4N1EA

Structural evidence for antigen receptor evolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
94
Chain Sequence
DIQMTQSPSSLSASVTITCRASQDIAAALNWYQQKPGKAPKLLIYASSYLQSGVPSRFSGSGSGTDFTLTIEDFATYYCQQDGYYPATFGQGTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin variable light chain domain
publication title Structural reconstruction of protein ancestry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 18
structure length 94
sequence length 103
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n1eA00
3QIUC 4NQCE 4XP4L 1YNKL 3H7BB 4D9QD 4FQXA 4OCSH 4ELMB 2Q6WA 1LO4L 1LEIB 3SJVA 4MJIB 2XZAL 4JFZL 3FFCB 4ZPVA 2WM0A 5IROC 5GGSA 3E3QC 2MKLC 4UNVA 2FWOB 3SDXE 3DI2B 5EIIB 2VKXA 3D18B 1T3FA 5F1SA 3ZKMC 3H9HA 3ZKXC 5EBMA 1Q9OA 5DJCA 2BC4A 3ULVC 1C1EH 3SGEH 4OZIA 1U8LB 5F7DB 3RIFK 4U31A 3T0AA 3EGSA 1IJ9A 4ODVL 4QF1B 5B4MC 5IR1A 5CBAA 1RVFL 2B0SL 3VA6A 3W11C 3L3DA 4RWYL 1JRHH 4P57B 3UXFA 3TFKC 3LQZA 5ESQA 1MCOH 4XXCC 4PR5B 1GYAA 3U4EA 1HZHH 4PG2C 3UTPE 2XQBL 2H9GA 2R0LH 3WSQL 5D1QD 3MLYL 1BEYH 1PYWB 5DD1L 3RAJL 1NGPL 5D7SH 4X6EB 3SDCA 1ZHKA 3BP4B 2HJFA 2VXSL 2RIKA 5HHOE 3U83A 4QTIL 4D9RE 1FORL 5EUOA 2AJ3A 2OK0H 1T1YB 2P5WB 2PTVA 2ADFL 2RGSA 2NX5E 5LGJB 3P40A 4HUWA 2HTLD 4P46C 5HPMA 1MIEH 4JFHD 5DURB 3FHQA 2NY4B 2Z92B 3BP7B 4R7NA 1CLYL 1NCTA 5CLWA 1OP3K 4XPGH 3UBXG 3VXPB 5JXED 2DTMH 1W0WA 3B9DA 1K4DA 5DJZB 4KI5C 1NANI 4FZ8L 4HWBL 4Z7VF 2FLBT 2CO6B 3QFJB 1M6OA 1IM9B 4UBDC 3WFEL 5GS2D 3D0LA 4M7LH 5IB3A 1H8NA 1CXHA 4ZODA 5EU6D 1YYMH 1XGRA 4HIHA 2BNQA 4EI6B 2ZCLL 1IGCH 3ORJA 4FQ2L 4WU7A 3P2TA 2OI9B 4IRJA 5BZDA 3AREC 5LAXB 1NBVH 3I6LE 5TDPA 5ISZD 3MRGB 4P2QE 4JDVA 2FYYB 5J11C 3OAUL 2OS7A 2J6EA 1DR9A 2CR3A 2NY6C 5FM8A 5I0DA 1MLBB 1I8LC 2CLVA 3HZVB 5IFJB 2FJGA 3JUZA 4MA7H 5BQ7B 2DN7A 2R29L 2JF1A 2FATH 1YEIH 2DQDL 4ZUUA 1FZMB 3FO9A 5CP3H 2CDGA 3BIAX 1ZA3B 4HSQA 3QBTB 3QDGA 5F7MC 3LQMA 3FCTB 2GQHA 2DMKA 4M6OL 1DQML 3ZYIA 1DBKH 1T1XB 1EO8L 5DTFB 1HKFA 3RUGE 5KBNC 1UENA 1VFBB 3G6JF 9CGTA 3NCJH 1ZS8A 4NT6B 4QXTA 4XVUD 1OTSD 3RWGA 3LEYH 5GRWA 5C70A 3TESA 1ZLUH 4JM4L 2X4RA 4H1LH 4JFOA 4WGWB 4TVSa 1QTYT 1KULA 3DO7A 1QBLH 1P4LA 5DD0H 4C54A 5M94B 4PJIB 2GJZA 1NCCH 3ILQD 5J11B 3TNNA 2BNUB 5CILL 5CUSL 1A4KB 4Y5XA 1Q38A 4OGAC 1OAKH 2AEQL 4UQ2A 4HUVA 1BREA 5D9SB 2GEEA 4XBEL 2CKBB 3W0WB 4HPOL 3LRHA 4YHIB 3L7FB 5GISL 1JHTB 3IJSB 3KXFB 4OZGF 1IAIL 5CD3B 3GM8A 3Q6FA 1LNUA 2R0WL 2WMPA 4NM8H 3V6OA 5F6IB 4HG4J 3FJTA 3MREA 4U6YB 3INUL 1BD2E 4JZJC 3ZTNH 1AR2A 2AKRA 4APQA 1OT1A 4XPBL 3H0TB 3LKOA 4U1NA 2OSLB 5EZLA 2VR9A 3ARFA 1EAPA 5HHPB 1R5VA 4EUPG 1I1AA 2X89A 2BVPB 3PQYA 5E2WL 1GAFH 4NN5B 4PRID 4Y1AE 3KPNB 3HPLA 2R23B 4FZEL 3GSNL 1CF8L 1GGIH 1IGYA 2CKBL 1MFDL 2WNGA 4U1MB 4MAYD 3BSZL 5BV7B 1JJUA 4GW1A 4OLXH 2HVKB 2D9QB 1JP5A 2NZ9C 4UDTB 1TCRB 3T3ME 2QADC 1A1NB 1SBBA 1F00I 2CDEB 4HDIB 1C5DB 3DETD 3W9EB 5I9QC 1TZHA 5FGRA 1KSRA 4J3TA 2GYSA 3WN5C 3B9VA 2W9LA 3WFDL 3WLWD 3Q1SL 4E5XB 2WANA 3ARBA 2NY3B 1MF2L 1ZE3C 2R1WB 5JPNB 1HWHB 1GZQA 3U4BH 4DGYH 1ES0B 4NM4H 4DKEH 2R2EB 1OW0A 2QEJA 2HVJA 2MWCA 5BV7L 3B83A 4OB5H 3BH9A 4LSUH 4IOIB 2IPKA 2E6JA 5I1IH 1OAUH 5F70A 1AQKH 2P49B 4PJGF 2AK4A 4CVXA 1V7NH 4UTAL 1MWAA 1KUMA 5DVLA 3QSKB 4HCRH 4RQQB 2QADB 3DI3B 3BKMH 5EBGA 2EEDA 1HHJB 5FYLE 4WV1C 3PXHA 4XGZA 1J0ZA 2ZKHL 4HKBB 2DI9A 1I3UA 2FEDC 2UWEA 3I3DA 3QXAA 5I9QB 2VQ1B 1XH3B 1OAXL 4B5EA 3KPSD 1S7WB 3O2WL 4PJ9D 3WN5B 5FGCB 4N9GA 2JIXD 3VXRA 4IHOA 4G6ML 4M48H 5SWSA 1KBGH 1JPST 2C5DC 1LEGB 2DWEA 5ETUA 1CU4L 3OXRA 5IMOB 3WCYA 2M26A 5I8CB 1AC0A 2BSRB 3EDFA 3QNXB 4KMTH 3VE0B 1KTKE 2UYLA 3TIEA 3SEPA 3OB8A 1A02N 3GJEB 3MOBH 2QSQA 4I1NB 1H8SA 1MRCH 4J1UB 3FONB 5I66A 5DD6B 5H8DA 3KVQA 3QZWB 1WC7B 4I18C 1CXIA 3SKMB 4AT6B 1OHQA 2YD9A 4U49A 1C1EL 1T22B 5JW4M 4N9OB 1T5XB 1E4XL 4I2XB 1HHHA 5JHDD 4PJBA 3RIFF 3GBNH 3QHFH 3BQUC 2M8XA 3TZVA 2VLRB 1CI5A 1UADC 4Z7UB 4BFGA 2J5LC 1V5JA 2YBRB 1NMCC 1HZHL 2YD6A 4X6BA 3RWFB 4HLZH 2R0LL 4N5EC 4ZUVA 3G5VA 1MH5A 1OF2A 4JLRA 4Y16B 2CIIA 1BEYL 3MBEC 4U05A 1JFQH 1AKJB 3KYNB 1JBJA 4D2NA 2L7JA 3GO1H 5D7SL 4G8FA 5DT1H 4L4VD 1J0HA 1CFBA 4NO5B 3X12B 4JKPL 5L6YH 2EDBA 5FKAA 1XGPA 4PJAF 2LABA 2Y4SA 1I7RA 3B9EA 3D69A 2OK0L 4QWWD 2NXYC 4HWZB 1W72H 3L3HA 1MIEL 1FYTD 1F11B 4PG9B 4RGNB 2AAVA 3NIDF 5ABDE 4PB0H 2O61B 5ILTH 4XPGL 2DTML 4YFDB 4X5WA 4FXKB 3BQUB 4XB8A 1A6AB 2CJUH 3FT3A 1YUHB 1H5BB 1WICA 3GSQB 4ZXBC 3QO1B 4YDVB 2WP3T 3HE6B 3V6ZB 5AG9A 4RMUA 3QJHA 1NMCB 4CAGA 5J3HD 1GJIA 1P84K 4M7LL 3WUZA 4XI5D 4HFWA 1FYHB 3V8CA 5FECA 2X4UB 1KCKA 3GBLA 2YS4A 1YYML 2V5SA 3QQ9C 3NZ8A 4Z8FH 1IGCL 4N1CA 4X0KA 5CP7A 1TTUA 1XGUB 3H3PH 2UVEA 1F3DH 4MD0B 4HMDA 3FQNB 4NZDA 3VXUD 4PJXA 1NBVL 4YX2H 4MA3A 3X11B 1S7VB 2F5AL 4C56D 2I25N 43CAB 4KKCD 4ORZC 2YWYA 1UZ8B 3BW9B 3L1OL 5DJ8B 3BFOA 2HJLA 4OUOA 4MA7L 4EXPX 4BK4A 1ZAGA 3MOAH 2FATL 5GGUB 4U3CA 1PQZA 2MQCA 2LE9A 3NTCH 3WHXA 3UTZB 4MB5A 4OT1H 1GL4B 2X4QB 4L3EE 1DBKL 3QCVH 1GRWA 1TDQA 4ZQKA 1LDSA 4Z6AT 1UH2A 3HUJE 3C60D 3NCJL 4G8GE 2DQGH 4PGBA 3LEYL 3UTQB 4I48B 4KU1A 4F3FA 3TJHC 1I7ZB 4EIGB 2FSEA 1QBLL 3MRDB 1KIRB 5DD0L 4MS8C 