3QXTA

Structure of an anti-methotrexate cdr1-3 graft vhh antibody in complex with methotrexate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
molecule keywords Anti-Methotrexate CDR1-3 Graft VHH
total genus 31
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxtA00
1NDMB 5DJDB 1A1NB 2APBA 3R06B 3P9MA 4MD5B 3C60B 4I48B 5EOCJ 3UJJL 4KKAC 2F5BL 1Q0XH 3HNTL 1NC2D 5F9JB 2ORBL 2R1YA 4X6EA 2Z4QA 5CEYA 3NA9H 4QXUL 4TSBH 1C5DA 4K8RD 2BVTA 4HMCA 3O6LL 1RUQH 2X4OA 3BJLA 4PIRF 2IG2L 2Q87A 3N50A 4D3CH 2VLRE 4BSWB 3R0NA 5FDYA 4JY5H 3VXOB 4RX4D 2C7UA 4QHMB 3WXVH 5EBWA 1JF5A 2Q7YB 1VGEH 2D0HA 3TCXA 4IHOB 5C08E 1JI1A 4W68A 5AYUH 3JBG7 4ZOCA 3D39B 5A16B 4B53A 3MJ7A 5FM8A 1WCBB 2R69L 3HZYA 1JJUA 5I1KH 3HNSL 5I8CA 4U6TA 4GW5A 3V9FA 4CAGA 5A43C 2NY5L 1MSPA 3ISWA 4L9LA 1YYML 3RVXC 1ZMYA 1KCRH 5TE4H 4QO1A 1PGRB 1TXKA 2IH1B 2XYCA 5GGRA 1EBPA 1JZ3A 2B7DT 2I25N 1T83A 4L4TA 4F7CB 4Y19E 2GYSA 3HFMH 4LCWA 3JV5A 4KK9C 2Y06H 3DGGA 1DZBA 4Z7QF 2FB4L 3R8QA 1KJ2L 2BVOB 4QXTB 4PP2A 4OCNC 5BQ7A 3B5TA 1V8HA 1DE4B 1EFQA 2P7TA 4AEIL 3WIHH 3SDCD 3TO2B 3S9DB 5FKAB 1KULA 4NC2B 4BQ8A 4U1SA 5BZDA 1FBIL 2NY4C 4WNQA 2YPVL 1YDPA 4EUPA 3PP4L 1LD9B 1R0AH 4FQXD 1F3DH 5DRWB 3SE4A 4S11A 3FB5A 3T0EC 4U2ZA 3O2WH 3D18B 4I9WE 5C0GA 4GW5B 1NUFA 2D31A 3F7PC 1HSAB 1DQJA 2YS4A 5E6IB 1FV1A 4ZAKD 3TA3D 3KDMA 1U58B 3JWOL 4CN1A 3BGFC 4LVEA 4G3YL 1FFPA 3Q5YA 4TVPD 5K9JH 4HS6A 2Y1VA 2R2EA 4EVNB 4RBPK 3E0GA 4YX2H 1R3KA 1N2RB 4P9HH 1YPZB 5DD1L 5I16B 1D7FA 1U3HC 1FL6A 4Y1AD 4YR6A 1FGVL 1BQHG 5CIPA 3HB3D 4O2CA 3I9GL 1VFUA 3W5MA 4X9FA 4PRHE 1JPST 4MAUH 4WV1C 1V5JA 1HKFA 4ONGL 2DLEA 5H37G 5IESH 3UJIL 4JEGB 4KKNA 2V5MA 2I07B 4JB9L 2DM7A 4K55A 2ENYA 4XRCB 4WU7B 3UTSE 4XNQA 4I3SL 1BOYA 1RK1B 5ACLA 5GHWL 5IT2L 3C6LD 3KPMA 4OZGE 2G5RA 1C7SA 4LCIL 1D6EA 4LCCB 2A74B 3DXAD 4P3DA 3C5SB 1ZSDA 1BLNA 4IRSB 4NYLA 4FMFA 1RUQL 4LGRB 5DJXA 5D5MF 2DM2A 5J7CC 4ZUVA 1TPXC 4XCNA 4LNVA 3QFDA 3TCLB 4X99B 2GFBA 2OR8A 1IAIM 3IGAB 3PV7A 2M26A 4K2UL 3H8NA 2NR6D 1JNHB 3SDDA 1YYLH 4FZ8H 2A0LC 1IC5H 1BFVL 2IAMD 4P3WA 4YWGL 3MRMA 4MCZA 3NIFF 2P44B 1Q94B 4N0YL 4PJAE 1IKFH 1KLUA 5AZEH 2UY6A 1A7RH 1CFTB 5SX4H 2AW2A 4NBXB 4HKXA 3TBSB 5C0EB 5HDQL 5I2IB 3RKPA 4E41A 3UJIH 4X6DE 4L1HA 4Z7NF 4XBEH 5DJYA 1T03L 3QNZA 1DFBL 4HFUL 3I9GH 4MB3A 1VEMA 1ULVA 4Z77B 5LAXA 1HXYB 4Y19B 5DK2B 3S34L 5I1GL 1YQVH 4LKXB 3T0EE 3UBXB 4ZUWB 4IRJC 1OPGH 2Q7NA 2DIAA 3K46A 1NC2B 1Q9WA 2Z93A 3KJ6H 3QEHA 4R0LC 3KNBB 2GFBB 3C60D 4X8XA 4PRPE 1REIA 1XCQA 5L2KA 3IRPX 4N1EA 5HGDA 4FP8H 2BHYA 2E8ZA 5CD3A 5FYKH 1NFIA 3RX5A 3B6SB 3OJVC 3MLTA 3ZKMD 3FO1A 5F3HA 3PWLA 5GJSH 4NKOB 2AKRB 3SCMD 3MRKA 4EOWH 2G60H 4JPKL 3OV6A 4WI8A 2VH5H 4HZLA 4HQQH 1Z5LA 2H41A 1J1OL 4BZ2L 5DJYB 1AE6H 1NGQL 5DJ8B 3P40A 4F57L 3VH8G 4HIHA 4P4KD 1MFAL 2E9WA 2YBRB 4PS4H 4RAUA 4Y19A 3FT3A 3QIWB 1XR8B 3RKDD 5DHVA 4KHXH 1I7UA 5E00B 4MJ6A 3IKCA 3LVEA 1AD0B 2DQEL 3FMGL 3PDOA 4FQCL 4HT1H 5E08H 4I3RH 2Y72A 1TZGH 3AU1B 1P84K 1AH1A 4R3SA 5HGDB 5KAQG 3O4LA 5HYSB 5TE7L 1KN2L 1TETL 1J8KA 3C6LC 3W5NA 2LTQB 4OKVB 4LEOA 2HT4C 3C9NA 1L7TL 4TOYL 3RBGA 1NGWB 2CJUL 4RGNE 2OTUB 1Z5LB 1N8ZA 3U46B 4C4KT 1CI5A 1FSKC 5DJ0B 3MV9D 4FP8L 2JK5A 5GGRY 3FQRA 1KACB 1ORQB 3EYVB 2GQHA 4I77L 1KB5A 3WSQH 4MNGA 1BQHA 1CVSC 3CFCL 3SE9L 4ZO7A 2YPLE 4Z0XB 1BFOB 1RHFA 2Y25A 4OB5H 5IVZA 3UBXG 4LSPL 1E4JA 2B4CH 4U7MA 1MUJA 1EEZA 5HBBA 2BVPA 3HHRB 3O3AB 3RWDB 2I07A 3IDMA 3MBEB 2ZCLH 1DEDA 3B8YA 3TESA 4KJYB 5JO5B 4IJ3B 2D4FA 4RA0C 1PZUB 3TP4A 2V2WA 3QXAB 3U0WH 3IJSA 3F12A 4OLWH 1SBSL 2YA2A 2DQIL 5ESVA 4PGEA 1LO5B 3P0YH 3LEVL 3BPNB 3RWFB 1CR9H 2AEQL 3CCHA 4JN1H 4KTYA 1KEGH 3EOBA 5SWZB 1N6VA 4ODBD 4TSAH 5EBLA 1FN4A 1MNUH 1N4XH 3OKKB 4FQJH 1UA6H 4AEHL 5MHSD 3SBWC 1NBVL 4WO4D 1KSRA 3TH3T 2BJML 1JNHA 3GFUA 5GGTA 1KIQB 2B4CL 5I17B 1MREH 4JY6B 3BDYH 4HK3J 5E5UB 1GOHA 4GXUN 4P0DA 2DM3A 3O6FB 4PJCE 2WIIA 3IDMB 3MBEA 5D2NC 5GS3A 2PXYC 5DJZB 2J6EA 3T09A 1SM3L 4P4RA 3Q6FB 4HUVA 1F4WH 4RGMC 4HMDA 1QR4A 1LDSA 4M62H 1UXWB 1ZK9A 1KB5L 1I3RB 4APQD 4NZTH 5DSCA 3L3JB 1ONQA 3MLXH 5CBEB 2GAZB 1YDPB 4EUPB 5IR1B 4F7TA 2DQEH 1FORH 1U8IA 5H37H 4WU5A 1JNNL 1MIEL 3L3GA 4OUUB 2C9AA 3B6SA 5CD5C 4P59H 1D5ZB 3ZT5A 1JGLL 3LDBC 4GRLB 1T1ZA 3AXLB 3IDXL 4DWHA 4JFDE 4EDWL 3FFCA 3I6LE 3U1SL 1KGCE 4LCWE 4MXQD 4L4TD 1V3MA 1FNGA 1MVUB 3BH8A 4LEXL 6FABL 4NHUA 2BSTA 4X6CA 3DVIA 3PNWA 2G60L 1S7SB 4P2OB 2UWEF 3MXVL 1NCDH 3EO1A 2EKSA 5ANME 1AGDA 2IC2A 1QLFA 4O9HL 1HHHB 1Q1JH 3GMLA 4Q6IA 2AJVL 4XP1L 2CUMA 5D1ZC 3RAJL 4Z7WE 1B4JH 4M1DL 2GAZA 5JXAL 2PTVA 1NDGA 4PJHB 4TUOA 4MXQC 5EU7C 5IEHB 1A22B 3NGBB 4AL8H 5C0FA 1A9EB 25C8L 5C0NC 3LHPL 4XNXH 4U1MA 3A6OA 3WO3B 2BVQA 3RWEB 1KC5H 1VPOL 3MLYL 3O3BB 4XBPA 5H2BA 4IHOA 5HXMA 4FRWA 2HVKB 3SE3C 3L95A 2ESVD 4RDQF 3TT3L 1ZE3C 4XVTH 3QUZA 4UTAL 1NAML 4NQDA 1ZVSB 3GDBA 3QHFL 3DVNB 1A14H 3RL1B 3H7BB 4OJFH 3RHWF 4HMEA 3OKLA 2C1PA 3WLWD 2ATPA 1N64H 1T04B 7FABH 1A2YA 2EE2A 3H0TB 2ZG3A 4OFKA 3IFNH 2PXYD 3K1KC 3TH2T 4J4PC 3CLEL 35C8H 3IDJA 2HFTA 5DQ9A 2YUZA 4WTZG 1T0MA 5HYFA 3LQAC 5HPOA 2NZ9C 1G9ML 2CRYA 4G5ZL 