3QXTA

Structure of an anti-methotrexate cdr1-3 graft vhh antibody in complex with methotrexate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Methotrexate CDR1-3 Graft VHH
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 31
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxtA00
4R97B 5T3XL 1JFQL 1B4JL 5DRZB 4PJ8D 3VXOA 4FQHA 5ALCH 3MO1B 3SPVB 3ESUF 1INQB 1YUHB 2V9TA 1A7QL 3QULA 3NFNB 3EKCA 3TVMA 3ULUF 5JOPD 1U95A 5TDNA 1A7OH 4HWZA 2BSRA 5GGQL 4ODVH 2GFBA 1TJHL 4KUCD 5GQBA 3MGTA 3SO3C 2AVGA 1QRND 3RL1B 2GK0A 2X4SA 4OD2A 2VRAA 3ZT5A 5EO9B 1P1ZA 4G8GB 1G0XA 4TVPE 3I2CH 1QR1B 2K3TA 2X7LA 4XB7A 3UTSD 3KPRD 3QIUD 3TJEH 1A2YA 5FCUH 4CVXB 4BSJA 3BYYA 1JZ5A 2W0FB 1M05B 1NL0H 5HJ3A 2VL4A 2XRAH 3FOLB 3ZTNL 1EAJA 3SDYL 3HNSH 1EVTC 4DZ8B 1INDL 3DO3A 1CTNA 5KS9A 2F53E 3O41A 5CEZE 4FFYL 4QRSA 3RTQD 1HOCA 5JOFB 1CE1L 3RX8A 2CLVB 1S9XB 4BQ9A 4JY4A 4DZBB 3WHE1 1MCKA 3C8DA 3UTPE 5ALBL 4BQBA 3L5WA 5C9JB 3HNVL 1SYSA 5KG9B 4JFXA 2LE9A 2DAVA 3RL2A 1N5AB 3AVEA 5C0CA 1S9WB 3WL9A 4NKIL 4O00A 3OXSB 4Q0XH 4OZFH 1Q72L 1EGJL 1W72A 1X5LA 5FUCC 4G6KL 4OZ4A 1HNGA 5I1HH 2AXFA 2ITCB 1GOHA 3DXAD 2BRRH 3RKDD 3FO1A 3VWKC 2Y5EA 2VSDA 3U36A 1I9JH 2ZUVA 3SY0B 2J4WH 2YD6A 3V5KB 2DF3A 3EDEA 4KHTL 5HDOA 2B4CH 4I18A 1IT9L 1DN0B 1MCLA 3GM8A 4HD9A 2JLLA 5D8JH 3BXNB 5DUBA 3DSNA 1UCBH 1QBAA 1A0QL 3DETD 4KI5F 1MWAB 4XBEL 4IDJH 4XAKD 5FGBA 4MXVF 5IGXL 3DGCR 1DBMH 1FRGH 4GW4A 1FBIH 4HH9B 4NSKA 2FYYB 4PJ5D 1G6VK 3FKUS 3ZHKA 5SWSE 1UYWH 4K9EL 2JB5L 3TN0D 1T04B 2VITA 5DK0B 3QEHA 1AXSB 3VFMB 3SKOB 3T8XA 4G8GD 1BJ1H 5J56B 3OAUH 2I24N 4F15C 1VFBA 5E9DA 2VDLL 1A4KB 5T3ZE 3DX7A 3PE9A 2ICEB 4DN3H 2FEDD 1RU9L 4D3CL 4Z5RB 1FORH 2JJVA 4S1DC 3MREB 3VFUA 4MCZB 1T5WA 1KXQE 1VADB 2CJUH 2J8HA 3D2UB 5GRXG 2I26N 5DI8B 3T0VA 3HR5A 1HE7A 1OVZA 1P4LA 1IL1A 4HFWB 4K94L 4HV8B 3P4NA 4P2OB 5DVNA 5IMOB 4K71B 5HHOE 2M26A 4MQ7A 3ARFD 1HXYB 4K8RD 4HK3J 5D70L 5D4QA 3MA7B 3B4NA 4GS7C 4ELME 3DRQB 1KCVL 5CSZA 5EU4A 4G9FB 1K6QL 5DJCA 1CD8A 1OAKH 1LK3H 4MHHI 5T33H 4G43B 1RZGB 4X4YA 3MLXH 2ATPA 4X5XA 4D0CB 3B9KA 1ZGLB 4ZS6C 4G6MH 2JF1A 3DHMA 1H0DB 1SM3H 3UJIH 4HAFA 4IJ3B 4KUCF 4S2SB 4FP8H 2DM4A 1HSBB 3MUHL 5BQ7A 4P5MA 5ISZE 4JQXA 2WM0A 2DDQH 3RPIA 3WHXA 3MLUH 1CDIA 1L6XA 4W68A 3ARYA 4MWFB 1KG0A 4CN1A 4ODHH 3QPQC 2M2DA 1SVZA 5D7JA 1FPTL 1FFNB 1ZV5A 4U2ZA 1V05A 2CO6B 4FQCH 1G9MC 3EYVB 5LKNA 4YNYB 2OJZH 4FTVA 5D93C 3VI3E 4H26B 4K3DL 1JZ4A 4GKOA 1RJCA 4TTGA 1KPUB 4YBLB 1AHWC 3DMMC 3VXSE 2XKUA 4XP4L 2ITDB 1AGDB 1WFTA 4OJFH 1CLOL 4PGZA 1ZLVK 1A3LL 2FGWL 3GNMH 5TQ2L 2CMRH 4GAFB 3VW3H 4JN1H 1VACA 2B1AH 2VXUL 4JZNA 1WISA 1DP0A 5EU7C 3PQYA 2C4FT 4S1RH 4F3FB 3EYFA 3ARGB 2Z8RA 3IU4H 1KSRA 4KDTC 5CINH 2E27L 4XP9L 4GBXD 3QG6B 2QSQA 5F6IC 4KFZC 1KLFA 5I8OH 3WJJC 3E6HB 4CW1B 2EDWA 2EIBA 4KMTL 5FXCH 4K23L 5D2NC 1C12B 1MLCB 3MRFB 5F9JA 4WU5A 1GYAA 4L8SC 2YPLD 2BVQA 3CVHH 4KPHH 4G9FD 2DLHA 2R69L 1VEMA 1PLGL 1OGTB 3VXQB 4L4TE 5EUKB 5FKPB 2BSSA 3QCVH 4ORGB 2H8PB 3KYNA 3MCG1 4UV7L 2OSLB 5KSBA 3SJVD 5JPNB 1RVFH 4Y8DC 2EO1A 5FDWA 3HZMB 3QXVA 1WC7B 2X44D 1XIWB 4WI6A 4XPTL 3SDDA 3DYOA 1YMMD 3VJ6A 2R0LH 1WCBB 1ZWIB 4M7LT 5F9OL 2CR6A 2XKNA 3NPZB 1B0RB 3KPPB 15C8H 2GW5A 2GAZA 4JGUA 1AO7A 4CDHA 3G6AB 5IVXE 5L2JB 5MEOA 1JK8A 5E95B 1NC4B 5FO8B 5SX5K 4Q97A 3ILQC 4FHBD 1K85A 5ANMB 1F4HA 1FCGA 3DGGA 3BKYH 5GHWH 3GBLA 3FO2B 4XPAH 2VOTA 1YY8A 1YDPB 2IAMC 2OZ4L 4PJAB 5T3ZL 5CJQH 3UYRH 5BV7B 1I7UB 2XYCA 1UA6L 2GJ6A 3QI9C 2EIDA 5C0DB 1KNOA 1HEZB 3TP4A 4PRPB 4NGHH 4P46A 2X10A 3PWJA 5IMMB 4M93B 3U0PA 1LK2B 2W9EL 2HYMA 1GRWA 4N9GA 3RIAF 4UB0L 3QDME 2X6MA 1B3JA 7CGTA 4PY8I 3UTOA 5DJ6A 1JWSA 1X4YA 1LO5B 1EJOH 1JUFA 1QSEA 3RP1A 5BZDB 1KC5L 1FNGB 3UX9B 4O58L 1KCUH 4AEHL 2BNUB 2R0KH 3RX7A 5KN5B 5CKAA 1FV1A 2XZAH 3LQAC 5E2TH 1QEWB 4PJGE 4NOBA 1IMHC 1H3TA 4BM7A 1RJZA 4JLRA 4HS6B 4YAQA 4ZD3H 4EUPG 3ULUL 1QSFE 1XGRA 3CVHA 2V17H 5CJ5A 5KTEH 5ESVB 3KPSE 3PV6A 5HPOA 2H3NB 4U7KA 4YHYB 2Z92B 3U1SL 1H3PH 3MRDB 3L3DA 4PJ7E 4QXGH 1T6VN 2QSCL 3SGEI 2ZUQC 4Y4FD 4HKZB 3FQWA 2WBJA 2P8MB 4MAYC 3FT3B 4PV9B 1M6OB 1JZ2A 2WP3O 3CSBA 3S36X 4ERSH 2BNQB 4EDXB 3O2DH 5IB1A 2D7PA 1ZLUH 4GMTL 4IDLA 4HUNB 1IKNA 4WU7A 1E27B 4DAGH 4U6XB 4HIXL 2DMCA 4ZFGL 5ILTH 1TMCB 2E8YA 1CFQB 1Z5LA 2A6JA 1CGSL 2NZ9D 3HNTL 1UVQA 4UOW1 2VN4A 4WI4A 3CFDA 3A6CH 25C8H 1HSAB 4JGMA 4NKDB 4FS0A 2C3VB 4E41B 3QDGA 3L3IA 4RA3A 3RWDA 3F7RA 3QUZB 4KHXL 3QUYA 4CADB 3BPOC 1TXKA 1G7JA 4N1HB 3LD8C 3C5ZB 4UT7L 4ALAL 4LCCC 2X4RA 1OCWH 4X6DA 1EAPA 3LOWA 3D18A 4H20H 4H25B 1RJLB 1T89C 2YMXL 1DR9A 3L6FB 1DDHB 4S1SH 1AQDB 3EGSA 3WUZA 3QWQB 3QR2A 2BY1A 3VFSA 4H0IA 2VIRA 1FNAA 4LU5H 2AJSL 4NRZB 3WUWG 2ICES 4GG6E 4F7CB 1FL3A 5D5MF 3GSWB 1VGEL 2F5BH 1QRNA 2VNCA 4HFUH 3FZUD 3ZHLA 1GGCL 4KTDH 4IOFC 1CFVH 4NNPH 4NFBA 5DHVB 3WFDL 3NCEB 4NO5A 1F4YH 5DA0B 3UTSA 5T1KA 1DEDA 1KLUA 2VXSL 4KGLA 4XTRD 4LLVA 1QLRB 1NCAL 2XZQL 3MBXH 2R2HB 1BLNB 1OAQH 4U1LB 2XQYK 4LLMA 2MTPA 3S3JA 4ELKA 1D6EB 1PY9A 5EZJB 1E4JA 1CT8B 4M1DL 3EOBB 5EOCL 3QAZC 1H3XA 1Q0XH 2YUWA 5C0AB 5ESAB 3TNNB 4URTB 4Q6IC 1JPSH 3HI5L 