3QXTA

Structure of an anti-methotrexate cdr1-3 graft vhh antibody in complex with methotrexate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
QVQLVESGGGLVQAGGSLRLSCAASRRSSRSWAMAWFRQAPGKEREFVAKISGDGRLTTYGDSVKGRFTISRDKGKNTVYLQMDSLKPEDTAVYYCAADDNYVTASWRSGPDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Methotrexate CDR1-3 Graft VHH
publication title An anti-hapten camelid antibody reveals a cryptic binding site with significant energetic contributions from a nonhypervariable loop.
pubmed doi rcsb
source organism Lama glama
molecule tags Immune system
total genus 31
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qxtA00
4QF1B 3O41B 3DUSB 1HHGB 2XTJE 1SJEA 1KLGB 3ZTNH 1PY9A 5IR1A 5EBLB 5IESH 3H0TB 4KV5F 4MDJA 1P4IH 1AC6A 1UZ6F 3VFTB 1T22B 1A1NB 1CFSA 5JW4N 3U7YL 3E2HB 5CS7A 3U9UB 4X99B 1A7OL 3TV3L 1OGAA 1ZEAH 4L8CB 2R0LL 4PRHE 3RWJA 3K4DA 5HVHC 5HHVL 3CFCH 2EDTA 4OM1L 3L9RB 1NL0H 4OBSA 2VZ1A 3C60C 3D85D 5FF6A 1DQMH 2I9LA 1F2QA 4MWFA 3X12A 3T1FA 3G5ZB 5FKAB 4WV1C 3WFEL 1J8HD 5HPOA 4PIRF 5DGRA 4OD2B 4JFZH 5J57B 4U1LB 3L95B 2F5AL 4HHAB 1LEIB 2VZUA 4HK3J 4NUJA 2PR4L 3FT4A 3QIBA 3ES6A 1NEUA 1IGYA 4EUPB 4U1JB 1QFUL 2CSPA 5E8DH 4DVRH 2EYRB 2ZOLB 3SDDD 5K9KB 5FYLL 3KDMA 4LKXB 4IOFC 3JBG7 4L5FL 3PL6D 1SEBB 1YUHA 1I1RA 2HFFB 2Z91B 3DYOA 4LK4A 1UJ3C 5EZIH 4Y16D 3IU3B 5JZ7C 1WIPA 4BSVA 5HYSB 2NY7L 2ICES 4PGBB 5CEXB 3UDWC 3D39B 5H35B 5EORL 1NGWA 4KJQC 4I0PD 5E9DA 5F88A 2FO4B 4PJXF 1KGCD 4XC3L 4LIQE 4OFKA 4ODVH 5C2BL 4IRSA 1T1YA 2AJVL 4F2MB 4O5LL 4NUGL 1A6TA 1MCIA 3DVIA 4U0QB 5D7LD 1OB1A 3H2WA 3E8UH 3GRWA 4MAUH 3EIFA 2N1KA 5ECJE 3QIUC 4G7YL 4XPGL 1DL7H 2XZCL 3W82A 3ZKQD 2VWEC 3LHPL 2J6EL 2HJKA 3G5YB 5EZLA 5ENWA 1SY6A 4R4BA 4HJ0C 4QOKE 5GGSA 4R3SA 5IJKC 4X9GA 3GSUB 3BO8B 4F80A 1WWWX 4OZHE 4OZIF 2FX8L 3LH2H 4XAKE 5CZXD 1XZ0B 4G42B 3PV6A 1J0ZA 1S7XA 4G80A 4ZTOH 3RUGE 4HJGB 4G9DB 3A67H 4QY8B 1MIMH 1Z0NA 4PJ7E 1M71B 5I66B 1RIHL 4APQA 1T7XA 1XAUA 2MKWA 1NSNL 1L4IA 3F6IA 4G6FB 5C07E 4EIZC 5HI5C 5GGUB 5IF0A 2ADIA 5SWSD 1CS6A 1R3IL 4FZ8L 5GGTL 4PRID 3FO0L 3EYUH 1G7HA 4S0SD 3GHBH 4LARH 4ZUVA 4OBRA 1JNHB 1PW3A 1K5NB 3FQUB 1SBBA 2FSEA 2IFFL 2DDQH 5TE6H 4BA8A 3PHQB 4Z0XB 3SJVA 3IJSA 5C08A 3FFCA 2J3SA 4PTUA 3FRUB 3VRIA 1D6EB 5JO5B 4HUXA 1R0AL 5DEGB 3W0WA 1LEKA 3WJLC 4OLYH 4IRJB 2EO1A 4NZUH 2AABH 1QLRA 3QP3A 4YQXH 1I9RL 3LQZA 4Z95L 2AK1H 3EJYC 1A6AA 2G5BA 2AI0H 3L3OA 5JQHC 1SYVA 3GI9H 1IGTA 4QRQA 2OJEA 3H8NA 3UBXG 5IB1A 4Z7VB 1FZMB 1O7SA 3MLRH 5ID0A 1G7IA 2A9MH 3MACH 4I18B 3TJEH 2HMID 4ODXA 5DFTA 2R69L 4EI5B 1TTFA 3X3FL 3FB6B 2XWJB 3TNNA 1J87A 3O4OB 3GB7B 3CUPB 4ERSL 4DKFL 2CRIA 4PP1C 2YD5A 3PWPD 5I8EA 4NO5A 3T3PE 1FL3A 1ZOXA 2B7DT 1Y6NR 1VENA 1RZFL 5EUOA 3B5TA 5D71H 3MCKA 3HZKB 3QIBD 1BOYA 3MLYL 5DYOA 3TO4B 1IKFH 2RCSH 5FO9A 1A2YA 5F96L 2X70B 1JPTL 4OGXL 5E8NB 4N8PA 1F4XH 4Q6IA 5KVFH 2QBWA 3RGHA 5EUKA 5E5MA 4NZRH 3PWNA 5JIPA 1UB5B 3FQXB 3RWGA 4L4VA 3S36H 3D2UA 4O2EB 2VQTA 2EXYD 4S1DC 2Z92A 1BOGA 3FT3B 5D9SB 3PGFL 4YE4H 3QUZC 2AEQH 4HWEL 1TTUA 2QSTA 2R2HB 1CQYA 3DRQA 2VISA 5C1MB 1PG7H 2H26B 4BZ2H 1ZA6B 1ZKAA 1AH1A 4XRCA 3LN5A 3I2CH 2GJJA 2GJ6D 1RJCA 4HX1A 5J12C 4MXVF 3VXSD 2MTPA 4JHWH 4YXKH 1PDKA 1KJVA 4XTRC 2I9TB 1Q9KA 1HEZA 1NBZA 3NACH 1FNGA 3B4NA 3K81A 4U2YA 2BNRA 1I8KB 5MEQA 5I1HH 4FXGB 3RGVB 4XCYA 3WLBB 5CJQL 1Y18A 3I02B 3U0PA 2A73A 4MQ7B 4FQIL 3C8DA 2IALA 3PIQA 1R3HA 2QADD 4HMDA 4XVUC 4DEPB 2J8OA 3LPGA 2V5YA 3QUMH 3LIZL 4NO2A 3FQWB 5I1JH 4CBPA 4OLEA 5DF0A 1D5MB 3MZGB 4GRWF 5I1IL 4PJDB 3TYGH 1T4KB 3HG1A 2P8PA 4AMKH 5T3XH 4HUWA 3ILPA 4YDJA 3VWKB 4ZUUB 1T0MA 2O5YL 5DZLA 4OCYH 3CZJA 3RWIB 4FQ1H 2R1WB 4L3CB 2CMRH 3IDMA 4LCWD 3HLAB 4X6CB 3I75A 4APQD 4MLSA 4P3CH 2CO7B 3UCRA 5HHMB 4YFLF 4NQDA 1U9KA 4P46B 3VXMD 2JK5B 4NN6C 3CZFA 3L3JB 5I74C 3RPKA 3PABB 2NY3C 1IGML 2VERN 3BISA 3G04A 4U1IB 4C4KO 3TA3D 1DBKH 4Z7WE 3CX5K 4LCUB 5T1LD 2LU7A 3QUXC 3VFMA 1FNEA 1L7TL 4HIJB 3SJVD 3VA6A 4QF1A 3O41A 1KCRH 1WEJL 1DLHB 2BVTA 1HHGA 3DUSA 1NFKA 4ZDHB 1KLGA 3H9SD 1U58B 5EBLA 5C09A 5MI0C 3H0TA 1T66C 3VGAC 3W0WD 4NQSB 4K3EH 4LBEB 2IPUG 3VFTA 1T22A 1A1NA 3REVB 5EOCL 2D7TH 2E27H 2JCCE 3U9UA 3HC4L 4X99A 5KSAB 4L8CA 1F3DJ 4JO4H 35C8H 3L9RA 3BPCB 3ZKND 4U31A 4FNLL 2V6HA 1BLNB 3G5ZA 5FKAA 4YDKL 3RVUD 3ZE2E 5D1XC 2HKHH 1O7VA 3J8F7 4Q0XL 2FIRT 4OD2A 1B4JH 1AO7D 5HPMB 4TULL 4U1LA 3L95A 4HHAA 1LEIA 4MNHB 1IQDB 3QAZB 1HIMH 2F19L 4LRNL 2ARJQ 1DEEB 1LWRA 4Q9CA 5DQJB 3ARZA 4EUPA 1CF8L 5SWZE 3TWCH 4M6OH 2UY7A 2A2QT 4FFWC 4KVNH 4RGNB 4U1JA 4QHKI 4QCIB 3ROOB 5I73C 3EBAA 3MV7D 4JDTL 4M3KB 2EYRA 2O26U 2GCYB 1Q0YL 5K9KA 2X1QA 1YMME 1P9MA 4LKXA 1AIFB 3W2DH 1SEBA 4OGAD 3D2UD 1RK0B 5EG6C 4LL9A 1JHKH 1JI2A 2HFFA 1AP2B 3BZFB 2Z91A 5ESQB 3WIHL 1PZUB 3BW9B 5B4MC 3IU3A 4GXUM 4AEEA 1TETL 1KTKE 2FJHA 5HYSA 2ZZUT 4PGBA 1NCNA 3TT1L 1BZQK 1OD7A 5CEXA 3D39A 4WFGD 5H35A 1K4CB 3BRFA 4LGSB 2FO4A 5J9PB 3H9YA 3BT2H 3W9EB 4JR9L 3V0WH 2C3GA 3QR2A 1HHHB 1FFNB 4JZJC 4I2XB 4F2MA 4WY7H 4MHHI 4YZFF 4O02L 2DAVA 2BERA 4ZYKB 1OLZA 4LFHD 5I1LB 3NIDF 3CX2A 1I7ZB 1JF5A 2FBJL 1YEGH 3MXVL 2AJSL 5A3ID 4DQOL 1DUZB 4YJZL 2VL5B 4M4RA 