2IPUG 5FO8B 1QFPA 4I77H 4LHUD 1A6ZA 4YHNA 5IFHH 4OD1L 1JV5B 1BWWA 1G9NL 2F19H 1ZT4B 2EEDA 3ARDB 3NBNA 2E6JA 5INDA 3MBEC 3FT4A 5D2NA 1YNLL 3VXUE 4MA8L 1JTTA 4Y4FC 5L2KE 4NKIH 5GGUB 3X3FH 4WGWB 3FT2B 5JA8B 4YAQA 4QRTB 2OR7A 2R2HA 2FECL 2KZ1B 5D96B 1QKZH 1QO3B 3FN9A 3C8KA 3H42H 1YPZF 2X1QA 3QULB 4G6AD 1WBZA 4Y4HD 3S5LB 4NKOA 4Y4HA 5DHXB 5I1DA 1BQLH 4UINH 1R24B 1FSKB 4JG0L 4YHPA 1KJVB 3PL6A 1EJ6A 4JM2B 3MOBL 2AJ3A 5L6YL 1FH5H 1K5NA 2BNQB 2N1KA 2NY0D 3ECBA 5T3XH 5JW4M 1EZVY 4QF1A 2XTJC 1T0PB 4QOKB 4Z7VF 4C4KO 4OCRL 2YPLB 5DC9B 1S9WB 3D85D 1KJ3L 1NPUA 2MPAH 2YD8A 5INDB 1L7IH 4IMKC 1PBYA 1S7TB 1I1FB 3D0LB 4CU6A 3CDCA 1LO2L 2NPLX 1XGRA 5EO0A 4BH7B 4F7TB 4EKXA 5E9DB 1C1EL 5BRZE 3QUXD 1SM3H 3MV01 1Z9LA 5I8KH 5JPNB 2DQUL 3MRCB 5J6HB 4M1CC 3QB7C 2X40A 2FO4A 3MFFB 3T65B 2NY7L 5JMOC 3GHEH 2NLJA 1WBZB 3QAZB 3S5LA 1CFTA 5C0EA 3NN8A 4PJFA 1MFBL 3I02A 1KCSL 3H3KA 4FFWC 3VFUB 1JZ6A 4JDVB 4PR5A 2Y6SC 1DBJL 4IEFB 1S78D 1GOFA 3FQTB 1H3XA 4N0FA 1KGCD 3MOAL 2P5WD 4X99A 1NBZB 3QYCA 5FO9A 5DYOA 1CZ8L 3EO1B 2PO6D 1UWXH 3DX6A 4PJ5E 2ED9A 4ZS6D 3ZT7A 5AWNH 3ROLA 4QHKJ 1PSKH 1T66D 2VZ3A 2AEWA 5DJ6A 5D7LD 4ZSOB 1HSBA 5KVGL 3WE6B 2Y7QB 4MA7L 5IVXE 3GSUB 4WI3A 5ETUB 2Y36H 1AI1H 3QDMD 1QUNA 4PRID 3PGFH 1QHPA 3REWB 2AJYH 2WBJB 1MY7A 2D31B 2E8YA 2ZUUA 1KN4L 3VE0B 4I4WA 4H8WH 1AFVH 5DUML 4DKAA 1T2QL 5FDWA 4UOJA 5DS8B 4DGIH 4PJEA 3UC0L 3BMVA 5J4MA 3CSGA 4JLRA 1QBMH 3GSQA 4G8FA 3AMKA 4MGXA 2C4XA 4JFDD 2O5YH 1JRHI 1QVOA 5A2FA 4JRYD 3T4AA 3MTRA 4CJ0A 1F11A 2AQ3A 3PL6C 3NCYP 2VDKL 4H8WL 2IPTL 5DUMH 5L2KB 3C09B 4FTVE 2AK4B 5C0CB 1JGVH 5HHOE 5JMRA 3V0AC 4R26H 1CICA 1VDGA 3GJEA 1K85A 3BWAA 3HC0A 3G5VB 3KJ4B 3O6ML 4O4YH 3SGJA 1RK1A 1FFOA 1XF2B 4AT6A 2NY2D 5TE7H 1IGML 3U79A 4LHUA 1S7XA 1IM9A 2IPUK 5CP3H 1PG7L 3NFPA 1FYTE 3BZ4A 4UT9H 2ITCB 1WLHA 25C8H 1T7ZA 2A6JA 5I75C 3G6DL 3BAEL 1VENA 1CU4H 3EW3B 3PDGA 5EU6A 4XGZB 3TVMA 5EC2B 1WCBA 3MLZL 3SGKC 1HNFA 3X3GL 3AU1A 5F7NC 5JXEA 1ZLSL 2FLBT 2JCCF 4MA1B 3L5XL 1AIFB 1Q0YH 3S7GA 5LQBL 3CX5K 1T1ZB 4F8QA 3K7UA 5C0IA 5F7YC 1OM3L 4NT6A 2WBWB 3F7YB 4JFQA 2Q3ZA 4P9MH 43CAB 4P2RE 4Q2ZA 3UYPA 3Q5TA 4F7CA 1AC6A 4JANB 2A9NL 5ANMA 1ZGLA 4OV5B 3MV7E 4HXAH 3TVMC 3WNOA 5DRZB 1MI5B 2NXZB 3BZFB 4NC1E 5E2JA 3CFIC 3O6KH 4HIEA 3ZT6A 5E2WL 1LO0H 5HI5D 4CNIA 4L4VD 3GI9L 3G08A 2ARJA 4X9GA 3ZYJA 3U6RB 3H7LA 4HZAA 5F9WB 1U92B 2HJLA 1I8IA 2IQAA 4WNQB 3TBVB 3SDCA 3VFMB 4ISVA 3BZEA 4BH7A 1AHWB 1RURL 2P1YA 1IGMH 5AUMA 4Q9QL 3IVKA 1OL0A 3V7AE 3IU3A 3OHXA 5I73B 2FGZA 1W0WB 4TNVK 2L0DA 2EXYC 4NO2B 4RISL 1XGQA 4KWUA 1SMAA 5C09B 1QRND 2Z92B 5E5MA 3M17B 1MPAH 2ED8A 5DWUL 2CKBH 4E42A 4XVSH 4P99A 1SYSA 2C3GA 3PE9A 2PCPB 4G6AC 2F5AH 1MCCA 1T0NB 1ZHLB 2WAHA 3DV6B 5FB8B 4NRYA 5E8OB 1OQXA 2QADC 4DOHE 3EGSB 2UWEE 2DWDB 3STBA 3ZDXF 4RFOL 4HIXH 3H9SE 5FCUL 1DBML 3X11A 5C86A 1CDYA 4HWBH 4OCYH 4TSAL 3BW9A 4YE4L 1CXEA 5E2TL 1WV7T 1TVBB 2HRPL 5ISZB 1Z6JT 4P4RB 2CO6B 3BD3A 4Y4KB 5IW1A 2A6KA 5F89B 4XMKL 4OT1L 5IMOA 2ZNWA 1FZKB 1M05A 3QSKB 3RDTD 4YDKL 3VFGL 4MQXC 1WZ1L 1AY1H 2A83B 5T33L 4HSQA 3U7AA 4GG6B 2VLME 5IB2A 4Y4FA 1FIGH 2D7PA 4MNQE 3OR6A 1DBAH 2X7LA 2ZUQC 3V6ZB 4BQ9A 1K8DB 1I4FA 5DD5L 4CADB 3HNVH 4NO5A 5L88H 1AR1C 2CH8A 1QSFE 3P9WB 5FF6B 1CFVL 1WWBX 4MCZB 3VJ6A 4HW6A 4NM8H 5IF0B 1DBJH 2VAAB 5EC1B 1JZ7A 1NJ9B 4P5TC 3V0VB 2AJZA 1N59B 1VFAB 3TNNB 4FQQA 4KJYA 3VWJB 1GXEA 1WK0A 1JVKA 3SDYL 5BXFB 2VISB 5KZCD 3WNPA 1SJVA 1HH6A 5DK2A 1JYVA 1QEWA 5K59E 2GUOA 5KOVC 2VDPH 3HE7D 4LDEB 2GSGB 3GSNB 1B4RA 4PJBB 1TETH 4HS8H 4BZ1L 3FB7B 5HVFB 5DA4A 3BO8A 2BNQE 5B4MD 1FFRA 4GAFB 3L7EA 3JXAA 1CWVA 4A6YL 4YC2B 1IGJB 5ICYA 3SE8L 5JHDD 1QZ1A 5BOPA 4YHZH 5L6YH 4EI5C 2VLLA 3DVNA 4GRWB 1FV1B 4N5UA 5IHZB 4HS3A 1YMHB 3ARTA 1S7WB 2X42A 4GKOA 4K8RH 1F6AA 1F97A 3PL6D 5IKCA 5ICXB 3MNWA 4F57H 4LU5L 5E4EB 1R3KB 4ALAH 3PQYB 4KXZH 1MQKH 2AJXH 2DMBA 4JPVL 5I1EL 1B0GB 4X9HA 1HH6B 2UY7A 4Y16A 2OMBA 5BJTB 3PHSA 3HE6B 1ACYL 4PRIE 3SQOH 3DX7A 3IXAB 3JWDH 1I8KB 2ARJB 4X6DA 3WXWL 1VGEL 1FNHA 4IDJH 2VLKB 4Y5YA 2EC9U 3QQ4B 5FIEA 4CU8A 4OGYL 5MEQB 4JKKA 2LVCA 1KLFA 4AYFA 2D03H 4C56E 1MHCB 4JHAL 4LRIA 1MLBA 4QRPA 3CLEH 1JGUH 1CLZL 3ILPB 2IADB 2O5XH 2H9GB 1CT8A 5FAAA 5SWSB 2MJWA 4G8EB 1IMHC 1ZS8B 2R4SL 1ZEAH 3ARFA 5M95B 4DK3A 2MCPL 3BD5A 3JZ7A 4NHUB 1NBYB 3WS3A 5EZJA 2WINB 1T03H 1ZWIA 1KPVA 1K5NB 3WIHA 4KJQD 5F8RC 1GC1H 3TCLA 3LEVH 4PP2B 2W0KA 1U8HB 4ODHL 4JO3H 3ARFC 1T22A 5BS0E 3PGDB 4IMLA 1A3LL 4WY7L 1INDH 1JZ8A 1VFBA 3BPOC 5JORA 3DX9A 1EVUA 4K23H 1MFEL 3BIAX 1LD9A 3UYOD 1GGUA 4QRSA 2CXKA 2RFXA 3GMPA 4XCYA 4HH9B 5KVDL 5MEOB 4NQTA 1MCIA 1SY6L 3QHZL 4R0LA 3D48R 5DF0A 1M7DB 3B2VH 3KPRA 4OCMC 5DURB 5J6HA 1H8NA 5DR5H 3RIAK 1IGCL 4EEEA 1WFOA 2X4QB 4BJLA 3HI1A 1OGAE 3P4MB 2PYED 3U2SA 5LXGH 5CIPH 5EZJB 1LQSR 1D6VH 2XN9E 3C8HA 3K2UH 4XHJD 1D5MA 2V7NA 2Y5TA 4Q74A 4YIQA 5E94A 3UJTL 4JFPB 3V5HB 1KELL 2WUBH 1XR9B 2F8XC 5TQ0H 3P0VH 1GZPA 4P5TB 4XZUB 3V2AR 1TQCC 1HKLL 4GW4A 3FZUC 4NGHH 4HLJA 4H0IA 1CLYH 3PWNA 2OK0H 4W81A 2XQYG 4M48L 4AQOA 1ZT1A 4LIQH 4OFDA 1DQLH 4NQUA 4ENEC 5HHPB 4OFPA 4DKEH 2Y07H 