3B83A 4W6WB 4X7TA 1FG2A 3AU1B 4PJXE 3IFPB 4LVEA 4LSQL 1U91B 4RBPK 4HIJA 4AENA 3QB7C 3B3IB 2NR6D 4KV5E 4DEPB 4Z95H 2FDBP 5IESL 2QQLL 3K2MC 2CPCA 3O2DA 4M62H 3V52L 4M6NL 3D85D 4MNQA 1AKJA 3QEQA 4OF8A 2IPUG 4AL8H 3C2SA 3VRLF 3JWNC 3PGFL 2VXVL 4LCIL 5DD6A 4NKQB 2AW2A 2B5IC 4CL7A 1IAKB 3OGCB 3SHSA 4YHIA 2YPKA 1EK3A 3QA3B 4HUKB 4O4YH 3CSYA 5B3JF 4WWKA 2VQTA 1XGYH 3V4PH 4ISVA 1OAXH 4M7ZB 4J8RA 5DJDA 4AQ1B 3TEUA 4IRSD 2Y7QB 4MA1C 3GSXA 1MCDA 2VLRE 1DQLL 4WW2A 1OAUL 4YDVB 4XNZB 5GRUH 4L8DB 4U1HA 1QFWH 4OQ1A 5BVPH 1RFDH 5JHDB 3TFKC 1F58H 1KYOJ 2UVFA 3AS0A 5EUOF 4RQQB 4ZUVA 4MMZC 2AXJA 5JQ6L 6CGTA 5CD5C 1R6VA 4F7TB 3S4SA 1B9ZA 2DQHH 1UM5H 3O3BB 5FYKL 1I8IA 1ZT7B 2EEAA 4RRPG 4TN9A 5IG7A 1OHQA 2IANE 4OB5H 3PF2A 1UXSB 1FYTB 3O3AB 5BCAA 4HUUA 3KR3L 2X9WA 4O9HH 5C0RH 2ZPKL 1TTGA 2I9LA 3EDKA 1MHPL 4YC2C 1I85C 1T5XB 2WBKA 4PRIE 2NY0B 1ZLWK 5B39A 1U3HD 1TZGH 4QXUH 3TVMB 1U95B 5TDNB 4HMCA 3AREC 2NY5C 5B8CC 2BSRB 2DM2A 1DBAH 1YY9C 5E94A 1G1YA 3K4AA 4M1CC 1P9MA 3QWRA 1P1ZB 3IDNB 3BJ91 1S7UA 4PUBH 1CCZA 5ESQB 3WDHA 1CDCA 3SEPA 4KKBC 3TBYA 4LLDB 1W0VB 4DFHA 5DFTA 5HJ3B 2W07A 3TC9A 1JHKH 4PB9H 3LEXB 3WFCL 1MCHA 5KS9B 3O41B 1NEZG 4KK5D 3GFUA 2DJ4A 4QRSB 1AY1H 3NABH 4YXLL 4XNUH 2VXTH 4NO2B 2Z9TA 3PL6B 3BIAX 2MKWA 1TVDA 2VYRE 4JY4B 4XMLH 3RVXC 1P84J 3UJJL 1NDGA 3FMGL 3L5WB 4G7YL 4V2CB 2OL3L 1SYSB 4JFXB 5JHDD 5I8KL 3RL2B 5C0CB 4JRYB 1LNUB 2K7QA 3ZE1F 4WTXA 4QXTB 5FGCB 1W72B 1T2QL 4WDIA 1A1OA 1P2CA 2AXFB 3CLEL 4HIIA 1YNTA 3RWJA 2LVEA 3FN0L 1I3VA 3FO1B 1MJ7H 3U36B 1CLCA 3OB8A 4QHLB 2P24B 3ES6A 5C70A 4GBXA 5FUOL 1YEKL 4I18B 3D5OF 4LCYA 2WUBH 4ONGL 3VH8A 2XN9A 1NCDH 2W65B 5A16B 4PS4H 5DEFA 5A1AA 5DUBB 3BQUA 3GHBL 5I1GL 3MRGB 3U7WL 1LP9A 1ZXQA 1CDYA 4CJ0A 1WFUA 3IF1A 1C5DB 5I66A 1U8IA 3F65A 3ULSB 1JNJA 4NSKB 4O2CB 2IMMA 4FQJH 1QACA 1S78C 3WXVH 4HGWA 3UAJD 2VITB 1Q9LB 4KQ4H 3MOAL 1AD9A 4MXQD 3GI8L 3T8XB 4NUGL 5GJSL 5DRNA 1BBDL 3MLSL 4NCC2 1FGVH 1MWAL 2OR9H 3DIFA 1VFBB 1WZ1H 3SGJC 4M8QA 5E9DB 3WBDA 4LNRA 5JORA 2VLJA 4NM4H 3V8OA 4OCLC 5ITBH 3VFUB 5HHPA 2HJFA 2JJSC 2YRLA 2VZSA 1C5BL 3C60C 4CVWA 3SE8L 4XVJH 1P4LB 2JCCA 1IL1B 5ANME 1A64A 1VFAA 2WSKA 3IXTA 1C8PA 3PL6D 3P4NB 4WHYG 3LN4A 2RAMA 2R29L 4J3WA 1KELH 4MQ7B 5DT1H 1MCCA 4JFED 1E6JH 1RUPH 4PJAE 3S34H 1JHLH 1SMOA 1MQ8A 5DEGA 4N0CD 1QRKA 4Y8AA 1U3ZA 3GJEA 5EU4B 2CGRH 3SCMD 1V7ML 2DYPD 3BRDA 4PRPE 4X4YB 2ATPB 4X5XB 5CGYC 1K4DA 3B9KB 3GJFH 1J1XL 2VB5A 2W0LA 1PJ9A 1SBSL 3P9MA 4JCLA 1PKOA 4OZFB 4OQTL 3TBWA 2NX5A 3FRPG 4YUEH 1I3RA 1GXEA 3QIBA 4OI7A 3GKZA 5E2UH 4W6YB 4L3EA 4ODXA 4QWWC 2VH5L 2EDNA 2DTSA 1Y6KR 2OTPA 4RISH 3WHXB 1YEGH 1MI5A 2A73A 4UNVA 3EAKA 5D7JB 3AS1A 4RAUB 4OFYA 4OF6A 1IBGL 2EEDA 5INDA 4D9RE 3WMSA 1YNLH 2R56L 5LCVL 3S7GA 1S9YA 4UDTA 1I8LA 4AJ0A 3NFSL 5IFJA 3SGDH 1QA9A 2P4AB 5IHBA 5T1DL 1AP2B 1P7KB 3T4YA 1NPUA 5E08L 5F1SA 5HPMB 4HLZH 4I3RH 3JV0A 4R96B 3UTTA 2APWA 1KN2H 1II4E 1I1AC 1N59A 1LEKA 1VACB 4J7RA 2G60H 5C0JA 4JZNB 4Z7UE 1W0YT 4MJIB 1Q8MA 3I50L 5TJWK 4OKVB 3EYFB 4POZC 2R8SL 3V0WH 3MBEA 4KJQC 2X41A 3VD9A 1CR9L 3QNZB 4JQVC 3JTTB 5A40E 3QPXH 2PTVA 1HI6B 3MLPA 3N50A 2NY4C 5BS0A 5F9JB 1WK0A 1RIHL 4WU5B 5FOBA 1J8KA 3REVA 2O93L 2BVQB 3VXMD 5E4EB 1U8PA 1JNNL 4UTAL 1N6UA 3UMTA 3OG6B 4I1NB 1INEH 4D0DA 3BO8A 3E8UH 4MDIA 3RZWA 3MYZA 4WW1A 5CJXC 1Q38A 2FD6H 2J3SA 4HKBA 1S5HB 2AEQH 3FOMA 5DXWA 4PJCB 3ARPA 3GJFA 3SDDB 3LPWA 3EO0A 3VJ6B 1HHHA 1NAMH 4U7MA 2GAZB 1AO7B 1N64H 5FKAA 3VXUE 5MEOB 1JK8B 3I9GH 3A67H 4BSWA 4AIOA 1JWUA 3B2UD 3EFDL 4QRPD 1EEZA 3KXFA 1MRFL 3DGGB 4GXUM 2X1XR 3PWPB 1GC1H 2ARWA 3WSQH 5KS9F 1YY8B 3OKLB 5EOTA 4LDOB 2FR4A 1BFTA 5EA0H 1OWWA 3B5GA 1JV5B 2GJ6B 1KNOB 4ZAKC 2MFNA 4DQOH 3MACL 5F8QC 4P46B 5EU6D 5KSAB 3PWJB 3U0PB 1G9NL 1SEBA 2IPUK 3X12B 2HFGH 4S1QH 5EG6C 4N9GB 4FQQA 1TVBA 2IFGA 5HSFA 2X1OA 1JF5A 5C0AE 3SE9H 1BQLL 3QDJB 4YBQC 1KN4L 3KHOA 5DJ6B 1JWSB 5HYJB 4OCXH 4EDWH 1JUFB 1QSEB 5AD0A 4YDLB 1PY4A 1WIUA 3Q5TA 1NGQL 5SX4H 5TH2A 5MEQA 1EV2E 1AR2A 1WT5A 4QHUB 3TM6A 3QP3A 8FABB 4RAVB 2HKHH 4NQEA 3W39A 4JKPH 2VDOH 3D85A 4PGEA 1KEML 2NXZC 1MRDL 4WENB 4EI6B 5CP7B 2FJHA 2IFFL 3BN9D 1MJUH 4OFDA 1QYGH 4JEGB 5E6ID 4N1EA 1AJ7H 3X13A 1FNFA 5C2UB 1RJZB 4JLRB 2CRIA 3DI3B 5GSRB 5AYUL 3I6LD 3CVHB 3L5XH 4RFOH 3G5VA 1KLGA 3RWFB 3PV6B 2RGSA 4PG2C 1U8KA 1MIEH 3L3DB 1KB9K 4N5EC 1ZS8A 5KOMC 2AKRA 3RIFK 3MODL 1AIFA 1ND0B 5DUML 5HYQA 1DN2A 3FQWB 3NVQA 4RGOL 2WBJB 5FYLD 3CX5J 1OP9A 2EYTB 1CVRA 3IRZA 4M1GH 4HXAL 3G9AB 1F97A 4FA8A 4XGZA 1TPXB 5IB1B 4LIQL 1NAMA 5BO1L 4N90D 3K46A 4WU7B 3N0PB 3IB4A 4K7FA 9CGTA 4JDTH 4XX1G 4C54A 3WO4C 4AH2A 1Z5LB 5C2BH 2H26A 2Z8SA 4Z7OE 4EBQL 1UVQB 1NUFA 4ZG1A 3CFDB 3QDGB 3L3IB 2EDBA 5KSAD 2V7NA 3RWDB 1N0XH 3QUYB 3O3DA 1G7JB 3QH3A 1ES0A 2X4RB 4X6DB 3F5WA 5IFAH 3H9SD 3D18B 3S88L 1FYTE 3QDJD 3SOBH 3EGSB 1K2DA 4NFCA 4V1DA 2C4XA 3VFSB 1G7IA 4NUJA 4DKFL 2J8UB 3ARDA 2NY1B 3ROLA 3RVWD 2JK5A 4ZFOA 3GM0A 4IRZL 4X7SL 1YNKL 1RURH 4FFVC 3HAEH 1FHGA 2EDXA 2VDML 3HZKB 3K2UH 5FB8A 2VR4A 3MROA 4WO4D 5DUPL 4BSVA 2V2WA 5GGVH 2APFA 3KYKH 3O45B 4XVUD 1AD0A 1Q0YL 4P99A 3CK0H 1PSKL 