1FPTH

Three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
220
structure length
220
Chain Sequence
b'QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIQWIKQRPGQGLEWIGVINPGSGGTDYNANFKGKATLTADKSSSIVYMQLSSLTSDDSAVYFCARDFYDYDVGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT OF AN NEUTRALIZING ANTIBODY FOR TYPE 1 POLIOVIR
publication title Structure of the complex between the Fab fragment of a neutralizing antibody for type 1 poliovirus and its viral epitope.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Complex (antibody/pv-1 fragment)
total genus 36
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1995-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fptH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fptH02
4R2GB 1RZJL 4F37F 5I71C 3MBED 3F12B 3G6AA 4L1DA 4ODHH 4L29B 4HD9A 5IB5B 2IPKB 1HKLL 1F11B 3QT2A 5B22A 2IG2L 3DGGB 4Z7VB 1NKOA 2MCPL 4BUHA 3WHE0 1TIUA 4LSRH 1VFUA 1PSKL 1U3HB 3OKOA 5FYKU 3TPUB 3MLYH 1ZLUH 4L1HA 3L3GA 4J3TA 4QYOA 4WDIA 5SX4I 3MJ9A 4D9RE 4DVBB 2FO1A 4KJWC 2PW2A 3FQUA 1ZGLB 2ZCLL 5DC4B 4U6XA 2HT4D 5KVEH 1UB6B 2VLME 3G6DH 3K2MC 2VLJE 3IDMB 4YHOL 5FIEA 2AS5M 1HDMB 5A1AA 1A9BA 5I9QB 3U1SL 1KJ2B 3DMMD 3K8LA 4BQ8A 3QR2A 1DVFC 5DFVD 5HHQA 5INDB 3RNKB 1KCUH 4ZUSA 3QISA 5EO0B 5SWZD 4Q9BA 5F7HA 1HEZA 5DMYA 1EAPA 3LKRA 1WTLA 2BK8A 5KTEH 5HDQH 2XYCA 4PLKD 2Z0BA 5JOFB 2VAJA 4FZ8H 4L4TD 4OFVA 4WO4A 2Q8BH 1HXYB 1H3GA 4ZS6D 3O11A 1DLHA 1FFNB 2BRRL 4PJ8C 1I1YA 3NN8B 5I1KL 5E94B 1J8HD 4PJFB 1RJYB 5E4EC 2Y6SC 3SDYH 4Z7UB 1BGXH 3PQYE 1ROWA 1UCBH 4K3DL 1Q9WB 5IVNA 3KXFA 3T2PA 5CJ5A 3ARRA 3BVNB 2D31A 1HI6B 4ZQKB 5A3IC 3PXJA 1U42A 3LB6D 2BZDA 5D96B 4ZPVB 5T1KA 4P2RD 1QKZL 3FMGH 5F7NC 4Z7QF 4OLUL 3SJVD 3LMJL 2D2OA 1T4KA 1I1CA 1KXQE 3SQBA 2P8PB 4PJ8B 5HYIA 5ISZB 3PDDA 1FYTA 4JVUA 3V6ZA 4UV7H 4RMSA 4RX4D 4UNUA 3LN9A 1NCBL 1LO0H 2ESVB 3IDNA 5DJXB 3WUWA 1B4JH 5IBLD 4Y16D 1I3GH 5SWSA 3NZ8A 4YX2L 4Z76B 4YDJB 2ADFL 4PTTA 3PV6A 1R5WB 3ARFC 4K71C 4J8RA 5FGCE 1T7ZA 2AV7A 4TUJB 3FT4B 5CCKL 3RVXD 1JUFA 2VXTH 5CEYB 3FT3A 3X3FH 1Q0YL 1G7MA 3QB7C 4I77L 1KCRH 4NGHL 3EFDL 2NY6C 3AUVA 3H9YA 3NCEB 4WGVB 2YOCA 4U1MA 1Y0LA 1BBDH 3HI1B 3RL1A 2IQAA 2A6IA 2WP3T 1PKQA 2ZSVA 4PV9B 3VWJA 3MGTB 1OM3L 1ZLVH 1S9WB 5FO7B 4AEIL 4YO0B 5JW3L 3PWPD 1J88A 1OW0C 1V3LA 5B39G 1OVZA 35C8H 2B8OT 2R2EB 3UX9B 2EH8L 3SCMA 5L2KD 2VZSA 2ZNWA 1R5VA 2F54B 1U8PB 3LY6A 2YPKB 1Q1JH 4PRHA 5HYJE 1ZLUK 1D5BA 5GRUH 2F8VA 1IM3A 1J8HA 3UYRH 2VQ1A 3RHWF 4PJBF 3IJYA 4QO1A 4WRLA 4R7DA 3KLDA 3VFMB 3CVIH 1S9YA 4WJ5B 5JXEC 4PJCA 2NY0C 1QYGH 5CILH 1FG2A 4YPGB 4PGBA 3WFCH 3BFOA 5DRWA 3BPCB 3I75A 4JZJA 3JWOL 4PJHA 3GB7B 1AGFB 5FUOL 4LAQH 2ZSWB 4F7MA 1GZPA 4X5WB 1MHHA 1A6TA 1KEML 4C83B 1JP5A 32C2B 3B6SA 4X83A 1LQSR 3DSNA 1QFWL 4FOMA 3VH8A 1NBZB 4PRBA 3EJYC 2GTZA 4RX4A 2DQIL 4LLUA 1T20A 4RRPA 3O3EA 3U0PA 5E7FA 1RHHB 4QRPA 1CFBA 1OSPL 4QOKD 2NY0B 1U8IB 4Q2ZB 5C9JB 5E6YA 5TPWL 1F58L 5L2KE 3EYUL 4BFBD 5CMAA 2HG5A 4JFXB 1X5JA 15C8L 3BZDA 1JPFA 1NDGB 1OAKL 3UCRA 5FYLD 4E0RA 1HWHB 2Q7YB 2DQCH 5DDHB 4EVNA 1GOFA 4LOUD 3KYMB 5DJCA 3ROOB 4MJ5B 4Y4HA 3D69A 5E9DB 3QDJA 4NFCA 4LSTH 2IWGA 4UDUA 4GH7B 5E03A 5E1HB 4DZBA 3WYRA 1IM9D 1OAZH 4D8PB 2KKQA 4G7VH 1MIEL 4YXLL 1CLZH 2GCYB 4YHML 3HC4L 1R24A 5TDNB 5JORA 1CTOA 3RL2A 5I18H 3EZ8A 4YC2B 2V2XA 2X9XA 4G7YL 4TSAL 4UV4L 3WJJA 3PWPA 5IHZB 1KB9K 1ETZB 1J1XL 2NW3A 4P5MB 3SKOA 3I50L 2VN4A 1A1MB 5FV2A 2OS7A 4IRJB 1DN0B 1H3UA 3VGAC 3QXDA 4N8VB 5T3XD 5CEXA 4LCCA 1TVBA 3UEZA 2FB4L 1L7TL 4GKSB 3VG9C 4JGMA 4E41D 5K9QI 5FYLE 1MQ8A 1JWUB 2X4UA 4NO2B 4Z5RA 2BHUA 1S7SB 2G9HA 3QFDB 1HIMH 1UH2A 1YEIL 4CVZA 1S8DA 2NCMA 5DJAA 3HB3C 3T0WA 1TENA 4KZDH 3DUUA 4JCLA 5C0AE 1GPOL 4XAWL 4DKFH 3HNTH 4LLMA 5D1QD 2D4FA 1F4HA 1SMAA 3DWTA 3H9SA 4M9OA 1S3KH 3B9VA 1P4LA 1TQBC 1AD9B 3QQ4B 4C57C 2RIKA 4OZHA 5MEND 4MCYA 4XPGL 1Z0MA 4QHLA 1BZ9A 3CC5A 5F7EL 2HTLD 5DJZB 4XCCL 2EDQA 1MPAL 3BYYA 3CXHK 5HDBE 4JKPL 3BHBA 4M7KL 4XHQA 5AG8A 3K4ZA 1MHEA 1NCCH 3BP7B 3W9EB 43C9B 4IMKA 4AIXA 3I6GA 2Z4QB 1FO0L 3CDCA 43CAB 2IH1B 2BVYA 3QI9A 5E8DH 5T3XE 3IJHB 3LCYA 4PJEB 5CGYC 3JWDL 2O5ZH 1BQHB 5EU7C 5IK3B 1QSED 4E41E 4ELKB 2IF7A 1U8OA 2JB5H 5EWIL 1VFOA 4KROD 4D0CB 5TFSL 1YN6B 4FQ1L 1MEXL 4HHAB 4U1GB 3RX8A 1CN4A 3D2UD 4P2CG 1OF2B 2OTUB 4FQXA 4KRLB 4DUWA 2BC4B 4YHKL 4NQSB 4P4KB 1G9NC 2WP3O 4PBVC 3NACH 4XP6H 4F80A 3QCUL 4MB3A 4PJ7F 1OAQL 4XBPB 4JG1H 1FZJA 4PJGE 4DAGL 5L6YH 4PPTA 5CZXC 3ARWA 4AH2B 4XT1C 2NLJA 2I9LA 2NY1C 3MACL 4MNGE 1EGJA 4NKMB 2CJUH 5FGRA 1B88A 5ANMB 4KC3B 4C58B 3BPNB 2R2HA 4GAGL 1QRKA 3IDIB 4APQC 5D70H 4ODUA 4PJ9C 4JE4B 4TUOA 3EJJX 4F9PC 3HG1D 3CFEA 4V1DB 4L3AA 5KS9F 1WBZA 1QSEE 2BOBA 4PR5A 1LE5B 1OTSC 4JRXA 5DA0B 3Q2CA 2BDNH 3GMRA 5EPMB 3FO1B 1SJEB 1Z6JT 1JE6A 3CPLA 1ADQL 4UOW0 1K4DB 3KPTA 1ZGLM 1NEZA 2WV3A 4ZS7L 2GW5A 1XF4B 3EDEA 5FGSA 1WCBB 2PCPA 5D7LA 5F1SA 3QXUA 4Y5XC 5BJTB 5DVKA 5DVNA 1KCSH 3GRWL 4PJ9B 3L3IB 4HXAL 3VXSA 2EIBA 1JYNA 4ZFOL 5BV7H 1PQZA 3P0YH 1MFDH 3D85A 2ICWI 4OZGE 4X6FA 2I07B 3C60A 4Z0BH 3RWCA 3SKMB 1E6OH 1VKXA 1YJDH 2RHEA 5KSAB 3X17A 3S5LB 1UYWL 3T8XB 3ULUC 1U8QA 1I8IA 