4N1EA

Structural evidence for antigen receptor evolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
94
Chain Sequence
b'DIQMTQSPSSLSASVTITCRASQDIAAALNWYQQKPGKAPKLLIYASSYLQSGVPSRFSGSGSGTDFTLTIEDFATYYCQQDGYYPATFGQGTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin variable light chain domain
publication title Structural reconstruction of protein ancestry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/hydrolase
total genus 18
structure length 94
sequence length 103
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n1eA00
5CMAB 1KJ3L 5LVEA 5I1CH 3TWCL 1FIEA 1BZ9B 1FVDA 5GSVB 1O7SA 2HFFA 4GG8B 2YD9A 2GKIA 3TA3C 2V9TA 3QT2A 5JHLH 1IAKA 4S2SB 4DGYL 5I1AB 1XCTA 5EOCH 5B3JF 1YN6A 1BJ1J 2BVQA 4OCYL 5FECA 4X80H 2XOTA 4XX1G 5DEGA 5T5NF 2B4CL 3ZKMD 2YXFA 3QFJD 3NCEB 2ZUYA 2DLEA 4FQXD 4OLZL 1UM5L 3VGGA 2OBGA 2X9WA 3HE7D 4P9HH 1AY1L 5C7XL 1PGRB 2E9WA 1G9MH 3VFMB 3ARBC 3LDBB 1IEBB 4WVRA 1XGYL 4Y5YA 1T20A 1D5ZA 3BP6B 1UACH 5F7UA 1UZ6F 3RWGA 5I17B 4LNRA 5EU3A 4MD0A 4YE4L 2PW1B 5EO1A 2XTJB 4UNVA 4TSAL 1KCUL 5KOMC 3WFDL 4G9DA 4CU6A 2JCCE 2ZSWA 1KENL 5C07E 1EEYB 2ZPKH 2XIDA 4OF8A 5IM7B 5TF1H 3PWJA 2N7AA 1CD8A 3CFJA 4G8GA 1MI5A 2VZOA 1XF5A 1ZHNB 4PRPE 2HRPL 2JCCB 5GGSB 3HZYB 2I07B 3OX8B 4NBXB 4BJLA 2R2CA 1HQ4A 3JTSA 2ADGB 5EUKA 4AM0A 1S9VB 2XN9D 4K8RC 3TC9A 1AGFB 5E6ID 3UTSB 1FGNL 4APQC 2W1NA 2EECA 3QUZD 2VITB 4TQEH 4RFOH 2J8UE 4X5XA 5DFVD 3PP4L 4PJ5B 4N9GB 4OZ4A 2HVKB 3MLXL 2I27N 1RZJL 3G6JE 1RZFL 4DTGL 3OKEB 1H3PH 4PP2B 5T33L 4NGHH 1QSEA 3RGVD 2QLVB 2J8UB 3LEYH 3JZ7A 4V2BA 1F2QA 3BPNB 5ESVA 3G6JB 3UYRH 5IFHH 4M7ZC 3FN9A 2IH1B 1NLDL 4WU5A 1U3HB 1I8LC 1IGJA 4RGMC 3CUPA 3ILPA 4D9LL 4WO4A 4OSUH 3RAJL 1ZHLB 1FGVL 1P7QA 2VLJE 1OPGL 1UA6L 4AEIH 1RY7B 3OJMB 1X5HA 4JN2B 3QDJA 1DVFB 4QT5A 1G7JA 1AFVH 3U0PA 1RHHA 5FA4B 4C57C 4LDOB 3TBWA 4N8VG 3BGFB 3Q0HA 4JANA 1FVCA 4Q6IB 4DZBB 5EPMB 1KPUB 2FYYA 3ARDC 3KYKH 5SX5H 3KLDA 3MCKA 4XAKD 1F4HA 2XV6B 2OQJB 3AREA 5FYKH 1CT8A 3MBEB 2VLME 3IU4H 1EMTH 3B5TA 3DI2B 1JNHA 4KPHH 3ZE1E 4R4NC 4L3CB 3NA4A 1B6UA 5IW1B 1TVHB 2G60H 3T4AB 1CGTA 3KXFA 2CR3A 1P1ZB 4H5SB 2MCPL 2DKMA 5I1KL 3UJTL 3VDBA 3NTCH 4WFGD 