5HGHA 4NO5B 4UT9L 1QFWI 2V7HB 5T1KB 4NO0B 3WXWL 4H0HB 1MCEA 4H8WC 1FNSL 5B38A 4EI5C 1H5BC 4DWHA 2FBOJ 32C2B 4ODUA 2YHGA 4LLMB 4Q9QH 1IC5L 4KRPB 4ELKB 5C7XH 2NXYC 1K5NA 2HMIC 1RUQL 2ZZUT 3RDTC 2DQDH 2SEBA 4NNYA 4X7TB 5J13C 1HWGB 5SWZB 1DCLA 1FL5A 1UACH 1T80A 1F6AA 3MMEB 2R0WH 3E3QC 4OGXL 1JN6A 4AENB 2DBLL 5AEAA 2XY1A 2XZCH 3U4AA 1FNLA 1RULH 5C1MB 5C0CE 3GKWL 4NN6B 1KB9J 3RWIB 3N1GC 4LFHD 5E2WH 3GBNH 4GW1A 1F90L 1LWRA 2ZUUA 3PJSA 3WFHB 2Y6SD 1A5FL 3WFBL 3VWJC 2VZOA 3BZ4A 5DD6B 1CBVH 1G7PA 4YHKL 3T4AA 5GZOD 3Q6GH 2Y07H 4YHIB 1YEFH 1UWEL 3FN9A 5TE7L 3GO1H 3S36H 4UQ2A 1PQZA 4P9HH 3T08A 2X1QA 5GS3A 4Y4KD 4C83A 2VLKA 3B5HA 4PJCF 5DJDB 4ZXBC 1X3DA 1UFUA 3GSXB 1MNUH 2BX5A 3V5DA 4CNIB 2IG2H 4MGXA 4S10A 2EC9U 3J8F7 4OF7A 4LSSH 4WW2B 5ERWA 2PW2A 1MCWW 3O9WC 5MHSE 4Z76B 3PGDA 3HAEA 4XHQA 2GI7A 1AGBA 1A22B 4XPBH 2RCSH 3V2AR 3KPOA 3CCHA 4NQSA 4ZUVB 1GOGA 1CLYL 4OLYH 5E9DE 3HI1A 4IOIA 4KRPD 2WWKT 5DFWH 5C09D 3S4SB 3ULVD 4Z78A 1D6VL 3LQZB 4MXWL 2I9TA 2I60L 1CG9A 2PO6D 2ADGA 3P30L 4Y16A 4F33B 1QBLH 4TRPH 5IG7B 4JDVA 3O6LL 3PWVA 3C6LA 3O0RL 4R6UA 1KTRL 5SWZD 4E9LA 2FCBA 2I9LB 5EBGA 2JJUA 5FM5O 3S5LG 4GAYA 3MRJA 5B39B 4JQIL 3W9DA 2VQ1A 4EIZC 4LVHB 5I1JL 5E94B 1JGDA 5GRYA 4NDMA 5D1QA 4TSCL 3X3FL 2APXA 4BH8A 5L0QC 2XWTA 1G7LA 1SQ2N 4ONOA 5GS0D 1UM6L 1CICD 3HMXH 1NGPH 1A3RL 1NAKH 4NIKB 5DMYA 2PXYC 2ZSWA 3IETA 4PY7A 1R3LA 4HULB 3X14B 4NNXB 1I9RH 3F6IA 4Y4HA 4OFPA 4WV1C 5D2LA 3RX5A 1OAYL 3P4MB 4CBPA 4J6RL 4OGAD 5GRZA 4K9EC 4N0YH 4GKNB 5IOPA 1NKOA 2FB4H 4RBPH 2X40A 4U6TA 3M8OH 1XF5A 1NDGB 3WE6B 1H9VA 4FTVE 3NN8B 4WVRA 4GH7B 4JPVL 4X5LA 3ARUA 4KZDL 3QUXC 3EO9H 5HI4D 5I30H 4R8WL 1FFQA 4WGVB 4M4PA 1JGLL 4XPFL 4RFNB 4NN5B 4GQ9H 1GSMA 1BM3H 5K9JL 2ZUSA 1RZ8B 1MFEH 4RMRA 4XI5C 3VGAC 4GRWH 4WDIB 4MQXC 5CILH 1A1OB 1P2CB 3MJ7A 4C4KO 3C2AH 3HC4H 2BMKA 3PHQB 4U6HA 5F7YC 3RWJB 4U33A 1X5GA 3PQYE 5I15L 4WFHE 3ES6B 1M71A 3L9RA 2OMBA 2CKBH 2ORBL 4OLZH 4NWTL 1L7IH 4LCYB 5GZND 2XN9B 5LXGL 4LAQL 2FO4A 3FCTA 4X6DF 4IMKA 4AMKL 4JM4L 1W72L 3AXLA 1NBYB 4I3GA 2MOVA 4R0LA 4U6VH 1GPOL 4YEFA 2EDKA 1I3GL 3O6ML 2LAAA 5I66B 1OTUD 1U8IB 4LSVH 3CXHJ 3BUTA 1MFDL 2J8UF 4BZ2L 2D0GA 4HGWB 4W4OA 1BIHA 5L6YL 5JO5A 5D7KD 2PR4H 5KSBE 3S9DB 1EH9A 1R3IH 4LHQB 4HPYH 4I48A 2D7MA 3SGDI 4FXGA 3V4VH 3D39E 2IPKA 3DIFB 4JVUA 1AXIB 1A9EA 4M8QB 4AEIH 4OT1H 4LNRB 5JORB 3VDBA 2VLJB 4UV4L 3WIHH 3O8XA 1AO7E 5ALCL 1QPPA 4D9QE 1MVFA 4XWOC 2A74A 2X42A 2KPNA 2IBZX 5HHPB 2HJFB 3ZE2E 4QRPA 3VGGA 5I6XC 4BUHA 5DQJB 3ZT7A 1A7OL 2JCCB 4GXVH 3ULVF 4PR5A 1VFAB 1JTPA 2EH8H 4ODVL 3FB8B 3IXTB 4N0UA 1K8DA 3LN4B 5IROC 1CE6B 3RZCC 1T1XB 2RR3A 2YD3A 3GSRA 3TO2B 4JE4B 5DEGB 5JXAH 3I2CL 3GJEB 2FGZA 1BQUA 3H7BA 5FCUL 1VB9A 4LSRH 2YBRA 3F12A 1EX0A 1K4DB 1NL0L 2H45A 2XRAL 5CHNA 5F21B 2IALA 4WFFD 2NMSA 3MV9A 3P9MB 5IB2A 1J7VR 2QADC 1N6VA 3HNSL 1PDKA 3TBWB 2NX5B 2J2ZA 1I3RB 3AM8A 3OAZH 3QIBB 3E6FA 4BUGA 1EVUA 1MEXH 5TGBB 4QRRA 5AG9A 4U1MA 3B9EA 4I77H 4L3EB 4ODXB 5HD8D 5L8JB 3HE7C 2AJXH 1QSEE 3TBTA 3QRGH 4OIAA 1QSVA 1H3UA 1KFAH 2A73B 1MI5B 1FLRH 2UY7A 2JJTC 4MHHG 3VMOA 4U6YA 2VZ1A 1HQ4B 2CKBA 4U1GC 5TFSH 1CD1A 2DJSA 4Q0XL 4OZIF 2VXQH 5I1DA 3GUTA 2BNRA 4JM2B 2J5LC 1I1YA 3NIDE 4ZS6D 1S9YB 3Q48A 3MXVH 1JGVH 4HK0A 5I1HL 3BN3B 4UDTB 4OTXH 4LSUH 2BRRL 3RWGA 1R3KA 4PIRF 1HYSC 1DQJB 1I9JL 1V7NH 2J4WL 5GGVY 3UTTB 3FQTB 2B4CL 2NYYC 4R4FH 3ZDXF 3JWOH 1LEKB 3G6JF 2PUQT 3PP3H 1BIIA 5C0JB 5D8JL 3U82B 3DNKA 1UCBL 3MV11 4IDJL 3PV7A 4NQDA 3ABZA 4Z9KB 1RIUH 3WIHA 1DBML 1BFOA 3MBEB 1FRGL 4YBHA 5GRWA 3NGBB 4MS8D 3HI6H 1FBIL 2HJLA 2UY6A 3IYLW 2FH6A 4JO1H 1UYWL 1A9BA 2X4QB 5SX4I 5BS0B 3DMMD 5F96H 4TOYH 2N1KA 3LKRB 1MFCH 3OAUL 5HHNA 2FEEI 3QDGE 4D0DB 3BO8B 4DN3L 4MDIB 1MJ8H 1YJDC 1FORL 3S3SA 5IQ7H 1LEIB 1T66C 4X6DE 1Y6NR 2CJUL 4HKBB 1RZJC 4O51A 1KBGH 3TZVD 2AEPH 3GJFB 3EO0B 3CFJA 5F93C 3I02A 5HHQB 5GRVL 2KQNA 5FKAB 4LLAA 4ENEC 4CMHC 4ZYKA 5C8JB 3ARRA 4BSWB 2DBJA 4M6OH 1JWMB 1FSKC 1YA5A 2BHYA 1YN6A 3RIAK 1EEZB 3ULUC 1OAKL 1LK3L 5T33L 1QRNE 3WNOA 3MQIA 3MLXL 4N1CA 1DJSA 2Q76A 1P7QA 4OZHA 3CGTA 1WAAA 6FABH 2I07A 4G6ML 5EOTB 2FR4B 3IDJA 5KSVA 2V2TB 1SM3L 3UJIL 2FLRT 3UTSE 4PTTB 4HG4K 4FP8L 1WCQA 4PD4J 5IF0B 4XH2A 4G7VH 3BGMB 5CZKA 3ARBD 1IM9A 4AYFA 1U8LA 4NBXB 1X9QA 1SEBB 2DDQL 2LTQC 5HGBA 5E03A 3MLUL 3HMWH 2F54A 2IH1B 4FQQB 4ODHL 3ILQD 1TVBB 4X6CA 4LCWA 1JBJA 1VSCA 5IBTH 4P59H 4MNGB 5IW6A 4FQCL 1RZ7H 1ZGLP 1ZVHA 4JZJC 5MEQB 2OJZL 5TH2B 3U30C 5L8KB 4WEBH 4ZTPH 4NQEB 3W39B 3WV0A 3FTGA 5ABDE 4Z7QE 2GITA 2HTLD 4MNQE 2FJHB 3KPLA 1CDGA 2Q8BH 3GMLA 5F9AC 4OJFL 2ZUYA 3QEQE 3GNML 4TUJA 2QSVA 5DR5H 3O4LD 1W0WB 2CMRL 2EE3A 3DXAE 3VW3L 1T4KB 1YN7A 4UBDD 2B1AL 2P5WA 3SBWA 3K81A 5J12B 2ZNXA 2E8ZA 4YDKH 4MJ2A 4S1RL 5I9QB 1U8KB 2XKSA 3IU4L 5CINL 1YYLH 4KAQH 1FVCA 2AKRB 5I8OL 1AIFB 4HWBH 4Y4KA 1OQXA 2COQA 2DLFH 2NY3D 1U92A 4XMPH 5D1XB 5HYQB 1UM4H 2KBGA 3GMPA 2FL5B 2IF7A 1U3JA 3CJJA 4OM1H 2BVYA 4KI5C 2H32H 4I13B 4XGZB 3CVHL 1NAMB 4KPHL 1U3YA 2C4FU 4OV5A 4U1SB 1S3KH 2YEZA 3BDBA 1YEDB 3ZKXB 1WF5A 4HF5H 3QCVL 2P47B 4IRJD 1PD6A 2ED8A 2JCCF 1UGNA 