4MX7B 2R0WL 4NQTA 3T0EC 1CK0L 2XZQL 3MJ9L 5F21B 2HVJB 4Y5XB 3WKML 4JPWL 4L5FL 3G5ZB 1TNMA 4N1HB 1TETH 3U79A 3Q6GH 4DGIL 3FO2A 1U6AL 2BVOB 1AKJB 1RIHH 5FUZH 3EOTL 3QEUB 4G6KH 1DLFL 5F70A 3WE6B 4G43B 4I3GA 1I7UB 4WENB 1ACYH 1A6WL 5JHDB 5L9DH 1IQWH 3QHZH 4PJBB 2PYED 5C09B 1HQ4B 3T0EB 5FB8A 1BFVL 4D0BB 1J0IA 2AJ3B 3TLRA 1H9VA 2DMBA 4RAUB 2YA1A 3O9WB 5HSFA 1NBYA 1BFTA 3WXWL 4NJ9H 1UJ3B 1XF1A 4OCSH 1OB1B 4PRIB 3G5VB 1JTOA 4DZ8A 1INDH 3QG6B 2UY7A 4LHUG 5F7MC 1A47A 3ULVE 2NMSA 1OTUC 4M00A 3IFLH 4U49A 4PY7B 2IANB 1JGLH 1BJ1H 2XZCL 5L8JB 4NJAL 1RJLA 2OLDA 1KFAL 1A64A 4JO1L 4P2QD 1CBVH 5ID1B 4D2NA 4YK4B 1UM5L 4NQVB 5HGBB 1WAAA 4WHDA 3GIZH 2W9DL 4X4YA 4OUUA 1N6VA 3BXNB 3PWJB 2NZIA 2DYPB 1TLKA 3TA3B 3H0TB 5HGHB 1EXUB 4QRRB 1KTDB 1Q72L 3IXAA 5D72L 5LGHL 1I9JH 5LGKA 3KWWB 3EZJB 4FXKA 1IC5L 4PIRF 3HC3L 2VSDA 2HRPL 4MAUH 1YY8B 5AAWA 3MO1A 4JPVH 4CBPA 4NUGL 1RZ7L 3EFFA 4I5BB 3WIIH 3QUMH 3OKNB 3O3UN 2OI9C 2B1AL 3FQWA 4F7EB 5LXGL 3GSXA 4RMTA 3VI3F 5JIPA 5ITFA 3H42H 4HS6B 3HZVB 2GI7A 3QDGB 3ZKSD 1U36A 4KVCH 4Y1AA 4JQXA 3MLZH 4JY5H 3G5XA 1CZ8H 1QSFB 3SKUD 2ICWB 3VD9A 4PRAA 1R5IB 1ZA3A 1DQJB 3QJHA 4O00A 4JRWA 1LE9A 1PZUB 5C07E 4P2QE 1T66C 4JFOA 2DLHA 1G0DA 1R6VA 3TNNB 3FRUA 5IESL 4H1LB 3ROLB 3TBSA 3QEQD 3ARYA 4PJDE 2J5LC 3JTSA 4LCWD 3GMQA 1CF8L 2MKLC 1PD6A 1T22B 3GI9L 3TPKA 2QLVB 1XCQA 3MZGB 5GRXG 2BOCB 1EH9A 1GGBH 1X6LA 4KQ3H 1X7QA 2A83A 3LSOA 4JREC 4P5TD 2JJTC 1QO3A 1LDSA 5D1ZD 4Z78B 2VYRE 1N2RA 4MJ6B 3PV7A 1OARL 1QBBA 3T4YA 1KN4H 1KNOA 4KQ4H 3GBNL 2GIYA 4AJ0A 1C5BL 4ZOBA 5T3ZD 5GGVH 3QWOA 4C55A 3LEXB 4UBDC 5E4IA 1G0XA 2D7QA 4OQ1A 2F9BT 3HUJF 4NM8H 3CNKA 3IDGB 5J4MA 4Y2DA 3F8UB 5I75B 3ZKXC 1F4WH 3RIAK 3MCG1 1LP9E 1T3FA 4OCYH 2V17H 5DI8A 3UMTA 1LK3H 2VDOH 1XZ0A 4Z6AT 5LKNA 4PLNC 2EE6A 2HLFD 1OT2A 4KV5F 4JFPA 2ERJB 2Z8VC 3KPQB 4FN0A 3WCYA 2UUDH 3VFRA 4HX1A 1MFBH 2R1WB 4LDEB 5I1CL 4OIAA 3UZQA 3VE0B 2YS4A 4Y19A 3ZZ1A 4N5ED 2FEEL 3KPMA 5E08L 4ACPA 4X98B 3S34L 4G6MH 3VW3H 4PJ7B 5T3ZE 1U58A 4XRCA 3OKKA 3REVA 4ZAKD 5C0DB 1N4XL 4JAMB 1SEQL 1RK1B 2NXYC 2XN9A 3EYQC 4IRSD 4UT9L 4XCFL 4YR6A 3P0GB 4XHJC 3FN0H 3U0TA 5IMKB 4Z8FH 4PJXA 3VXOA 5KVMC 3HFML 3DO7A 1XGQA 4HWBL 4X4XB 5F3HB 1EMTH 4ZXBA 3CFJA 2BNQB 5DJ2B 2HKFL 4KGLA 5I76A 5IIEB 5IW6A 2HFFA 2X40A 4AL8L 5BXFB 4ODWA 1NAMA 4YGVB 3QIBA 2EYSA 3UTTA 3C8KB 3DYPA 4GKZB 1OAXL 4G9FA 3RTQC 4GAYB 1R3KB 1I1FA 3CMOL 1BFOB 2KL6A 4P9HL 4NRYB 1IARB 5KS9B 2OTWA 1RUQH 2XACC 1GSMA 8CGTA 4HK0B 1RJZB 1CLYL 3ZT7A 3B43A 5KBNC 4A6YL 3BKJH 3QWRD 2EXYD 2JIXD 5T1MB 1U2CA 3BISA 5I1AB 3FQTA 4R4BB 2YUWA 1N3NB 3KPSA 3KYNB 1A3LL 3LKPB 5TQ0L 5C0IA 4LNRA 2D0GA 2FL5A 3GMLA 1NLBH 4LHUD 1RIUL 1YMMD 2F8OA 3TWCL 4F3FA 4WU7A 1LK2A 1MJUH 1GXEA 5I1LB 4GO6B 1T1WA 1G9EA 2OR8A 3VFTA 3IU3B 1VEPA 1K3IA 1FP5A 4P2OD 2ICEB 5EZIL 5DRXB 3QIUA 3MCKB 3LRSA 2WQ8A 2WIIA 1GYAA 1RHFA 4DTGL 2BCKB 4K7PH 1OT1A 4CVUA 4HUVB 4YHLL 5C9KA 3T04D 4C56B 3WLWD 4LLQA 2CQVA 2Q86A 2FATL 5F7LB 4MJID 4XCNA 2APTA 1EFXA 3BZEA 3H7BB 1I3VA 1QRND 4O02L 4KRNA 5GGTH 2XQBH 3O6FD 3WS3A 4Y5VA 1J1OL 4KKNA 4R4ND 1A7RL 4HLJA 3BEWA 1WFNA 1RMFH 1AGCA 4ODXA 2Y06H 1E4XI 4FTVD 3V9FA 1LO5B 2VIRA 3MA7B 3U9UB 3WUZA 4AM0B 3ZTJH 5MERA 4IOFC 4JANB 5FYLL 2XTJC 1FGVH 5FO8B 3DV6A 3ZDZF 5DD3H 1T5XA 4OFPA 3VXRD 5E8EA 2FJFB 1YC8A 4ZNCD 4L3EA 5DRNA 5C86A 3IDJB 2AJYH 4MSWB 5A16A 3T1FA 2ZJSH 1NCAL 4BH7B 2VABA 1NC4D 4H88H 3IXTB 3RWEA 3RPIB 1MCCA 1X5GA 3ARQA 1XF2B 1G7HA 5CJOH 1D9KB 4BUGA 2UUDK 1N0XH 1C5CL 5IB4B 4JDTH 5DD0H 4QGYA 2XWJB 3OL2A 4DQOH 5C3LD 1M6OA 4OLWH 4WNQB 1FORH 2H8PB 4Q9CA 2YMXH 2OQJA 4YBLC 4OBRA 5I8KL 2VLRB 1QRNE 2WMPA 1I8KA 4QEGA 5J6HB 3C09B 4LRNH 3EBAA 1P5VA 3A6BL 4N0UE 2X70B 3O2WH 4QCIA 4OI8A 5T3XL 4RA3A 4ZUTA 5I74B 1T7XA 4FTVE 4WI2A 2BNUA 3TT1L 1FG9C 1NSNL 1X44A 1VA9A 4NQDB 2BP3A 4HGMA 2F74B 3ZYZA 5I8OH 3QG7H 2WZPD 3V7AG 1EK3A 3VXRE 1AHWC 4X7SL 1UM6H 1KPVB 2AABL 2GFBA 2ID5A 1CFQB 4HUXA 1WICA 1JF1B 1HKFA 5B4MC 2I9TA 1WZLA 2WLZA 3NAAL 2C1PB 4HUWA 4BSWA 3X13A 3VXUB 3MRQA 4TUKH 2CLVB 3LS4L 4XP4H 1KXVC 2YPLE 4M48H 1IFHL 3MRGA 1T04A 3ALPA 4FMKA 4QHNA 1S5IL 4KKLC 1L9MA 2YWZA 4MJIA 4HIXL 3ARGD 1ZEAH 1WISA 3DOSA 4PJ5B 4U6HA 1A02N 5KJRH 3VXMB 5T5FH 4P23D 1RU9L 5IWLA 4Q6YA 4G80B 1G9NH 3HR6A 5I73C 3BGFC 4M6OL 4M1CC 3GMMA 5F9WB 4AEHH 4K2UL 4ALAL 3REWB 3B9KA 1CGSL 3SE3A 3IRPX 2MHAB 1JGUL 2RAMA 1IT9L 5F1OB 3EDFA 3W81A 3IVKB 3QNXB 4JFEA 2K7QA 2H2SC 4MLIA 4X4ZA 4N0YH 4KJQC 5I1GH 1FPTH 4X80L 3MV8A 3U4AA 2DQUL 1KIPA 3W9DB 3B5TA 4HBCL 4J6RH 5CJXC 3EYOA 4ZDHA 5JQ6L 1KJ3H 3HUJB 5GGRB 5IVOA 1A5FH 5DEFA 3SY0B 1M1SA 3TZVC 1G6RB 5I2IA 1FAKT 1U8HA 2BVTA 5A2FA 1WJ3A 1CE6A 1VGKB 3RDTD 4XVSH 3RVVD 4GLRH 4PREA 4XWOD 4W6XB 2LE9A 5JO5B 2A0LC 4F37K 3HPLB 3R8BB 1BPVA 4M3KB 1YZZA 5TQ2H 4QY8A 5J6GA 3GSOA 5J1SC 1MI5E 5BRZA 3S4SA 5TE7L 1F00I 4I4WA 4U1IA 4CMHC 2ZUWA 5CP7B 4TNWF 4L4VB 2Z93B 2CKBL 3ARDB 3TBTB 4XVTH 1I1AD 3SO3C 1S7RB 3X11B 3ULUH 2QSCH 1AC6A 2ICCA 1A14H 1MCSA 5DVMA 3K4AA 5C08E 3L3OB 1NL0H 1AQDB 4LHQB 4DGVH 3BGMA 1T03H 2APXA 4BJLA 2AEWA 4G8EB 4NNPH 3TVMA 4G5ZL 1L7IL 1RZGA 4PRPE 2AQ1A 2HWZH 1J0JA 3VD7A 5DTFA 1UA6L 2V5SA 2G5BB 1AXSA 1ZKAA 2WQRA 