4O00A 3R06B 4NC1C 1XIWD 2YA0A 1NCCL 4HUKB 4HPYH 4H5SA 5F89A 5HY9A 4PJBE 4Z0XB 1HK6A 5KSBF 4QRUB 2WIIA 2ARJQ 4M6NH 5DD5H 5JLZA 2H8PB 5FHBH 3M1BB 4NC2B 1VESA 3V5HB 3VXQB 5ICZA 3MGAA 1XZ0B 2PTUA 1T89C 3BISA 1G7IA 2X4OA 2DB8A 2R1YB 2DL9A 3IFLH 1RHFA 4HS3B 4U3HA 1AH1A 5DJYA 4Z7VB 5JORB 5J6HA 3LPGA 4QT5A 5EORH 3QDAA 2PYEA 3CCHB 1U3HA 1C5CL 3QG6A 2XZCH 1JMXA 5DMKA 4JFEB 4YPGB 1WZ1H 2AJXH 1UM4H 1BJ1J 2D7TH 4NQDB 4LLUB 4Q74A 5EIQA 1D6VH 2FECI 1A3RH 4WFHD 1ZHBB 1GGIL 3ABZA 5CGTA 3MV7E 3MODL 1MCWM 2HFFA 4GKOA 4X6FA 5E1AB 3MCKA 1M05B 3AAZA 3BKJL 4RX4D 1OP3H 4DFIA 4E41A 2KBGA 5T5NF 4ELKA 1K8DB 2ATKB 3QWOB 5CBEB 2C9AA 3CZJA 4PBVC 3U30C 3PJSA 2QSTA 3UTTB 3WDIA 4ZFGL 1NCWH 3CNKA 4PRPD 2P8MB 2LTQB 1II4E 1I1RA 3MNZA 1VACB 4HIEB 5T1KB 2CMRL 2BHYA 4RFEA 2DM2A 2OJEA 3FQTB 2FJHA 4LLMB 3ISWA 3G6JB 3TV3H 4LSQH 2VQTA 2QTEA 1RUAL 4HWNA 3W9DB 1BAFL 4HIXH 3U4BL 2ZUYA 4DKEL 5C0CB 1JGUH 4KZEH 1HDMB 3SDXF 4P2RD 1UYWH 5A2JH 4OB5L 3RIAK 3F62A 4LSUL 4Y19B 5C08A 5I1IL 4O4YH 4OZHE 4B7LA 5DSCA 1OAUL 2XG5A 1AQKL 4AZ8A 4QRPD 3UC0H 4Z77B 5C92A 1V7NL 4HCRL 2P43B 2LQRA 4PLKC 5CJQH 1VFAA 3BKML 4LSTH 4OZGB 3KWWB 2HLAB 3U30B 1FHGA 3V7AG 1BBJB 3T4AA 1KCVH 5CJXC 3SHSA 5EOTA 4KK9C 3MRBB 2Q7YB 1P1ZB 4MXQD 4KUCF 2QHRH 3MXWH 4GW4B 5I1DB 2WWMC 4LLQA 4M6MH 3LKRA 4R8WL 5GRYA 4LAJH 5I19H 4IMLB 2B2XH 3MRLA 4HMCA 2X4PB 4M48L 5ANMB 3VG0H 4EZMA 2R8SH 5BZWB 4P3WA 3V7AE 4LPUA 4LOUC 4ZUTB 3MJ8A 4LF3A 4OD2B 4WFFE 4HBQA 5J1AA 1U2CA 3RA7H 4KMTL 4PV8A 5E70A 4EN3D 4ODTH 5MEOB 1CZ8H 3MOBL 3QIUD 4JGMA 8FABA 5EO9B 1CCZA 3OKMB 1MRCL 1UB6A 3LZFH 5FA4B 4FQQB 4O5LH 4XHQA 4Q9RH 3EYUH 1D3CA 2HKFH 1S9VB 2P24B 5KS9A 3S98A 1PZ5A 3ESUF 3T1FB 1C5BH 5AZEL 2Y7QA 1GZPB 4JQVA 3PIQB 4YH6A 3RL1B 5C9KA 3ZKMD 1CTOA 1W72B 5LXGH 4N0RA 3FL7A 3OTTA 3RDTC 5DJ2B 2X9WA 4HV8A 3ULVD 3GBNL 1MCWW 4JREB 2NY4D 3UPRB 1LP9A 2Q76A 4O9HH 5L8JB 5B4MD 3E6HA 2QQNH 1U91B 3IXAB 3VXSB 3W11D 1MUJA 5MENA 3KLAA 1DE4A 3LMJH 4PGDB 5CSGA 3T04D 3MRFB 3VH8A 1JZ5A 3TFKD 4PJCA 1KNOA 1JFQL 1YJDL 1IM9D 4XCYA 4NUJA 3GO1L 5TPWH 3O8XC 1DBBL 1HI6B 5DT1L 4PJGB 4F7MB 3HZMB 3O0RL 1F45A 5L6YL 4WWKB 1CVRA 2E3VA 5IB2B 5EN2B 3FO1B 5A16B 3QP3A 1W72L 5E6IC 3RWEA 3RZCC 3C5ZA 2HN7A 4OZFG 3HG1A 3OHXB 2F5BH 3MA7B 4JY4A 5KN5A 4PB0L 1F97A 1ZANH 4P46D 5ILTL 1RFDH 4NO3A 4QRRE 1DN0A 1G0XA 4YBHA 2CJUL 3IB4A 3BZFA 4P5TC 5C9JA 4Y2DC 3H3BC 1QLEH 3RUGF 1U93B 5C0DB 5DS8A 2AXGB 4RAVB 4JRYB 4PV9A 2IQAB 3JVGC 4OV6F 1V3KA 4KI5D 4UBDD 1YY8B 4Z8FL 5BMFH 4DKDC 4GRWE 1ZT4B 3H3PL 2CRIA 1M71A 1D7FA 5D2LE 4R7DA 1VHPA 2IAND 1CICC 3NPSB 1MJ7H 4MA1C 4YX2L 1ZHLA 5DRNB 1FFPA 4KPHH 3VD4A 1JNJA 1DQLH 1XAUA 3ARED 3P0GB 5E9DB 4XX1G 3BP6B 3RZCB 1T04B 2IPTH 2XWJA 2GUOA 4RFNB 3L5IA 1N0LA 1I3RA 1DQQB 3T0EC 5IVZA 1ORQA 1J8KA 4PBWD 4JKWA 1UCBH 2NY6D 3MOAL 4PJ5A 1A22B 3OGCA 1NBZA 2R69H 3NTCL 4YUEH 1IZKA 3MRQB 1DEDA 4OT1L 5EIVA 1J8HA 2OX5A 3QCVL 4L8SC 3WFHB 3TEUA 3EUUA 5D7LE 3WS6C 5T1DH 2V5YA 3CDGA 2ADJB 2DM7A 4YHPB 1XF2B 5E95B 4V2CB 5HJ3B 2AJSH 5MEQB 2AJZA 4JG0L 3TPKA 5CD5C 2Q8AH 1UEYA 4PJAB 4NFCA 1X5XA 1QR4A 3F7VB 4JZNA 4NIKB 1G7PB 2VYRE 4HPYL 4MVBC 1NC4D 3T3MF 5TE4L 4LSVH 4H88H 5D7KE 2UZIH 5I1LA 1QPXA 4M6NL 4IRZL 1WAAA 4I9WE 4JM2F 1J05B 3TT1H 3V0AC 4EI5C 5E6YA 5EU4B 1YECH 4OGAD 4I0KA 3IFLL 5SWZD 1IC1A 1YMHA 2DWDB 2HJKB 3DVGB 2VDMH 4AENA 1QKZH 5EORL 3B4NA 1RI8A 5K93A 3RVXC 2XZCL 3STZA 1BFSA 5I76B 3O2DA 4CU7A 2YPKB 1JNHA 3CFDB 1WZ1L 3P77A 4ISVA 1JGDA 1UM4L 2D7TL 2DQEH 4QXUH 5TQ2H 5KSAC 1BOGB 2VZ1A 5A3IC 1D6VL 3SBWC 1A3RL 3IF1A 4X4MA 5IQ7H 3D39B 1BFTA 1YYLL 3JTSA 2DMCA 4ZD3H 3B43A 1VPOH 3FOMA 1KJMB 2DKMA 2VAJA 5A40E 3UJTL 4C57C 1TIUA 1IGMH 1PVHA 5HSFA 4WUKH 2F54A 5J57B 5T3ZL 3GB7A 3CXHK 3KPPA 4RIRB 4QHKI 1OWRM 1NCWL 2NZ9D 3MLTB 5C07B 2QADD 4QCIA 4NCC2 2EDTA 3VFGH 5C0AD 2ZCHH 2CK0H 4PPTA 4MQXC 2JCCE 1L4IA 1JN6A 3D1MC 3X3GH 3CFBA 5B8CC 2EDNA 1A9BB 1RMFH 4LSQL 3TV3L 1J0KA 5I16B 4LP4A 4X98B 4W4NA 4HIXL 4CN1A 1JGUL 4KZEL 2AJUH 4M61A 3QUZC 3LKSA 2VITA 1UYWL 3T2NH 1Z9LA 2F53B 3MV8A 1RQ5A 4PJDB 4YEFA 1WUNT 4BSWB 3OKNA 3WJLA 5EO1A 2MFNA 4OUUB 4Z95H 3RIAF 3UC0L 1BQUA 5HYJE 2H1PL 4ERSH 1ETZB 3MRPA 1EK3A 1NMBH 4F7CB 1J8HE 2C26A 4W6YB 2X6MA 4OCWH 1TQCC 2FGZA 5KG9B 4LU5H 5IHZA 4YHYB 5IEHA 3ULUH 2DF3A 4WENB 1KCVL 1EBPA 3SGJA 3W39B 1F6LL 5F9WC 4NYLB 5IVXA 1ED3A 5EU3B 4ZAKC 1G7MB 3BPOC 5IIEB 2QHRL 4YXLH 1D5BB 3MXWL 3X14A 4PRHE 2D7MA 2I9LA 4M6ML 2FEDD 4HGWA 4NRXA 5I19L 2B2XL 1GC1C 3KPMB 1T6WA 4FQIH 2C4XA 2EXYC 3J7HA 3GNML 3VG0L 2R2BB 2R8SL 4OFPA 4P2OC 4MD5B 2VSCA 3PHOB 5D2NE 1VEOA 2WINA 3QUZB 2X70A 3LN4B 4N5UA 3DURA 5IBUB 3RA7L 5HYSG 4ODTL 1VADB 1CZ8L 5IFHH 5H35B 4EDXA 3SDDA 2I9TA 1EEUA 3QXDB 4NQEE 3FAXA 3LRSB 5DEFB 3KPRE 2C4FU 5GSRB 4FQ1H 1EGJA 3LZFL 1ZLSH 4Q9RL 1UA6H 4O5LL 2VUYA 3MNVA 3HRZB 5D7IE 3EYUL 4JANA 4ONGH 1IAKB 2HKFL 2HFTA 5GSVA 1XR9A 3IAPA 5EOQL 5DQ9A 1TVBB 4K3DH 1EIBA 1RZIB 1G6RH 1A6TA 2BSSA 1F5WA 2ICWJ 5LXGL 5BRZB 2JB5L 5K33A 3IGAA 4NQCB 1PKQE 4BQ6A 4L4JA 1UGNA 3RTQB 4O9HL 3LY6A 3DPBA 1J1OH 2QQNL 4TUJA 3WIFB 5CFHA 1A4JB 3BQUD 4G43A 2VABA 3WLBA 4NWTH 3TCLB 3LMJL 3SDXB 2OZ4H 3GMOB 4IMKC 4S1RH 2KQNA 4I0PA 4X6CE 