3QXTA

Structure of an anti-methotrexate cdr1-3 graft vhh antibody in complex with methotrexate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Anti-Methotrexate CDR1-3 Graft VHH
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
total genus 31
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxtA00
5D1QD 4MNGE 4LGPB 2BOCB 5TE4L 5F93C 4K3GA 1CTOA 4I8DA 4AEEA 4TTGA 4NN5B 4U1MA 4K71C 2R0WH 4L8BA 2W0FA 4J6RL 1IFHH 4X6DF 3M1BA 5I74B 3SDXF 1NC2D 2MQ3A 1UJ3A 4X4XA 3B6SB 1V3LA 5E2TL 3VFTB 4NCC2 1CFSB 4ZUVB 3T0EA 1FCGA 1NEZA 4MQSB 4KPHH 1PY4A 3FT4B 2OQJB 4MD5A 4MXQD 1QKZH 2EE2A 4GBXD 5DMKB 2QQLH 4GMSH 1DLFH 2VLRA 1TPXC 1RUPH 4G8FB 4XAKE 2NW2A 5FKPA 4HLZH 1NCBH 4JDVB 5J13C 3WS6A 3WDIA 1MRFH 4JZJA 3UAJC 2JJVA 3VXRD 5BS0B 3ARWA 1FLRH 2BP3A 3MYJA 2CDEB 2BFVL 3L95A 3K8KA 3CSPA 3QFDB 3QWOA 5HHPA 1BOGA 3B5TA 2HWZH 3TVMD 5FGBA 4OKVA 5SWSD 4UTBH 5HHMD 1PZUB 1P4IL 1ZVSB 3KYNB 4KJYB 3RI5F 3TCLA 1NFDB 3UJJH 3GNML 3MFGB 3WJJC 4RGNE 1IKFH 4AG4L 1RJLB 3KPSE 3IVKB 4PB0L 2I5YL 3HC3L 1KT2A 4IOFD 1BQHB 3D85B 1CGSL 4MJ6B 4P99A 1RUAL 3OKMB 2XTLA 4UBDC 5AG9A 1XCQB 1A9EA 2CRYA 2VXSH 4QOKB 3TWCH 2BCKB 3NTCL 5HYJB 1PGRB 2G9HB 1Z3GH 3DSNA 4IRZH 5B38B 3NGBB 1L6XA 3QDAA 2J8OA 4LDLB 1DVFB 5DUPL 5BV7B 4EUPH 43C9A 1MCIA 4ZAKC 4P23C 5DJ6B 1BJ1J 1FNAA 2EKSA 4YBQC 1NCUA 3BH9A 1BJ1H 4H0GA 4NQDE 4R8WL 4Z7UE 5CP3H 1G7QB 3A6OA 4HUUA 1IGJB 3DYOA 3QDME 3QUYD 4S0TD 4X7DC 4MNQD 1NBZB 4MB3A 4XVTH 4D3CH 3SKNA 4E5XA 1KB5L 5ETUA 3VFRB 5EN2B 1E4XH 4LFHD 5AYUL 3IDJB 2A6KB 4B5EA 4XCYA 5IJVA 2AEQH 2Z92A 4O5LH 4HS3A 4TNVF 3U9PL 5ERWB 1LP9E 2H3NA 3FB5A 3K7UA 3QQ3B 5GS3A 4P5TA 4IS6A 3MV11 4OT1H 3IFOB 1YEEH 3INUH 4XVJL 3S4SA 4DN4H 3VFGH 1ES0A 4R97B 5DQ9A 1JUFA 5GQBA 3QG6B 5MEQA 1R3KB 1S9XB 4ELMB 1HOCB 2Z93B 1IZJA 3BPLC 5CSBA 4HXAH 2IFGA 3WNOA 4Y16A 3D2UB 4NZTH 4M9OA 4TSBH 3KDMB 4PV9B 3FO9A 3G6AB 5CWSA 5T5NG 1TDQA 1T21A 3FFCA 2XQYG 4F33A 5GGQH 1BZ7B 4O2FB 4P9MH 4HUVB 1FAKT 4YDJB 3RTQC 3TBWA 1KJVA 3SDCC 4LPCA 3VFSB 2VERN 1N5YH 1U58A 2COQA 2FLBT 5BVPH 5IHBA 3RGVA 2BSSB 5I76A 2VLKB 2YEZA 5JO5A 4HH8A 1FN4B 2AV1B 3PL6B 1N4XH 2DWEA 4AH2A 5DVOA 4YHOH 5KVMC 1OM3H 4Y4KA 4UILH 2W9EL 5DK0B 1OSZA 3RX7A 1TJGL 1R5IB 2O61B 3V7MA 4WW1A 1QLRB 3GSRB 3QUXD 3MREA 3QBTB 1FFPA 5DRWA 5T5NF 4K9EH 3V52H 2C1PB 3MBEC 1E6JL 1UB5B 4PJFF 4R90L 4DOHE 4DWHA 1ONQA 3ILPA 2VLJB 4XTRD 1KPRB 3VI4E 2EYTA 4YWGH 4CMMA 1QFWI 1ZOXA 1IAIM 4DN3H 2NY2D 2AJSH 4ACPA 4MDJB 3T2PA 1A3LH 3SE3A 2NZ9D 4OCRH 5EPMB 2A1WH 1A7QH 1EHNA 3BRDA 1ZHLA 3PJSA 1CICB 5DURB 1MHHB 2CGRL 4PRIA 5FDWB 1F3JB 1MHEA 3GIZH 1BM3H 3GJEA 5KS9F 1CLOH 2V2TA 1MFDH 3VH8A 1EV2E 1BEYH 2CO6B 4K8RH 5D1XC 1A1MA 3C8KB 4IJ3C 3AROA 5I1JH 5IW6B 3AAZB 3HPJB 4XI5D 1LEKA 2FJGA 1LK2B 4NO5B 1HWHB 2ADJA 1FZMB 1PY9A 3T4YB 4HFUH 4PV8B 1J8HA 3UROR 2VDKH 1EFXD 1MUJA 3ARXA 5CLTA 1DCLA 4DTGL 1W72H 4PJIB 3X11A 5FOBB 3GRWL 2A74A 4XP6L 1IAIL 1KACB 3TP4A 4IMLB 5TQ0H 4DZBB 1DQLH 1E4JA 4XAWL 1TZGL 5F88A 3P9WB 3MJ7A 3RIAF 2AABL 3ARDA 3W11C 5DUMH 4NRZB 2Q87A 1G7HA 1MFNA 1EJ6A 3VXRE 2HT4C 5I1IH 3BIBX 1QSEA 4XMLL 1I1AB 4UOJA 3BIKA 2NY3D 3QR2A 5ADOH 1H15B 5JPMB 3WIFB 3BHBA 2ZKHH 1D5XA 4GG6F 5A1AA 5SWSE 5HHME 1L7IH 3WUWA 4ZD3L 1UH4A 3JSSA 1G7JB 3QXWA 3ARUA 4H20H 4H0IA 4S1DC 4PJGA 3RNQA 5DJYB 5DTFB 4CNIB 3B5HA 3KPPA 2IMNA 3MOAL 5JQHC 4BELD 4C83B 4H1LG 1QYGL 2X1QA 3ARBB 3D85D 1P4LA 4YXKH 2PW1A 1K5NA 5HD8C 1CDGA 4HIHB 5E9DD 2MFNA 5DEFB 5EFIB 1G6RB 4HBQA 1S7WB 1VENA 4KJPC 4WO4C 2ITCB 1T1XA 2X5PA 3HI1A 4Q6IB 5FCUH 1D6VH 3OKOB 3TO4A 2C3GA 2X6MA 4IRJB 4WI2A 5CZKA 5JHDD 1GXEA 1AKJA 1KCVH 1DVFD 4Z7VB 4JY4A 4O51A 2RQ8A 2GSIB 5CGMA 1LEIA 2FO1A 2MOVA 1WAAE 3MRRA 5IVXA 3L7EA 3CSYA 1DQDH 1FGNL 2X09A 3WN5C 1S5IL 2VZTA 4BH8B 2HYMA 3CCHB 1SY6A 4QRSB 3QIBA 2HKFL 4D8PB 3FN0L 2ERJB 3RWIA 5C0BA 2WBJD 1YN7B 5KSBB 3VXTB 3DVIA 2ARJB 3MV8A 4QWWD 4U6HA 5C6TH 3FHQA 4WWKA 5HDLA 3JWDC 1XIWD 5BQ7A 4XNXH 4PBVC 1ULVA 2QSCL 1KLUA 4N5EC 4U2YA 3UTZB 3V4PL 2Y6SC 2EYRA 1CXKA 3GSWA 3BPCA 3VFOB 1MY5A 1QBLH 3OAUH 1CLYL 5GGSB 4LMQE 2Z4QB 3LS4H 4R2GD 5D2NE 2J8HA 4OD1L 1G7MA 5CMAA 2ADIA 3GMPB 4EBQL 3BKCH 4PJ8B 5FYJU 2VL4A 5CCKH 2NX5A 5K33A 3BEWB 4LCCB 1T80A 1NC4B 1FFQA 4N0CC 2B4CL 2E6PA 5T3XE 4NQED 3PWLA 5CSZA 2FGZA 2JTDA 1FSKC 5LWYL 3MGAA 2EDDA 5B4MC 3BE1H 2HRPL 4HKZA 1PFCA 5HJ3B 3C2SA 5CHNA 1PEWA 4V1DA 1PKQA 3MNZA 4HG4K 4RGNC 1EX0A 2UZYB 1A6PA 5C0CA 5C0IA 1GGIH 4LSRL 4ZS6D 1MI5B 2E7LA 2IANB 2N7AA 3F7VA 3WNPA 3GSQB 5DD1L 1R5WA 4WI6A 2D4FA 2DYPD 1WWWX 1X6LA 3RVTD 3QXTA 2PYED 5CZXD 5DD0L 1OCWL 2EE3A 3NIDE 4RRPG 3MFFA 3VGAC 4OCNC 3QRGH 1XGRB 1BWMA 4PIRF 3GO1H 1OD9A 3L3GB 2AJUH 1YJDL 5E5UB 5F3HA 3TEUA 4N0UA 3HFML 3Q6FB 5JORA 2KPNA 4JHWH 5CD5C 4JY6B 2YPLA 1KULA 1DTUA 3DGCR 4K7PL 5K9KA 3KPNA 3KGRA 2IQAA 1ZT4A 1TJIH 4LLDA 1DFBH 1IGIL 3ARGC 4OFYD 4NGHL 4K3DL 1N6VA 1F8TH 3VG9B 3S34H 1JNJA 2BNQA 4G6MH 2BVEA 1W72A 4JCLA 1T83A 4QHLB 1B90A 43CAB 4TPRL 3B9VA 1INQA 1VCAA 2Z31B 2LV4A 3KNBB 4L8SC 4JFYA 1I3VA 2EYSA 2JJSC 1J7VR 3K4DA 3VFPB 2M2DA 5BOPA 4OLYH 4I3SH 4TNWF 1PD6A 3RZCD 3AM8A 3QUKB 3BQUB 3C5JB 1WBXB 3QDJA 5F8QC 