1NGYA 2R29H 5IGXH 3QUMB 3IRZA 4AIZB 3G5YA 4NIKB 1ULVA 1T7VA 4ETYA 1G6RH 3WXVH 5DFVC 5HGGS 2YOCA 4XPAL 1XCQB 3GSUA 3BO8A 1A0QL 5C8JB 5E4IA 4MA8L 1U3HC 3LAFA 4CAGA 4KXZI 1WIUA 3LKSB 3BRDA 1XZ0A 2WV3A 3HG1D 3AB0C 4G42A 4RGOH 3QI9B 2OMBA 2RGSA 2UWEB 3IF1A 1G7QB 3B9EA 4P2YA 3JUYA 4HJGA 4G9DA 4UB0L 5LBSL 3SDCC 3B9KD 4QY8A 5ALBL 2Q8AH 3MXWH 4Y1AE 3R06B 4LSPH 5AEAA 1M71A 5I66A 3QNXB 2AJXH 4MNQD 5E99L 4GUPB 2X7LB 1WICA 3P4OB 5GGUA 1IEBB 2CR3A 3GK8H 4UILH 1I1CA 4PJHE 1UFUA 4FFYL 4N0RA 2B1HL 2NY2C 4Z76B 1UWEL 3RL2B 1CXKA 3C09B 4LRIA 2F54B 2X4UB 3GBML 3HC0B 1NBVL 3RY5A 1JNHA 2EIZA 3TGXA 1K5NA 1RFDH 3FQUA 3CSBA 5F9JB 3PHQA 2VC2H 4Z0XA 5DMIH 1N26A 2P46B 3FRUA 1D6EA 5JO5A 4LAJH 1OCWH 1NUNB 1MHCB 1Q9WB 4RWYH 4F33B 5C09D 4IRJA 3BPOC 5I19H 1N7MH 3RDTC 1Q1JL 5DS8B 4UUJB 4V1DB 2ESVB 1CLYH 5F8RC 3F12B 5ELIA 2VLJE 1WC7B 4LCCB 1GGIL 1RUQH 5KS9E 4JVWA 4Z7VA 1FZMA 4GH7B 4I18A 1PEWA 2YC1B 4EI5A 1A6PA 5AZ2H 4Y4FB 2APTA 2A9NL 2XWJA 1A7RH 4LSSH 5CJ8A 4Z5RB 3GB7A 1G0DA 3CUPA 4WEMB 5T1KD 1MCCA 1VFAB 1UWGL 4KK6C 3MOBH 3CAFA 2DBLH 4M7ZB 2PNDA 3HZKA 3KYAA 3TO4A 1ZTXL 5CEZD 2X70A 4NQCE 3BP6B 4WTWA 5E8NA 4K8RD 2R0ZH 1A7BA 2X1XR 4HZLB 2HFGL 3TT3H 5I8CB 1UB5A 3AS1A 1FBIH 3FQXA 4U1GC 4EIGB 3LMJL 4O2EA 4YHKL 2DQDH 3FT3A 2P5WB 1B4RA 3T08A 1LO2L 4G3YH 3PDGA 1P2CB 3PQYB 4NT6B 4R26H 3E3QE 4AK1A 2LTQC 2R2HA 3S5LB 4CUCA 2DIJA 3N1FC 1X9QA 2H26A 4KWUA 1ZA6A 4LPUA 5H94A 3D39D 1ZVYA 5TH2B 4PB9L 2AJUL 3QUYB 1JHLL 3NA9H 3UO1L 2H2SC 4P4KC 3WFCH 1Q38A 2I9TA 5BV7C 3P30L 4DVBB 5TE4L 1ADQL 5CP7B 1X4YA 2F53D 2ITCB 4XPHL 2C3WA 4PJ8C 2UV3A 4NYLB 2DM7A 4DUXA 3OXRB 1G6RB 1QSFB 1QFWM 1I8KA 3FN9A 1A7QL 4FXGA 3RGVA 3WLBA 1KXQE 1EFXB 3CDYA 1U95B 3I02A 5FHBH 2HLFD 3D18B 5EO1B 1K9TA 5CKAA 4N90D 4MQ7A 4URTB 2OBGA 5K9JH 4UIKH 1OL0A 1V7MH 3GMOB 5F1SA 1ES0A 2R4RL 3SOBL 3LEXB 3FQWA 1D5MA 4H26B 3RX7A 4JDZB 4PJDA 5KSBB 1T4KA 4ZS7L 2VDPH 4ONGH 3HRPA 2XQBH 3MRHB 2PYED 5HDBE 3VWKA 4ZUUA 1ZLSL 3BP4B 5DD0L 3QDMB 3RWIA 2R1WA 4L3CA 4G8GE 4R97B 3T4YB 3HLAA 4R6UA 3JWOL 4X6CA 5JXAH 1FNSL 3HE7C 2E6PA 1HILB 4ZD3L 4OD3H 4S1SL 4LMQI 5A2JH 4P9MH 5L2KE 4P46A 2JK5A 4FS0A 4NKIH 3L3JA 1KN4H 3REWB 3D25B 1I8MB 3KPRD 4C57C 4U1IA 1VPOL 2B0SH 1D5IL 2CUIA 1UZ8B 3O8XC 3AMLA 1G9NH 4J3TA 4LCUA 4MA3B 3ZE0F 3LS5L 4Q9RH 4ZFZB 4D8PB 5CCKL 4E9LA 2BVPB 3UJIH 5IFHL 1DLHA 1X6NA 5HI3C 1NCDL 4HK3N 4ZDHA 3RZCC 2Y07L 1U58A 3UTPE 5T3ZE 4PR5B 5AZEH 3V6FB 3EYSH 2RHEA 4NQSA 3F7PC 4LBEA 4M7JH 2V17L 3PP3K 4C55A 5I1CL 3REVA 5IHUL 4N1CA 1H3TA 3DBXB 2VXSL 4LASH 4X5XB 4KK9D 2UUDK 5KSAA 1A64A 1JL8A 5EOTB 1DANT 3WFBH 4F3FB 3BPCA 4LSUH 1QR4A 2R8SH 1BLNA 1BQLH 4NHUB 4S2SB 3O6FC 3MV11 5D7JC 5I71C 5DEZA 5HPMA 4QTHA 3ISWA 4MNHA 1IQDA 5IROC 1PLGL 1DEEA 4OGZA 1F00I 5DQJA 4JFYB 4MJIE 5CKGA 2XTJD 2ICWJ 5FUCE 5BV7L 1F45A 4OFIA 5E8EB 3ROOA 1KCSH 3UEZA 1IT9H 1MEXH 2A6DB 1ORQB 5DURB 5GGQH 4PLKC 3CMOH 4C58B 1GGBL 1H3PH 3HFML 2YD3A 3GBLA 4GQ9H 3QWRD 1AIFA 4PRHD 5FB8B 1IVLA 5KVGH 1U8QB 4POYA 5E2WL 3FO2B 2R4SL 5FIEA 4PLNC 1AP2A 1T83C 2D31B 4PJGF 3VXUB 5ESQA 4JFOB 3BW9A 2QLVB 1CGVA 3GHEH 1VERA 3QQNA 1QSZA 5IUSA 3MLVL 2NYYD 4X0KA 1K4CA 1AY1L 5J9PA 3W9EA 3V6BR 1YZZA 2DWEB 2HN7B 5FM5M 1CWVA 1FFNA 4I2XA 4KROB 2CGRL 4LAQH 4PRDB 5E03A 1PKQE 5I1GL 3CLEH 5GRXG 4ZYKA 3D9AL 2R23B 5I1LA 4UTBL 4HWBH 1HYSC 1S9VB 4YUEH 4J4PA 1DUZA 3C6SB 2VL5A 3AAZB 5JIHA 2LU3A 1J0IA 2VDOH 3BD5A 3QUMA 4Y2DD 1P4BH 3RGVD 2ZOKB 3VXNB 4AIZA 8CGTA 1NBQA 5ESAA 4BUHA 5TQ2H 4X7TB 2YWYA 5E7FA 4HMCA 4KJYB 1MJ8H 4JREC 3BQUD 2NY4C 5C8JA 1OQXA 2GTZB 1DQDH 1VEPA 5FOBB 4XP1L 3LKSA 3RI5K 3BP5B 4ENEC 1OARL 1CZ8L 2UWEA 2XZAH 1G7QA 2W0LA 5T5FL 5EU6B 1Q0XL 3VWKD 4GBXB 3P9MB 1QNZH 1LO4L 4X9HA 3R06A 5D1ZC 3QNXA 2WUBH 5C0GB 4GUPA 5TQ0H 5B8CB 3T2NH 2A83B 3P4OA 5F1IA 1IEBA 5J0BA 2H32B 2EEDA 3S37L 4HWNA 5HVGB 1UYWL 4BZYA 5CD5C 3SGJA 3DX6B 5FYJH 4Z76A 3BE1L 4O58H 2WWMD 3RL2A 1RU9L 4J1UB 2DJ4A 3GFUA 2F54A 2X4UA 1KJ3L 3HC0A 3RKDC 3RWDB 2FECL 3QFJE 4R4ND 4QOKD 2C1PB 3T3ME 5F9JA 2XWBB 2AXJA 3I84A 3SE3C 3UYOD 1MAMH 2Z9TA 5HYJE 1A1OB 1DEDA 2B39A 2ADFL 1QUNA 5K9OB 3QULB 4L8SC 3QPXH 4JO2L 4CU6A 3SKOA 1MHCA 1Q9WA 2IMNA 4XAKD 2ED7A 2NW3B 3PP3H 3VXPB 2OR7A 1FG9C 4F33A 2CLVA 5E1AB 1FN4B 1OAKL 5DS8A 5I1DB 4UUJA 4GMTL 4V1DA 5FCUH 2ESVA 3DECA 1NFIB 2UUDH 3F12A 2SEBB 2B2XH 1WC7A 1MH5B 3MO1B 4LCCA 2BVUA 1N59B 4MXWL 4GJTB 5DMGC 5C07D 4YC2C 4D2NA 1SHMA 2YC1A 5C0IB 5E6ID 4Y4FA 1S3KH 3O3AB 4ONHB 4H20H 4ZPVB 3U4BL 4Z5RA 3D1MC 1VFAA 4HJJL 4JG1H 2ZWLT 1CFNB 2CLRB 3V5DB 1U8HB 1AGCB 4TYUA 3STZB 1CQKA 3OAYK 1K8DB 4NJAH 4X5LA 1Y6KR 4B53A 2DI8A 3BP6A 1DN2A 1A7OH 3TV3H 4BQCA 4D9RE 2D7PA 5HHVH 4HZLA 4UV7L 1OF2B 2MQCA 4GRLD 5I8CA 3VDBA 2LAGB 1KIQB 3HCVB 4YHZH 3T0DA 3MBEC 5B21A 4I9WE 3S9DB 2P5WA 4MD5B 3PQYA 4Y4HB 5IVXB 1X4XA 4HIEB 4WENB 1CICD 4NT6A 4D0BB 1FZKB 3S5LA 5JOFB 3SDDC 3MPCA 3NFSL 4HZAA 5TH2A 4YDLB 4D3CL 3PL6C 3QUYA 2YRLA 1NCAL 5DD3L 3MUGB 5C70A 1KV3A 1WWAX 3VWJD 4MQXD 3T0AA 3FAXA 4KH2A 4L9LB 1LO0H 4Y16C 5CP7A 1OM3L 2ITCA 1BEYL 3PXJA 4NYLA 5F9DC 1U2CA 1G6RA 3N1QC 1QSFA 3OXRA 1FGVH 4PJEB 4Y5XB 3RNKB 3ZYZA 3THML 4K3DL 4KQ4H 4I0PC 1KLFA 1RIVH 4JVPA 4WUUB 4QHUB 