2WP3O

Crystal structure of the titin m10-obscurin like 1 ig complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
97
structure length
97
Chain Sequence
QGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBSCURIN-LIKE PROTEIN 1
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
total genus 18
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wp3O00
3GBLA 3C5ZB 1AC6A 3R4DA 1C7TA 3RVTC 4NKMB 1NAMA 1C5DA 1JI1A 3MV7D 3QNYB 1DVFC 1NFDA 1FIGH 4G9FA 5FUCE 5A16B 1JPTL 3QCVL 4KHTL 1NGWA 2CLZB 2HTLD 1IQDA 4RDQG 5JW3H 3K0WA 3WLWC 4ONHB 4FABH 1CGYA 4JJ5B 4FNLL 5I8KH 4L9LA 5CIPH 1YJDH 4JPWH 1I8MA 3TCXA 5L7XH 3B9DA 3RL1B 4QGTA 4PLOB 2BOBA 1RK1B 5E9DA 1MCWW 1JGVL 2AKRB 1UM5H 5DJXA 1YDPA 1TCRA 1KJ2A 3VFRA 4DUWA 5F7MC 1AHWA 4Y2DD 4NO5A 4PJGE 4UIKL 3VCLB 3BN9D 4PJXB 4XVJL 2DQFA 4NBZB 2X10A 3TPKA 2X4RB 1MHPL 5C0BA 4LPWA 1UJTA 2JB5L 4WWID 3OX8B 2HKFL 4LU5H 1N5AB 3QPXL 3ZDYE 3D0LB 5F7DB 1BBDL 4H26A 2DWEA 3WNNA 4X4ME 2JJVA 3JUYA 1PZ5B 5T1LB 4O2CA 3EYFB 5JOFB 4JEGB 4HUWA 4K3GA 4Z0BL 1OAXH 4U1NA 4OLUL 2A6DB 2CQVA 1ITBB 3RWEB 4ZPTA 2M2DA 5F1NA 3V6ZA 5SWZD 3U9UA 1IC7H 3ARRA 4K9EL 3X14A 2EC8A 5GGSY 4MJ6B 5GS3A 4NUGH 3B9EA 3OKYA 4PGZA 3MRNB 2VDOL 1HH6B 2VERN 3BYYA 2BX5A 3G08A 4HHAB 4LKXB 2VLRA 5HY9B 5F6HI 1K3ZA 1P4BH 5T1DH 4YDKL 3MBED 1AGBB 1KTLA 3LRSB 5I1IL 4RWYH 2H8PA 3U1SH 1BECA 1RMFH 4W68A 4NN7C 3RRQA 1J18A 4WUKH 3HUJB 3RL2B 4XP1H 5I1LA 3TA3A 1BD2D 1JGVH 3QIUB 4S10A 1GAFL 4X7SH 3T09A 4EIGB 3WIHH 3QJFB 2E6PA 3WNPA 4LCWE 2QSQA 5FUZL 4EUPG 2WW8A 1KNOB 2QQLL 3FB8A 4PY7B 4XPBH 3L3GB 4PGJA 3PXHA 2K1MA 5TDNB 3UJJH 4XVJH 3DI3B 4HC1L 4KDWA 1WBXA 1RIVH 3GNML 5E5RB 4D8PA 2A38A 3IDXH 3HZYA 1N8ZA 3JVGC 4NIKB 3FJTA 5FO9A 4RGMB 3ZHLA 1NDGA 5EWIH 2EKSB 2UZYB 4KI5C 4LLYA 1RUPL 5DMGC 3VFSB 5KSBE 2FX8L 3GSXB 3ZDZF 3SGEI 4FQCH 3UEZA 1BQHB 1MIML 4OLXH 2WBKA 3OKKA 5DEFB 1LO0H 3BVNB 3PDDA 2BVTA 5I1EL 4KZDH 3E3QE 3PGFH 4H8WC 2ZZUT 1OPGL 1ACYH 2PYEB 1MFBL 3PL6C 4G9FD 4WWKA 5E2JA 2XZAH 3T65A 1J05B 4LLDB 5IB5B 1WBYB 1SYVA 3QWQB 1JNNL 2BVOB 2O5XL 4X6CE 4AMKL 1U3HC 1KTDA 1C16B 1NL0H 4J3UA 2V5YA 2X4QA 4PTTB 5E9DD 3PWVA 3BRDA 4C58B 4P9HC 4U1LB 3E8UH 5GXBB 1RV6X 1RZJC 4FZ8L 1U8HA 4PJEE 3MTRA 4JFZH 3T3PF 2KUTA 4PJ9C 3HG1E 1TQBC 1BZ7A 4AJ0A 5E8PB 4M4PA 1RJCA 1E4KA 3LCYA 1EUTA 1YEJL 4K23L 4ESKA 1QLFB 4PJIF 1KEML 2HLFC 3P77A 3KAAA 1CDBA 3H3PH 5C0BD 2ARJB 4Y4FA 4MCYA 3MMEA 5DA0B 2X4UB 4AIXA 3B43A 1OW0A 1QSFE 3ECBA 1D9KA 3FZUD 1S9YB 3QEQB 1IT9H 4KROD 4JB9L 1ZXQA 3T2NH 2KDGA 4XWGL 5LKNA 2PYFB 5I6XC 4D0DA 1YC8A 5JXAL 1ZANL 4ZFOL 3G5VB 2G5RA 1U3JA 4HEME 4HIJB 3JWDH 5J1TC 1U8JA 4ORGB 1SBBA 3ULUF 4O02H 2P5EB 3L3KB 3GK8L 1O5DT 2R2EB 1IFHL 1FZKA 3MNZA 3BEVA 1IKNA 4DEPC 3QHZH 1LDSA 5JW4M 3R1GH 3DVGA 1CTNA 1E4XI 3ETBF 2VLRD 1MFBH 3WHE1 2OM5A 2GFBA 3EO0A 3REVB 1UCBL 3MUY1 3REWB 1HIMH 5C0EA 1U8NA 3HE7B 1JNNH 1F3JB 2F54D 5IBTL 4M7JL 3LKRB 4LDEB 4AMKH 1QG3A 5EU7E 4WDIB 4PLNC 2R2HA 1YNTB 3DRQB 3TBYA 4OLVL 3TA3D 2IPUK 4NSKA 1WIOA 4YEEA 2X05A 4QRPA 1FO0B 4OF3A 5D9SA 1R3JB 4UIMA 5JLZA 1CLCA 1ZSDB 4C56E 4BQ8A 1IC5L 1O7VA 5JORA 4WNQB 5C0RH 1BGXH 2FL5B 2KPNA 1JTPA 2P8MA 4LF3B 5T1MB 1JBJA 4OZHF 2AJ3B 2HFEB 2X7LA 4DGVL 5M7QA 3QPQC 4ODXA 3RWDB 3WFEL 2NY6B 1S7XA 4GFTB 2EC9T 4XTRC 5IMOA 4RFEB 3BH9A 3LB6C 4LSSH 1C5CH 3UAJC 3RHWF 3TO4B 3ZKXB 4J2XA 1OVZA 5E8OA 4QT5B 1MPAL 5E6IC 1ZGLB 3VGGA 5IVZA 2WUBL 4GT7A 4PRHA 1KIUA 3HRZB 1OT1A 3RWGA 3P9MB 3LV3A 3TNMB 4XBGA 2PETA 1TNMA 4OZIE 1V3LA 1DLFH 4PV8B 4WWKD 2V9QA 2BSED 4LAJH 2J8UA 1FFOB 4PRPE 2DWDB 1HZHL 1U36A 3B9KB 1JK8A 5E08H 3MFFB 4PLJC 4GRWE 2EIEA 2VXQH 2HMIC 3WFHB 4YUEH 3QIBC 4YK4B 2DF3A 2D7TL 2AEPH 5BXFA 4JY6B 1ROWA 4W70A 3TP4A 2XG4A 3N1PC 1A7OH 2A74B 1GGTA 3S7GA 4HZLB 5EOTA 5I76A 1HK6A 3R0MA 1S7TA 1WLHA 3G5XA 4NQSB 1DQJA 1NCDL 2XIDA 3NFSL 3PWNB 2HWZL 5HYQB 3Q48A 4Y4FD 3UC0L 2DQEH 4LQFL 3DVFA 4LLVB 3S34H 4Z7VE 4Y4KA 4HH9B 3QHFL 4UNVA 2DYPA 1D9KD 1OD9A 2AXFA 3L5WB 2DS4A 4E0RB 4L1DA 1SMAA 3V4PL 4QRUA 4YBQD 2RJMA 3EGSB 3LQZA 1WAAF 3OR6B 5FUOL 5FYJH 1A4KA 5H94A 4MD4B 5E4IA 1T2QH 5EOCH 2DLTA 3MLXL 5JO5B 2VL5B 3LN4B 3ARDC 1JZ2A 2R23A 1A7BA 1VGEH 2WV3A 5HVHC 1BAFL 2HVJA 2Q7YA 1MRDL 4N8VA 1I4FB 4GAGL 1QFWL 3DMMB 4KQ4H 1MCWM 2IALA 3ZZ1A 1LK3L 3U4EB 2PO6B 3BWAB 3NPSB 4H1LA 5IKCA 3EJZC 4QY8A 5HI5D 1FVEA 4D9QE 4XC1L 4LPCA 2ATPA 3LDBC 4PYGA 5HGBA 4QRPD 1OTTD 3MR9B 1WZKA 4LCWB 5ALCH 2OMNA 4LSRL 2V2XB 1FNEB 1JTOA 1QA9B 5C0AE 3DVIA 3HTLX 1IZJA 1ORSA 4GKNB 3O4LB 4AT6B 2Y1VA 1FIEA 1T83C 2G60H 3I50L 3NFSH 3UTZA 5DHVH 5F7LB 2HN7A 4N0FA 2EIBA 3L95B 4U1HA 5T3XL 4Z7OF 1NBVL 4LQFH 4D9RD 3RWFB 5KSBB 1MEXH 4PGCA 3S5LG 2HYMA 2YD3A 4NKOA 4YQXL 5TJWK 4YDJA 5CCKH 1CF8H 3QEGL 3GBMH 2WP3T 2MMXA 4PRHD 4NO2A 2Z92B 1C5BL 4JDZA 4ODWB 1Q1JL 4LLQA 5JPNB 5C09E 1GJIA 5HGHB 4OJFL 4PJAF 3PJSA 1EEYA 3TIEB 3VXOB 4UT9H 3V5HA 4NNXA 3O6FB 4EUPA 3J7HA 3JWOL 3PWUA 5JW5B 4X6CB 5IVXF 3UTSA 4BH7A 4RMSA 5HGDA 1XR9A 1LE9B 3VRLF 4HWZA 5BQ7A 1G9ML 1KN2L 3OAZH 5C07A 4HKJB 4XCNA 2DQJL 2H26A 3EYOB 25C8L 3DPBA 4GH7B 4XMPH 4UB0H 4GAGH 4CDGC 3HC4L 1GH7A 4U2ZA 2UWEF 4RIRB 1F4XL 3BPLC 1LK3H 