1Q0XH 3GMNA 3G6JF 4Y5YC 3TN0C 2X4NB 5C0NC 2R2BA 1JNHB 3MRNB 5TQ2L 4WY7H 3NZHH 4CAGA 1RZJH 3VXMA 3D25B 4LSQL 2FO4B 4YDKH 3TBTB 3JV4B 1GGCL 3D39D 5GS0H 4KVCL 3DLQR 3L3DB 2HH0H 4WW2B 4N0FA 5KVEL 1F42A 1FNGB 4QHNA 1XF2B 5SWQB 1N2RA 5EZOH 1JWSA 4HEME 4M5YL 2FD6L 1ZLWH 1GC1C 2HFGH 1XH3B 2OSLB 3U0WH 1JIBA 5I8KL 3WXWL 1QHPA 9CGTA 1U36A 5KVFL 5AZEH 3V4VH 3I9GH 3IETB 4RWHA 3BZEA 4L3CA 1PG7H 3RWHB 1B2WH 4RQQA 5F8RC 4HIJA 1PJ9A 4OGXL 1T2QL 1WSST 2VZUA 3LN5A 1NFDE 4HDIA 3CSBA 3HI6L 5C6WH 3B9KC 1KPUA 1XFPA 4OZIA 3ZTNL 5IBTL 3VGEA 1X4XA 4N1HB 1G1CA 4PY7A 5KOVC 1F3DJ 1B0WA 3SDDA 2DTMH 2UWEE 4L29A 1M7DA 3L3JA 4QOKE 4Y2DC 1F3DH 4PJ7A 5HYJE 3CFDA 2Y7QA 3AS3A 1VFOA 3HB3D 3MBXL 3ZKSD 1LE9B 5JXAL 1QRND 2MKWA 4P46B 4QHMA 5JHDE 4NP4H 3K2MC 5IMOA 1YC7A 3ILQC 3JV6A 4PB9L 2XNAA 3LH2L 4D0CB 1QNZH 1KBGH 3Q0HA 2K7PA 4NRYB 1G1YA 1XGYH 2DD8H 2YPKB 3IF1A 1DQQA 5D1QC 3OJDB 3V7AE 4BKLB 3UZQA 1OF2B 5D7JA 2CIIA 3E2HC 3I2CH 2I60H 4W6XB 2C5DC 4GAJL 4I0PC 4TOYH 2BRRH 1UYWH 4PRBA 1MLCB 3AFLA 4NFCA 5FF6B 1OAXL 2FJFA 4GAYB 5F9JB 3ARPA 1OGAB 3T0XA 4OFDA 5I71C 3MLWH 1Q9WA 3KPLA 3FTGB 4JLRA 3VFTA 1KCRL 2H8PB 4PREB 2IBBA 3QCTL 4PJAB 3MRGB 4MXQC 3GIVB 4WIQA 4QYOA 2EIDA 3MV7D 5I8EB 2V7HB 3HCVA 1S78C 1BQLL 1LNUB 1AJ7L 1IM3B 1KOAA 4RMWA 5GSRB 4MA8L 3BPOC 5EOTA 3NAAL 4EDXB 2X4OA 1OAUL 3JBG7 2Q8AL 3VXQB 5IVNA 3F7YB 4PGZA 2P48B 1FVEA 4AMKH 2WZPD 4NHUB 2BMKB 5E4IA 1HH6A 1BBDH 2GT9A 2X40A 4WTZA 1UB6B 3RUGF 1KG0B 4LSPH 3EZ8A 4HJ0D 5E8NB 2ATKB 1KCUH 3KPTA 1MSPA 5D7SL 4KRPB 5FUCE 3TNNA 1U8KA 3DVNA 3RP1A 1FFNB 1U8HB 3GB7A 4M02A 5HI3D 1DEDA 4DUXA 4PJ9C 4KKBC 3QEHA 2FX7H 25C8L 1KIPB 2YD8A 5DEGB 2HFEB 5HHOA 3IVKA 4IOFC 3W0WA 1WJ3A 3GM8A 1W0WB 3NBNA 3G9AB 3GI9L 4M43L 2VITB 4HPYL 2AVGA 4RGOH 1XF4A 2DM2A 2VDNH 5IW3A 3MODL 4POZD 1CGYA 3EOTL 5IFHL 3VE0B 1U3HC 2PYEE 5ESAB 4XX1E 1FORL 2ATPA 4LCWB 4Z76A 4FQ2H 4OLVL 4NM8L 2EDKA 3GBNH 2FWOB 3G6DL 5CIPH 3U4AA 2AXJA 1E28B 2UY6A 4JJ5A 3WFHA 2PF6A 3BD3A 8FABA 4X6DB 1UGNA 5EU3A 1FL6A 3KJ4C 5F89B 5T1KA 3SDXB 1AP2B 2DKMA 2A73A 2VLJE 4ZTPL 2R2EB 1UM4H 2XPGA 1KJ3H 4TVPH 2DJ4A 4QHUA 5CJ5A 4IOIA 4F7MB 3LS5L 4DFHA 1F6FB 5EN2A 3DURB 3RVVC 2F5AL 2IWGA 1J12A 2B1HH 5IVZA 2XOTA 5HY9A 3T77A 4XVSH 3EOAA 2Z31D 3KPMA 1D9KC 5DC4B 5DK2B 3IFOA 4UT7H 1CTNA 1IEHA 5C2UB 1AXTL 1YQVH 4HUKB 5FECA 2G2RA 5D2NC 1S9XA 3QIWA 5IJKA 5IMMB 4LCUB 3H9SA 5C0RH 4XWOD 1ZLVH 3L1OH 2JLLA 2WP3O 3I6KA 4OZHA 1TJHL 4K94L 3SKUD 3CMOH 5GGRY 5GRZA 1FIGH 5EU5B 1UACH 3UYRH 4PRDA 3D39E 3I50L 1A5FH 5E56A 3P4MA 4X7TA 3LB6D 4LVNC 3FB8B 3RY5A 2VDLH 4OFKA 2V5SA 5LGJA 3BEVB 1T22A 2NMSA 5E5MB 2R15A 4CVWA 3UBXI 4JRXB 3NN8B 4Q9RH 1A2YB 1CZ8L 1HINL 1MEXH 3NPSC 4HD9A 1HEZA 1P7KA 1NANI 4XNYL 1SVCP 1KGCE 2DMCA 4JO1H 4XXDA 1ZA3A 3ZYJA 3D48R 4U0QB 1X5ZA 3ZL4L 4Q9QH 4DGIH 4MAUL 3V95A 2CMRL 1BIIB 4JREB 1KB5B 3UO1H 4F2MA 4HMDA 1KC5H 2HJLB 4HCRL 3QUXC 1HNFA 1YPZE 2C4FT 4V2BA 5INDA 2GK2A 2YUXA 4PLOB 1TTUA 1HHIA 2NR6C 2V5RA 3W5NA 4TVPE 1FYTD 3MZTA 1KEGL 2GAZA 2HLFD 3PWVA 1VKXA 3B2UD 4JQXA 5A2IH 3ESUF 4XTRC 1UM5L 3KYMA 1KPRA 4WNQA 3DI2B 2X4QA 3IB4A 5ALCH 2NY2C 3LHPL 1QRNE 4N1EA 1MCBA 4YHKL 1AQDB 4XC3L 1T03H 2XZAH 2NZ9C 2OZ4L 1MRCL 4KK6D 1U8LA 5L2JA 5HDBF 4XH2A 2JJTA 2H1PL 5FYLH 3H6JA 4F15B 1F3JA 3FQNA 4ODBD 1YEJL 3RU8H 1CE1H 5ANMA 3Q6GH 3KYOB 3BZFA 3MRDB 4PGBB 1KSRA 2EDTA 3N50A 1T1ZB 4OLUH 4GRMA 5KSBE 4RX4D 3SQOH 3V5KA 4EN3B 3IKCA 1MREH 3AAZA 2N1KA 3QNYB 4MVBD 4NN5C 4I2XB 3WO4B 4JQIL 1NBYA 5KSAA 4J4PD 4RIRB 4WHYG 2B4CC 4YNYB 4M9PA 5GGVH 5F72S 3UTPD 4KKAC 5I74C 2VL5B 2NY1D 1MJUL 4F3FA 4G6AD 4FQPA 4NRXA 4QXWA 4UTAL 5E2VL 5K9QG 1TCMA 1KN4L 3O2WH 4PJIA 3C5SA 3X3GH 2DWDB 2YD1A 4HK0B 2IMMA 4NUGH 3REWA 3B9EA 5DZNA 5LGHH 1YYMH 3MV7E 1ZA6B 5EWIH 4J3UA 4EZMA 1MCWM 5JOFA 4U6TA 4GUPA 4P2RB 1A9BB 4NRZA 4X6FB 4ETQB 1Q0YL 4ELKA 5F9DC 2EH7L 4I13B 2AK1H 1P7QA 2PO6D 1LO0H 2RCSH 4X99B 5INCB 4OV6F 5D2LA 5D7IA 4DKEL 2F15A 2MQ0A 1KENH 2NY3C 3FO2A 3RHWK 4LPUA 4XVUD 3ULUF 2A6DA 5CIPA 3UBXA 2BX5A 1YUHA 4FXKB 4PJFB 1H3WM 4CNIA 3GJFB 1HXYB 3X14B 3C5ZB 2UUDH 5IB3B 3Q3GA 4NBYB 4LIQH 5IFAH 1R3JB 3RKDC 2DAVA 2EZ0C 1A1NA 3LKSB 3ARBA 1MI5E 2Y5TB 2IANE 2N56A 4ZO8A 3ZKND 1D5BA 3GMOA 4DUVA 1U91A 1DUYB 2QL1A 3R0NA 4Q6IA 5JQ6H 3C6LD 5I1DB 3MRKB 4P23A 4LCWD 3L9RA 1KJMB 4DQOH 3NGBC 5FYJH 5BV7C 1DVFC 5I6XB 3MGOB 5DRZB 4LKCA 6FABL 3IDYB 4XPFH 5E4EB 4TRPH 2GK0A 5F9WC 3QXAB 2KZWA 1AGFA 3T3PF 3U7AA 3HZKB 4D8PA 3MV9B 3KPRB 4R26L 3KVQA 2NW3A 5EC1A 4LEXL 5JXEA 4PJXE 5CEZH 5GPRA 5EO1A 1IM9D 2CO7B 1I7UB 3EYSL 3VD7A 4N8CL 2V2XB 4OQTL 4RAUB 4CDHA 2XG5A 4UI2A 2LU7A 5KSVB 5GS0C 1N64L 3FHAA 1J1XH 2XKSA 2P5WB 3MLYH 4JFOA 2JB6B 5EBGA 2XT1B 3IS0X 2KUTA 5CINL 1V7NL 4R2GC 2DQIL 4R97C 4HW6A 4NNPH 3ZHDA 4I1NB 3H8NA 1B4JH 4JRYD 3VW3L 5BW7C 1QG3A 4E0RB 2KZ1B 4CVZA 3NPZB 1A14H 1S7SA 2GJJA 4GG6B 1RMFL 1NAML 4YXLH 1NCWL 3BKML 5I1CL 1YMMB 2JIXB 3BN9C 4JN2B 2F8OA 5D7LA 3F12B 4LGRB 5IIEA 4BFIB 4WRLA 5C0AD 2XN9B 4JPVH 3SOBL 3CMGA 2QADD 3SE4A 2VTFA 3MLZH 4ODHL 2X89D 3EYOB 4LIQE 2PW2A 5FUCC 3LKRB 4EEEA 3SO3C 2OBGA 1BD2B 1MVUA 4O2EB 3KXFD 2LVCA 2I24N 1N7MH 3K3QA 4ZNEA 