3C60C 5JHDE 4GAGH 1SMAA 4Z7QF 4CVZB 5B8CA 3MO1A 3S4SA 1R3KA 2A73B 4O4YL 4L5FH 1M7IB 4I0PD 1AGCA 4G8FB 3DYOA 4U1HA 4YAQB 1MHCB 1ODAA 4JDZA 4FOMA 5C0FA 2ZUQB 4WW2B 4FFWC 1IAIM 2Z9TA 3L3OA 4EUPA 3S34H 3CMGA 3PIQA 1WCQA 2BNRA 3GSVB 3NH7L 1T5WA 4XGZA 5D7LA 5EU6A 5EZIL 3X3GL 4AT6A 1UC6A 4NM8L 4XCEB 5JOFB 2AEQL 4NHUA 1MJ8L 3GMLB 1DDHA 3CH1B 1F6FB 2VSDA 4OF3A 3VFRA 1HHIA 5MEPA 4TPRH 5E4EB 5CGTA 3WFHA 1H3XA 2X42A 2XZAH 3WL9A 4DN3H 2FX7L 3OKNA 5ALBL 4K7PL 2CIKA 1JPSH 4QTHB 5GSRA 1J1PH 5MENA 3QA3A 4ZTOL 2H3NA 1MEXH 1INEH 4XZUA 5FKPB 2X05A 4TVPL 2HVJB 1CE6A 3RI5F 1AD9B 5DK0A 4HPYH 2FEDC 2R1WA 3VRIA 3L3DB 1KJ2H 4Z78A 4QXTB 4BH7B 5DEFB 2PTTA 4QRQB 1U8JA 2M26A 1G7LB 4N5EC 2W9DL 1AE6L 2W38A 5JA8B 4PJCB 1JPTH 2EYRA 1KV3A 2HN7A 4BSVB 5FYKD 4M1CC 5FYLE 2PYEA 1MIML 1T4KA 1KGCD 3BZ4A 1J1OL 1CD1B 5MEOB 5FUZL 2O5YL 4O2CA 4P4RB 4IDLA 4LSDA 3MFFA 2E9JA 1YY9D 2AXFB 1Z0NA 4OTXH 3LPWA 4ESKA 4Y4KB 3R1GH 5KVFH 4HXBL 2OCFD 4NQEA 1J88A 1D5MA 1MJ7H 3U30B 4JY6A 2YRLA 3QJFB 5FYJE 1MFCL 1SYVB 4Y5VC 2P24B 4NRZB 2DM4A 3H7LA 2B1HH 5T3ZL 5IHUL 3GMRA 2GJ6E 1XF4A 2XZCL 5AG9A 1JYXA 4U6XB 2EE9A 3VXOB 2XQBL 4NYLA 3T0EB 4Z95L 1QFWL 3W2DL 2NNAB 43CAB 4NO3B 5KW9L 4XP5L 1P7KB 3NFSH 3P4OA 5CGYD 1OP9A 4QRPE 1ZANL 4PIRF 4KVNL 3O6FB 1OHQA 4F80A 1U8IB 1LO2H 2HMIC 5BQ7B 1A7PL 1NC4D 2GT9B 3H8NA 4LLQB 3LN4A 4HAFA 4O51A 2VYRE 4U1KB 3ZE0E 4L8DB 1C08B 3RX5A 4Z76A 3LZFL 3QWRD 4LLWB 3ULVH 4YIQA 3WKNA 2ZOLA 3DETC 2VC2L 4ZQKA 2FGZA 4Y2DC 4X0KB 2ITCB 1MCCA 2C3VA 1EK3A 3QIUC 4QRTA 1S9KC 4X5LA 2ICWA 4N9OB 4WENB 3UXFA 3DTXB 2OR9L 1X4ZA 3VFOA 3TO2B 4HUWA 5HI3D 4PRBB 2RFXB 4V1DD 3VXSE 5KSVB 3CAFA 4HWBL 1OGAA 1N6VA 5DA4A 3SJVE 3KLHD 1J1XH 4M43H 2EC9T 3KS0H 3RKDD 4WI6A 4FP8H 4WUUB 3Q6FB 1U93B 5ISZE 5CBEB 1NDMB 4N5UA 3C6LC 5B3NA 5F88B 4G43A 3QZWB 3VFPA 1VFBB 1X7QB 3BD5A 2F53B 3IGAA 5C09D 4RAHA 1VGEL 2JB6A 3OXSA 3HE6D 5F96L 4H1LB 5ISZB 5D7KD 2LTQC 1EJOL 2P1YA 4P4KC 4K94L 4URTB 2FGWL 1GC1C 1RULH 5I74C 3D3VD 3RUGF 3HR5B 1IM9A 1XIWD 1IFHH 1QLFB 4KJPD 5IG7B 1A4KA 3MOQA 4IM8A 2DOCA 4Z7WF 1FN4A 1R0AL 3SHSA 1MRDL 3CCHA 4XBGA 4YHLH 4PBVC 2CUHA 4XHJD 1GPOH 2C3XA 2Z31D 2IG2H 3X13A 3U4EA 3KPRE 4G5ZH 4PP1D 