4NRXA 2HTLD 2H8PA 1FE8L 2HTLC 1PY9A 4I5BA 2VSCA 2HA1A 4DQOH 3QCTL 4H26A 4Y4FD 1MAKA 4FG6D 4D8PA 4TVSa 2VYRE 5HJ3B 1MCBA 2QADD 3ZDZF 5E70A 5EO1B 5DMIH 3T77B 3TGXA 1F13A 4PJEB 3IJYA 3S4SG 3RZWA 1W72B 2V9RA 4XH2A 1ZAGA 4PV8B 1P6FA 4RMUA 1IAIL 4NN7C 4P23B 2X05A 4WHYG 2OSLB 4RGNB 1LK2B 3V7MA 1ZVYA 3FTGA 2HJLB 2IQAB 5ITFB 4OSUH 4ZFZA 3KYOA 3S4SB 1FL3B 5GQBA 3ARBB 3GB7B 3HLAB 1MEXH 4XNUL 3MX0A 1F58H 3EFDH 2XG4A 3QO1B 2CDEB 1P53A 4PJ9A 4E41B 3L3HB 4N8PA 3GSVB 2MMXA 1T6WA 4LVHC 5DJ0A 5E2VL 5B8CC 4ELMF 4E42B 2OJEA 3C6LA 1FYHB 3CZFB 2M8XA 3L6FB 4PJXA 4NO3B 5HHMD 1I8KA 2N7AA 1G9EA 2Z93B 1ZANH 1DUZA 4XI5D 5BZDB 4KJQC 4KRNA 4ZUSB 4R26L 5HDLA 2BERA 5HSFA 1DCLA 1QFUH 2EDRA 4D2NA 5DK0A 4I13B 1ZLUK 3O4LD 4GW1A 3ARRA 1QBLH 1UH4A 4P2QD 5F9WC 5DLMH 1IQWH 2CRMA 2W0FA 5J11B 4PGCB 5CJQL 1IL1A 3BESR 2DICA 2BC4A 3L3HA 4ONHB 1NFDF 4JFQB 3V8CA 5SWZA 5I66A 3KPNA 1NKRA 4JFZH 2JCCB 4OM1L 5ESQA 4FQ1H 2NW3B 4OB5L 5ISZE 4F9PA 4JDZA 4M7LH 2ZKHH 3I2CL 5GRXG 5IMLA 3CXHJ 1LK3L 4ZAKC 3CU1A 1T2QH 4HEPG 4PYHA 4CADA 1CK0H 2R4RH 3FB6A 3D2UB 2DIBA 5D7IA 2EH8H 3L3OA 4Z7WB 1NQBA 3SOBL 2PW2A 1ZHKB 3RZCA 3WE6A 1F3JA 2IAND 1NJ9A 4JB9H 1JPGB 2HLFC 3N0PB 3ULVH 3DHMA 3TO4D 5CZVH 3JWOC 5EIIB 2P49B 3AFLA 4Q9QH 1OD7A 3KPMB 1RZKL 2OI9C 3PQYE 1I7RA 5ALBH 4M43H 4I4WB 1JHKL 3I50L 1G6RL 5IW3A 1RMFH 2ITDB 4L3CB 3FOMB 3V7AG 3L7EB 3VG0H 4Y16D 2VLKE 3WL9A 3NCMA 1JZ2A 4L4JA 4YBQC 3FCTB 3IF1B 4LSVL 3MNVA 4F9LA 2HLAA 5LKNA 4KKBC 1A7BA 4GSDL 2H2SD 1DR9A 1WICA 2VH5L 2H45A 3ZKSD 3QH3A 4NO2A 2AQ2A 2XWTA 4K71B 1CDJA 2W1NA 4JM4H 3SGKA 2D9QB 2VC2L 3VFVB 1EHLH 1KJ3H 2F54E 2K7PA 2MPAL 3DGGB 5A2JH 3GSWA 1Y18A 4XAWL 1SHMA 1HOCA 3MSPA 5DD3H 3BZ4B 1LNUB 1M1SA 3IRZA 5DT1H 2CRIA 3WEXB 3KYMB 4JQVC 4GMSH 5D7IE 3QJFB 3INUL 4PLJC 2YEZB 5E8OA 2BNRB 4OZFG 5JR1L 1AQDB 2GTZB 1YC8A 2DQDL 3MRRA 1J1XL 2GK2A 3AVEA 5ITFA 4OF5A 4Y1AA 4M1GL 4OZHE 2D7MA 1YYMH 4M8VA 1N5AA 2EYTA 4U1IA 5KANI 1U3ZA 1GH7A 4GG6F 3IKKA 2V9TA 3HC3H 5EC1A 5LCVH 4V2CB 1M71A 4J1UA 4K7FA 4P23D 4GKZB 1MF2H 2IBGA 2JB6B 2GITB 3K1DA 4MAYB 3TT1L 4KDWA 2CLVB 1EX0A 4FQHB 3EYSH 1X5JA 3QDHA 1QSED 2X7LB 3CK0H 3P4NB 1A64A 2I27N 1G9MH 3I2CH 4XPGL 4ORGB 1LNUA 1I7UB 4MX7B 3SDAD 1ZVSA 3BP6A 2W0PA 1JI2A 4HPYH 1OLZA 3QUMB 2EDHA 2VKWA 1AO7E 3GI8L 1MJJA 2F5BH 3BH9A 2RFXB 1IBGH 4S2SA 1A4JA 1PX3A 2X1PA 3EDJA 1T1XA 2IFFH 3QUMH 2NY2C 3MRNB 5EUOA 3MRBB 5F9AC 4JRXA 3QI9C 4GKZA 5SV3A 4UNTA 4U7KA 1NMBL 4XVUD 1FAKT 4JCLA 3QFDB 4PP1D 4PJFF 2ZCKL 5BS0A 5C9JB 3GSNL 2MQ0A 2HTKC 4Y0GA 3UO1L 4D9RE 3SGJC 3SJVE 1UM4H 1FZJA 5E8DL 4DTGH 5L9DL 1IAMA 1KENH 1E4XH 4Q0XH 5IHZA 2OI9B 3O9WD 4WV1B 4QRUA 3SKJL 4AT6B 4PGBB 3OGCB 4QNPE 1S5HB 5D1QC 5HGHB 1NCDL 4JRXB 1EGJL 2EDEA 1NL0L 4ZUWA 4TUJA 3DECA 3T2NH 2HKHH 4PV8A 1FNAA 1I7ZB 2VDLH 4G8IA 4GT7A 5FKPA 4L3CA 3BGFB 4RSVA 1AD9B 5TDOA 4GRWH 1HEZB 4JFFB 4U1LB 5I16A 3QDME 3JUZA 1L9NA 3FHQA 3IDXH 5E6IC 4KROD 3GSOA 5GS1A 1NFDA 2XIDA 1RUKL 1IFHL 5IB5B 2XZAH 3BSZH 4I0PC 4XMPL 1U8QB 1YNKL 3IETA 1MRCL 1U0QA 4KVCL 1C08A 1A6WH 4IOIA 1OB1A 4DZBB 1F8TL 5SWQA 1G7JA 4N8VB 1KBGL 3GSRA 3IFLL 3GSVA 5C2BH 2VABA 3LKQB 3MV8B 3VWJD 5F7EL 1AKJB 3ZKXC 3MROB 5I9QB 3PQYD 3GM0A 2HJFB 2R0LL 1A6ZB 3VFWA 4YHNB 3BP7B 1QRNE 3OAZH 3QXTA 1G9NH 4KRMB 4M5YH 2NY3D 5BRZA 3BI9X 2IBZX 4IRJD 1OGAD 1P7QB 1MAMH 5C0BB 2ZCHH 4KDTC 4YPGB 1SY6H 4ZTPL 1PAMA 1EEYB 4ESKA 4QXUH 4TSBL 4L8SC 2QHRH 4PRBA 1R3JB 3IJHB 4I18B 3PUCA 1C08B 4TRPL 2HKFH 1U8KA 3RKDC 2B1AL 3O2VH 3ZL4H 3IDUA 4XC1L 4OLYH 4G9DB 4OZIE 1A14L 3MV7B 5HYJE 4WY7H 3FO9A 4LSQL 3EDKA 1TITA 2VABB 1NAMH 1D5MB 3WLBB 1CLOL 1HQ4B 4DKDC 2DLIA 3RL2B 4JRYA 3VFWB 1E27A 1JIBA 1EJOH 2V5RA 1GZPB 4X80H 3ARSA 4UDUA 1D3CA 4ZOEA 1P4LA 2DLTA 5IOPB 1LK2A 2Q8BL 4KJPD 4U05A 4LRIC 1A9BB 2FX9L 1EZVX 1HH9A 1YY9D 1TJIL 2GHWB 3BWUC 4MJ2A 3UYRH 2YHGA 1CYGA 4G8GD 4NJAL 4JRXD 1HILA 1MCLA 2AERT 1ZV5A 1U36A 3CFCH 2PTTA 3WSQL 1KT2A 3PHOB 2AKRA 1S9VB 5IMOB 4R2GD 5IG7A 1MCEA 4BFGA 1B4JL 1EUTA 1QSZA 4FQXB 2MNUA 2QTEA 4LSSH 2OZ4H 4Q97A 1EMTH 4P2QB 2YRPA 2OSLA 1QFHA 1XF4A 1ADQL 2J4WL 4Y5XC 5IVXF 4WTZA 2EYSB 1KTDA 1YY8A 4Y2DC 3TJHD 4L8BB 4J4PA 1EFXD 2BVYA 4MCYB 3TPUB 1XFPA 1NMAL 2VSDA 2VLJE 4X6FA 2FR4B 5EO9B 1GOGA 3LQZA 4OZFA 5CSBA 4P5TD 1A2YB 4FQCH 5CJ8A 4NQXA 1LO3H 1RFDH 3GNML 4JFOB 4HWZB 1BJ8A 1RJCA 5D8JL 5C7XH 1YMMA 2ESVE 4Q9RL 4OKDA 3QFJD 32C2A 5I1HL 1MCSA 4G7YL 2NCMA 3FN0H 3QEQE 4PGCA 4KK6C 5BO1L 5EBWB 2LQRA 1JF6A 3MLXL 3T3MF 3KPPB 1ZA6B 5E8EB 3O45A 5EUOF 4PGJA 7CGTA 4G9FE 5I18L 1GC1C 4ISVB 1YNTA 3BZEB 1Q9LB 2O93L 1CCZA 4P4KA 4R3SB 1HHKA 4HUWB 1NANI 3RUGA 2FX8L 1EEZB 2BVEA 3WIFA 3QULA 3QWRA 2BY2A 1KF9B 3MGAA 5B21A 3FFCB 1JPTH 3DROB 2ZOLA 5KSBE 2DI8A 1T2JA 4PBVC 2DDQH 4UOW0 4YHOL 1ORQA 2QV2A 4L3EE 5C9KA 2D9CA 5JOPD 1MELA 2ADIB 1NC4A 2OXGA 1OGTB 3NFPB 4OUOA 5FOJA 4ORGA 2APXA 3WJLA 3G5XA 5F9OL 4LARL 4Q9CA 4NCC1 4KVNL 2I9LB 4NFCA 4UB0H 3N1FC 2JIXD 3RZCB 1EGJA 2CGRH 4DW2L 5IMMA 4NZUH 1IC1A 3K8MA 4KTDH 1KCLA 3QJHB 4M6NH 1G7IA 4TVPL 1OAQH 2YUVA 3DTXB 1T20B 3B2UD 2E7HA 5CJBA 4G80A 3U0PB 2NMSA 1C5BL 2EZ0D 4FTVA 2F74B 3WHE1 2FEEL 1UKSA 1H3PH 1HDMB 