1DQQB 1EFXA 4QRRB 2QR0B 4M43L 4PGEB 3VFUB 1U95A 4CU8A 4HF5L 5E4EC 3CXDL 3D18A 5EO1A 4JM4H 4FQ2H 1LDPH 3GMRB 1SEQH 4UQ3B 2DLFL 2PUQT 3LB6D 3GMOA 1WJ3A 3CDGB 2XRAL 3LEXA 4I1NB 3GKZA 4GO6B 4Y4KA 3TN0C 3P9WB 4JDZA 4RX4D 4NFCA 3ROLB 5KSBA 3MLWL 2XI9A 2CD0A 5GS1A 5DD1L 3NCCB 5K9QI 4LSQL 3MRHA 5L9DL 3O6LL 5D1QC 5IBLC 3VXTB 1NCBL 1AFVL 3BP4A 3QDMA 2AJVH 3T4YA 3K1DA 4NRZB 3ARDB 3V52L 5DVNA 1HILA 5CZXC 4S1RL 5IMKB 3VFGH 1CTOA 4G7YH 3G6JB 4XPGH 5D7IB 4J12A 2J6EH 3F65A 3X11B 4JPKL 3REWA 1R5IB 1KCKA 1VFBB 3D25A 5E5RB 1I8MA 5B38B 1I3UA 1HQ4B 3QNZB 2Q7NA 2XXCB 2VN7A 4MA3A 5HGAB 4EOWL 2HLAB 4HULB 1FC1A 5EPMB 4ZFZA 2A1WL 4D8PA 3ARFC 5CJOL 1NC2B 3M45A 3ARRA 5IVZB 3LEVH 4HG4J 1T2QL 1L0YA 3U82B 4PR5A 3V6FA 2WUCL 2JELL 4WI8A 2ZSVB 4XNXH 2AW2A 2NY1D 3ZKMD 3WSQH 1NSNH 3VMNA 5AUMB 2ESVD 1VFOA 5F70A 1F58L 3TO2B 1G1CA 5D96C 3QEQB 4Z7QF 1R3IH 5EOTA 5GGTH 4P99A 4F3FA 2W9EL 2IEPA 4GKNB 4K94H 4OB5H 3SGEI 4PGCB 2W60B 1X5IA 1Z9MA 3K3QA 4OUUB 3WDIA 1T20B 2X1PA 1KBGL 4S2SA 4U1SB 2MHAB 1UXWB 2IFFH 1EO5A 4L8DB 3NAAL 1R0AH 3OAYH 1LEGB 4KMTL 4LSTL 3C6LB 3H7BB 4HKXA 4DKDC 2HMIC 4JFYA 1FSKC 1I9RH 4QLRA 3X3GL 1F4YH 1UH2A 4HCRH 4POZC 5FV1L 4WW2F 3GUTB 5E8EA 3R0MA 5IBUB 3DHJA 2IFGA 2A6DA 1ORQA 2AGJH 4XP6H 5C9KA 3QIBC 5GS2D 2GSGB 5FB8A 1U8QA 2R2CA 3FO2A 5DJ2B 3SCMD 2HFEB 1MCEA 1U42A 2D31A 3VXUA 3SBWA 4BELD 1NEZB 3NCMA 4JFOA 4DKFH 1IC7H 2RIKA 1TJHH 4ERSH 5JW3H 4PJ5E 2ZNXA 2CK0L 1D9KD 3AGVA 3P4MB 1I1AD 3BPLB 1ZE3C 3TBVA 1RZFH 2C3VB 2PW2B 2FX7H 4H8WC 3MLYH 4ZAKB 4YFEA 2B4CH 1WZLA 4RMVA 2DWEA 1QHPA 2VKWA 4KHTL 2HN7A 4P23B 5F96H 3QWOA 1OHQA 1JPTH 2HT4D 3BKJL 4NP4H 5HDOA 5DD5L 2R23A 1B0WA 1V3KA 5SWZD 1S9VA 2D7QA 3ARGD 4Z8FL 2XICA 1YEHL 3AAZA 2EC8A 5IHBA 4R2GC 4Q7DA 1RMFL 3BJ91 4OD1L 2ZOKA 3VXNA 2FWOA 1KJ2L 1RUAH 1OAXL 1YMMD 4IRSC 1MF2L 2DMKA 4HWEH 4X7TA 3QYCA 4KJYA 4KTDL 2GTZA 5AYUL 4Y4KD 4ZOAA 4WI4A 4KQ3L 3EDDA 5FOBA 5GS3A 4LSVL 1PEZA 5HI4C 5HYFA 4PRBB 3BP5A 4ELMF 5EDXA 3I3DA 3GSNL 1AKJB 1CCZA 4X4XB 5EU6A 5EU3B 4GBXA 2OI9C 2HJLB 3P9MA 1CD8A 4E42B 5DGQA 3ECBA 2QADC 1J12A 5LGJB 1QD0A 5TF1L 4JQIL 3QISA 1T0NA 3OJMB 5C0GA 5L8JB 5B8CA 2J88L 4ZXBD 2A83A 2APXA 1IAIL 3WFZA 1CVSC 5SV4A 1S7RB 4ZO7A 4HUKB 4ZUSB 5ANMB 5CJQH 1KB9K 3NZHL 1YMHB 3C5JB 1FZJB 2IG2H 1EH9A 3DX6A 4JPWL 1CG9B 2CR6A 2GT9B 4J1UA 1JFQL 4X4ME 3RWDA 4APQC 2LU4A 1BJ1H 2C1PA 2HRLA 2ZUSA 1OP5K 4BQ9A 1BM3L 1NUDA 2XWBA 5ALCH 1OAQL 3O6ML 2YPLB 4U49A 1A1OA 5HHOB 1C12B 1A7PL 5ADOL 5K9OA 3QULA 2ZCKL 2IH1B 5DMYA 3UTZB 2AQ2A 5C86A 2NW3A 1JIBA 5HHNB 3VXPA 2VXVH 3MOAL 3STBA 1T2XA 5E1AA 1FN4A 4OUOA 5DZNA 3B2UD 5I1DA 2G75B 1NFIA 3QCVL 2CDFB 5IW1B 3C60B 1ITCA 2C5DC 3IDXH 4Y1AD 5HGBB 1JRHL 4JKMA 3WMSA 3MO1A 3FONB 4Q97A 5F7FA 3MYJB 1N59A 2HVJB 4WV1B 1HZHL 2PTTB 3PXHA 3ZT5A 1BF2A 3WIIL 1IGMH 4HFUL 3TH4T 4HEME 1RVFL 5L2KA 1NBYB 4KKLD 3RHWF 5C0IA 5IBTL 1MY7A 4PJAE 4W70A 3O3AA 2GK0B 4ZPVA 5CJBA 4OI7A 5EB9A 1HI6B 1WEJH 2VSCA 2KPNA 1CFNA 4L3EE 2CLRA 3V5DA 2RBLA 1AGCA 5EO0B 3STZA 4H8WL 3ZKNC 2KKQA 1K8DA 2E9JA 4OZHF 5EOCH 4R90H 4PGDB 3ETBF 2ZCHH 3ORJA 3TJHD 3IDJB 1OF2A 5FGRA 2FHFA 4WU5B 3V9FA 4OZGF 2VLRE 2VLJD 3HCVA 2ATPB 4PJ7F 1UJ3B 4MQSB 4L3AA 4XMKL 2MSPA 4YDKH 2G2RB 3NMEA 2Y6SC 3V8OA 1R3KA 4Y4HA 5IVXA 4HIEA 4O00A 3E6FB 4D0BA 1C1EH 1FZKA 1MLBB 2P24B 4Q6IC 4P3WA 2BNQE 2X10A 5EBWB 5FOJA 5JOFA 3UXFA 2Z4QB 4F7CB 3V7AE 5F7UA 3GRWL 1EDQA 1MCDA 1AGBB 1LP9E 4TTGA 5L7XH 4LRNH 1XGQA 2BSRB 1NMCB 4HWBA 2KBGA 3VFOB 1SY6L 1FYHB 1CDHA 4K23L 4YXHL 4WTXA 3WXWL 3QIUB 1GZQA 2HVKB 4U6XB 4JDTH 4L9LA 4JFFB 1X5LA 4FTVB 2VR4A 4NQCD 1WAAF 1Q0YH 2P8MB 1HXYB 4Y5XA 3KS0J 4B7IA 3RNKA 4HKBB 2CDEB 3DURB 2H2PC 4Y8DC 5ACZA 4WUUA 4QHUA 1DQQA 2AJYH 4PGEA 4QRRA 3VFUA 3A6BH 3BOVA 5IVOA 1FNHA 3MUY1 4JKLA 1EMTL 3NZ8B 3GMRA 3ZDYE 4QT5B 4UQ3A 5EOQH 5B39B 5HVWA 5DVOA 4DTGL 3CDGA 5D2NB 1H15B 3V6OE 5A3IC 3ROLA 3DV6B 5FKPA 3TT1H 4WI5A 1SM3L 1U3ZA 1U3YA 1WZ1H 4N8VB 1I1YB 4KAQL 2DKSA 4FXKB 3MUHL 3OX8B 1NJ9A 4GBXD 3VXTA 3BRGC 3BUTA 3OBAA 4NRZA 3ARDA 1RK1B 5FA4B 2AXFB 3IXTB 2K9UA 3MXVH 2AJSH 3T3PF 3QFDB 4JO3H 1N6VA 5JPNA 5IMKA 3G6JA 4JPIB 1MCOL 5D7IA 2C3XA 4E41E 1R5IA 1F2XK 2W59A 2AERT 4I48B 4BZ1L 5B38A 2WIIB 4XX1E 4PJ9D 1JZ2A 3H3KA 1HQ4A 3QNZA 2FCBA 2PXYB 1A0QH 3RIFF 4MA8H 5HGAA 1WK0A 1HINH 2HLAA 5EPMA 1H5BA 2WP3T 4U6HB 3GSQB 5D2LF 4XBPB 1HNFA 5IVZA 3QPQC 4GG6E 7CGTA 5FUOL 1XGUB 3HB3C 4X83A 2ZSVA 1FAKT 5ERWB 2DLHA 2VZ3A 4JKPH 4NKOB 2VZOA 5JA9A 4DGVH 4OQTL 4UU9A 5AUMA 3U4EB 2P1YA 3MV9B 4G8GD 3TO2A 3S34H 1QQDB 3SDXE 1A6UL 3QEQA 5FV2A 4AG4H 1IMHC 1CDYA 4JB9H 4S1QL 1EO8H 4QHKJ 2DQCH 1UWEH 5L2KD 4PGCA 4XVSH 2W60A 2D03L 4OUUA 1QBML 1T20A 2VZTA 4DKEL 2OL3H 4U1SA 2MCPL 3VXRE 2NZIA 1U92B 2MHAA 5HD8D 3WUZA 1UXWA 4AJ0A 3BEVB 3BSZH 4H5SB 2X89A 3L7EB 1N0LA 3K2UH 2J8UE 4ZNEA 1DZBA 5JHLH 1OPGH 3I50L 4L8DA 5H37G 2XXMB 3GZKA 1LEGA 1G7PA 5HYJA 2H8PB 3C6LA 3H7BA 4RGMC 1JGUL 1AQDB 4WNQA 4XMLL 4DN4L 3WL9B 1L7IL 3E1F1 3KYOB 3UTPD 1KCUL 5T3ZD 3GUTA 5E70A 3ARBD 2M26A 3S35L 5IB4B 1EEUA 4TVSa 5T1MB 1UENA 4PJIB 1OTSC 5GHWL 2XQYG 4QYOB 2R15A 2YPKB 5HY9B 2GSGA 5E7BA 2BMKB 5DJ2A 2HFEA 3OMZA 4QEGA 1UVQB 1RIUH 2IQ9H 4M6MH 1NEZA 1PVHA 