3E6FA 4Z8FH 3P9WB 1INQB 3P4MB 5GZOD 4RX4D 2EH7H 5J12B 4HS6B 4H26B 4LEXH 3KPRB 4OCWL 4GS7B 3S37H 3OF6D 1S78D 1CLOH 4OGAD 5KSUB 1S9XA 1GAFH 4TUJA 3B4NA 4XT1C 5HHOB 1PW3A 1MCWM 1R5VB 5E8DH 5INCA 5DVKA 2IBZY 4IRZL 1S8DB 3VXTB 4EVNA 1LE9B 3RPIB 3IDIB 3I9GH 3LD8B 1OT1A 5BRZA 3QQ4B 4XNZB 4Z7NE 2R56L 2QQKH 1VB9A 4WHCA 4KROC 3OXRA 4AEFA 5IUSA 4LASL 1ED3A 4QTIH 3VWJB 1BM3L 1SEQH 5D96B 1F3JA 1W8NA 2DMKA 4RFNC 5FDYA 4ONHB 4D3CH 2MJWA 5A2KH 4KJQD 1T03H 1QQDA 3O2DA 3MOAL 5F3BA 1JRHI 3M17A 3RTQC 4QRSB 2V5YA 3WSQH 4YXLH 4N1CA 3MRJB 3QFJA 1KCRH 5I1EL 3SPVB 1FO0L 1N7MH 3QYCA 1VEOA 1FFOB 2JJSA 3PL6B 3B9KB 3GKWL 3I02A 4R7NB 3T08A 3ILQD 2VABA 1IGTA 4NBZB 4Y4HC 3T3ME 5GGVH 1T89C 5DJXB 4ZO6A 1RMFH 1A7BA 2XZQL 2NW3B 2AJSH 5F7FA 3WIIL 1J0HA 3V52H 1R5IB 3MRGA 3WNOA 5JQ6H 3F58H 5DURD 3QP3A 1QSZA 2DYPD 3OAZH 3GSNB 4LLVA 4CNIB 3MV01 2X1OA 5L88L 4PY8I 3MRLA 2BNQE 2NR6D 1LO0H 1U8LB 2A1WH 3VCLB 5F9DC 4U1NA 1REIA 5CD5D 1K5NB 2I25N 4FQ1L 3EOBB 1IKNC 2B39A 4RMTA 1JHTB 2CIIB 5KG9A 3H0TB 1RZKH 3O8XC 1HEZB 1MCPL 5TPWH 1FVEB 5DHVH 4KAQH 4MB3A 1QR4A 5TH2B 5MERA 5E6IA 1S7RB 5LXGL 5DGQA 2DQGL 5IJVB 3P11L 5ESAB 2VE6A 4JZNA 3ROOB 2PYFB 3GI8L 2QQNH 4OLWL 3OZ9H 4GAJH 1K8IA 7FABL 2R0KH 3DUSB 4N0CC 3GJEB 2FO4A 2VXTL 2EZ0D 1Z3GH 3L3GA 3CFDB 2DQFA 1I1YA 3RGVA 4M6MH 5SWZD 4R9HA 4S1RH 2D7NA 5TDOA 4HWEL 4X4YA 5C0IB 3VMPA 4J12A 5LGHL 5D2LE 3IDXL 4JPIB 2MCG1 4XVTH 3U1SL 3HNVH 1QEWA 4CADA 1DTUA 1QNZL 5I1IL 5DD5H 4W6XB 5IVXE 4MNQB 3RVWC 3FT4A 1BVKB 3TZVA 3DMMB 1X5JA 1AGEA 3WDJA 3GBNL 3BZFB 3QXDB 4MAYC 1WFTA 3EO1B 2YS4A 1CS6A 2HP4A 3RUGA 4HS8L 3HAEA 4YE4H 4WTZA 4OIAA 5IV2B 2VXUH 3OGCB 4HK0A 2DDQH 4LSUH 3TYGH 2A9NH 2P42B 1HYRC 4R8WH 1UGNA 4HJJL 2X6MA 4JO3L 5AWNH 5L2KB 2APFA 4L4TE 1P2CB 4IOIB 2BVEA 4RA0C 2BMKB 3MUGB 1EVUA 4J6RL 4Y19D 2BP3A 1K4DB 3ARWA 3D5OF 4G8EA 2OX5A 3L3KA 1D9KC 3TV3L 5HI5C 3F62A 3DVNA 5EUOB 1MFEL 1NANH 5HPMA 4PJIA 5HVWA 3VW3H 1NBVH 1NBQA 5KVGH 2H26B 3VFTA 5HVHC 1WC7A 4YHYC 4Z7VF 3E3QC 3W9DB 4P3WA 4I0PA 1TCRA 2F5AH 1W8OA 2R1YB 5SWSE 1FRGL 4MJ5B 2V2TB 1FFPB 2X4NA 1G7QA 4D2NA 5D1XB 2C5DC 4TSBL 3EUUA 4JO1H 1M6OB 1UWGL 1UH3A 4NO5A 1JGEB 4DGVL 4HCRL 5IJKC 3QI9D 3PWPB 