2Y7QA 4F7PA 2FNBA 4X9IA 4UINH 3CVHB 3SGKC 2BY2A 2FIRT 4P23A 3C5ZD 1CFNB 1I7TA 2V5MA 4KMLB 1CGWA 4WFGD 2AK4D 4CN4A 3EOBB 3FT2A 3K2UL 5C0CB 2CKNA 2Q76B 4UT7L 3U36A 2EDOA 2JCCF 3LKSA 2AJXL 4NRXA 3V0VA 5DC0A 3OJVC 4RGOL 5J1AA 4N8CL 5GS1C 4X6CF 4XXCA 5CBEA 5C8JB 4I48A 4JM2A 1OGAB 1C1EL 3QUXD 4GXUN 4OSUH 4G9DA 3SE8L 4OB5H 3BUYB 4BA8A 2X5PA 3HE6B 5ESVA 2WWMD 4MA3B 4EUPH 1CDBA 4JDZB 5CHNB 3VXNA 3DVFA 1CDYA 2P8LB 1HN1A 1KV3A 4NQEA 4O4YL 5I30L 3MLPA 4F7CA 1F8TL 3FB7B 5F6IC 3TBVA 4XMLH 3SGDI 1U0QA 3U2SB 4R4FH 1E4KA 3MBXH 5IG7B 3BRGC 3INUH 3WFEH 2FGWH 4JFQA 1F90L 3MUGB 1TPXC 3D39B 2AK4E 3K81A 4WFGE 4HF5H 4Y4KD 1ORSB 5SV4A 5IB3B 5L0QC 4UMGA 1G7IB 1EV2E 4G6JL 4JFZH 4MGXA 4KMQA 4LRIC 5DJ0B 2DICA 1N7ML 1BOYA 4JZNB 4WI9A 1BFSA 3BKYL 4Y4FC 1K8DB 1K5NB 5I15H 1KENH 3GKWL 1MCRA 4NBXB 5KOVC 3BE1L 4J1UB 4LCUB 4GKNA 4P46C 5BZWB 1Q0XH 1B0GA 2J8OA 3VFNB 1N59B 3O4LA 1K3ZA 2XOTA 4H8WL 5B38G 4I9WD 5C1MB 3UYOD 3IFNH 1IAKB 4EI6B 4J3OC 1XH3A 1QBLH 1T21A 2WBJD 7FABH 3P4NA 2VJXA 5ICZB 3UC0L 3NA9L 4ZPTB 1A6PA 5F3BA 4R26L 2DWEA 4WU5B 5T1LB 4AK1A 2XNAB 1RURL 4TSBH 3MFFB 2B20A 1NQBA 4KJYA 5A43C 5CKAA 3C6SB 1GGCH 4AZ8A 3G04A 3UPCA 4MXQD 3FQXB 5I17B 5DJ8B 3UJIH 5JA9A 2GK0A 1FNFA 1QFWI 2R8SH 3MNVB 3F5WA 1BAFL 4HWEH 1PLGH 3TFKD 2Q6WB 2V5YA 5IQ7H 3RHWK 3OGCA 3HNSL 1DEEB 4JFFB 3V7AE 2M2DA 1T7VA 1DQQB 5E2TL 1S9XB 1KN2H 3QUXA 3GSVB 3N50A 3CFCL 3BN9C 3SE4A 1HHIA 2YD1A 2WM0A 5HHXH 5T33L 4L8SA 2BERA 2CIIA 3MCLL 2FR4A 4ERSH 4Q9RL 3T0DA 4XPFL 2E7LA 4EI5C 2YEZB 4WWID 4IS6A 2Z31C 4H26B 3W0WD 3FONA 4XTRC 1RUPH 1PFCA 2BSSA 2CXKA 4K7FA 3FOLA 4EQ3A 4G8GB 4HWZB 2OP4H 1VFBA 2ORBL 4CMMB 1BJ1J 4UI2A 1JRHH 4M62H 5LBSH 4ONFH 5K9OA 3RWIB 1NGZB 2VDPL 1R0AH 1IKFH 1VGEL 4GRLC 1F2XK 2HMID 1AGBB 4FQIL 1F4XH 3HI5H 4EI5B 2G2RB 1PKQE 4F7TB 1N64L 4U6YA 3VFWA 1DN2A 1DE4B 3PGCA 1INEL 1F3RB 4N90E 1R3LB 3WNKA 1KLFA 3MLSL 2XI9A 2H9GB 3QUYC 5CSZA 1N6QH 3EYFB 4YIQB 4FA8A 4UTAL 2JJSC 1ACZA 1D6VH 4CJ1A 3RAJH 1OQOA 5FM8A 2YPVH 3W2DL 1KELL 2JK5A 4PRHE 4R0LC 1AE6H 5MEOB 4QRSA 2XPGA 5IB1A 4KI5D 4HK3J 4OIIH 2AK1L 3IDYC 1LO4L 1S7QB 4X9GA 4MJ4A 3T4AA 5EZLA 4PJCE 2DQJL 3FCTB 1P1ZB 3QUYB 2DF3A 1MWAA 3BYTA 3B2UC 4PJHE 2K1MA 5HHVH 1MFNA 3U9PH 5KSVA 4K7PX 1UCTA 1HILB 1OD9A 2P8MB 4LSRL 3ILQC 4K55A 4LKXA 5C0BD 2IPTH 5HXMA 3KPNB 3CH1A 3MLYL 4OGZA 1G7PB 4DUVA 1QLEH 3MYJA 4B0MM 5CD3A 5IMOA 1W0VA 1MJ7H 5EUKA 4FQQA 4HK3N 4QRPE 5CIPB 2PO6B 1P7KA 3D6GA 3MRKA 1KCKA 3S6CA 5KVEL 3N9GH 3G6DL 2C3XA 2J8HA 4GKOA 2DD8H 1BQLH 5EU3B 4QHKJ 1P6AB 2A38A 3G08A 3QFJA 5EUOB 4KI5E 1XGPA 2RCSH 2QADB 1KCUL 2AJVH 4L29A 5IB5A 1AO7B 2IPKA 5I1EH 2VDKH 1A3RL 3ZE2F 3DGGA 5A3ID 4DCQB 5ESAA 3UAJD 1A9EB 4CVXB 3QNZB 4FZ8L 2W92A 3CZFB 1UXSB 1U3HA 1V5JA 2DKSA 2DMKA 4M6MH 2E6JA 5GRJH 3EYSH 1ZVSB 5C0BE 5IEKB 4OF0A 3SDYL 1ZGLA 1GOHA 2EKSB 4OV5A 1UCBL 2P7TB 4P59H 1UB6A 1EBPA 3UTQA 1JHKH 4XPTL 1SY6H 2UWEF 3IDMA 4GQ9H 5IFAH 2AJZA 1HDMA 3H7LA 4FFVC 2JCCB 4EOWH 1CL7L 3ARFD 2D0FA 2D0HA 3AB0C 2O61A 2GJZB 3FMGL 1T1XA 5I1DA 4QNPF 4NDMA 4X6CB 4QRUB 3L7FB 1DBKH 3RNKA 1QLFB 3SPVA 5EO0A 3QUZC 3V52H 4UQ3B 5JOPD 3R8QA 2LU3A 2R1XB 4ZSOE 4UV7L 5DT1H 3HZMB 4B7IA 1LO0L 1OL0A 1VB9A 5JOFA 1IC1A 3FHAA 1X5ZA 4AMKL 1B4JL 1HXYA 1I3GL 5HDLA 4HC1A 1CDGA 3O8XD 1FRGH 1XAUA 1YPZE 5GGQL 1DVFA 4PJFA 1NUFA 1RJYA 4Z7UA 5EU6B 5IB2B 1Q9WA 2DQHL 2C7UB 4FP8H 4LCIH 4XI5C 2VXTL 3QUZB 3RUGE 4YXHH 4PP2A 3BVNA 4ZOAA 4HKZB 1J0HA 3V6FA 3X3FL 4ZQKA 4ONHB 4JG0L 4ZPVA 1KCRL 4MLSA 4XPAL 1CDUA 3VWKD 1W0WB 3P77A 3O45B 4PRNA 4OM0H 4PJ8A 3QWQB 5ISZA 1BBDL 2WW8A 3U30B 2QL1A 1FO0B 1FBIH 1GAFL 5ALCH 2P44B 3SDDB 4Q58C 1KG0B 3NH7H 3PWUB 2ATKB 5JXED 3BPOC 3PL6D 5CWSB 4EIGB 3QZWA 1R5WA 1ZV5A 3JUZA 3SDCC 1ORQB 2Y07H 4RNRB 3FT4A 1FIEA 3DX8B 4YBQD 1Q1JL 4CVWA 1UB5B 3V4PH 3DGCR 4RMRA 5CEYA 5GRUL 4N5UA 4ZTOH 3KPRB 2IAMC 3D3VD 3UYRL 3EJYD 5F88A 4HUUA 5FXCH 1FSKC 3DIFA 3CCHB 1SHMA 3CVIL 2Q20A 1QYGL 5CILL 2CR6A 4LKCB 5H37G 2NX5D 3U46B 3WFCL 2EDYA 1ZANH 3HI1A 2YN5A 3DHJA 4O2EA 1NMAH 4N1EA 4NQCA 3LV3A 4LAQL 2YKLH 2GITB 3KPLB 3MGTA 4NT6B 4YO0A 2E7CA 3RWDB 3BN3B 2APFA 2IAMB 4JRXE 2BY0A 3D25B 1VFMA 4JHZA 1NUGA 2BMKB 2X4TA 4UIMA 1MRFL 5C6WH 5D2LE 1U8PA 1OLZA 3U7YH 2YPKA 4Q9QL 2ZG1A 1OY3B 2XICA 5JW4Q 3E3QE 1TJHH 1J7VR 1U92A 5CUSH 4MDJA 2VAAA 1RUKH 4E42B 2OL3H 3A0OA 5CBAB 2JKXA 1MNUH 4FQ2H 1K6QH 4LLVB 3C08L 4MYWB 2DQCL 3ARBC 1WK0A 3D3VE 3CK0H 1N8ZA 2CRYA 1OW0A 3ZTNH 1G0YR 5HD8D 3G6AB 4ZFOB 1XIWD 3KYKH 5FA3B 1VACB 3OKLB 3LEVH 2BNRE 3GB7A 2APVA 1AGFA 1KUMA 1A7PL 2ZSWA 4XNQA 4OZFH 1OAZL 1FVDA 4G7VL 1UKQA 1CLZL 4C83A 1BIIB 3PNWA 4POZD 1N26A 5I18L 2CR3A 4OLXH 1KJMA 4QYOB 2YA0A 5F7DA 5MI0C 3C6LB 2NY3B 2VLKB 3V0AC 2PW2B 3FQUB 3J8F7 4U6XB 1S7UB 4KDTC 3HB3D 4GG8B 4BQCA 2P1YA 4PY8J 1RI8A 6CGTA 1U3JA 4JFXA 1A9BB 3MC0A 4PV8B 1PW3A 2VOTA 1ZVHA 4UU9B 2HJFA 2RB8A 3PP3H 2Q7YA 5DDHA 1NDMA 1JZ5A 3KYMA 1MCPL 5HHQB 3ROOA 4NWTH 1KGCE 4IIQC 2QQNH 3AVEA 4GW5A 3AGVA 1CR9H 3AY4C 1HEZB 1HIML 5MI0B 5F1KC 1IC4L 2DLEA 4D8PA 2CGRL 4IMLA 1N0LA 4WO4B 4KZDL 4XVJL 5TDNA 3NIDE 4DKFL 1JPST 1U8MA 5CGYD 1EZVY 4G8IB 3O11B 2AJUH 1S3KL 2V9RA 5IHZA 1ETZA 4X9FA 1AD0B 2WUBH 4IIQB 1XT5A 1W72H 4Q0XH 