2Z31A 3OKMA 4LLQA 1RVFL 3JTSA 2VZUA 3LVEA 4MQSB 1OTTC 2RIKA 5E00B 2EZ0C 5C6PB 2UZYB 3ZMRA 2R0LL 2V7NB 3TO4A 3PDDA 5I71C 15C8L 2UUDH 4LSDA 4J3OC 2H2PC 1ES0B 1FZKA 2DD8H 2K9UA 4M43H 2Q87A 3BPLB 2EIEA 2MCG1 4PRBA 1X5HA 1K2DB 3BKYL 5GHWL 4XPAL 4V1DB 2NY6B 8CGTA 2GHWB 4JN2B 1G7IB 4BK4A 1DLFH 4NUJB 1SJXA 5CJQL 1H15A 4WHTA 3UYRL 4U2YA 3E0GA 4E42A 4L3CA 2A6IA 5FB8B 1DLHB 3MC0A 4BSVB 3SQOH 2V2WB 2BVPA 3TGXA 4PJ8C 1RV6X 4LDLB 4NGHL 2WMPA 2XA3A 5E70A 4PJ9C 4NQCB 5HGHB 5I1AA 2CRZA 4JM2F 5HI5D 3SKNA 3OX8A 1X5AA 3ZDZE 2ERJC 3TCLA 4ODUB 1EJOL 2YD8A 3BEVA 4KZEH 1NUGA 5JNYB 1K5NB 5I16A 2VQUA 1JHTA 1KCUL 3PXJA 2JB6A 3QIUC 2R0KL 4MD4A 1MRCH 1ZT4A 2XZAL 4HWBA 4UAOB 1FL5B 1L0QA 4XZUA 4I4WA 5E2TL 1F6AB 5TE4H 1SJEA 1KGCD 4U1JA 3HRPA 1A6AA 4CN6A 4ZD3L 4BYHA 3QO1A 2H32A 3RTQC 2V17L 5KTEL 5ELIA 3WLWD 4XP1H 1EHNA 3T3ME 2HLAA 4GW1B 5ICZA 1H3PL 4PJEF 4PV8A 3PJSB 5JTWA 1Q9KB 3HC0B 4QXGL 5KVEH 2ICWJ 4U4BA 1G7PB 1A4JA 5JR1H 3T4AB 2V9QA 1M7XA 3HUJF 4UI2A 5DC0A 2M1KA 4BZYA 3LY6A 1NFDA 4ERSL 1WEJH 1N26A 4UQ2B 3O2DL 3PUCA 1PQZB 2XN9E 2NY2B 2ZUWA 2DLEA 3RKDC 4DAGL 4C83B 1S9KC 3BPNC 4JRXA 5E8PA 3VMNA 2VLKB 5ILTL 1S7SB 4OIIH 1L7TH 2YPLE 1LP9E 3EO1A 1JZ7A 4WJ5B 1MFNA 3C8HA 5ERWB 3A6CL 25C8L 4EKXA 1XGTB 3VFPA 2DWDA 5E24E 3VWKA 3SJVE 3PGDB 5GGRY 3HAEB 3V7MA 4NQCD 1DVFD 1NDMA 4H5SA 3DARA 4TVPH 1VFMA 1OCWL 3B9AA 3KPOB 3CCHB 4NQSB 1G9MH 3EOYG 4H20L 1NGYA 3ETBF 3F7VA 4B0MM 3HI1B 4YPGB 4S1SL 3TN0C 4UIKH 4QY8B 4WI3A 1JPTH 4Z78B 1CG9B 4Y16B 2ADGB 3RNKA 4LU5L 4PB0H 5CEZH 4HUXA 2ARJB 5IHUH 3DX6A 2VJXA 5DTFA 4P23D 3PWVB 2AJ3B 3C6LB 4CVUA 2FEDC 1J05A 2F5BL 5FGSA 5F1IB 3VRJA 3W9EA 1NGXA 3G5YA 4HFUL 5DS8B 3P0VH 3T0DA 3DWTA 2FJFA 4KTDL 2EIZA 4KRLB 2OR8A 4GAYB 1CFVL 2C3XA 3MRJB 4NNPL 3DO7B 4OZFG 5L2KD 3QXWA 4Y5VC 4XP9H 1F4YL 4XHJD 2ZOLA 4HJGA 1MFAH 1RHFA 4X7CC 3T0BA 4LKCA 3KYAA 3F7QA 5CD5D 3O6FB 3ARXA 3MBXL 1JGDB 5D1QB 1MAKA 1OAQL 4BH8B 5F3HB 2XWTB 1WQVT 2KZ1B 3ARFC 4K8RC 3NIGE 4RSVA 1PEZA 4X4ZA 4Z0BH 1TVHB 3D3VD 3W0WA 4EQ2A 1Q0XL 2NX5E 2GTWA 3IETB 3BIBX 4PY7B 3PWLA 1R3LB 1JPSL 1NLBH 3HG1A 4L3EE 1DUZA 1QBMH 4KK8D 3BP7A 4Y4HB 3TIEA 2DWEA 4FFZH 5D2LB 2EYRB 5F7LB 4HXBH 1T7YA 3D0LB 4Z95L 3ZTJG 3DVFA 2N4IA 4M62L 1W2KT 5F88B 5IOPB 5BZWA 2B7DT 3BD3A 4P2CG 2QL1A 2Y36H 2I27N 2VAAB 2OCFD 4AL8L 4QT5A 3U0TA 5K9OA 5E4IA 4I0PD 3FFCD 4HWEH 1NGZA 3BOVA 1X5FA 2P46B 4GO6B 4B50A 1URLA 3D48R 4TYUA 2CDGA 3UTTE 2VL5B 1OY3B 4O4YL 1VKXA 4OCYH 1RK0B 5K33A 3MJ7B 1IAOA 1KIRB 3IDGB 1XGYL 2BMKB 2HG5A 3V4PL 4U6HB 5JZ7D 1OAXL 2GIYA 5BOZG 4QTIH 4NHUA 1M71B 3L9RB 2CK2A 4QOKD 5BXFA 3QEGH 3IDYC 2DQFB 1NGWB 2FO4B 3BT2H 3MRPA 2NNAA 3FCTB 1AHWA 2X89D 1FZJA 1LO4H 3AXLB 5GRUL 3O4OC 1QFWL 3DMMA 5GS1C 1RFDL 5BVPL 1SJHA 5BS0E 1FL6A 4JG0H 1F58L 4XNYH 3O6FD 3BRFA 4K71C 4M61A 1D5XA 5FYJD 1MCWM 2PYFA 5JO5B 1J10A 3QXDA 2VC2H 1ACYH 4LVOC 2DQHL 1UM5L 3MCLH 1JL8A 4FXGB 4OB5L 4JJ5A 1I1CA 4G3YH 2C1OB 2IPKB 4WFED 5FOJA 1WIPA 3WJJA 2VR5A 1BP3B 4XNMB 3LQAH 4KGJA 2WZPD 1A9EB 1GL4B 4YR6A 1LVEA 5D2NA 4O9HL 5C0RL 3O8XB 4L8SA 4OI8A 4O2EA 5KSUB 3EHBD 2W60B 2P48B 2UVEA 3U9UA 1TZGL 3OXRA 4QXUL 3STLB 3KNBA 2HAZA 2OP4H 4YZFE 4PLOB 4PR5B 5C0BA 3LPFA 3KXFE 1JP5A 1DBAL 1AGFA 1K8DB 4TTDD 1A3QA 4Z6AT 4OBRA 3I3BA 1MCPH 3KLHD 1HDMA 3KPQA 5HI3D 5A2LH 5IBLD 2ESVD 4LGRB 4PUBL 5DDHA 3H7BB 4F9PC 3V5HA 5DJ8B 4LHUD 4ODTH 2YBRB 3F12B 3NAAH 4DOHB 4UMGA 2JKXA 5CHNB 2IALB 1IVLA 1JHKL 3MV9B 4PB9L 3HZYA 5TDOA 3E6FB 1AY1L 3NABL 4XNUL 2VXTL 4GRWB 3TBTB 4XMLL 4FN0A 2IAMA 3VXRD 2A83B 4HEPG 3QI9A 4HH8A 5DD5H 4U6YB 4NQEE 4OUUA 5CGMA 5A2FA 2CKBB 5T5FH 1TZIA 4P2QA 1BVZA 1HH9A 3AROA 5F7NC 3RVUD 1D9KD 5F6HJ 2NW3A 1AGEA 3GUTB 1I4FA 4RIRB 1XCQA 5CLTA 3T0ED 4MDJA 1CF8H 4HK0B 2XTJE 4LMQI 1PYWA 4HUVA 3MRRA 3RWGB 4M6AA 5FCSH 3VGBA 1MJ7L 4HCRH 1BBJB 4OD1H 2G5BB 5KVDH 3CFKB 5D7IA 2WUBL 5AWNH 4JFDD 4JB9H 5JDSA 1NCDL 3MGAA 5F71A 4PS4L 4Y5YC 4LSPH 3G9VA 1JZ6A 2CK0H 4DVBA 1XIWC 5IK3A 3CFBA 3IGAA 2BY3A 4NQDB 3CC5A 1CFTA 4Y4FC 3MRHA 1O7VA 2HJLB 3C9NA 4FQJL 1VPOH 1FFPA 1OGAA 3WXVL 3R0MA 3UDWC 1KIPA 1A9BB 5I74C 4P2RA 3N06B 4GLRH 4KQ4L 3ECBA 2ZOKA 4MAUH 2X70B 4OSUH 5BMFH 1IQDA 2L0DA 4BK5A 1IGCH 2J7LA 1A6VH 1ERNA 1FGVL 3LDBB 2OR9L 1WZ1L 5HHNB 4NM4L 3INUH 4MAYA 2WNGA 5ITBL 4OV6F 5BV7C 2NZ9C 2CKNA 4CGTA 1YEEH 3VXPA 5CCKH 3WO3B 4O51B 5B22A 3Q0HA 3S35X 4XVJL 2VUYA 2D0FA 1XF4A 2XG4A 3ARVA 3CFJB 3SDAD 4W70A 1TQBB 3QRFM 3G6DH 4QYOB 1MCJA 3C5JA 1BZ9A 3MGOA 1KELL 5DT1L 5CMAA 1E6JL 1RUPL 3S34L 1JHLL 2PCPA 1YN6B 2A0LC 5D2LF 2CGRL 3D25A 4AG4H 2AV1A 3GSOB 5J4MA 4JDZA 4PY8J 4K3EH 2Q76B 4OZHB 1ADQA 2EDQA 1JYNA 4LSTH 4LCCA 4I2XA 5KSVB 5DFVD 3AB0B 4KJWD 1T89A 4R9HA 1K9TA 5IJKC 3QFJD 4YUEL 4L4TA 3HA0A 2VE6A 3RWHA 4MQTB 4XH2B 3FZUC 3MV8A 5E2UL 4DGVH 3HS0A 1IM9B 4PJBA 1KTDA 1A47A 3NOIA 5HGBB 4RISL 1SYVB 2VDKH 1YEGL 2F54B 1QFWM 4HCRA 4LVNB 1J9CT 4X6CB 4XTRC 1OP5K 3MFFA 3KPMA 1YNLL 3ZYJA 3QQNA 4C56A 2XA8H 3BH9A 5DZOA 1JPGB 5H2BA 4OF3A 4NQTA 4BFIB 2R4RH 5DK3A 4P4KD 2NTSP 3FTGB 1OSZA 2ZCHH 2APTA 2GITB 4P5KA 4ETQA 3V6ZB 2PTTA 3GMLB 1PZ5A 4I3RL 4LLWB 3RGVD 4TUJB 1KN2L 5IKCA 2NR6C 4PGDA 1YN7B 