K71B 3STBA 4ZTOH 4DUWA 3RFZC 3CZFA 4BQ6A 1KEML 2GSGB 2OQJB 3WL9A 2EIZB 3LPFA 1JYNA 4XNQA 3G5YB 3UBXB 3T3ME 1CGWA 4GAYA 3QULA 4U1IA 4U1GC 1KJ2L 2X4NB 4N68A 5DRWA 4OLYL 3VFPA 3LKQB 4FFYL 1OAKL 3BEWB 3BGMA 1JHTA 4HEPG 4PJDB 2Y5EA 3SOBL 4ENEC 1TQBC 3HUJE 4PJAA 2B1HH 5L88L 4HWEL 4HKJA 3V6BR 3QH3A 4WWKA 5DQDL 3CVIH 3RDTB 2VXQH 3TP4A 2OR9L 3D87B 1A6AB 1S7VA 4UBDC 2F8VA 2D31B 4RCAA 3V5DA 4PGCA 1CZ8H 2BVQB 4J3OC 5C3LD 2X44D 1KCUL 1DCLA 1KLGB 2HT4D 3MJGX 2YWYA 4HUNB 4MXWH 3HMWL 1YDPA 2VLRB 3T77B 1GXEA 4OGXL