3HE7B 5HVFB 5KSUB 3U6RA 2H1PL 1CXKA 1DN0A 1IGYA 1C08A 4N8VA 3JV4B 5T1KB 1NCCL 2IALA 2OR9L 4YH6A 4GKSA 4LLDB 5E8DL 1JWUA 1W8NA 3V2AR 5DJ6B 4NO2A 2R1YA 2X4RB 4DKDC 1S7SA 3QFDA 2FEEI 2O5ZL 4YAQB 1FYTB 5CZXD 2JB5L 5SWQB 2HT4C 3IDNB 2NY1D 3DVNA 1YEFL 3WUWB 5E70A 3MBEB 3O4OC 2AJSH 4HIIA 3NZ8B 3MA9H 4JQIH 1JNHA 5LCVH 3FFCD 4Y1AE 1UEMA 3PV6B 5CGMA 3DMMC 4HIJB 4APQD 1K8IB 4J8RB 4OD1H 2AV7B 4XP6L 1EEQA 5ABDE 2F5AH 4P4RA 2X10A 4NM4H 2UWEB 4JG1L 1EHAA 1U95B 4JR9H 5GS0D 5DJZA 1M71B 5C0JB 4RGND 5L6YL 3IAPA 1G7MB 1KC5H 4W70A 2C9AA 3BP7A 3W9EA 1QKZH 5F8RC 3O4OB 4PS4H 4K3JH 2CJUL 3TH3T 3CX2A 4ISVB 3IJHA 4PJEA 3WNNA 1FNAA 3ORJA 4X6EA 3BO8A 4U1MB 1UJTA 3CDYA 4JCMA 1BQHA 5IVXA 5IK3A 3RL1B 2A6IB 5D70L 4FZEH 1G1YA 1D5XA 2N1KA 2V9QA 2HKHH 4DFIA 4D0CA 4NCDA 3VWJB 1YN6A 4NZRH 3DX7A 5SWZB 4HHAA 4YX2H 3NFPB 1T6VN 2BDNL 3ZKND 4PB0L 2DBJA 1GC1C 1EO7A 3MROB 5EOCH 3ARUA 2OTUA 4JY6B 3LB6C 1QFWM 4U31A 5FA4B 3SCMB 1HHJA 3ULUD 4L4TB 4P4KA 2BHYA 4RFNB 5ECJE 3L6FB 5FGCB 1JF5A 3EW3B 3SDAD 1CD8A 1D5BB 4JPIB 3U7WL 4M1GH 1KCSL 1J8HB 1Q0YH 1INQA 4HW6A 4RCAA 5BV7L 2EEDA 1MFDL 4RGNE 5IBLC 4Y16C 1S9YB 1XR8A 3IAGC 1MCWW 5ANMA 1FG2B 4PGBB 1EA9C 5HVHB 5IMMA 2FJHB 4Z0BL 2AW2A 5DRWB 4OZGF 1YJDL 3IDIA 3VFOA 4GRWE 4P2RB 3QEHA 3PP3K 5D1XD 4HLZH 4F7MB 4V1DA 1MHHB 3RVXC 3SJVB 3B6SB 4URTB 1Y6NR 1V8HA 5JW3H 1LE5A 4Y19E 5EPMA 3FO1A 1CIUA 4PRBB 2YUXA 2GTZB 1EVUA 1OGTB 1TETL 1K4DA 4H20L 3Q6GL 3O3EB 4KMTL 5ESQB 3P0VH 1H3TA 3GBML 1XF4A 4Y16B 4CN1A 1RIHL 5FUZL 1V05A 4G6KL 3WJLC 3FFCA 4KXZH 3DSFL 4NN5C 1JGVH 1WAAF 5CMAB 1ACYL 5KG9B 2XN9E 4PJ9A 3L3IA 3NVQA 2HG5B 2HVKA 1DANU 2E7HA 1JPFB 4E0RB 4D9QD 4RIRA 4HUMB 1J9CT 5K59E 4EVNB 2VKWA 3J7HA 3AXLA 3MOBL 2AV1B 5DJCB 4OI7A 4Y4HB 3SKMA 2X4QA 5KSAA 1FL5A 4NJ9L 3S5LA 4PBXA 3S3SA 1WIOA 5D2NE 2ZCHH 4MJ2A 2EC8A 4P2YA 1KEMH 1INDL 2MTPA 3CAFA 1RAMA 2HVJA 4J3VA 4Y5XA 1R24B 2Y1VA 1ZLWH 2DMCA 3IFLL 3G5ZA 5CEZD 5E0QA 3ES6A 2DQIH 4MNHA 2V2XB 1IGIH 1FFPA 4WUUD 4CRPA 1AKJA 4I18B 1MCHA 3DVGA 1CBVL 3PWPB 3QCTH 3QEUA 5EZOH 3WE6A 4G43A 3KPSE 1I7UA 3GIZL 2IEPA 2NW3B 3RZCC 3BDXA 3FAXA 5L2KB 4A6YB 4PJBA 5C09A 2QSVA 2J88H 4LVEA 15C8H 1HQ4A 3Q1SH 4HCRH 1QSVA 3T0EA 2FHFA 1E6JH 3QXDB 4D0BA 5CEXB 2A74A 1TVBB 1OAUH 2XY1A 4ODVL 2BX5A 1I9JL 4X7CC 4NO0D 5T5NG 2X4UB 1RD6A 4D9QE 3L3HB 4MAUL 1T66D 4DK3A 4JPVL 1UJ3A 1OB1A 4PRIA 3G5VA 3QUML 4CVZB 1MIEH 4YXLH 4WV1C 2PF6A 3DI2B 3DUUB 3H42L 3MR9B 4RDQF 5J12C 4J4PA 1CGYA 4KVCL 5KANG 1DUZA 4HZLA 3CU1A 2IANA 4ZFZA 1SM3H 4RMWA 4JY5L 2C3WA 1CZ8L 3H9SB 3KS0H 1P4LB 3B83A 4G7YH 5GJSH 4TSAH 4UV4H 5CEZE 2DQFB 5IBTH 4LOUC 4YDVA 4MCYB 5HGBA 4QHLB 1VENA 2XY2A 5DJDB 4TVPE 3BXNA 3I50H 3JV5A 4TPRH 4WI6A 1UG9A 1BEYH 4KRMB 2BSRB 3WN5C 4QOKB 1FC2D 3TA3A 1EJOH 3BHBB 1WWBX 1T5WA 1EXUA 4QRRA 1IE5A 1MHEB 4WV1B 4U0RC 1SJXA 3I6GB 4FRWA 2LTQB 3AREC 4PRDA 3LQMA 1YEIH 5ACZB 4EUPA 1GGBL 4I5BA 1CXHA 3OKNA 1JVKA 4KWUA 4U2YA 2EYTA 1DTUA 1S7TB 3QDGA 3MUY1 4XP9L 1GPOH 4NZJA 1KN4L 4KQ4L 1IM9B 5GGVL 1QSFA 4MA7H 2ICWA 5BS0D 1R5IA 1ZHNA 4JY4B 4NM8L 3TN0D 1ZA6A 3HA0A 4XXDB 5DFTA 3CD4A 5F7EH 4R8WH 1F4WL 3M07A 3AAZA 5E99H 2IBBA 3TNNA 1BOGB 3QH3A 3WSQL 4OCYL 4WUUA 3NIGF 1MPAH 2V17L 1JYXA 1LK3L 3ROLA 3UDWC 2XXCB 1WSST 2HRLA 5DGRA 1LP9F 2VDOL 4FS0A 2FBJH 2NLJB 3FFDB 4WFFE 1BF2A 3I02B 5C0EB 5GISH 5D1QC 2NXYD 1CE1H 4MHHI 3F65A 3BP5A 2X4NB 2BOCA 3ZE0F 4XX1G 1MFBL 4XHJD 4Z78A 3CFEB 2X89D 4MJ6A 2HTLC 3FN3A 4K8RD 1JI2A 3GMRB 3E8UH 2XG5A 4WFHD 2H41A 4I1NB 5E2VH 3N1QC 1WWWX 1CT8B 3B4NA 1A0QL 4JKWA 1TZIB 5BS0E 5D7LB 4ZUUA 1DBJH 3H3KA 1AXTL 4KVNL 4TNWK 1MFEH 3VXSB 3FN0L 2EDJA 5MENB 2VKXA 2VE6A 1BVKB 1EMTL 2J6EA 3RY6C 4X6FB 4M6NH 2EDTA 3KPQA 3RWCB 2FX7H 4Z7NF 1VKXB 1QVOB 1GGUA 4D9LH 3QIWC 1U8QB 2R1WA 1I8IB 1P9MC 3VE0A 4RQQB 3O3BB 4XNUH 1RUQL 3CLEH 4OZFG 5GZOD 2Y4SA 4MMZC 4WTWA 3FZUC 3RP1A 2QR0B 4X98A 4HGKC 4OUOA 3MV8E 4JFDD 4KROB 3FO2B 4ZS7H 1F6FB 1ZMYA 4BSVA 3UTPD 4PJ7A 5GIRA 3P11H 5F9DC 1IGFL 4WFHE 3THMH 4JRYD 3D2UB 1RK1A 4HJGB 4YHPA 4JKMA 4DUXA 5F7UA 1NLBL 3OKYA 5IMKA 4TULH 3BAEH 1FYHB 4X4XA 5F3HA 1MJUL 1JTPA 2BNQA 2A73A 5DJ2A 5IIEA 5BXFA 3MLVH 1AXIB 1YDPB 2A1WH 4GFTB 4OZGB 4GAYA 1R3KA 1UYWH 4FFZH 5B39B 8FABA 2EIDA 4NRYA 5IROA 2WK2A 1CK0H 4LAJH 5BMFH 4IOFD 4W68A 4MNQA 1CXFA 2FJGB 4YDLC 2XTJD 4K7PL 5BRZE 1RJZA 4DFHA 3JBG7 2NYYC 5GJTH 3HG1B 4DGIH 4EN3D 1B4RA 3OPZH 4M43H 1KTKE 5T1MA 5I1AA 1KYOJ 3KGRA 5GGTL 2IH3A 1WFTA 1SJVA 2XQBL 4R4BA 4OLEA 1DLFH 2DI7A 1IEHA 2VC2H 2CKBB 4X4YB 2XWBA 4OUUB 3UTPE 3RTQA 2P5WD 2BVQB 1RMFL 4PGDB 3DPBA 3ULVC 2Y06L 1FL3B 1K2DB 4JRYE 4NKIL 3KJ6H 4KK8C 1NGQH 4YDLB 5DF0A 1FGVL 3LS5H 5DD3L 4GBXD 1ZT7A 2ICEA 2XZZA 1KJVA 4K23H 2AJYL 5DRXA 3WXWH 3MO1B 3MCKA 2ZJSL 2ZUQB 2F53D 2RFXB 5F8QC 4NNXB 4H88L 3GSXB 4HG4K 4B50A 4HUVA 4LCYA 3OKMA 2XQYG 3DTXA 1N0XL 1CS6A 3L9RB 3H7BA 4JDTL 5DD0L 4BFGA 2YSSA 4DQOL 3QJHB 5CSGA 3RWJB 1SEBB 1FORL 4HAFA 2ADJB 2V7NA 4X9HA 1D3CA 3FRUB 1LO5A 3MA7A 3U9UA 3O2WL 4U1SA 1RZ8A 4JANA 1X5XA 1CDIA 4HFWB 5FO8A 4ZNEA 4MQXC 2Q3ZA 3GMQB 3T2NH 1YECH 1IC5H 3G9AB 2O5XH 4KKLD 2FJFA 2PYEB 2HRPH 3QQ9C 3IDJA 4MSWA 1F6LL 1RZ7H 3PDOA 4NQXB 3CH8A 5ELIA 4BH7A 1YEEL 2A83B 4P5KA 3IXTA 