5SWSB 5BW7C 4POUB 1U8NA 4KHTH 5KBNC 1MH5B 3FQNB 1DJSA 4OV6F 4BH8B 1JYNA 2H32B 3P9LA 5F6IC 2E7BA 4FQLH 4DKEH 3RAJH 4X99B 3W9EB 1BP3B 1EJ6A 2PN5A 4ERSL 1UQSA 2VLRA 2VL5B 3CFIC 1ZEAL 3ZSTA 1WIOA 3IF1A 2XFXA 4L8CB 4LLMB 1EEZA 1HILB 3BEWB 1NCDH 2GY7B 1FH5H 3MA7A 4WJ5B 2NYYC 1NC2D 4B5EA 2VDMH 5DJ0B 4NIKB 1LO3H 4HC1A 1NCAH 1HSBA 3IDYC 1QUNA 5GIRA 1UM6H 2GJZA 2W0LA 2YA1A 4J1UA 3IU3B 3MLZL 4LF3B 3LKRA 3ZDZF 4P3DB 4BQBA 3FN0L 3GJFA 3MRQB 4XNQB 3IKCA 3S97C 2VLKD 5GGTL 4P2YA 3O0RH 5A1AA 5FDWB 1T7ZA 4QGYA 3SQBA 2Q3AA 3JTTA 5JPNA 1N6UA 5TE6L 1GOFA 4AY0A 3MFGB 5J3HC 4FZEL 4O2EB 3TF7C 2NY5C 3QUMB 5SV3A 1QPPA 2G5RA 4ODUA 1WWAX 3N50A 4JAMA 5DTFB 3MYZA 1AHWA 3U6RB 4FFYL 3V0AC 4F9PC 4K23L 1Q94A 3QZWG 3HUJF 4MQXD 2IJ0C 3D87B 3MRMB 4LIQH 3WUWB 5C2BL 3ET9F 5ESQA 1ZVHA 3WNLA 3O3DB 4H1LG 4Z5RA 4XCNA 2DQUH 4K2UH 1B0WA 2VAJA 2HH0H 2RJMA 4YHKH 4PGJA 1JI2A 2EDXA 1SBBA 1AGBA 3CXDH 3G6DL 4KH2A 3OAYH 1NC4A 1NUDA 3BKMH 4YDIL 2PXYD 4UV4L 2FB4H 1OAUH 2HJLA 4O9HH 2E27L 5D1QD 3F7YA 1BOGA 3L5HA 4E41D 3PWLB 1MWAB 3QWRA 2CUMA 3NIDF 4WW1A 5I0DA 4HLZG 3DOSA 1YJDH 4OAWA 4QXWA 1FCGA 2XQYK 4Q2ZA 3UDWA 1UEYA 4PJAF 1YZZA 4IMLA 2BRQA 5FA3B 1T1WA 4S1DC 5IMKA 3CU1A 4F57L 3J8F7 4KRPD 4HGWB 5ICYB 1NANI 3D18A 1J10A 3HRZB 1NQBA 4LAQH 3HS0B 1HNFA 5FCSH 1G7IB 3LS4H 4YX2H 1INDH 3VWKC 4Q58C 1ZT1A 4NFBA 1F02I 1EBAA 4C83A 3W81A 3IFLL 4CU8A 3A6BL 1QRKA 1TNMA 5FGRA 4OCRH 2D31B 1JVKA 2DQTH 1VFOA 5K9KB 5FYJU 1ZGLM 1MFCH 3MLPA 4BQ6A 1JV5A 2B5IC 2OZ4A 4P57A 5C09A 4HF5L 5E70A 3E2HB 4NRXA 4CKVX 2DD8H 4HHAB 1KLGA 3HE6A 4Z7VA 2VAAB 4PRDA 3WS3B 1U92B 1IEHA 1G6RB 1A7RL 3TBTA 1S5HA 2XY2A 3PHQB 5L0QB 2AW2A 2YEZB 1NLBH 1KN4H 1SJEA 2O5XL 4OD1L 4WWKD 5F7EL 3D3VA 5I8OL 3HC4L 1T3FA 1XIWA 3U7WL 2MQ3A 4NFDA 1GZQB 4AIZA 5E8OB 5D8JL 4DK3A 3BQUD 4N0UA 1HZHL 3R06A 2JIXB 4M1DH 3OG4B 3VH8B 3TNMB 1JZ6A 4ZSOE 2WLYA 2Z31A 2HAZA 1MHPH 1MCRA 4PREB 3C9NA 4R0LB 2BVOA 3QEGH 2WBJB 3TT3H 1YEDA 4RX4A 4TVPD 4LCWB 8FABB 4UINH 1A3RL 4LKXB 5LGJA 2A9ML 1EZVX 2FIKB 1S7TA 2VKXA 2DQCL 1ADQA 5IKCB 1MRCH 4MA8H 3VG9C 3CSGA 3SDXE 3BJLA 4XPHL 2X4RB 1OTUD 5HHNB 5FF6B 4YHOL 5DFWH 1U95A 4M7JL 1RZGA 4G6JH 2X4OA 4M1GH 4L1DA 5H35B 4PLJC 1IC7H 