4LSDA 4PJEB 4F9LA 4XB7A 1RZKL 2DQDL 2FJHA 1IGTA 3HG1B 1BJ8A 4XAKE 4NRZB 2CDFB 3ZTJH 3B83A 3DX9A 4PRNA 1CFNB 4PRIE 3QNXA 1KLUA 2Y7QA 3C8KA 1N2RA 4DFHA 5ANME 1MNUH 1IM9A 5C0JB 3V5KB 4I5BA 3S97C 5FM5M 1KJVA 1IEAA 1ZVSB 1RJLA 1BFVH 1YN7B 2R29H 4Y4KD 1GC1H 1M6OB 1IAMA 1MI5B 2I60L 1ZMYA 2DYPD 3PWPA 4OFPA 5C0GB 3FQUA 4MB5A 1L0QA 3K8MA 4O9HH 4Y4HC 5KBNC 4G7YL 4O00A 1IRAY 2DOCA 1JYWA 1CR9L 3KPQA 1DQDH 1SBSL 5C7XH 3NCCB 3D25A 1GZQB 4Y5XC 4NZJA 1QZ1A 3KLSA 4WI5A 2VLJE 3OGCA 2FWOB 4X8XA 2VH5L 5D2LF 4N90D 2YMXL 4BFIB 3C08L 4XBPB 2D31A 3SDAA 35C8H 3VE0B 1YPZE 5I8EB 1NUGA 1NMAH 4ZNEA 3UTTA 3KYAA 3JWOH 4MZ2A 4HAGA 5CEZH 1FZOB 5DJCA 3HPJB 2Z93A 4ZNCD 2I24N 5FAAA 2OR8A 4KKCC 4V1DE 2DQJH 1TPXB 1I1AB 3QJHB 3LKOB 3RU8H 25C8H 1HWGB 3RPIA 4C56B 4X5LA 4R7NA 2PW2A 4PFEA 1G6RH 3O41A 4X8JA 3LKSB 1AQKH 4Q74A 4P5KB 4IRJC 1KCSL 3BGMA 3GSVA 3C60B 1VDGA 3SPVA 4KK6D 3U6RB 4M5YH 4ENEC 2I60H 4F33B 5SX4I 3DXAA 5DUPL 5IUSA 4NZUH 3IFNL 2AERT 1YQVL 4Z7UF 1DBJH 1QTYT 4JVUA 4OZIB 1BEYL 3DUHA 2G75B 3RVVD 4Q6YA 3FT3B 4XBEL 4M3JA 1A6WH 4NZRH 5F7YC 4JPVL 4PRPB 4LASL 5LQBL 4MQ7B 3U0TA 2IC2A 4GRWB 3UTSD 2AV1A 4ZTPL 3W11D 2DLIA 4QXUL 3N9GH 4F2MA 5C07D 3H9HA 5KVMC 5LWYL 2PR4L 4XPFL 5DQ9B 2I9LB 1FBIH 4Y19A 1UZ8B 3WSQH 1IM3A 1LNUA 1OF2B 1S9VA 2YKLH 4UAOB 3ARFB 3K81A 2D0GA 1ZLUK 5D1ZD 2WSKA 5CMAB 4JE4B 4JRXA 2PKDA 4NQDB 4J1UB 1KJ3H 5D1XB 3TYGH 43C9A 4P2OC 1JWMA 4WW2B 1AO7A 1IM9D 1D5MB 4XMKH 4P3CL 4JN2B 4Z7VB 4DVBB 5MP6L 1WF5A 2W60B 3O2DH 3PWPD 5CJQH 3JV6B 2ESVA 3HI5L 4LGPB 3OKDA 1UA6H 3T0BA 3QFJA 3UX9B 5F96L 1TZGH 3D18A 4YGVB 5DUPH 4KXZH 3AS0A 1CQKA 4UTBL 4RBPK 3CCHA 5TQ0L 5I15H 1UZ6E 5ETUB 1S8DA 4GJTB 1UWXH 1BEYH 4QNPE 1UADC 4XBEH 5D1QB 2YD1A 5F93C 3SDAD 1SMOA 1R3LB 4JO3L 3UTTD 2P4AB 4R4BB 1XGTA 1MHEA 2EYSB 5BS0A 5T1KB 3I9GL 1PSKH 5EU5A 2JF1A 4UTAH 5I0DA 2X40A 1A3RL 4HSQA 1S7QA 4PP2B 4QOKA 5E2VH 1XF5B 5LWYH 4JFDA 5A1AA 4UUJB 1AIFB 5EC2A 5DHYA 1YEFL 5F21B 4BJLA 1Q0YH 2FEDC 3WKNA 1T03L 1KXVC 3EYQD 3LN5B 3MV7E 1QLRA 4DAGL 1BQUA 3IF1B 5FHBL 4NGHL 3ULUC 2AI0L 3PWJB 4MNHA 1P84J 2IPKB 1PEWA 3HPLA 3LOWA 3SKNB 3M07A 3DXAD 3HI5H 4HX1B 4PJHF 2C1PB 3M8OL 1AXTH 5C09B 4FMKA 1CI5A 2EDRA 3O6LH 4M1CD 1TVHB 1WZMA 2KL6A 4JN1H 1RUMH 2ZOKA 5LXGL 3FO1A 1OAZL 1MH5B 1NDMA 5I1JL 1LO4H 3U7YL 5FYLL 4YHLL 4J4PC 4NFCA 2BVPB 4U1JB 4EBQH 2IANA 4GBXB 5DXWA 2NY7H 3FRPG 1H8SA 2X09A 4Y19D 2DIAA 4X6EB 4TUJA 4V2CB 4Z95H 4KJWC 4W6YB 12E8L 2H2SD 1MCFA 2NY4C 5CJXC 3SE8L 4PRIB 4EDXA 5GZNC 4JRXD 4PLKC 1DVFA 3AB0B 4IRSC 2E9JA 5SWZE 4MZ3A 3X3GH 5JW4Q 4PGEA 1DDHA 1YEFH 1IQWH 3NIDF 1HHKB 1AO7D 1K6QH 4UT7H 3HN3A 2FLRT 1T03H 1I7UB 5J1AB 3VI4E 4LMQI 5F9WB 3FT2A 4MNQB 4HIXH 4NQUA 4UQ2A 5E8NA 3MSPA 3HNSH 1MCEA 2ESVD 3PP4L 2CGRL 1Z2KA 3HI1B 1QFWI 3QFJD 1ULVA 4K7FB 1BD2E 3U36A 5DD1L 2JE8A 3TJEH 1FSKC 3VXRA 5IM7B 2R0LL 2NW3B 5KSAB 1G7JA 3MV9A 3OV6A 3EJJX 1FO0H 5EC1A 1YPZB 1NCUA 1KB5B 4W6XB 1KPRB 4P4RB 2G5BB 3OKNB 3S88L 5D7KD 5EA0H 5AWNH 2OK0L 2DBLL 2Z8SA 1Z6JT 4KC3B 3FOMA 4PRDB 4CVUA 1MJ7H 1MVUA 2CO6B 4LGSB 2GHWB 4V1DB 1U93A 4YX2H 5EO1B 3UZEA 4LL9A 3QXDA 4QOKD 1P69B 4OT1H 4JZNA 2P8LA 4JFDD 3ZT7A 2HRPL 2J2ZA 4APQB 2LFGA 4GS7B 5C3TA 3D85B 3IDIB 3V6OA 1BF2A 3T4AA 5FA3B 2EDQA 4P46B 3BKJH 9CGTA 4DUVA 1JUFA 1NFDE 4NQEA 4LVEA 3NZ8B 4UV4H 4XHJC 2ZUVA 4PBVC 4FA8A 1EUUA 3JV0A 4MS8C 5IEKB 2X4TB 3MLVH 3VXUA 3BAEL 5I30L 2EE9A 4HXBL 2QKIB 4FQ1H 5F7NC 4XCEB 1A7QL 3GSRB 5E9DE 3VFPA 4KH2A 4ZO8A 1PAMA 3F7VA 3I02A 5TE4L 1W72L 4S1QL 4PREB 1A1NB 2NXYC 4X6FA 3BH8B 3QA3B 5J3HD 1YECL 4LCCC 2ADIB 3KJ4B 3NABH 1MAMH 1RUAH 1Q9KB 5IIEA 3T2PA 1LEIA 3OB8A 2R0LH 1UVQB 4OSUL 3EO1A 1F02I 2DQGL 1DUZA 4U1IA 5A2IH 4H25A 1K8IA 2JCCA 1OTSD 3QI9A 5DI8B 1XGPB 3LS4H 5BVPL 2IAND 2HFGL 1C08A 2YA0A 4I0PB 4TNWK 5HI4D 5IF0B 4FFVC 4I4WA 2EDWA 3EYSL 2P43B 3CDGB 5DVMA 1A4JB 2GK2A 4OIIH 5D7JC 2X70A 5D93B 3H9SA 2PCPB 4L29A 3FCTA 1CK0H 1QVOB 5HHPB 3VFTB 1CG9A 2CXGA 4AG4L 4G42A 2CIIB 5IV2A 3UTPE 1ZA3B 4YBHA 3W2DL 4Q6IA 2Y4SA 3ARXA 3BP7B 5FOJA 3VFWA 4Q7DA 1HEZB 4YC2C 4C55A 5DJAB 4ZODA 4Z9KB 2HJKB 3UTOA 5MEQB 3BO8B 2LAGB 2F54E 3OAUL 4P2RB 1KFAL 2VKWA 5C08A 4ZFFB 4HXBH 4GQ9H 3RQ3A 3ET9F 2Q87A 1CGSH 3G5ZA 1OHQA 2ICCA 2OJEB 3VXRD 3QIWB 4MDIB 4KAQL 3S4SA 1W72H 1F2XK 1NFIB 3ARQA 3T3MF 4M7ZC 1ZEAH 3MV9D 3TT3L 3QQ4B 1NCCH 3B2VH 1KELH 3NGBC 4O2EA 1FAKT 5KSUB 4ZAKC 1NJ9A 1YEIL 1CDGA 3D48R 2Z91B 4MCZA 1FPTH 2FDBP 1VERA 3MRHB 4N0UE 1M71B 3PNWB 4OLZH 1FVDB 4CW1A 1GGIL 1Y6KR 4WFFD 4NOFA 4GG6E 3MLUL 3QO1A 1T2JA 5DJ6B 3OB0H 2V17L 2GUOB 1KBGH 2V2WA 5I66B 1JPSL 5IHZB 2XN9A 2FR4A 1U3YA 1WV7T 2LVCA 1NLDH 3SO5A 1J0KA 2W0FB 4WFED 2P7TA 7FABH 2OZ4L 3MV7B 2DKUA 1G84A 5F7HA 1KIRB 5ENWB 1N64L 4ZXBC 1ZV5A 4KRLB 3THMH 2D03L 3VXUD 1D5ZA 2H6PA 2ARWA 4ZQKB 1C8PA 3T1FA 4OV5A 4J3VA 1I7RB 3RZCC 4LLUA 1EO7A 4BA8A 5GRZA 4OCWH 4KKBD 1JYVA 3H7BB 1D5XB 4HUNB 4JFEE 2FX7H 5IQ9B 1A9BA 5IB1B 2OJZH 5IR1A 3MRCB 4OLYL 5JHDA 2Z31A 4KAQH 1X6NA 3CC5A 2NLJA 5DQDL 2OP4H 1CDCA 1YC7A 3DGGA 3VG9B 3A6CL 3HNTL 3L5XH 3QI9D 3U48A 4EKXA 2AQ2A 3MROA 2C7UB 2V7NA 2VDNL 5E6IA 3WXWL 4AEHH 2K3TA 4ODHH 4XC3L 2P46B 1Q9LB 4RRPG 