4HPOH 2G60L 4Q6IA 1NC2B 5MI0B 2NY5H 3ZE0E 4JPKH 3PP4H 1MVUB 4LEXH 3V0WL 5CAYB 3OPZH 4R26H 3QPXL 1U92B 5BRZD 3VFRB 3GMPB 2VLKE 1L6ZA 5EFIA 4KK6D 4GSDH 1YQVH 2WLZA 3LSOB 1WTLA 3V95A 4HJ0D 1FVEA 4Y19D 3IS1X 1AE6H 2UZIH 3RY6C 5EO1A 4OV5B 2IQ9H 4PFEA 1GHFH 1ODAA 2YEZB 1INEL 3V4UH 3S4SG 4X6BA 2X9YA 3E8UL 4IRSC 1PZUB 2Z31B 4LLQB 5DJ0A 4HX1A 3C87A 2FD6L 1I7RB 2AEQL 3GMQA 1HHIA 1U8QB 2NTFA 4RMWA 2CDEA 4POUB 2XPGA 4FABH 3GI9H 1NAML 3B5TA 5C9KA 1N64L 2QHRH 5B39G 1AGCA 3WIIH 5H8DA 3I9GL 1FZKB 3A67L 4YGVA 4PRHB 4WRLA 5DJYA 5JIHA 4F8QA 1GC1L 4MA8H 4WNQA 3WSQL 2G5RA 1KULA 1H15B 5EA0L 2WANA 4L3CB 2A6IB 3O11A 1BD2D 3ZYZA 3VG9C 3H6JA 4DQOL 3LQMA 1QSZA 5IBUB 4RFEA 2GUOA 4F7PB 3OR7B 1SY6A 2HFGL 4LEOA 1U3HC 4WI9A 4GT7A 1JI2A 4JPWH 4S1QL 5CP3A 4DW2H 3LAFA 5I1AB 4JFFB 3SKNB 1XGUA 2CLZB 3OX8B 3TT3H 1ORSA 3SE9L 5DA4A 3BDYH 3AY4C 4WI7A 1RHHB 4OCXL 3PABA 5CZVH 4EDWL 4IHOA 1I85A 5M95B 1R5WA 4N9OB 4F58H 5I16B 1JHTB 3AREA 1ZE3C 2HKHL 5B8CA 3MRBB 4JKPL 2VDOL 3FT4B 4NC2B 3GSVA 5C07B 4TSAH 1IC4H 4D8PB 3CZFA 1MJUL 2FEEL 3MLYH 1R24A 4I4WB 5GRVK 1QYGL 4FQ2H 4KTEH 1AJ7L 5ETUA 1NUDA 1SJEB 4U1JB 1KCSH 1AXTH 5D72H 4GG6A 3QO1B 5D7LB 4KK5C 1F11A 2H32B 3SDXA 3L5XL 5DGRA 4RFOL 5EZLB 1ZA3A 1RI8A 5TDPA 1YEIH 4KY1H 4ZUWA 4X9FA 3H7LA 1MIEL 1EFXA 4LP5A 2I5YH 2B1HH 1KJVA 3T3PF 1MLBA 2BP3A 1A4JB 5C0FA 2A9NH 5TF1H 1MCBA 1ZHKA 3KWWB 4M1GL 4QOKA 1MCOH 5T1LD 1NFDB 4EZMA 1GCFA 5IUSA 4PRHD 5D1ZD 1RMFH 1KXTB 2NPLX 2X89A 2H6PA 4JDTL 1P4BH 4JRXB 4XXDA 1TTUA 4FNLH 4JFPB 5C2BL 3EO1B 4PJXA 5F7DA 3QXTA 2FSEB 1UB5A 4Y2DD 3VFPB 4RNRA 5C92A 3GRWH 3VWKB 5GJTH 1MOEA 5HTSA 2Y06H 1N0XL 1NDMB 5T3XD 4Y1AA 3ARZA 1OWRM 2DN7A 4JRWA 4KKCC 3VFTB 5IFAL 3L95B 3D0VA 1A1MA 2XZZA 4GRMA 2V5MA 1CXHA 2Y4SA 3KLSA 1U8HB 1WAAF 4S0SD 1NGYB 4PPTA 3SE3A 3SOBL 3F7VB 3UAJC 5E8OB 3TYFA 1R3HB 4JKMA 4MXQC 3RNKB 3T2NH 4HUXB 3DX6B 4QRPE 1RURL 5DTFB 5DURB 1SHMA 4ZSOB 2E9JA 3HE6B 3AFLA 3D69A 3K2UL 3BKJH 5C07D 1EO7A 1J05B 4N0UE 5GGVL 3VRJB 2IGFH 1NGXB 2MWCA 3G5YB 4OZGA 3KYKL 3UZQA 4X6CF 3OJDB 2EIZB 4NPYB 4LLYB 2CQVA 4FQXD 3CK0L 5KVMC 2VLRA 5D7LD 3FRUA 2ZOLB 4F15B 4HJGB 3SGJA 4LKCB 5DRWB 1MCQA 3PL6C 4PJDB 4DUWA 1Y6MR 4Q9QL 5C7XL 3UPRA 3MRMB 1J0IA 3QHTC 2JJSA 4XC1H 3ZL4H 5MEPA 3BIKA 5LJYH 3C60A 1IGYA 3MV9E 4N0CC 2R2CA 2WW8A 3U79A 3W0WB 5ICYA 2GTWB 2DQDL 2XWJA 3SCMC 3F6LA 3B6SB 3RWEA 3PWLB 4QRRE 4GRWE 4I3SH 1D5BA 1DUZB 3BP7B 1UACL 2DWEB 3MJ9H 1UQSB 2R0WL 2ADJA 3BZEA 1UH4A 2IANA 4LQ1A 4W6XB 5E8DH 3X3GH 2XZCL 2IBZY 2JE8A 3U7AA 3F7YA 1RULL 3QJFB 2GSIA 4WUUA 3SE4C 3BEWA 5BZWB 2BNRE 4RGMC 3GBNL 5E2WL 4PRIA 4UUJA 2AXGB 3HN3A 4QT5B 3U0TB 5K9OB 3I6LE 4TQEH 1NMCC 1CBVL 1NGZB 3EIFA 2XTLA 3M1BB 5AZ2H 5MERA 2WQRA 2Y07L 3Q6GL 1YEFL 2XWBB 2CDGB 3GRWA 3S36L 3GO1L 4MD0B 4P9HL 1VKXB 5FYLE 1IAOB 2HG5B 1HH6A 5K59F 5F1OB 1RK1A 4MNHA 1J0HA 4M5YH 3H2WA 2ED7A 3CXDH 4NHUB 4JVWA 4NQDE 1MNUL 5E5RB 5BXFB 1KPRA 3HE6D 2IG2L 4N90E 3P73A 5D93B 2VO5A 4LSSL 4ZOAA 4GRLB 3IVKA 5JIKA 3HKFA 3UP1A 1AHWB 1FZJB 3T3PE 5J6HA 1ZSDB 3E2HC 2JIXA 3JUZA 4FQ1H 1FL6B 3R1GH 4XPBL 2OBGA 2RCSL 4NCDA 1I1AA 1LMKA 4OLYL 1D3CA 4NRYA 4X5WA 4M61B 1VDGA 3V6FB 3I85A 5CEXB 4MVBC 2FX9H 5FECA 1CL7H 4EN3D 3H9SE 1QBLL 4TRPL 3KYMA 2ZJSH 5F6IB 4JJ5B 4JQVA 2QR0A 3SDAA 3QXUA 5D2NB 4TVSa 4L8SB 4O2EB 4NZDA 1NJ9A 1VFOA 3U9UB 2P5ED 4ZO6A 3OXRB 5I76B 1CQYA 1ZLUK 1KJMB 3DV6B 3MJ9A 2YUXA 5C0BB 4R3SA 3WFZA 1AGFB 3PDOA 5EU3A 5CJXA 4OZHE 4U49A 4XPHH 3V0AC 5F89A 4YHMH 3HMXL 1NGPL 3KPQB 3QFJA 1NAKL 4I9WE 1RZFH 4HLZG 4GLRI 4IS6A 3NIFF 3QYCA 3V5HB 3OGOE 1DQQA 4LPVA 5GIRA 4M5ZH 1I9RL 2JJWA 5K9QI 4TVPD 1OT2A 2F74A 2F54E 4YDIH 2VABA 4M6MH 4LCWE 5KSUA 1EXUA 3GK8H 1S7VB 4G6AD 4N0YL 3EYUH 3QZWB 2FB4L 1J11A 2YD4A 2B2XH 2IAMB 4U1NA 3M8OL 2XOTA 3MA9H 4GRLD 4Q9BA 3QI9B 2F53D 5CEZD 2MHAB 2XQBH 1NFDF 1WBZA 4ZAKA 3MNZB 3CFEA 1TZIB 4P2QB 4J3UA 2DM7A 3EO9L 5I30L 1HH9B 5GGSY 5I18H 2NW3B 1AGEB 3UTPD 2GSGA 1I4FB 4GQ9L 5F3BA 1BM3L 1UJTA 4MDJB 2ZCLH 1MFEL 1WWCA 3MRKA 3BH8A 5ENWA 5CILL 3C2AL 2P5WE 3HC4L 1NSNH 3LKNB 4RGNE 4OD3H 1CGVA 3BN9C 3CFCH 1KT2A 4HAGA 3HE7D 5E6IC 4ODWB 4OLZL 2AABH 2CKBL 5D7IB 1L7IL 5KJRH 5BRZA 3QSKB 2GK2A 5JDSB 1LD9A 1TZHA 2DI7A 1F4WH 2ADFH 1ZANH 5EC2A 5C08A 4WI5A 5HDBE 2D9CA 5IK3B 4U6VL 3CFBB 3IGAB 3L3OA 4H8WH 4LSVL 3MRHB 1HYRC 1JF1B 1H3GA 2IBBA 5E56A 1OGAB 4MCYA 2VKXA 1KIPB 3L5HA 4P2RB 2PR4L 3ECBB 4PG2A 3MLWH 1R3IL 4XVTH 4PRAA 4HPYL 4XBPA 3V4VL 2ZUQB 5SWSD 3MUZ1 2NLJA 3KJ4B 5M94B 4AEIL 4OT1L 1S7QA 3T1FA 3WIHL 4MAYB 1RIVH 2R1WB 4JPIA 3HPJA 4KJPD 5J9PA 1YMHB 3Q5OA 4UQ3B 1J8HD 1UH2A 1YPZA 4PJDF 4KKNA 3VXPB 3FQUA 2XIDA 5T3ZD 4GXVL 5KSAC 4N8VA 2EH8L 4ZQKB 5I8EA 3DYMA 3AGVA 4PRNA 4XNQA 3C5JB 3MGOB 5CMAB 1Z9LA 3IU3A 5E8NA 2NY7H 1BD2A 4K7PX 5JXAL 1DQDH 1D5MB 2Z93A 5HHOD 4FZ8H 4YDLC 5J0BA 4JDZB 5A43C 4LSRL 1B0GA 4APQB 3BPOB 1PKQA 5IVZB 4LKXA 3RVWC 4R7DB 1FDLH 1ZT1B 4I2XB 3RIFF 3CFIC 1J1PH 3GMOB 1CGWA 3KYOB 2HVJA 4WO4C 5I1KH 4L4TB 3IRPX 3EW3B 3RWHB 1MEXL 3MV8B 4R2GD 4XVUC 4I77L 5CKGA 4NQVB 2AJXL 2OK0H 4H1LH 1FYHB 3QRGL 4KK9C 1JYXA 1KTDB 2NCMA 1KFAL 4KROB 5B3NA 1FLRL 1Z9SA 3WNMA 5ISZD 