4LSVH 1JZ3A 3WIHL 2EDHA 3SDDD 3IDJB 4OQTL 4ZPVA 5FKAA 1DBML 3TCXA 3L9RA 3O6KL 4IOFC 4JZJA 5I8KL 2DLGA 1UXWB 4IRJB 1JF1A 3BN9D 4K94H 5DSCA 4JFED 3OB0H 1EA9C 4GMSL 5D9SA 4PTUB 5T3ZD 5KSAA 1A14L 4MXWH 4M6OL 4BSWB 5J8OA 5IB2B 1CFVH 2HA1A 4WHTB 3ZKMC 5D2NA 1F2XK 5D71L 5GS1A 4FQXC 4ENEC 3ES6B 3HE7C 5EOCJ 1R6VA 1BF2A 4HQQL 1HK6A 3HUJA 2NY3B 4PBXA 4POZD 3MOBL 4Y16C 4KI1A 2DLFH 4UU9B 1NGQL 2GSGB 5DJAB 1WZKA 5E9DE 4RGND 5CFHA 3PHOA 1MJUH 5ILTH 1AR2A 3QAZB 4R2GD 4HIJA 1Q0XH 2IANA 3SDCB 3BX7C 3WKMH 2B20A 4F8TA 1EUTA 2DF3A 5F71A 1IM3B 3IRZA 4ZUUA 5I9QB 3V5DA 2HWZH 3IXAB 4M00A 5FHBL 1FAIH 3LSOA 3PJSB 1II4E 4TVSa 4PJAA 4NT6A 1D3CA 4MJIB 4E9LA 3DBXB 3QRFM 4KKAC 3QUZC 3BKYH 3C6LB 3D25B 2O5ZL 3PGCB 4M93B 2ZKHH 3MLUL 1BM3H 1IGFH 4LP5A 5C0CE 4PJHE 2H1PH 4FQHB 4OZFB 5SWZA 1TJHL 5BO1H 4NO0D 3H9SD 3V7AG 1DBJH 4ZFZA 3OHXA 1A0QH 4LLYA 1C12B 5F9JB 3BMWA 3FO9A 4PJHB 5GS3A 1EGJA 3ELAT 1QFWI 3BIBX 1ZA6A 1NBZB 1GGUA 2XWTB 3UTQB 5I75C 2J4WH 4PJDA 4DAGH 2IBZX 3U7YL 3I3DA 1LWRA 3GIZL 5F7LB 4F7MB 2XZQH 4U1SB 5B38B 3ECBA 3C09C 4FMFA 3V4UL 1JMZA 1PY4A 4QRRD 3KG5A 4P9HC 1QOKA 4G9FE 1Z2KA 1P84J 1LE5B 3AM8C 4DVRL 3EJYC 3EYFB 1G9MC 2FRGP 1KG0A 3QIWC 5AAWA 2DN7A 3PXHA 4DFHA 1A6WL 4JJHA 4UOW1 3TBSA 4DKAA 3ZKND 3CLEH 4FG6C 4G9FB 4U1IB 1I7UA 3V4VL 4JKPL 5FGCE 4CJ1A 1NL0L 3H9HB 1EHLL 3UAJD 2VH5H 1HH6B 4Y19A 1MCBA 2DQIH 2NLJA 5B39A 1CU4L 1U8KB 5C08E 1MCPH 1QBMH 4X4MA 2Q8BH 1N5YH 1UWEL 4G3YH 4HDIB 3ULSA 4YDKL 5ITFB 1F6LL 4LHUB 3SCMC 1BX2B 4ZS6C 2HT3D 1EDQA 5AZ2L 1FVDB 1MREL 1DFBL 2HFFB 2FJHA 1GHFH 3BP4A 1PG7W 2AXJA 4OD3L 3B2UD 3IJYA 2QTEA 4HKXA 4HK3N 1IAKB 3LHPL 1RJZA 2OYPA 3G5ZA 1XCTB 1CLYL 1LNUA 1DBBH 1YN6B 5M94B 3U36A 1OT2A 2BVQB 3QI9A 4XMPL 4R26L 5FECB 5BVPH 5DEGB 5AYUL 4YDLB 5T3XE 4OM0L 3MRPA 1QNZH 3GSXA 2GITA 4H25A 3HC3L 3H3KA 3QNYA 4OLYL 3S6CA 1FORH 5L2JA 4Y5YB 1T20B 1D5ZB 1FL6A 4FQCL 3RWGB 2F58H 3DARA 4KFZC 4LNRB 4MD0B 5EU3B 3WUWG 4FABL 1ORQA 5EO1B 4Y5XA 2DB8A 3BUYA 3T77A 1NC2A 4G9DB 1J8KA 2R15A 2ZSWB 2W07A 5KAQF 5MEQA 3L3IA 2VO5A 3PWJB 3CFJB 3VXRE 1CDBA 4G8GB 1MI5B 1XF5B 3MXWH 3V6ZA 3JXAA 3O4LD 3BPLB 1V05A 2CK0H 3EO9H 3IDMA 1HQ4B 3JTSB 3BSZL 5EUKB 1XF2A 4AM0B 