3DMMB 3NCBB 4PJDA 3AS1A 2W60A 1G6RA 5CUSL 4FXKA 3FOMA 3RIAF 2J6EL 3F62A 3VH8B 5FUCC 2VXQH 2OJEB 2VB5A 2ZUYA 4HIEB 2VJXA 2XA8L 3SQBA 5DUPL 5FYJU 1FQ9C 1FFQA 1DUYA 5I1JL 5DWUH 4O2CB 2WW8A 2UUDH 5MEND 2W59A 3QUZD 1T21B 5DJ6B 3IU4H 4JR9L 4ZDHA 5CAYB 1K3IA 3SY0A 1KIRB 5KSUB 4R4FH 2UWEA 1TZHB 2V17L 4C56B 4Y1AB 3MACH 3KR3H 4XTRC 5L0QB 2AABL 3UTTB 5GSVB 5TGBB 4EXPX 2VDOL 1T89C 4U4BA 4HWEH 3P9LB 2CKBA 4XNYH 2ATKA 3VXOA 5KSVB 4PJ8B 5F88B 5C8JB 5GS1C 3RP1A 3QPQD 3BN9D 1TCRB 3OB0K 4F58L 2RR3A 2W60B 4KK5C 3W9DB 1ACZA 3BO8B 4QTHA 4TTGA 1DQQA 4N0UA 3QZWB 1K6QH 2MKLC 3RY6A 1DSFH 4MNGB 5ICYB 1J8HA 5MEPA 3WIIH 3OR7B 1IT9L 5C0BD 5IB5A 3GJFB 2H1PH 1RU9L 5AD0B 2H2SC 1CDBA 4GRLA 3CDGB 3TEUA 2UWEB 1R0AL 2YZ1A 1J05B 1A7QH 2DS4A 1Y0LB 2G75A 5C0RH 3LN4B 5ACMA 3OBAA 4IOFC 1FNGB 2BY1A 3CJJA 3UTTA 2IANB 4HBQA 1T1WB 2QSCH 1TPXB 2NY0C 5ISZA 1YMME 4CMHB 3JWDC 1A6TB 3ARPA 4MQSB 5EBGA 5HHVL 1P7KB 3KPPA 2ITDA 1IVLA 3CC5B 1D5IL 3MJ8A 1MJJB 5T1KB 4DEPC 1P69B 1XGRB 4NQED 1KCRL 3NZ8A 1T3FB 2R8SL 4NO5B 3CVIH 1F5WA 4HGMA 4HX1B 5ICZA 2JF1A 4LCYB 1FVCA 5TJWK 5IVXA 1JWMB 3HMXA 3KXFE 4UU9B 5HI4C 3QQ9C 2X9XA 4G9FB 3TJHC 4YO0A 3O8XC 4R4BB 1CE6B 3C5ZB 3QG6A 3QI9A 3BQUB 3UDWA 1MHHB 4CW1A 2WQ8A 4OI7A 4PJEE 5FO9B 5GGSB 3MNZB 3E2HC 2UUDK 1RZJC 5GGSY 1S9YA 1YEDB 5CBAA 5EU4B 2QHRL 3QJFA 4RFNB 4PGDA 4WENB 5D1QA 3UDWC 5EIVA 4WFGE 1EIBA 4HJ0C 4UUJB 5F1IB 1A6AA 3FQNA 1CD1A 3K8LA 4BYHA 3IXTB 5AAMA 3KPSD 2AJSL 5IROA 3OX8A 5HVHC 2AJYL 3IU3B 4S1SH 1HHJA 4EI6A 4FZEH 1RZKC 2EIBA 5GGRB 5GRYA 4G6JH 2I24N 2YMXH 3ULUH 5ADOL 1PSKL 1TNMA 4JM2A 4N0RA 2VOTA 1CDHA 4JY4A 3QI9B 3RUGF 4X6CB 1KXVC 2QQLH 4Y16B 1WBXB 3VXSD 4WHYH 4J3OC 1ZLWH 1DUYB 1U2CA 2XV6B 1FC1A 3BRGC 3PWJA 4JAMB 4C83A 1NMCC 4RAVB 4G7VH 3FQNB 4TUOB 3GHEL 3S35X 3S6CA 3ZYIA 4BSJA 3I75B 4DVRH 4OI9A 2YR3A 2DQUH 4OLXL 5CS7A 3NIGF 5IB3B 1U8LA 4ZFOB 3F12B 2W9LA 1M6OA 3LZFL 4ELKA 4NRZA 1B6UA 1K4DA 2IEPA 4DGYL 3HZKA 1YECL 2M2DA 3ILQD 3MLPA 1YUHA 5HPMB 4RMQA 1IGIH 3WIHL 1L7IL 4MQ7A 3MV7A 3BEWB 1QOKA 3SKJH 2CLZA 4M6ML 2AJUL 3P73B 4M8QA 4N0FB 4NWUH 4UIMA 1MIML 5A1AA 1BVKA 1QLEH 3IDYB 4I0CC 2Q8AL 1H3WM 3LY6A 4XCCH 2UVFA 4NP4H 3OAUL 4Z0BL 4NQEB 3RWCA 4C55A 1ROWA 2BMKB 5I15L 4M7KL 4I48A 3QCVH 3TYGH 3LEYH 4C83B 1T04A 3TBWA 3ARWA 3L5WA 2WBJC 3SKOB 4RWYH 4OGXH 4HH9A 1J9CT 4GS7B 4AG4L 3F7VA 1A6VL 1I9RL 4GKSB 4NFBA 3O8XD 2BZDA 5GRJL 4OFYA 3WFCH 4NQSB 1MLCB 1J12A 1GGCL 1HOCB 2X70A 4QTIL 4BSVA 4F7EB 1CFNB 1A6TA 2DQTH 3JTTB 4S1RL 2ZOKB 5CEXB 4UILH 4M61B 5ADPH 2IFGA 4ZO6A 3WNKA 1BLNB 3MV9E 4IRSA 4NO3A 3JV6B 2FCBA 4K71C 1X6NA 3EFFB 1AXTH 3PWUB 1P9MC 1DQMH 4WRLA 4M8QB 1JL8A 2SEBB 2GW5A 1UWEL 5T1KA 3SDCB 3SDXB 3FQUA 4R8WH 5ALCL 5D2NE 2FX7L 4M02A 3X17A 4D3CL 1ND0A 4EN3C 5IEKA 1VKXB 5CJXC 5I0ZA 5C70A 4WI4A 3LSOA 4V1DB 4PJDE 2XZQL 2DI9A 2A73B 4XPAL 4PB0L 1OB1B 3QIUD 2CK0L 4Z7OE 3T1FA 2DLFH 1IZJA 1RV6X 3X14A 2ZSWB 3TIEB 1P5VA 2JCCA 4YO0B 5E5MB 4GXUM 2IAMA 3RWGA 3W9EA 3QIBD 4AENB 4NJ9L 4PJGE 2E7BA 4HKZA 5E4IA 4EZMA 2ZOKA 2XXCB 5CEXA 5IGXH 2W9EH 4MCYA 4IM8A 5D7IB 1OSPL 2EYRA 3O2DH 4P46A 4U0RC 1K2DA 2A6JB 1RY7B 5IM7B 1PQZB 3OXSB 3PWUA 1RK0A 5DQDL 5JZ7D 2EXYD 4N8VG 3DRQB 3S36H 4JM2C 2ENSA 3BH9B 3OKMA 3U36A 1QSFA 4XNZC 4JHWL 1CN4A 5D5ME 3NTCH 5C0GB 1G7PA 5GGQL 4X5WB 5HHVH 4WEBL 1I7RB 4ZAKB 3MLWL 3VWKA 1HHJB 4M7JL 5EU5A 2BSRB 4A6YA 3VFUA 4YDIL 2IQ9H 5GISL 1JWUB 3KYAA 4M6MH 3U0TB 2GKIA 5TF1L 2AJVH 1WC7A 5J13B 3HI5H 4LPCA 4CMMB 1XGPB 4P4KB 4UT6H 1AR1D 3HCVB 4PLNC 1MCWM 4KAQL 5E1AA 5EA0H 3GJFA 1MCWW 1TJHL 2R1WA 4LLQB 2ED7A 4FA8A 3VGBA 1OAZH 3ZE0F 5ITBL 3VXMD 1I8IB 5JQ6H 4ZFOL 3FRUB 4G7VL 12E8L 1EAJA 5LGHL 4O5LH 1QG3A 1WVZA 5CEZL 2P5WB 1P4BH 2VDNL 4F7MB 1MIEH 4FOMA 4JHBA 3WKNA 3C5JA 1QPPA 4XCFH 1NGWA 4GAYB 4N0CC 2YXFA 4QRRB 1JF1A 2VZVA 5I1LA 5EULV 5TDPB 3V4VH 2YD1A 5HHME 3BEWA 4LLMA 4OGZA 3MJ8B 4G6JL 1OAUH 2X4PB 1M7XA 3PGCA 1MVFA 3L7FB 4L8BA 4LLDB 4XB7A 3HPLA 4R4FL 4GMTL 5TF0A 3EO0B 3TZVA 4P5TA 4XZUA 2AK4A 1IGFL 4JZJC 2DBJA 3NPSB 2FIKA 4OZ4B 1BJMA 15C8L 5KSUA 1U8MB 3TBWB 1R24A 4P23C 2BOBA 2Q1EA 4GAGL 5ID0B 1NCTA 2UZIL 2MQCA 4PJDB 5C08D 2F54A 1ES0B 5BV7B 4GKSA 3CGTA 3QIWD 5CUSH 1MCOL 3U4EA 4MJIB 3ARQA 2K7QA 2AEIT 4ZNEA 1OAKL 1F4YH 2P43B 2XFXB 5EU3A 2DQJL 3WFDL 1L0QA 2K3TA 4WI2A 2QQQA 3HZVA 3RWHB 5EZOL 1VGKA 2APTA 2P5ED 1HXMA 2KKQA 3BP6B 4POUB 3D6GA 4X6BA 1OAQL 2WUCL 2BX5A 4OZHB 4POZD 5T1DH 5AZ2H 5MEQA 4KU1A 2FATL 1RUML 1A1OA 2DQHL 1T1XB 3VCLB 3QBTB 1AXIB 1NFIB 1UEMA 2XA3A 5DUBA 3RWJA 1TVHA 2YD3A 1FZOB 1IGYA 1YEGL 1NCNA 4U31A 4L4TE 2W9DL 3TN0B 4JZNB 3BHBA 4DUVA 2C3WA 3S37X 1B6DA 3QZWA 5JIHA 5HHXL 4HDIA 1BJ1J 1HCVA 3KLHC 1SEQH 1HINL 1K8DA 1OP5K 3RWIA 3SDAA 2JB5H 4KK8C 4XNUH 5DJDA 1JWSB 5BS0D 3BVNB 4K94H 5CBEA 4X98B 1DDHA 1ZHNA 5A3ID 1A7QL 1HH9B 4RQQB 5C0RL 2NY1C 1JN6B 1N7MH 2UYLA 5DI8A 5J9PB 4P9HC 2YK1H 4PJBF 2EYTB 5J6GB 5JPMA 5F70A 5FECB 4L8CA 3VRIA 3OKEA 4BSWA 4U1KA 4P3CL 1IT9H 1ZHBB 1TZGL 2YN3A 1QEWB 5MENB 3BYYA 3IDIB 3MO1B 5CGMA 3ROOB 1JUFA 3EUUA 3ARGC 4W6YB 3VRJB 2FHBA 4OLZL 5ICXA 5I1HH 1E4XI 4JFEB 3P4OA 4XHQA 3SJVB 1RPQA 1YY9C 3MA7B 3MNZA 