1GH7A 3MFFB 2OI9C 2A38A 3UBXA 3KPMB 5TFSL 5DC9B 5D96C 4C55A 2VXQL 4C56B 3BH9B 3NIFE 5IVXB 5GGTH 3NZ8B 3VXUA 3B9VA 2A6KA 5H2BB 3MXVL 4N0FB 1JGVL 4GKZA 5FO7A 4OGZA 4OTXL 4LSUL 1LE9A 4EI5A 1M4KA 1OSZB 1H5BA 4ETQB 1CD0A 5MEND 2ARJQ 1V7NL 4XCYA 1PZ5B 2CXKA 1OW0C 4R4FL 5EZOH 3QAZB 4PGDB 3RDTA 4BKLB 3JWOL 4KMQA 4G80A 1TENA 3VXSD 5D6DC 1J18A 5FFLA 1CWVA 3QIWD 5IB3A 1VESA 3WYRA 4JY6A 2XT1B 4MMXC 1RIUL 2Y6SC 3HI6L 3QDMB 4O02H 4WTZA 4JO1L 3FB5A 4JRXE 3SDCB 5GZOC 3DECA 5HGAA 5F7EH 4UTBH 5F96L 4TOYL 1T0MA 1FVEB 5I1LA 5FUCE 1MFCL 4X8XA 3TT1H 1QO3A 1MUJA 1CYGA 5EO1B 3VWJA 1XF2A 1WZLA 4Y4KC 2B5IB 4RWYL 1MJ8L 4TNWK 3TA3D 2ZUTA 4L9DA 5DQDH 5IQ7L 1NFKA 4HX1B 5E5UB 5C6TH 4FFWD 2FWOA 1KBGL 5JW4Q 3S35H 3GMQB 1HHIB 2AEPL 4YFLI 2CDEB 4ODBD 4ZXBA 4G6FB 4KROD 1WFNA 3L5JA 1KENH 4M6OL 4H1LA 5JXED 1MHCA 3O9WA 5DJAA 2EDLA 5DJYB 4KRPC 3ILPA 3ULVC 2PO6C 1FNEB 4WNQB 4XP5H 4FQXA 6FABL 4M9OA 3UC0H 2YA1A 3ARSA 1IGTA 2ICWI 1HWHB 3BDXA 3O11B 1X5ZA 3JXAA 5GGTA 3X11A 1IC1A 2OXGA 1FZMA 4G7VL 4JKKA 5DRXA 4X0KA 3OKNB 3ORJA 4LEOB 3HMWL 1GVIA 4NN6C 3O3EA 2CIIB 3W0WE 3GMMB 1DANT 4P4RA 1XGUB 1RUAH 1UB6A 5IBTL 4P59L 1DUYA 3HG1E 4ELMF 4HT1H 1RZ7L 4ZOEA 4YC2B 5GS0C 1CICC 1U58A 1EO5A 3W81A 5AAWA 2Q3AA 4WEBL 3AREB 2WLYA 1IJ9A 4ZTPL 4CN4A 3SDCD 3GMNB 2DKUA 5DMJB 2HA1A 2R2EA 3GSVB 4LHUG 4QRUB 2Q8BL 3VXNA 1ITCA 1R24B 1ZHBA 2EKJA 2A6DB 4PJ9D 5DR5L 1SJVA 1Q1JH 3G5XA 1UXWA 2PXYA 4GG6B 5ITFA 2DQIH 2HT4D 1F11B 4OGAC 3ROOB 3SDXB 5IVOA 4J4PD 2DKSA 3DVNB 4YDKL 2DQTH 1QQDA 3BGFB 5TDPB 4WV1A 5J7CC 1BX2A 3GJFK 4HS3B 1KJVB 1YYLL 4KAQL 3MV7D 4HWBL 1QSFD 2DLFL 4XMPL 5GSVB 1UM4L 3NCJH 1DQMH 3KPSD 5FYJU 3PGCA 5HI4C 4JG1H 5C0FB 2FZ3A 4OM1L 2OL3B 3OHXA 3VI3F 1X7QB 1Q9WB 2E7MA 3V6OE 3VDCA 1P5VA 1LDPH 1S3KL 2AK4A 3QUXA 4MD5A 4HF5L 1FAKT 4LDEB 4H88H 3WJLC 5I0DA 5GGSB 1DFBH 4X6EB 2VERN 4PJXB 1XH3A 5F7DB 4G8IA 3BRGC 5FYKD 1BVKA 4AQOA 5GZNC 5SV4A 1UB5B 5FA4A 2E5EA 2V9RA 4RNRB 4UDUA 4LRIC 4NQXA 5EU7E 5IMLB 4U7SA 5IW1A 3C6SA 2XQYG 4DGIH 4Y1AB 4CDGC 1RAMA 1WWAX 4TUKH 1OTUC 2DD8L 1A1MB 3D0VB 4GRMB 5F70A 5KZCB 4ORZC 4M43L 1AFVH 2VDQH 5D2NE 1XF3A 3VFWA 2P8PB 5D71H 5J1TC 2ED9A 1DLFL 1T1ZA 2DIBA 4PYGA 1IZKA 3C5SA 4A6YH 2EDTA 4JY5H 5C0BE 3FN3A 4NJAH 3SQOL 2BOCB 4OZGB 2BSTA 1HKFA 2LQRA 4Y5XC 1WICA 3K3QA 5D6CB 4HHAB 5HY9A 2VLRB 4M02A 1FJ1A 4WI8A 3FRUB 5IVXF 2AI0H 4BH7A 2XNAA 1R5IB 2HRPH 2W92A 3DUUA 4IMLA 5E1AA 2YRPA 4XAWH 4F8TA 3JV6A 3IKKA 5MEPB 4KZEL 4YHPB 3BIKB 3C60B 1IGYB 2FATH 2R1XA 2XWJB 3HRZB 1CL7I 3RWEB 4RFNC 4BQCA 5IROA 3RZCA 1LQSR 4ZFFA 1D5BB 1MRCL 2FJGA 1LILA 3LEVH 5C0IA 5DK2A 4LRNH 1YJDH 5TE4L 4FQIH 3BZEB 2IANB 4NC1E 2BVOA 4HS8H 2DMBA 4Z0XA 2EEBA 4P2QE 2P43B 4WEUD 5HD8C 2ZSVB 3BEWB 4XP1L 3BP6B 35C8H 3P77B 3O4LE 2ICWB 4PRIB 2YD5A 3FL7A 4L3AA 2GT9B 4PGJA 3BE1H 1NEZA 5MP6H 1OD9A 2V6HA 3BP4A 3U6RA 4OLEA 5KVEL 3N9GH 2EDEA 5JR1L 1V3KA 2Y5TA 3OQ3B 3HE7A 1T2XA 3R4DA 5MERB 5FUZH 3UO1H 4L29A 5I17A 3OKEA 1WEJL 3WNLA 5D7IE 1P5UA 2JJTA 2LU3A 3DX8A 4MJ6A 1L0XA 2GCYA 4PJGF 2E7LA 5IR1A 1HH6B 1T20A 1RK1B 4MNHB 4OIIL 1L7TL 1XR9A 3CNKA 4HMDA 1GJIA 1UWGH 1R5VA 2YWZA 4P3DA 1KPRB 3BKMH 2N7BA 4LBEB 1XGQA 1OGAE 4N5UA 2IMNA 4PJ7F 4A6YA 3P0YH 4P2RE 5J6HB 4TVPL 2W9DH 2V5RA 3NA9H 4MS8C 3V6OC 1G9ML 2C1PA 4NRYB 4X5WB 1JPFA 4LCUA 4UIKL 1JPTL 1TDQA 3OKYA 3LKSA 5FECB 5L9DH 3K74B 1T0PB 1UCTA 4PB0L 5CEZL 5IHUL 3B8YA 2QR0B 5J11B 4XB8A 1NBQA 4RX4A 5F6HI 1CFSB 4P5TB 1QFPA 3UBXI 2AEWA 2NY4B 3P0VL 2APVA 3U4EA 4DUXA 3D2UD 3TZVC 3VFGH 3VFNA 5GS2D 1MFAL 3QO0A 4P2OD 1V5JA 3EOAA 1ZHNA 4R3SB 3WNPA 3PDOB 2VLLB 3BHBA 5EU3B 5EOQH 2A77H 2YC1A 4I2XE 5E99H 5F89B 2E9WA 4Z0BL 3ALWA 2YZ1A 1X6NA 4JM2C 1DQQB 3MV8E 5GIRB 1NLBL 3OB0H 4GG6F 1E4XH 1QBML 3QNXA 4PJBE 5CEYA 5JUEH 1J88A 3HPLB 3SDXF 2PYEA 4FFZL 1HK6A 5DJZB 1I9EA 2F74B 4HXBL 4MX7B 2VABB 3WIFB 3BZFB 3D39A 5IWLC 1ETZA 4GAGH 4XVSH 2Q86A 1OD7A 3FB6A 3R0NA 1N2RB 3MJ8B 1TETH 1EXUB 4M03A 3HCVA 4YQXH 5FK9A 3ARBC 1BFVH 3L3KA 4C56E 5HVGB 4U1NB 3FO9B 2OYPA 2Y36L 3FRPA 1ULVA 5EU5A 4FRWA 1WGOA 5KVGH 4HWEL 4ZAKB 3BUYA 3GSQA 2EDYA 5EB9A 3MRKB 3BH8B 4OCYL 2OXHA 4NC1C 3TBSB 4PJXF 4LASH 1CXKA 2HTLC 4KV5F 1KT2B 3EDFA 1EJ6A 4QTIL 3ELAT 4YHLH 4JZJA 1SEQH 1WVZA 3QEGL 2BFVH 1BAFH 3ZSTA 4UBDC 1TZHB 4P5TD 1OL0A 2L7UA 3BT2L 1QTYT 2NXZB 3OL2A 5EC2B 3TJEL 4YK4B 1LO4L 1FC1A 3JV5A 1OB1A 3ARGD 5D9SA 3L3OB 4JG0L 1Q94A 2FECI 1VERA 1NCWH 2NY3C 4XNYL 4GW5B 3S98A 1CXLA 3TA3A 4MCYB 4MJ4A 1BEYH 1GIGH 1JTTA 2VC2L 1ACYL 1OLZA 2DB8A 3MCLL 4M3JA 1V3MA 4PRAB 2IJ0C 3D87B 4JFOB 3GB7B 5K9KA 4G3YL 3U46A 4L4VA 2NLJB 1T21A 3LQAL 1QLFA 5BW7C 1S7QB 4IRJC 1N8ZB 1BVLA 4XNXH 3ARWA 1NBZA 1WTGT 4JPIB 1JMZA 4QCIB 1QFOA 3HPJB 5EBLA 1XIWD 2OTUB 2E6JA 5IHZB 1T0NA 4QTHA 1YPZB 1S5IH 1IRAY 3RA7H 1IEBA 3FQUB 2OP4L 2QBWA 3BISA 3GHEH 2WAHA 1AC0A 1TQCB 4JAMA 4N8VB 5I8EB 5IBUG 4Z7UB 4YFLF 3EYSH 1IEAA 3HLAA 4PGBA 4PRNB 2EXWD 1NC4D 1Z3GH 5L2KE 1MCPL 3K8MA 1RJYA 3LS4H 5E8NB 3H3KA 3MRCA 1I7ZA 2HRLA 5ACZA 2EDOA 2XXMB 1RZKH 2HVKA 2WQ8A 3IAPA 4ODTL 2D9QB 3NAAL 2Q1EA 2X4TB 2O5ZH 4LKXB 3JVGC 3JZ7A 3OF6A 4X7FC 3FFDA 1NCNA 3L7EA 1PW3A 2HVJB 2X1PA 3U2SA 