2QV2A 4K8RC 3I6LE 4YIQB 5DHYB 1EHLL 4RMSA 3P4MA 2DB8A 4KU1A 5J12B 4OCNC 3AU1B 2C3VA 3FOMB 2PW2A 1KFAL 2ZUVA 2RQ8A 1P9MC 4ZAKA 4BFEA 4Z7WF 4NQEE 2NXYB 1A3QA 1PX4A 4P23A 4IHOB 5H8DA 2Z31D 1RZKH 4MJID 2FGWL 4IOSD 2HFGH 4Z7UB 3SE8L 4HUVB 5KN5B 25C8L 3LMJH 3ZL4H 4YHKH 3U9PH 1RZJL 4P5MB 1LO2H 2WWKO 1N2RA 2JCCF 2IBGA 2AV7B 2UZIL 4J3UA 4ZFOL 1OSPH 1YJDC 3NGBC 2C7UB 5KVEL 4LU5H 4PRBA 3MX0A 4RRPA 2AJUH 1TFHA 5EU3A 3ZE2F 2HLFC 5DVMA 1U93B 3RWCB 2NX5E 3UO1H 4DGYL 2X6MA 2BY3A 5EC2B 5LGJA 3P30H 1UM6H 1F8TL 4P4RB 4NN6B 2J6EA 3HUJB 3TLRA 4XPHH 3BH9B 3ET9F 1JTOA 3MUZ1 4CJ0A 2W9DL 2J1KA 1S7RA 1A7QH 4NQXB 2JJVA 1MQKH 4MNGB 5ANMA 3W81A 2P7TB 4ZUSA 1YMHA 2QQNL 3C5JA 1FZJA 4LLUB 4LHUB 1MCPH 1MLCB 1CG9A 1OP3K 2GT9A 5CLTA 1F6AB 5IJVB 4XP9H 2A6IA 3V4VL 2R4RH 1N0XL 2YMXH 3SOBH 2JLLA 4ZS7H 2YPLA 3L5XL 5DLML 5HHOA 1K85A 1C12A 1QBLL 5DWUH 2IC2A 4PJXE 1FLTX 2IH1A 2J4WL 3UTZA 5DD0H 5HHNA 3UYRH 3D3VB 3QXWA 4LRIC 5JORB 2YXFA 3JWOH 3CSPA 2BY2A 2G75A 1FNSH 4XH2B 5GGTA 2CDFA 4NC2B 4KKCC 5IW1A 3C60A 5HGBA 3MA7A 3VCLA 4PG9A 5I8KL 3FONA 2J2ZA 1CE1L 2HVJA 3MYJA 4IBLT 4XNZB 3QQ9D 4WV1A 2PTTA 2OL3B 5D1XB 3KJ4B 2DKMA 4TQEL 1OGTB 1NBYA 1VESA 1QEWB 1VDGA 4IRJC 2FX9H 3B5HA 1GIGL 4TSCH 4E5XB 5CEZL 2IANB 3LS5H 2GK0A 2WIMA 5BS0B 3KPQB 2OJZL 3RX8A 4K8RL 5FYKU 4KK9C 4KI5E 3MJ6A 2UYLB 5JW4R 1E4XL 1HI6A 2ZKHL 1RUML 5B3JE 1UCTA 3WO3B 3HI5L 4HCRA 2Y07H 4PB0L 4D94A 5EO0A 1TZHA 4M7LL 5HYJD 4NN7C 3C6LD 1TVHB 3UTSB 1FO0L 2JJWA 5I73B 1QR1B 5I1CH 1VACA 2Z8RA 5IHUH 4WJ5B 2VOTA 1BFTA 2GUOA 3QDHA 5MENE 1MCNA 3O4OC 4NOFA 3DXAB 3DX7B 3I6KB 2P5EE 2IGFL 4B7LA 1IC5L 4ZOCA 4YX2H 4IEFB 4WU5A 1CVRA 2ATPA 4PJFB 4N0CC 5C0BB 1S7VB 3TO4C 3S36X 3ULUE 2XTJC 2G2RA 4NGHL 2CLZB 4HLZG 4F15B 1CLOH 2VQUA 3OWEA 1MLBA 4M6NH 3ZSSA 2Z93B 5EBWA 3QSKB 1MCKA 1YJDL 4HQQH 4P2OB 3DGGB 2Z4QA 4F7CA 4RMTA 1AGBA 4PJHF 1PG7X 4JZJB 1PLGH 2J8UB 2EC9T 3BHBB 1MVFA 2BSRA 2Z8SA 3B83A 4OIIL 5DA0B 3UMTA 3QA3B 3RTQB 5GSVB 5SV3A 4U6XA 4NNPL 5GRJH 4JFFA 4FTVA 1FP5A 5T33L 3B3IB 3KPPA 4NWUL 2P8MA 1GGBH 1HXYA 5DC4B 5IJKA 4HKBA 2CDEA 3DURA 4ZUWB 4JRYE 2NYYC 3S6CA 4ZFFB 4D9RD 1DFBH 5F7WC 1J1XL 4UT6L 5BOPA 2R4SH 1U3HB 4C56B 4P2RB 1DE4B 2EEAA 3NZ8A 1N4XL 4QT5A 3AB0B 3QDJB 3T09A 1MRDL 4JZOB 4KJWD 4I9WD 2NLJB 5D2NA 1H15A 3B9VA 4IJ3B 3DV6A 5KS9F 2DRUA 3SDCB 3BD4A 1FYTE 5ACMA 3MLVH 2BOCB 5CD3B 4N8VA 1I1YA 4Y2DC 3RGVC 2HJFA 4FXKA 4NHCH 5BMFL 3NOIA 3OX8A 4MB3A 3MV01 1EVTC 3V5HB 1R5WB 4K3JH 2CGRH 5I1GH 4RIRB 4DEPC 3D9AH 1IC1A 1RK1A 5GRVK 5FA4A 1H3UA 1FL5B 2AXFA 4JM2D 4QHMB 5IK3B 3IXTA 3QFDA 1IGJB 3ZTNL 4GAGH 2R0WH 4WWKB 4JPIA 2YD1A 1P4IL 1FGNL 2X1OA 1KB5H 1DVFD 5ICZB 3VWKC 4I48A 1OP3H 2WIIA 4C83A 5HJ3B 3B8SA 2YUXA 3LEYL 3HE6B 4DZ8B 2PXYA 4OFYD 2EZ0C 2FECI 4GKOA 3LQMA 4U6HA 3GSQA 4XP1H 1NL0L 2JJSA 3BN9D 5GXBB 3HNTH 4XBPA 1OARH 1CGSH 5DMJB 4CRPA 1JYNA 3VDCA 1S7QB 1XGUA 1BAFH 2DKUA 3SHSA 5ERWA 1CLZH 4NKOA 3B9DA 3KWWB 4R4NC 3U4EA 5J6GB 1I9EA 3MV9A 2V5MA 4KKAC 4YWGL 5M7QA 1QQDA 4R4FH 3S37H 2DTMH 1UYWH 5C0AE 2W0KA 3VG9C 1INEL 4Y19E 3BE1H 1RU9H 3BDXA 3OB0K 1AC0A 5D4QA 2DQTH 1Z2KA 1A6ZB 2NY5L 5E8DL 5E6ZA 4UMGA 1KJ3H 4DVRL 5BW7C 4BM7A 2CJUH 4R96B 3DHMA 1GC1H 3BEVA 1IM9D 1L0XA 4H5SA 3L7EA 5GZND 2ADFH 3V4UH 1Y6MR 3MJ8B 4JO2H 3S98A 1XCTB 2H8PA 1AQDA 5E6IC 5EZIL 1OAKH 2KL6A 4GMTH 3WL9A 3KYOA 1BVLB 3QQ3B 3HHRB 3M8OH 3OGOE 3N1GC 2IPKA 4U1GB 2VLKB 4J2XA 5HDBF 3BIKB 5CWSB 2DMBA 5IB4A 3KLSA 5JIIA 5T1MA 2CRYA 2WBJD 4PJIA 2Q1EA 1E4KA 4ODVL 5F1NA 4QYOA 5C0NC 3HAEH 3RJDA 5C0EA 5HY9A 1URLA 5EIVA 1PY4A 2BMKA 3OKYA 3VG0L 2E7CA 1B2WL 1MCWW 3N1PC 1UVQA 1ZT7B 5J89A 4RGNC 3U4BH 4MAUL 3SQOH 1TJGL 3OG4B 4YIQA 5DHYA 1DL7L 4XNMB 2I26N 4OZIB 3AU1A 3K8LA 3FOMA 4O2FB 3Q6FB 2A0LC 2CQVA 4X7DC 3IDUA 2VZVA 5EIIB 5CGTA 4GRWH 1F6FB 5A2LH 5C6WH 2J8HA 4PJCE 3VGDA 3CXHJ 1CICC 4PRPB 2V5RA 1RSFA 1IKNA 4KKNA 4PLJD 4W4NA 1BECA 4ZTOL 2D9QB 4G9FE 4UV7H 4JKKA 4R8WH 1KYOK 3A67L 3KPSE 4HUVA 5KN5A 4EXKA 5KVMC 4X7CC 3Q5OA 4WO4D 4YDVB 4BFIA 1IGIH 1W8NA 4LF3B 4P5MA 4NZTH 4RAVB 5LKNA 2VLRA 3VWJC 4J23A 1U41A 4MQXC 2AV7A 5TF0A 2PKDA 3L3KB 5DK0B 4F9PA 3ARPA 5K59E 3KPMB 3ILQD 2C7UA 3RVWC 3WFDL 3EYUL 3NFSH 1NGQL 2V7NB 3LRSA 4PJ5D 4D3CH 1P5VA 1ZT4B 5DD3H 2IAMA 1U93A 3D87B 3RWCA 3UTOA 2E8YA 3MYZA 3DWTA 2DDQL 5EC2A 3EYQD 4WU7B 4P4RA 3HUJA 4XP5H 2HAZA 4HS8H 1QZ1A 2W07A 2C1OB 2X40A 4K3DH 3THMH 4NZUL 4NQXA 4MNGA 2P7TA 3NFNB 1PYWB 4M43H 4Y89A 1BQHG 4LLUA 3RKPA 4LHUA 1Q9LB 1MLCA 5F7DB 1WTLA 2AK1L 3KPLB 1F6AA 2AI0L 4NO0B 4DUWA 4HT1L 1DLFL 2XRAH 3GI9L 3STLB 1X5AA 4Q9BA 5AAMA 3MLWH 4PBVC 3TJEL 1WT5A 2DQHL 1H0DB 3L3IB 4KPHL 3O6LH 1ODAA 5M94B 3SGJC 1P7KB 4MD0B 4G43B 3VFRA 3C09C 3D3VA 5JORA 1FFPB 1W0WB 1TDQA 3NIDE 4TSAH 4XH2A 3V52H 4FABH 3VH8B 4MHHG 1ZT1B 2UY6A 4QXGH 1IKFL 2XY2A 2RCSL 1NCWH 2V5SA 2OL3A 4ORGB 5D1XA 3OB0H 2BVEA 1AGEB 4X4YB 5LG1A 5D7JB 2FEDC 1OGTA 4GW4B 1QEWA 3UTTE 1F4XL 2GI7A 3HR6A 5KVFL 1P7QB 2LV4A 4E5XA 2NY1C 4YXLH 5IG7B 2IANA 3MRIB 4RA3A 5D5ME 5BS0A 3KPQA 4U0RB 1AE6H 2UYLA 5CJOH 4LCCC 3WNLA 3S36L 1VEMA 3M07A 3AM8A 3IAPA 4YE4L 3WS6A 1KTRL 1X5XA 2GTWB 2JELH 4EQ2A 1TVHA 5C0CB 3UTSA 1T21B 4JFEB 4L4TB 1M6OB 2X4SA 4WJ5A 1EHNA 