5LXGH 3PGDB 1XF2A 2MJWA 1UM6L 3MRDB 4OZIF 4JPKL 1C16A 4ETQB 5I1JH 2B39A 3VI4F 4U7SA 4NP4H 3F7QA 4P0DA 2CIKB 2IMMA 3IDXH 4OD2B 5FGBC 4JHAH 1SY6A 5C0RL 4TUKL 1RV6X 3BDYL 1TQCC 1YEGL 4AYFA 4OF8A 4WNQA 5JQHC 4ZUWB 4Y2DB 2VLRA 1ZEAL 2BJMH 1T3FB 3IF1B 5DI8B 4P2QB 5KJRL 3NMEA 3WO4C 2VZ3A 5T5FL 1JWMB 5E2JA 4YHYC 3G5YA 2C5DC 4PJDB 2B0SH 4U1KA 3GI9H 3GDBA 1FHGA 2XRAL 4JFPB 5EBWA 4NQDA 5E1AA 3TZVD 5DS8B 1FZOB 1TQCB 4UIKH 2FHBA 4UZGA 1CFQA 4ESKA 2A0LD 4N0YL 3KPMB 1JF1A 2C1PA 3WO4B 1B6UA 4J6RL 2H3NB 4U1LB 2P5EA 1KJ3L 1U58B 1MRDH 3OKKB 1BLNB 1CICC 3UJTH 4JJ5B 5GS0L 1BF8A 4GMSL 4PJ5A 1ZGLP 4YR6B 2W0FB 1AHWA 1GC1H 1J1PH 4P5TC 2FYYB 4WW1A 3MGOA 1LP9B 4XX1E 3NA4A 1GCFA 5D1ZC 4XVSL 3DO7B 1XGQB 5FO9A 4G80A 4LSQH 4ZXBB 3S7GA 5FYKH 3R0MA 2VR4A 5E95B 5IW6B 4ODWB 1HHKA 1O7SA 4IM8A 1U9KA 3SGJC 3X14A 3QEQB 1I1FB 2MHAA 4LCWB 5TQ2L 1CVRA 3DRTB 4O2CA 2OTWB 1OP3H 3TBYB 3UPAA 3IFOB 4LEXH 1QTYT 3QNXA 4MDIA 3QHFH 4FQHB 5JMOC 2P48B 5E08H 3V79C 3S34H 4XVTL 3ULUL 2QSCL 1IAIH 5HHOA 2XKUA 5GGRA 4WFED 4P9MH 2DQTL 1EAJA 1SEQH 4DGVL 4YE4L 1T03L 1F2QA 3KG5A 4NNPL 4W4NA 3B2VL 3KHQA 5C0IB 3ALXA 1HINH 4MA8H 2WSKA 3GMLB 1G6RA 5MHSD 5I19H 1VGKA 5JW4M 3HFMH 2EDBA 2HWZL 1H5BB 4O9HH 1LK2B 5MEPB 2OXGA 2HKFH 1T1WB 3VFTB 2R0LH 4AL8H 5JO5A 1G6VK 4N5EC 1MY5A 4JKKA 1BQUA 4UINL 1CL7I 2CRIA 5AUMA 3QIUB 5EBMB 5CJXA 1EX0A 2HFEB 2R4RH 2FDBP 2WIIB 4ZAKC 5J0BA 4FQJH 4MB4A 1W0YT 3RGVC 3MRIA 4MAYD 5EC2A 2GJ6D 4IRSC 4L4VA 3VDAA 2Z93A 2Q86B 4K3GA 3TBTA 4R2GD 1DANT 4NC1E 4XCNB 5TF1L 1EFXB 1S7RA 3BZEB 3QDMD 3BSZH 2OL3A 3LZFH 4OGYH 1ZSDA 5D6CA 4G8EA 4OSUL 1Y6KR 3GGWA 4OB5L 2FZ3B 4XWGH 1U8KA 2A6JA 3OXRA 3NFNB 4ZAKB 4O2FB 5MERB 1UM4H 2F5BL 4M1DH 2G5BA 3DXAA 3OKEB 5C0FB 4I2XE 5MHSE 3DV6B 3HAEH 4IRSB 3EYVB 1G7LA 4K94L 3GMNA 2Y36H 3CVHA 4L3EB 4UUJB 5DRNB 5EZIH 3FB6B 5A16B 4N9GA 1F3JA 2CUIA 1AJ7H 3RWEB 3MBXL 4DTGH 3T65B 3EOBA 3INUL 3WFEL 2ZUSA 4O58H 4P46D 5C2BH 2FGWL 2CO7B 1EFQA 5GGUA 5H94A 1A3QA 4PP1C 5CEZL 1JGEA 4U33A 3DVIA 4HF5L 2VERN 3RJDA 2EEAA 2W1NA 4G3YH 4P48A 4X6DA 2Y5EA 2GJ6E 3OAUH 5EOCJ 2HT3C 1HYSD 3QFJE 4Z7WE 4JFZL 4BM7A 1MCQA 2SEBA 2G75B 1M6OB 5C8JA 1OGAA 4P2OC 2OQJB 1VEOA 3BUYA 4OT1L 5I15L 1KENL 4Z7VE 4MA3A 5FYLH 2DIAA 3NTCH 3UBXG 2AQ3A 3Q5TA 4JDZA 5CHNA 1Q0XL 4LVNC 2XV6B 1E27A 3WXVL 2LU4A 3UTSD 3TJHD 1YMMB 3FB7A 5D5MF 1NCAH 3IFNL 5GS1A 4KRPD 4OLZH 1NCWH 5IG7A 3O6FC 1QBLL 4HJJL 5KSBA 1U8LA 4R4NC 4JM4H 4LLWA 3NIFF 3MUGA 4U4BA 3D39A 1WBXA 2QQQA 4TSBL 1BD2A 2ICES 1LEIA 1ORSA 2A6DA 1DDHA 4MWFA 1C5CH 5IB3A 1GGCL 1XMWA 4QHUA 1QG3A 1OP3K 3X13B 4BSWB 2DS4A 3HMWH 3RA7L 2Z31D 5DJ0A 4QHNB 5KVFH 5HJ3A 2ESVD 4XAKD 4KZEL 1ZTXL 4MJIB 1PLGL 3LD8C 4YHZH 1K5NA 3QDMA 5IQ7L 4U6HB 3V5DB 1RVFH 5T3XH 4J1UA 4LCUA 5TE4H 1UACL 2DM4A 1FVEB 1KN2L 2YC1A 5JPMA 1BBJB 4RGMC 4X4ME 3VFNA 1N59A 5DURD 2HJLB 4FTVB 5F89B 3GMMB 4KJPD 5HHXL 4H25B 1QR1A 4ERSL 3WS6C 2VISB 4EI6A 4XH2B 1URLA 5D7IE 1WIUA 1NKRA 4Z7UE 1D5IH 3MRRA 4LRIA 3UTSE 2XZAH 4M7LT 1RUPL 4OZIB 2OXHA 4ZPTA 3LD8B 1NC2A 3MV7D 4Y4FA 5T1LA 4OFKA 2R9HC 3QULB 4GS7C 4WW2F 3O2DH 1NC4B 1T0NB 3NAAH 4HH9B 3KDMB 3LS4H 1JRHL 4M62L 1YEKH 4WEUD 2ARJB 3EYOB 4ZDHB 4ONFL 3P9MB 3VDBA 3MNVA 3R1GL 5HVWA 2P47B 2Q6WA 2EKJA 5ISZE 4XMKH 1F4XL 1NH6A 3CFDA 1DEEA 1TTFA 3HI5L 2ESVE 4XAKE 3WDHA 5C3TA 1RU9H 1DQQA 3G6JF 4PREB 4ZO8A 1S9XA 4LF3A 4LNVA 5IW1A 1IZKA 3SDXE 4HMCA 1N6QL 4K2UH 3ZKMD 2VL5B 3D9AH 1D6VL 1BHGA 5DJYA 3RAJL 1I3RB 4QY8B 5J6GB 3ARZA 2YPVL 1CWVA 4H26A 3CZJA 1A7QH 5HI4C 1H3PH 1B9ZA 2CK2A 4RZCB 1DBAL 3ILQD 4NO5B 1AE6L 3RIAF 1IILE 1MQKH 3ARGC 2E9IA 4U1IB 3JZ7A 1FLTX 4K8RL 4OIIL 4HWZA 3DI3B 2Y25A 4LIQE 3RKPA 4OF6A 2DQUH 4CMMA 1X4ZA 3S98A 3KS0J 4NYLB 1JPTH 5JQ6H 4HEME 3VDCA 4RFOH 1OLLA 2EE3A 3RWIA 4LP5A 3VA6A 4L8CB 3TVMB 3JTTB 3ZE1F 3OQ3B 2CDEB 4EI5A 4F7TA 2Z31A 3U9PL 3QXVA 1IKNC 1DE4A 1MHPH 5FYJD 3ZDXE 5DTFB 3NCMA 1HZHH 1AXSB 2IPTL 2Y7QB 3HPJA 4F7PB 5IW3A 1QLEL 3EYFA 4P23B 1MJ7L 2W0LA 5EORH 3GK8L 2F54E 3FB8B 1I7TB 3H2WA 3N9GL 2OSLA 1CDJA 1UEYA 2DD8L 5DYOB 2GY7B 1F42A 4GRLA 3U36B 3LKSB 1BJMA 3KVQA 3IYLW 3RDTC 3QHTC 1CGXA 3RVVC 5E9DD 4FXGB 3LHPL 4K3HA 4MA1B 3T09A 5HTSA 2RCSL 1ND0A 5I6XC 2AJVL 3FCTA 4M61A 1BWWA 3QUYA 1UZ8A 5I1EL 2VDKL 4G9DB 4G5ZH 4OF3A 4Q6IC 2CH8A 1L7IH 5ILTH 2DBLH 1HILA 3AS1A 2OK0H 4OBSA 2P8MA 2UZIL 1UA6H 1A6UH 3GKZA 3MV9D 3QEGH 4M6ML 5DK0A 3KPNA 1EEZB 4NQEB 3EYSL 5FYJE 3FAWA 1AR1D 3RDTB 1I1AC 1MHCA 4M03A 2PO6A 4PJIF 2P46B 3ULVH 4NKOA 4KK5D 5I6XB 4PG9A 4P59L 4GW1B 1LGVA 1LO2H 2DL2A 5IFAL 5EU3A 1BX2A 4UT7H 1WZ1L 4L9LC 4EOWL 1T2QH 1NGWA 4UAOC 5EUOA 5AEAA 4HCRA 1H8OA 1AO7A 5E9DE 4MD4B 1I1AB 5DT1L 3C5ZC 1A9EA 3QNZA 2GAZB 5DFWH 1UXSA 1B0GB 5SV3A 3HLAA 4L9LB 3C5JB 1FRGL 5I30H 1ZVSA 2DOCA 1F8TH 1K9TA 1A6AA 1XH3B 2P7TA 3BIBX 4FP8L 4HMDA 4LCIL 3P4NB 1KTRL 4NPYB 4YXHL 1FN4A 2AP2A 2JCCA 1F90H 2B4CC 2DWEB 4NIKB 3EDKA 3LDBB 5DVLA 1RZKL 3SOBL 1XR9B 5IM7B 2QEJA 2GJZA 3SDCD 2JB6A 3GJFH 4X6CA 4QRUA 3OAZK 2MCG1 4YGAB 4OM0L 1NFIB 5J13B 3WFBL 1MCIA 2R1XA 1FBIL 1AY1L 4H1LG 3HZMA 5ALCL 2DLTA 3BE1H 1X6NA 5AD0B 3BMVA 3QUXB 3NCCB 3IAQA 3M8OH 1BZ7A 1HHIB 4Y4KC 4LVOC 1C5DB 5CKGA 4W4OC 4TYUA 2CIIB 5D5MB 1YNKH 2R69H 