5EZLA 4OCLC 5SWZB 1G7PA 3CMOH 3H9SD 1MUJA 4IHOA 4X4XB 3QQ3B 4R7DA 4PS4L 1T3FB 1CZ8L 1J12A 4L8SA 1ZWIA 1CT8A 4LPYA 3KJ6H 1ERNA 3MRIA 1IGMH 3MBEB 3QIBA 1K8DA 4PJ8C 4GW1B 4X6BB 4BSJA 3KDMA 5HHXH 1LDPH 3VU2A 2UZIH 1C1EL 5LGHL 1X4XA 3Q6GL 4QYOA 5C08D 2MPAL 5E8DH 1BD2B 1T4KA 5I1KH 1FYTA 1U8LA 3FRPA 1XGQA 3L3OA 1DFBH 1H5BA 4OIAA 4ZOAA 1QSEA 1MHCB 2CUHA 2LTQC 4GW4A 4JGUA 5DD3L 4TTDC 1AXSB 1ONQA 1M7IA 3BD5A 2NW2B 4NWUH 4XGZB 2JJSC 3TVMC 3QDMA 5DFWH 1GPOL 1U8OB 4PJDE 3OJDA 4XVSL 5I1GH 1ZGLM 4P5MB 4F7MA 2WWKT 4LPUA 3PDOB 1AE6L 2FB4H 3IU4L 1SJHB 5DQDH 2DLGA 1PGRB 4GUPB 4NYLB 4M62L 2MTPA 5E00B 4D9RE 2B39A 3HMWL 4M8VA 1HOCB 1KG0B 3NZHH 1SEBA 4OI7A 4YFDB 1Q94A 3FTGB 3BWUC 1IAIL 4MA8H 2XN9D 5FO7B 2MCG1 4PRHE 3KPSA 4YHIB 2R0KL 1NAMB 4PJCA 1C5DB 4H0HB 4LBEA 4GG8B 4OM0H 1NFDB 4G9FB 4HUMB 3BEWA 3UBXB 1GZPB 4TSAL 5CZXD 3WFBH 4MA7L 1NGWB 1IQDB 1HINH 4UINH 1UM4H 1DBBH 3ZDZE 3K1KC 3BPNB 1FGVL 3ZE2E 4L9LB 1I8MB 2OS7A 1I9RH 4U7MA 4JAMA 5E9DB 4JVPA 2G2RB 4MVBC 4Z0XA 4GRWH 4PUBL 5DJXB 1YDPB 1D5BA 4IMLA 4JG1L 4MAYA 1KJ2B 3LEVH 4YGAB 4JKLA 4GAJH 3VD5A 1I3GH 1M7DA 5BV7L 2ZUWA 1JZ4A 2EXWC 1AHWB 4ALAH 1I7ZA 5KS9A 5KW9H 3O9WC 4NO5B 4ZFZA 2R0WH 2D7OA 3GDBA 2EDHA 2DQFB 1QNZL 4L4VA 2BNRA 3CVIL 5IGXH 1VFBA 5J0BA 1OSPL 3RNQA 4LEXL 4IBLT 2Z31D 1DTUA 1BFOA 3NN8A 3LB6D 1MLBB 1GPOH 4GRLA 3GMLA 4H26B 2DWEB 2E6JA 2WWMD 3O3UN 3T3PE 4O2CB 3BKMH 4KROB 4GOSA 5E6ID 4U1NB 1QRNA 3IFPB 1A14L 5DRWA 3K2UL 1WIUA 1OD7A 2MJWA 4DK3A 4ZPTB 3V6ZB 5F1NB 4KQ3L 1AXIB 4L5FL 4G8GA 1TTFA 2EXYD 1FC2D 3U9UB 3V0VA 2X4SA 4Z7QF 5GGRA 3VGBA 3ZSTA 3IETA 1CIDA 4JGJA 5H37H 1S9XA 2Z9TA 5BVJA 4N90E 4I3SH 3K80A 5JZ7C 3WJLC 3G08B 3KXFA 4XNZB 3NAAL 5HHMD 3C6LB 2O61A 3FO0L 1OP5H 5E1AA 1QOKA 2VDML 1KTLB 5ABDE 3QIBD 2H8PB 5L6YH 2F54B 4LCIH 3VD7A 4YDLC 3OR7A 4C4KT 5I1LB 5L9DL 1FYTD 4RMWA 2E5EA 5IW3A 4R6UA 1QSED 5F1SA 5MEPA 1CDJA 1J8KA 1BIIA 3VWKA 1WFTA 4FQJL 4JY5H 3W82A 3QDMD 3FB8B 3LKNA 4KTDH 1OGTA 3AREC 4R26L 1WBXB 1Y6MR 3CVIH 4D8PB 1VFUA 1OSPH 4Z7WF 2BSRB 5AZ2L 4OD1L 1JGEA 4TN9A 3MCLL 1EGJA 3S36L 2BCKB 2YPVL 4HPYH 5FO9B 1HH9A 2VISA 1NDGB 4I2XE 4LLYB 1P5VA 2V9RA 2BNQA 5CINH 5F8RC 1WIPA 4CUCA 1CLZL 3ILQC 3B9AA 3OKKB 2BVQA 3K2UH 1U8QB 3KPSD 3V9FA 5I1CH 1G0XA 4YFLF 4WWKB 1IC4H 3T65B 3DO3A 3MO1A 1SYVB 4H5SA 4K8RH 1EV2E 1JGLH 4PR5A 3U4BL 3UTSE 3G5YB 1Q8MA 3BFOA 1KTDB 2LU4A 4BQ9A 3EJZD 4QEGA 2DQUH 5CUSL 5C07E 2X4QB 2AJVH 4WI6A 3WO4C 1YZZA 2EDLA 3PWVB 4LIQL 5I75C 3T4YA 4MAYD 1S5HA 2EH8H 4JFEB 1OQXA 3U9PL 2VXSH 1X5GA 2CDGA 1BZ7B 2NTSP 2QQKH 3W5MA 2GJZA 4XXDA 4E5XB 4L4VD 2BNRD 4KK5D 2R1WA 3P77B 2ZG3A 1URLA 5DJYA 3TM6A 3BW9A 2MSPA 4HIIA 1OQOA 4MCYB 3MMEB 1EAJA 3GSNB 3RAJL 4GRLD 4R26H 2C3VB 2VN7A 1UJ3C 4S1RH 2GITA 3ECBB 1D9KB 4KVCL 5I9QC 3PWPE 1QRND 4AZ8A 1T0PB 1RY7B 2L7UA 1MCOH 4XVUD 4G8GD 3AGVA 4YFEA 1U8JB 3MUZ1 4RGOH 5B8CB 4AL8L 5A2JH 4KHXH 2A0LD 2GY7B 5IT2L 2A1WH 4W4NA 1FZKB 3MNZB 4WV1B 4EOWL 3DVGB 3TEUA 3KXFD 5FYKD 4O4YH 4U3XA 3LD8B 1CFTB 1BREA 3EO0B 2J3SA 4IMKA 1U8NB 3UTTE 3ARVA 4R4NC 2RCSH 1SQ2N 3E0GA 4YDIL 5TGBA 3O6ML 2HJLA 2R2HB 2ILLA 4NSKB 2R56H 5BJTB 4QRPB 5GRWA 4UIMB 2DB8A 4Z8FH 3VWKD 1LEGB 3B9VA 4U1MA 5KJRH 2F8XC 1P4IL 4PJDB 1OAKL 1U58B 3K74B 4LLWA 3WFZA 1A7PL 1KEGH 1YJDC 4ODXB 4P59H 2X4NA 1CVRA 3AY4C 3ALWA 5IMOB 3A67L 3BH9B 4WTWA 5J7CC 1E4WH 1KPUA 3C5JA 1WZ1L 3IJSA 3AS2A 4RQQA 4A6YL 3DROA 3HRPA 3DURB 3O3EA 4WFHE 1NC4A 1G9EA 4IJ3B 3DXAE 3PHSA 3ZT6A 5IVZB 4PRHB 2X1WL 3EHBD 2IQ9L 2P49B 4YE4L 3RWGB 1BQHG 3LV3B 4KUZL 3KYKL 4KDVA 1CL7H 3HB3C 3KPPA 4Z7NF 1U42A 1ZHKA 1RZ7H 2J8UB 3Q5TA 1ZK9A 3TIDA 2DD8H 1R5VA 1XZ0A 4JFHD 1JK8B 5HYEA 5IROA 4H8WL 2F53A 3UROR 1T7YA 1YNLH 2X1QA 4ZUTA 1DBAH 1YEHL 5JDSB 3KPLA 4EEEA 3WJJA 4Z78A 2BC4A 4PJAE 5BXFB 4PY8J 3ARSA 1OARL 1HXYB 4WCYH 2BDNL 3O6MH 5L0QC 2XACC 3S37L 1D5IL 4XP6L 4U31A 3CFJA 4HF5L 5EOTB 3QG7H 3VRLE 3D1MC 3G5XB 4OB5L 2X2YA 4JRXE 5ITBH 3U4AA 1RZJL 2OYPA 3GMNA 4G8EA 3LRGA 1NPUA 1U41A 4G3YH 2NY3D 3T2OA 3WIFA 4DGYL 3BI9X 4H88L 3RTQA 5GRJH 1P4IH 1AO7E 3FN9A 2UWEE 4RA0C 3TCLA 5FGBC 4XT1C 4Y4KB 4ENED 2DYPB 2IWGA 4Y16C 5CD3B 2AXFB 2JJTC 4JKMA 2ESVE 4QRUB 3MRKA 1KIQA 2YPKA 4PJXF 4XCYA 2D9CA 3RP1A 1QLEH 3QFJE 3X11A 5C2BL 1A4KB 3MCKA 4P99A 5HYJA 2HG5A 4K3DL 4YR6A 3IDMA 2HLAA 4NP4H 3G6JE 2R8SL 2IQ9H 2DQHH 5SX5H 2R23B 2V5MA 4KUZH 4MSWB 3BZEA 1RK0B 4LSQL 1DANT 2HT2D 1EERB 4OZHA 2HVJB 4J4PA 2XTLA 5D7KE 4N8VB 2J8HA 2IALB 3INUH 4HUKB 5EO9A 3OTTA 5IQ7L 4H8WH 1INEL 5IKCB 1J1XL 4QY8B 1M1SA 5CJXA 1FVEB 5FCUL 2NXZC 3W9DA 1R0AL 1QBMH 4DGIL 4IRSA 4CVZA 4KJQD 5DJ8A 4MDJA 3G04A 2DM4A 4PBWD 4R4FL 2BDNH 3BZDA 3S96A 2AK4A 5FECA 3UDWA 1JGUH 1ORSB 1RIHL 4JVWA 1IAII 1FLTX 3K8KA 4P9HH 3VD3A 3WD5L 3MPCA 3QUYA 4GRMA 4YHML 4POZD 3I84A 3UTZB 2HN7B 2EYTA 4N0FB 1HN1A 2QJDA 4U1HB 2ZUQC 4M6ML 4QTIL 4LAQL 4YHKL 1S5IH 5CILH 4PGCB 5D6DC 3LQAH 3D9AL 4NKOB 1UACL 2DI8A 3LIZL 2XNAA 1NC4D 5ISZE 3KPMA 3CU7A 1FRGH 4NO2B 3NIFE 3QZWG 3CXDL 1S9WA 2DTML 4JDZB 4RMQA 5E2TL 3RVUC 4LLQB 3O2VH 5L88L 5EUKA 2F15A 5DJZA 5AUMA 3PJSB 1EEYB 5EU6A 3TBSA 4HG4K 1N26A 3T0EC 3V5HB 4NNXB 4K3DH 4EUPB 3UTSB 4AYFA 