3CNKA 4BZ2L 5C3LD 3DXAA 3I6KA 1I85A 5KANI 1GGTA 1MI5E 4S10A 4U1MB 2V5TA 4YXKL 2DS4A 5A16A 4BFGA 4PJFA 5C0BA 1S7VA 5JW4M 1KBGH 3OF6A 3KXFB 2GITB 2QQKL 4C54A 3MRPB 1S7TB 2Z93A 5I1HL 4P2OA 1JWSA 3DGGA 4TNWF 4GRWB 3HZMB 2GK2A 4KMTH 4JZJA 3OR7B 4LSTH 2FJFB 3GO1H 2J8UA 3BHBA 1CT8B 1RHFA 3F5WB 4KJPD 5I1JL 1CD9B 3T3MF 5FHAH 4L3ED 4Y5VC 3RA7L 2P4AB 1N5AB 4YHIB 2DQGL 2FJGB 3QA3A 3RTQA 4I77L 5GSVA 3TNMB 4AMKL 2AXHA 4OZFG 3ZHDA 5C9JB 2CUHA 1MHPH 3OL2A 4EVNB 4N0UB 3B3IA 3ZSTA 1I1AC 4OCYL 4EEEA 3A6CH 4UT9H 4ZUWA 4ZFFA 4FQ1L 5I2IB 4OCRH 4JREB 1G9MC 2W92A 2YXMA 4C56A 3VW3L 1A3LH 1DE4A 4P2RA 4P3CL 1UACH 2HT4C 2VLRD 3AS3A 3QIWD 4WFEE 3QDJA 4U6TA 1AI1L 4JZOA 4V2BA 2NLJA 5DXWA 4M48L 4CADB 1UA6L 1U8NB 2HTKC 3SDCA 5CD3A 2BNQD 1DBKL 1ZMYA 4Y0GA 4KRMB 2OMNA 1S9XB 2IAMD 1OAZL 2OX5A 3V5HA 4KZDL 1R5WA 3BKJH 4OKDA 3MJ9L 4RIRA 4WI6A 3J7HA 3M1BB 5DD5H 1GGUA 3EO1A 4CMHC 5J56B 4Y4KC 1FL5A 4S11A 5IK3A 1CD1B 4AY0A 2X4PB 1IGJA 1YEHH 5ICXB 1IAII 4WWKA 5GS1C 1SVZA 3BGAA 3DV4B 1RMFH 5CAYB 3UZQA 4K3EL 3DUUB 4OD1H 2XZQH 3FQRB 5ICZA 1HDMB 2YR3A 1OAXH 4QGYA 2D7TL 5HJ3A 1QRNE 1HE7A 3HZYB 1K3ZA 1MF2H 3OQ3B 4D0DB 3HE6A 4BQ6A 4DZ8A 4P2QE 3I6GA 1REIA 5AYUH 4L8SB 2BRRL 1QSEB 35C8L 3TPUB 1YNLH 4KQ3H 3V0VB 1AR1D 5JW5B 4LSVH 1NAKL 1K2DB 1S7UA 4A6YL 2WSKA 3CLFL 1S7QA 3Q48A 4MZ3A 5I9QC 1B4JL 2E8ZA 2LFGA 5DJ8B 3TZVD 4WI2A 3KWWA 5J6GA 2VQ1B 2FRGP 1HIML 2XACC 2J88H 1JRHI 4DJMA 1C16B 1IAIH 5A40E 1QFHA 3AFLA 4JM2F 3HRZB 3TWCL 4M6OL 4JFDE 3WUWG 1YECL 5DUPL 4JPWH 1BQSA 1K6QL 4PY8I 3MRLB 1A6ZA 4MGXA 4O9HH 3B2UC 5TDNB 4E41D 5IT2H 3UX9B 4WTZA 2QJDA 3TVMD 4R96A 1AXTL 3ZT6A 1Z9SA 1OAQH 3D85B 4TRPL 1I3VA 5DRXA 3ULSB 3DETD 4CU7A 2IH3B 4I5BB 3W2DL 5ADOH 4HUUB 2VH5L 2VWEE 1ZLWK 2ZCKH 1JHKL 3MJ8A 2DI7A 3QB7C 1J8HB 1XCTA 2QQQA 4NQVB 3MOAH 3WIFB 5A1AA 1DTUA 4Z7NE 4NBYB 2JIXB 1KXTB 4D0CB 1BVLA 3QCVH 3QQ3A 2VAJA 1BF8A 3ARTA 1JRHH 3BIKA 3LPFA 5CWSA 1OLLA 4CVUA 3BT2L 1JF1B 3WIIH 1D5BA 1RVFH 1J0YA 2K1MA 4WY7L 3GJEB 4MLIA 2ZG2A 1G9ML 1NAMH 5IBTH 5F8QC 1CD0A 1YEGL 1ZT7A 2PTVA 2EDFA 5EZOL 4I4WA 3SDDB 3N06B 3CK0H 1Z9OA 3TJHC 3PL6B 4XNMA 3MJ7B 4ZSOB 4J3SA 4EI6B 2R2EB 4L9DA 4G5ZL 3VXRD 4OZIA 2MPAH 4LHQB 3KLHD 3P0VL 3WXVL 4O2FA 4RNRB 3Q6FA 3VMOA 1UC6A 4A2LA 4K71C 4Y16B 3BI9X 4UNVA 3OAZK 1GRWA 4XNYL 2FIKA 4PRPA 2H1PH 4RGOL 4I0PB 3OZ9H 2OR9L 5MENA 4NN5C 1UCBL 1ZGLP 2Q8AL 6CGTA 2YD9A 3KLAB 5D7LB 3ZMRA 4YDVA 1MELA 4XMKH 4LF3A 4P57B 4ONOA 4RAVA 1X4ZA 2YEZB 1FE8L 4KROC 3BYYA 4ZS6C 3BIBX 3L3KA 3QDJD 1E6JH 5DK0A 3IAQA 4UILL 1CU4H 3F7YB 2Y06L 3KPMA 2YK1H 4P3DB 1BGXH 3I6LD 1FORH 1CE6B 3IJYB 3QNYB 4D9LH 4AM0B 1ZT4A 9CGTA 4XWGH 4NFDA 5F9OL 2FD6H 2ICCA 4K23H 3MQIA 4YXHH 3WXWH 1A6VH 1RZ7H 2CXGA 5DMIL 4WU7A 2D9CA 4ODUB 4HS6B 1RD6A 1KB5A 4NCC1 4NQED 1OCWL 4XXDB 4W6XB 3SKNB 4RWYL 4N0FB 3QHFL 1GHFH 2C1OA 5GGVY 5I19L 1N7ML 1CDIA 1PYWA 5EOCJ 1EA9C 4GBXC 3T0EE 1Q9LA 2I60L 3HMWH 5F7DA 1DBBH 4GSDL 1CLYL 4PJGE 1DQJA 3KPLA 3IYLW 3HE6D 4NO0A 1V3MA 4PGZA 4HAFA 5SWSB 3STLA 5CBAB 3OHXB 2NR6D 1H0DA 3L3IA 4F7EB 3QEUB 4KAQH 1G9NC 2XG4A 1A7RL 2ZJSL 1FFOA 1P7KA 4MD0A 4G43A 3S4SB 1VFMA 4PJ9C 5E2TL 4OIAA 3EW3B 1FVCB 1FFPA 1W0WA 3MOBL 5D96B 1R5VB 1LDSA 2NX5D 1SJEB 3VH8A 4OCSL 5IR1B 1ZT1A 2ILLA 5I0DA 2ATKB 1MCOH 3WNOA 4ORGA 4MB5A 1CR9L 3DI2B 1AGEA 4X4YA 2QQLH 5D7JA 5B22A 5J3HC 4GW4A 1X3DA 3Q5TA 1P7QA 4G6JH 5IG7A 5CFHA 3TT3L 4RMQA 1ZLWH 4OF6A 5FF6B 3TP4A 2DWDA 4WI3A 1JN6B 2DQDL 3FB8B 1FSKB 4JQXA 4G3YL 4WDIB 3S97C 5FUOH 2IQAB 2GTWA 5C0CA 1T21A 4JFEA 4XHJD 4RA0C 4L4TA 1M6OA 4K7FB 3BD3A 3PWPB 4OQTH 1M7XA 4HIIB 5HD8C 5GGVL 3HAEA 4GFTB 2LE9A 3I9GH 1NAMB 1IGYB 4PS4L 4BQBA 5F7YC 4N1HB 3FZUD 5ETUB 4IDLA 3WFCL 5LXGL 2D03H 1IGCL 4YLQT 4X80H 4Y19A 2WMPA 5F1OB 3KXFA 3K7UA 2GITA 3ARBC 3MRPA 1HHKB 3KDMB 1S7TA 4EJ1C 4HW6A 4Q9QL 3BVNB 3HZMA 4OLZH 3EHBD 5D7KE 5MP6H 3OR7A 2V9TA 2FJFA 5K9JL 2YA2A 3WNKA 3CJJA 1T03H 1CT8A 1JGUH 3NCJH 3OAZH 3F5WA 2WLZA 4DN4H 1L7IH 1N5AA 1KCUH 2DF3A 2FJGA 4Y4HC 1QPXA 3WNMA 2XT1B 2VDPL 1OTTC 3I3EA 3TNMA 5C9JA 3S35H 4EVNA 2GJ6B 4N0UA 4Y88A 3W11D 4K7PH 3VXSB 1C7TA 4QXUH 5DQ9B 5FK9B 1S78D 5GHWH 5MEND 1HOCB 5GRYA 1KELL 5I2IA 4HKJB 2P5ED 4Z0BH 3RVVD 5JXAL 3EOAB 4OD3L 4HKZB 4U3XA 4P9ML 1TNMA 3ULUD 2X9WA 4L9LC 4NKIL 4CADA 1KN4L 5CINL 5ID1B 2OI9B 4CVWA 1U8NA 5FUCC 4Y5XC 3EZJB 1FC2D 4KI1A 1KFAH 2QADB 2B0SL 1LD9B 4X8JB 1INQB 1G9NL 1L9NA 5DJXB 1PFCA 1S9XA 4PJAF 4Q9RL 2NY0D 1QFWL 5KG9B 3AXLB 1XF2B 5TGBB 3O3BA 3AY4C 5CGMA 5HYEA 3U30B 1S8DB 3CFIC 4W68A 4BK5A 3ZHLA 1XMWA 2X4PA 4UDUB 5CJ5A 5ICXA 25C8H 3DV4A 5AZEL 3DUUA 4LCWB 4M7JL 4ODBD 5DQDH 3FQRA 1HDMA 1RZJH 1YEIL 4APQB 2FATH 3EYFB 4JRYD 3VDAA 3GBNL 4D0DA 3VXMB 3ARDC 3QZWB 4FA8A 3PHSA 5C6TH 1EGJL 1QSEA 3TPUA 1FV1B 3V0VA 2YA1A 5JW5A 5KVEH 1XGRA 1K2DA 3TA3B 2R8SL 1BWMA 4KRPD 3ZT7A 3U36B 2C4FU 5T1LB 4FXLA 1FYTD 3BESR 4DGYH 2Q8BL 3JV4B 3F58H 3SJVB 5DJ8A 5DO2C 3F7VB 2VQ1A 1H5BC 1R24B 1YEEH 3H9SB 3GSWB 2VDRH 1TXKA 3HI1B 3W0WB 2W9DH 2BCKB 1QO3B 2FB4H 3AS0A 3VFSB 1FIGH 1SBSH 3QXTA 4BSJA 3IFNH 3MRLA 2G5BB 2Q20A 5C6PB 5TDNA 3V4VH 1IT9L 1N0XH 1MEXL 3B2VL 3O11B 5FXCH 5GGQL 2APWA 4N1EA 4YNYB 2GEEA 3D85A 3L5XH 5DHVH 1HHIB 1E4XI 