2QQNL 5DR5L 4Q97A 3QXDB 3QPQD 4M3JA 3S3JA 4ZS6C 3PL6C 4K7FA 5DJ8A 4KTEL 3W5MA 5E6ZA 5EZLB 1MWAH 3MGTB 3SGEI 4X7FC 1T66D 4N5UA 1JF1B 5CZXC 4HK3N 2DI7A 4NQVB 3MC0A 3U4BH 3JWOH 3QQ9D 2AJ3B 1WBYB 3BKJL 1ZGLP 4JY6A 4X6EA 4KFZC 4KZDH 5JUEL 3RVUD 4F37F 3GMLB 4H1LB 3SBWC 3WKMH 2X70A 4MLSA 2XTJD 5T1LB 5E00B 3GKWH 1U93B 5FA4A 4MGXA 4Z7WB 4HAGA 1T7WA 3P3YA 3AXLA 3TBSB 1U3JA 3RPIA 4J6RH 4YH6A 2V2WA 2ICES 3CPLB 1CD1A 1WTLA 1ZLWK 4YHYB 2APXA 4NBZB 1SEBB 5E2TH 3QUKA 2P24B 3CXDL 3MRQB 1I7RB 1ODAA 5H94B 5MEND 3CNKA 4UT9L 5KANG 5I1EH 2CDGB 5F21B 4JM4H 3QUMA 3DIFB 3IJHB 4K3EL 1TMCB 5JZ7D 4QGYA 4PJAE 5GGUA 5HHQB 3TBTA 1P2CB 4XCCH 2PETA 4BK5A 2IALB 5BCAA 1AY1L 4XP4H 1FNGA 3QDHA 1U8MB 3O4LD 4OLWL 4LKXB 1UM6H 4BH7A 3CX2A 4AQOA 1R0AH 3QDGB 1I1AC 3CFEA 5I16B 3TZVD 2J5LC 4JKPL 1YNTB 3GNMH 2VO5A 4PJ5A 4AG4H 1RZ8B 2YD3A 4Y4FB 3HZMB 4H8WL 2I5YH 4Y19A 1CGSH 1QA9A 1S9WA 3L5JA 5DRXA 1FC2D 1RUAH 2B1AH 2GCYA 3NTCH 3U83A 5HYEA 5T3ZD 3FJTA 4PRAA 4CBPA 2R9HC 5DJAA 5DUPH 3T0WA 2XFXB 4OBRA 1XR8B 1JZ7A 3CDGA 4LCWE 2EDHA 4ODVL 4P46A 4IRJC 4R8WH 4NKQB 3LKNB 1TZHB 2V5TA 4QO1A 4ZO9A 3WLWD 5DS8A 1C16A 1HQ4A 5IV2A 5BMFL 4U1NA 1T20A 5K9JH 3GUTB 1KB5H 2ZG1A 5I73B 3DYMA 1Q9LB 4X6DE 1H3VA 4G3YL 3SDXE 5EZIH 3JVGC 1TZIB 4UUJA 3G6JB 3BP7B 3MV9D 3RIFK 3U9PH 2WQRA 4BSVB 4IHOB 4WFFD 1MLCA 3GSXA 1BFSA 3RX5A 5F9JA 1I8IB 3TC9A 3G08B 4XCFL 2Z91B 1OGTB 1MIEL 4BZ1H 5EOQH 2P1YA 1WLHA 5IK3B 2OTUA 3DMMA 3FTGA 4L3EA 5HI4D 5FAAA 2I26N 4OD2A 1RJYB 1U8PA 3TA3D 5E6IA 4ODUA 1EHLH 3SKOA 4LAJH 4JRYE 1JJUA 3A6BL 3WFBL 3AB0B 4NYLB 5ENWA 2VISB 4NQXA 3L3KB 5DWUL 4UQ2B 3UMTA 3NH7H 4G8GB 3LEYL 4PJ8C 4ZPVA 4L1DA 4WCYL 1MWAA 2CIKA 1HSBA 1FZJA 1D5MA 4QHKI 4HF5L 2HTLC 5FCSH 2BMKA 5GRWA 1FNEA 3KLSA 2OTPA 4X6CA 2CPCA 4HJ0C 1MCSA 4OCXL 5ISZB 5CJBA 2AKRB 2VR4A 4LHUG 3G5YB 4BQ6A 4IRSD 4GKZB 3DUSA 3IGAA 5HI3C 5T5FL 1NAKH 4Q74A 1BFVH 5FDYA 3BH8A 5DD3L 1BD2D 5I2IB 4ZXBA 2ZCHL 1P6AB 4JRXE 3P73B 3BO8B 4Z0BL 2W9EH 2WV3A 1A7RL 2VXTL 1W0WA 4YHZL 1TJGH 1SJEB 2GYSA 5CEXB 4POZC 4PRHD 2FECL 4XT1C 3OKLA 5I9QC 1T5XA 3B2VL 5IKCA 1YEFL 2D31A 3L5HA 4KTYA 4F7EB 5DLML 2ZUTA 5HHNA 3O9WB 3I6GB 5I75B 4Z7UA 3MCKB 2VDQL 4PRNB 3BVNA 3OKDB 1IAKB 1G7IB 4YBHA 1WT5A 5I18L 4UV4H 1QO3A 5C08B 4G8EB 2FRGP 3FCTB 1J88A 2X1XR 5GHWH 4BK4A 3DO7B 3VD5A 4OF7A 3PNWA 1X5HA 5FGCE 2CGRH 5T3ZL 4JGJA 1FVDA 3U7WL 5D9SB 2XTJE 5HPOA 4XRCA 5CBAA 4HFWA 4YIQB 3ZE1F 4LDEB 3DURA 2WWMD 1LP9A 3VWKB 4L8SA 1SHMA 2D7TH 2JJSA 1I9IL 2VXQH 4ZDHA 4AT6B 3OZ9H 2Z31C 4LAQL 5B22A 4BZ2H 2BXZA 3ZKMD 4QRRB 4MJIA 3VXPB 2X4SA 4YBLB 5E2WL 3RA7L 4I2XE 4X8JA 2W0LA 3A0OA 3GRWH 3DXAD 1UZ6F 4FHBD 5MENE 1PLGL 5CJQL 3RUGB 1LO4L 2WQ8A 4XWOC 5H35A 3K74B 1F11B 4JGUA 4XAWH 1GGUA 5FXCH 3DROA 1A02N 3AGVA 1EEZB 4PG9A 4LF3A 5EU5A 4QTHB 2W60A 4MDIB 3TIDA 2V5YA 1I8KA 4WW2C 3RVWD 3LB6C 4P2CG 3QXUA 5IMLA 3TYFB 4M1GL 2O5XH 2BVQA 1XGUB 4P2RE 4XHJD 4XMLH 1RI8A 1HHHA 3MA9H 1XGPA 2CSPA 4LSTL 4ONFL 3GMQA 4U1LA 4WGVB 5EO0A 1JF6A 1Z5LB 4ESKA 4RISL 3REVA 1FE8L 4ZD3H 3O3DB 4KKCD 3L5IA 3TV3L 4QCIB 3W9EB 3UZVB 5MEOB 3ARFD 3B3IB 1AO7B 3C9NA 3MOAH 5TGBB 4X4YA 1F02I 1WC7A 4PJFE 3RNKA 4QRTA 1KB5A 4D0BB 1QYGH 3MRCB 3B9KA 1U6AL 3O6LL 1AIFB 1RUKL 1A6UL 3C08L 3P0YL 4NDMB 5D4QA 4UZGA 4D0DA 4OI7A 3V2AR 1MCKA 4FQIL 2P7TB 3VD9A 5BRZB 3FOMA 2A83A 2HLFC 5GRXG 1UKTA 4JFEB 1MY7A 5F7FA 3UTOA 4IDJL 4WUUD 4PTTB 1IEAA 1QEWB 3LZFL 4S2SA 2GSGB 3QHTC 5KS9E 3I02B 1FGNH 1SMAA 1XGQB 1WICA 1J05B 5E2UL 1NCAH 4KK6C 4Q2ZA 2HKFH 4XBGB 1IAII 3FN0H 4AZ8A 3PGCA 2EC9T 3FKUS 5D1QA 4Z78B 2ENYA 1DLHA 1MNUL 2W0KA 1H3PL 3T65A 1GZPB 1WVZA 3KYOA 4YHNA 3MV9E 1T1ZA 3CVHL 4U1IA 3V4PH 2ZPKL 4OI9A 1Z9LA 2WSKA 3RY4A 4J4PC 1NC2A 4WFFE 4KK5C 4ORGB 3LRSA 3WO3B 4DVRL 2NY1C 2JJWA 4H1LH 4MCZB 3C09C 2GKIA 3FMGH 2X41A 4YHIB 4MHHI 5IT2L 4F57L 1N8ZB 4OD1H 2VIRA 1PVHA 1A1OA 3RWGA 3VRJB 1C8PA 2MHAB 1ADQH 4GBXA 1YNLL 4JDZB 4AEHH 1T04B 3DNKA 2H6PB 5BJTA 4RSVA 3QISA 2NY6D 1NFIB 2UUDK 4PJHB 5SX4I 3NCYP 1YY8B 2A0LD 3GSVA 5L8KB 3TIEB 2XZCL 4M5ZL 2V5MA 5LWYH 4TTDC 4X4ME 1JGDB 4LPWA 4OCSH 2HRPH 3KPOB 5TDPB 3LKOB 1NMAH 3D6GA 5F1SA 3TVMA 4GO6B 4XVUC 5DFWH 2XN9E 3BXNA 1VGEL 2IPTL 1R24B 3FRUB 3RJDA 4PJEA 4OCYH 1V3MA 4LSRH 2LU3A 3QJHB 1M05B 3E0GA 4BM7A 1BD2E 3MRMA 4LQFL 4M7JH 2WBKA 4C56B 5DD1H 3VI3F 2XACC 3LMJL 5IB3A 4OLXH 3QEUA 5DJDA 4G9DA 4UNUA 3HN3A 5DD0H 2O5YL 1RK0B 1MLBA 2G5BB 4KI1A 5J7CC 3P40A 3TF7C 4X9BA 3MLUL 1WFOA 5I17B 3U46B 2QKIA 3GK8H 4U1JA 5J57B 2JCCA 4WFGE 1YEKL 1RVFL 1YJDH 4MQ7B 3BP5B 1I85A 1DUZB 3HFMH 3OG6B 2OMNA 3MRKA 3M17A 1DANU 4P59L 4APQB 1NQBA 5DHVB 4ZUWA 1J10A 1WAAA 5IEKB 1JZ2A 1OB1B 1DQMH 1IGIH 3D0VB 3MLRH 5SWZB 4C55A 2A77L 3QUYA 3SJVB 3U6RB 4FZEL 3H0TB 4K3DH 3S4SG 2HLAA 4MNQA 4ODXA 5EO9B 3MRJB 3LSOB 5FK9B 3T08A 2H26A 3GRWA 1GOFA 1AHWC 3VWJD 2FEEL 5E1AB 3MJGX 5KZCD 4QXGL 4K3HA 2IH1B 4YUEH 4YO0B 1M7XA 1JWMB 4TPRH 5LG1A 4ZFGL 2XWJA 2FZ3B 4YFEA 3ALPA 4JHBA 1AE6L 3CUPA 4D9LL 5IHUH 1T6VN 1D6EB 3EFDL 4Y2OA 5HYSA 1Y18B 4NOBA 4OCMC 5KSVA 3VXUB 4UOW1 3WBDA 3HE7B 3CZJA 4PR5A 2JB6A 1M71A 2JB5L 5C0JB 1J0JA 3HR5B 3UPRA 5I1LA 2X2YA 3OGCB 3NABL 