5HGDB 2DL9A 1XR9B 4HWZB 3RGVC 5DD0L 5BQ7B 2F53D 5C07B 1CD1A 1I8LC 2ORBL 5I1DA 1U8MA 1WTGT 2EECA 2H26B 2B0SL 5JTWA 5GGTA 4HT1L 5HHNB 2IANE 3LSOA 2GEEA 4HXAL 3MYJB 3V5DB 5D1ZB 3NH7H 1A3LL 3DX9B 1FL5A 4PRNB 2X5PA 3TPUA 4F9PA 1WAAA 3QNXB 5F7EL 1EO8H 2Y7QB 1ZLSL 4NJAL 1FDLL 4V2BA 3C8KB 1N2RB 1YA5A 3X12A 3B3IB 3ULUD 3W0WA 3RTQD 1OGAE 5L8KB 4I5BB 3IDUA 1KJVB 2JELH 1IEAB 4Y1AA 5ESVA 1JIBA 1P9MC 1RJLB 3KLAA 4OZGA 3PWPB 3GM0A 1TMCB 2VB5A 5ILTL 5IBUG 4FQXA 3HFML 1ZLWK 4PRAA 4LAQH 4X5WB 4LCCA 4HUXA 1MWAL 4PB9L 4M5ZL 1UACH 4XXCC 3D25B 5CJOL 3OSKA 4UBDC 2DDQL 1ETZB 4JZJC 5ICYB 5HYJD 3OGCB 1H3GA 3VXRE 5L2KA 3ARWA 5C9JA 2MCPL 3CXDH 3WN5C 4Y5YA 4ONFH 2B1HL 2D31B 5DEGA 3SDAB 4JFQB 4HCRH 1EHLH 1X44A 4S1DC 5LJYH 3MODL 1X9QA 4J4PD 3RI5K 3UTTB 4YBLC 5JIIA 5DJCB 5DK0A 1XF2B 2Z93B 5IBLC 5EO0B 4F3FA 2VDRH 2NY4D 1RU9H 3ZYZA 4MAUH 4X9HA 2B0SH 4WFFE 3HR5A 4IRSD 3TESA 3MA9H 4HT1H 3RPIB 4JG0H 3MOBL 1DL7H 4IDLA 3GIZL 3FO2A 5IK3A 1X6LA 2PW2B 1JV5A 4X8JB 2AK4D 3V6OE 2L4OA 4EN3C 4WFEE 1QQDB 1GIGL 3CPLA 3T0VA 3QUYD 2VXUL 4ONGH 4M1DL 3RIFK 5EBWA 1MHHB 4EI5A 2EZ0C 4LCUA 5IVXA 2RR3A 1IZKA 2CRYA 2NPLX 3F65A 3GSVB 2AS5M 2B7DT 3VXUE 3MOAL 4NC0B 1XGUB 3DXAB 1F90H 5EZOH 1MCPL 3T0XA 4BZ2H 4JFFA 5FYKU 1MCSA 4IDJL 4DQOL 2NY1B 4TSBH 2QBWA 2XTJD 2EDKA 3PGCA 1KJ2H 2FHCA 2XV6B 1UM6L 2W91A 4KKAD 2J6EA 5EU6D 4ZAKA 1NMCB 4QHNA 1CS6A 5DLML 3B6SA 3JBG7 3U0TB 2AV1B 1WQVT 4L8BB 3TF7C 1H3UA 1CFBA 1JRHL 4F2MB 2B1HH 3TZVA 5HVGB 4KUCD 3ROOA 3H9HB 4R9HA 5TF1H 4DN4L 2PTVA 4OD3H 4RAUA 4G6AC 1NCAL 1EA9C 1QD0A 2UY7A 4JHZA 4OCSH 1WC7B 4QO1A 3UXFA 4L8DA 1OOAA 1A6ZA 2NX5D 4JRXB 4DZ8A 3JV4A 3H9SE 3NCYP 43C9B 3GIZH 2WWKO 3ZO0A 1AO7B 1YYML 1CL7I 2CSPA 3W0WD 4MS8D 3MA7A 4R90L 5IFAL 3ULVD 4P23C 4Y1AD 5F1OB 2R4RL 5FA4A 3HMXA 2OXGA 3ARGC 2ESVB 4PJGF 3OKDB 1H0DA 4FQXD 4R97C 1NAKL 5F1KC 2NXYD 3QFJB 1MJUL 3NIDE 3VGDA 5C08E 5DUML 3D18B 3OAYK 8FABA 4ZOCA 3S8WA 2I9TA 3U2SA 1U6AL 3MLRH 4MA1C 5DYOA 3G6JB 4LSUH 5LCVL 3CCHB 3RWIA 3ZDYF 3CUPA 2Q8BH 5F3HA 5L2KD 5IFHL 1LO3H 3SDCC 3CH1A 1T66C 4YO0A 4F8QA 5INCA 4X4YB 4ZS6C 4ZYKA 1QFWM 5HYFA 1XGTB 2V5TA 5JOEA 4AQ1B 2C26A 2Q86A 2Y07H 4W6WB 3UJTL 4FFVD 1JRHH 4LLMA 3LAFA 5IJKC 1X5HA 4GLRH 5KG9A 1S7QB 4QOKB 3OJ2C 1U9KA 4DN4H 1MCKA 4JFDB 3P0YL 3MLYL 1A3QA 1V3MA 1IILE 3N1QC 4LRNH 5DHYB 1FH5H 3I75B 3BPOC 1FNAA 1JHTA 4G6FD 1IL1A 1FL3A 5BOZG 4MXQD 3WE6B 1ITCA 5JIHA 1Q0XH 1BBJA 5IWLC 2SEBA 3LPFA 4PJ8A 5I73C 4NBYB 2PTTA 4EI5D 5C0CA 2FBJL 4NN5B 4PG2C 1YYMH 1CU4H 3EFFB 1A22B 2HP4A 5FKPA 4UDTA 1PBYA 2DL2A 5ECJE 4R2GC 3C5SA 5ISZB 1PG7H 4P4KA 4HH8A 1PLGL 1DSFL 5F7WC 1A6AA 4JFFD 3GMRA 3ARBA 4WEUD 4YWGL 2XWJB 4CADA 4N0CC 4UT6L 1NCWL 2ZOKB 4ZAKD 5LCVH 3NACH 1IMHC 3FO1B 1GC1C 4OCXL 2MHAA 5DD6B 3VFNB 4FFZL 2F74A 1CFVL 5KSBF 3TZVD 4NPYA 4FQ2L 4C4KO 1RHFA 3RX5A 3GKZA 5HD8D 4CN1A 2YC1A 3VWJC 2IANB 4NO3B 1ND0A 4JQXC 2GI7A 3GSNH 1BQLH 4TUJB 2QADD 4XX1G 3RKDD 1B3JA 4E42A 4EDXB 3GZKA 5HHQA 2A9NL 3P0YH 3BD3A 1U95A 1RQ5A 4KTYA 3OKMA 4PGEB 3OB0K 4X6CF 3X3FH 4KKLC 3QZWA 4OF0A 3IXAA 3CFKA 3EDEA 1K9TA 2XA8L 1VESA 1F3RB 3SDDA 3SCMA 5HHME 4AEIH 3FT2B 4NKDB 2A6JA 4UQ2B 4PJEF 4FFYH 5E8NB 5IEHA 2YK1L 3QDAA 5CD5C 5ALBL 1DE4A 4HPOH 1QACA 1A47A 2WNGA 4JKPH 3N0PB 3U36B 4QRQA 4PJBA 3WXVH 4RA3A 5GHWH 3VXRB 1LILA 5FDYA 1QSEE 1HYRC 3C5ZC 2F58H 3MV9B 5EC1B 5GSRA 3VJ6A 4NZTH 1AJ7L 1J8HA 1KN4L 2Q3ZA 5T33H 1RZFH 3CAFA 3H2WA 3MXWH 4ZUSA 1UB6A 2A2QT 2D7MA 3IJYB 3EDFA 4XP9H 3FOMB 2GSIB 4OGXH 2D3VA 4UILL 2VDLL 1MVUB 4G5ZH 1U93B 1KT2A 4JR9H 2ZKHL 4JZNB 5I8OH 3WMSA 2P8LB 1G6VK 4UZGA 4LPVA 1VFMA 3OPZL 5AZEL 2AJSL 4MX7A 3NA9H 4Q0XL 3L3HA 3STZA 4KU1A 3H42H 1K5NA 3MFGB 5DO2C 3BE1L 3KPSE 2Y25A 5KAQF 1DBMH 1JUFB 1D6EA 1L6XA 2VLMD 4PJ8D 1DLHA 1QPXA 1YMME 2VYRE 4HKXB 4M7LL 1K4DA 4G7VH 2BNUB 2M26A 5DD5L 5C0CD 3IKCB 5CJBA 4LVNB 3VXUB 2XA8H 5C71A 2VR9A 2O26U 3QDJA 4HWEL 4YIQA 3ULUL 3MJ7A 3VFPB 1RZGA 3NCJH 2CR6A 4P4KD 1EBPA 1V7NL 3LPWA 5K9JL 4QRRA 2E7BA 3F7VB 3I02B 4TTDD 1MQKL 3JWNC 2AGJH 3ARBD 4X6FB 3SBWC 1MCNA 5KANI 3QUZD 3O8XA 3MCG1 2GTWA 5C86A 1YEDA 3L7FA 5IIEB 1LEIB 2BNRE 1RURL 1O0VA 5EORL 3EO1B 3TN0A 4PJFE 1DUZB 4U1IB 4QCIA 4H25B 4AENA 4MLIA 3UMTA 1K8IB 1KN4H 3EFDH 3QUXA 4TQEL 4WW1A 2HVKA 3C8DA 3QI9B 3QBTB 3VFGL 4M9OA 2EE3A 2YRPA 2VKXA 5IESH 2EO9A 5DWUH 1RULL 5KVDL 2VDLH 6CGTA 4OZIF 4F7EA 2A6KA 5HI3D 4XNQA 2GJ6A 1P7QA 3UO1L 4Q9RH 2X70B 3QIUC 1MJJB 1Q9OA 3H9SB 1HQ4A 4X80H 3FCTB 4G8GE 4ZD3H 1CG9B 2WK2A 4KTEH 4GRWF 1FZJA 2GSGA 5IV2B 1G7LA 4OBSA 1OP3K 2VMFA 3EJYD 3HS0A 4I77L 4Q6IB 3ULSA 3C09B 3VFWB 4JFYA 3KXFE 3SDDD 1I9EA 4KVNH 3CZFA 2DAVA 3SCMD 4F7PB 3V52H 1HKLH 3ZYJA 4XPHH 5F1IB 2BK8A 4G6ML 1VSCA 5F9JA 4RGMC 3KR3L 1I3UA 2EXWD 5C08B 1JPGA 4BKLA 4U4BA 3V4UH 4HWEH 5B38G 3WLBA 3G5ZB 4JQIH 1GGBL 4WW2F 5DMJB 5CZVL 2GIYA 3S4SB 1IJ9A 1N4XL 3MUHL 3CZJA 4Z7VF 1KC5H 5EG6C 5A40E 4JRWA 5JIPA 1J8HD 1Q72H 3N85H 5D70L 1Z5LA 4G43A 2OI9B 1MSPA 1NJ9B 4MCZB 4PGDA 4CW1B 5J1SC 2B4CH 2AW2A 5EU3A 1HI6A 3B5GA 4LP4A 4WI4A 2N1KA 2ICWJ 2UVEA 5FM8A 3QO1B 2ATKA 2APFA 4NJ9L 2V2WB 1F45A 2UUDK 3MNWA 3WNLA 1HKFA 2XN9B 2FR4B 2ED8A 1AH1A 3LMJL 