5ID0B 2IH3A 2JJUA 4I5BA 4HUUA 3BKCH 1QOKA 3QQ9C 2YD6A 2J4WH 1J8HA 3AMKA 5CGYC 3O9WD 4NQVA 3WIFA 1AO7B 2WLYA 5C0CD 3ARVA 1U6AH 4IRZH 1WGOA 1N5YH 3V8CA 2JIXA 2IWGA 4D0CA 3C5ZD 4G6AD 3QO1B 3MLSL 5EUOB 1FPTL 4KDTA 3DIFB 4H88L 1CE1H 4OF0A 1F3RB 3MRDB 1O0VA 4GRMB 1JF1A 4KUCD 3MCG1 2FR4B 1IFHH 3C6LC 3GJEA 3ZKXC 5IIEA 4HPOL 1GIGH 3MV7B 4HWBL 1JYVA 5C0AD 5CEZH 4YUEL 5E2UH 2HP4A 3QUKA 1CYGA 4Y19D 3SDDA 1KCVL 3Q1SH 2OJZH 4K8RH 1WV7T 3PL6A 3MJ7A 4ZSOA 5K33A 1P4BL 4EI6A 2R2EA 1PKOA 3HI5H 3INUL 1N6QH 4KK5D 4M7LH 3RVTD 3K0WA 2EDBA 2PO6D 1FO0H 1MJ8L 1HNGA 4Y16A 1F4AA 4JRXE 1DQDL 2AKRB 1VSCA 2BNUB 2Q87A 2G5RA 4I0PA 2IGFH 4GG6F 3RX5A 4CN1A 2WWKT 1MNUH 1B3JA 3BPLC 1G7MB 3MA9L 3EDFA 1P5UA 1JUFA 4LEXL 3KLAA 4PBWD 3MJGX 1Q9KB 3RWHB 4P57A 3TF7C 2I07B 3PDOB 1YNKH 1TQBB 3ARSA 1RZ8B 4QRPE 3QCTL 3SDXF 2OTUB 3F7YA 4P3DA 5F3BB 3U0PB 2FGZA 1CE6A 1M4KA 3QNYA 4AM0A 4DAGH 3WO4B 1B0GB 4OIIH 1JZ4A 4UI2A 1MAML 1EX0A 1QBAA 3P0GB 5FGCE 4U6YB 4ALAH 1VB9A 4HS6A 4P0DA 5T33H 4R7DB 4XXDA 5I8OH 2XFXB 4RISL 3B9KB 3SKNA 4N0FA 4NKDB 3MFFB 3BIAX 4NOBA 1J1XH 4UT6H 4ZFOB 4G9FD 3IDIB 4MNQB 4TN9A 4DN3H 4G8EB 3R1GL 3KPSD 5L88L 2AK4E 1OY3B 1FJ1B 2ZCLH 3VMPA 3G6AB 1KG0B 4JM2C 5SWSA 5CBAA 1GAFL 4M5ZH 1O5DT 4F7EA 1U36A 1DVFC 1ZHLB 3RHWK 3VRLF 1S3KL 5B39G 4H20L 3S4SA 4QKXB 4NC1E 1FVCA 1IAKB 3MMEB 4HV8A 2EH7H 4JG1L 1R5VA 2IADB 3IJHB 4OLWH 2C4FT 4EDWL 3BN9C 3MBXL 1IC4H 5FGSA 5C09B 2QEJA 2ATKA 3TESA 5IW6B 1FGNH 4NJAL 1TPXC 1WWBX 5GSRB 3OSKA 2ADJB 3AC0A 3ULVF 2EECA 5JPMB 3LEYH 4NRXB 4KGLA 3CSYB 2OXHA 1KIRA 3UAJD 2R1XB 2WINA 3FN3A 4YEEA 5IB5A 4ELME 4GG8B 4K94C 5J4MA 1VGEH 4YHZL 5EU4B 1WCQA 4RGMB 1JN6A 3FB8A 5DRZB 5C71A 4WDIA 3MRNB 5MEPA 2IQAA 1ACYH 3L1OH 5T1KB 1MFDH 2DIAA 4OJFH 1U8MB 4M4PA 4K7FA 1FZOA 3PWPA 2JIXD 1EJ6A 4HIIA 1IZJA 4ODWB 3F8UB 2BOBB 4YWGH 4X6BB 15C8L 2X4TB 1NAMA 2VITB 5F1KC 5TDPB 4AT6B 1FNFA 2EDEA 1VFUA 4EKXA 1INEH 5ETUA 1EUTA 5JHDE 1OW0A 5TPWH 4XHQA 5CJXA 2NY5H 3E6HB 2F74B 4PJBE 1LO0L 4PG2A 1FQ9C 1NDMB 2XKNB 5KOVC 1FGVL 5ILTH 1HHKA 4WHCA 1H8SA 3UTTD 4KQ4L 3M17B 1RIVL 2KQMA 1KCLA 1FO0B 3BVNA 4K3GA 4JM4L 4FQ2L 3EDEA 1LDPL 3CFEB 4X6DE 1SEQL 4MA1B 2VLME 4FQXD 2CKBH 4BKLA 5C7XH 1J88A 2FJHB 1ZHNA 1AXSB 3JTTA 3DI3B 4X7SH 2RR3A 2GJ6A 3VXSA 2B4CC 5DQ9A 4OSUL 5FK9A 4LLVB 2F5BL 1HOCA 1JWUB 4HKJA 3HA0A 1MI5D 4DOHE 3DO3A 2WAHA 3VG0H 1NMCC 2VE6A 1B2WH 4XT1C 3EOAA 2F53B 3QRGL 3QDGE 3NGBB 3RRQA 4HKZA 1TJGH 3VFGL 2ERJC 1NGYB 4PLJC 1KEGH 4B5EA 5ID1A 1U2HA 1YYMH 3FO9B 1IEAA 5BRZE 1LD9A 1RURH 4X8JA 4LLQB 1INQA 5DJXA 1NCUA 4MYWB 3RIFK 5KG9A 3AXLA 1XF2A 5TGBA 3VGGA 1DJSA 2PYEB 3O6KL 4KI5F 4MVBC 2BY0A 3IF1B 1S8DA 5B3JF 5D2NC 3LEVL 3ILQC 4PREA 4UDUA 3D69B 2VXQH 5EU7C 4LLDB 4OZGE 4XWOC 2BC4B 4LCWA 4X9IA 2VUOA 4XNXL 5HXMA 3LRHA 3WSQL 5TDOB 3PWUB 1CFQB 4FFVC 2JB6B 3EYFA 3SDAA 1MPAH 5FCSH 3QO0B 3U79A 4FRWA 3EYQC 3VXMA 1LK3L 2BJML 3QZWA 3BKYH 4LIQH 1FV1A 3PDDA 3MV8E 3BJLA 1ND0B 2W91A 3KPRB 3WFDH 2OSLB 1NGQH 1EZVX 4K94L 4OB5L 4WFED 3T04D 3TA3A 5C0JB 5DR5L 1U8OB 3U36A 3ULUF 5T1LA 2QHRH 1NFDE 2EIZB 3JV4A 4AEHH 2PXYC 3F7VA 2C3HA 4NM8H 1R24A 3H9SA 3GSWA 1WAAE 4OV6F 3HI1A 2JJSC 2BCKA 3U83A 1QO3A 3MRRB 3VFSA 2KZ1B 1F4YL 4HCRL 1J0HA 4HT1H 1DLFH 3VD7A 3T0EA 3O11A 4PJGA 4YNYA 1QRND 2AK4B 2AGJL 4XP6L 1HHIA 4NN7B 2DQHH 3MRJA 4P2QD 4WUKH 3G6DH 4KPHH 1MFBL 5E2VH 4F37F 3O2DH 4OQTA 3UPCA 1J1PL 4X7FC 4MJ6A 4IOFD 4U7KA 5JW3L 1AO7A 1IC7L 1TJHL 1DBAH 5JDSB 2Y7QB 4KC3B 1H3XA 2HTLD 3QO1A 4H1LH 2FX7L 3DIFA 3S3SA 5GRUH 4GKSB 3MRDA 3WHE1 2B4CL 1TLKA 5C0FA 5JZ7D 2XTJB 4GRMA 2KH2B 1GPOL 3JV0A 2FR4A 4DGIH 4M5YL 1I9IH 4NP4L 3EO9H 3MV7A 1OAUH 2AJZA 2Q76B 5JTWA 1WBXB 1YY8B 1CXEA 3N9GL 5E08L 5D2LE 4PRHB 3P11H 1PQZB 2CKBB 3CU1A 1KTDB 5KAQG 1RUAL 3T77B 3OAUH 1E4KC 2YN5A 5AWNH 3MROB 2AKRA 4HJ0D 1HH6B 4OTXH 2CKNA 2XN9E 4HDIB 2BNUA 5H94B 1SJXA 3KR3H 2X4NB 3G5XB 3OV6A 4WHYG 1QSVA 4BH8B 5EBMA 3L6FB 1G7MA 4EZMA 1KACB 1BD2E 3RWHA 4KJPC 4PV8B 2NXYC 2I07A 4LQ1A 1F42A 4MCYB 3PDOA 4KUCF 4OI8A 2QQKH 1RZ8A 32C2A 2OTUA 1IKNC 4Y2DB 2ZP0T 3X14B 2IG2L 5F3BA 5HI5D 1EFQA 3BQUB 1ES0B 1B0GA 2KQNA 1QG3A 2L7JA 2R39A 3RA7H 5ICYB 3CCHB 1P6AB 2DQGH 5A2FA 3QIWC 5ALCL 3UBXA 4I77H 2EDJA 4U6YA 4F9PC 2WW8A 2B1AH 4R7DA 2XFXA 4TPRL 3BXNB 3B9KA 4KK8C 4PJEF 2DM2A 4FMKA 5JQ6H 4NKDA 4UT7L 3MFFA 2VXVL 1CK0H 3KHOA 4HD9A 4ZFOA 3IDIA 1LE9B 4MNQA 3VW3H 2IAMC 1SQ2N 4G8EA 3SDAD 1FJ1A 1N8ZA 3IDXL 4B50A 3G6AA 1AI1H 1KG0A 4NFBA 4M48H 1TENA 1UA6H 3EJYD 4EXPX 3BGFC 1YQVL 3MZTA 3DSFH 1ZHLA 3IKKA 4Y5YB 4LOUC 1IBGH 5JXEA 4QOKB 3EDKA 4RMRA 1OAZH 4KZDH 2PTUA 4JY4B 1IAKA 3MJ9H 3MMEA 4P5TD 4NZJA 4GT7A 3WBDA 4LKCB 2IADA 4OZHB 3IJHA 1AR1C 3VG9B 3SKUD 2YHGA 4MMZC 3B8YA 2WP3O 1WT5C 4OLVL 3T0WA 5IW6A 1V5JA 3RUGB 5GSRA 1YPZE 2DL2A 2ADJA 1QFPA 4PJCF 4R90L 4YDIH 5JPMA 4PJ7B 5DHVA 2ZCHL 4NPYB 2APVA 3O2VH 3TZVC 4NRXA 3UYPA 2W0FB 2AQ1A 3CSYA 3FL7A 2BRRH 3T0ED 2R1XA 3ARWA 5C07B 5E8OB 3VA2C 1GYAA 1NAKH 3FRPA 4GG8A 4O2CB 4A6YH 3OKDB 3MGTB 3BMVA 5EU4A 1RJLB 5CMAB 4XNZC 3CLFH 5E6IB 3ZTJG 2APBA 5DRZA 3KJ4C 3MRNA 3OKNB 5T1KA 1C1EL 4H1LB 5IMMB 1UH3A 4E0RB 1LO3L 1U8MA 4S1DD 4QTHB 2R9HC 5K59F 3QUZD 4C59B 4ODWA 3GSOA 