2AI0L 1A6VL 4YDIL 4YXHL 1MAJA 3IDMA 3SKMB 2NXYB 2OI9B 2MQCA 4LP4A 5TQ2H 2BVPB 2D0FA 3S35L 1UQSB 3Q5OA 1CXHA 3CIQA 3MNWA 4LSQH 1GGCH 5DK3A 3MNVB 4KVCH 1GAFL 2PN5A 3S36X 1UXSA 3PHOB 1AGCA 4KMLB 3PABA 3IFNL 3ZE2F 5KVEH 2VABA 2ZZUT 4JPIB 5FA3A 3PHQB 4NO0D 3EUUA 5IHZB 1XGTA 1E0OB 1BJ8A 1ZTXL 3LEVL 3QI9B 2VDOH 3V6OA 1NGZA 1V7ML 5AD0B 5AWNL 2FJHB 4BSWB 4CVXA 3IKKA 3WXWH 5I8KH 3ARED 5K93A 5IWLC 1HHKB 3GHEL 4O2EA 3V5HA 3QPQC 3IRPX 1BGXH 3DV4B 3ELAT 4EI5B 4TSCH 1LO3L 1T7VA 3ME0A 1T2QH 1W2KT 3L3IB 2XWTA 4GKNA 3W2DL 1ZS8A 5M94B 2DBLL 2R1WB 3HI6H 3HI5L 2EO9A 2AXFB 4F9PA 3UYPA 1MAKA 4XPGL 4YDVB 2WUCH 4HBCH 3QQ9C 1IBGL 3JWNC 1JN6B 3VH8G 1RZ7H 4AM0B 5C7XH 3MBXH 4NKOB 3ARRA 4WUUE 4U6YA 1Y6KR 4PB9H 3LQAC 5DVLA 3HS0B 1WIPA 3U1SL 2XTJC 4I0CC 2H9GA 3LPGA 2H45A 3FQRA 3QAZC 4OLZH 5IQ9A 2UV3A 2EDWA 4LNRB 2AV7A 4LLAA 2YOCA 2DQTH 2Q1EA 1AGBA 5LAXA 4F15C 3W39A 5FB8B 3IFPA 2GJZB 1QSFB 1OAXH 2VC2L 1JP5A 2P4AB 1G7LA 4KTDL 3G6JE 1MCPL 4EN3C 1FVCA 4I18B 2BNUA 1EFXA 1KCRH 2HT3D 4E41D 4HUNB 1R3HB 4LASH 1F6AA 3QCTH 1EZVX 3GSUB 5H94A 5HYFA 5DJZA 3SGDI 1KNOA 4O4YH 4EXPX 3O11B 1ZT7A 2UZIL 4LLWB 12E8L 3O8XD 4Y89A 1BQLH 2E27H 3TBYB 1YDPB 2IFFL 1IEBA 1AJ7H 5CS7A 2O93L 3WUWG 1FBIL 4ISVA 2FH8A 4MA8H 4BZYA 1EBAA 1V8HA 5C3LD 5EIIB 4UIKL 4ZFZB 3BRFA 1CVSC 1XR9A 2AS5M 2VH5L 2PYFA 4LRNL 3QA3B 1T5WB 3P4LA 1FFOA 4WUKL 4LLQB 3SDYL 1OW0C 3UTSB 4NKIL 1X5FA 3IRZA 1ZLSH 4B41A 4JO2H 3HE6B 4QTIL 3CGTA 1ED3A 2WW8A 2CRMA 4GRWF 2DQHL 4MJ5A 1GGBL 1WZ1L 1EZVY 4XPBH 4HPOH 1S8DA 5EOCL 1CU4L 3RX8A 3GI9H 4HPYH 1NGYB 4BFBD 4MA7L 4P5MA 1S9YB 3MODH 2Q3ZA 3EOTH 1N5AA 4E9LA 5E9DA 1DBJH 4LARL 1FORH 2Y07L 3L6FB 4OLVH 5F1OB 3QFJB 1YEHH 3V6ZA 1BVLA 4KJQD 1QR1A 4TNVK 4PJGF 5TPWL 4PP2A 2XFXA 4P5KA 5JHDA 5ITFB 1C5BH 4L5FH 4QT5A 4N8PA 2VUYA 3PP4L 5DZLA 3GDBA 5KAQG 3FO0H 4OAWA 3WLWC 2SEBA 2AJVH 5I6XC 1C1EL 2OL3B 4HV8A 4YHPB 2DICA 4ZTPH 4FFWD 1YN6B 3EJYD 2XV6B 1IL1A 5EBWB 3SJVD 5E4EC 2WBJA 1U8NB 3QH3B 4JY5L 5C08E 4JN1L 4P9HL 4JEGB 1MCOL 5J1AA 4F58L 2F5AH 1XIWA 5DT1L 5C09B 2VAAB 5IVXF 4RMVA 3QEQA 3MUJA 1I8IA 1TCRB 1QFPA 2UVEA 2Z91A 1AXTH 1OGTA 4NPYA 1AGEA 5D93B 3VXUD 3WMSA 1WFNA 2P5ED 4KI5F 1C08A 3H7LA 3VG0L 1T0NB 4X7SL 1GPOH 3TT3L 1YEGL 5BZWA 4I77H 2OJZL 1ZXQA 4NQCB 3VFWA 2MTPA 4WTWA 1UZ8A 1FL3B 4B7IA 1OT2A 2GTZA 5KAQF 3WXVL 1PSKL 2ZOLB 5I8CA 1UEMA 1TJHH 2XA8L 1FRGL 5C92A 1A6TB 1I7ZA 3BSZL 3N1QC 3I50H 4U6VL 3IDXL 3U36B 4FABL 3CZFA 2A6JA 5JIPA 4NQEA 5EUOE 3BPNB 4KQ3L 5FKAA 4QRPD 3CX5J 4XCNB 3JV5A 2XRAL 1OPGL 4ZTOL 3WEXB 5ISZA 1LMKA 5ILTL 4Y5XA 4IRSC 2VAJA 1X5AA 1JRHH 3KS0J 3GJFK 4XNYH 4XNZB 3KS0H 3WE6B 2DYPA 2VUOA 5L8JB 3MA7B 2DIBA 2PYEA 2XYCA 1TVBA 1AR2A 3P2TA 5CEXA 2NXZD 1I4FA 4R0LB 1AO7E 5C0EB 2C1OB 3ARQA 4U1HA 4L4TA 2NY5C 2EICA 3CFCL 3MRLA 5L88L 5M95B 3LQZB 3OQ3B 1KEGH 4ZPTB 1UXWA 5C0DA 2JF1A 4JFDB 1JMZA 1UM5H 3MCKA 4DAGL 2P45B 3VCLB 3LHPH 3OKDA 3NIFF 3NFNB 2AEWA 1A6ZA 4RDQG 4OFYA 4XC3H 3IU4H 4G8EA 3SBWA 4G6FD 1G9ML 2OZ4H 3FCTA 3I75B 4O00A 1MRCH 4AENA 3DO7A 4OZGA 3ALWA 2CLRA 5BXFA 4JHAL 2H1PH 5I1HL 4HIIB 2LABA 4PJCA 3D69B 4W6WB 1YEJH 3HLAB 2L4OA 1VADB 3N06B 3ULVD 4XCEB 1IQWH 4V2CB 3S37X 2BSRB 2DKSA 4Z7QF 1M4KA 3R06A 5HDQL 5DHVH 4JQIH 5C0FA 3ULSB 2NY4B 3WFEL 2DLGA 2DBJA 3SCMD 3ZKMC 1E6OL 1MJUH 3RZCA 3CH1B 4GRLD 2EDQA 4JO4L 4DVBB 4LDOB 4XBPB 4UTAH 4G9FA 5E2VH 5BVJB 4YHYC 2N4IA 1KN4H 1N59A 2A9MH 5DI8B 4ZFFB 3P0GB 5HGAB 3P9LA 1NMBL 1JFQH 4MA1C 4RDQF 1MIMH 1SYSB 2E5EA 2IBZX 5CKGA 1NJ9A 3TYGL 1E4KC 5IG7A 4X6BB 1Q0YH 4JFPB 2C7UB 2EH7H 2ADGA 1IAOB 4OTXL 2XKNA 3RVWC 2NPLX 2F54B 2X4TB 4Y4HD 4U2ZA 1A4JB 4F7TB 1JHKL 4DKEH 5GGTL 5HGHA 1TETL 1FG2B 3M8OL 1U2HA 2VLMD 1CGVA 4WI5A 8CGTA 5JMRA 4FQCL 4LBEA 4GW1B 4YFLI 3BDYL 3CFJA 5CP7A 3WDHA 3O3DA 3ULUH 1UWEL 3UTTB 1XZ0B 1H5BB 3ARFC 4WHYH 1T7ZA 4KGJA 5D72L 3ZT7A 1LE5B 1U95A 3HE6D 2DKUA 2Y06L 2ICEA 1CT8A 4U6XA 5E8EA 4K23L 1I7TA 4JFHD 3IXAA 2Q20A 1JPTL 4HJJH 4KDVA 5TE6L 3IS1X 2VQTA 1YPZA 1MFEH 1U2CA 2IBZY 1AIFA 4LHUB 3TT1L 1KJ2B 4OJFL 5A2KH 3F5WB 4HKBB 1CR9L 5FUZL 1CFNA 2DDQL 5BRZA 1NGXB 4GH7B 4MAYD 1OT1A 4KV5F 1U92A 1QRNA 5HDBE 2EIZB 1QSZA 1RU9H 6FABH 1U8IB 3PGDA 4M7LT 4OZIF 1I8LA 4O2CA 4X5XA 4P2OD 4GQPH 1KELH 2HG5A 2XKUA 5SWZE 4PJ7F 5CILL 3SJVE 5GRVK 3HG1B 3JVGA 5T1MB 4JFFB 5IFJA 2HVKB 4RWYH 2BHUA 4N8CH 2Y5EA 3OX8B 4OQTH 3LRGA 1ZWIA 4ZSOB 3H3PL 4PBXA 4PTUB 3IJSA 4MCZA 1J1PH 2IJ0C 4GS7B 1V7NH 2WIIA 3VXUE 5EU6A 1SJXA 4G8IA 1CIUA 3VW3H 4WTZG 4IIQA 2P8PA 4PRPD 4Y8DC 1ZGLM 4FTVB 2NCMA 1RUMH 3MV7A 4AL8L 3ULVL 4XNQA 3G04B 1NAMH 2NY6C 2Q6WB 1W0VB 4PJHA 2YWZA 1NCWH 3MLSL 3AB0C 5I1CH 4WU7B 1RIUH 4UIMA 2BVYA 3B9DA 3J7HA 3ULUE 4EOWH 2AEPL 5H2BB 1CWVA 1FH5L 3ARSA 4JCMA 2A6IB 4I48B 3GMMB 5A43C 4HCRA 3C2AH 4ODHH 4FMFA 4F7PB 4QRPE 1MCNA 5F7WC 2IF7A 2RBLA 2ZSWB 4OUUA 2YWYA 4P3DA 5GISL 1QFUL 1K2DB 2AK4B 2VXUL 4EI6A 3LPFA 3QUZA 1BFOA 5ICZA 4KTEH 1CVRA 1JPSH 4HQQH 3KJ6L 4XMKH 2IPKA 2OZ4A 3MO1B 3CVIL 3WD5H 1E4WL 4PG2C 2Q76A 5MHSE 1UCBH 1CD8A 4Z0XA 5IW1B 5DRNA 5ICYA 2ZCKL 3BKJH 2VDRH 2DTSA 3T3PE 3LV3B 4O02L 5DJXA 2K1MA 1IC7L 3NCCB 3S97C 4S1RL 1F4XL 5EBLB 1OB1A 4S1SH 