4JHAH 3FHQA 4RGOL 5ID1A 1W72L 5GRUL 1QSEE 4X7EC 3O4OC 4X5XB 1T7XA 2FHFA 2ZUTA 1CDCA 1MFBH 4OZ4B 4CL7A 3MGOA 4W6WB 4HH9A 3WJJA 3MJ6A 2EDEA 4JGMA 1QSEB 4W81A 4MGXA 4JVUA 1FLRL 2VLLA 5E94A 4X6DF 1P4IH 2AXGA 5ESVB 3BDYH 3FB6A 1CBVH 4JFFA 4LCUA 4YK4C 4PGEA 2FIRT 1MPAH 3CK0H 1JJUA 1KXQE 4WU5B 4ZXBC 1IGJB 3JVGC 3CUPB 3ILPB 3IXTA 3SKJH 4WO4B 1H15A 5DRNA 1P7QB 2EDJA 4YZFF 5D93B 1KFAH 2EDOA 3QDJB 4QT5B 3ZT7A 1G7JB 3ME0A 3V0WH 2XG4A 2D9QB 3U0PB 1RHHB 4CW1A 3NPZB 3C5ZC 4ONFH 4XVUD 4L9LA 3TBWB 2PXYA 5EU5B 4JANB 1FVCB 2AABL 3TCLA 1PKQE 4W4OA 3UTTD 3ZHLA 4E41A 2FYYB 3RVXD 3MCKB 3STBA 3AREB 1DQMH 5GISL 1CT8B 3VH8G 3WO3B 3NACH 2QHRL 4I18C 4WRLA 5IVOA 1JNLH 1JNHB 5F7WC 1QHPA 1NMAH 4O58L 1UVQA 4HEPG 12E8H 3E3QE 3OKDA 4WTXA 3KXFB 5ANME 1BD2E 2VXVL 2UYLA 3KPSE 3QXVA 3D48R 1WEJH 2EEBA 3TJHC 2YUWA 1MY7A 5DJ2A 5LQBH 4TUOA 4PY8J 1AQKL 5HI3C 1T2XA 1GSMA 2PCPA 3REWA 5B8CB 3MO1B 3S4SB 1R3KB 1AGCB 1YEIL 3SDAA 4U1HB 4RBPH 4JDZB 1WZLA 5I1LA 5C0FB 3RKDC 1G7PA 3JV6B 5DVMA 3L3OB 4EUPB 2KZ1B 4OCSL 4U3HA 1I7TA 2OTWA 3PIQB 1RK1A 4L4VE 2BNRB 1Q9OA 1T5WB 3B5HA 4XGZB 4ZFGL 1NCWH 3PWNA 3QPXL 4K3EH 5D7LB 4NN6B 5EU6B 2AK4A 4AT6B 3QHFH 3X12A 4NHUB 1MLBA 2G2RA 5K9JH 3KS0J 1DDHB 4LSTL 3VFRB 1HHIB 5MEPB 1RIHL 4KDTC 1DQTA 3WFHB 4WWKA 4IRSA 4B7IA 3O11A 3WL9B 3AMLA 1CN4A 3EFDL 2OMBA 5E99L 3OKNB 2CIKB 1RUAL 3BQUA 5HD8D 1UEMA 5GSRB 5B22A 5MENB 3BIKA 3QA3B 1NMCC 2E7LC 2H3NB 2YA0A 5F8QC 1F4YL 1KYOJ 3EOYG 4XZUB 4M6NH 5DQDH 4D9QD 1CE6B 3EBAA 3KR3H 5DK0B 2R1WB 5F1IA 3VRIB 4Z78B 2PTTB 3T0XA 1U8JB 4J3XA 4GRLD 1NGPH 2HG5A 4D9RD 2XTJD 3TVMD 1QBBA 2EYRB 4L3AA 2HN7B 4OLXL 1T2JA 1S78C 3ULVC 4OGAC 2PYEB 1I8KA 1KBGH 1KCVL 1ITCA 1EH9A 1FYTA 1T4KB 2VZUA 4AK1A 2IPUG 1FIGH 4XTRD 4O2CB 4KUCD 3MFFB 3O9WD 2ORBH 1RJCA 2FEEL 5EIQA 5C6WH 3EDEA 4XPTL 4PJXF 4GBXA 3U4BH 4NQEB 4GAYA 4PLNC 1D5MB 1U0QA 2M1KA 4JRXA 3RU8H 4JY6B 2EH8L 5ADOH 2OSLA 5IHBA 1KPRA 4MMZC 3GMRB 3ZTNH 1XF4B 4LGPB 4DKFH 3DNKA 4FN0A 4JFEA 4NN5B 4NYLB 5DJZA 1J12A 1D7FA 5DRXA 3VFNA 2CR6A 4YHMH 4FQJL 5AZEL 3P4OB 4X6FA 4X6DA 4OZFG 5D5MA 4AIOA 5C2UB 4S0TD 4ODSH 4JQXC 1E4XL 1FNGA 4OZIF 3MACH 5FGBA 2FD6L 3TM6A 1KEGH 1TPXC 2BDNH 5I1JH 2OR7A 