3LQAH 3FO2B 4LKXA 3C08H 5KSUB 3TC9A 5TPWL 3AM8A 3HE7B 1N2RA 4HT1H 3MBED 2DQCH 4OF6A 5TDNA 1KIPA 4CVZA 5CINH 2VJXA 3UZVB 1YPZA 4WO4B 1UH3A 3WS3A 3H7LA 4PREB 2GCYA 5D1XC 2IH3A 1R0AH 5FGBC 1HH9A 3NIGE 5LKNA 4A2LA 1S9XB 4HGKC 2F5BL 2GHWB 1EHLH 2NXYD 4BQCA 1QA9A 1H8OA 3FT4A 3VMNA 4DCQB 2DBLH 3TH2T 4X8JA 1MI5D 1RFDL 5DA0B 2VKWA 1RJYA 2P8PA 3H9SD 4QOKA 4Z7NE 4U2ZA 1WBYA 3E2HB 3IDNA 1NCBH 1QLEL 1X6LA 3HUJF 4H8WC 5FF6A 2XTJC 5B3JE 1OGAD 1JF6A 2OBGA 5FK9B 1XT5A 1SYSB 4XNMB 1F3JB 5HHOB 2EIDA 4Y8AA 4ZXBD 1IARB 3A6CH 3S37H 2Y1VA 4ZOCA 2D0HA 4C55A 4PJ8B 3TN0B 4PGZA 2NX5B 4W70A 5ADPH 3C9NB 4JY5H 4KV5E 2Z31A 3FTGA 4JGJA 1U8PA 1MJ7L 4PJBF 1YC7A 1HSAB 1AXSB 3QQ9D 5GS0H 3FRUA 4KPHL 1ONQA 1DQLL 3JWOH 4YC2B 2W9EH 1MAML 4LMQI 3VFUB 1GVIA 3GIVB 2IPTL 1ZTXH 5EA0L 1S5IH 4M00A 1XGQA 1KTDB 1G7LA 4FQXC 1MCNA 1R3KB 1ZGLB 1P5VA 2O5ZH 3UTSA 3KJ6H 4JFQA 4YHKH 1Z2KA 1A6ZB 1UCBL 4PLNC 4HUNB 1A6WH 2DICA 4CGTA 2R69L 5F3BA 4YUEL 2GTWA 3LH2H 3SY0A 2BSED 3O6FA 4U6HB 4PGEA 1ZMYA 4G6AC 5T1DL 4FQLH 2BERA 3BHBB 2A6KA 4P2QB 2P46B 2DQIH 2A1WH 2AJSL 1D5XB 4HK0B 2E9BA 1JUFA 3K81A 1SJHB 4QHNB 2Q8AL 1G7QB 2PYFA 4DN3H 2ZP0T 2K7QA 2VDRH 4KZDH 3MUY1 2EIZA 3V4UH 1NFDE 1GOGA 3EIFA 3GJFK 3TJHD 5DVNA 1JE6A 1NMAH 4G6JH 4H88L 4LSVL 3N1PC 2UZIL 4MS8D 4NQDD 1JHKH 2J3SA 2DI7A 1YEHH 1I8MA 1R5WB 3BN9C 2Q6WB 3TT1L 3VRIA 4EDWL 4ZG1A 3HR5A 4IIQA 1DN2A 1JV5A 1YECL 2JJVA 3SDCC 5GGSB 5IB1A 2VDML 1DZBA 3RUGB 2Z93A 1QKZL 4OCXH 1VDGA 2E7BA 1OOAA 2YD7A 5D5MA 1YQVH 1GGBH 1FNGA 5DJCB 2ZUXA 4HH9A 4OZIB 4FHBD 4H26A 1CD1B 3HAEA 1YPZE 4ZYKA 3B9AA 5JR1H 1HKLH 5IR1B 1N7MH 5CBAB 4HUMB 1HXMA 4OZHF 2DQEL 5L8KB 4HKZB 3L3DB 4QXUL 5TQ2L 5GGVH 5ERWA 4URTB 3LQZB 1JGVH 1L0XA 5ESQB 4HG4K 4MX7A 1W0YT 3U4EB 4ZD3L 2BRRL 2H9GB 1VPOL 5TQ0H 1O7VA 2YA1A 1IGML 4WUKL 1BD2B 4Y19D 1ZXQA 3SDCB 4IRJC 4NPYA 5L8LB 3VI4E 4JPKH 3P0YH 2EICA 2YSSA 2KZWA 4DKAA 4NQXB 1ZWIA 5EUOB 2AJ3B 3VFGL 2ZCHL 2KL6A 3NCBB 2CK0L 4HUWB 5GPRA 2VB5A 3X3GL 3SE8H 1RMFL 1NUDA 2W65A 4FFZH 4M7KL 1QD0A 3TBWA 3SO3C 4OD1H 1BHGA 2ORBH 2VZSA 2AJUL 4X6DA 3LEXA 1K4DB 3O3BB 3T2NL 1AGEB 3PXJA 3UTSE 1M6OB 4ZOAA 1NCUA 4X7TA 3LB6D 5IB3B 1DUZA 3I02A 2LU7A 4Z95L 3ETBF 1RIUH 1I8KB 2EDWA 3RP1A 5FOBA 1NMBL 5BZDB 3VJ6B 1UC6A 4OCWL 5TFSH 4LU5L 5GRJH 1KIUA 3UMTA 4PJFA 4PLKD 4WUUD 1BZ9A 4LKCB 3QWQB 4NNPH 1KLFA 3HZYA 1BIIA 4JDVB 4D3CH 4YXLL 3L7EA 2NTSP 1G6RB 3LD8B 5I75B 1G7HA 2CLVB 4KK9D 4GAYB 5DUBA 3WJJA 2FJGB 4FQIL 2AVGA 3IDMA 2VXQH 3RWIA 1KJVA 4DOHB 1NJ9A 2WWMD 1NDGA 4RSVA 1H3XA 2AGJH 4W4OA 1PDKA 3CK0H 3EDEA 1CIDA 1MFCH 4CRPA 1UG9A 2CDGB 3V6OC 3RFZC 4L9DA 4G6FD 1MY7A 4LOUD 5IFHL 5EZIH 5BW7A 2XFXA 3NCYS 1U8KB 4FQ1L 2PW1A 4EIZC 3ARFC 1ZLSL 1IEAB 1UA6L 5C09D 1ZS8B 1FO0A 3GSXB 5LWYH 1IC5H 3IFNH 4ONGL 1E6OL 3K46A 5DD3H 1VEPA 3UO1H 1QSEE 4KRPB 1CDGA 4WW2F 4K3DL 1P4LB 3O9WA 1G6RL 4NO0A 2GJZB 2P5EA 4Y5XB 1WT5A 3GMQB 4BQ8A 3T3PE 4P5KB 1CXKA 1J1OL 3RDTD 5IMLA 2Z4QB 3WUWB 1I9IH 3D3VE 3IDXH 2QBWA 4GRWF 3KHOA 5JPMA 5ENWB 5D2LF 1DUYA 4LP5A 3K1DA 3G6AA 5FYLL 1B90A 2OZ4L 3BYYA 4KQ3H 5GJSH 4HKXB 3LQAL 2OYPA 3C08L 2ARWA 3TIDB 4PTUA 1DSFH 2WUBL 2AKRB 4HC1A 4HJGB 4APQB 1WBZA 1A7OL 3DXAA 1G9MC 3GGWA 2V17H 3QI9B 4HT1L 2DQCL 3CFIC 3EYSH 1RK0A 1MCEA 3ARFB 3O8XD 1I1AB 5CINL 1OTTC 5H37H 4M6AA 3ARBC 3NACH 1X6NA 4NZJA 5DJDA 1R0AL 2R15A 1OW0C 4Y4HA 1KPVA 1ND0A 5BVPH 1WIOA 1PSKH 3HPLB 2DQHH 1EHLL 5E9DD 1JGEA 3V95A 2GFBA 5E6ID 2DBLL 3RZCD 1MHPH 3EFFA 1OSPL 1UXSA 1HWGB 3K8KA 4GW1B 1NCBL 3OR7A 4BA8A 5CCKH 1HHKB 4J4PA 3OX8B 4R96A 3P4OA 3HI1A 3O4LE 1CFNA 4MMZC 3CFKA 4RDQG 4P5TD 4Y2DD 4J12A 3IU3B 1I8IA 3A6CL 4JPVL 3S37L 3VFVA 2VDNH 5HHNB 3ZDZE 3GSRB 1KTLA 1GH7A 2DJ4A 1VFMA 2EDOA 5DVKA 1KCLA 1TZHB 5GS1A 1BOYA 5ADPL 4JY5L 1MVUA 3GMMA 2R0KH 3QO0B 5GS0L 3QUXA 1H3PH 3JWOL 1A7BA 2W9EL 1E0OB 1MY5A 1CICD 4RAHA 5EUKA 4AL8H 1TJHH 1ZTXL 4U1SA 4XVJL 4K94H 2WLYA 3E0GA 4E42A 4F2MA 1LO3H 3U7YH 2O5ZL 4YHKL 7CGTA 1VFOA 1NLDH 3BH9B 2LAAA 4UOW1 1A6WL 4JFFA 4NNYA 3T0ED 4BQ9A 4DEPB 1CGWA 3RVTC 3LH2L 3GHBL 4GT7A 1PX4A 3F8UB 5HGBA 1PBYA 3G08A 5DJ6B 2EKSA 1IEHA 3WXWH 4XGZB 3P0VH 4K8RH 4FQLL 2YN5A 4QRQA 5D1ZA 4N0UE 5KVEH 2DQIL 4NQSB 3BPCA 4X99A 2A1WL 4XP5H 4DUXA 1RZKL 1UB5A 3DUUB 4DN3L 2VDRL 1S7XB 3VWKA 5C0RH 4KZDL 2QQKH 4N9GB 3V4UL 5E8NA 4IHOB 3O45B 4M93B 1J1PH 4KKNA 1VKXA 3BAEH 3DBXA 2VLKA 3FN9A 5CD5D 3BXNA 3GSUA 1U58B 2DWEB 4HFUH 1NMAL 3OXRB 4G6JL 2OR9L 4P4KB 1OLZA 2YD3A 4I3GA 1JHKL 1YEHL 4Y7MA 4MVBD 1EFXD 5JW4R 2UYLB 3TIEB 3MNWA 4XBGA 4L3EB 4HF5L 4GRWH 4YHLH 2JCCF 1IM3A 5L7XH 4OCXL 4G8GB 4LDOB 3NGBC 4LVNC 4EI5D 4NKOB 5I66B 4U7SA 2VXTH 4POYA 3BMWA 4GG8A 4JDTH 1YQVL 1GGBL 1NL0H 2OTUA 4QXWA 4RWHA 4U1GC 4YEEA 5C07D 4GG6E 2CSPA 3FB6B 2YD1A 5CAYB 3RVXD 4R2GB 5JR1L 1HH6B 5C86A 4CN4A 3T77B 2VAAA 4PJBB 1AGCB 2ZOKA 3IFOA 4G9DA 4M9OA 3PGCA 5GGVL 5ADOH 1ZEAH 4FQCH 2PXYA 3TZVB 1JGVL 4KI1A 4WHTA 3RWHA 3OJMB 2G60H 1RJLB 3IRPX 1MJUH 5KSAD 4KMQA 1X7QB 4UU9A 5A3ID 3GSOA 1MH5B 5TQ0L 4LNRB 4KY1H 2CIIB 4M7ZB 1CL7I 1HIML 3O4OC 1R5IB 4I77H 2VZVA 3GDBA 2H45A 1N5YH 4HXAL 3I9GH 1HHGA 4JPKL 5TE6H 5J13C 4YHOL 1L9MA 5FKAB 4LVNB 4ZSOE 1I7RB 4CMHB 5L9DH 3RWJA 