1HINH 4PRPD 4JO2H 4K3GA 4RMVA 2Q7YB 3EYQD 1F02I 1YC8A 3KPNA 5B21A 4Q2ZA 4MB3A 3RY4A 5HVWA 4F7MA 2ENSA 5HI5C 5DD5L 1KYOK 5J12C 3EJYD 5I9QC 3UBXB 5T5FL 2A0LD 2DQGH 4PJ8A 1QNZH 1G84A 3CDFA 4ZPVA 4PJ9A 1JZ3A 5LG1A 4X99B 3CVIH 3VXUB 4OCSH 1CF8L 4GKZB 5FO7B 3OWEA 1K8IB 4P3WA 5C3LD 5FGRA 4D9RD 4EI5B 3SDXE 3V7AE 2L4OA 3ZKMD 4HCRL 3Q6FA 4XCYB 2QHLA 4OD1L 2NXYB 3MV7A 5KVDL 4BELD 2AJUH 1A6ZA 1I1FA 4NZTH 5AWNL 3H0TB 3RDTB 3KPRA 4JB9L 3QIUA 4LSPL 1FN4A 4R7NB 2CK0L 4MB4A 5FA3A 3I3EA 5IB3B 2AJZB 3OKOA 4QOKE 3WLWC 4JY6B 3ZDYF 2PTUA 2Z91B 1EFQA 1S7WA 4AY0A 1Z9OA 4K8RH 3IDUA 1VPOL 3RTQA 2EH7H 1OAZH 2BNQD 1BQHB 4MAUL 4OSUL 2WWKO 5HGAB 5BMFL 2R1YB 3DTXA 3I84A 1KTKE 1IGCL 1BZ7A 1A6VL 2Z8VC 2DLIA 3VWJB 1CLZH 2YD7A 5DYOA 3INUL 1UWXH 1EIBA 3GIZH 3BX7C 4Y1AE 3NACH 1XR8A 1PG7X 1XZ0A 1YEEL 5CCKL 4E41D 3DXAA 3FB7B 4OF5A 5DJXA 1P84K 2EECA 4YO0A 3QUZD 5HGDA 4JR9H 1L4IA 1QLEH 3C5ZD 3IT8D 5E2VH 4LNVA 5HYSA 1DVFC 3G6DL 1S7TA 1EHXA 5F9WC 4K7PH 2WV3A 1NCCH 4H1LB 5H37G 1MHCB 3O9WB 5DJAB 4U0RC 1FVDA 3SPVA 2WK2A 4AG4L 3ILPB 5DD3H 4OZGE 2CD0A 4K3EL 1EHAA 4LSTL 1FG9C 1UJ3C 3QQ4A 4PP2A 4P23C 4PJ5A 4YHZH 1WBXB 5J1AB 5E8EA 2Q7NA 3TN0A 3X11B 5JW5A 1FZMB 2WINB 4X7EC 4DGVL 5EO9A 2E9IA 1KTLA 5JW3H 4MA3A 4G8GA 1QR1A 2WBWB 2VDKL 4XHJC 3RRQA 4PYHA 1HKLH 4U31A 2DIAA 1M05A 5CD3A 4PJAF 1UB6B 1M1SA 1DUYB 1B6DA 1QHPA 1CIUA 1F2XK 3W2DH 2Z4QA 2XA8L 1OSPH 3HHRB 4QEGA 4Y5VA 1BF8A 1E28A 5C0AD 2R4RL 2CLVA 4DZBA 2ZCHL 1T3FA 2QKIB 5L0QB 4KK8C 4AT6A 4WUUE 4AM0A 4F37K 5C9JA 3ARFA 3VXOB 4FQHB 5FHBH 1VGKA 3VXNB 2VSCA 1ZHBB 1X5YA 3QULB 3U4BH 1JYVA 3G5XB 1UXWB 2PXYB 3OXSA 5ITFB 4HWZB 4HPOL 3MNWA 3KLAA 3RHWF 2GFBB 3WEXA 2OMNA 3MGTB 4GKSA 3G08A 2NY5L 1QQDB 5DZNA 5IP4A 2GK0B 2X4SB 4JPKL 4OD2B 3PP4L 4WV1B 4LEXL 1BX2B 1XCTA 3OPZL 4LQFH 4R26L 4I0PC 4B5EA 2X7LB 3PGCB 5ADPH 1A2YB 3K4DA 1NUNB 3OAZK 3ARTA 4GSDL 4DKAA 1YQVL 2FZ3B 2CSPA 3HFMH 5EZIH 1CIDA 3MUJA 1JIBA 5HHXH 3ZYIA 3GGWA 4GUPA 2A9MH 4EIGB 4XCCH 1AE6L 2RFXA 2UZIL 2IQ9L 1GHFL 2AK4B 3QUXB 3V4UL 5JZ7C 4MD5B 4FG6D 2V5YA 1HOCB 4HIHA 3Q1SH 4HH9A 2FYYA 3AAZA 4Z7UF 1XH3B 2C3WA 3VGAB 1TFHA 1BVKB 1ZHLA 3TLRA 4KQ3H 3O2VH 5FA4B 1AXSA 3ZDYE 4WHDA 3SKOA 5IV2A 4NQXB 3GI9L 4FABL 5IW1B 3WL9B 3C6SB 2QHRL 4YXKH 3PDGA 1KJ2H 3WIIL 1S9VA 2ZUXA 5CGTA 5HVHB 1LEGA 4OZ4B 3O6FC 5LGJA 1PGRB 5J57B 4JFHD 4Z7NE 5GS1A 2D03H 3PP3K 4YE4H 3VFWB 2AK1H 4MA8L 3B9DA 1MCIA 3V0VA 1T1ZB 4RMQA 1FYTD 4PBVC 2DTMH 3C5SB 3A6BH 5CJBA 5IMOA 4OQTA 4XMKH 1FAIH 3SE3C 2GEEA 1DQTA 1NMBH 4WEMB 2AJVH 3QDAA 2BSTB 5E7FA 2NY0D 2YPLA 3EHBC 2Z35A 2P8LA 3TVMD 4G9FA 4JPWL 1D5ZA 3QFJE 4KKCD 4NHCH 1PBYA 4DW2L 4GW4B 4BH7B 5DF0A 3TT3L 1ZGLA 4TTDC 1QP1A 1GGIH 3QZWG 3BDYL 3SJVA 1HZHH 3S5LA 3QEHB 5CZVL 5DO2D 3DUUB 4IMLB 4S2SA 5E1AB 3KLHC 1HSBA 4IOSD 4F58L 5HI3C 5I6XB 5IBLC 1YMMA 4JREC 5CFHA 1OF2A 4UINH 2YA2A 3DX7B 5D5MA 1U6AH 3RZCB 1UZ8A 3IJYA 4FMFA 3P9LA 4ZFFB 4TSAL 1IC4L 2FJGB 4MWFA 5C0IB 4D9LH 3MLYL 1T5WB 5DK2B 1FFNA 4FQ2L 4KTEL 5EORH 2DJUA 1T7WA 1QHOA 3OBAA 1KCSL 1AXTL 5D72L 5BV7H 3HR5B 3EYVA 1HN1A 2BVOB 4F9PA 1HQRA 4YNYA 4Z0XB 3BKCH 2IEPA 4LHJB 1O0VA 4HZAA 1YEIL 4KY1L 4H26A 2I5YL 2B1HL 2QADB 1EHLH 1K3IA 3QISA 1NEZB 5C0CD 4JRYD 3U6RB 5CSZB 5DJCB 3TNMA 2A9NL 3RVUC 1D9KC 2ATKA 2Y5TB 1GGTA 4X98A 5TF1L 3KPTA 5AG8A 1A14H 1PAMA 1MCOL 3T0EC 4L29B 1F6LL 3OKEB 2P45B 5EC1A 3DX8B 5BRZE 1RMFL 1U42A 1E4XI 3WN5C 1KJ2A 2AQ2A 4U1GB 2GCYB 5BQ7B 1P4BL 1T20B 2AGJH 4P5MB 5C08E 3P3YA 1XR9B 4FNLL 4QKXB 2J5LB 2EE9A 1R5VB 3TF7C 4ACPA 4P3DB 4CW1A 3RPIB 12E8H 2MCPH 1R3JA 4L4JA 1KG0B 4BZ1L 1C12A 1MLCA 3MRFA 3RQ3A 3GRWL 5GJTL 4A6YB 3CDYA 2PNDA 2Y06L 3EFFA 5A3ID 3CX2A 1M7DA 5EUKA 1KCKA 4ORGA 3QQ9D 4FTVB 5MHSD 1XF1A 5JPNA 4Y5YA 5AYQA 3TPUA 3LRHA 3DYPA 2D7QA 1JPFB 2PN5A 1XIWA 2P49B 3LKSB 4I0CC 3EOTH 1YPZE 1X5XA 3T2NL 1U8MA 4Y4FA 5E9DD 1B0RA 4ESKA 2ENYA 3BKJL 3UDWA 4Z7OF 2ILLA 5L2JA 2VLMD 4FQPA 2UWEE 2IGFL 1YEHH 5FO8A 3H9ZA 4OI9A 3PQYB 3U4EB 4M3KB 2HLFD 1BD2E 2GJJA 3VFNB 5EUOA 4EQ3A 1ZHNB 5E0QA 3SDAC 3L3GA 1YDPA 3U7YH 3BHBB 1PKQE 4MVBD 4AEEA 2ZG1A 3CX5K 1GZPA 4XC1L 1HEZA 3ZL4L 1FFOA 4MLSA 3SKJH 2J6EH 4B53A 4O2FA 4J1UA 3LKQA 3MUY1 2BSSB 1LK2A 3B9KD 3KYNB 3S37H 4DFIA 4I3SL 5CEYB 5KSBB 1MFBH 3MJ9L 5FDWB 2UUDK 4JFZH 3JWDC 5DFVC 2DQCH 4KJWC 3DSFH 1FSKB 3DJ9A 5E8DL 2EDJA 3D39B 3X3GL 4B41A 1HIMH 2Q86B 3FB6B 3HCVB 2XKNB 1RD6A 3L3KB 2HJKA 3U0WH 4JKLA 3LMJH 4OM0H 4Q7DA 3MFGB 1UKTA 2W91A 1KXVC 2BNUA 4IEFB 5D7JD 5IJKA 3ZHDA 5EU5B 5I73C 4TQEL 1A7RH 2MPAH 4K7PY 5AZ2L 3ESVF 1MHHA 2BERA 4BQ8A 4K2UH 4FTVD 1LO2H 5EH1A 3GIVA 2H3NA 4P4KC 1LDSA 2Z92A 1H8NA 2LU7A 5IB4A 4M5YL 4Q6YA 3CXDL 4KH2A 3RGVC 3E3QE 4JZJB 3M17A 3U30B 4Z7VE 3S3PA 4MJID 4PG9A 3H3PH 2VDNH 3PQYD 2BNQA 4WFHD 4RMTA 1OB1B 3ZKNC 2VISA 3EDJA 3I6GA 4FQ1L 2AERT 3R1GL 4YJZL 1Z2KA 5F72S 2HH0H 1Q94B 1MPAH 2YN5A 1CFQA 2EICA 1JPST 5IFHH 4KK6C 5T3XE 4L8CA 1FV1B 3BMVA 2FX9L 4HJ0C 3U9PH 3K1DA 1CL7L 4E41A 2C3VA 2J8OA 2ZJSL 3DBXA 5K9KB 2HKFH 4M7LH 3U46B 4YAQB 1T21B 4XCEA 1C7SA 4HKJA 3MZGB 1XGRB 1HCVA 2J6EA 1BVLB 3THMH 2E7BA 5DD1H 4PRDA 1FH5H 5I1CH 2H9GA 3AB0C 5EBLB 1T0NB 4QTHB 