5I75C 1I3RB 3QNZB 1ZHBB 3R1GH 4OV5B 4X80H 4ZQKA 1RY7B 4JANB 3KR3L 4MCYB 2VZSA 4QRQA 2L7JA 4X83A 3TH3T 3V0VA 4BFEA 2V17L 2B0SL 5MEPA 1WZKA 3VWJC 4PJXA 4Q9BA 3VXSD 4LSSH 5C8JA 4U1MB 5GZOC 5IEHA 1FO0L 4L8BB 4JPKL 3JXAA 2W0FB 3ULVE 1HH9A 2L7UA 3P11H 3QRFM 3M1BB 1OQXA 2BHZA 2GJ6B 1D6EA 5ABDE 2F53D 4F8QA 3N1FC 3VWKC 4X4XB 3FQTA 4G80A 3UJTH 1JI1A 3HE7A 1CLZH 4JFXA 1QD0A 3T0EB 2IPUG 3CXDH 1NEZB 3WSQL 1UC6A 4MD5B 3OGCA 3MJ8B 1ZLUH 4UT9H 4EIZC 3DRTA 4YEFA 2VLRB 2BVPA 4K3EH 5FKPB 1KN2L 5HXMA 5D8JH 5TE7H 3O3EA 2ZUVA 1FG9C 3VFMB 4JZJB 3S98A 3KHOA 3EKCA 3MYJB 3PHQA 2JE8A 3L5WA 4JDTH 3L95B 3QWOB 4OLWH 1EGJL 32C2A 5A16B 4RFOL 1BOGB 1QHOA 2R0KL 3D3VD 5CJXC 4OKVB 3VDBA 1Q94A 2FCBA 1DBKH 3EYFA 4OFPA 5ECJE 5AD0A 4OZHF 3WL9A 3AREC 4BSWA 5A3ID 1CN4A 3BGFB 3TCLB 2VLME 4JKPH 4O58L 3UPAA 2JK5B 3S36H 3UTSE 5D7KD 1I9JL 1KT2B 4QF1A 4H8WH 2RB8A 1ERNA 5DJ2A 3MROA 3UTTD 4YHLL 1A9EB 3L3IA 3SDAB 1IZKA 2AQ2A 2G60L 5EC2A 3ZDZF 5DUBA 5L2KA 4LNVA 1INDH 3HR6A 43C9B 3E3QE 3F58H 4ZAKD 1FYTA 4P57A 2IAMA 2EKSB 3BH9B 4OQTA 1OSPL 1Y0LA 4YBQD 3VU2A 2YPVL 4JHZA 2Y72A 4HUUB 1MFAL 4NIKB 4Q58C 2HVJA 5B21A 5IM7B 5MI0B 5BMFH 3SKNB 4E5XB 2EECA 5ETUB 2APWA 1XF3A 4OD3H 5E8OB 3CLEL 5ADPL 4YC2B 1HZHL 5IJVB 4XCYB 3DX8A 4RA0C 3LKQA 2Z92B 1Z9OA 4HS3B 3WS3A 3RL1A 3HG1D 1DDHA 3GZKA 2Z8RA 4DKFL 1NAMA 2H3NB 2X1PA 3FB5B 4RX4A 4P5TB 4IS6B 3HMWL 2G5RA 5IQ7H 4Q6YA 3S4SB 1ES0B 1CK0H 4J4PA 4NUJA 4XCFH 4U1GC 5DQ9B 1JUFB 4M8QA 5MEQB 3PWUB 1CFVL 3UC0L 4NO3A 2HT3C 4PUBL 3D87B 1VFBA 4Y16B 5GS2H 2E7HA 1WEJL 1YEDA 1JV5A 3A6BH 3O11A 3WFBH 3FO9B 5CWSB 1T21B 3NIGF 4HH9A 4DK6A 5DWUH 4MS8D 2WK2A 4KHXL 1EEQA 3TBWB 3RTQD 1KJVB 5DO2D 3SDCD 4FNLH 5F7DA 4WCYH 4WHTA 4YHML 4PJIF 2PO6A 4HIXL 4JVWA 5B39A 1S7QA 5DC0A 3RGVB 4Z5RA 5I76B 1UH3A 2YEZB 4LLQA 1R3IL 5JO5B 2X9XA 4OCXH 4L4JA 5J06A 4R7DA 4ZUSA 2FX9L 1WIUA 4C59B 2DWEB 3THML 4ODSL 4AH2B 1BVKA 3AS1A 3NZ8A 3STLA 5T5FH 1QRKA 3BISA 1OAYH 1G9NL 5DD3H 1IJ9A 4P4KD 1C12A 4Y4KB 2LAAA 3NACH 4Z0BH 3OB0H 1G9MC 2AK4D 1WBZA 1CDBA 1OSZB 5D2LF 5D7IF 5FO7A 2KDGA 4WW1B 4UINL 15C8H 1SEQL 3MREB 1FFPB 5DRWB 2EEDA 4UV7L 1X5LA 4LRIA 2YKLH 4L4VD 3B2VH 3OKKA 3L6FA 3MBED 2ESVA 2IADA 2E7CA 5DLMH 1ONQB 3C6LA 3H9YA 3CSGA 3ILPB 2EYTB 3BWUC 5GJTL 3GGWA 4CMMB 1AXSA 3ZT5A 1L9NA 2IGFL 3IFLL 3KLHD 5DYOA 5I18H 4APQC 1NDGB 1LO5A 1DBBL 1F2QA 4QGTA 4FFWC 5BOZG 1NEUA 2YS4A 1UWGH 1ZHLB 3PJSB 3EJYC 3ZDXF 4PRIB 1MHEB 3U7WH 3GJEB 1AHWA 3PE9A 1Z0NA 4JG0H 4ZFOL 2V2TB 1H8SA 3VH8B 4LCIH 2R4RL 4U7SA 5DMGC 4L3AA 4Z7VF 3H42L 3OXRA 4JKKA 1VFAA 2WNGA 4KQ4L 4D9RE 5C09A 2VAAA 1I9IH 1LEKB 1ZHKA 2FJGB 3HHRB 3QO1A 3P0VH 2ADJB 5KJRL 4LAQH 1CDYA 3BJ91 1J8HB 2F53E 1AH1A 1A0QL 1WCBA 3RAJL 2OJEA 1XMWA 1MUJB 4M1CC 3ESVF 5CZVL 2BSTA 2A74B 2R1YA 1KIQA 5ACLA 5IGXL 3NMEA 1LO4H 4AIOA 5F88B 4PLNC 2OI9C 1FPTH 2FBJH 4PS4H 2ILLA 5ACZA 4XP1H 3ARDB 1LK3H 2F58L 3ULUC 4X5WA 2X1OA 1G7HB 1R3LA 3ZKQD 4GRWB 1QSEB 3NFSL 4PP1D 2NLJA 2B5IB 4TUKL 5C0AA 1RJCA 4XPAH 4YZFF 3BIKB 3VMNA 3WNMA 3BHBB 4LSTH 1D5XB 3D3VE 4HMEA 1KTKE 2PKDA 4JQVC 2ZSVA 4H5SA 3WUWB 5F7EH 1T0MA 3KXFA 4TN9A 3NCJL 4PJGB 4Y5VA 5FYKD 1CDIA 3RNQB 3TV3H 2X9WA 1YEIH 1I9EA 3KPPB 2EEAA 5D7KE 5I1KH 1X5IA 2J6EH 5GRUL 4MD0A 1NCCL 1AI1L 1P4LB 3UTTE 2PW1B 1DSFL 4MMZC 1K5NB 3O6LH 1KCKA 2NXZC 3TPKA 1RUKH 1JCKA 4HHAB 4PYGA 1A6UH 1VPOH 3P0YH 4R0LA 4KJPD 1T1XB 3SEPA 3TO4B 5AEAA 2ED7A 4PJDE 3V4UH 1GOHA 1AKJB 3LQZA 3EGSB 3JTSA 4JY4B 4O51B 3ROOA 3SQBA 5LBSH 1LEIB 2Z35A 2JELL 1UA6L 3LZFH 3MRRB 5IVXB 3L7EB 3CSYB 2ZOKA 5DQDL 1WZLA 2EXYC 1UEYA 4YEEA 3ZE1E 3QIBB 5AYQA 5E94A 3RWIB 5C0BB 1B0GA 1D7FA 1P69B 4WHDA 1LO2H 5IB1A 4JPWL 4U6HB 4WWKB 4ONGL 4JZOA 4IBLT 1JBJA 1X44A 5BQ7B 3ULVC 1FZKA 5HYQA 1KLUB 2VZOA 1NCDL 2IBGA 1G0XA 3T3MF 2EYRB 3H3KA 2Y6SD 3HG1E 1N26A 2FIKA 3GSWB 2D0HA 3BPCB 3PV7A 1Q72L 1L0YA 3SCMC 3TNMA 4GRLC 4ZSOE 3RBSA 2M1KA 1KXVC 4KAQL 4QXTA 4Y1AB 4I18C 1G7MB 1T3FA 4RFNB 5MENA 2ADIB 1YNLH 4FFYL 3R8QA 1PQZA 4RZCA 5HGAA 4CJ0A 1Q9KA 1EHXA 4KUCD 2NX5B 1CXIA 2H32A 2QR0A 4G6KL 3HAEA 2DQJH 1F4WL 3GFUA 3O81A 2BK8A 1EIBA 4FTVE 3FFCD 4N0CD 3MR9A 2HRLA 4HT1L 3PWLB 5CSZB 4M5ZH 2XA3A 5A2JH 1IAOA 3K2UL 3O4LA 4LVOB 3NFPA 1UT9A 4Y4HC 4M3KB 4DW2L 4HKZB 5D6DC 1J18A 5CHNB 4FA8A 1OAZL 2VB5A 1BZQK 3LDBC 4V1DB 1PKQB 2EDFA 3MNZB 5J9PA 4GW1A 3QUML 5C0CB 3TZVA 5C0IB 2UY7A 3KPSD 3O6FB 1DEEA 3WV0A 3F7VB 4MD4A 5KG9A 3HE6C 4LQFH 4NQSA 2C9AA 1R5WB 2EH8H 4F9LA 3LMJH 1FAIL 1SBBA 2AK4E 4YR6A 2O5YH 5KSUA 4KROB 3MFFB 3E3QC 4J3SA 5MERA 3MLUH 4HJGA 5F3HB 5FHAL 4N0UB 1RVFH 4G7YL 1C5CH 5JORB 2YPLB 1IGCL 3AY4C 5K9KB 2YXFA 3KPNB 4HLJA 2ZCLH 2C3WA 3OJVC 1IQDA 4MAYC 4UT6L 2IQAB 5EU7E 1ZT4B 2X1WL 4LLDB 5FYKL 3V5DA 5KS9A 3PIQA 1MAML 2X7LA 1OAKH 3MLTA 3T2NH 3R8BB 4FZEH 2Q86A 4P2OC 4WFHD 2VQ1A 4D2NA 4LLYA 1URLA 1QR4A 5GGRA 2H2PD 3DVGA 1INQB 3AU1A 4JFYB 3IAQA 1AE6H 2EYSB 4D9LH 1MHPH 5IUSA 1T6WA 3UXFA 3P30L 3QWQB 4FQXD 5FO9A 3OX8A 2RAMA 1KEMH 5IMKA 2VKWA 5HBBA 2Y36H 1F2XK 1OAQH 3PWNA 1VA9A 5F7NC 1ND0A 2JB5H 4ZMAT 3QDJB 4HKXA 4M62L 5HVHB 5J6HB 4YDIH 5CSGA 2AI0H 1A6VH 3GMNB 3TN0D 5D93C 5FGRA 2R2BB 1RIVL 5FHBH 3TA3A 