3SGDI 1ZGLP 1U92A 4MNGE 1DCLA 1SJXA 3OKLA 2A9MH 2ATPB 4U1GB 3SE8L 4KRMB 1G9NH 1NGWA 2YRLA 4FFZL 1DJSA 3QUYB 4MQXD 3MV7B 4OD1L 2MNUA 2ORBL 2FWOA 5EIIA 2WWKT 3D18A 2D2OA 3QJHB 4LVHB 4PJHA 3PWPA 5D7IF 1V3LA 3VFOB 3QUZD 5JHLH 1RIUL 1CE1H 4X83A 3BPLC 2HH0H 2Y72A 4O2CB 5IQ9B 3QPQC 4X0KB 4LCWD 3MV9E 2FR4A 5DMGC 4RISH 5TFSL 5HI5C 4ENEC 4POZC 4HMEA 5C0IB 5GRJL 5GRUH 2IFGA 2ZUSA 2ZCKH 4P57A 3DUSB 2HT2C 1GGYA 4D3CL 1J11A 4PR5A 2DIAA 1VB9A 3VMPA 4BSVB 5L2JB 1YNTA 2Q86A 4HWBA 4NCDA 4NC0B 2ICWA 4PD4J 3QDJA 4AG4H 5HHME 4L9LB 4ZAKD 4X6CF 4C59B 2VXQL 2ZUWA 1MJ8H 1ADQH 2Y6SC 1Q9KB 4P4RB 5DDHB 3BP4A 2EDQA 4NRZB 1MFCL 4QYOA 1X5GA 1PQZB 2EXYD 3PDGA 1E4KA 3CFEA 3GJFH 3VMOA 2AV7B 3WHXB 3O11A 5M7QA 1AO7E 3AB0C 2YEZA 4JN1H 2P5WA 3BYTA 3K8LA 5LGJA 2EDJA 5EZIL 1U3HC 1VFUA 2J1KA 4MD4A 3NIGF 1RHHB 2Z92A 4D0BB 5LWYL 3BP7A 1CS6A 3IFNL 2E9WA 5C0BA 3V5KB 5DD3L 3VXPA 3UO1L 1MJJB 5JIIA 2NY5H 2Y36H 1YMME 5DQDH 3QA3B 4Z7NF 5T1LB 2YPLE 1LILA 3QFJA 3IVKB 5B3JF 5FDWB 2YUVA 4NZTH 5HY9B 3SKJH 4XNXH 1RJCA 2WIIB 5JLZB 3OB0K 5C2BL 3MRRA 3FB7A 1NH6A 1I9IL 1G7IB 2GY7B 2X4OB 1F3DJ 1KTRL 3QISA 1ZHNB 1F3RB 4KV5F 5LAXA 4U1LB 4KQ3L 5GJSL 3MRGA 2OTWB 3VA2C 2FYYA 4TVPD 5BS0D 4K8RC 4PJ7A 3Q5OA 1P5UA 4U0RC 2D03H 3EYSL 3QQ3A 3DMMA 3HZVA 3RVUC 2MTPA 4M4RA 2VDKH 2DLEA 5IBLC 3V0VA 5KZCB 3GKWH 5BQ7A 3NACL 3BD4A 2X41A 5I30L 3VU2A 4Z76B 1FZMA 2H2PC 4Z78A 5BVPL 1PSKL 1ZA3A 3ZDXE 2DQHL 4LAQH 1X5HA 1JYNA 1IAIM 5D1XD 2YUXA 2E7HA 1MHPL 4JFYB 1TVHB 1T1XA 2NW2A 2BY2A 4XVSH 5JNYB 2HFFB 2Q8BL 3VDCA 4KK6C 4IOFC 2APXA 2RFXA 2CGRL 2W0PA 5CCKL 4E41B 4NT6A 5D93C 1NQBA 2AW2A 5CWSB 4Q6IC 2ERJC 5KVDH 3BEWB 2XTJD 2VDNL 4PJIA 5AYUL 1NFDF 3G5ZB 2VL5A 5HGHA 2ESVE 3ARSA 3ZE1E 2W0FB 3IDYC 3MNZB 2DKUA 1K3ZA 1A4KA 3PDDA 4U0RB 4GMSH 2OJEB 5DO2C 1H3PL 5HHQA 3GSNA 5D9SA 3RVVC 2CKBA 4YHIA 1KB9J 3G04A 3IJSA 3HMXA 3KXFA 2X1PA 5CD3A 4AL8L 4QRRB 1TJHL 4WW2B 4LLDA 3HB3C 4K94L 3RWDA 5A1AA 2QQLL 1CE6B 3MMEB 1LO3L 3QB7C 2E27H 3S36X 3U7YL 4U6YA 3DHMA 1NLDL 5HVFB 1OSZB 1FQ9C 1TENA 3D2UD 3H0TA 4FQXD 2M2DA 1KGCD 2OSLA 4NSKA 1FRGL 4GS7B 4Q0XH 5AAWA 3SJVD 1PJ9A 2FHFA 1UZ6E 4GRWB 2EO1A 2IBGA 4L8BB 3WXWL 5GHWH 3P0VL 4K55A 4AK1A 2RCSL 3T4AB 3KPNA 5KVEL 1KXVC 4JQVC 2R23A 4XP5L 5EOTB 3C6LB 1CGVA 2DIBA 3OF6D 2FGWH 5LQBH 4G6AD 4LPYA 4HK3J 2CR6A 4LLQB 3LKRB 2QQKL 4WFED 3TJEL 1UH4A 5IB5B 3BAEL 4UDTA 1TCRA 2BNRE 4RA0C 4HFUL 1RULL 1EVTC 3MJ8B 3DV6A 3IDUA 2APBA 2CDEA 5I1JH 4PBXA 2IAMB 4UI2A 3VI4F 5J1AB 4R0LC 4UV4H 3WE6A 3K1KC 4WJ5A 3W9EA 3I75B 3NFPB 4PRAA 8FABB 4YHLL 3BN9D 4M5YH 5D7LB 4XNUH 3MC0A 5L7XL 4GOSA 1UB6B 4JRXA 4P48A 3K0WA 3SDCD 4E5XA 2VXTL 1KFAH 1R3LB 5JPNA 3S35H 1D5IH 1ES0A 4JDTL 2R2EA 3VG9C 3C5ZC 1NL0L 5K9OB 3DRTA 1T03H 1P7KB 2WQRA 3ULUD 2DQUH 4BM7A 4HV8B 3LS4H 1E6JH 2VLJE 1WFNA 1ZEAL 3DROB 5ADOL 1LP9B 4FQCL 5I0ZA 1REIA 3E6HB 4RQQA 2CQVA 4P2YA 1HHJA 2G60L 1MJUL 3KLAB 1MREH 4HKBA 3OMZA 2IMNA 1UJTA 4KY1L 1JZ7A 4I77L 4P9HH 1XH3A 1Q72H 2XPGA 3FFDB 3GFUA 2W38A 1S7WA 3OKOB 1HHIB 3OR6A 5TE6L 1VGEH 2BNQD 5JDSB 5LVEA 3MV11 4IRJD 5L9DL 1LEGA 2BDNH 1HOCB 5IMOA 4LDEB 4PTTA 2NY5C 2GJ6A 1IKFH 4U0QB 5I8CA 2R4RH 3GSVA 1G9NL 2CUMA 3GMLA 4JCMA 1TJIH 3QNXA 1FVDB 3U2SB 4NO3B 3VH8G 1DN0B 3EAKA 2QSCH 4YE4H 4J3OC 3CC5A 3G9VA 4J1UA 4XCEB 2GITA 4ZDHB 3MFFA 5DD6A 3QZWA 4PV9B 4OLZH 1WC7A 3QNZB 1S7QA 5JHLL 2E6QA 2VR5A 1CE1L 3QDGD 2HH0L 5F9AC 5EFIB 1Y0LB 1EEYA 4NP4H 4XWGH 3B5GA 4XAKD 3DECA 1EZVY 4UAOC 2JCCB 1QRNE 5IHLB 5GRUL 1NKRA 5INDB 1P69B 3H9ZA 4HUXB 1FFPB 3T3PF 5CS7A 3QDME 4FG6C 2UZYB 4Z7UA 3REWA 1FL3B 3RWFA 4KRPD 2GUOB 1FLTX 2DJSA 4Y16A 4AG4L 1AKJA 4X4YA 3AS3A 3K7UA 1ORQB 5J8OA 4FTVE 2QSVA 1MJ8L 1ADQL 2DLTA 4PJ5B 1UKQA 4NO5A 4G8IB 5HYJB 1MPAH 5E08H 4J7RA 1PX3A 1X5FA 1U8QA 1J8HB 1INEH 2W9DH 4DWHA 4HWZA 4LCIH 1F11A 4PG9A 2EEBA 2BXYA 4JFDA 1L7TH 4APQD 2O61A 2OP4L 3QEQA 4PRHB 4PYHA 1IT9H 4FXKA 2C3HA 3TCXA 3ARFD 2Y36L 1A6AA 5DQDL 4JFPB 1Z0NA 2X89D 1H5BA 3E1F1 3BZEA 3HMWH 2XQYG 3HE6A 3PQYD 1I3GH 4NZTL 3RWCA 3VXME 4N0YH 5D2NB 2I60H 4XNXL 5I1LB 1JZ4A 5E6ZA 1FFQA 2X4UA 3F58H 3ZDZF 1XGUA 4MD0A 2C1OA 4LCYB 3FQNA 1OM3H 4NQEB 3KPRB 2IF7A 5T3XD 3KGRA 5I8EB 4AENB 3X11A 4H1LA 1S7VA 2V7NA 5DK2B 4LCCB 4WIQA 4RDQF 43CAA 4GMTH 4YGVA 3BW9A 1QSFA 2ICWI 5L2KE 3V0WH 1CT8B 2VDKL 3GKWL 2JJTA 1X5KA 2C4FT 1JGDB 1PKQB 1RUMH 5GGUA 1BJ1H 4DZ8B 1J0YA 4KDVA 4HJ0C 2VISB 2X4SB 4LAQL 1OTTD 1K2DB 4N1EA 5F9JB 4GLRI 1E4JA 3ARBD 3UTZA 3PUCA 4MJ4A 3WDJA 4OI7A 3MUZ1 5ALCH 4HQQH 3JTSB 5F44A 2X4QA 1K8IB 1EAJA 4XVSL 3WJLC 3BGMB 2V2WB 3FOMB 4X6CB 2C7UB 2EYSB 3UTQA 2AK4D 4YFLI 4G9FE 1FPTH 3MRDA 2NYYC 3R06A 1S78C 4LGPB 4L3CA 3NOIA 4GMSL 4Z0XA 3BOVA 1CDUA 1JN6B 3TWCH 1S7SA 4QRUA 3KPTA 4WI3A 1IQWL 1JMZA 2H8PA 4MNQE 3M1BA 5DHXB 5B3NA 3V5HA 4BK5A 3VXQA 5JZ7C 2DJUA 1FGNH 1CGYA 1GGTA 5F1OB 2KQMA 2R1YA 2W1NA 4ZO9A 4HS3A 3VXRD 4M61B 3MUHL 5FEBA 2HLFC 5SWSD 4NFBA 4TPRH 5IK3A 4EBQH 4XP9H 3OKNB 4PY8J 5EO1B 5AYQA 3SDDC 2QKIB 3QIWB 1YZZA 5SV4A 4JFEA 1JPTL 4Q0XL 1Y6MR 1RURH 4GG6F 2COQA 1MVFA 5A43C 3MRPB 2J7LA 1SBSH 3GHEH 5GHWL 2YRPA 5ECJE 5HYIA 3S97C 3RVTD 2A0LC 4LLUA 2OL3A 2XY1A 2F19H 1FSKB 5IVXB 1ED3B 1DDHB 