2P5WD 3LN4B 4O51B 3RZCA 3BPOB 3X14A 5TQ0L 1G7HA 4Z76B 2GAZA 1HWGB 5DD1H 5DR5H 4ONGL 4YIQB 1TQCC 2EKJA 1DUYA 2Q7NA 3WFCH 2UVFA 5TDNA 1QKZH 2ZOLB 5IW6A 5B38G 2ZZUT 4ZQKB 3NOIA 5EFIA 2ZNWA 2ESVE 2VDOH 3GIVA 2C3VB 4Y1AD 4D0BB 3CFCL 1ZA3A 5DMKA 4QRTB 4JJ5A 4Y7MA 2ICWB 4XXCC 3HG1D 4JPWH 2X4UA 3VFOB 4OGZA 4HUWB 4LARH 4LVNC 3ARZA 3GUTA 1OGAB 4K9EL 1WBYA 4Z0BH 4A6YB 5FYLH 2DIAA 4ISVA 3RL2A 3HNSH 4Z7QE 1UYWL 4OIBA 2I24N 5I76B 4ODTH 3ZL4L 3E6HA 4HWBA 2QV2A 4OLEA 4UB0L 4G43B 1LK3L 3F6IA 2HTKD 3VFPB 4P2OC 4JEGB 3IGAB 4MDIA 2JB6B 1HHHA 3OXSB 5DZNA 3FAWA 1QRNA 3R8BB 1RV6X 4LHUG 4LQ1A 2FLBT 3H9SA 2AI0L 4JDTH 4XP6L 3AB0C 1Y18A 4P5KA 5J0BA 1A7QL 4NWTL 5FYJH 1JNNL 1A14H 2ADFL 1IM9B 3OPZL 4N90D 5D1ZC 1A4KB 3KPPA 5JW3L 4CDGC 1R3HA 3GM0A 1I85A 1FN4B 3CCHB 4XBGB 3T2PA 4HKZA 1MELA 3PWVA 4JDVA 3X13B 2CLVA 3U4EB 4FQ2L 1UKQA 1HHGA 3E6FB 1ULVA 5I71C 4QRRA 4RMVA 4PJFF 5DMJB 3RWEA 1I9IH 1QSFD 5E2VH 4YFEA 4KY1H 5CJXA 1T2QL 5MHSE 3DRTA 5IWLA 3ZE2F 2W60A 2Z35A 4Q7DA 5TE7H 1NKOA 1F11A 3K80A 2R4RH 4LSQL 1S9XB 4TUJB 5LBSH 5CJQH 5DT1H 4XNUH 5KANG 4NQCA 2HKFH 4O02H 4TTDD 2YD6A 5INCB 32C2A 4HJGA 2CGRL 1JBJA 3L1OH 2JJUA 4B41A 4EVNB 4KZDH 2WUBH 5I30H 1TITA 2RIKA 5BRZB 5EOQH 1OY3B 1UB6A 3OXRB 1MCOL 1YNTA 5FUOH 1RZKC 2QHLA 1ED3B 4PD4J 5L9DH 4UOJA 1YEKH 1UH4A 1F3JB 3EYUL 1TVBA 4NZTL 2IQ9H 4DN4L 3QFJE 1IBGH 1QQDB 5CSGA 4M62H 4N8CH 4H1LH 4K3GA 4DWHA 5F3BB 3M17B 2J88L 3MRNA 4U05A 2FATH 4KI5C 3QFJB 5IHLB 4Q9QL 1FFQA 4HLJA 5GRWA 4LL9A 4P23A 2DKUA 4LHQB 4N0YH 5HI4C 1C1EL 1BEYH 2XICA 4JY5H 5EO0A 3I02B 5DJYA 5T5FH 2X4SA 2VABB 1IGTB 3T0ED 4J4PC 2YXMA 4HLZH 5FK9A 3SY0A 4MAUL 1FO0A 3PWUA 2C3HA 3O3UN 1D5XA 3IS0X 3V4UH 3MRGB 4JG0H 5JNYA 4L8SC 3T0AA 2AEIT 4LU5H 4LNVA 3SO5A 4LLVB 3MGAA 4PLKD 2VSCA 1JTOA 4KVCH 5CZVL 3OJDA 4OZIA 5C0DA 1JGLH 2EYSA 3QIBC 3MRLB 1VSCA 2CDGA 4K71C 4MXVF 2AJZA 4JO2H 4KUCF 4U1NB 2XN9E 1EHLH 4TNWK 3GSQA 4GKSA 4H88H 4X7SH 5CSZA 1NUFA 3O4LA 1J8HD 2HLFD 4WFFD 2BJML 5IROC 4XVSH 3B3IA 1CZ8L 1L7IL 5KG9B 3LRSA 4GW4A 3U0WH 4YHZL 1GZPA 4H8WH 5MERB 5E6IB 1A3QA 2AJYH 1I7RA 2NY7L 4YDKH 4G6AD 2YPLD 1X5KA 1BVZA 2VE6B 4JZNB 3U9PH 4TSCL 3VDCA 5AZ2H 3B8SA 1K8IB 4JG1H 4ALAH 5ICXA 