1IZJA 2Y07L 4QXUH 4RMVA 3MV9A 5IB2A 3BZ4B 4WHYH 1JCKA 2PETA 3L1OL 3FONB 3V4PL 3QUZA 2X4SA 3GM8A 3OR7B 4HKZA 4ZTOL 1L6XA 3LH2H 5F9OH 3FOLB 4NN7C 5J11B 1VFBB 4IRZL 4UQ2B 3KHOA 2K3TA 1CQYA 4NHUB 4RBPH 3MZTA 1W0WA 3WDJA 1QBAA 4GG6A 1Z5LB 4Y4KB 1ZANL 2R0KH 1NMAL 1D5MB 1FO0A 2W65B 5LAXB 2YKLL 1KG0A 3C5SA 2ATKA 2WBJC 5EIVA 5GSRB 4Z9KB 5CWSA 3QJFA 2I5YL 3V8CA 3O41A 1T0PB 1HQRB 5CSZB 5T33H 5K9JL 4D0DB 1KTLB 4RNRA 3U7YL 4XPFH 2J8UE 1TFHA 3O2VH 1UB5A 3AFLA 5DO2D 2O93L 2GKIA 5CUSL 3CXDH 1RUKL 1TMCB 2XPGB 3DROB 4QRSB 5IB1B 1NEUA 4WW2B 1MNUL 4FQ2L 5T3ZH 1K6QL 3T77A 3MREA 3VCLB 3CK0L 2EXWC 2EDWA 4MMXC 4Z7QE 4OM1H 4WTZG 4P99A 5BV7B 4PLJD 3QQ3B 5IMLA 4DEPB 3GUTB 3KYKL 3N85H 2B5IC 1AI1H 3KPLA 1RIVH 2E5EA 5KSVB 3G6JB 4V1DE 5DXWA 1H0DA 3CSYA 3TT3H 5DHVH 3RWDA 3U82B 2IAMA 2I60H 3D25A 2FGZA 3CH1B 4ZFFA 4OLXL 5CD3B 3ZHDA 1DR9A 1V3KA 2VLJD 4FQQB 3RPKA 1P7KB 4JZJC 5JHDD 2D7TH 3HZYA 4P3WA 1ADQA 1BREA 1LEGA 1G7JB 5CBAA 2HMIC 2AK1H 4BQ6A 2NXZC 2VDQH 4LLVA 2NPLX 25C8H 3TGXA 3W0WB 3G08B 3O9WD 1XGPB 2DQJH 3V6BR 3GRWA 2VB5A 4NWTL 2KQNA 1TTUA 2QQNL 4QHKI 4ZFOA 1CR9L 1ZT4A 1VHPA 5FA3A 1VACA 3OKLA 1YNTB 4Y5YC 4FNLH 3GJFK 3CDGB 1U41A 1JNNL 2AXHA 5ESAB 4LP4A 5AYQA 1BIIA 1R3HA 5TE6H 2WWKT 4KI5C 3LPWA 3PQYD 1Z0NA 3VU2A 2AJUL 3C6LA 3NPSC 1XFPA 1YMHB 4S0SD 1DSFH 3ARBA 2VLKA 2MQCA 5L8LB 4S10A 4FMFA 1VADB 2VDNL 4DKAA 1S7UA 5C6TL 4OV5B 4MD0B 2DYPD 3TC9A 4GG8A 2WUBL 4DOHB 5I71B 1W72L 3UTQB 4Q0XL 7CGTA 2AJZB 5JHDE 4N1CA 4Y5YB 3FTGA 3T1WA 4PV8A 4PJBE 4WUKH 4UU9A 5C09E 1JNLH 2OJZH 2O61B 4ODTH 2ED9A 1T1XB 5I1DB 3GJEA 4NDMB 1NBQA 2FX8H 3MRJA 3QUKA 1ZHLB 4PJEF 3SPVB 3WJJC 1P84J 1UZ6F 2A2QT 2ZUUA 1A3RH 2Z8SA 5IVXF 1WC7B 2E9JA 4F57L 2VXSL 2JLLA 4LGPB 1WT5A 3AMKA 4PGCA 2DDQH 5GS3A 1IEAB 2AJSL 3MA9L 4LCCC 4G8IA 4JQIL 3QXAA 5LCVL 3QUMB 2IANE 3FN9A 4I0KA 3MOAH 1DVFB 4PJIB 3DX9B 5MP6H 4OD1L 3BESR 5JIKA 4TSCH 2F5AL 4KHTH 5C0BB 1AD0A 4IIQA 4NM4L 4XPTH 3HE7A 4JR9L 5KSUA 4BZ1H 4PP2B 3V6FB 2VLJA 1CL7H 5HVGB 2R29H 5IEHB 3OV6A 1KC5L 3UTZB 3JV4A 3UAJC 2DQDL 1A2YA 1XGYL 4PS4L 4K3JL 4LLDA 5FYKD 1NFKA 4HQQL 3P77B 5DSCB 4LARH 5DJ6A 2X4RA 4PRNB 4O5LH 2VN7A 5TDPB 4QHMA 4YAQA 1NMBL 3A6CL 4FZEL 5E4EB 5SWQA 2HKHL 5BO1L 4AMKH 3GSNH 1EIBA 3MBEA 1P7QD 4NZRL 4I13B 5JLZA 3Q6FB 2K9UA 3QDGE 4CU6A 3F7YA 4F15C 3QZWB 5EOCL 5GGQH 4HIJA 5HYJD 1K8IA 2FD6H 1HSAA 3S36H 4HJ0C 5F72S 2DQHH 5EU4A 2UWEA 1U95A 2HTKD 1M71A 5C0JA 1U93A 4Y8AA 4M1GL 5F88B 4HUUB 2FO4B 3DIFB 2VR5A 3ETBF 1U3ZA 4JG0H 5E6IC 3STZB 4M4RA 1PG7W 4XPAH 3QNYA 1CLOL 4FQXC 4ISVA 1YN7B 3O8XC 3ARFB 3DMMA 4K71B 4RISH 5FYKE 1KEGH 1HK6A 4O2EB 4NQCB 1PG7H 3LV3B 1GAFH 3BD3A 5J3HD 1KBGH 5EU5A 1PX4A 5SWZA 1G1CA 3NFPA 4X0KB 1DCLA 1V3MA 3MROA 1ZLSL 4CNIB 4JY6A 5D7JC 3M17B 5J7CC 5FA4A 2X4TB 4L4TA 5HYSG 3EHBC 4UIMB 1J5OL 3P0VL 4LGRB 2NY6B 3VWKC 3TYGH 4G42B 3L6FA 3VA2C 3MX0A 1QQDA 4KUCF 3O0RL 5IT2H 1JGVL 1U92B 4JPIA 2VZ1A 4LIQL 2VAAB 4MDJB 5DUPH 4WWKD 5DQDL 3ULUF 1L0XA 5CD5C 4N0FB 5IKCA 3VMPA 3OXSB 3U83A 5ADOL 5CZKA 3PL6C 2JELH 5A2KH 1N8ZB 4OTXH 3N1PC 3WKNA 4PLOB 1MF2H 2FJHA 1C12A 1CTNA 3RZCD 2G5RA 4ZOCA 4P2RA 4R6UA 3GBLA 2OCFD 3E3QC 4XNQB 2ZCHL 3VWKB 1FVDB 1CD9B 4YBQC 3MQIA 3SJVA 4MZ2A 1EHLH 3ZDYF 5C71A 3PNWB 1CU4H 4U3CA 3BJ91 3MRCB 1OGTA 4NWUH 1KJMB 1IGIL 1WLHA 5F7DB 1MRFH 5ESQA 2V2WB 4Y16A 2Z8WC 3PL6B 4Q9QH 3QCTL 5A2IH 3VXPA 5EZOL 1HYRC 3AMLA 5KG9A 5HYJA 3BW9A 4A2LA 1H3XA 1KOAA 2WWKO 2J88L 3Q1SL 4HCRL 2HJFB 1E6JL 2XWTB 1UH3A 3C08H 5B3JF 1OAUL 1IAMA 4JO3H 4NUJA 1NDMB 4PY8I 4NNYB 5ICYA 5EFIA 4HWNA 2AV1A 3D3VB 5KAQF 2X44D 4GW5B 1T1ZA 4QGTA 2N56A 4HWBA 1S7VA 5D8JL 1K85A 3ZHLA 2ZOKB 4OQTH 5HYQB 1A7PH 1A22B 5C0AD 1DFBH 4IMLB 2NX5B 2HLAB 5KS9E 4S2SB 1II4E 3MLTB 4XCEA 3BH8B 2Z35A 3UTOA 3PWLA 1U8MB 1SM3L 2VITB 2Z8RA 3ARED 6FABL 4NBZB 3FB5B 3OTTA 5GJSL 4I18A 5H2BA 5IBTL 4WEBH 3P2TA 1UWXH 2CMRH 5A2LH 2NY7H 4BKLA 4QXGH 5HD8C 1JZ3A 5E00B 1XIWC 4MXVF 4TPRL 5L2KA 2R2BA 3WIFA 4A6YA 3A6OA 1BEYL 3U6RB 3HMXH 5L2JB 3DECA 4X9BA 1EJOL 1IGYB 1C08B 2GY5A 2MSPA 2V5TA 2IALB 3F7VA 1MCPH 2VZOA 4J2XA 4POZC 3NCBB 3MOQA 3L3HA 5FKAA 2R1YB 3KLSA 3BD4A 4DN3H 5L8KB 2OYPA 5IJVA 1IC4H 3CDFA 1QZ1A 3S8WA 5FV1L 3HAEA 2CGRH 2GTWA 3SE9L 1D9KD 2EIEA 3DVNB 1YYML 4XVJH 3MR9A 5GRVL 1XIWB 4C56E 4HIIB 1CG9B 3HI6H 1JNHB 2IQ9H 1N5AB 3VGAB 4NO3A 4WCYH 4MA7L 1GHFH 3HS0B 3GIVA 1ZLVK 4TOYH 2DQFA 3OR6B 1LNUB 3TO4D 4GLRI 3W11D 3VG9B 4U7KA 4P4RB 3BPLC 1NCUA 5DJDA 1NFDF 1Q9OB 1YYLL 3L5WA 4WHYG 2KH2B 4R8WL 4YXKH 5E99L 2H1PH 3MTRA 3KLAA 4DWHA 2BSRA 5D7SH 4QOKA 2LAAA 4WV1A 2FBJL 3GEWB 2OR9H 4IJ3C 5E2UL 4MXWH 4JQXC 4YZFF 5GISL 1CE1L 4E5XB 4X6EB 3BO8B 5IVXB 5ACZA 1TQBB 2B4CH 1YEDB 1D5XB 1NMCC 1YEFH 3KYOB 1S7TA 2X4PB 3DX7B 4M3JA 3IFPB 3VXUD 3WN5A 4TRPH 1IM9A 2L4OA 3E8UL 5CFHA 1KB5H 3O6KL 1HHJB 3QIWD 4ZO7A 3LQAC 2IBZY 4G6AD 1TZHB 4JY4A 4R97C 5E2VL 2YRZA 4XXDA 3DJ9A 3PWVB 3VXMD 1DBJL 1NCDL 5IFJB 2VLRE 1BOGA 3FZUD 3VGGA 2YD2A 3C8DA 1INQB 1MFEL 5EIIA 4HIEB 1SVZA 1CFTB 3FFDA 5C2UB 1XR8B 3FRPG 1TJIH 3I02A 5LVEA 5C0EA 4M6NL 5IMMB 2FX7L 2X4NA 3VFOB 4D9LL 3MRPB 3QEHB 1UVQB 4E41A 4XNUL 1VPOL 3VI3E 3CLEL 5GSVA 3O3DA 5GS0C 4RGNC 2YUZA 3FHQA 4PB0H 3OF6D 3UDWA 