5C0ND 4UB0L 3VXMB 1F4YL 2HJFB 4M7KH 4JB9H 1PG7X 1M7IA 5EBMA 5HGBA 3Q5TA 2VLRE 1I1RA 3RFZC 2Z8SA 5JPNA 1KUMA 5CGYD 4QHNB 5IB2A 1MCQA 2OCFD 4OBSA 1N2RB 3MCLL 1CL7I 3LEVH 3RDTD 1JWSB 1EXUA 3NCEB 1QSED 1FL5A 2ORBH 1RK1A 3BPNC 1J0ZA 1EBPA 5AWNH 1UVQA 2R23A 4IMKC 5ITBL 3VI3E 5D5ME 4IRSA 3BZEB 4L3CB 2W91A 2DJUA 4RQQB 4HIJB 4F37K 2V7NA 4OGYH 1ORQA 5E8DL 4XNZC 3LN5B 4HDIB 2DL2A 5ID1B 4YQXL 1E27A 4FG6C 1K6QL 2DBLH 4ONHA 5F6IB 3HI5H 3QP3A 4KH2A 4X6CF 2Z0BA 2ID5A 2FEEI 4OZIB 1SVZA 1JZ5A 4PRHA 4PY7B 3SDDB 1YZZA 2VDPL 5GRJL 4L29B 1M7DB 1VHPA 2FIRT 3L3JB 1H8OA 1NLBH 4PJ7B 4Y2DD 4DKDC 1VESA 2YR3A 2Y7QB 3CFDB 1RUQL 4OM0L 4TULL 3CVHA 2E9JA 4QHMB 4DGVH 4WEMB 4HS8H 1RPQA 5IMOB 3JV6B 2XNAB 4N1CA 3STZA 2W9DH 1JNNH 1ZLUK 2H41A 3C60D 3BI9X 3IF1B 4M6AA 1O0VA 1DQQB 2O5ZL 5E24E 2VMFA 4YLQT 3EDKA 4Z7OE 4HGWA 1I8MB 5D7JB 2CIIB 2J3SA 5JDSA 4B53A 4Z7UF 5E99H 3OR6A 5L6YL 3MV8D 2CDFA 4M6OL 4KI5D 4I0PD 4PRBB 3QIUA 2FJFB 2GJ6A 2VC2H 4KTDH 3WKNA 1BLNA 1A6WL 1MCPH 2R0LL 5FO8A 1Q9WB 3MXVL 4RMRA 3KPLB 5JR1H 4JLRB 4KHTL 1IVLA 3O2VH 3PWPA 1M6OA 3MRHA 1MCEA 2XWBA 1MJ7L 1QACA 2FHBA 5D1ZD 5C07D 3DXAA 5F9OH 3MJ8A 4QYOB 2RIKA 3ZE2E 5JW4N 5TFSH 3FL7A 3O6ML 2A2QT 4DGYL 1A4KA 3HCVB 3OJMB 1S78D 1QKZL 1PW3A 4JZNA 2IFFH 5FM8A 1WTGT 3DI3B 3U30B 1G9NC 2HTKD 1FBIH 2G75B 1DLFL 4KRNA 5EOTB 3WFZA 1RUPL 2X4OB 3VFMA 4R4BA 3DGGA 3QQ4A 4NNXA 1U8OA 1NCBL 1TQCC 1FVEB 3FFCE 1NLDL 2VH5H 4LRNH 5HGGS 4RA3A 5LQBL 5A16A 1HH6B 2GT9B 5JHLH 1DN2A 4WUKH 3QCUL 2QEJA 2YUZA 4KU1A 4ALAL 1WIOA 1JZ4A 3TNNB 1HI6B 5A3IC 3C87A 1U8KB 3DVNB 5DDHA 3LD8C 3RWJA 4NHCH 3GB7B 4I5BA 1RHFA 2WLYA 3AC0A 3QEHB 4PJ9D 4KKBD 2OMBA 4ODWA 2JK5A 2OTWA 5HHOB 5L0QB 2LTQB 2DQHH 2XZZA 4BQCA 1GGBH 1WZ1H 4OF8A 5EOCJ 3NOIA 3W0WB 1JK8A 5GXBB 1IKFL 4R6UA 5EOCH 2BY2A 1CU4H 1H5BC 4GRWH 1XF4B 3SDAA 3WJLC 2VSCA 3VRLF 2PXYA 3EOBA 4WEBL 3VFNA 5EU4A 1U3HD 2CXGA 3MLVL 2ATPB 4Z76B 4LARH 1GC1L 2BVTA 1MQKH 4HUXA 4JM2D 1L4IA 4CU8A 2VDML 4JJ5B 2D2OA 3WFHB 5IOPA 2YBRA 8FABB 1DQTA 1AD0A 5EU3B 1FL6B 5T1KB 3VFVA 2A73B 3JUZA 3MPCA 4CN6A 2ARWA 2XPGB 5IM7A 4W68A 5GS1A 4QHUB 3EYVA 5B3NA 4IOIB 2ADFH 4FFZH 3T04D 2VN4A 3K4AA 4JN1H 5E8OA 2BNQD 4WFHE 5JNYA 1MCOH 3OSKA 3RVVD 4J8RA 5F9AC 2UYLB 5IVZB 1E4XL 4PJBE 2K7QA 5DT1H 4U1KA 3T77B 1KYOJ 5HY9B 3C8DA 3EOAB 4NO2B 1HSAA 2PNDA 3KPMB 1D9KD 1QFWH 3QQNA 2EDBA 5FECB 3SKJL 2G2RB 3INUL 3PWUA 2DI9A 1SY6H 3QIWB 3VFGL 4LHJB 5TDNA 1ZT1A 2BJML 3VG0H 4CU7A 1INEL 1A7PH 2VLLA 3H9SB 3BDXA 3CK0H 1YEGH 2OJZH 4GS7C 4HUWB 5DHYA 4HXAL 2YMXL 3I6KB 4OZHB 3QYCA 1PSKH 5CJOH 3OB0K 4NZTL 4HEPG 4PRDB 4MS8C 2R2HA 4TSBL 4DEPB 4QNPF 5T3XD 3IDXH 5DO2C 4FABH 3P4MB 4X7TB 3BAEH 1R5VA 4HWEL 4P9ML 3NCYS 1Q38A 3QSKB 4KQ3H 5J12C 5LGJB 1N5YL 1T22B 1Z9MA 5TH2A 4GRWE 2R0ZH 1OPGH 2XRAH 4GW5A 4HX1A 4ZTOH 1K4DA 1QSEE 2I9TA 1IILE 4KKNA 3RL2A 1HEZB 1P7KB 5GGSY 1IC4L 2W65B 1ZEAL 4XXDB 1ZA3B 4P4KC 5L7XH 4OCWL 1N4XL 3WIHA 3CLFL 1TENA 4F2MB 4PJGE 1OM3L 4Z18A 4UILL 4PJEF 5INDB 1HHIB 2NR6D 4NKMA 5HHXL 2EC9U 2GAZB 3CFCH 3OHXA 5L88H 3U82B 3PWVB 5EU7C 1OWWA 1VKXB 4K9EL 1I1YA 3KYMB 4WNQB 2X4QB 2HKHH 4GAFB 5I1AA 4DAGH 3KLHC 5LCVL 5HYSG 1WFUA 5I66A 2WMPA 1NDGA 3PG2A 4YWGL 1Q9OA 3O41A 1T1WA 2AJSL 3K8MA 4L9LB 1U8LB 4TUJA 5L2JB 4XH2B 4RAVA 3BJLA 3FQUA 5IVXE 2JCCF 1T7YA 3FQNB 2A1WL 3VWJA 5ANMB 3KPQA 3BZFB 1KLGA 1OLZA 4G43A 3GIZL 4GRMB 4K71B 4I9WE 1BM3L 4PGCA 4U31A 3V5KB 1DZBA 1MFDL 4AQ1B 3IKCB 3MV8E 1BEYL 5KSAB 4KI5E 1NBYB 2W0PA 4U3HA 1KPVA 2YN3A 5I1JL 3TJEL 4KKAD 4F3FB 1KTLA 1UJ3C 5DF0A 1F6LL 2HFFB 4K3JH 4NRXB 3KYAA 2WANA 3C5SB 1HKFA 1YMHA 5DJ0A 4PD4J 5F71A 3VXOA 4M7LL 5C07E 3REWB 3MXWL 5GGVY 1NMBH 2Q8BH 1TPXB 2YK1L 3DETC 1ZE3C 4LLVA 2XQBL 1HQRA 5TQ0L 5JOFB 5J13B 4GUPB 2DRUA 1YNKL 3GSNL 4ELKB 1U9KA 1PX3A 1J11A 4NO0A 3ZSTA 5EUOA 2NX5E 5DUML 4H0HB 1P7QB 5TF1H 4JZJC 4PP1C 3W81A 5BS0D 4ZYKA 4LSUL 5D2LB 5D7IB 2BNRB 5I1IL 3FO2B 1RZFH 4OFIA 4GG8A 2YA1A 1TETH 2A6DB 1VGKA 1T7XA 5AG8A 4FQCH 2E9WA 5CIPB 3T1FA 5FGBC 3UBXB 5IF0A 3BDYH 1C5DA 1YUHB 3OMZA 5DXWA 3MUY1 2FH6A 1BBJA 1L7IL 3BGFC 1PKQE 3HUJA 5DD6A 5T3XL 3Q3GB 3D18A 4K23H 3W0WD 1A1NB 3RKDD 2EZ0D 1D5BB 3GMOB 4HHAA 4QOKD 1U91B 2MNUA 3NIFE 3TT1H 4OJFH 5HYJD 5IROC 2YSSA 1CR9H 4YPGA 4P23B 3L9RB 2DDQH 4CJ1A 1NDMA 3EGSA 5KN5A 5FCUL 1D6VL 2EE6A 5ID0A 4JO3L 1N6QH 4LKCB 2X4PA 5DQJA 4N0UE 2Z8VC 3STBA 2YPLE 2GK0B 4EXKA 4WTXA 3T4AA 1AGFB 4WJ5A 3CFBA 3RWDA 2L0DA 1FV1A 4Z7QE 1HWGB 1U0QA 2NW3B 5EC1B 1MCWW 5MI0C 5EO1B 2BNQE 2AGJL 5I8OH 1GGTA 3HA0A 3MJ6A 1GIGL 1QQDA 4YC2C 3EIFA 3QG7H 5GS0D 4M48L 1Z0MA 4JFOB 2HJKA 4X9IA 2CKBL 5F97E 1QBLL 3OAUL 3FQXA 3BPLB 1BJMA 4E41A 4Z7WF 3SN6N 4Y1AA 1L0QA 3N1PC 3LS4L 3QIWD 4NOFA 4Z8FL 4HS6A 3QDJE 4AL8H 4CVZB 1S7SB 3O8XA 1FZOB 4MX7A 3ARTA 4M93C 1P9MA 3D2UD 3FT2A 2AW2A 2R56L 3BKCL 4FFVD 2XXCB 3BN9D 4L8CB 5CCKL 5D7LB 3VXME 4I4WA 5EG6C 5IIEB 3PXJA 2PTTA 2AEPH 4LPXA 5KVDL 1IGTA 3DWTA 4ENED 5T33L 5K9QI 3E6HA 4P3CH 2BRQA 2PW2B 4BA8A 3N85L 5I1GL 2FNBA 1UG9A 5DGQA 2E8ZA 1MVUB 2KH2B 4E42A 4AIZA 3HNTL 4HZAA 1OP5K 3BGMA 3L3HA 2VLKD 5GIRA 1CQKA 5GISH 4KXZH 3CC5A 2VXUH 1EVUA 3O6FA 2P44B 1ORSA 