5L7XL 2BOBA 4HS3B 4UZGA 5FUZL 3DETC 4X6BA 2X4TA 4DZBB 2VITA 1EZVY 4X5WB 1N64H 5TDPA 5TJWK 4AT6A 3AM8C 1QACA 1YECH 3WS6C 1LMKA 5DUPH 1K6QH 3HPJA 3ZKSD 3E6HA 2F74A 5J11C 3SE9H 3P4LA 2EDWA 1INDL 3VD3A 4GRLB 1AXTH 1NDMA 2XKNA 2QSCL 3GSRA 4TRPH 2M1KA 3M17A 1LQSR 2XY1A 1I85C 4ZTPH 1FO0A 2AJYL 2EDDA 2VH5H 3A6BL 1GH7A 3CFEA 5GS2H 1CICB 4WTZG 5EOQL 5GZOC 3GMQB 1NMAH 4JGUA 4OI9A 4Q6YA 1JNLL 4F15C 4JAMB 2V9RA 1TZGH 3IXAB 1AXSA 3DJ9A 3H3BC 5DJ0B 1EAPB 5EA0H 1CXHA 4X0KB 1WZ1L 4P2OC 3NCYP 4PRIE 4LLVA 4KDWA 3KLHC 2O61B 3VWJB 3AVEA 1JWUA 2E7HA 3K80A 5DZOA 1ZHKB 1RZKC 1G9MH 2DYPD 1AGFB 1UKTA 2APFA 1KTLB 1WBZA 2F53A 5EZOH 1MAJA 4JO3L 3D0VB 3LN9A 4GKZB 3RTQC 2OLDA 3FTGB 2FLRT 4G5ZH 4MAYA 4PUBH 5ESAB 1KN2H 3P0VH 1JMZA 3FO9A 5D2LB 3RBGA 4W81A 1Z5LB 2NTFB 4LLQA 1U8KB 1NKOA 4MDIB 1GVIA 4XVJH 1HINL 3NABL 5D5MF 4XNYH 2PYEA 1OGAE 3QHZL 4NNYB 1HWGB 1T1WB 3U46B 3QUXD 4LCYB 4IJ3C 2OR9H 1YEKL 3D69A 4JGJA 2XG5A 1NDGB 4LLDA 1UCBH 2BC4A 4D9QE 2PYFB 4JKPL 5TDOA 4DK6A 1XGPB 1CFQA 3PWUA 4DGVL 2JB6A 3VXOA 3MRQA 1FE8H 3QO0A 2BZDA 1HCFX 3S34L 5F1IB 3T0XA 1TIUA 4G6KH 1W8OA 1M7DB 1EUUA 4AG4L 2Y06H 1B6DA 4JB9L 1ND0A 3KPRA 2OSLA 4WWKC 1EO8L 5C0JA 2DQCL 1MCRA 4PY8J 1BBJB 2YA0A 4XVSL 5GISH 4DUVA 3N0PB 1U8OA 4YBHA 2OL3L 5FEBA 5F9OH 5JXED 3QWQB 1LGVA 2FEEL 3PGCB 5I0ZA 3GM0A 3BSZL 3HE6C 3KPOB 3O45B 3K2UL 4RFEB 5JHLL 1JPSL 1OPGL 4WRLA 4X98A 3SKOB 2QKIB 3LD8C 3RAJH 3MODL 3QHFH 5IVNA 2NR6C 2CLVB 1DANU 3MRRA 3JWOC 2NY1B 3S37X 1JGDB 2I60H 4GSDH 4JGMA 4A6YB 3ARED 1XR8B 2EE3A 2AK4A 4KFZC 4U4BA 3EUUA 5E9DE 2EH8H 5F89A 3WD5L 4PRNB 1FRGH 2ZJSH 1RIUL 3RU8H 2IQ9L 5CEYB 4M6ML 5E2TH 2R56H 3VE0B 3L5HA 4Z7WB 4ISVB 5JDSA 4AEFA 1VA9A 2Y7QA 2X41A 5BOZG 1EPFA 3OXSB 3G08B 4OCSH 2WANA 3IFPB 1IQWL 1SMOA 4GKSA 2AQ3A 1XEDA 2MJWA 1CR9H 4FQCL 1RZKL 5HTSA 2Q76A 1WBXA 1YY8A 4JHZA 2JCCB 2YD2A 3QWRA 4TOYL 4PRHA 2GJZB 1PQZA 2CKBA 3ZL4L 2EYSB 5TE7H 4QTIH 3SCMB 3U9PL 4N5EC 1KTDA 3T77A 4Y5VB 3FZUC 4MZ2A 4ELMA 3SDYH 43CAB 1JTPA 1H8NA 1Q9OB 1D9KB 3C8HA 1OSPL 1UM5H 3MROA 4ZNCD 1HH6A 1I1AB 4LU5L 5DFVD 5GGVH 3CC5B 4HDIA 2DM3A 1IILE 2AJ3B 4PFEA 2X4NA 2YBRA 4PS4H 3G5XA 5IV2B 4BH8A 3EHBC 2L0DA 3L6FA 2XPGB 1NGPH 2ZPKH 5J1AB 5LXGH 2DLEA 1UM6L 1IGCH 4UDTB 5SWZB 4ACPA 4PV8A 4CMMB 2NXZD 3ARGB 4MCYA 1MREH 2FLBT 3MREB 3SGDH 2BXZA 4GAYB 5GIRB 5C08E 4Y2DA 1FVEB 2OM5A 3FFCE 1EK3A 1MQKL 3W11C 4Q9QH 1JZ8A 3P0YH 3X14A 4MAYD 1S78C 1DQLL 1MCPL 3BAEL 1YMMB 4CMHB 3D0LB 3BQUA 4M61B 4XP9L 2YMXL 8FABB 2EIEA 1R3LA 2NZ9D 1QFWI 3OR6B 4Y4KB 5L2JB 1YEFL 5ICYA 3CCHA 2JE8A 3C2SA 2NY2D 3OPZL 4JE4B 4P9HH 5GS1B 3ULUC 5DWUL 4JRXD 1I75A 4M6AA 3BXNA 3EYOB 3U2SB 1G6VK 2XKSA 5F6IC 1KELH 2GY7B 3UYRL 2FZ3B 1A3RH 1LE9A 4Z7NF 4XNUH 1V3LA 5BZDB 4OZ4B 3TBYB 4ZXBB 1OD9A 3RDTD 4XCCH 3MGAA 3O3UN 5CINH 1XIWD 2AEPH 4JPVL 1QTYT 4GW5B 3WEXB 4QRPD 4XBEH 5I9QB 1Q94B 2FX9L 4TSCL 4Y5YA 2YUVA 4GMSL 4QOKA 5I18L 1QFWH 4LVOC 2ICEB 3CPLB 4JY4A 2EDHA 2BVOB 2X9YA 4LKCA 1VEOA 4OZHA 3ARUA 2YSSB 3FN0H 1B6UA 5D70H 4EN3D 3VD9A 4KK6D 4L4VE 2A74B 3QXVA 3RUGA 2ZUQC 4FQHB 5BW7A 1YEIH 4PLOB 3CFBB 4Y2OA 3R8BB 3NVQA 4PJ7A 5JLZB 2H6PB 3GBNH 4Y1AB 4NPYA 5F3HA 1FG2A 2W0FA 2XOTA 1EGJH 1HCVA 3O2DA 5FM5O 4YX2L 1DBJH 5C07A 5E8OA 2AK4D 4O2CA 3OKDA 3MGTA 3S96B 4WFHE 1RJLA 5CMAA 5F7MC 5E6IA 4XZUB 1CLOL 4PJHB 4HPYH 3OKNA 1GC1C 2Q8BH 4H1LA 1OVZA 4M6NL 5HDQH 5IMMA 1DSFH 4E0RA 1WFTA 4HQQL 3MNVB 4TNWK 4U0RC 4HS3A 4NZDA 2BNRE 5IEKB 5IWLA 1XF5A 4HKXB 4QHNB 3PP4L 4DZBA 4JO1H 1MCSA 4X5WA 3HS0B 5ISZE 1WAAA 1BJMA 4JQXC 2GFBA 1S9WB 1ZANH 3V4PL 2DL9A 3Q2CA 4UINH 3DLQR 5GRJL 1NC4D 3MRGB 3B2VH 1HKFA 4OT1L 3Q5YA 4GRLA 3K1KC 2H2SD 5T3ZH 4ODTL 3ZDXE 2VLJB 3HG1E 2YD4A 1MFAH 1DFBL 3Q6GL 1A1MB 4K71B 4P59H 3WNNA 4PJ8D 5KS9B 1LO5B 1CICA 2IBZY 3GMQA 2EDQA 2E7BA 2N7BA 4JAMA 2I25N 3VGBA 3IXAA 5GRZA 5DJ0A 1EAPA 3MLSH 3TBVB 4NN5B 1FPTH 4NQDE 3ULUL 3ARXA 4H88H 4TSBL 5EZJB 4NHCL 2I24N 4HXBL 2Z8VC 1J0KA 3NTCH 3VI4E 4KK5C 5FM8A 2O61A 2YRPA 3VWJA 3QWOB 4K3JL 3WKNA 1X5YA 4M9PA 5F7NC 3P2TA 1ZHKA 4HPOH 5JOPE 1AGFA 1KTLA 4NQCB 3D0VA 3R8QA 1KCVH 4GKZA 5JHDD 1RZIB 4M7LT 4GAGL 2R0WL 2G60H 2BSSB 5CUSL 3V95A 3FTGA 2F8VA 3BGMB 4TUKH 1KB5L 1FIEA 3HE7D 1GJIA 2FWOB 3INUH 5D2LA 1Z5LA 2NTFA 3GMLA 1U8KA 4MDIA 1M7IB 5KBNC 4RX4A 5CZKA 2VLMD 3HNTL 3O8XD 3LRGA 5SWQB 4NNYA 1CGSL 4QO1A 2N4IA 1T1WA 4Z7UF 3U46A 4LCYA 5D93C 1NDGA 4AQ1B 3MA9H 1BAFL 3ECBB 5INDB 1WZKA 2PYFA 4LEXH 4QXWA 5I75C 4CW1B 1CLZL 1XGPA 3RZCD 1T0NB 4WCYH 1HN1A 5DD6B 4WVRA 2AV1B 4R4FL 3QCTH 1M7DA 3C2AH 3VFWB 2DTML 3QDGD 1JHTB 5IFAL 1H8OA 4PJ9B 4JEGB 4OF3A 1BBJA 3MJ9A 3ZHKA 2DQTL 1EBAA 4MJ5B 4X6FB 3WLWD 4F7PB 2CJUL 3DX8B 1GC1L 2VDLL 3PGCA 3KPOA 1S9YB 3EJJX 3O45A 4RFEA 3V4UL 4JG0H 3O6FD 2QKIA 4RISH 1TZIB 3V7MA 1IZKA 2PF6A 2XQYK 4HXAL 4HIXL 1JGDA 3R1GH 1II4E 4M9OA 5L88H 4G8GB 3M8OL 4A6YA 1WLHA 1KIPB 1T3FB 2GSIB 1XR8A 1QFOA 3KJ6L 1GAFH 1EEQA 5DUML 1S5IL 3OJVC 1IL1B 4OCWH 2AEIT 5L2KB 4KZEH 1WSST 1V3JA 3MV8D 4KRNA 4PRNA 4Q58C 1RQ5A 2JJTA 3QEHB 5CEYA 3SQOL 3VE0A 2CDGB 4Z7WA 4ISVA 5EBGA 4NC0B 2Q3AA 4B41A 1IE5A 1X7QA 3OXSA 1UG9A 3G08A 4EDWH 3IFPA 3MBXH 1OSZB 3LSOB 2EE6A 3QDAA 4FFZH 5IHZB 2HG5B 2BFVH 3N85H 