2YBRB 3RY4A 4UT6H 2E27H 2NY1B 4DN4L 3VXUE 3P11L 2I27N 1CT8A 2LU7A 4BFIA 1TZIA 5HHMB 3THML 5D1QA 3FFCB 3MLWH 5DR5H 5KVDL 1X5HA 4APQB 3U7WH 4PJ5E 2HVKB 4TULL 2NYYD 5MENA 3VG0H 3VXME 3BAEL 1BVKA 2MQ3A 5IHBA 4RIRB 3PGFH 3AXLB 3ZKNC 3MLVL 2A1WL 2X4QB 1QVOA 1FL5B 5GGSY 4I0PD 5E6ZA 3ULVD 4FFZL 4M5ZH 4KK8D 4LASH 4RQQA 5CS7A 3BGAA 5GHWH 3VJ6B 5BMFL 3O3BA 1YNLH 1P53A 3SDAC 4HMEA 3GHBH 3ARDD 2QR0A 1QSEA 2ZUYA 3RBSA 3EO1A 3ES6B 4H20H 5GJTL 4MNHB 4KMTH 1FFPB 3SO5A 3V7MA 1O7VA 3GBMH 3OPZL 4M43L 3DVGB 1B2WH 3BIKB 2ARWA 4B53A 2VXUH 3HUJE 1KULA 3MRHA 3D2UA 2VC2L 1Z2KA 5D2NC 3DSFH 2X1WL 2BVPB 3T3MF 4HJGA 5DZOA 1NLDH 1QFPA 4XPBH 1J8KA 3HZKB 1NBVH 2FBOJ 5D1XC 3AROA 3KJ6L 2E3VA 1NGQL 1KT2B 2A74B 1M05B 2BSTB 1V7NL 4J3XA 3DBXA 3MOBH 3LS5L 4KV5E 1YDPA 1ZE3C 1JN6B 4OZGA 5DZLA 2WINA 4K23L 1JZ7A 4M9PA 2PN5A 3OG6B 2JJUA 3E2HC 5B39A 5C0CD 2VRAA 3TNMB 3K8MA 2FJGA 5D2NB 4F2MB 4MQXD 3LKQA 3L3KB 4RAVB 2XT1B 4KK6D 1DUZB 4HZLB 4ZFZB 3QQ9D 5D1XB 3HG1A 5I1IH 3CUPB 5C07D 1Q9KB 1MVFA 3OB0H 3LQZA 4YDVB 4K94C 1HHGB 2CKBA 4MQTB 1J0YA 4OLYH 2BVQA 3HE6D 4PGDA 2ZG2A 1QUNA 2ZNXA 2EO9A 1FL3A 3E2HB 1K2DA 4N0CD 5FOJA 5T5NF 3UZEA 1T5WB 1H3WM 3A67L 3KR3H 4ODVH 4JB9H 1P69B 2EZ0C 3T2NL 1YECL 2P24B 2O5XL 4PG2C 4HS3A 2MNUA 2B7DT 3O6LH 4PRDB 4EUPB 4WI7A 1RULH 2AXFA 4Y5VC 2RFXA 3GSQB 2D9CA 4NNXA 2YD7A 4PB9L 4AENA 3MXWH 1JRHI 2EYTB 1QR4A 5C0CE 5JMRA 3QXTA 3EKCA 5I1JL 4B7LA 3SEPA 4KDVA 4NP4L 1KACB 3IDXL 3NBNA 3QCVL 3L9RA 4JHAL 5BOPA 4ETYA 3V6OA 2EYRA 1X9QA 1ZHNB 5GZND 3RWJA 1SEBA 3TCLA 2YRPA 3KNBA 1ZA6B 3JV0A 1Q9LA 2ADJA 3AAZB 3CFIC 2BJML 3QH3B 4WUUB 2OI9B 3DUHA 1FAIH 4HFWA 5IGXL 1XGRA 3OJ2C 2F58L 3ZT6A 2B0SL 3MRMB 1CICD 2PYEA 3T2OA 4U1NB 5E8NB 3BP5B 2VUYA 4NQXA 3S36X 1EZVX 4GT7A 3PGDA 4UIKL 3VFPB 1PKOA 1FNSL 3MRDA 3EO9L 3T3PF 1I8MA 2C1OB 4KFZC 4ETQA 4XP9H 1J05A 3WNMA 3D39E 2CIKA 1OAYL 4OD2A 3HC0A 2J5LB 4F8TA 5DMGC 3GO1H 1MRDL 2VWEE 1C7SA 2O26U 3BQUD 4X7FC 4ZUWA 1NFDB 2UVFA 2XA8H 1HSBB 4G8FA 4Z7OE 3UJTL 4ZUUB 4JFFD 4ZG1A 3GJFA 1JMXA 1PG7X 3WSQH 3IF1A 3K74B 3BP4B 4P2QA 4JREB 1GC1L 1J1PL 3E1F1 4M93C 5GRWA 1AFVH 2FWOB 1JWMA 2VE6B 1EJ6A 4LSQL 3D0VA 1QNZH 4HULB 1FV1A 4PJDA 5FYKL 3ZDZE 3S35H 1F4YH 3PG2A 1WTGT 5DS8A 1MVUA 1FZOA 1XCTA 4Z95H 3RX7A 1T6WA 4TQEL 4LEXL 3TN0C 3WD5H 5E24E 3KJ4C 3ZKXB 3QHFL 5D71H 4AIOA 3KPOA 5I1HH 3WBDA 2H3NA 2IPUG 2MQ0A 3IETB 4U1LA 4BSVB 2PKDA 1IAIL 3EDDA 3V4VH 5GIRB 5F9JA 4EDWH 4P9ML 1BLNA 1A0QH 3B9KC 3MLRH 2YRLA 3RGVD 4JJ5A 3JWNC 3O3AB 1QBMH 4YHPB 1AXTH 4KVNH 1HINL 4MA8L 2W0FA 4PD4J 2FYYA 2OJEA 1LP9A 2QHRH 5I19L 3GMPB 3QQNA 4JFFE 4O9HL 4TTDC 2CLRA 2A73B 2Y5TB 4K8RC 1F6AB 2R0LL 1QFHA 3CIQA 4S1DD 3GZKA 1FL6B 1FE8H 3QEQA 1H3VA 1Z9MA 3NCJL 4IDJH 5DD6B 4LCWA 8FABB 2R4RL 1X4XA 3DRTA 3TBYA 1QEWB 2MWCA 2W0KA 4FQJL 1S78D 3BH9B 3IFOA 4MNQB 2DI8A 1JJUA 1F5WA 2NXYB 3BP6B 4FQHA 2AKRB 4GW4B 4PJAE 4P5TA 1CXIA 4G8GE 3DV4B 1X5KA 3RZWA 2PXYD 5D1ZA 4ZODA 2OZ4L 4KTYA 4X6DF 2P45B 3BSZL 4EJ1C 2IH3B 2NY2C 4JFHD 3LZFL 1IGFH 4OGYL 1UADC 3STBA 5I8CA 2XWBB 4X7EC 3RTQB 4PP1D 3PHSA 4XWGL 5DQ9B 4QLRA 5MEPA 1H5BA 2HT3D 5GZOC 1UM4L 4M1DL 5B8CC 3D5OF 1EO8H 1ZT7B 2Y36L 1KJVB 5EBMA 1N6UA 2HFEA 2WUCH 1AJ7L 3VXQA 5IBUB 2OX5A 4O58L 5C2BL 4YDKH 5KSBF 4NN6C 4LCYB 3OKMB 3DTXB 3TH4T 5CZVH 5JIIA 3SGEH 1MAML 4M4PA 3RU8H 1HNGA 4G3YL 3OAUL 1Q8MA 3FQNA 4Y88A 2YSSB 4YFLF 4KDWA 4Z7WF 3OKDB 5F96H 2D3VA 3HRPA 2V7NB 4JFDB 4JFHE 4Q74A 3FQRB 4HPYH 4NKIH 2FZ3A 3NFNA 3OAYH 4ZAKA 4O2FA 5HPMB 4U1SB 1RZ8B 3RGVA 3OJDB 1LD9B 3NTCL 3OKEA 5C0FA 2O5YL 2B1HH 5IR1B 4OCNC 4IRSA 3EYVA 5HI5C 4NN6B 4UUJA 4OF5A 4YQXH 3FB6A 5JUEH 4LVHC 4EN3C 2D7OA 5F7WC 3PDOB 3VRLF 4OLZL 1IL1B 4P5KB 1NCWL 3T65A 4I8DA 4JHWL 3NGBC 4JM4L 1C16B 4LFHG 2W60A 5BOZG 5CJQH 2H32H 2YPLD 3B5GA 3ESUF 3GFUA 4GAFB 2KBGA 2XTJB 3HMWL 2G75A 1MCOL 4GBXC 3VXTA 5FFLA 5KVFL 4F9LC 4YHZL 1AO7E 5CLTA 1E4KC 5DMIL 2R9HD 4OFYD 3QWRA 2JIXA 2YHGA 1RVFL 5TE4L 3G5YB 1CGTA 2P5WB 4OKVA 3PHOB 4U1KB 1YQ2A 2JE8A 4LHUA 1RZKC 5EBWB 1YMMA 2VXQH 5EU6D 3UPRA 3ILPB 4Y8DC 5E1AB 4YEEA 5AYUH 1FNGA 1GOGA 1YEEH 1OHQA 2P43B 3WUWG 1D5IL 1YC7A 1VERA 2XZAL 4P2OA 4YBLB 4JPKH 2OTPA 2F53B 4S11A 1R3JA 2ITDA 3O2DL 1A8JH 1MUJA 1U8JA 5C0RH 3QO0A 3N1GC 2P5EB 3BDYH 1YEKL 1YEGH 3MRNB 4QWWC 4X6CE 1BECA 2ADGB 3BX7C 5HI4D 1XGUB 3DLQR 3SDDD 1JMZA 4XMKL 3V5DA 5HGDB 4FQPA 1QRNA 4X6BA 1AHWB 3QYCA 4WW1B 3MGOB 3O6FA 5E7BA 1NANH 5DD5L 1BWMA 4L3CB 3RVTD 1L6ZA 1FVEA 4N0UA 1LDPH 5FO9B 3LQAH 1BBJA 4YFDB 2XRAH 2HJLA 4FTVA 5F89A 3MV11 1HHKB 4H25A 3GSNA 5AAMA 1MI5D 3X14B 3D9AL 2VISA 1S9VB 4XH2A 4QTIH 1I9RH 4LMQI 4HKJB 3KPRD 1A7QL 5EU6E 4O2CB 3VXRA 1H3PL 4OZIA 4MDIB 2X4OB 2WAHA 3PHQB 4Q97A 5KN5B 1MQKL 1B3JA 2GYSA 3IB4A 5JHLL 3QULA 4ORGA 4AG4H 5C08D 2YD6A 1NC4A 1T0NA 4HH9A 3SE4C 3KDMA 4JLRA 5I73B 1JPTL 2ARJA 2QJDA 5HHOB 5DRZB 3BGFB 4L8SC 4RFOL 3P9MA 4WGWB 1HH9B 4LEOB 2YPLA 3TJEH 2HP4A 2D7PA 4PRPD 5GS0H 1UENA 5HY9B 4GMSH 3NZHH 4LPYA 3IT8D 1MHPL 1P4IL 3VFUB 1HZHL 3Q48A 4GRWH 4XNMA 3I84A 4YFLI 2VL5A 5AUMB 3K80A 3BMWA 4K9EC 5EORL 5F9AC 4EXKA 1I3RA 4C59B 4RZCA 4NO5A 3MRIB 3VH8G 5EC2B 2DJSA 3TZVB 3KPRE 4J3SA 3VGFA 2JJWA 4RRPG 4HFUH 3DUSB 2FHCA 5EUOF 3FO9B 5H37H 