3RU8H 4D2NA 4OFVA 3RY6A 1IEBB 3SDDD 4IIQC 3PNWA 3K80A 3UPCA 1RUMH 1MCFA 3EJZD 4JAMB 3VFVA 1AO7D 4IRSA 1IEAB 3HLAB 4PGBB 5KW9H 4XPHL 3GSWA 4YHML 2XXCB 1RZFL 3MRCB 2X4PA 3VGFA 1U93A 1WBYA 3PWPD 4QGTA 4M5ZL 1MQKH 1YYMH 2A6JB 4R4NC 1ORQA 3RI5F 2GJ6D 2F8OA 3FFDB 4YDIL 1CXEA 3DHJA 4M6ML 4U1LA 1A6UH 4WFGD 2KDGA 4WCYH 4P46D 5EZJA 3GK8L 4TSBH 3EYUL 2WIIA 4Q2ZB 2B2XL 3MA9L 5ESAA 3T65A 1EAPB 3TNNA 3VXTA 5EIQA 3V7AG 2BHZA 2XQBL 3AU1A 2LABA 2R2BA 5HYJD 3IFPA 1U91A 3CSGA 1QSED 4DTGH 5I18L 4OFKA 3HZVA 4ZPVB 1EEYA 4DN4H 1U3HA 3NH7H 2VIRB 2ZCLL 1KCRH 2G2RA 1FL3B 1NSNL 5HHME 5KBNC 2ERJB 3AY4A 5DHYA 1QRNB 4OD3L 3CFCL 1KEGH 3QXAA 4FZEH 3CUPA 1Q9OA 4KK9D 2AABL 4GAJH 5KJRL 5FYKU 1A6ZB 1I1FB 3UTSB 3KPRB 3OGCA 4XRCA 3QIUB 2GYSA 3LIZH 1KLUB 1F4WL 2ADFL 4HBCH 4XXCC 4LLVB 1ZANL 4DVRH 4HIEA 1V8HA 3C09C 1EEUA 5GISH 3K1KC 4H8WL 1CK0H 4WY7H 3S97C 2DQUH 1S7WB 2WBJD 1AR1D 2AK4E 3RTQB 1VA9A 4ODSH 3MLWL 1FG2B 3DTXB 4M7KH 4XVTL 2HT2D 3BSZH 5C6WH 5D1ZC 1MREH 1BZ7B 4HIJB 4L8DA 3NCCB 5JHDA 5DYOB 1RIVL 3LRGA 2QTEA 2BDNH 2RQ8A 4MNQB 1UEMA 1T7VA 2DL2A 1AKJB 3MLZH 3V6BR 3QEQB 1XZ0B 3CSPA 3DXAB 3QDGD 4Y2DC 5DJXB 3BPNB 5ACMA 3QUYD 3TWCH 2R39A 2R23A 5HYSB 1S7TB 3NPSC 4MB5A 2VZVA 4NQUA 2YPKB 2A1WH 5KSBF 2NY7L 1DQDL 5I2IA 5L7XH 3CSYB 4XWGH 4WWKB 5T5NF 3MPCA 1FVDB 1BECA 1T5XA 4ISVB 4FZ8L 4OLWL 2VDPH 3JSSA 4J8RB 2NY1D 3MOQA 3CPLA 5C0EA 4JO4H 1FDLL 4EXKA 1XEDA 3QQ4B 1J1PL 4PP2B 3TV3H 4PJ5B 3LPGA 5E8EB 3I3DA 5I1KL 4NYLA 3TN0B 5EBWA 1LE5A 5JW5B 3VI4E 3ZE2F 3UEZA 1RSFA 4U1HB 4AZ8A 1KTLB 2C26A 3IDNA 4MA3B 5KANI 2OK0L 4M48H 4FQXC 5ESQA 5T1KD 4NO0D 5ADOH 2K7PA 3EZJB 1HHGA 4LLDA 5BJTA 1W0VA 4NKMA 2RJMA 5CD3B 2D7TH 3SKUD 2FECL 3CXHK 3LEXA 2Z4QB 1I8IB 4HUWA 1OM3H 5GGTL 1BGXH 5JA8B 4Y5VB 5DMIH 4LPCA 1E28B 1A6WH 4HLJA 5J89A 1TITA 4NO2A 3PL6A 4HUUB 2I25N 1T3FB 3TESA 4AT6B 3RFZC 4AM0B 2D31A 4GG8A 4JFEA 5IVNA 3ARFB 1VGKB 2HFTA 5C0ND 2AEIT 3IFNH 3MXWH 5EZOL 4JRYA 1LNUA 4TNVF 3SCMA 2DYPA 3N1FC 1ONQA 3MNWB 4MNQD 1T03H 3KLAB 4QF1A 4QXTA 3WEXB 1AKJD 4GKSB 3G08B 3QEQD 2CH8A 4PBWD 1XCTB 3MUGA 4HBQA 3BAEH 4O02L 1S7UB 4QHLA 2P24A 3NIDF 3QT2A 5KAQF 1CGYA 3SE4A 3TBYB 3LV3A 4HQQH 5F7EL 4UTBL 1S7XA 2W65A 5FM5M 5ECJE 5A16A 5E1HB 3WCYA 1JGUH 4WHCA 4QNPE 3TT1L 3GGWB 4GUPB 4LPYA 4WWKD 4Q9RH 2RFXB 2W59A 3MRGA 4CKVX 2UZXB 4U3XA 4Y88A 3KDMA 1C5DA 4ZTOH 3RVVD 3ZTJH 3SN6N 5IT2H 3Q3GA 4HIHB 3ULSA 5DQDL 4O2CA 3AAZB 3HE6C 3CDGA 1PG7H 5C6TL 3ME0A 1A8JH 1TNMA 1ZHLB 4I8DA 5L88H 3UXFA 3BVNA 3S35L 1Q9LA 4OLXH 1V3LA 1WFOA 3GBMH 5IV2B 43C9A 1J8HE 2IWGA 3ZO0A 3IKCA 1S9VB 4AEFA 2DLGA 1VFUA 3IDYB 4NZRH 1LEGB 3P40A 1KENL 3VRIA 5LGJB 1B90A 1WWWX 1B2WH 1YNTB 4HIIB 3LB6D 1L9NA 4K94C 3O4OB 2CRYA 5GS1B 1IZJA 1EUTA 4EN3C 4XP5L 1YECH 4EVNA 3UC0L 3V0VB 4GBXB 1JMXA 5FF6A 3VH8B 4WWID 5DEFB 4LVOB 3BQUB 5I1EH 4XP6H 5DJ2A 2YPLB 5J3HD 3VXMA 1LP9B 2Z35B 3LS5H 5IW3A 2P8LB 1G7MA 3IF1B 1P7HL 1D5ZB 4DKEH 5M7QA 2YKLH 3QDHA 4Q74A 1RUAL 3NZHH 3T2PA 3QWRD 3SJVB 3S5LB 1CDBA 4HT1L 3BFOA 4OZFA 1AD9B 1EO8H 4KKLD 5FYLH 5J1SC 2PYEE 5HXMA 4CVZA 5CWSA 5DRNB 1EUUA 1YMMB 3ULUE 1OF2B 2O26U 3QUKA 5D5MB 1UZ8B 3IJYB 3P9LB 5CJOH 4QO1A 1DANU 4RAUA 1A02N 1VHPA 4HC1H 3QCTH 1OP3H 1Q1JL 3I75A 2EE2A 2DQIL 1HQRB 5MENE 4G6AC 1F6FB 2DQTL 3VG0H 1IGFH 4GRLC 2XY2A 4UU9A 3MLVH 4XC3H 4Z8FH 3EYOA 1AP2A 1P7KA 4NKOA 3T09A 3LKOA 5C3TA 3NCJL 5HPMA 1DQML 4R96A 4X8JA 4JG1L 4RZCA 3IFLH 5EU6A 3TNMB 2ATKB 4NOFA 4X98B 2F5AH 4Z7QF 4BQ6A 5EC1B 4MJIA 1HXMA 1LDPL 4ZMAT 1KJ2B 4OKVA 1FFRA 1WV7T 3WDJA 4H88L 3ZSSA 1B6UA 4PD4K 1DFBL 3QNZA 3JTTA 2BSED 1HI6A 2XN9D 3AC0A 1MCSA 1R3JB 2X4NA 3MOBH 3BQUD 4CU8A 2E7LC 5INDB 2H2SD 2D0HA 3EFFB 4L9LC 5E6IA 4DGIL 3QG7H 1M7DB 2W0PA 4TUKL 2AXHA 3E1F1 1Z0NA 3WNNA 4L4VE 3QNYA 4N8VG 4NM8H 2DL9A 4Y5YB 3TPUB 5IFJB 2CIKA 1AFVL 1QA9B 3W5MA 2VDQL 4CUCA 4YHNA 4WW2F 1S5HA 2YXFA 5D71L 3T4YB 3CH1A 4PJCA 4KI5E 2YOCA 3WHE0 5JHLH 4QHKI 5HDQH 4YX2H 3T1WA 1U8MB 4MXVE 4A6YL 4Y4FB 2VLJD 1N59B 4JY5L 1GZQA 1MIMH 3AMKA 4NJAL 5I74B 1QG3A 2VKWA 4KJPC 4B7IA 4GMSH 5I19H 2OQJA 5EUOB 3PWPA 4LARH 2AI0L 5IMKA 1SMAA 3L3GB 3OKLA 4HC1A 5H35A 3DLQR 2HRPL 1V3JA 1JV5A 4JHWH 5FOBB 4XAWL 1GZPB 1FFOB 3REVB 4BJLA 1U8PB 1A7PH 1KUMA 4O2FB 2FATL 3UBXG 5KSAA 4J1UB 1AI1H 3UPAA 3LKQB 2DQEH 3X12A 4RWYH 3RUGA 4F80A 1NKRA 4WW1B 3LEVL 3H9SA 1UH3A 2E9BA 4LRNL 1YJDL 3QDJA 4JFQA 4FQIL 2NX5D 4J12A 5HYJA 3FOMB 3QIBD 4M4RA 4C57C 3MJ6A 4HS8L 4L3ED 4N0RA 4KWUA 5I75C 4R2GC 4RAHA 5JLZA 1RZJL 1OT1A 1HHHB 2HJKB 1ZVSA 5EULV 4CU7A 4POYA 4QHUA 1F8TH 8FABA 1TJIH 4RAVA 35C8L 1MI5D 3ZDZF 5JOPE 1C16A 2KKQA 4EI6A 3FQXA 2YUVA 4OFYD 5CP7A 3BE1L 1JWUB 3LZFH 1U8OA 4WO4A 5MP6L 4P2YA 3N9GL 3KXFB 2LU4A 4JM2D 5FUZL 1MHHB 3UO1L 5GSRA 3MV7E 1HILA 2XFXA 3MLTA 3ULVH 4J3XA 4WTZG 4LLUA 3BWUC 1YEJH 1A6PA 3KPRE 3RWFA 3GIVB 3WKMH 4DGYH 4AIXA 3B2VH 1BQHG 5IB4B 5DVOA 2AV7A 3UTTD 2PKDA 1ND0A 1UWGL 3JV4A 1PX3A 3KJ4C 3M17B 3BKML 2EYTA 2WWMD 2C3GA 4PG9B 3FHAA 3T3MF 1E4KC 4X7DC 3QIWC 3P0YL 2VISB 3I6GB 3MBED 5FYKE 1I8MA 2W9DL 1OW0A 3BD4A 5AD0B 2BRQA 5EO0A 3NA9L 1T22A 4KJYA 4AIZA 5GS0H 1MJJA 2MQCA 5D6DA 3D85B 3RJDA 4PGEB 5BS0D