4MNQA 4UIKL 2EKSB 3WLWC 1S9XA 4XNYL 2QL1A 1MFAH 3CXHK 4L29B 2OK0L 3QXDA 1OGAB 3HB3C 4NO0A 3OJ2C 4BZ2H 1U8QA 3IETB 3O0RH 4WEUD 2C4FT 1CBVL 4NPYB 1HI6A 1S5IL 3B9KA 3CX2A 3JV4B 1PW3A 3VXUD 4PTUB 5F3BA 2GJZA 3B9DA 4YHML 1MFCH 3A6CH 1SVCP 1H5BB 4K3DL 2FDBP 2CK2A 2PTUA 1B0GA 2J88H 1H9VA 3RWEA 4OD3L 1UGNA 5HHXH 3I6GA 3LCYA 2YKLL 4MNQD 5T3ZE 3W9DA 1ZOXA 3U30C 2CPCA 1QFWL 1F3RB 4Y5VC 2B0SL 4NNPH 2LABA 5F1IA 3NH7L 1NFDE 1WJ3A 43C9B 3DSFL 5DMGC 4EI5B 5FF6A 4HFUH 4BUGA 4KROB 3B9KD 1FC2D 3H9HA 4ZPVA 5JORB 3O2DL 3LN5A 4UDTA 1FCCA 1U8MA 2VUYA 3G6AB 4GBXB 1RUMH 2WIIB 4WW2C 1KCUH 2OR9L 5F1KC 1DANU 4L9DA 1CG9A 3GSXA 2GCYB 3RBSA 4NWTL 4YXLH 4PLKC 4ZFOA 4ZOAA 1ZTXH 4QRPD 1BIIA 4HKZB 2C7UB 4QHMA 3RU8H 2QR0A 3G04B 1QRNA 1HXMB 3WS6C 3CX5J 3G08B 5DSCB 3QO0B 3KPRD 4F80A 2I9LA 5JUEH 4LVNB 3MYJA 1J0JA 1RZFH 5HGGS 4QRSB 5LJYH 3DXAA 3LKNB 4GW4B 4PLKD 5HHOD 4KTEH 3DTXA 4ONFH 2WLYA 1O7SA 1KLUB 4U1NA 4Y8AA 2GTWB 1CQYA 5F7DB 5DQJA 1FVEA 3QDGE 3BJ91 1C12B 5DXWA 5IESL 4P5MB 1PX4A 3ZE0E 4Y4KD 2Z92A 4K3JH 1GAFL 1UFUA 1PVHA 1HZHH 1CXHA 2JJVA 4RGND 3CH1B 2EE3A 1AKJA 4NHCL 4QXTA 4YIQB 3TWCL 4R90H 1BQHB 3FAWA 2VXUH 2EXWC 1H3GA 3QWOB 2AK1H 4QHNB 1YNKH 1U2HA 4XMPH 1S7VA 2BMKA 3PIQA 4ELMA 4WW1B 5EZLA 1SY6A 3QEHB 4M93C 1RUKH 2WNGA 3NFNA 1IEBB 3O81A 4OD2A 3IDGB 5TQ2L 1I7TB 5I74C 2AJUH 4TQEH 5C0BA 5IEHA 2A2QT 3D18A 3WFEL 2Z31D 1R5WA 3SKNB 1YEEL 3MRCA 4Z77A 3ZKMC 4JFXB 4Z76A 1UJ3C 1B9ZA 3K4DA 3NCCB 4NDMA 3DRTA 1XIWC 2W38A 1JUFB 4ZD3H 2E6PA 2W91A 1XEDA 3O3BA 2XY2A 3MCLL 1NCCH 5ENWB 3SDYH 3G5YB 1LO4H 4HUXA 1II4E 5EOTB 4JO4L 2DLHA 2JJTA 1OW0C 1DTUA 2XN9A 4IRSC 2DTMH 4MXWH 5CJXA 2E27H 1E27B 5K9KB 5B3JF 1K2DB 4NM8L 4GFTB 5E8DH 3VU2A 4RFEB 3L3DA 4Y1AE 3LS4H 3L9RA 4Z5RB 4EUPG 1OP3H 3P3YA 1U3JA 3IDNB 5D7IF 1WWAX 4LCUB 4G42A 1MH5A 1HWHB 2ESVA 1QFWI 1RUAL 3BZFA 4HUVB 4PJIF 1KPUA 3P11L 4M3KB 3KPTA 3LKRA 3CVHH 1E4WH 1H8SA 3BUYA 2C3XA 2XN9D 4BELD 5GJTL 4KTEL 5E9DE 4P2QA 5HHQA 2C1OA 4R7DB 4YDJA 4OF8A 4JFFA 4U1LA 3EJJX 2AXJA 2HT2D 1L9MA 5IHLB 4J3VA 5E1AB 3O11A 2V2XA 5IVZB 3ULUC 3BT2H 3FFCE 8FABB 4LCYA 2Z91B 2R0KL 2ZCHL 2XACC 4P5KA 1Z0MA 3U9PL 2F5AL 4HGKC 1ZT7A 3STZA 5H35A 2BNUA 1BOGA 1TFHA 4XVSL 1S78C 5FHAL 1A21A 2F8VA 4DEPB 2AJ3B 2GI7A 2R0ZH 1YEHH 3CFDA 3TJEH 1J87A 1YJDL 1AGCA 3X13A 2GEEA 5J8OA 3OKOA 1VSCA 1QLFB 3PWPE 5BQ7B 1WF5A 2GJ6A 3VFRB 4FQLH 4W4NA 3UTPE 3ZTJH 4LF3A 4YHLL 4ZPTA 2SEBA 1ZHNB 2HT4D 2AEPL 3GMOA 5D7JA 3AREA 4LLDA 2EDWA 1E6OL 3FOLA 3ETBF 4S1QL 2B0SH 3O3EB 4KUZL 3ZDZE 1B90A 1DEEA 3C09C 2BXYA 2A1WH 3OX8B 2LAGB 2OP4L 4OAWA 3MGTA 1CXFA 2DWEB 1NLBL 4QY8B 2NLJB 2DTSA 2EDNA 4X8JB 1BAFH 1JF1B 1FFPB 1EO5A 4Z78B 4NWUL 4KHTH 4TNVF 3D85A 1A02N 5C6TH 4NSKB 4GG6A 2MHAB 3QIUB 4X0KB 4N0UB 3CZJA 2RGSA 5F7HA 2P47B 3O4OB 1HQ4A 3QUZB 3ARBD 4YR6B 4GKNB 2JTDA 5IROC 4K8RC 3QEQD 3DX6B 3VXTB 5AG8A 4J3SA 4GSDH 3VGDA 1BZQK 1RU9H 3CDYA 2EDBA 1A6UL 1RK0B 1EH9A 1FLRH 4X4MA 5IQ9B 1U6AL 2JJWA 1EO8H 1XMWA 5D1XD 4NO0D 5ID0A 3LN4A 3MXWL 4ODSH 5FCSH 5CEYB 5GS0L 4RA3A 1K9TA 1RMFL 3ZE2E 2FZ3A 1J18A 4NN6C 4M6AA 4HBCH 3VW3H 3WFBH 1KT2B 3PHOA 5I1AB 4PY7A 3RY5A 4GXVH 4G8FB 1BREA 1RIHL 1OHQA 3D85B 4FNLL 2J5LC 5ESQB 4K7PH 3NABL 5L2JB 3V6FA 5TDNA 4FXKB 2DMKA 4Y4HC 2YMXL 3EYVA 3P73A 4UIMB 3BGAA 1AO7B 2WM0A 4HWUA 4P49A 3V5HA 4F3FA 4NN5C 3MRHA 5C07A 1FL5B 4PTTB 1V7MH 3HTLX 2H3NB 4LAQL 5CJOL 1JGVL 2WANA 3HI6L 4NQCB 1I1AB 3MUGA 4HKXB 2X4RA 4DZBA 4C56A 4MAYA 2W65B 1JGEB 4U3XA 1AGEB 1BM3H 2MKWA 2BSTB 4KZEH 4OM1H 5EWIL 3BIKB 3OPZL 4OLEA 2FD6L 2PYFB 4F9LC 5IFAH 3QI9D 1FG2B 3Q0HA 1QA9A 4ZNCD 5IHBA 2A77H 5EU4A 3MYZA 2B5IC 1M7IA 5TDPA 1D5BA 1JCKA 3AB0B 1OT2A 1ZKAA 1RHHB 2ID5A 3LS5H 4KQ4H 2BDNH 3OR6B 1E4WL 2OR9H 3NA4A 3EZ8A 4OLVH 3QPXL 1LDPH 4M4PA 4PJAB 2CGRL 4KH2A 3BN3B 3LRSA 1B2WL 2DYPA 1FDLH 2ZUTA 3GBNH 5J57B 1FL3A 5D96C 1WEJH 2X2YA 1QPXA 5GRJH 1FGNH 1GPOL 4ODTL 5J12B 3FO1B 1NEUA 1U91A 4MB5A 3ULSA 1P2CA 1F45A 4X7TA 3P2TA 5IMKA 1T5WB 1BBJB 2A6IB 5FOBB 3NVQA 4FQQB 2F53D 2IANA 2HN7A 5E2VH 3KPRE 1MAJA 3FQTA 4HUMB 3U4AA 4OCXH 4UTBH 1FPTH 5DT1L 3HAEH 5C9JA 2HMID 1CGSH 2DF3A 5DHVB 2OTWA 1LP9A 3L1OH 2QSTA 3UEZA 5L2KD 3JSSA 4TTDD 1VFBB 5DMKA 4HPOH 1D5BB 4JVUA 3MRFA 3MOQA 2C1PB 5CILH 3NIFE 2DYPD 4ZTOH 2XWJB 2RAMA 3S98A 1OARH 1MFDL 2BOCA 3OKDB 5IHUL 3KPSA 3LZFH 4NQVB 3QRGL 4X6DF 4LPTA 4HEME 5CMAB 2LU7A 4G8GE 4OLXH 4MSWA 5IJKA 2DWEA 5FK9A 2V2TB 3OHXB 1M4KA 3GBML 3FO0H 4X7TB 4GBXA 2J8UE 3G6AA 5D1XC 4RGOL 5IG7B 1K6QL 3S37H 4YUEH 4DQOL 3RNQB 1XF4B 4JDZB 5CEZH 4OLZH 4S1QH 4PJGB 1JHKH 3BPCB 2O26U 5TFSL 4QGTA 4GKNA 5JQ6L 1T83C 5T3XE 3SCMA 4PJ9D 5EO9A 3BFOA 5ADOH 4IOIB 2ZUVA 3QNXB 4MDIA 4R2GC 3TN0C 2V17H 5EO0B 4JFOA 3TJEL 4Z7VB 1T4KB 1F4AA 1D6VL 3K2UL 1UJTA 5CFHA 3H9SB 4ZFFA 4L8CB 1A4KB 4R4ND 2QQNL 3KPLA 4H20H 3GGWB 2HFFA 3TA3B 2V2TA 4U1NB 1BIIB 4F7EA 2XTJD 1KJ2A 2QKIB 3WDHA 3DJ9A 4WVRA 1Z0NA 4CN4A 1G1YA 2P45B 3RVTC 3LOWA 1GL4B 1YEFL 4LQFL 4XTRD 3FAXA 2ICWI 4JFZL 1XT5A 3BISA 5DD0L 4HIIB 3RTQB 4ZO8A 5DYOB 4MNQB 2PO6C 4QHUB 1C5BH 2FEEI 4ZXBA 4OJFL 3DHJA 3KPSE 4OGAC 3B9KC 1OTTC 4NO0B 5IF0A 1P4LB 3QHFH 3VGAC 4AMKL 2R15A 