1X5JA 3RWJA 2P7TB 4JO4H 2YHGA 4LSPL 3S35H 3UO1H 3HE6D 3P30H 3SKUD 4J12A 1B90A 3Q0HA 1UYWL 5SWSE 4P57A 4P2CG 1F4YL 3DX7A 1S78D 3KGRA 1D5ZB 4QRSB 2H6PB 4EUPH 5FDWB 4OV5B 4LLUB 5INDA 1LWRA 3EYUL 3QDJD 1JRHI 3U0WH 2BY3A 2IG2L 3ZT5A 5LBSH 3LN9A 1PD6A 4XCFH 4QRRD 3ZL4H 4HKBA 1KCUL 1ZHLA 5F3BA 4I0KA 4DTGH 4HFWA 1INDH 1A9BB 1JWSA 1Z9MA 3O8XD 4DKFH 3D6GA 2VNCA 2ERJB 1HHHA 2Z31B 1WBZA 3AY4A 4M6AA 1FG2A 2NLJB 3TN0D 2BHYA 4HIEA 1A0QL 1I9IH 3MRFA 1NLBL 3QUXD 4OCRL 3B5TA 5DA4A 3MROB 2HT3D 1QO3B 1F00I 3BKYH 3IDNB 3HE7C 4Q9QH 4HS8L 5JXEA 3QH3B 1CE1L 2GAZA 4X9FA 5KTEH 4GMSH 2OTWA 2XRAH 5FKAA 5H8DA 5C2UB 2GJ6D 1P7QD 3PV6A 2YWZA 3RBSA 4LSTH 1MUJB 5D7SL 4IHOB 3MJ8A 3QHTC 4QHKI 4L8SB 5TE6H 1ZWIB 1N7ML 4LEOA 1UQSB 3QEHA 3MACH 1CT8B 3MLWL 5DZOA 1W0YT 4TPRL 5HHMB 3EDJA 2ZNXA 2HFFB 1CXLA 2NY6C 1CYGA 3KDMB 4KK9C 3Q3GA 5EOCJ 2FGZA 5J13B 5FXCH 4QYOB 4AM0B 1UWGH 3TO4C 3ZKXC 1T4KB 5I19L 2OL3B 1XGQB 3L3OB 1H5BB 1QSEB 1R3IL 4GW4B 1DUYA 4KPHH 4F58H 3MRRA 1RJZA 5IB4A 1M7IB 1DBKH 4H0IA 1WEJL 2Y36L 4NM8H 5DUBB 2V7HA 4FOMA 4OCYL 1WFOA 5FUCC 1OTUD 3GHEH 3OJDB 5FGBA 3TBVB 4F7MB 3B9KC 4ISVA 2J4WH 2JJTA 1A7RL 3CJJA 3QXWA 3BP4A 1WT5C 4CMMA 5D96B 3WIHA 4JFXB 5GJTL 3CK0H 2J6EL 3NBNA 4OCRH 2GT9B 2DLHA 2EIDA 4ZFGH 1SEBB 1U8IB 4YK4C 4FXLA 4O2FA 1Q94B 1LGVA 1RUQH 4BH8A 1F4AA 1YPZF 2W65A 1EFXA 3KPSB 4NN6B 4PJCB 1L6ZA 4LBEB 2LV4A 5DR5H 5ADOL 3BEWB 5TE7H 2VC2L 3SGJA 1ED3A 2F5AL 1YMMB 2BHUA 4MXWL 2MNUA 3F58H 2UVFA 1KGCD 1F8TH 1VADA 2ZSVA 1N7MH 3FMGL 3GSQB 1PYWA 4NO0A 3MRLA 4JAMB 2DQIL 2GCYA 4Z0XB 5E2WH 1D5BB 4MAYB 3RDTB 1JVKA 4DOHE 5CEYB 2W0PA 2CK0L 5E2UL 5IMLA 4OGZA 4TUKH 1I7ZB 5KS9B 4JO2L 1RHHA 3V8OA 4XNXH 3EOTL 5SV3A 3W9EA 4YAQA 4L4VB 2BNRB 1VFBB 4UOW0 3DRTA 4PJFB 3UP1A 3DSFL 2H41A 1SM3L 2Y36H 1AGEB 2IPTL 1BFOB 2OXHA 3NN8B 2XZCH 5JQ6H 2CIKA 3QXAA 3O6KH 4GRLB 2IH1A 1EEZA 2NQCA 4KZEH 4P0DA 5K93A 2DICA 3ZDXE 4F80A 4LVOB 3DMMC 4KDTA 1P6AB 3DX8A 3IDGA 5GS0D 2JLLA 1QRNB 5I16A 2P24B 2PO6C 5JXED 3NPSC 3W39A 5L8LB 1J88A 4G8GB 3GRWL 4NQXA 5I18L 3CDYA 1U92B 2C3GA 3V0VB 1JHLH 1MFAL 5GGRB 3T0EA 3IETB 1NSNL 5HYJE 1ES0A 5I1HL 3CFCH 3RGVA 5BVJB 2RFXA 1J5OH 5F9OL 3KXFB 2HH0L 1WTLA 2O61B 4B7IA 4KI1A 4JHAL 4RISL 2F5AH 2BFVH 1A2YB 1DEEA 5MHSD 2A83B 4Y5VB 3AU1A 4N0YH 1D6VL 2OSLA 2WMPA 4HEPG 4HJGA 1QR1A 2V9TA 1OSZB 2RHEA 5BCAA 1W8NA 4N8CH 1N6VA 3VXNA 3GJFK 1EX0A 1EIBA 1MRCL 2XZQL 4G8IA 3HC0B 1BIIB 3VWKB 1SEQL 3DI2B 2X41A 4JO2H 3LKNB 3E3QC 5ACZA 3KNBA 1OGTB 5TFSH 1MREL 4U6YA 3B8YA 2R2BA 3DETD 1BP3B 1CIUA 3O6FC 4X7TA 4LDLB 1X5FA 4X98A 1HH9B 2VISB 2PN5A 1H9VA 5DJ0A 1J87A 4XXCA 3SE9L 1UZ6F 4OFKA 1J1OH 3VI3E 1I75A 1YEEH 1FORL 2CRMA 2H2PC 4QNPF 1VGKA 3I3EA 2ZCKH 3TNNA 3EOBA 1XH3B 4URTB 2BVQB 1EFXD 1H3TA 1ZT1A 2A77L 2XTJE 4J3TA 5LGJA 1A6PA 1UH3A 5SWSB 4H5SB 4PR5B 1LD9A 4J8RA 5SX5K 2B2XL 4NO0D 4G9DA 4CDHA 1FLRL 4F8TA 3VMOA 3CH8A 4U2YA 4ELKA 2YWYA 4ZFOA 3T4YB 4M7KH 5KVGL 5J9PA 5GRUH 1S5HB 1OWRM 1XR8B 2Y06L 3QDHA 2AXGA 1IE5A 2FX9L 1ZLUH 3HZMB 4HBQA 1INQB 4YHYB 2AXJA 2ICWB 1XGYL 2Q8AL 2NX5E 3BUYA 2MOVA 3LHPL 4XXDB 1KSRA 2B5IC 5BO1L 1A6TA 3RVWD 4HDIA 5DJYB 4KRPD 1MELA 1R3HA 2IMMA 2NY3B 5JUEH 1SEQH 3BW9B 3PG2A 3BDYH 4JHWH 3W0WE 3MGTA 1AGDB 3RUGA 3MJ9H 4DKEH 3ULVE 2GITB 4Y1AE 3FT4A 5T5FL 4GAYA 5CWSA 4OZGE 5EUOE 4FZEH 1XAUA 3IGAA 5EU7C 4L3EA 3T8XA 3TLRA 4WUUA 4BSVA 1BOYA 5D6CA 4OCNC 3PABA 2FGWL 1TPXC 1I1AC 3AROA 4K7PH 3SDXA 4ERSH 4OD2B 1TVDA 5IJVA 3T0ED 4LDOB 4RBPH 4QXGH 5CHNA 3RGVD 5B3JE 5FHAL 2EICA 1I85C 3NA4A 2ITCA 1AI1L 1LQSR 1YNKH 3LKPA 4Z7WA 5DF0A 3DYPA 3G6DL 3ARZA 4HG4J 2O5ZH 3C60C 5DDHA 2ADFL 4HW6A 3JSSA 1PG7X 2B2XH 2R9HC 1QSVA 1XCTB 4BUHA 4WHYG 1DQML 4JDTH 2YD2A 2BMKB 4L4TA 1E6OH 3IDYB 2Y5TB 4YPGA 4XWOC 3GHBL 3VI4F 3H7LA 1EJOH 3V6FA 4LLWB 2Q76A 2BRRH 2G9HA 4YHPB 2X4NB 3I6GA 2WQ8A 4RAVA 2FD6H 2HJFA 5J6HB 2QSVA 1KPUB 2AK1H 3C5JB 3IJSB 2QSCL 2MQCA 4RQQB 1JL8A 2H32H 1N6QL 3DROB 3O3EB 5GZOC 2CKBL 1NC4B 1MY5A 1FNSH 1E6JH 4TVSa 4ZUUA 4UAOC 1IAIM 3ARFC 3L1OH 3WDHA 5DHVA 4JDVA 4FQQA 4OQ1A 3HUJE 1N0XH 3WUWA 4UOW1 5D1XC 3KPPB 5KZCB 5GIRA 3ESUF 4WW2C 5T5NF 1R5VB 3TIDB 4LRIA 3ZKNC 1KENH 3GKWH 3FQWA 1HSAA 5C70A 4KK8C 1CFQA 4TSCL 4K3HA 4ZUTB 5JR1H 1KCVH 4HK0A 4NNPL 2W92A 3KPLB 5BMFH 2VQTA 4DOHB 4D2NA 2PF6A 4X6DE 1FE8H 2BC4B 3VH8A 1T89A 3IB4A 4X0KA 5E24E 4P2QA 1VKXA 1G0DA 2QSTA 2K7QA 2Q3AA 1NFDF 4D0CA 3CFJB 5D2NA 5E70A 4WY7H 3KPOA 5IWLA 4QXTB 3VRJA 3MRBA 1K2DA 4G8EB 4GSDH 3K2MC 1NBYA 3P4MA 4XRCA 3HR6A 4Q97A 3EO9H 3WIFB 1F58H 3RTQB 2X4PA 3C2AH 4HS6A 5D1QC 3TCLB 5MEOA 3PHQA 1JE6A 2B1AH 2FJGA 5I1AA 3RVXD 2PYEE 2GKIA 4KV5E 4BQCA 4KY1L 1MCRA 4L3ED 3MRKB 1JCKA 4WO4A 4WUUD 4MB3A 1SVCP 1KIQB 2YPKB 4XCYB 3VW3H 1E4JA 3BIAX 1GGCH 2I5YH 3MYZA 4U6VH 5HYJB 2HG5B 3OWEA 3GO1H 2VSDA 2RIKA 4YR6B 3IDMB 2HLAB 3LS5H 4F37K 4YXKL 4MNGA 3MNVA 1UH4A 4L3CA 3BZEB 3CFEA 3VWJA 2F8VA 5JPMA 1EZVY 3BD4A 3P4NA 5TDOA 3Q2CA 5EO9B 1QPPA 4M03A 3QISA 4P3DB 2NY4B 4LVHB 5T3ZL 3W9DB 4CVZB 1XCQA 5ELIA 4L4TD 3LH2L 5B3NA 5DJ8B 4MDJB 3G04B 5GS1A 3IAPA 2PW1A 3OKLA 2AK4B 1UEYA 3CFDA 3KYOA 5FECB 5HYIA 3LEXA 4NQTA 4K8RC 1KLGA 3A6BH 5H35A 3QUYB 