4K7FB 3PL6D 5DJ8B 3A6CL 4ZODA 1NBQA 1HHGA 3KJ6H 1ZSDA 1JYXA 4Y4KC 3CVIH 2E6JA 4M03A 3TO2A 1S3KL 1E4WH 4KV5E 1QBBA 4OZFA 1CXLA 3IDNA 3V7AG 4IOSD 3P4NA 5M7QA 1CBVL 4OZIE 4O02H 3GO1L 4X6EB 2P43B 4S1RH 1F4XH 4JHWL 1W0YT 3UX9B 4XPHL 2VLJD 4R4NC 4KVNH 1CFQA 1TJIL 2X70B 3SO5A 3KR3H 7FABL 3MRPA 3SE3C 1OY3B 4N0YL 2V17H 3RJQB 1F8TL 1KCSH 2B0SH 5FA4B 3S34L 4CUCA 4N68A 4W81A 5MP6L 4G6ML 3L7FA 2H2PC 1CICD 5DURD 3EHBC 4FZ8L 3AXLB 3CDFA 1U3YA 3RPIB 4JPKH 4IJ3B 3WHXA 2V2WB 5BV7L 4FQXC 2BVOA 3U0TB 3ZDYF 4MLIA 1DBAH 3LEXB 2VN7A 1CD1B 4GSDL 1DBMH 3K4ZA 1RZKH 4OLYL 3HC0A 2W9LA 2VR5A 1S7RA 2P5EA 5J6HA 4R4FL 3SE9L 5GGTA 1WWCA 4FS0A 4F7CB 3PQYB 3QUMB 4KXZI 3E6FA 2HJFA 4RMUA 5GGUB 5EZJA 2APTA 2Z8WC 5GS0L 1YECL 5CGYC 3RQ3A 2HH0L 1NUFA 2ZG2A 3FFDA 1EGJH 3RDTC 5TDOA 4RFOH 2OLDA 4BH7B 1L7TL 4JVPA 5BS0E 4QRPA 4NWUH 3CFEB 4P49A 4JQVA 2GITA 1I1AD 5C9JA 1KGCD 4O58H 4PJ5B 5FEBA 2BDNH 4WI9A 4Y19B 5AZEL 3I9GL 1QA9B 1S9WB 5DRXB 2YXMA 1QPPA 1B2WL 5ID1A 2GCYB 1MHCA 2G60H 1XT5A 4PRAB 3W0WE 5DJAB 2R9HD 4TVPD 3ARBD 1I75A 3VGGA 4H25A 1OARH 3QCVL 4XGZB 3F7RA 3CDGB 2DTML 3TO4C 2YPVH 4IRJD 5HSFA 1MFAH 1UKQA 2MPAH 3LVEA 1JPFA 3WYRA 1BPVA 5DS8B 1C16B 1HQ4B 5IV2B 1MCDA 1VFMA 4U1NB 1T20B 4W4OA 2EDNA 3C60C 1T89A 3V6BR 1EHAA 5JA9A 1GJIA 1QBAA 1QNZL 1KBGL 1FQ9C 3QIBC 3CLEH 4UUJB 1K3ZA 5J56B 1I8MA 5HVGB 3HTLX 4J2XA 5JXED 4P4RA 4KI5C 2DM3A 4WWKC 5J6GA 1QLEL 1HN1A 3GSXB 3HMWH 4NKDA 1IGFH 2I60L 3CFKA 4YDLC 1LWRA 2B20A 4BYHA 2PTVA 4M00A 3SCMA 4OZGF 2OTUB 3DMMB 3HZYA 1CFVH 4L3EB 4GRLA 1QZ1A 3UC0H 4PJCF 4Q0XH 1GHFL 4PUBH 2PTUA 3UTQA 4OD2B 5D1ZC 1U8PB 5E6IB 4ODUB 4P2QA 3SKOB 5H8DA 5B3JF 3PV6A 1WEJH 3BD5A 3PDOA 1JI2A 2OP4H 4ELME 5ENWB 1RAMA 4WDIA 4NQXB 2HTKC 3MCG1 3H9SE 2G75A 4PJ8D 1A7OH 4ZPVB 1IGMH 1HXMA 1MWAB 2CIKB 4MNHA 1ZGLA 1JGLH 4O9HH 1HSBB 1FZJB 1D5MB 1NC4D 4Y4HA 2CRIA 2HTLD 4OF5A 1FNEB 3OXSA 4X6CB 4EVNA 5J11C 5KANI 4G7VH 2DLEA 5IB4A 2FX9H 4K9EC 1HI6A 4LSPL 4RGNB 3THMH 3DUSB 3IGAB 3VA6A 3D9AH 3BH8B 3ZDZE 2VLKE 4ZXBB 3CD4A 3Q1SH 2QQQA 5B8CA 2FX7L 2OXGA 2E7LC 1MI5D 1CF8L 2IAND 4XHQA 3NA9H 4WEUD 1OLLA 5JLZB 1ZANL 4UAOB 4DZ8A 1LDPL 3OKLB 1S7UA 4M7ZB 3UJIH 1T5XB 4RGOL 4U0RB 3QPXH 2D31B 5IKCB 1ACZA 2VDNL 4KROC 5FYLD 5IB5A 4YE4L 1FO0A 1KYOK 5HHNB 2AJXL 4FQ2L 4JM2C 4NQDB 1WWBX 4Z7UB 5GJTH 4K8RC 4MAYA 3BVNB 3QDMB 1RFDL 1J0IA 4BSJA 3RY6A 1TNNA 2IGFH 3GKZA 1NANH 3IFLH 1QO3B 1F90L 1LEGB 2FSEA 1YPZF 2FL5A 1DBBH 4HUMB 4MA3A 3ZYOA 1V3KA 4P2OA 3PNWB 5D6CA 3A67H 1FVDB 4YK4C 4XRCB 5CBAB 4HFWB 1LILA 1P4BL 2CLZA 4TVPL 1LP9B 1IRAY 1TVHB 3H42H 2IG2L 4L8SB 2UYLA 1G6RL 4ZDHB 5T1DL 5ESVA 5KJRH 4NO2A 4FP8L 1EVTC 3EYUL 3RAJH 4HKJA 2V9QA 4MJIB 4XVSL 2X4SB 2ICWI 4JKWA 3S96A 1QVOA 1EGJA 3T0DA 2DIJA 2ZG3A 5CGTA 1ZV5A 3NIGE 4X8JB 2AQ3A 4NCDA 3AM8C 5DSCA 2MCPL 1YQVL 1NGQL 3BQUD 1OQOA 5IGXH 3DVFA 5HVHC 5H35B 3CDCA 4PRPA 4HUWA 4FQJH 1D5ZA 3DROB 4PJIE 4PG9B 1JGVL 3W9DA 5KOMC 4LF3B 3L1OL 2W60B 2F58H 4U1SA 4GW4A 3TIDB 3OKYA 3HPLA 3CMOL 3UZEA 1I8KB 4NC1E 3UYRL 4A2LA 2P8LA 2VYRE 5IMLB 1S7XA 2ARJQ 2BVQB 1HHHB 1XGPB 2I07A 3GMQB 4U1LB 5EO0B 2VDLL 3AS2A 3REVB 1P1ZB 4PJHF 1RHHB 5D2LE 5D7IE 2AXGA 4KRMB 1YQ2A 3NCJH 3V0AC 3TPUA 2DN7A 1ZHNA 2W65A 2DM4A 1MEXL 1HDMA 3C9NB 3SY0A 2WBWB 3T09A 4X4YB 2GTWA 1WC7B 2E9BA 5GRUH 2BXYA 1NCCH 3RNKB 4QRTB 3BMWA 4WV1A 3B9KB 4Q9QL 1DSFH 4DGIL 4XMPL 1EERB 3UO1L 5F6IC 1HK6A 4D0DB 5FIEA 3ZYZA 1KC5L 5L8LB 4Q7DA 5JOEA 2D03L 1J0YA 3FOMB 2A83B 3UDWC 3SE8L 2R39A 2F74A 3SDDC 5CEZD 3GMRA 3WHE1 1IEAB 3N1GC 3ZDXE 5GJSL 3G5ZA 4S2SB 4XNUL 1U8QA 3DV6A 1EO8H 1KIRA 4GAGL 1U42A 2YD5A 4P46D 5DQDH 4Q2ZB 2C3VB 4Z7VE 3WDJA 2J8UA 3PGCB 4L9LA 4PD4K 4AEFA 1F4HA 2XZAL 5D1QB 3T0VA 1T03L 4OLEA 1FJ1A 3EO1A 1DLHB 4NM4L 2X4RA 2N7BA 4R96A 1WFTA 3VXSA 3FB6A 3T65B 1N6UA 3E2HB 4YHNB 1WGOA 4ZUUA 3PWJA 1Y6MR 1YC8A 4U1IB 2HN7A 3RU8L 2QQKL 3CH8A 2F53A 1NC2B 3CJJA 4UQ3B 1G0YR 3LIZL 1Q72H 3X12A 4KK5D 3LRSB 1MREL 2W1NA 2WAHA 1S9VA 4PJXF 4GMTL 1OGAD 5GGVL 2ICWA 2HFFA 2VIRB 3RWGB 1A1OB 3RGHA 3S5LA 4L3ED 4GBXB 3S3PA 3HZVA 5HGDA 4KUZL 2AJZA 3O2WL 3X3GL 5BJTB 2B2XH 5J3HD 4QLRA 3GSVB 4YZFE 5LGHL 3R0MA 2J1KA 3DJ9A 3VXRB 2QHRL 2PCPA 3U30C 5EWIL 3LY6A 2Y9RT 1FC1A 1CDUA 3K2UH 5F3BA 2BC4A 3ECBA 4TTDD 4DW2H 2RHEA 5D7LE 2BNRA 3D3VA 1N0XL 3TVMB 3V0WH 1OAZH 3CU7A 5HHMB 1LO0L 3BXNB 1AGDA 4PJEB 2NY7L 3PXHA 4HGKC 3QULA 3G5VA 3QUMH 1B0RB 4K7PX 4R3SA 4U33A 3WJJA 4KRPD 3UEZA 5E5RB 1QOKA 3MRMB 1T0PB 2B39A 1D5IL 1MPAH 1XF5A 4TVSa 5HPMA 2QSVA 4ZXBD 3QEUB 1FAIH 5DJDB 4G9DB 3WJLA 1MLBB 4G5ZL 4LIQL 4ZFOA 5HVFB 5E08L 4PJDA 2QKIB 4U1JB 2JCCB 2EDRA 3DSFL 4FQHA 1S7VA 4TSAH 4G7YH 2ZP0T 4ZAKA 3M17B 1IGCH 2QTEA 5FYLE 1Z2KA 1L6ZA 3IDIA 2CK0H 4UT6H 4ZUWB 2EDJA 1N3NA 4DQOL 1QLFA 3QUYB 2HLAB 4MNQB 4ODXB 4CW1A 2Q7NA 3EDFA 2DOCA 1S5HA 3QHZH 2H26B 3T3ME 3SGEH 3M07A 4X9GA 1OD7A 2GFBB 1K8IA 3BOVA 2XWJB 1WK0A 2RFXA 3OAYH 3CUPB 1MF2L 2DLFH 3P30H 1RZJC 5CEZL 5HYSB 3GSNB 4U4BA 1I1FB 3JTTA 4UDTA 1K85A 4PR5B 1M71B 3D1MC 3UPRB 1J1XL 5I1LB 4M62H 3EO0B 3FN3A 5DD5L 1H8NA 3IDMB 2AJYL 3QO0A 3QIWC 4UB0H 1Y6NR 3FT3B 3LN4A 4HIEB 4NNPL 3JWDH 1F4YH 3MNWB 1KTDA 1FZOA 