4GH7B 2Y7QA 3CVHL 3N85H 4KKAD 3QH3B 4FFWD 4WFGD 2LU3A 3NMEA 3HKFA 2BNUB 4KZDL 4Q2ZB 5IK3A 2F9BT 2GJZB 2WBKA 3QDGD 3WMSA 3B5HA 4JJ5B 2GJ6E 3OAYK 4YHIA 5FUOL 2FD6H 3S35L 4EBQH 2P8MB 3EHBD 2ILLA 4KZEL 4MQ7B 5D2NB 3FB8B 4WIQA 3NIDE 3TIDA 2VXSH 3IAQA 4PRPA 5C0DA 3RVWD 4M1CD 1JZ4A 1U8OB 1L4IA 3A0OA 4X9IA 1UENA 3KPOB 2B2XH 3V52H 5CZXD 2VDRH 1NCAH 2R29L 2XRAH 5JW4N 1CGTA 1CXKA 3L9RB 4Z5RA 4XBGA 3G5VA 5I18H 3U46A 2ZJSH 3MNWB 3IB4A 3BPNC 5KVEL 3I85A 4I0PD 2XXMB 2H1PL 3WNMA 4GXVL 1X4YA 4LASH 4OCSL 3IS0X 3NFSL 2WSKA 1HE7A 4Y2DD 3VW3L 1YMMD 5CZXC 4X6FB 5I15H 3LQMA 3U4BH 3ZZ1A 5KJRL 1WZKA 5D2LB 5F1SA 2Z31B 1QQDB 4PJIB 3CFJA 4DKEL 3UTSD 4NBZB 4NIKB 3FB5B 4NHCH 2LVEA 1RJZB 4PJXF 5CZKA 4R97C 1J1PL 4YBLB 3S88L 5E6IA 4BZ1H 2HKHL 3PWLB 1OARL 1LEIA 5GZND 3VFTB 2OJZL 2AV1B 2CMRH 1O0VA 4MYWB 1S7UA 4HJGA 2NY6C 1RJYB 3IU4L 1CFQB 4JR9H 4WWKB 1O7VA 3RNQA 3O2DA 3V52L 1ZGLB 4OV5A 1YN6A 2CR3A 3WN5B 3MMEA 4NOFA 5FUZH 4R9HA 4X7SH 2HAZA 4HWNA 2J1KA 4N9GA 4PTTA 1C5CH 4IIQA 2DBLH 4LRNH 1RIUL 4UDUB 2R2BA 5L9DH 4DTGL 3JWNC 4JRYE 1SJEB 5I71C 1VFMA 1N3NB 5IBUG 2FBJL 3NIDF 3UYRL 1D9KA 4Y5VB 1SJHB 5FUOH 3VFMA 1Y0LA 3IDGA 1NUGA 4XCYB 4IRZL 3WFHB 3QEGH 1CE1H 4MD4A 4NKMB 4PRDA 3E8UL 5J56B 1P1ZA 3KPRB 5HDBF 4B41A 3MRJA 5FV2A 2IMMA 2R56H 1R3LA 4A6YB 5ILTH 3GSQB 1UM5L 3KYMA 4PJBA 1P7KA 4G8IB 5FKPB 1ONQB 5FM5M 1N6QH 5DURD 4R7NB 3IFOB 2YC1A 1Q9OA 5IFJA 3RTQA 4YBLC 4WCYL 3OAZK 1XIWA 3TPUA 1DEEB 4LFHD 1A0QH 3DV6A 5FB8A 5KSAC 3L3IB 5I8EB 4XXCC 1T21A 5B39G 4BFEA 2B8OT 2B1HL 4XPTL 1XGUA 1PZ5A 5CLTA 3TV3H 4GS7C 5F6HJ 5ESAA 5E2UL 1JYXA 2GY7B 4F37F 3EBAA 1P1ZB 4KMTL 4HDIB 3RHWK 4FXGA 4J3WA 4K07A 1IM9B 5F7FA 4N8CH 1NCWL 1G7MB 2OQJA 3WCYA 5BV7H 3HPJB 2WBJD 2JJSA 1MHPL 2P7TB 5AG9A 3IDYC 2X4SA 3UTSB 1IAKB 2KZWA 2FSEB 3EFFA 1S7TA 4ORZC 3SKMB 3R4DA 5D71H 1S3KH 4H1LH 4KI1A 3IF1A 3ARYA 3LAFA 3AC0A 3QG7H 4JY6A 1D9KC 1J0IA 4U1KB 4FS0A 4RGOH 2R56L 3F58H 5EB9A 1YEJH 1JHTA 5FXCH 1I9JL 5HY9A 4KC3B 4I2XA 4XBGB 2R2CA 3TNNA 2DD8L 3CD4A 5FFLA 4YHYB 3EO9L 1KFAL 2V6HA 3T0VA 4FFYL 2G9HA 4HS8L 4XCEA 2VN4A 4ZTOL 5EOCL 5T5NG 1JK8A 4DGYH 3RIFF 5DHYA 5I1CL 5CILL 4APQC 1JGDB 4NM4L 5AYQA 4B50A 3DWTA 4TYUA 3WFEH 1C5CL 4LF3B 4P2CG 1JTPA 4QOKE 5DRXB 5IOPA 4XWOD 4TPRL 5ERWB 2WQRA 3MJ7B 3B9KB 1KEMH 1PKQB 3JV4A 5KSAA 2DB8A 5KZCB 5F44A 3CLFH 4YPJA 4MVBD 4I8DA 4LLYA 2PO6B 3PABA 4F58H 2VWEC 1MJ8L 4F7PB 1FCGA 5EU5B 5J1AA 5DS8A 3BPLC 4R90L 2AV1A 4O2EA 2BC4B 4ONHA 3W39B 4OQ1A 4IRJA 5BRZD 3MRDA 4X0KA 1DBKH 1NUDA 4BA8A 2R0WH 2I5YL 5BV7L 5FYKD 2DI7A 1EJOL 2NXZC 4YZFE 5A40E 5I6XC 3G6JB 4QRTA 3W81A 3Q2CA 3W0WB 4NQDD 5K9KA 5K9OB 5HDBE 1Q94A 1UZ6F 4U6HA 2AJSH 3OF6A 1HQRB 5DRXA 3TBTB 4U1SB 1QFWM 1DBMH 1CK0L 2R4RL 4D9QD 2FGWH 3QFJE 1VFOA 3O8XB 5GIRA 4LASL 1IQDA 3SEPA 4XPTH 4TRPH 2ZKHL 1LHZA 3BKMH 5JUEL 4H8WC 5LVEA 2DQGH 3O9WC 4GG6E 4ZTPH 3BQUA 2BVOA 4XXDA 5FK9B 4LSUL 4S1DD 3VFOA 2PF6A 2FH6A 5C8JA 3ESUF 3EOBB 4M5YL 5K59F 5CP7B 2O5ZL 3N1GC 3RY6C 3UMTA 4ZQKB 2F58H 4KFZC 4M3JA 5EC2A 1AO7A 3DI2B 1TJGL 1WBXA 1I4FB 4N0CD 4KVNH 2V5YA 3WFCL 5CD3B 4MAUL 3U48A 5AWNL 3T0DA 5C2BL 3X12A 5HGAB 5K93A 2BNQD 2NY0B 5INCB 1UACH 1XGUB 3S35H 2DMCA 3C87A 2WP3O 5J13C 3AB0C 3BE1H 3AAZA 5DC0A 1W0VB 3WJJC 1IQDB 3FRPA 43CAA 4HAFA 5DJZA 1W8OA 1XF1A 4P9HL 4YX2L 4LRNL 1A4KA 3CH1A 4NP4L 2ADIA 1NBZA 3PP3K 4OD3H 4MD0B 4ODSL 4NFDA 3BX7C 1GRWA 1T7WA 3EOTL 4V1DE 3SDAC 4QRPE 4WO4A 2UZXB 1VCAA 5DO2D 4MJ6B 2BK8A 5D7SH 5EFIB 2DKUA 3FONA 2NW2B 4X6BB 2HH0H 4PJIA 4ACPA 1A9BA 1KUMA 5HYJD 5GS1B 3V4PH 2PYEA 4JPWL 3VI3E 2J8OA 4DUWA 4HKJA 3PWNB 4TN9A 3GM8A 2CIIB 4G80B 3C9NB 4LSVH 1WQVT 3HZKB 4YK4C 5CCKH 1ZA3A 1I1RA 4UIKH 1BAFL 1YEJL 4UU9A 3X3GH 1NGXA 3VG0L 3RGVB 3LMJH 2ZG1A 1CG9B 2CLVA 1S7UB 2BSSB 2YD5A 1U93B 3QG6B 4W6XB 5JZ7C 1HIML 3LIZL 1EVTC 3HS0B 4P2RB 3ECBB 1MWAL 3QUYD 3IGAA 2PCPA 2DKSA 4YHIB 2FL5A 1G9MC 4M9PA 1GGBL 4ETYA 1OQOA 4KI5F 3OXRB 5KVEH 5IJVA 3LB6D 3MRFB 3NCEB 3QUMA 4O58L 1JZ5A 1RZGB 3O6MH 4O4YL 4PRPB 5C0DB 1A6AB 3H3BC 1OWWA 4AQ1B 5HHPA 2ZSVA 2XRAL 4NJ9H 1ADQH 4N5ED 3QNZB 2X41A 2VDRL 1EEYA 3PABB 1N0XH 4V2BA 4F15C 5DEFA 4PD4J 3LSOB 3MLRL 2X10A 5F3HB 5BMFH 4WJ5A 1FO0L 5B8CA 4OIIL 1RZFL 4MJ4A 4HHAA 3QUXA 1V3JA 2A9ML 1PKOA 5JDSA 5JHDB 2IG2H 1ZLUH 2RCSL 5J0BA 4HK0B 3W9EB 1KPVB 2WIMA 2X4PA 4R8WL 2XOTA 3IS1X 4H25A 4RZCB 1FL5A 5DLML 2ADFL 4JFDB 1OTTD 2APFA 4M7LT 1A3LH 4JAMA 1CGSL 1F2QA 4UTAH 1AI1L 4P48A 4JREC 3G5ZA 4NZUL 1PZ5B 1EUUA 4OCXL 2VE6A 1RJZA 4YDVA 4XWGH 4LSQH 4EIZC 4HUUA 2YOCA 1U3HD 1FYTA 1KPRA 4JZOB 4WEMB 4NBYB 3DGCR 3HE6D 3WJLC 3ARDC 3VFRA 4XNXL 1ZSDB 4PJXB 1EEUA 3QDJA 4MS8D 4MS8C 5IQ7H 1IAKA 5IM7A 3QQNA 4GUPA 3IKCB 3D39D 5D70L 4GAGH 2FYYA 4K3HA 3OGOE 4JM2D 3W11C 3EYQC 3L5IA 2QQNH 1YC7A 4Y2OA 3WXWH 4WUUA 2QSCL 4WUKL 4AM0B 4I2XE 1Q1JL 2ZUSA 3SQOL 4NNYB 3TNMA 1YA5A 2X1WL 1ZT1B 1KG0B 5LGJB 3G5ZB 1G7LB 4HWZA 3TM6A 3KPNB 4ELME 3ULVF 4KPHL 3QUYB 4JQXA 1NSNL 2Y5EA 4L1DA 3KS0J 5TPWH 2NZ9D 1SYSB 3KWWB 1LE5B 4LKCB 3JTTA 4LL9A 5BJTA 4QOKA 3D2UA 4R96B 2P8MA 1XF3B 2HFEA 4LLQA 1W8NA 1INQA 1ZA6A 5E8EA 3V79C 4Q9RH 2EE9A 1ZHKA 4LMQI 4Y5XB 1OF2B 