2YPLA 1FIGL 4GRMB 4QWWC 4O5LH 2IBZY 4WU5A 1I8KA 2VLME 2EYTB 5JW3L 2P5WE 4FABL 4B53A 4BFGA 3KWWA 3L6FA 5I8KL 1YJDL 4JPWL 1LE5A 5F6HJ 3DHMA 5L7XL 1G6RA 1X5YA 2XNAB 1UM5L 4GBXC 3ILPA 3KPMB 2XZZA 2ZCHH 3IU3A 2XTJB 3UYOD 2VQ1B 5ESQA 5EUKB 4NRYA 1LO5A 1VCAA 5DJZB 3QNYA 1B4JH 1P1ZA 3AB0C 2APXA 4MQTB 4ZS6D 5EU6B 4PJ7A 3TBSB 2H9GB 4TNVF 4XP4H 2XQBH 2CLZA 5EPMA 1I1YA 5DK3A 4ONHA 1AKJB 5DMKA 4JJ5A 1KXQE 5HTSA 4WEBL 4LU5L 1B0RA 2RBLA 5I1DB 1U8MB 1RK1A 5F9WC 3WHE0 1G7IA 2X44D 3KLHC 1JMZA 3LSOB 4H0GA 4P2QD 2NX5B 4YXHH 1FL5B 3TPUB 5KSVA 3VFUA 3X17A 2Z0BA 1A5FH 5ICZA 2YOCA 1IC7L 2MWCA 3X12B 3VXSA 3W0WB 4NUGL 5KSAC 3QDGA 3OX8A 4JREB 3GI8H 3D0LA 5CBAA 4Y1AB 5CGYC 5ESVB 5JOPD 3KLAB 5I74B 4OZGB 5EUOB 4K3JH 5T1LA 1P4BL 5T1DL 3AC0A 5JOFA 4RWYL 3U1SL 4FQXB 4JM2A 2YBRA 1RMFL 4QHMA 3BOVA 1NBZA 4WO4D 4WUKL 1U0QA 2HTKC 2J5LB 4HUXB 2X4OA 4XP1L 4UNTA 1MVFA 3HKFA 1MCLA 4HJ0D 2NR6C 4X7SL 5HDBF 4I1NB 3WIHL 4APQC 5L2KB 1SY6L 4GS7C 3O2DA 5E03A 3SE3C 1CQYA 4OFYA 3S35X 3T77A 5C9JB 1CLYH 4H20H 2OL3H 2NMSA 4Y5YB 4XPBL 5FK9A 5DSCA 5HY9A 3UJJL 2V2TB 1J8HE 4P46C 2AJZB 1RIVL 3CXHK 5T3XD 2IJ0C 2VDKH 3VWJD 1V5JA 3IDXL 3CMGA 4RSVA 3TV3L 4MJ5A 4N8VG 5DK0B 4WEBH 1K3IA 3T04D 3K7UA 2CLRB 3F7QA 3O2WH 5EWIL 2WBJA 5EDXA 1N59A 4H1LG 3QIUA 2ICEA 1GSMA 3K4ZA 4RGND 3MV8E 4FQCL 3MGAA 1IEBA 4P5TA 3FO2B 4OLXL 5IK3B 3PQYA 4G6FB 2C3HA 4YHNB 1JV5B 3BSZH 1LO0L 3V4VH 5KVEH 3L3GA 2OTUA 4N9GB 1XIWB 5CEZD 4IOFD 4KZDL 3KJ4C 3PGFL 2YRLA 3CPLB 5C0IA 1ACYL 2YPLD 1MF2H 2XZAL 4EI5B 1FCGA 4LCUB 1G7HA 2KQMA 2CH8A 1AR1D 5LAXB 3FO9B 4Z5RA 3IFLH 1NL0L 1U2CA 3VRIB 4MD0A 2D7NA 4YHZL 3QDJE 1PW3A 4JFFB 3FB5A 4I0PC 2D7QA 4GQPH 3E8UL 5E1HB 1JN6B 4QRRE 3OBAA 4PJDF 3MLSH 4JFZL 3R8QA 5EZIL 5D93C 1CGWA 4QHNB 3WHXA 3B6SB 1SY6H 3OJVC 3H3PL 2BVOA 2OBGA 4OBRA 2FCBA 3TZVB 4EVNB 4GMTL 3ROOB 1EDQA 4PP1C 3ZKMC 4PJ5A 3ZKSD 5FEBA 4X6DB 3O4LE 3RJDA 1IT9L 1QFOA 4RAUB 3TV3H 1KCRH 2CK2A 2QADB 2CKNA 3T2NL 2VWEC 4L8DB 3F62A 4BK5A 4G6KH 1A6ZB 5I2IA 1DQLH 4DZ8B 4EXKA 3JWDL 1BVLA 2YRZA 4R8WL 3QIWC 2WANA 4O02L 3ZE2F 5IHBA 4MD5A 3T0WA 3VXSD 5GGVH 3MA7B 3QDGD 3RY6C 1A7NH 2WIIA 1PX4A 2MFNA 3QHZL 3R1GL 1IAOA 2H1PL 3V0WL 1HYSC 3OXSA 5T1LD 4PB0H 4I48B 5JW4R 3BGFB 1HIML 4IIQB 4LGRB 3T2QA 1H0DB 2XKSA 3P9WB 4JM2D 3QT2A 3QUKA 1GRWA 5DVNA 4JPIA 4NC2B 1BX2A 1HHJA 4N5ED 3G5VA 8FABB 1PZUB 3R0NA 4P49A 4YHZH 2XXCB 2I9TB 2A6IA 4DFIA 2P5EA 5DYOB 1N6UA 2I07B 5D7IA 3RWIB 1F2QA 3CUPB 5F3HB 4JKWA 5K33A 3CH1B 4OFYD 1L7TH 4YO0B 5C0RL 1BGXL 2DN7A 5EZIH 4X9BA 1BHGA 4CKVX 4RDQF 1FAIH 1FL6A 2DI7A 3REVA 3UTQA 3REWA 3LQAC 4XVTH 2HTLC 3GBNH 1F3JA 2YA1A 3LKRA 2Q86B 4OGAD 2Z35A 4LLMB 4LSSL 1C5CL 4GMTH 4FS0A 1YNTA 4QLRA 4W81A 5KG9B 2WBJD 3RKPA 4GXVH 1FO0A 1EGJH 3QIUD 2J88H 1GXEA 1X7QA 1MI5E 2R1XA 4QRTB 4P5TD 1NANH 3PQYD 1FL3B 3BN9C 5FO8A 4FN0A 2AJ3A 1DLFL 1ZHNA 1HHIA 1A1MA 3LZFH 2SEBB 3OZ9H 4M4RA 4R8WH 2BY0A 1CGUA 2P5WB 1H8OA 5E4EB 4RFEA 5JHLH 1KGCE 4UDTB 5E08L 5IMMB 1OB1A 3TO4A 2VXQL 3VG9C 3V0WH 2H1PH 1GVIA 2X6MA 4OCMC 4K7PY 3IXTA 3C5SB 4QT5A 4WI2A 5IHUH 3QUML 4P4KB 4YNYB 4YUEL 2X89A 3U7WH 1A6AB 3GMRB 2AEPL 3ARBB 1QSZA 3QUZB 4MHHI 3OXRA 1A7OL 1S7VA 3KHQA 3ME0A 1OCWH 3DECA 1FFOA 3MLPA 3B9KA 4CNIA 2HT4D 1GHFL 4EI6A 1TZHA 1T21A 2MHAB 3MFFA 4CU8A 3VXQA 5IB3A 4OF6A 2C4XA 2DQEL 2O5YH 4NPYB 4GW5A 4A2LA 3LEYH 4JQVC 4PJ5D 2E27H 3MBEC 3S34L 3WFHA 4YPJA 1C7SA 3P73B 5KN5A 1ND0B 4XAWL 3SGKC 4PJGA 4OLWH 1YUHA 1MRFH 4ODTH 3BMWA 2DM3A 4E42B 4X99A 5HHQB 4NQSA 3AM8A 5FYJL 4RFOH 1L7IH 1T2QL 5EOCL 1JMXA 3QZWB 3PWNA 3IXAB 4FQLH 4L8CA 2XWBA 3TJHD 3CFKB 1OWWA 4X4MA 2IAMA 4HH9A 1VGEL 3SDDB 2IBBA 3SCMB 3TBTB 2A6JB 5I8CA 4KQ4L 1A6VH 1WVZA 4BFEA 3EGSA 1DE4B 1KF9B 1TJHH 1JF5A 3OR6A 5E5UB 3QUMH 4PJBB 4NM4H 4LFHD 2JK5A 2P5ED 5ALCL 4PTUA 4XX1E 5E7BA 2VXVH 3LN4A 2VXTH 2OTPA 5GSRB 3VJ6B 3TWCH 3TFKD 1J8HB 3FONA 2NZ9C 4E41E 4ZUSB 1UB6B 3OL2A 4NQDE 1TZIA 2G60L 1GHFH 3F8UB 3U4EA 1J0JA 2PO6A 4ETQA 1QYGH 3BPNC 4L9LC 1RZIA 1AFVH 1W72A 1KT2B 2ADJA 1MEXL 3MV8B 4NWTH 2EIZB 5IBUB 3CSBA 3MR9A 5IG7A 5CCKL 4XAWH 3GFUA 5BZWA 4J6RL 1CF8L 3F7YA 1OAYH 4MX7B 1FNEA 3GBML 1AHWC 1NGYA 3STZB 1AGCA 3HZVA 1EBAA 1K5NB 2AV7A 2H45A 1H3WM 2XKNA 3RWHA 3HE6B 4AT6A 2IADA 1LP9A 1MFEH 3T1WA 1D6EB 2QHRH 5FYLD 3ISWA 4UT9L 2NY6D 1A64A 1K4DB 5DRNB 4YJZL 2CPCA 3MRMA 3VDCA 5BW7A 1EAPA 4ZTOH 1A6UL 3QDJB 4YIQB 5IW1B 5IP4A 3MJ7B 2MQ0A 1RZGB 3AMLA 4KROC 4XMPL 3CSYA 4UB0L 3V6BR 4QRRB 2X89D 4FG6D 2ZCLH 1CICA 2CXKA 2Z92A 4K7PX 3CNKA 4MJIA 5HXMA 5CGTA 4MWFA 1RI8A 5C1MB 3O8XB 2GTWB 3TIEA 1KCLA 5ITFA 3L7FB 4MQXD 2XA3A 4X6CA 3JV5A 3TN0B 3B9KD 1MNUL 4QCIB 4M1GH 4HKJA 1T1ZA 1GGYA 3QUXB 3AS1A 4GAFB 4XNZC 4WW1B 2HVKB 3C6LC 1BFVL 1Q9WA 2R29L 1GC1L 4XMLH 1IGIH 1IGCH 5E5MA 2IGFH 4PJEA 1YEKH 4F7EB 4O9HL 2A6KB 4NRZA 4GKSB 4XH2A 1CCZA 4XNQB 2D4DA 1P7QB 4LCYB 3FN0H 1DQDL 5C7XL 1Q9OB 5DJDB 1HQ4B 1YY9D 3SN6N 4ONOA 3I6KA 2P8PA 2EH7H 2H3NB 4J6RH 4ELMA 3GSUA 5IOPA 2GSGB 2DM2A 1G7LB 1T0NA 3V5KA 1E0OB 3HS0B 3BIBX 1ZVSA 1QSFA 4F15B 2IAMD 35C8L 1M6OA 4ZMAT 1NMAL 3W5NA 5C0GA 4YXLH 1TQCB 1P4LA 4JCLA 5CEZL 5F9JB 2Q6WA 4FMFA 4BKLB 4ZO7A 1I1CA 