2YD3A 1KCVL 4NYLA 4MZ3A 1UWGH 3ZSSA 3PIQB 3SKNB 2OL3B 2DQTH 4QXTB 1WF5A 4YE4H 2VQUA 2EDRA 1ZSDB 5D6CB 5DLMH 4L8CA 3B2VH 3JTTA 3GGWB 1QACA 4DW2H 2CDEA 4FFWC 1AH1A 5ILTL 3MNWA 1U8KB 1WUNT 2A6JB 2DBLL 3OXRB 2OK0L 5DHXB 1A6UL 1I7RB 1NAMH 3DXAB 4NC1C 3ARGA 3QEGL 4CMHB 4QT5B 2VH5H 4WIQA 1G7LB 4OZFB 3GMNB 4N9GB 1ONQB 3SO3B 1F3JB 1NUDA 4K3EH 3FB8A 3ULVL 5ALBL 1MOEA 5IVZB 1LO2L 5DYOA 1MI5A 3L5XH 5GGUB 5H94B 4DK6A 3NPZB 1P2CA 2ILLA 1T2QL 1JGEB 3MJ8A 2NY4D 5TF1H 2H2PD 1AGDA 4X6DB 1IKNA 4FXGA 1EHXA 1KPUA 2EE2A 3WIHH 2SEBB 3OZ9H 3B9AA 1KLUB 1VFAB 3I9GH 4KHXL 2EH7H 1IQDB 1RK0A 1AIFA 3MMEA 4WO4D 3DRQB 5IHUH 5I16A 2EDNA 4LFHD 2A6KA 4ELMF 5DHYB 2F5BH 4MAYC 3HCVB 4X99A 5EBGA 1EEZA 5JW5A 4K94H 4AIZB 4OFIA 4I2XB 2CUHA 1E27B 4OCXL 3RDTA 4R2GC 3KXFD 5GS1B 3SKJH 2VLKE 4S1SH 3VD4A 3K8KA 1F13A 4GW1A 5KSBB 1U8LB 1NGPH 4LLWB 5T1KD 4Q6IA 5CEZH 1WBXB 1BD2B 1U3HC 1LEIB 2A6DB 1DDHB 4MWFB 1DQDH 1W72B 2CK0H 4QHUB 4P57A 4TVPH 1YQVH 1MCBA 2DJ4A 5J57B 2GJ6B 4GG6F 2AI0L 1FYTD 1SVCP 4Z7WB 2AEPL 5HJ3B 4X7TB 3W39B 5IV2B 2IC2A 2YXFA 4MD4A 1I1AA 4OT1H 3IKCB 3WV0A 1UXWA 3PP4H 3QDMB 5FDWB 5F6IB 5SWSD 1KIRA 2GAZA 5CSBA 3K1DA 5I9QC 5HGAB 2YC1B 4ZD3H 4KXZI 1JYWA 3M8OL 4L9LA 5JPMB 3C5JA 1J18A 1TPXB 4LLYB 2YA2A 3WXVH 5L0QB 1QR1B 2AGJH 1YNKL 2R69L 2W0PA 3UO1H 4QXUL 1HYSC 3MRRB 3R06A 4HJJH 3RWFA 2F15A 2Z92B 3KXFE 1GRWA 4NPYA 4PYGA 3ZKQD 4FXLA 2M26A 4XPHH 1NC2B 4FG6D 4Y4FB 3LH2L 5F9OL 3C5ZA 1XR9A 3P30H 2ZKHL 5M7QA 5IM7A 2AK4A 3S9DB 3E6FB 4P46B 2GQHA 3S35X 3RA7H 1CCZA 4PGZA 3V5KA 3EDJA 2HYMA 5E2WH 5F1IA 3ZSTA 1NFIA 2XKNB 4DVRH 4U2ZA 1JHTB 4KZEH 1ZTXH 2R0KL 1CVSC 1EHNA 1O5DT 1LVEA 2EC9U 3TJHC 3VWJD 3ZE2E 1FYTE 4N90D 3CFDB 4KRPC 2E9BA 4CW1B 1UACH 3L95B 5AD0A 4JO2H 4LSSH 1EEYA 3VFSB 2EXWD 5D96C 1M7DA 4LF3B 1TVDA 3S3PA 3TIEB 3VFGH 1AQKH 3SCMD 4GXVH 5IW1B 5SWSE 1C5DA 5D5MA 4PRHD 5DJYB 2GK2A 3SHSA 3BZ4A 3O2VL 2NTSP 4PBWD 1KB5A 2UWEE 2J8UF 5D7IB 5GGRY 3CXDL 3OR7A 3UTSB 5LQBH 5D4QA 3N1FC 4KRPB 5T3ZL 4UQ2A 4YDIH 1NEZG 4NHUA 1MH5A 1FNHA 1J10A 3RVWD 4QNPE 1TTGA 1TJGL 4Z77B 1Z5LA 4OM1L 2HAZA 2UYLB 3R1GH 4Y4KA 4KJPC 4KTEH 4W4OA 4BH8A 3N85L 1D5MA 5JXAH 2W65A 3GI8L 4ONGL 4XP1H 5BZDB 5LAXA 4JO4H 2NXZD 1AI1L 3GHEH 1RIVL 2Z31B 1HXMA 3TT3L 5GSRA 4ORZC 4GAJH 3L3JA 1KSRA 3N06B 5SWZE 2EDFA 1G9MC 2I60L 4QRPD 2OMNA 3C8HA 3HPJB 3MNZB 1HQRA 1C8PA 1FFQA 4XB7A 3SDXB 4D0DA 1A6ZB 1KTLA 4X7DC 4L4TE 4PGEB 3D48R 4TN9A 2D7TL 1I85C 1DBAH 2OSLB 1U8NB 5DURB 3DROA 4K8RH 3VMNA 4GRLB 4WW2A 1J8HE 2Y9RT 3TO2B 2VDQL 3AM8A 25C8L 2MPAH 3VCLA 2WBJA 3VFVB 4Y4HD 1U91B 3QDJD 1BM3H 1ND0B 5E5MB 3MV7B 3CGTA 4M61B 3BRDA 2BY1A 3QQ3A 3GUTA 1UZ8B 4L4JA 1HCFX 3ZKMC 3X3GH 2DTMH 4P2RE 4FNLL 1UC6A 2HH0H 3T2QA 3G6JA 4LLAA 3SJVE 4R0LB 5H8DA 3GSWA 3LEYL 3QXWA 5TE6L 2AAVA 4R96B 5DK0B 4WI3A 3WHE1 1ZXQA 5CAYB 3IDYB 2DWDA 3L5HA 1DSFL 3GK8H 4JFYB 4KKAC 3UBXI 1MHCB 1CGUA 2NTFB 3BT2L 4NKOB 4M7LH 3GNMH 3AC0A 1JFQL 4PG9B 1M7IB 1CYGA 2J4WH 2DLFH 3LIZH 1G7JA 4IOSD 1BX2B 4WUKL 3TM6A 1JNLL 1OPGL 2OJZL 4ODTL 1NGWB 3W0WA 3LHPH 4MHHG 2FX8L 1PDKA 1SYSB 2ZPKH 3QDJE 1FNEA 1YNTA 1GZQB 3CFKB 3CDGA 2DDQL 3R4DA 4HIHA 2UZIH 1T89A 4BZYA 4OFDA 3H9SD 1BIHA 2LABA 3HLAB 1XGTB 3CMGA 2J7LA 3OHXA 2CRMA 3S37H 1YMHA 3MOAL 4HSQA 4GSDH 5GGSB 5MP6L 1FVCA 1VADA 1A6AB 1FFOB 4JN2B 1W2KT 4MD0A 3PWPE 4KHTL 4TSCL 4U1JB 4DJMA 4FQLH 4RWYL 2HFGH 2ENSA 2NR6C 3X12A 4BZ1L 1IGTB 4Y5YA 1FN4B 3LRHA 2HN7B 1WZ1H 2R29L 4F58H 5HHPA 2VXVH 4YPJA 2KUTA 4NSKB 1P6FA 2GEEA 3QI9D 2JB6B 1PZ5B 3GMOB 4XZUB 4YC2C 4HJ0D 1ZHLA 4LARL 5JW4N 4O5LL 4HZAA 3WFDH 1XF5B 2QSQA 4OGAD 1AR1C 1WC7A 1CLCA 4CADA 3CSBA 1IAOA 2NY5H 5E6ID 4KK5C 2X2YA 5HBBA 1BVLB 5C0GB 4ELMB 3GSNL 4CU7A 1Q94B 1IEAA 2APWA 4IRJC 4FQXD 1RJCA 4IOIA 2JJVA 1BZ7B 3QUMA 1KF9B 1FH5L 3MSPA 5C0ND 3V4UL 2IBGA 3AB0B 3H9SE 2FD6L 4PJIA 1SYVA 4YLQT 2R4SH 3DX9A 3QA3A 5DUBA 5KOMC 3S36L 3MV9B 3B9EA 3GSUB 4OZHE 5C0BA 4RDQG 4XCYB 1MSPA 3AS2A 2X4SB 1PJ9A 3QO1B 5IEHA 3I3DA 5D7JD 1CFSA 3UTZA 4QOKE 1RZKH 3SOBH 5BQ7B 5TH2A 3EHBD 5TF0A 5I66B 1FZMA 4GG6B 5DSCA 1J12A 5TDPA 3UBXB 2V7HB 4RISL 3RNQA 3VRJB 3LN4A 1KEGL 3WFBH 1AY1H 5CD5D 1PG7L 3SBWC 5ITBH 1XF3B 3PF2A 4HPOH 4JRXD 1KBGL 4ZSOA 3C5SB 3I3EA 5B3NA 3Q6FA 3QJFB 2IADB 1DBMH 3T08A 3O41B 1FGNL 4M7JH 5FUCE 1YPZA 4LBEA 5D7LD 4JQVC 3IRZA 3TYGL 4L8BA 3L1OH 5J1TC 5D9SA 3VXSD 5IT2L 1TVHB 5DUPL 3D85D 5DUMH 2B2XH 2FO4A 3RUGA 4BK4A 4F8QA 3STZA 4U1GC 4IRZH 1RZIA 3T77B 3MREB 3BPOB 3C60D 5MEQA 4O51B 3DETD 2JELL 4F33A 4OTXL 2VMFA 2BNRD 1YN7A 1WIPA 1MF2L 2AXGA 2BSED 4P4KC 3ARFA 5IMLB 2VR9A 2DQGH 4LSUH 4NC0B 3SDCB 1RFDH 3TP4A 4M8QA 3LKOA 3DO3A 5B38A 1H0DB 3CSYB 2QSTA 1EHLL 4X0KA 1I7ZB 5EA0H 2I5YH 2E8ZA 2YD9A 1S7WB 4LL9A 1CU4L 4CNIA 1FSKB 3M17A 5E6IA 5AWNL 1Y6MR 4ZFFB 4NWUL 5K9JH 1I1RA 5HGGS 3BPNC 3KLHC 2C4FU 5KZCD 4G42A 4X5LA 4AT6A 3O8XA 3HZYB 2J8UB 1X5FA 3HHRB 5FCUH 5D7LE 5AZ2H 3D0LB 1LEGB 1L9NA 1KPRA 4PYHA 4N0FA 4CJ0A 4WI8A 1QPXA 3VXSE 5L88H 1KGCD 3OXSA 3MODH 5MENE 4K9EH 2PW1A 4L8DB 4JO3L 5F71A 4FQCH 1JZ8A 5D7JA 1J87A 1ZT4B 1ULVA 2AEQL 4GQPH 4OQTL 4ZFGL 5T1DL 3VWKA 1DFBL 5DO2C 3LKNB 4LPXA 1Z9SA 1R3HB 3EO0B 3MRCA 5JW4R 2V2WA 4PUBH 3D18B 5JXEA 3ARBB 3PL6A