4CVXA 4NKDB 2VQUA 3VXQB 3GNMH 4R97B 5JQHC 2NY1D 4RBPH 4OCSH 4O58H 2UYLB 3IXTA 2AI0L 4NKQB 4XP6H 3EOYG 4OQTL 2FEDC 1OP9A 3E2HB 3IFPB 4PRHD 4HKJB 2CKBB 5DJ2B 1KELH 3HR5B 4W4OA 3I02B 1IILE 2A0LD 2IAMC 1BOGB 3DETC 5I1LB 2E9BA 3WHE0 3ARUA 1MRDL 3P4OB 1G7HA 2JB5L 5BS0B 5HYJA 1FLRL 4UTBL 1J11A 5C08A 4PJDF 4NOBA 5I17A 1E4XL 4QHNA 3ROLB 3BDYL 2VAAA 4Y4KC 2ZG2A 1F2XK 1U8NB 5ISZD 1HQRA 2FIKB 4OZ4A 5KTEH 3RU8L 4JVPA 2COQA 2BHZA 2FX9H 2XWTB 5K33A 1ZTXL 1VACA 1A1OB 3F6LA 1LP9F 1N64L 2EE6A 2HH0L 1FVDB 5EH1A 4WU5B 4P2RD 4BFIB 2H32H 4U6YB 3MZGB 1AY1L 4MJIA 2D3VA 4OI8A 2QADB 5FDWB 3F58L 2P24A 4I3GA 3VFTA 3HZVB 1I3RA 1SBSH 3ARDD 3HUJB 3FT4B 3QIUA 1C16B 4TUKH 5F7LB 4OLYL 3VG9C 1DLHA 1KJMB 3CVIL 3LKOB 4KI5E 3P4NA 4HAGA 3GMRA 5D71L 1KTDB 1YY8B 4H0GA 4F33A 3ET9F 5M94B 3Q48A 2OL3B 1MCRA 2DYPB 1JFQL 2JLLA 1U8NA 3MUY1 3MV11 2A9MH 4M93B 1GJIA 3RWDA 5ALCH 2OL3H 5HYQA 3TO4B 1UVQB 1P6AB 4H20L 3OAYH 3HI6H 2O5ZH 3RTQC 1MPAL 3EYSL 1UB5B 1IGFH 2ESVB 3LKQA 3MA9H 1RD6A 3I6KB 4NCDA 4WDIB 1GSMA 3TZVC 1HK6A 4C57C 3I84A 3V8OA 3VGGA 3ZKQD 5T1LD 4FQ2L 2DKMA 4WW2B 3NIGE 1RURH 1GGBH 4H88L 3KNBA 3MA7A 2IALA 3OB0H 3KPQB 3TYGL 2HLAB 5FECA 3OJDA 4Z9KB 2I9TA 2ICES 3QCTH 3INUH 8FABA 3HC4L 5JHLL 1P4BL 2VWEE 2IADA 1JNNH 3MUGB 2VLKD 4HLZG 3QRFM 4N90E 5K9QG 5GIRB 1KNOB 4QRUB 4P5MA 3DMMC 4JFYA 3DYPA 3DO7A 1V3LA 1BVLA 1OW0A 2A9NH 5KS9E 1X4ZA 4YQXL 1KLGB 2VDPL 3DIFB 3D69A 5ID1B 5HHOB 1EGJH 4RDQG 4WWKC 1CL7H 4L8DB 1HHGB 4LIQE 4G6FB 4PJ5B 3ABZA 5GISH 3RPIB 4NNXA 1QQDA 5FGBC 1FNEA 4UNUA 3O8XA 2XKNB 5IW6B 1SEQL 3UP1A 1FPTL 3CIQA 1I3GH 2A1WL 3IVKB 3F5WB 1G6RH 1YMHA 5D93C 2PTTB 4EIGB 2EXWD 3BE1L 4ZOBA 5DD5H 3U30B 1U8JB 3CPLA 5GXBB 5JDSB 5JHDA 4WGVB 4U7SA 5IKCB 3PL6B 5DZLA 4GG8A 4MNGE 2YD7A 1DFBH 3QIWC 5B4MC 1I1YA 5D72H 5I76B 2AXGB 5CZVL 3ZDYF 1JPSH 2W9EL 1TIUA 2WP3T 3QPXH 5KG9A 4D0DB 5LGKA 1EK3A 3K8KA 3HE6A 3PV6A 5CHNA 1HHGA 4JM2F 4NRYB 3BP7A 4QRQB 1G7QB 4MLSA 1SJEA 1LMKA 3MUJA 4YHKL 1BZ9A 5KVFL 3BWAB 2IH3A 3WFHA 4NZJA 5EIIA 2UV3A 4XAKD 5FA3A 4LLYB 5CMAA 1QNZH 3P30L 3MRNA 3QXAA 3RVUC 3GKWL 2CIIA 1ZHBA 2QSQA 3MROA 5DQJB 5FYKE 3WD5L 4IRJB 1QBLL 2E3VA 4OIBA 4R7NA 4WI9A 5TDNB 4LLUB 4WTXA 3BDXA 3VFPA 1YPZE 4ZYKB 3AROA 2VXSL 2PYEB 2H6PB 4DZ8A 1J0HA 3SCMB 5F1OB 2X89A 1CF8L 3MLTB 2ZWLT 3MUZ1 4P5KB 3NCJH 4OD2B 1CGVA 4JRXE 1NEZG 3WDJA 5ETUA 3MRGB 1X5GA 1UVQA 4KUCF 2X4OB 5BVJB 1T5XB 1H5BA 3GRWL 3OAUH 5DDHA 5FGCE 3KLDA 5ILTL 2G2RB 2R9HD 3SGEI 1RFDL 5GZNC 1QP1A 1FFNB 2VLRA 4P3DB 1MEXL 1R3HA 2EIZA 3OZ9L 2NTFA 2FH8A 5FYLE 4HV8A 1NMAH 5EOQL 1I9EA 4XCNB 4HQQL 4KRPC 5EUKB 1F02I 4JKPH 4ZYKA 1YECH 4DGVL 2R2HB 2P46B 2YPVH 1Q0YL 5LQBH 2Z8WC 4ZXBB 1DN2A 5GRVK 4YK4B 1YEEH 2ZNXA 4ZS6C 4BQ6A 3MGTB 3C8KB 1TVHB 1OY3B 3WHXA 1CS6A 1SYVA 4Z7UE 4NC1C 1FO0H 1P2CB 4K7FB 1NGPL 4TSCL 4APQA 3QUZC 3OKYA 4PV9A 3TFKC 3LN9A 4JJ5A 1MHHA 3QIUC 3B43A 5GS2D 2G2RA 1KB5B 1PG7H 1DQTA 3S36X 1CFNA 4YJZL 4CVUA 4XH2B 3H42L 1FIGL 3DUUA 5C0CA 4XP9L 4LP5A 2XTLA 4HF5H 4PJ5A 5D1XB 2PW2B 1WZ1H 3O3DA 2J3SA 2WMPA 2WUBL 1IAOA 3DSNA 4M00A 1MWAH 3BXNA 4LCUA 3BN9C 1T7VA 3ULVD 3U4BL 4YFLF 4KGLA 3LKNA 4LPXA 1X5XA 3ZKXB 3OF6D 1X5FA 1R3JA 3IJHA 4F7PA 3C5JB 2NY4B 3N9GL 3MFGB 4KK6D 2DLFL 1UKTA 4H88H 1PG7W 3HRZA 1GGYA 2E7LA 3QDJB 4XPBL 4JY4B 1C16A 2C1OB 3LRHA 1KYOK 2FYYB 4B7LA 4JKPL 4MJ5B 2FX7H 3FT3B 4HG4J 2GT9A 3OKOB 3CZFA 5EOQH 3ARVA 3OR7A 3S8WA 1DQML 1NCAL 2EYRB 4P46B 3BPLB 2ICWJ 4XI5C 1EO7A 5FUCE 1UM5H 3EOTH 4F2MB 1XCTB 1QFUL 2R0LH 2BNRD 4PD4K 5HTSA 2DQTL 1TDQA 1N59A 1ZXQA 3M07A 5H35B 4BH8B 3B9AA 3GEWB 4MB4A 5F7EH 5E6YA 5ESAB 5MEOA 3GK8L 4K7PX 1FP5A 5CSGA 1FLTX 5EBMB 4FXGB 3U0PA 4PPTA 3K2MC 2FWOB 2E7MA 2ICEA 4ZXBC 3UZVB 2QKIA 2QBWA 1FJ1A 3P4MA 1HDMA 3DMMA 3OG6B 3HMWL 4MXVF 1NANH 3CFEB 5HVWA 5DO2C 2EDYA 4PJBE 4XWGL 4KRPB 3EOAA 3OKNB 5E8NB 5C0JA 3MRQB 1OF2A 1R3IL 3KYKH 3NAAL 5E5RB 5K9JL 1LDPL 5L7XL 2P4AB 1TJGH 2IALB 5KW9H 5AZ2L 3NZ8B 3LS5L 1U8IB 3QNYB 3LRSB 4XAWH 1TZIA 4HC1L 3H2WA 1MFCL 3L3OB 4Z7WA 1D5ZA 4NQEE 4UDTB 5IFAL 1T6VN 1NEZA 2CMRL 5I1DB 2OJZH 1IM3B 1QYGH 3IYLW 1G7JB 4N8VA 4U0RB 4NRXB 3PP4H 3HC0B 3L5JA 3DX8A 1BD2E 1BVLB 2HWZH 4WFEE 4FG6C 4CU7A 2IPKA 2EECA 3DIFA 3SCMC 2NZIA 5CGYC 4YHKH 1R5IA 3LKSB 3VFSA 2J5LB 5F88A 1LP9B 3G04A 1N0XL 1CU4L 3FFDB 3CFEA 3QHTC 1N5YH 4J3TA 1KIRA 1CD0A 3STLB 4NZRH 4NNXB 1EA9C 5IQ9A 2VL5A 2VXUL 5TE6H 3PGCB 1JPSL 1OVZA 1MHCA 1RZIA 3UTQA 4EN3B 2C5DC 5C0FB 4O2FB 5GSRB 1DQJB 4MSWB 4K3JL 4AM0A 3ILPA 5JW3H 2CO7B 3KGRA 2P24B 3SO3B 5JNYA 4IDLA 4NZRL 4OZIB 2DIJA 3QDMA 3UTZB 4OLUL 2X1XR 3TPKA 2RIKA 5ANMB 3ULUD 1G0YR 3O4OC 2WZPD 2F19L 4P2RA 2JKXA 1TCMA 3V6ZA 5I19L 5IJKC 4AJ0A 3PWPB 1LEGA 5EU3B 5HI3D 3QUXC 5DR5L 4QCIA 4GQ9L 3MBXH 1UM6H 2FJHA 4H1LA 3F7QA 4G6KL 4XNMA 5T3ZD 1INQB 2FSEA 4OFVA 3OXSA 5EA0L 4HG4K 1HSBB 1AD0A 1NMCB 2BJMH 3QWRD 3MRLA 4C58B 4JPIA 1L6ZA 1QYGL 1UZ8B 4XPGH 2BRQA 4PJCA 2R1YB 4X6EB 2IH3B 1MFEH 3S97C 2BHUA 4FTVD 4FQJL 1FZMA 5D93B 1M7DA 1MCKA 4M6NL 4Y16C 4FFVC 4HS3B 1K4DB 3R8BB 2W0FB 3O4LE 4ODHH 3P4LA 4S1DC 3HR5A 3G9AB 4NDMB 3CSPA 5D70H 1CTOA 4U0QB 3UTZA 4KKCC 4MQTB 1E6JH 4UB0L 1XGYL 