5LQBL 1ERNA 1IAII 3S5LB 4HGWB 4TULH 3ZL4L 3O2VH 3QEGH 1M05A 4CVUA 3B2VH 5TDOA 4O02H 5EU6A 1K8DA 1IEBA 4HCRA 3UTTA 3DURB 2XWTA 3THML 3SKOB 1NUNB 3BRDA 1EEZB 4I0PC 5IKCA 4UV4L 4KQ4H 4JHWH 5CJ8A 3AM8C 1BWWA 5HGAB 4N0FA 5ACLA 5T1KA 1VACA 4HIEA 2I9TB 3OB0H 4M5YL 1DEEA 1FH5H 4PB9H 4XNUL 4XNZC 3FQTA 1K85A 1MFAH 4LLMA 3G6JA 4EVNB 3WO3B 4M02A 3W9DA 3MNVB 4R9HA 3KLSA 1F90H 1KFAL 4JANB 5F9OH 3S35L 12E8H 1D5IL 1MQKL 2MQ0A 5GSVB 5C0CA 3P4NB 3H6JA 4OIIH 1T03L 3MLSH 1DLFH 1HDMA 1QSFE 4YBLB 5J06A 4D9QE 1DQDH 1YN7B 2DQUL 3F12A 3GI9H 3BZ4B 1JCKA 3LS4L 1E6JL 4U1HA 4Z77A 4JCLA 2F74A 1XR8B 2X1QA 2N4IA 3W5MA 4OZGA 4TUJB 5F7HA 1DFBH 4NBXB 4KKAC 4G43B 1MREL 1RU9L 3JWDC 1BBJA 1EUTA 2DYPD 1DVFC 4P9HL 1EHXA 3MRBA 2Q7YA 1JYVA 2WSKA 5IVNA 2HG5A 3OAYK 1FAIH 1X3DA 1N2RB 1NDMB 5EU5B 4CU6A 1JNNH 5I1DA 2Z31C 1T0NA 5L88H 1MCFA 1VGEL 4IMLA 5D96C 5ID0B 1IKNA 4R97B 5FAAA 1AJ7H 4CVZB 5ELIA 1RJZB 1YPZB 5K9JH 2BRQA 2BDNL 4LGRB 5BZWA 3OKKB 3TGXA 2GCYB 2CUIA 3KNBB 2IH3B 2Q3ZA 4ZUTA 1IKFL 1X5ZA 2YPLD 4ORGA 1U8HB 2WV3A 2D7NA 2R4RL 1TJIL 3PWLB 5I71B 4S1QH 1B0RB 5MEOA 3FT4B 4XVUC 3KLDA 4QOKB 5FYKD 5D6CB 1ZSDB 2QSCL 3Q5TA 4YE4L 3OKMA 2XN9D 2WBKA 2FHBA 4OD3H 2GTZA 4JZOA 5FA4A 1RZJC 3O6FC 5ESAA 4OLZL 4PRBB 3BX7C 1S9VA 2P24A 4HC1H 4HAFA 1MHCA 2NY7H 1CGUA 3PIQA 4NP4L 2F8VA 4JFHE 1W72A 1F02I 2Z35A 5J0BA 4HK3N 2MHAB 2VMFA 3JV5A 3FKUS 3EYOB 4QHMB 3QPQD 4MQSB 3UPRA 3FQXB 3ARWA 5CEZD 5DMGD 2KZ1B 5HI5D 1U91A 3IXAA 4ENED 4POZD 3NH7H 2PUQT 1MNUL 1R3JB 3R0NA 2J4WH 4XCCL 3EO1B 1OGTB 1G7LB 4IRSC 3RHWK 2HT2D 1JPGA 1KENH 4GUPA 3JV4B 2BVYA 1EZVX 3UTSB 4QTHB 4JFQB 1U0QA 2AXJA 5EU6E 4YHZH 3OKEB 4IIQC 2YD2A 1I85A 3BUTA 2YK1H 3KYOB 4F7MA 3D25A 3HZMA 3SGEI 1MPAL 1E4XI 3Q6GL 2FL5B 2OLDA 2GTWB 3QUKA 3SY0B 5E08L 4WWKA 2Y6SD 3BVNB 3JBG7 4PGEB 5HDQH 2W9DL 1M7IA 4RBPK 3FO1A 5EN2A 5A16A 5IB2A 5ISZE 4LCIL 1X4XA 3DSFH 4MCYA 5DHYB 1AR1C 5F72S 2Z91B 2A6KB 3EJZC 1L7TL 3MA7A 3MROB 4M4PA 3ZDXF 1U8MA 2PYED 1KN2H 5HYFA 1JUFB 1U3HD 4B53A 2PYFB 1LWRA 1IT9L 3VGHA 3HMWL 4KJWC 2ZUTA 1GCFA 1I3GL 5C0DA 4F9LA 3ARXA 1NGZB 3SQOH 2JJWA 1U8IA 4JRYA 1MAKA 2IQAA 3MJ6A 1KPUB 3EOAB 2MOVA 1I8MB 4Y4KC 3AXLB 2V6HA 3PP4H 4ALAH 3F58L 4O2FA 1YY8A 3C8KB 1AXIB 3HR5B 4IIQB 1ZT4A 1JV5B 3ZE1F 5IMKA 1OM3L 4KJYB 1XCQA 2IPUG 3IDGB 5IB1B 2FZ3B 5DRNA 2ITCA 4E41D 3I84A 2VZUA 1I7TA 5SWQA 4L8DA 4GMTL 3VFTB 5D5MB 1T04A 2P4AB 2VZ3A 3NAAH 1EVUA 2Y07H 4LDLB 3PL6B 3OKYA 4H26B 3V0WL 5DJ0B 3VD7A 4K8RD 2J8UE 2Y06H 4HZAA 5DVMA 2F8OA 4HUUA 4O58H 3UDWA 2EYTB 5DEGB 2EO9A 5IBLD 3MRQA 5ALCL 4HQQL 1UZ6F 4MX7B 1KN4L 5JOEA 3EDDA 2H2PD 2UV3A 2ZG2A 4NN7B 4NCC1 2BY0A 3IAQA 2ADJA 4KDTA 1XF2A 4RMWA 2ZUUA 5AZ2H 5C08D 5MEQA 3M17B 1UEMA 4K07A 3C87A 2B4CH 1FPTL 4IOFD 4KK6D 4UT9H 5AD0A 1E4WH 4PJAA 2YSSB 3HAEG 3F7VA 3IXTA 1ZWIB 5FO9B 2K3TA 4PRIE 3ZE0E 4JFXB 3WNLA 3A6OA 4ZNEA 3QUMH 1TQBB 3CFJA 1YNKH 1EO7A 35C8H 1FFOB 4Y5YB 4ZUSA 2DTSA 1J05A 2W65B 1Z3GH 4PY7A 3WJJC 2X2YA 1HQRB 1MOEA 2R2HB 2GJJA 4JFZH 4WDIB 4W4OC 5DO2D 3PHQA 3RVVD 2DWDA 2HJKA 1Z9OA 4KROB 1OP9A 5E2VH 4X7TB 4HGMA 3UX9B 4EBQL 3O4LB 5MHSD 3EOTH 4XP9L 3ZYOA 4JVPA 5C0GB 4JHZA 3HB3D 2R0ZH 1MCIA 3AY4A 1X5JA 5BW7C 5I76A 3CPLA 1RURL 2YPKA 4P2CG 1Y18B 2EH7H 5FOBB 4MJ2A 3CFDA 1OL0A 4V1DA 4ODVH 1SBSL 2B7DT 1W0VB 5AWNH 3GHEL 2P47B 1NAKH 1BOGA 2LVEA 3O9WC 3HZYB 1ZT7B 3D39A 2B5IC 3L7EB 4GRLA 3T2PA 2W0LA 3CSGA 1T5WA 2IGFH 1WT5C 1KJMA 1G7HB 4TULL 1B88A 2ZG1A 1ACYH 3O2VL 3QEGL 3IDMB 3B2VL 3CFCH 1KJVB 4O02L 1MHHB 1NJ9B 3FQRB 1NDGB 4OLUH 2YOCA 5FUCC 4JVUA 4QRSB 2AEPH 2VXSH 4U2YA 4ZTPH 1TPXB 3MLTA 4KQ4L 4JHWL 5MEND 2V9RA 3NCYP 3DX7B 5IHUH 2RQ8A 3CMGA 1FH5L 4C56A 4PB9L 4JB9L 1MFAL 5FCUH 3KPSE 2PW1B 4N0UB 5I16A 1OARL 2O93L 4X98A 1F90L 5F9OL 12E8L 5F71A 4ZPTB 3SE4A 1IAOA 2DQJH 3STLB 5E24E 4OIIL 5IB4A 3MLSL 4X7CC 4Y4HC 3LKNA 4BH7B 4HWBH 4OIAA 4S1SH 2F53A 1DQDL 2NXZB 4I5BB 1C7TA 3GI9L 4BSWA 3C5ZD 5KSBA 4OUUA 4WHYG 3QCUH 3HG1D 5JOPD 1OP5K 5JMRA 3NCFB 1QSVA 1ETZA 2MSPA 5KTEH 4F7CA 3SO5A 1DFBL 3SKUD 5KG9A 5JPMB 4GXVH 3MQIA 1A64A 2WBJC 1M7DB 4NYLA 5EU3A 5GGVY 3FRPA 5JUEH 5IIEA 3DXAB 1D5BA 5GS1C 3GGWB 1JNNL 5L88L 4GG6B 3V2AR 4UZGA 1RK0B 5DWUH 5JHDE 3QUXC 3KPMA 4LEOA 1AJ7L 4NNXB 3HR6A 2R2BA 5K9JL 1ITCA 4GBXB 3BGFB 4MD5A 5DJDB 1FL5A 4D0CB 2DQDH 2FO1A 1ND0B 2OM5A 4S1QL 4TQEH 1VADA 3C60C 3RGVA 5H35A 1NEZB 1TFHA 3ILPB 1UXSB 4OIBA 3LRSA 5DEFA 3L3KB 5KANI 5GSRA 4L4VE 2Y25A 4OD3L 3ZLQC 5FYJD 4OFDA 4R96B 3HRZA 3HI1B 2WZPD 1AQDA 2NY2C 3CFKB 4PJ5D 3SGKA 4HC1L 2VXUH 1I8IB 1TVBA 2NY7L 1RZIA 5D1ZC 1FYTE 3CDYA 5CZVH 5BRZA 5GS1B 4MNGB 5CUSH 4NQCA 3N85H 2FX7L 4JE4B 3VGFA 3VWKC 4XMPH 3RTQA 3QUXB 4G7VH 3OSKA 4OAWB 2X9XA 4JO4H 5DC4B 3WIFA 4AY0A 1WCBB 1IAIH 3NH7L 5EUKB 1A4JA 4U1SB 4F7EB 2J4WL 4F7TB 3TCLA 3SDXA 4ZNCD 2XV6B 4E42B 4F2MB 1KENL 5DYOA 3QWRD 4FG6D 2A77H 3INUH 4XRCA 3RHWF 4YHZL 3HE7A 3E6FA 1PG7X 4XPBH 5GRXG 4U7MA 1OCWH 1T2QH 5ID1A 2IPUK 4LNVA 4KTEH 3VXUE 4GW5A 4P23B 4WO4A 3MV9B 3CXHJ 5HGBB 5HDQL 3AGVA 2NY2B 3IFPB 4PREA 4MQ7B 3MR9B 1NBYA 1LGVA 3DSFL 4C56E 1G1CA 3CSYB 2V5MA 1S9XA 4BUGA 4X99B 1KN2L 4FFYH 4PD4K 3GSNH 1CGXA 1ZT1B 3LAFA 4MNQD 1UB5B 3ROLB 