1UKQA 1A6UH 3P0VH 2VZ1A 4ZS7H 3BQUA 3RU8L 5K9QG 2OZ4A 3CVHH 1A1OA 1BQSA 5ID1A 5I71B 1C12A 1G6RL 3WL9B 3VXTB 4PRBB 1KCKA 1AQKL 3VE0A 2EDDA 5EBLB 5I8EA 3U0PA 1Z5LB 3MJGX 1IGYA 4I18A 4R3SA 5JMRA 4PGDB 3CFBA 2PO6D 3FQRB 5EU3B 1HI6B 4DWHA 4MMXC 1FQ9C 1I1AA 4WHCA 4D3CH 4M5YL 2ATKB 1FJ1B 3SJVA 2EEBA 3G6JF 4C56A 4MNQE 4NZUL 5HHVH 5M94B 4M48H 1ZA6A 2JIXA 1DBJL 1FC1A 3VGAB 1I85A 2PTUA 4X5XB 1E4KC 1A6WL 4P5KA 1X5LA 2DIJA 4NZRL 1RUKH 3QCTH 4G8FA 1CLOH 2E8ZA 4NCDA 3VDBA 1H3PL 4P57B 4K94H 3C60A 2ZNWA 5LGKA 3N9GL 4NHCH 3MV01 1D9KC 1GOHA 4G6JH 4F33A 5INDB 1VENA 3SKOB 3NFNB 2DM7A 1Z0NA 1FBIL 3NMEA 3BZFA 1B6DA 4OFIA 2YKLL 4YBQC 3WSQL 1ZHLB 5F3BB 1CICD 5JDJA 3SKMA 4OZIA 4BSWA 4LARL 2OQJA 4MJID 5GGTH 3WYRA 4S1SH 1QBBA 3AAZB 3BX7C 3IKKA 4DJMA 4NQCA 1SJXA 2NY2D 4ACPA 1HHHB 1KJ3L 4TVPE 4I9WD 5B8CC 3TYGL 1WBZB 1FG2B 3AVEA 2FBOJ 5FIEA 1J1PH 4ZG1A 2LAAA 3L7EA 3MRFB 4WV1C 2YZ1A 4XMKL 3UPCA 4HBCL 4DZBA 3LD8C 3RUGE 2E9BA 3O2DL 4KWUA 2I9LA 4XPAH 3NIFF 3PGDA 1UZ8A 5CJQL 3ULVH 2H2PD 1YEGH 1SHMA 1UA6L 4L3EE 2GAZB 1G0YR 4F7TA 5HI5C 2OTWB 5FKAB 4ZUVA 2COQA 4RWHA 4U33A 2VO5A 4OZ4B 3PV6B 1TZGL 1JNHB 1OTTC 4I13B 1R3KA 4MJ2A 3SDXE 2F19L 4EIZC 3FQNB 3MJ8B 3Q6FA 4FFWD 4WW2A 5I15L 1FZMA 4LEOB 3QEHB 1Y0LB 1HNFA 1QSFD 3SGDH 3D2UA 4LK4A 4NHUA 1IKFH 4OKVA 3WFCH 2X1PA 2C5DC 3PIQA 5IB2A 1H3PH 3KHOA 1PSKL 4PV9A 1I3RA 3Q3GB 4UTAL 3VG0H 5AYQA 3SDYL 1VB9A 2VABA 2VLKA 5E2VL 3BQUD 4ZO9A 1DUYB 2R4SL 3MRRB 4IJ3C 5IB4B 1WFUA 1TNNA 3LKQA 1TJIH 2FEEL 1Q0YL 4HUUB 3S4SG 3MOQA 4LARH 4E41B 1AP2A 5HPMA 4J3WA 2EYSA 1UXSB 4ISVB 2ZJSH 1WISA 2GY5A 1J11A 2EDJA 3ORJA 3WIIH 1G9NH 2V5RA 4PP2A 1IGJA 4D0BA 4HBCH 1GL4B 3BIKA 5DT1H 4BM7A 4DCQB 5AEAA 3SJVD 4O2FB 5J6GA 4XI5D 5GGVY 4C56D 5C0AA 2W65B 2JIXD 1G7MA 1AXTL 1JI2A 5GGRY 4P2RE 3O6LL 4OZFG 2VWEE 3U30B 5B4MC 2XPGA 1B4RA 4JN1L 5EBMA 1ED3B 2DQTL 1RUML 2F19H 3IJHB 2CD0A 1T1XA 3V8CA 2ZSVB 1TENA 1T7VA 2DMCA 2IPKA 1PYWB 3C60D 4NO0B 1LO4L 3KVQA 2R9HD 2W07A 3TT1H 1S7RA 2GCYB 1B2WL 4Y4KC 5MERA 3QULA 5DK2A 4EBQL 2NY7L 4HX1A 5I0ZA 1L9MA 1FFRA 2AJYH 5C09A 4Z95L 5KVFH 4P2QE 4DKDC 3SDYH 4OF5A 1ORQA 5CSGA 4DN3H 3K46A 1F6AA 5D2NE 4LMQE 4NQCD 5F7KC 3X3GL 2R4SH 3DRTB 4R0LA 2R69H 4KRPB 5EN2A 1IQWL 3MBXH 4ZDHA 5SWQA 5DRXA 1H15A 1K6QL 1NMBH 2UYLB 4UT7L 1P6FA 2CIKB 4BELD 2IH1B 1EEZB 4O58L 5EIVA 2PXYA 5EZJA 5GZOD 4HIXL 1I1FA 5C6TH 4CU6A 3IDGB 3DX8B 2JJWA 3WFDH 5I16B 3HNSL 3L3DA 2AAVA 1TCMA 1ZLWH 4TOYH 1FGNL 3HMXH 4PRIA 4OM1H 4K2UH 5F7FA 3VXMA 1CXEA 3MLTA 1VEPA 4NQXB 1ZLVK 5ANMA 3TJEL 1A9EB 4YFLI 1ES0B 5CEXA 2RFXB 1A8JH 3P0GB 1FO0L 1JZ5A 3STLA 2B4CC 3EYVB 3IRPX 3D2UD 5EA0L 5AWNL 2DQTH 5T3XE 4PPTA 1DEEB 2YSSA 3AU1B 1MJ7L 3HI1A 3ZKQD 4HJGB 4KK6C 1QBLH 4P48A 4YX2L 3MXVH 1B2WH 1I8IA 2VLKD 4OT1L 2VLJA 3VXNB 2VJXA 2NY0B 4RGNE 1BJ1J 4FTVA 4G8IB 5GGQH 1T1YA 1S9KC 1CDIA 3D69B 3RVVC 3VMNA 5ACZB 1YPZA 5C0DA 3NTCH 1M05A 1KPRA 2WIMA 4HIHA 3B2UD 4M02A 5CSBA 3KYNA 2E7MA 4HGKC 4U6YB 3BKJL 3O3DB 4PRDA 3TYFA 4XNUH 3EIFA 4UV4L 3C2SA 4X98B 1V3JA 3MLVL 2XWTA 4LHJB 4S2SA 3GEWB 3A6OA 5EO1A 4O58H 5DJ0B 4FQ1L 3MZTA 2NY5H 5EBGA 1VGKB 4F9LC 3EOBB 5C0AD 2XI9A 3Q1SH 5D1ZC 2BY1A 4D9LH 1FGNH 4M00A 5B38B 1ZT1B 1TXKA 4NQVA 1MFCH 1LVEA 4P46A 1F3DJ 1QKZH 1MAML 3NABL 5LGJB 1RUAL 4GKZA 5C0FA 4PJ7E 3I2CH 5C0ND 4WU7B 3RNKA 1AY1H 1NCTA 4M43L 1S7SB 1LD9B 4JO1H 5K9KA 5EOQH 4G9DB 5A2KH 4CN6A 2AJUH 4ELKB 4ZFOB 3LS4L 5J9PB 1T20A 4I0CC 3WS3A 5BS0D 3BZ4A 2ICES 2AXGB 3JXAA 3QA3A 1JJUA 2YA2A 4OIIL 2BVEA 5DFVD 1Z9LA 4M7LT 1Q9KA 2DIBA 1A6TB 1CK0L 1NEZA 1NGQH 2VZ3A 2BOCA 4HDIB 1R3HB 1UKTA 1XF3B 4NFBA 1EO5A 4M8QA 5B39G 3VXSE 3MGTB 3FAXA 3SDAC 4RCAA 1P7KA 3RUGB 2Z8VC 4YLQT 2DLFL 3FT4B 4DKAA 2IMNA 4GAYB 5HDLA 2PXYD 5CWSB 4G9FE 4KJYA 5TQ2H 4L3EB 2D7PA 4I0PA 3T8XB 4BSVB 5D6CB 1JFQH 3DUSA 3FOLA 3L5IA 3PABB 4HFUL 4PRID 3VXMD 3OAYH 4GQ9L 3O3AA 3SDXB 1CGSL 3G9AB 1CDUA 3VFTA 4KMTH 3QCUH 4ZPVB 4FQHB 1ZA3A 4TNWF 5CHNB 1ZEAL 4XPGH 3EYQC 2IQAA 3QWOA 1NCCL 3B2VL 1KELL 3VFVA 3K4DA 3R8BB 4A6YA 4HULB 4Z7WB 1LO2H 1PKQA 1FPTL 3JVGA 3BO8A 5CBEA 4M43H 4OLZL 3GJFB 5C0BE 5DDHB 3SGEH 4ZFFA 3QP3A 2DQCH 2ZUXA 3MUJA 4ODSH 1BPVA 1PJ9A 4K55A 4OQTH 4EDWH 3RY4A 2VLJD 4Y89A 4L4TB 4MDIA 4FTVD 1KBGL 3FQXB 4YPGB 2J7LA 2NY1C 1TJGH 4M1CC 1FYHB 1NLDL 3PP3H 3CLEH 4HGWA 1V7MH 3V6FB 3RVTD 1SYSB 3RY6A 2Q76B 1CXKA 4YHOH 7FABL 4B5EA 2G9HB 1IGFH 4K3EL 1DVFD 3PL6A 1NMCC 1JHKH 2AEWA 3I6GB 1M7XA 2Z91A 2QV2A 2HJFB 1XGRA 3WLWD 3F6IA 5CP3A 1U3HA 3THML 5GS2D 3OKOA 2DLFH 1B0GA 1TETH 5AYUL 4FXGA 4NDMB 5D5MA 2VLRE 1E28A 2NR6D 2GUOA 4OCWL 5I66A 1T5WA 1JWUA 1VEMA 4KKNA 4JJHA 5GISH 5J56B 4EQ3A 5DHVB 4JDVB 4FQQB 4HFUH 4PJ9A 4RFNB 1I9JL 2FX7L 5F8QC 3WUWB 4POYA 5ENWA 2OJZL 4IOSD 5DC0A 5GIRB 3N1MC 4KGJA 4FP8H 3MGOA 1JGDA 2OP4L 3MLZH 5HJ3A 1HSAB 1FNGA 1REIA 4HK0B 3L5XL 4N1EA 2F9BT 2WQRA 4LQ1A 1ADQL 1TLKA 2LVEA 2YEZA 5D8JH 4QGYA 4ETYA 1PY9A 5HDQL 4KMQA 3CXHJ 3MX0A 4X0KB 4AEHL 5DRZB 4C83A 3GGWA 4P2QB 4PJCF 1VKXB 1EVTC 4ODHL 5D2NB 1XF4A 5IQ9A 2QQNH 3OKEA 3KPOB 4PG9B 3MRCA 3CMOL 1EXUB 1UEMA 3P4MB 4XRCB 1E4XH 4OUUA 5F72S 1NGPH 4OZFA 5EB9A 3I85A 4KXZI 2X4PB 4F7CA 1U91A 