3ARBB 3G9VA 4CN6A 2BHUA 1FL6B 2BK8A 4R8WL 2JCCA 2JB5H 5FDYA 4WGWB 1EIBA 4ZUTB 3DUHA 2GJZA 4KDTC 1NKRA 3RIAF 3SGKA 2EYSA 3UROR 1HYSD 3OB8A 3SCMA 5MHSE 1IGIL 2FYYB 3L3HA 4P2CG 2EO9A 4NZTL 4Y5VA 1CDCA 1J5OL 1R3KB 1SJVA 1I8LA 43CAA 1XR9B 2EDXA 4BQ8A 1Q9OA 4U2ZA 1D9KA 4O51B 1I1AA 4FQLH 1X5GA 3CC5A 2AJ3A 15C8H 1NGZB 2NY4D 1XGQB 4XB7A 5IV2A 2BDNL 1JGLL 2ZUWA 2XPGA 5GRVL 2Z31B 5CBEB 5J1AA 3PV7A 4FQXC 2P8LB 1GZQB 3C8KA 4MJIB 3NH7L 4UDTA 5SWZA 5I1EL 4CMMA 3ARGA 4XP5L 3MREA 4HS8L 2VMFA 1YY9D 4GAYA 4AQOA 2PN5A 5GIRA 3PNWB 2ICWB 1ZWIA 5D1ZD 1MVUB 3HMXH 1FVEA 1N6UA 5ACZB 4IMKA 4LPTA 1QKZL 5CSBA 1YMMA 4F9LA 4W4OA 8FABA 3D0LA 4M61A 5IMLA 4XPFL 3OR6A 3VGFA 5L2JA 3HNVH 5FKPB 1TCMA 4X9BA 1DQTA 1ZHBB 2VYRE 4POUB 4K07A 5C2UB 4KUZH 1CL7H 4XAWL 4OSUH 1NJ9B 2F5BH 3ALXA 3EYOA 2XN9D 4Z7VE 1RY7B 2VR5A 3EAKA 4FZEH 5HHXL 3U2SA 2FZ3A 1QVOB 5KTEL 4TSAL 5GJTH 4TVPE 4JY5H 3QRGH 5BZDA 1C7SA 1T6VN 4OZ4A 5F72S 3TBYA 4FABL 4ZXBA 5JPNB 1PKQB 1MCJA 2A38A 2ZSWA 4QXGL 1YC7A 1BD2D 1NCWL 5H37H 3V2AR 4GW5A 4WWID 3WEXA 1AHWC 1OWWA 1Q94A 1UXSB 1XFPA 4HGKC 5FECB 3JWDC 4YXLL 4M7KL 5DMGD 1H5BB 2ICEA 3CPLA 1JPGB 3QQ4B 1T80A 1A9BB 2BVOA 1AE6L 3JWNC 4KKBD 4PGJA 3O6KH 1EEYB 1U8PB 2MKLC 2YSSA 2YKLL 3VFVB 2JKXA 3F7QA 4H25A 3BEWA 2A74A 3HZVB 4FQHA 1VHPA 5DTFB 1BFVH 4UU9B 3CFBA 2ED9A 3H7LA 5JLZA 2H6PA 4Y1AA 2X05A 1LK3H 2BJMH 2F9BT 1UQSB 3KYNA 1NLBL 1KJMB 3T65B 2H9GB 2UZXB 3S96A 4H0GA 4TVPH 1ETZA 4LVEA 5DR5H 3OKLB 3FHAA 4XZUA 2Y25A 3RQ3A 4PJHA 2HT3D 2CIKB 3VXQB 3MLTB 3NFPB 3QZWG 3ZDZF 5GJSH 2AEWA 3BZ4B 3MBED 3TFKD 3WJJA 3X13B 3QFJB 3MNVA 5BVPH 3BZEB 1G7PB 5HYJB 3GO1L 5IEKA 4QHNA 4M93B 4I3SH 4XGZB 3ZKXB 4WNQB 3HS0A 2O5ZH 5FHAL 1XF3B 2D7NA 3TPKA 1S9WA 2FHCA 4DW2H 7FABH 4XP4L 1NANI 1MHPL 3MRGA 3JXAA 2HTLC 4PJDE 3A6CL 2VLJA 4UT9L 2OCFD 3WN5A 5MEOB 4OCRL 2WNGA 1A1MA 4HAGA 1MFBH 4L4JA 5KS9A 1A3LL 1KPRA 1J1PH 1UACL 1LO5A 3QXUA 1OW0C 5E94A 5CJXC 4X6CE 5ITBL 1P53A 1J0JA 4PG2C 5KZCB 5HHME 1P4LA 2BVQB 1J1OL 2R2BB 3U7AA 1W2KT 1KNOB 2NTSP 1YYLL 5EZJA 2EXYC 3K8KA 3S35X 4XPTH 3TN0D 4K7PX 5A2IH 3V0AC 1GPOH 3IKCB 3IFLH 3CH1B 4M5YH 1PBYA 5D1QD 4IDJH 5IBLD 1NANH 2MQ0A 3QCUL 5DK2B 4NQCA 3P4NB 1RZIA 2BSSA 3N9GH 3SE4A 2X42A 5E08H 3BGMA 2XZQL 5CILH 1CFVH 2COQA 5HHQB 3GGWB 1N2RB 4NJ9H 5DSCB 4OM0L 1M7IA 3JWDL 1T5XB 5DVKA 1YNLL 5SWQA 4NBZB 2E6QA 3DVNB 1L9MA 1ACZA 2IPTH 1ZXQA 1I9JH 1V05A 1YEJH 3ARFD 4OLXH 5INDA 2W38A 4ZOEA 4CW1A 2F58L 4F7TB 4JM2B 1NCCH 4HBCL 1L6XA 5DD6A 2OTWA 3S8WA 2AV1A 2X9XA 1FAIL 3U30C 1DVFB 3VFWA 4M1GL 1JHTA 5KW9L 4LFHG 3O81A 1A4JB 4PJ9A 2DQJH 2Y72A 5LQBL 1U91B 4O9HL 4PJBF 2A6IB 4Z9KB 4MJ5A 4X6FA 5C0RH 4F7PA 4RGNE 3DX8A 1FLRL 3SDAC 5IB2B 2VDNH 1S9YA 2VJXA 1D6VH 3CD4A 1SVCP 2OTPA 3T0BA 1TPXB 2HKFH 4I3RL 4TPRH 4QWWD 4X6DF 1JYXA 1TZIA 2FO1A 4UT7H 3TA3C 1OGAD 3VU2A 1EGJA 5IW3A 1U8JB 3K74B 4HLZH 4F58L 4G8GA 1OAYL 1T1XB 3MA7B 1SMAA 4PG9B 3VCLB 1KIPA 2HRPL 4D9QD 4P5TC 1KULA 1T3FA 2GSIA 2VXUH 1Z3GH 3DVGB 4R0LB 4POZD 4S0TD 1XGYL 2XYCA 1IL1A 1K8IB 1YQVH 1NAML 1QA9B 1U3JA 1VGKB 3QEHA 4TNVF 1KPUB 5I1KH 4I2XE 3HNSH 3CK0L 1IM9B 2CDGA 4NSKB 2LVEA 2MMXA 4WEUD 1IGFH 1ROWA 2IMMA 3T0EC 3HI6H 2M2DA 2MPAL 3WHXB 2EDYA 1OSZA 3LSOA 4LP4A 4TUOB 4X7EC 1TZHB 4OLVH 2XWTB 2D4DA 5KOMC 5IHZA 3RVUC 2HG5A 1VACB 1G0YR 4GQPH 3QG6B 2GUOB 3ARBA 5IQ9A 2H1PL 5D7SH 4YBLB 5T3XE 2WBJB 1FL6A 3OZ9L 4ZUTA 5CSGA 1ZVSA 2X4OB 2UWEE 4HWZB 2FYYA 4JN1H 1WTGT 4J8RA 4AL8H 4R2GD 1XR9A 1LO3H 1E6JL 2ENYA 5E9DD 1F3JB 4O51A 1CU4L 3FRPG 1OP9A 2YK1L 4IRSD 1CGXA 2P47B 5FUZH 4NQTA 1BGXL 1FORL 4D9LL 1NGZA 4OGAC 5LGKA 4FP8H 4XWGL 5IHLB 1I1FB 3FMGH 1NFDF 3H6JA 5HI4D 2FD6L 2Z31A 5CBEA 1CGTA 3UPRB 1A6VL 1RZ7L 2P8LA 2ERJB 5BZWB 4MJIA 1A6WL 5GGRY 2F54E 1BFSA 5ISZA 1INDH 4I0CC 4RFNC 3BDBA 2WK2A 3KPPB 3ZE1E 1H3WM 2QSCH 3FFDA 4EUPG 3PNWA 1GHFL 2ICWA 2NPLX 1MVUA 3NPZB 3RWFB 2LQRA 4WO4B 3BX7C 1U8LB 3DVFA 4YK4B 3UTQB 3HMWL 1DBBL 4U33A 3AY4A 1JNLH 4EBQL 4V1DE 5F9WB 2ESVE 4BYHA 2EDNA 1WBYB 1E4JA 1TQBC 1ZHBA 2AXGB 2W65B 4J3OC 4LDLB 4PJ5B 3CDFA 1A14H 2HJFB 1AD0B 3GSXB 2EXWD 4CDGC 1QVOA 5HYSG 3ZYJA 3WO4C 2CO6B 2X44D 1I3GL 2ARJB 1I7TB 2NNAB 1PKQA 4IOIB 4L29B 4LDOB 1RZJC 4DWHA 2QQLL 4C83B 3B9KC 3KAAA 4K7PY 4FQJL 2LABA 5C08D 5L6YL 3H3PH 3O3EB 3FFCD 1UXSA 1OP5H 5FECA 4G6JL 1KUMA 2I27N 1JMXA 4OFDA 4X6EB 3NABH 4JVUA 2FEEI 4MD4B 1GGYA 1JPGA 3KS0H 4J6RH 3PJSB 3QQ4A 1A9BA 5INCB 3QHZH 1EEYA 1U8PA 3FT2B 4M1DL 2DTSA 5C0DB 1UT9A 1YEKH 1RJZB 4UOW0 3VFVA 3HZVA 5I17B 5DTFA 2P5WE 5JXEC 1F4HA 3OJDB 1JE6A 3PQYE 1QBBA 3IGAB 3UJJH 1OTUD 2MQ3A 3ELAT 2NY6B 2P43B 1EVUA 3I9GL 1UQSA 4WW1B 4OLUL 1RUKL 1T6WA 1KJMA 3T65A 2H9GA 2VB5A 4OKVB 5ESVB 4IIQC 4WEBH 3OKLA 4PYGA 3RY6A 1MRCH 4X80L 3UZVB 2VDML 3OKMB 2CIKA 2RFXB 3NFPA 2VDQL 3MLTA 3VXQA 3MNZB 4PD4K 4LVNC 3BZ4A 3AREC 1JPSH 3MUJA 4QHLB 5E95B 3X13A 3QFJA 4BFBD 2Y6SD 4DFHA 3EOTH 4OLZL 1MJUH 3BZEA 3IETB 5MP6L 1QSFE 1E28B 3MODH 3U0WH 4XGZA 1T03L 1FCCA 3V79C 3NCJL 3S88L 1W72H 2ZOLA 5HHPB 1XF3A 2Z8WC 1NGXB 2CRZA 2IPKB 4L4VD 5HSFA 2XA8H 4K7PL 4QXUL 2WBWB 5KSBE 1QLEL 5F1NB 3U0TB 3O2WH 2Z35B 5EN2B 5C0EB 1XF1A 5MEOA 2VTFA 4MA7H 5T1DL 4Z0BL 3IB4A 3WD5H 3VRLE 1JTTA 3BKML