4AMKH 5I74B 3HMXH 5HDOA 1J10A 5HHMB 5IW3A 2PXYC 4ZFZA 1G0DA 1INDH 4WW1B 5FK9A 4I8DA 1SYSA 4XNMA 2P8LA 1WTLA 1F3JA 5BOPA 5HHOA 2VQUA 5E94B 1T0MB 3PP4L 1HN1A 3GIZH 4PJ8A 1AO7B 3TN0A 1QZ1A 2NX5A 4CBPA 4XBGB 3C9NA 4R90H 4XCNA 1HSAA 2CLZB 1AXSA 3U9UA 2F54D 1MCPH 4HWEH 3NA4A 1FZKB 3VFUA 3MXVL 1OAQH 5GGQH 4P0DA 2YPVH 3BWAB 4LRIA 2OTUB 1KTDA 1YMMB 2Y07L 2RHEA 3ZKNC 5D6DA 5HVWA 3OAYH 5TE7H 1ZGLA 3HI6H 3CZFA 2XKUA 1A6ZA 2Y06L 2ZOKB 3SOBH 1R3IH 3HC0A 4O58L 4BFEA 3O41A 2CXGA 3G5YB 2K7PA 1CFVH 1Q94A 4WHTB 2B1AH 4U6HA 3MUJA 4HJ0D 4UU9B 4IM8A 4L29B 2ZKHH 4B50A 2ARJB 3MV8D 4P2QA 4ONFH 3P3YA 3GMPB 5AZ2L 1D5XA 3S34H 4CDGC 3F7RA 1U41A 1W2KT 2B4CL 4UT9L 3HTLX 1E4WL 4Q9CA 1NC2A 4C4KO 4W6XB 4GRMA 3N1FC 3CMOH 2KUTA 1PLGH 1P9MA 1WWBX 5LBSH 5I2IA 4JVWA 1U92B 4PGCB 5EOCL 3OKLB 3QUML 2NYYD 4WFHE 35C8L 1LD9A 1S78D 3T4YB 1R5WA 3IT8D 4KMLB 4KVCH 4LHJB 1NGWB 2X1OA 1Z3GL 1MCRA 5BO1H 4UTBH 1GOHA 5CEYA 4XWOC 4DVBA 4XC3H 1EV2E 4P3DB 2WWKO 3V7MA 1HXYA 4RMVA 3RUGA 1E4KC 5JZ7D 4HZLB 5E2VL 3EOTL 4PRPE 4PJHB 2HRLA 3PWPB 2R0ZL 3QHZH 1A1OA 2HLFD 5DUPL 3ECBB 2P45B 4UOJA 2NY4C 3S37X 1E4XH 1CD1A 2EH7L 2EYRB 3VXOB 5HVHB 3SDDD 3UZQA 2FR4B 2NY0B 5AWNL 3LVEA 2DAVA 1KB9K 4F37K 2X4NA 4HKZA 1NAKL 2VN4A 4MA8H 2CRZA 3IKKA 4RBPH 3U6RA 4MDJB 5F3HA 4P59H 4PGJA 4OSUH 4P2RE 2A0LD 3P9MA 1YEGH 1YNTB 2Q86B 1HCFX 2IGFL 1MFBH 2ICWB 2XKNB 1ACYL 3MUGA 3QDJB 1NCNA 3CFCL 4QRPE 3RY5A 1BD2A 1N8ZA 1VEMA 4ELME 4L4TD 4OLUL 2OI9C 3C5JB 4OFVA 4MJIE 3U46B 1TCMA 2AEPL 3FFCE 4IJ3B 4QYOB 2ZOLB 1B2WH 4JKPH 4ZTPL 3CFEB 3TBSA 2R1XB 3O11B 4NQXA 3KG5A 3PGDA 2YEZB 1IVLA 1NAML 5IHUL 1OPGH 2A6DA 4I0PD 4MD4B 1WZLA 4Y1AA 5FCUL 1NFIB 3DMMC 3L3OB 2YKLH 5DRWA 3HN3A 3TA3B 4XXDB 5C0BB 1WWAX 2DQJL 3S36H 3O3BA 4S1SL 4I3SH 1I8LA 1AGEA 2BNRB 4U4BA 4BYHA 4LVOB 1IGIH 4P99A 3K80A 2R9HC 1EJ6A 3QCUL 4JM2A 1I8KA 1L9NA 4KRNA 1XCTB 2HFGH 3KPQB 3MRRB 3FB7B 5KTEL 3VJ6A 3VFNB 2CUHA 4QOKD 4XMKL 1V7MH 4E0RB 4JQIL 1CTNA 3GEWB 3BPNB 1JL8A 3WDHA 3MGTA 4GXVL 3E3QE 4LKCA 5I73C 2F5AH 5K9KB 3C8DA 4JGUA 4KKAD 5JUEL 4PJ7B 1T7YA 2VDLH 1RY7B 1G6RA 1SYVB 3HFMH 4LPVA 2NLJB 4YDJB 3L1OH 1B6UA 5DWUL 3QQ3B 1DVFD 3DMMB 4GAYA 5C8JA 1TZIB 3ULVE 3BT2H 5IV2B 3V0VB 4EOWH 2Z31D 3BO8B 1CGTA 3T0WA 3BUYB 2VLJB 5EULV 4O51B 2J8HA 5JMOC 1FLRH 4Z78B 2BVTA 5F6IC 1AFVL 4OF5A 4TQEL 2DM3A 1TNMA 3HZKB 3DOSA 2OZ4A 5LGHH 2NW2B 1ZA6A 1FZJB 3AROA 1U8KA 1CDBA 2RFXB 1SEBB 1IEAA 3GSXA 4MAUH 1U8NB 4KK8D 5E2TL 1QR1A 2GT9A 3RRQA 4K9EH 2VXUL 1UFUA 4XHJC 4YDLB 4NN5C 4YDKH 1QLFB 4Q9BA 5I73B 5C2UB 2VL5B 5HGHB 3O6FD 5CZVL 3DX6A 3N85L 5C3LD 4XMPL 5J89A 3GMQA 5BV7C 5HHQB 1GGUA 3GSNB 4P5KA 2MCPL 4G7VL 1FV1B 1PG7W 2XKSA 5C1MB 4JO4L 1N4XH 1D5ZA 1EX0A 3G04B 1OT2A 5SX5K 3D0VB 2Z4QA 3WUWA 4FNLH 2KPNA 1JTOA 5ENWA 4LLDB 1J18A 3RWDB 3QXTA 4HKXA 4O2EA 4X7EC 2A77L 5JW4N 3NIFE 4NJAH 5GJTH 4KI5E 3TIDA 3QCTH 4HJGA 1C5CH 3MYJA 3QI9A 4IRSD 4PLJD 4NSKB 1OCWL 1T2QL 4M3KB 3UZEA 4Z5RA 2IANE 4KTEL 1W8NA 1I7UB 2IH1A 4L5FH 2NY3C 2J8UF 1QRNB 3C2AL 5FM5M 3JV6B 4MLIA 2P48B 4FP8H 1SEQH 2VWEC 2NY1B 4H20L 4FFYL 3QDMB 1MCSA 4F15B 1AR1D 3HC4H 2VERN 3MODH 3SDAB 4AMKL 3HMXL 1EBAA 3EJZD 2ENYA 4PRDB 3BKJH 5D70H 1HHKA 1INDL 3OX8A 4FTVB 3S3PA 5EB9A 3DV6B 1J0JA 1LK3H 3IU3A 4KJWD 4ZFGH 2DIJA 3GIZL 1U8JA 5HHNA 3GSRA 3WE6B 2CXKA 4WJ5B 3UAJC 3TBTB 3DHJA 5E8EA 4PRAB 3CUPB 4MDIA 5EPMB 1OP5H 2OMNA 3ZE0F 3VGAB 4R90L 2CMRH 1Q0YH 4Y4KD 4PJEE 4QRTB 3T08A 1MCJA 2WUCH 3QO0A 4JRXB 1MCPL 4HWEL 1RUAH 2OL3H 1BAFH 1OAQL 4N8PA 5GGQL 2YPVL 4N90D 3DRTB 3SCMB 5TH2B 5GIRB 3ZSSA 2X44D 4JO3H 5TE7L 3HS0B 3HI6L 3MACH 4NBZB 5HI3C 4G7YL 4XPTH 4LHUB 3VXMB 2O26U 3SOBL 1R3IL 5DFWH 2D9CA 1V3JA 1ACZA 1CFVL 5SWZE 2B1AL 4PYGA 5F7FA 3PP3K 4YO0B 5DJ6A 4CNIA 1P4IH 3QH3B 1N6VA 4NQUA 5CJ5A 4ZFOB 3AC0A 4JPWH 4ONFL 4JKLA 4NQSA 1QFWM 3RX8A 3S34L 2XPGB 4LQFH 4XB7A 2I27N 3S3JA 3R1GH 3DUUA 1S7XA 4R8WH 4Z0BH 3OR6B 5C6TL 3O45A 3CMOL 4G42A 2P7TB 1PLGL 2R2CA 5EWIH 5LBSL 2E8YA 1U58A 5TF1L 4PTTB 4P4KA 2GJ6B 3VWJB 3I50L 1DQJB 2IMMA 3F5WA 3DTXB 1KLGB 3GSVB 4KVCL 3VGGA 1J5OH 3GMLB 4Y16C 3FAWA 2GAZB 4PIRF 4X9FA 2GSGB 2RB8A 5BO1L 4UTBL 4L3EA 4JO2H 1K5NB 3FQWB 4XC3L 3ES6B 3HUJA 3CC5B 2G75B 4G8GA 4LLWB 2GITB 2PTTB 3MBEA 4ZFOL 3MFFB 4NKOA 4N8VA 2ADIA 1S7QB 5FYKU 3RU8H 4G9FB 3QHZL 3A67H 4ODHH 2D7QA 5C0AE 4DKFH 5AZEH 1EEYB 3FB6A 3RGHA 4RGNC 1F4AA 1HH6A 3T77A 1AGCA 3OKDA 4X7SH 4MA8L 5C71A 1U8OB 4F37F 1H5BC 2PNDA 3H9SA 2VLLA 3P11H 4JDZB 4Y89A 3HE6C 1DL7H 5L0QB 3REWB 4P59L 1RJLA 4OSUL 4M03A 1YEGL 1X7QA 1MFBL 3O9WD 4LNRA 4NO0D 4JPIB 1UM6H 2P5ED 1G7JB 3GUTB 1HEZB 1X5LA 4X4YB 1YJDH 3QZWG 1R5IA 4JG1H 1U9KA 1M4KA 4ZXBA 1DBBH 1DP0A 4L8CA 5FIEA 1NGYB 1B2WL 3O0RH 4FQPA 4WHCA 4L1DA 3K2MC 4K3EH 1U8QB 1IE5A 5IESH 5MI0C 2X10A 1OPGL 5IG7B 1HQ4B 3U1SH 2ATPA 4XBPB 3PWVB 3GK8H 1VENA 3CDCA 2QR0B 4JFDB 2YKLL 2G9HB 4NKMB 3QUYA 4NKQB 3DXAD 2HMIC 3MV7A 2JJTC 3QEQB 1TITA 4LCUB 4R3SB 3Q3GA 3S36L 2PO6B 3TYFA 3ARGB 1QFOA 1OD7A 3BZEB 3CU7A 4I3SL 4YLQT 1IGIL 3RWCB 3ALXA 3VFOA 4JJ5B 2N7BA 2VOTA 4Y4HD 4O2CA 5E2UL 5IQ9A 1XMWA 2HFGL 1TXKA 1T6VN 5F93C 4D0DA 1UT9A 2C1OB 3JWNC 1V7ML 4CADB 5C0IA 1Q9LA 2JLLA 3CVIH 4YZFE 4GO6B 