2YA0A 3RY4A 3VMOA 4D9QE 5D1ZD 4HK0A 3WN5C 4LARH 2Z8RA 1MJ7L 1PLGL 1X7QA 3V5KB 3TN0D 1WZMA 2XN9B 2CIKB 2H26B 3HRPA 4JDTL 4N9GB 1D5XA 3MOAH 1F6FB 3LV3B 5CBAB 1FAIL 2DDQL 4N1HB 1WEJL 3VFNB 3ULVE 4G9FD 4OZFB 2UZIH 2VR9A 1JWMA 1RJLA 5EN2A 2ADGA 5T1LA 5ERWA 3FRUA 5DD3L 4BM7A 1TZHA 1BBJA 3W11D 3GHBH 4RFNC 2J88L 3CMOH 2PXYA 5JXAH 5ACZB 2F58L 4Y2DA 5I71B 1G6VK 2VXVH 3GMQB 4NUJA 4QXGH 1EBAA 1WAAE 2AGJL 1C1EH 3BQUC 1S7XB 3QDGA 4P2QE 4D0BA 1ZS8A 4QRRD 4L8DA 5EU6E 2R0KH 1MQ8A 4KI5D 4AH2B 1HYSD 1M05B 2XZZA 5C0AD 3OKKA 3V4VL 1BM3L 2YWZA 3V6FB 3PWVA 4PBWD 4PB9H 3WIIL 1EHAA 3GKZA 2CD0A 1T80A 3ZE2F 3N9GH 5KG9B 4JN2B 2MFNA 3QNYA 2VL4A 3EO0A 4JG1L 5CIPB 4L3EB 3TZVB 3W0WE 4PREB 1PDKA 4WUUB 4LAQH 3RUGB 1T7XA 3T4YA 3TBTA 4S1RH 1UYWL 3CDGA 3T0XA 5F7DA 1FG9C 3GBMH 3CMGA 3TO4C 5BCAA 5BW7C 4MQXD 5JW3L 4RMTA 4EVNA 1T4KA 2Q76B 4JKMA 3VA6A 2VISA 5KSAD 4CMHC 4LGSB 5IV2B 4D9LH 2VDML 3C5ZC 4KK8D 1ZLVK 3QCVL 5E1HB 4NQDE 2B20A 4LHJB 1IE5A 2VUOA 1A6PA 2JJUA 2OZ4L 2GTZA 1XGTA 3QCUH 4WI7A 5EPMA 1ERNA 5HVGB 5GS0H 4GRLD 3QNXA 4MHHG 3DO3A 2V7NB 5DUPH 3VFPB 5DJAB 5HYEA 2PYEE 3KXFB 4N90D 2HT2C 1AP2B 3LEXB 2CUHA 5F6IC 3QHZH 3VGAB 5LWYL 3NTCL 5DUBB 3MV8D 1FVCB 2HFFB 3TA3A 5KVDH 3VGFA 5B39A 3UX9B 3HNVL 2W07A 5L88L 5B8CB 1YEGH 2HFGH 2HG5A 4G43A 1QFOA 3DPBA 3GSRB 5D7JC 1S8DA 4L4TB 4WO4C 1MHEB 3PQYA 4PJ8C 2NX5A 4DN3L 5TQ2H 1BBDH 4QXWA 1LEGB 4BSVB 4Z95L 4QF1B 4LKXA 3F6IA 4YNYB 4Y88A 5C0CE 4LCCC 3HC4H 1FFNA 2VLRB 3E6HB 2ARJQ 1NAMB 1U95B 3HG1E 3ESVF 2NW2A 3TA3C 1MCFA 1HNGA 3NCJL 4NQXB 2QQLL 1Q72H 1F4YL 4UQ2B 3GIZH 4ERSL 2XZQH 1VACB 5C0AE 4ZFZB 1TMCB 1FFOB 1VADA 3QEQB 1AJ7H 3EYFA 3PWPD 3RI5K 2FHFA 4Z7UB 3VXRA 4JHAH 4DCQB 1NKOA 3ULUE 1FYTB 1KPRB 1GIGL 2PW1A 3EZJB 4PGEB 5GS0D 1XF5B 5AEAA 3WS6A 2E5EA 3E3QC 1CGYA 2VXVL 4QXGL 5JA9A 3RDTB 2ZSWA 4WFHD 3TIEA 4XX1E 3HN3A 1B88A 5IT2H 1F90L 3TT1H 4TNWF 3WNNA 2BRRH 4J7RA 1C7TA 5TH2A 4GRMA 3EYOA 2XG5A 5MP6H 1NDMA 5J3HD 4ONGH 4TULH 4QGYA 1I9RH 3NPSC 4EBQL 3IFLH 4JDTH 1Q72L 3D0VB 4Z7VE 2FGWL 1IM3A 3CFJB 1GYAA 1PEZA 3RIFK 3STZB 4XNQB 5E9DD 4KROC 3DBXB 4XMLL 5ACZA 2L7JA 4P46D 1N6QL 4P59L 4X7CC 5DRNA 3SBWA 2IMNA 1XGYH 1UB5A 2CDFA 2G5BB 3WV0A 5D2LF 3BIKA 3NACH 3BD4A 4XPHH 5FO8A 1EO8L 3FFCD 4LIQL 4TUJB 4E9LA 5E00A 4HJGB 1WFTA 4URTB 4XP9H 2VZ1A 3FQXB 4HUXB 1TJHH 3PWVB 3TVMD 5EU6D 2HYMA 4P9ML 3H9SD 3CVHB 3NH7H 3BXNB 3WO4C 3GSOB 1UXSA 2FBJH 4I0PA 1YJDC 3HE7B 5FYJE 5LWYH 1BFOA 4U1IB 1HN1A 3GZKA 1RIUH 1P4IL 4NCC2 4UAOB 2EDKA 2JIXB 1N3NA 4OIIH 5DZOA 1UWXK 2DJ4A 1AGBA 4RIRB 1LO4L 1YMMB 3A67L 2Y06L 4OGAD 1T5XA 1UM4L 5EUOE 3IJSB 4YBHA 1BQUA 2ZP0T 2VDMH 3IJYB 3HCVA 1AGFB 3M1BB 4ETQA 2Q8BH 5E56A 5B3NA 2PUQT 1N4XL 5FGSA 2AI0H 4H1LG 2LAAA 1RULH 1NMBH 4X80L 1QSEB 3RPIA 1I9JH 4X98A 4ZSOE 4JO3L 1I8MA 1UYWH 3HG1B 3NACL 4OFIA 1ZLVH 3BQUD 1YEHL 5KJRH 5IVOA 5JHLH 3T8XA 3MNVB 1ORSA 2V2XB 4PYGA 1HSAA 5T3XD 4L4VE 5C09E 5JLZB 1F4XH 2I60H 2D0FA 5HGBB 4K2UH 2R4SH 3QO1A 4GAYA 5CCKL 2B1AH 4PJ8A 2XWBB 4XPAH 5C07D 4PUBL 1PKQE 2PKDA 4H5SA 4HPYL 2HWZL 3MRDB 4QHLA 1GAFH 3O6LH 2LV4A 1EDQA 1OAYH 3MACL 4ENED 1IC7L 2GY5A 3DV4A 5B38B 4LKCA 1T22B 1F90H 2NX5E 4LLWB 5DVKA 5D7KD 3UJJH 1BHGA 4WUKH 3MZTA 4LOUD 5AD0A 2YWYA 1MCPL 3C6SA 5GHWH 2JE8A 5FGBA 2ATPB 3GHBL 4DUXA 4ZPTB 5EZIL 1H3VA 4CVZB 5BOZG 2NYYD 1R3IH 3DX8B 1WAAA 2P5EA 3G6JE 2B39A 3HMWH 4OUUA 4Y2DB 3SKNA 3ZO0A 1I85C 3GSWB 5DFTA 4QY8A 1SMOA 1KBGH 2R8SH 4PJ7A 4OGXL 3E1F1 3HZMA 3LS4L 1FG2A 2OTUA 4FQXC 2HVJB 3RDTC 5DD1H 1JE6A 3BKJH 1MVUA 3BH8B 3U2SB 3MREB 3STLA 2CLZB 3BRFA 1MCJA 3UPRB 4KKLC 2R9HC 4P2OA 1XGPA 4XCCL 4QT5A 2D2OA 1CVRA 3AS0A 2WUCH 4JQIL 3SDDB 2DJUA 4Z7OF 5JOPE 4XP1H 3H9HB 2VC2H 4NN6B 4ZPVB 4LSRH 4RNRA 1PFCA 5FYLD 1MCHA 4DOHB 5I1IH 1OAKH 5FM5O 1JYNA 3I3DA 3DBXA 1FVDA 1UKQA 4LCWB 1XF2A 3UTTD 1FZMB 5F8QC 4X7FC 4NQSA 1QLRB 1QSFD 4B0MM 4CW1B 5EBMA 1S7SA 1L0YA 2K1MA 4QNPF 5I19H 3VDBA 3A6BH 3ROOA 4WO4B 5T3XL 1YEDA 1JTOA 4GJTB 3GO1H 1TCRA 5EBLB 4BZYA 3KJ6L 1KTLA 3G6DH 3E6FB 4DKFL 5DJCB 3MRQA 5GRVL 3TIDB 1NUNB 3VXMA 5DD6A 4UT9L 2PETA 1CDCA 4L8SB 3GSNH 4I0KA 1ZVHA 5E9DA 3KG5A 2C3HA 5DZNA 2OL3A 2VITA 4B5EA 3G9VA 3BDBA 1ZGLP 3VFNA 4HUWA 5JOEA 3OKEB 5T33H 3RFZC 3V4UH 5TQ0L 3AY4C 2NY3B 2WV3A 5MHSE 2GTWA 3ZDXE 1GZQB 4GRWE 2F53E 1WT5C 4QEGA 4NQCE 4UMGA 1WSST 2VQ1A 2MCG1 4JE4B 4JFEA 12E8H 3Q6FA 3WXVL 4YBQD 3NFSH 4LQ1A 1XR8A 2GUOB 2EO1A 4PB9L 3RL2A 2J6EH 1A6UH 2CDGB 1XF3A 2HFEB 3M45A 3VMPA 1FZJB 3D3VB 5K9QI 3BP4A 4F9PC 4DGVH 3NZHH 1HI6B 2AVGA 4U33A 4PJ5D 2GJJA 2FRGP 4YAQB 4PY8I 3T3ME 1KTKE 2VITB 2XQYK 4JKLA 1G7IB 4XNZB 3OZ9H 2VLLB 1T0MB 4ZFGL 3L1OL 5ICZB 1FIEA 5KW9L 4AEEA 4JFED 1QSEE 4XVTL 1H15A 2A74A 1W0VA 3RX8A 1WBYA 3KYKL 1Z9OA 3HRZB 2NNAB 1F3DJ 1RIVL 1JWUA 4PRPD 1LE9A 1FAIH 1U3YA 4UT7L 1Z3GH 1E6OH 2EDQA 2X5PA 1PYWA 4OZFH 4WUUD 5HHOA 4GRMB 2HJFA 4YFDB 1XR9A 1D5IH 1QRNB 3IXAA 1E6JL 1NCWH 3O3AA 2HJKB 1UZ8A 1FNEB 5C0AA 3S96B 3AAZB 3OKDA 4WFHE 4YDVB 2GCYA 1CICD 3WD5H 5EZOH 3MRBA 2X70B 1ZA3B 1IC7H 3NZHL 1X5LA 5DD0H 1A7OL 3LKRB 1W72A 2HVJA 5SWSE 1QNZL 4MAYC 1Q9WB 1BFSA 3BKML 4JREB 1T7YA 4GQ9H 5JIIA 2D7NA 1DQQB