1RJYA 4HS6B 3PHQB 4K3EH 4Y2OA 3KJ6L 2FJGB 1QHPA 5I1AB 3HHRB 1IGML 2C7UA 4NCC2 3FFCA 4NQED 5GJSH 4HK3J 5HHXL 3I3DA 4CMHB 1LDPL 2UZIL 4WO4B 1W2KT 1EHXA 1MFDH 4JPKH 5E8DL 5AYUH 3CD4A 5I1KL 4X83A 4HWBH 4PJFF 5GGUA 1VFAA 1DFBL 1EJ6A 4P9MH 5F71A 5GRVL 4NWUL 4JZOB 5D7IE 4Y2DB 1CGTA 4MNGB 3MNVB 2DKSA 4L3CB 43CAB 5CZKA 1I9JH 2FEEI 3ZKMD 2QEJA 4PGBA 3CFEB 5I1GL 5E95B 3BHBA 4X6BA 4NN5C 3SGKA 5TDOB 2FB4L 3AMKA 5F9DC 5HDBE 3ZE0E 3BKCH 3BP5A 3V7AG 5AAMA 4KI5D 4FQIH 2ZPKH 4RGNB 1ADQH 5DMGD 3MUGA 1BLNA 3NZHL 4HCRA 1AXSA 1DN0B 2XYCA 5HDQH 5GS1B 4MA8L 4Y0GA 4C57C 3TH4T 3OKLB 3CFDB 3KYOB 5J3HC 3UPRA 3IVKB 3MRPA 3UYPA 1KLGB 3GI9H 5H35B 4CL7A 4OM0L 2YPLB 1R5WA 3PL6D 3DV6A 3BP6A 4WU5B 1V8HA 1I8KB 3WFBL 3PDOA 3Q5YA 2VDPH 5FYLE 1SJHA 1HINL 1P7HL 4UINL 1CE6A 1UM4L 1DBBL 3NCBB 3KWWB 1U3HD 3O4OB 1OTSC 5E00A 1LE5B 1N5YH 3SOBL 1I9RL 1G6RB 5FGCB 1FNLA 4YH6A 4X7FC 2FATH 1HOCA 3MC0A 3LEVL 5HI4C 4GAJL 3ILPB 1I3GL 5J11B 3IU3B 1Z3GH 5FO7A 2ZSWA 4ALAL 2WP3O 5KW9L 4YHIA 4OGYH 5ESQB 1UWEH 4NRYB 4M93C 1LO5B 4PJ9D 2R0WL 1P1ZB 4GG8A 3UBXA 1K4CB 1GZPA 4PJ7B 5IGXL 4QRPE 5EPMB 4AH2A 1I1YB 2HLFD 5DMKB 1JNLH 5E94A 1QEWB 3CLFH 1B0RB 3H9YA 5CJ5A 2G2RA 3WO3B 4I3RH 5A2LH 1MWAA 4U6HB 3BKML 1G7IB 2KZ1B 5EIIB 5GRYA 5KSVB 3VFUB 5GS0H 5HYSG 1MCQA 1WWCA 5ICZB 1B88A 1NGXA 4Y88A 3NCMA 3QQNA 3EZJB 5DQJA 3VXSB 2IPUG 2W9DH 3QDGB 1MOEA 3ARDA 1OP3H 1MLBA 1RVFH 3QAZB 4I3SL 5CBAB 6FABH 1OM3H 1MAJA 2OR9H 3RA7H 2WM0A 2VZOA 1J7VR 3FFCD 5L6YL 1OAQL 4AIZA 4JM2B 4LCIL 3IFPA 2J8UE 2XG5A 2YBRB 1UXWA 4QHMB 3HNVH 1NBZB 3FB7A 2X4OB 3SOBH 4UV7L 4XP5H 2BOBB 2AQ1A 3D39A 4HGMA 5HDOA 4KJPC 1TCRB 3DNKA 3VFRB 3T77B 3ZHDA 3V6OC 4JY5L 4W4OC 2VL4A 1CGVA 4KTDL 5FK9B 5LVEA 3D0VA 5DSCB 3C6LA 4OLEA 1JPTH 3QCVH 3TBWA 2W38A 1I7TA 3QPQD 4JANA 5IW6A 4IS6A 4KHTH 1T83A 5B39A 5JHDD 2F54A 5C0BB 4MJ5B 4U05A 1MCCA 3CU1A 4XTRD 3BYTA 4FNLH 4HPYL 4LVNC 4M3KB 1U8KA 1CD8A 3UAJD 1ZT4A 2WBJB 1N59B 2ICEB 1PQZA 5CINL 4HLJA 4HUWB 2UUDH 1UCTA 1IEBB 4KKBC 4P5TB 3PQYB 3N1GC 1AD9A 4UIKH 3UZVB 5F89A 2OTUB 2RQ8A 5I1CL 4KGLA 5E8EA 5C0IB 1IC4L 2BSRA 1LP9E 1MHPH 4N0UA 4PBXA 3X14B 3ARUA 5IMKA 3MRJA 2BCKA 1G7HB 1U3ZA 2JB5H 4K8RL 1JGLL 2HKFH 3QPXH 3MREA 1BBDH 4PLJD 1AD0A 4Z5RB 2E9WA 4GG6A 2DQUL 3QI9C 2VLRB 5F9AC 4MD0B 2HMID 2AJVL 4Z0BH 3FB5B 1OAQH 4OLUH 1CGXA 2IFFL 2EH8L 1FN4A 4ORZC 1U8QA 5A43C 2VXSL 3TA3B 4ODVL 3HZKA 4UV7H 4MJIE 2NZ9D 2QQKL 4K9EH 3WHXB 5L8JB 4I9WE 2VDOH 2I27N 3F5WA 3G5YA 4OAWA 4Q6IC 3C09C 5FV1L 4PJ5B 4S1RL 4YDKH 3SY0A 1PY4A 4OF7A 5I1IH 1TITA 2LU3A 3FB6A 3GIVA 3HZYB 1MLCA 1N8ZB 3LQMA 4JFEA 4Y4HA 2Z8RA 5I2IB 1AGFA 1MCOL 1GAFH 2YN3A 4E5XA 4Y5XA 3IYLW 5J12B 1BVLB 4LHQB 4RGOL 4MD5B 5FUZH 4KHXL 4ELME 2QQLH 5DC9B 2J8OA 2A1WL 2VDQL 3ARDD 2CO7B 2WIIB 3GSNA 4HC1H 1UC6A 2C3VA 3GNMH 1IAOB 4NOBA 4O4YL 3OXSB 2P1YA 1T04A 2OI9C 3DHJA 3HA0A 4C54A 1KB5L 2RCSL 4U6XA 3QUKB 4JPIB 1HDMA 1JZ7A 1BX2B 1HHJB 4I3GA 1RUPH 2R56L 1YQ2A 2FX8H 3D39D 3ROLA 5C8JA 2A6IB 5B8CA 1MIMH 1QR4A 3ES6A 5D7IB 4EZMA 3UTPD 2E3VA 2IFFH 4Z8FL 1U8HB 4TVPL 4WV1A 5I1EH 5FM5O 5KJRL 3ZDXF 4ODVH 2Y5EA 1OPGH 2ZUYA 1LK2A 1FL6B 2MKWA 3C6LD 4XB8A 3V95A 3P11L 1CFTA 5CZXC 1JP5A 1NQBA 3UTQB 5L2JA 1KEGL 4P59L 1CBVL 2N7BA 4IRJA 2O5XH 3C6SA 4Y4FB 2Z35B 5SX4H 1E4WL 3OHXA 5BJTA 4QF1A 1X7QB 2VITA 3SJVE 2R1XB 4QXWA 4FZ8H 1LEGA 4PJDA 4D0DB 1H3XA 2FIKA 2FZ3A 1U58A 3DYOA 5AD0A 5FO8B 1YEJH 4K23H 1ZHNB 1HHIB 1A1MB 2ERJC 1CL7L 1KEMH 2Z31C 1LEKA 1RZ7L 2KZWA 2DD8L 2VDQH 3BEVB 1OB1B 2WWMC 1YNLL 3DURA 1DBAL 3IXTB 1F6LL 3IT8D 2GFBB 5C0EB 4ZNEE 4JB9H 3OG4B 1KB5H 3E6HA 4XWGH 5HSFA 3ABZA 5JXAH 5HVFB 2JKXA 4WCYL 3OXRB 1ZANH 1S7VB 1WICA 3TBYB 5D71L 2EXYC 3QG7L 4Q2ZA 3E2HB 1UG9A 3FN3A 5D9SB 5ITBL 1F5WA 4NQCE 4WI8A 4CNIB 4P2OA 5JLZB 3GK8H 4EI6B 1TZHB 4G3YL 1IFHH 1T21B 4L8SC 3RHWK 4TVPH 1HXMA 5JORB 5EULV 5GRJL 3VXQB 5IB3B 3VI3F 2P8MB 4GW5B 1KIPA 2X7LB 5JDSA 3P11H 3IS0X 1UCBH 5KN5B 1CBVH 1S7XB 5IBTH 5GSVA 4Z76A 4M7JH 3U82B 2W1NA 4PJGB 1YUHB 4I8DA 1HXYA 5DGRA 5J13C 4JFED 3G6AA 4Y4HD 5FCSH 3N50A 1QFUL 4OLVH 3VD9A 1ZT7A 4X99B 1QLEL 1MY7A 3ZHKA 5E8OB 1B9ZA 1DZBA 1H5BC 2BNQD 3KS0J 4EXPX 2IF7A 4L8CB 2XWBB 1IC5H 4NP4L 4KUCF 2DQHL 4XBGB 3P9LA 4DGVH 2IAMB 1PVHA 2VSCA 4NUJA 3DVNA 5CD3A 4PYHA 3WFEH 3MRQA 5I8CB 4ZOEA 4PJIA 2ZG2A 3INUL 4NZDA 5C9KA 5D96C 2JJUA 3DIFA 5ERWA 1T1WA 3MJ6A 4KKCD 1QBML 4XHQA 1A02N 2VLKE 5DHXB 3GJFH 1MPAH 2JK5B 2VQUA 5EFIA 2WUBH 4PTUB 3I3BA 4Y19E 3ULVF 2XKUA 4MSWA 5HYSA 1JGUL 1RK0A 4NN6C 5D71H 3FONB 4OZGF 5EUOF 1ZS8A 5I76B 4P9HL 3VFMA 1S7TB 5B21A 5K9OA 1DQJB 1ZKAA 1TZIB 1HZHH 3CSPA 3NFPA 1ZOXA 4IRJD 4ETQB 1NCBL 1RZIB 1W72B 2CMRL 1S5IL 2ADJB 5CILL 3SO3B 5J89A 3LQAL 1PX3A 4HLZG 2Y23A 4MAYC 3RDTC 5IG7B 4JLRA 2D7TH 5B3JF 5BZWB 1HQRA 3F7YB 2YD7A 3QWRA 1FRGL 1NGYB 3WEXA 1QFUH 1AGCB 3LQZB 3HZVB 1FG9C 2AV7B 1CTOA 2XKNB 3O2VL 4U7SA 4HK3N 3RWHB 2IADB 5DGQA 5H94B 1LP9B 4HZAA 4KK5C 4U1KA 5FM4A 1NCDH 2HWZH 4I2XA 5AG8A 3MRMB 4QKXB 1NUFA 3UC0H 3ZSSA 1EAPB 3HCVA 3ZE1E 5EU4A 4GRLC 4NC1E 3QHFH 4NKQB 2AP2A 2XQYG 2Q7YB 4LVOC 3DSNA 3CSYB 5CSZA 5K59E 3V4PH 5BS0E 1CICB 2J12B 3BESR 4H1LB 3GMPA 4MJIB 5DZLA