2BVEA 3DUSA 4H1LB 2V7NB 2V9QA 3QEHB 5MI0B 4B41A 1H15A 4YGVB 2AJYH 2VDLL 4BSVA 3DUHA 5L2JA 2WBJD 3HFML 3TO4A 2YD5A 3TH4T 2J2ZA 1MFEH 2BXZA 1QSFB 2YD8A 3QAZB 4L9LA 3BT2L 3STBA 4EOWL 3LN5B 4OZHA 1Q9KA 1AP2A 4P4RA 5DDHA 1RUPH 5GGTH 4NRZA 3QUXD 3KR3H 1FLRL 1X5YA 4BSJA 2AV7A 3OG6B 4DTGH 4FRWA 3WXVH 5GRVK 3ZYZA 2IBBA 3I3EA 4UINH 5LGHL 4NBYB 1LK2B 5KAQF 4FXGB 3K3QA 4F9PA 2DRUA 3LEVL 4H1LG 1PEWA 2A2QT 3LKQB 5J7CC 3QFDA 1RHHA 1TLKA 1TMCB 1KOAA 5DI8B 3VXNA 4D0BA 4MAUL 1LMKA 4JG0H 4K3JL 3V9FA 3V5KA 4K9EL 1J1XH 1MJJA 4JFFD 4QHUB 1EA9C 4YDKL 3QA3A 5T1LA 1MCBA 1A7PH 2A73B 2NY2D 3IVKA 5FDWA 5TE4H 4P49A 4L3CB 2QQQA 2R4SL 1QSZA 1UQSA 3TF7C 1S7SB 2ZPKH 5D1ZD 1KACB 4IRZH 5T1MA 1T2JA 1MI5E 3OJDB 3Q0HA 3H9SE 3BEVB 1N4XL 5D1QB 3F6IA 2YZ1A 4YGAB 3PDOA 4FNLL 5IJKC 1AGBB 1ZHNA 3VWKD 4JKMA 4U1IB 5CJBA 1OGAE 4JR9L 4RCAA 4U1LA 1ORSA 1O0VA 1BVKB 2BVQA 5FA3B 2VLKD 4NJAL 5GJTL 1ZLVK 2OTWA 3QCTL 3QNYA 5IK3B 3UYRL 2LTQC 1LVEA 3SE3A 1S7RB 5DA4A 1FG9C 4WI8A 4M9PA 2JTDA 4BZ2H 1MLCB 1F6AA 4L5FL 1KIQA 2AP2A 2ZSWB 4U33A 4Z76A 4FP8L 1F6FB 1SEQL 3JXAA 1EH9A 4EEEA 1DQTA 2ITDB 2OL3B 4TUOA 3FT2A 5IWLA 5MEPB 5I1KH 1YYLH 3CH1B 4JFYA 1TVHA 3JTTA 3HC4L 5JNYA 3UJTH 2WBWB 4KH2A 5D70L 5TDOB 5EU6B 5T3ZH 1IEBB 3L9RA 2FDBP 1LK3L 5CWSA 3MBXH 3MLUH 1R24A 2PXYD 1HINH 3BEWA 2AABH 2XWTB 1IBGH 5IKCB 3G5ZA 2PKDA 4TUKH 1RIVH 4N0FB 4POUB 2W0FA 5ISZB 1FG2B 1Q0YL 1WJ3A 1DEEB 2BP3A 2WUCL 2Q20A 2OL3L 3CSPA 1UVQB 4QRRA 4G6KH 3LB6C 4WW2A 3QQ4B 2J8OA 3WNPA 1CE6A 4JO3L 3MMEA 3NMEA 1LE9A 3MACL 4YFEA 4NQDE 3HPJB 4NC1E 4BKLB 5JA9A 1OSZA 3L6FA 4XPTL 3RJDA 2QJDA 3F12B 4TRPL 5JQ6L 3LOWA 3ZKND 4U1HB 1YJDC 5DVOA 2F74B 2PR4H 3D87B 2H1PH 4MJID 4AQ1B 3FFCD 5KANG 5I17A 2P1YA 4L8BA 5D2LA 1P4IL 5C0JB 4MYWB 1KPRA 1BFVH 2BVOA 3MO1A 4JPWL 3I3BA 2AEIT 3C6LA 4F7PA 2HG5B 3PWPD 4LQFL 1LEKB 4YPJA 3R1GL 1D9KA 3DX8B 2XG4A 1T0NB 4Z0BL 1I4FA 1BWMA 4JREC 5IB5A 4KRLB 1KC5L 1UJ3B 3GNMH 5EWIL 3DSNA 2J8UB 4ELMF 2GKIA 3EOBB 5DMIH 1N0XH 4ORGB 1T7VA 4Y5VA 5DHVH 1J5OL 1H3VA 2IAMA 3MZGB 5I6XB 3I75A 3NFPA 1L0YA 4JO2L 1H0DB 1I85C 5D7LA 5C7XH 4Y19E 3QDJD 4XNQB 1F4XH 1BVLB 3ZT7A 2GTZB 4JZOB 4WWKC 1EFQA 3AVEA 3CJJA 4TNVK 4XWOD 5ESAB 4WEMB 1R3LA 4RZCA 3RU8L 3CSBA 3A67L 4ODHL 5EOQH 4DKFL 5K9OA 1OQOA 1MHCB 1P7KA 4XMLH 2P5WD 5FYJU 2Z35B 2CKNA 4KHXH 3T8XA 2JB5H 1CFSB 5DURD 5E6IA 3DROA 4X7SL 2VDPL 4HLZG 3LCYA 2MKWA 4MAYB 3P11L 3TBYB 1AD0B 1DL7L 5C0BD 1T7WA 4F9LC 5ANME 2MPAH 4LHQB 1YDPA 2DOCA 1JPGB 4CN6A 3WD5H 1UM6L 4GUPB 1KXTB 3QFJD 4P5TA 3P4LA 4JG1L 3FFDA 1RZGA 3QG7H 5ESVA 3OXSB 5I8OH 3OKOA 1HHIA 4KTDH 3D25B 3NPSC 4Y2OA 3QUKB 4K3EL 5JDSA 3T1WA 2GK2A 3ULVF 5IESL 4WUUE 1M7IB 1HOCA 5SV3A 5D8JH 4OQTH 5D71H 3U1SL 1B9ZA 4MCYB 3GK8L 3N06B 4RFNC 1VGKB 1YEKH 1U8MB 3IRZA 3F7PC 1WIPA 1FVDA 1Q0XH 3ARPA 2BSTB 3U2SA 4TNWK 4TSAH 4X7DC 1NKOA 3DMMD 3UDWC 1FZOB 1ADQA 3MRCB 1ZLWK 1FBIH 4XCEA 4ZDHA 1YEDA 5FM4A 1U8IB 2E7MA 3QNZA 3GJFA 4FQHA 1B4JH 4DFHA 5EFIA 4O2FB 4KDTC 1Y0LA 4J3WA 2BCKA 4Z7OE 2R9HD 4F33A 5IMKB 2JCCA 5C09E 3CVIL 1XCQB 1AXTH 1CG9B 2QL1A 3KPSB 5INDA 3RI5K 2D0GA 3PP3H 4HUXA 1TETL 2ITCB 3KHQA 2BMKB 4PJ9B 3AS2A 4NWUH 2EC8A 1I7TB 1MAMH 2JIXB 5SWQB 4L8DB 1FL3A 2AJYL 1TVDA 4RNRA 5F8QC 4Q2ZA 1X4YA 3S35X 4HS8H 5EA0H 5GZOC 1MFEL 3VGDA 3V4VH 3I6GB 4GXUN 3NIFF 3MRHB 4KI5F 1RUPL 5GGTL 4HUUB 3KR3L 4G8IA 1SQ2N 1N3NA 2D7PA 3S4SB 3W0WD 5HYJA 1UXWA 4XX1E 4DTGL 3WXVL 1N59B 3KXFD 2Z8VC 2P42B 4UINL 2AERT 4J6RH 2CD0A 3VFMB 4OCNC 3SN6N 4UDUA 4DGIL 2Q7NA 3MRKA 3T0VA 2O5XL 4PRHA 1J1XL 3HLAB 2AXFA 5AD0B 3L95A 5JHDB 1M7XA 4JFPA 3IXTB 4ETQB 1A7PL 3VD3A 4XHJD 4GRLC 5D2NA 5E9DE 2ZPKL 3CFJB 1EEQA 5CJOH 4C58B 4ZUSB 5I1HH 4PY7B 2LU3A 3BWUC 3SBWA 4JY6A 4EDWH 3NZHH 2ICCA 4S0SD 3C09B 2CDFA 5IM7B 1JYXA 1CD9B 4LCYA 4YIQA 5HPOA 3P30H 5D4QA 4NQEA 3KPRA 1S5HB 3MJ7B 3PHQB 4DZBA 4PJEF 4IS6B 5I8EA 2D4DA 2FB4H 4WGVB 5DK2A 5IBTL 4GKSB 4M43L 1FN4A 4LCCA 1PEZA 3ALPA 5D7IA 1P4BH 4NDMB 3WMSA 3SE9H 1NUFA 1AHWB 3CPLB 5EZOH 1EO5A 1T66C 1FYTB 3WFBH 4BZ2L 1CT8A 4V1DB 4WCYH 2KKQA 1H3UA 1PKQA 5F9DC 4MZ2A 3SE4C 4W68A 4DZ8A 2HTKC 4JRXD 2VISA 2X4SA 2C1PA 1K2DA 5F9JA 3GSWB 5I1KL 2NY3D 5ACMA 1L7IH 1I9RH 2HA1A 4GRLB 1K8IA 3BGMA 2BRRH 1T5WB 2V2WA 3EFDL 2YHGA 1FNAA 4X6CA 5J12C 2C7UA 1ZV5A 1FNEB 2EYSA 4GFTB 3S3SA 1MIMH 3BJ91 3T0EE 4CMMB 1K3IA 3U36B 2YR3A 3EHBC 4OCMC 2LU4A 3MBXL 4YHYC 3MLUL 1HINL 2AABL 1IBGL 4TUKL 1RIVL 2E7CA 4P3CH 2FEEL 5IW1B 1A2YB 5EOCJ 4C56B 2NW3A 5IGXH 3UAJD 4ZFFB 4M7KH 1Z5LB 2V7HB 4ZAKA 1XF3A 4G6KL 1IAOB 4B0MM 5IB4B 1QHOA 2G5BB 1QO3A 3EKCA 3LKNB 3KYMB 2XZZA 1PG7H 5DGQA 3RGVC 2IC2A 1S7TB 2GJ6D 5DHVB 5KSBB 4MNHA 4P2OA 1CFQB 1HYSC 2QKIA 3QIWA 8CGTA 1A5FH 5J12B 2PR4L 5HI3D 4GXUM 4F80A 3WKNA 2XT1B 4J3XA 3A6BH 3MPCA 1EPFA 3ULSA 3SGKC 4LK4A 1BFVL 5KOMC 3BN3B 1DDHA 5C07E 3V5DA 1P2CB 1XIWB 2E9JA 5F6HI 3EJYC 4KXZH 3S5LA 3O81A 1JF1B 5J6GB 1RZ8B 3RTQC 4EUPH 4LEOB 2PCPA 3VFRA 1JWSA 1ZVYA 3ZO0A 4LEXH 4BH8A 2L0DA 4ONHA 3DGCR 5DMIL 1N0XL 1FL5B 4FQJH 4OV5A 3CVHA 5C0EA 5B38B 4U1KB 3SKOA 4UB0H 1EEZA 3N1QC 2VLRD 1BQHB 3RGVB 5HGAA 3HE7C 4N1HB 5C7XL 4PJDE 4Y16D 3GZKA 1JTPA 1F4XL 1AKJD 4J2XA 4EVNA 3C6SB 1AGFA 