6CGTA 2BSED 3DUUA 5JDJA 1FDLL 1UXSB 1AGCB 3PABB 4FFVC 2VABB 1A14L 2OM5A 2A9NH 4OGAC 5FA3B 1DN0A 3RTQA 1NSNH 3X3FL 4YXLL 4L8CA 4F80A 3SDCA 1XGTB 3F7PC 4JR9H 4LVNB 2FEDC 4R7NA 4ENEC 4NJ9L 1NGZB 4U3CA 3V6FA 5JW3L 1ETZA 3D0LA 1EEUA 4JPVL 4CVXB 2NZIA 1FGVH 4FN0A 1NGPH 5ITBH 3TESA 4CDGC 3V5HB 3NPSB 4X0KA 2P8MA 1A21A 1EDQA 5DJCA 3DYPA 3SPVB 3QNXA 4JRXD 4X5LA 4P4KA 2J7LA 3IDGA 3LN9A 1A3RL 4YX2L 5E8DH 2XWTB 4GKNB 5FYJE 1ZS8B 4N9GA 4GXUN 4YQXH 4NSKA 1TQBB 3QUXB 4Y19E 4YGVA 1CE6A 4B50A 1A7NH 5EH1A 4L4VA 5GRJH 3MBEA 4OM0H 4M1DL 1RUQH 1IMHC 3MRIA 1BECA 3OL2A 1GZQA 3GHBL 1WISA 2OK0L 1OTTD 2NY2B 5CEZE 4U6YB 5FM5M 1KXTB 4JQXC 2DQEL 3DX9A 3DX6A 2FX8H 4CADA 2H9GB 2O5ZH 3BW9A 3MUZ1 3K8LA 1Q8MA 5F96L 3FQRB 3WKML 3WNNA 2D7NA 5IQ9B 2AV7B 5TE4H 2JJTC 1AGBB 1CICC 5EULV 5LAXB 1LHZA 3GKWL 3VGFA 2AP2A 2BOBA 5D1XA 3IFPB 3W39B 4M6OH 5EUKA 5L6YH 1DANT 4X9HA 1G7LB 1FLTX 3U0TA 2I27N 3LEXA 3MRFB 1A6WH 1FVCB 2OR9L 2R0LH 4EN3D 5KSAC 3MXVH 4NC0B 2BNUB 1EFXB 1LGVA 4KHTH 1JPGA 1F6AB 5IBUG 4NBXB 1MJ7H 5DJZB 1OGAE 4LHQB 1KNOB 4F7CA 1ZT7B 3O6MH 4DGYH 4L3EE 3PQYA 1IEBB 5I1EL 5GZNC 3IT8D 4JM4L 2F9BT 4ISVB 2IPUK 3X17A 3I6LE 4NC1C 2V6HA 2EIEA 1JGEA 1JPST 4XCCL 2FR4A 1XR9B 2PYFB 1MRDL 1NLDH 2BFVH 2HT2D 1NL0L 4P2RD 2J88L 5BZDB 4XP4L 5LQBH 1IKNC 1FFOB 3PDGA 4RFEA 3QCUH 2NY3B 1RV6X 1UM6L 4ALAH 5IP4A 3X13A 1P4IH 3BP6A 4HC1L 2KQNA 5D5MA 4GKSA 4FXLA 1R0AL 4UU9A 2NTSP 4I3GA 4X6CE 1ED3B 2BY3A 4JAMA 3EO9L 4MJ5B 4MJ4A 4PB0H 1OP9A 3HC3H 3T2QA 1S8DB 3MRBA 3O3BA 4P5MB 4DCQA 3G5XA 4NFDA 2HP4A 2DQUL 3C5ZD 4QHKJ 4WEBH 1N5AB 4LLMA 3U4EA 5E9DB 2B1AL 3LKPA 3MLVH 2UWEB 1GC1H 3ARBC 4KY1L 3V6ZB 1BVLB 4WO4A 1QR1B 5IROA 4X98A 4PP2B 4P5KB 5F1IA 5JHDB 4XGZA 2VDMH 2XXMB 3FZUC 4Q6IC 4QT5B 4UMGA 3DRQA 4Z95L 4OB5L 4OAWB 2SEBB 4HV8B 1DJSA 5F9WB 3WN5A 3SGKC 4LSDA 2IQ9L 1IL1B 1P5UA 4MNGA 2WBJB 3HMXL 5K9JL 4MB5A 1RZGA 5J1AB 5AYUH 2ERJC 3KPRD 1XIWB 3KYKL 1NFKA 5JXEC 5EZIL 5FUOL 3L5XL 4XXCC 1K8DA 2GIYA 3ZSSA 3HAEG 3QEQB 4XVJH 3WFDL 3K0WA 4FQQA 5E03A 3DECA 4NPYB 1AGEB 3LQAL 3SKJH 2C3XA 3BFOA 1C08B 4R2GB 2P5WD 4BZ1L 5EOQL 2BJMH 1TTGA 1INEH 5DA4A 5BZWB 4MJIE 3K1DA 3VFWB 1PZ5B 1UZ8B 1CGUA 2GTZB 3EDEA 5FOJA 1H0DA 2YMXH 5I8CB 1PBYA 1EHLL 1I7ZB 2OXHA 1ZK9A 3KAAA 1O7SA 3CZFB 4QRUA 2A6JB 4FRWA 4BUHA 4HWEH 2CXKA 4NQEB 3NH7L 4LCCC 1YMMD 2JIXD 4L8DB 4PGJA 3N9GL 4GLRH 5FKAB 1B6DA 4RGMB 2XN9D 3WLBA 3SE4C 3H9HA 1VEOA 3SO3B 1CFTA 4Y5XB 1GOGA 1IC4H 2CUMA 1ZEAH 3VRLE 3KPSA 2YRPA 2CLVB 4LSVL 4OCWH 1NAKL 1BFVL 1OP3H 3CLFH 1G7PA 1I3GL 2DYPB 4JVUA 2PYEB 1TVBB 5GSVA 1A64A 5JLZA 1I4FB 1LD9A 1W8OA 4WFGD 4JE4B 4U1HB 4L4TB 4LVHB 1E4XI 3MRLB 5HHXH 1E6JH 1UXWB 5C0DB 4R90H 3IXTA 4L9DA 4NQDA 5C0GA 2OYPA 4OM1L 3QDMA 4XC1L 3RWEA 1A6ZB 5LCVH 3ARGA 4LL9A 5ICXA 5JW4M 1LEGA 3DHJA 1JHTA 4AENB 4UV4L 3DTXA 4OZGB 1ZLVK 2CLRB 1VEMA 5BXFB 5GHWL 3VG9C 4PJCB 5T1LD 3OB8A 4KKLC 4PJBA 1DQJA 4J23A 1TVHA 3IJYA 4M61A 4HWZA 3IDUA 1JTPA 3R06B 5C0FB 4FQXA 3OWEA 4NZUL 2D7TL 2VXQL 3TJEH 3RZCB 4GLRI 4MWFA 3OZ9L 3V8OA 1MJJA 1OTUC 3U0PA 4BZ2L 1JYNA 2QSQA 4G9FB 4N8VA 1TTFA 4DTGH 3GSOA 4MYWB 1N59B 1K9TA 3I84A 4XP6H 1IAIH 3BQUC 4G6JL 4Y5YA 4LEOA 3TN0A 2VQUA 4M7LH 4QNPE 3P9LB 4UDUA 2R69L 3MXWH 1JVKA 2YK1H 1TZGH 3P77A 1A8JH 2XQBH 1KFAL 3D39B 1NJ9B 3FRPA 1AQKL 2AABH 5IG7B 1YNKH 3DBXA 3GSNH 1YYLL 2ENSA 2DS4A 4WI3A 5JW4Q 2ADGB 4XNMA 2YD6A 2XKNB 4NT6A 3P4OA 3PGFL 2IH3A 3RDTA 4LSUH 1ZMYA 4H88L 5HGHB 4NZJA 2NNAA 3RWCA 2O5XL 4LBEB 2E7BA 3MA9L 1T4KA 3CFJB 2J5LB 1P1ZA 2BZDA 5CP7B 1RHHA 3R4DA 4EUPA 3U48A 3QDGD 1U95B 4PJEE 2ICEB 1CT8B 4U6XB 5SX4H 5E8EB 1VERA 5T3XH 1I7TB 5CP3A 5F1NA 3IXAB 5DHXB 4Y4FD 1X4ZA 1DR9A 3L3OA 3S88L 1YPZB 3HC4L 3FO1A 4PGEA 3MMEA 3VD4A 1MELA 1CFNB 4Y2DA 4CN1A 1U92B 1QRNB 2DI8A 4JO3H 4U49A 2J12B 2JCCE 3BYTA 3UPCA 1EH9A 3PGDB 4P46C 5CEYA 5CD3B 1S5IH 4O2CB 4X5XB 5DZOA 2C3VA 3IU3A 1BVZA 3C60A 4K2UL 5JIKA 3ZZ1A 1A6AB 1SJHB 2HG5B 1NCAL 1NEZG 3MTRA 2M8XA 1EPFA 4MNQE 4XP9L 2DQFA 3TH4T 5IFJB 2I9LA 1ACYL 2AGJH 2NY5L 1O7VA 4JKLA 2QSCH 3KPRE 1GIGH 4I0PA 4P2YA 4PGDA 1ZWIB 4LMQI 4M48H 5DC9B 4UQ3A 5CUSL 3H9ZA 3NVQA 1CLYH 3IJSB 4NNYA 4Q9CA 5IBLC 4BQ9A 2ZUQB 1CXEA 2GEEA 5DMJB 3QEQD 4WVRA 5D71L 2CKBH 2WIIB 3HKFA 5EU6B 4G8IB 3FQWA 3DMMC 4KK8C 5C07A 5D1ZA 1PKOA 2P5WE 4IIQB 2P8PB 5AUMA 3FMGL 1AC0A 1UCTA 1I9RL 3OPZL 3MV7B 3RWFA 4Z8FH 4XNQB 4EBQH 2X44D 1AR1D 5E6IC 5A2FA 1ADQL 1CGTA 1HILA 2FHCA 5J3HC 2R56H 3FB7A 4AEHL 1JWUA 3BWAA 4UIMB 4GXVL 5GRVL 2FLRT 2DLTA 3VXRA 2B4CH 5KW9L 2PUQT 4GG6E 4J3VA 4G8GD 3OKEB 5KVDH 2APFA 5T33H 3FONA 1YMME 1BZ9A 3N85H 1CLCA 5SWSA 5I1GH 3BDBA 1S7TA 4WHCA 4OCSL 4NWTL 3HNTH 1NMAL 3JWOC 3VJ6A 3V6OE 4OUUB 4P3DB 1B0RA 5ISZD 3U9UA 4EI6B 1DE4A 3HNSL 4PJ9A 4KRPC 4OCYL 3QUZB 1BFOB 1T1YA 1F3RB 5ICZB 3A6CH 1AD9A 1RJZA 2KBGA 3ISWA 2IPKB 4ZXBC 1L9MA 4OF3A 4M7JL 1X7QA 5GRYA 3ZT6A 2Q76B 1OCWH 1CL7L 1S3KH 3MZGB 3OAYK 4LQ1A 4Z0XB 1U3HA 4OLXL 5I9QB 3O4OB 4UAOC 5DRNB 2FATL 5ICYB 4GJTB 1CBVH 4M7ZC 2DQDL 3TM6A 3KLAA 3OF6D 4U0RC 5DJXB 3HRPA 3GK8L 4JM2A 4L4TD 4K7PH 2MSPA 4XPHH 3O9WD 3E1F1 5DEZA 4NGHH 1BX2A 1G6VK 4ZQKB 1DQML 1WT5C 4QRQB 1U8JB 7FABH