4WO4C 1AQDB 1BLNA 3REVA 5E5RB 1E6OH 5IP4A 1HSBA 3VFSB 4G80B 3P4NA 3ROOB 4U6TA 4TNVF 1NFDA 1ZLVH 3QEUB 3VDBA 4XMLL 1YN7A 5ACZA 4KHXL 3VW3L 3BZ4A 5IBUG 5D1XA 5FCSH 1RIHH 4JFDD 4RGND 1XR8A 4OLVH 3E2HC 3AMKA 3UYPA 1WZMA 2H32H 3QEQD 3AMLA 4YR6A 2MPAL 5FYLH 3DIFB 4YZFF 5T5NG 3WD5L 5DYOB 2ED8A 3HE6D 1KYOJ 3B6SB 4PJ8C 4XRCB 3TN0C 1FFRA 4OM1H 5C0FB 2WUBH 3QG7L 4PRPB 3E6FB 4R6UA 1A7OH 5I8OL 1NDMA 3HNVH 5EU5A 3AS1A 4KTDL 5I1AB 4LCWE 43C9B 3X17A 5ID1B 5ID0A 4YC2C 1RJZA 4GW5B 1Z0MA 3DV4A 3OKKA 5E4EB 1NBYB 3KNBA 5D8JL 4OQTL 5D71L 3NCMA 4JN2B 1U8HA 3U82B 4LRIC 1XF4B 3X13A 2EECA 1YEKL 4KC3B 5D6DC 3PWLA 5ICXB 5D7JA 1B0RA 3WHE0 2FO4A 1Q0XL 1EHNA 1HILA 4P2RB 4TSAL 1OSPH 2HP4A 4OCYH 5D6CA 1ZSDA 4K71B 2XICA 1C12A 1WITA 3D2UA 4TNWF 4ZFZB 5K9QI 1FBIL 4QRPB 2HMID 3OQ3B 1QBBA 4XP1H 4PRBA 1R3HB 2P8LB 1B4JL 2Z9TA 4JPVH 1QBAA 3OL2A 2EE2A 4OKVA 5ALBH 1BFOB 2MHAA 2BHZA 2DKSA 1ZVSB 4XCNB 1E27B 2H41A 4YXHH 3OF6A 4QHMA 3EYOA 1AXTL 3E8UH 3FQXA 3U9UB 4HJJH 4NWUL 4LPCA 3DVNA 1P9MC 5E00A 3SQBA 3RI5F 3PABB 4JHAH 1R3JA 2OQJB 4R4FH 4LGSB 2UZXB 3IJHB 4HS8L 5KOVC 4XVJH 3EO1A 1OGTA 5F88B 1UM5H 2CLRB 3JV4A 3CZFB 4RGMB 3V4VL 1YN6B 3J8F7 4QTHA 1JYWA 1HE7A 2XNAB 3OKEA 4EN3B 3KYOA 3V79C 3HC0B 3TP4A 5SX4H 2Y5EA 3O41B 3KAAA 3QIUB 4I13B 1IQDB 1N6UA 3UP1A 1T4KA 2FL5A 4ZOEA 3UBXB 1Q94B 3GHBH 3BVNA 4PP2B 2NMSA 2E8ZA 4OLWH 4J6RL 1JF5A 5EC1B 4PFEA 5DHYA 4TVPE 5BS0E 2CIKA 2Z91A 3MROA 4Y4FA 3FMGH 1RZKH 1N26A 2IFFH 1WFUA 3ZKXB 1OY3B 1TZGH 1MSPA 4JFED 1NC2B 1A3LH 3BESR 1F8TH 3QXUA 2AS5M 1DLHB 1T7ZA 4GRMB 3NFSH 1IAMA 3DYPA 1NGZA 5I2IB 2EZ0C 2OR9H 2Z0BA 3O6KH 5CJOL 1KPUA 3EOAA 1LD9B 2H3NA 3AXLA 4HX1A 5HTSA 4QEGA 4DGVH 5I1HL 1SVCP 3RVWC 3C8KA 3NZHL 3V4PH 3KS0H 3D85A 5CEYB 3VFPA 4PRNA 3P30L 4HF5H 4KJYA 4DVBB 3IDGA 1HXYB 2FZ3A 2MQ3A 2FB4L 3G5XB 4XZUB 4F8QA 1VERA 2DLGA 3ZHKA 4NGHH 2EE3A 1P4BL 2VIRB 2XTJE 1QFWH 3ULUC 3B9KA 3VFTA 3SE9L 3UTTD 1KJ3H 5I1GH 1QSEA 1KEGH 1A1OB 1T20A 5EZOL 3PL6A 3WFBL 2MCG1 5DJ0A 2APWA 4WCYL 5T1KD 3ULVL 3QJFA 2BOBA 2X4NB 2I07A 4P46B 2EYTA 3U0PA 4PUBH 5DEGA 2ZSVA 3Q5YA 3U6RB 3O3EA 5F3HB 1L7IL 3D3VA 1I9RL 1SY6H 5C0CD 1OD9A 3P9MB 2J88H 4JM2C 3MUGB 4NHUA 3B3IA 1O5DT 3BZDA 1HIMH 1T21B 1N8ZB 1JK8A 1MIML 1JNLH 1KGCE 1NBQA 4NUGL 3M17A 5CZKA 3SJVE 4HXAH 1FC2D 1DANU 4M8QA 5E1HB 1ZLWH 4YHOH 4OZ4A 1BM3H 3TBSB 5CMAA 5TF0A 2IANB 3PGDB 5FO9A 4PLOB 4P3CL 4W6WB 5FUZH 5FM5O 4JFXA 1BZ7B 1KXQE 3AREB 3FB5B 4QNPE 2A6DB 1EMTH 3LD8C 4Y1AB 4NN6C 5I75C 5IGXL 3W2DH 1FFOA 4Y5YA 5DRWB 5GGRB 2XIDA 2PW2A 4WFEE 3P73B 3RZWA 4OZIE 1HQRA 2R2HA 4WDIA 4EUPB 3CX5K 1E28B 1FIEA 3OJ2C 4YXKH 2NY6B 5H2BB 3UTOA 1FFNA 1PG7L 3JZ7A 3W82A 3O4LA 1P53A 5C0GA 4H25A 4JM2B 4MXVE 5H94B 3LQAC 1A5FL 4EKXA 4AM0A 1Y18A 4P5MA 3V52H 1W0VA 3A6BL 2Z8WC 1QOKA 4PJEB 3MZTA 2P44B 5GRVL 3MGTB 4KRPC 1ZT7A 5M95B 2ZUVA 5EUOE 1MCHA 2AXHA 4Y5XC 5HI4C 4NN6B 2ID5A 3ULUE 1NC4B 4Z9KB 5F1NB 5C8JB 2BOCA 3TH3T 1D5MA 1PAMA 4TYUA 1MHHA 3FQRA 3RQ3A 4LEXL 32C2B 1WFOA 4FQJL 4RGOH 2DLFH 3T65B 2NR6C 5HHVH 4QRSA 4J8RB 1N6QL 4UB0L 2H32B 5SWZB 3VXSD 3DX7A 4APQC 4LLVA 1ZA6B 2VC2L 3S8WA 3QI9C 3QXWA 4N0UA 4Z7WA 1I1AC 1QR1B 4JZJB 2BNQE 2GT9B 1MFNA 4ZPTA 5GS0C 1N5AA 2K9UA 3JWOC 3STLA 4WWKD 4BH7A 1MRFH 5DC0A 4I5BA 2ICES 3DX6B 5DZNA 3M8OL 2X4TB 1RIHL 3U4AA 4OLVL 1D5ZB 5C2BH 3TVMA 4P9ML 2V2TB 3OPZH 3U7WH 4HAGA 4Z7OF 3O6MH 4DOHE 2NNAB 1RZ7L 4K3GA 3TPUB 1NUGA 2NZIA 4O2EB 1M7DA 5DQJA 1CXFA 4OM1L 3PWJB 2B8OT 3GMNA 3QDGE 4JRYD 1F13A 3HNVL 4S2SB 3MYJB 3P4MA 5IMMB 4XAKE 2JJUA 5C0AB 3MLRH 4GG6A 4M1DH 4Z5RB 4XNYL 1RD6A 4I4WA 4NNXA 1RZKC 4HW6A 1KCSH 2IH1B 4GBXA 4LIQE 4D8PB 4X5XB 4HULB 5I30H 2PF6A 5F7LB 4GAGH 3VRJB 4D0CA 2APTA 2JB6B 1QUNA 3FO0H 3WUWG 5HVGB 3MRNB 4GKZB 1NEZA 1PFCA 3ILPA 3NFNA 4YWGH 4H0HB 2Q8BH 4OCYL 3L3KA 4WEUD 2IJ0C 1LQSR 5FXCH 4DEPC 1ULVA 2CGRH 1S9YB 4OCSL 1T83A 2WW8A 5E2JA 3NN8B 1A6PA 4XP1L 3KDMB 3ARUA 1B0WA 4ZSOA 5AYUH 1U8JB 3LSOA 2Y5TA 1RSFA 3V6OE 5E8EB 3TNMA 4MDIB 5ALBL 1P7QA 4XH2A 4MNGA 1SM3H 4YXHL 3U7AA 3L3JB 2AK1H 3RL2B 3P9LB 4WV1B 5A2KH 1CLCA 2JJSA 3E8UL 2BVUA 4M93C 4HJJL 4OAWA 5HGDA 2A6IB 1WCBA 4JHAL 4P4KC 4R4FL 4L3AA 4F7EA 4F7TA 1AIFA 3PQYE 4ZO7A 1KT2B 5CGYC 2C3GA 4LARH 2QQLH 1QG3A 1UM5L 4H0IA 2EDRA 2OXGA 3DNKA 1JRHL 4A6YH 3EO0B 4PS4H 1MCOL 1FVEA 3X3FH 5GZOD 3PGFH 2HFEA 3WL9A 3K4DA 1FRGH 4RAUB 3FHAA 1JWUB 4JAMB 4F58H 1RZFH 4P23A 3MV9A 4OTXH 5T3XE 4OLWL 3IFPA 4UUJA 1QHPA 3MR9A 4MQ7A 4CNIB 3DYOA 4HXBH 2RCSH 4GQPH 3CSYA 5T3ZD 4Z7WE 2VLMD 4MXWH 1JI1A 3MLWH 3MRMB 4MGXA 4R2GC 3FMGL 1ZT1A 2IFFL 5EBLA 1SJEB 4LBEB 4LSPH 3ROLA 1TZGL 1AY1H 4I18B 1A3LL 3TJEH 1F8TL 3IS0X 4AEEA 2FIKB 5KVGH 3NCCB 3NFSL 4K2UH 4OLYH 4G42B 4V1DD 4AIZB 2VO5A 3TZVC 2Q1EA 4WW1A 3PWNB 4R26H 1RULH 3O6KL 4WI7A 3U0TB 4OZFH 3F5WB 5E94A 3MA9H 1T0MA 3VGEA 4DGVL 1J87A 1LO2H 3D39D 2YMXH 4M7ZC 3FQUB 1AO7A 3L3IB 4UV7H 5CIPH 4UQ3B 3V4PL 4GRLD 4KVNH 1Q9WB 3GRWA 2DYPA 2J5LB 4N8CH 2CLZA 3HUJB 3CLFH 5IW6B 2AK4E 3MBEB 3BIBX 4HHAB 1FZKA 4F57H 4N8VB 4NGHL 2ADIB 4CMHC 1QFWL 1KB5H 5I1GL 4KKBC 1KJ3L 1KEGL 3BWAA 4G3YH 5MERB 1YMMA 1INQA 3V6BR 2A83A 4G5ZH 4KJPC 2YPLA 2QHLA 3FOLB 1JWMA 3QUMA 3QUYC 3BD5A <