1XH3A 2FO4B 5JUEL 3L3GB 2DQFB 1I1YB 3RGVB 5JXAL 4BZ1L 5BS0E 5JPMA 3S4SG 2BSTA 4Y2OA 5TDOB 4X4YB 2NY2C 4JREC 1YEGL 3ARVA 5CP3A 1BJMA 4JPKH 1QEWB 4EUPG 1CG9A 1TFHA 4GRWB 4CADB 1N4XL 3D6GA 3FFCD 3HC3H 3RUGE 3FT4B 3TZVB 4OGXH 4OFVA 2H2PD 3JWOL 1AGEB 3SE3C 5EO9A 1P4BH 4Z7WE 2R8SL 4GQ9H 3MRIA 1N6QL 4XAKE 3RUGB 4OZHA 3HAEB 3IFNH 4HIHA 1WBZA 4PJ9C 4HK0B 1KB5L 5EIVA 5EN2A 3UTTA 3ZO0A 3L3HA 1I3RA 5D1QC 1IC4L 1FZKA 3GSNH 3JSSA 2IAMC 4NZUH 2LVEA 1RIUL 4OLVH 1OTTC 3I85A 5KVEL 1TZGH 3DV6A 3Q6GH 4H0IA 5F93C 4MA3A 4MVBD 2ZUWA 3DIFA 5HY9A 5LGKA 4G8EB 1N59A 4PJFA 3RFZC 1K4CA 3L3KB 4JKKA 4ACPA 3DVNB 1HINL 4P9ML 3WO4C 5HPMB 4PJIB 4RAUA 5GZNC 2N4IA 3A6CH 2J8OA 1F4XL 2IBGA 3VFTB 4KUZL 3KVQA 3GMQA 1NAKL 4WWID 1WC7B 5GS2H 3VG0H 1P6AB 4MA1C 4I0PB 4WW2F 1TCRB 4IIQC 5E08H 4BZ2L 2X4NB 1G7QB 2VZ3A 5DYOA 3TFKC 4OFYD 4NO5B 3AC0A 3K3QA 4JO4L 4UTAH 1HIML 2FSEA 1YECH 2X9YA 2C4FU 3U82B 1BGXL 2C1OA 1CFTA 1U8NB 3WFZA 3VWJD 4U6VH 1MHHA 2Q8AL 3DSFL 5L8JB 3RL1A 5C0EA 4Z0XA 4C4KO 4EDWL 3TPUA 3P9LB 5DVNA 3AFLA 3RWCA 4HCRA 3EGSA 4YGVA 3VU2A 3CNKA 4KJYA 4YBQD 1CGXA 1FC1A 1UQSB 2APBA 2OXGA 2VLRB 2ADIA 4OT1H 1K85A 1NGZA 5FHAH 3SN6N 3IF1B 1AO7D 1EO8H 2XFXB 1EEZB 4EXKA 4AJ0A 3LIZH 1MQKL 4XMKH 3PL6D 3MA7B 2P8LA 2ATKA 4CVWA 1GJIA 5ALCL 1F4WL 5FYKE 2BERA 4F9LC 1FNHA 1HSBB 3D39A 5GIRB 2Y36H 4PR5A 2GJZB 5D70L 1UT9A 4JPVH 3D0VA 2Y72A 4GRLA 3H7BA 1KGCE 4PJCF 1RUPH 4J1UB 3ARQA 2VDNL 3TVMA 1K6QH 3LKRB 5BV7B 3SBWC 3RNQA 5CBAA 3D0LA 1IVLA 3HLAA 5JLZA 1QFHA 4R3SA 4XPAL 4OB5H 2OP4L 3GJFB 1YJDC 4NQUA 4R7DA 3IKCB 4MCZA 3S88H 2XI9A 3HZKB 1OTUC 35C8L 1OAKL 3OG6B 3CVHL 5GRVL 1JGVH 3JTTB 3QDMA 3WHE1 5JPNB 3O9WA 3RWHA 4GOSA 5GGTA 1HKLL 4OFPA 4LRIA 4L4JA 2NY6C 5HHMD 4EIGB 4JCLA 3SDDC 3T4YA 1HYSC 1NCUA 1IGMH 4ODUB 4JAMB 5INDA 5EC2A 1V8HA 1AHWB 1TQBC 3GNML 3QWQB 4WIQA 5E8PA 1IEAA 1Q94B 5A16A 4Z7OF 5HYJE 4XWGL 2E9IA 2H32H 3LH2L 4JFPA 3P30L 4DFIA 1QBAA 4LCIL 5E6YA 5ESQB 3TYFA 2AAVA 4Z5RB 4XCNB 2D7TL 4NNXA 2GTZA 1UZ8A 1AGBB 1NC4B 4ELKB 2VUYA 2P5WA 4LLAA 5F9OL 4JM4H 4GAFB 2DIBA 4BKLA 2HJLB 3F7YB 1KJVA 2XXCB 3WJLA 1DLFH 4QHKJ 4J8RA 1CLZH 4HS3A 5L6YL 3GRWH 4WW1B 4UT7L 4KTEL 3O6MH 4G42A 4OAWB 5JR1H 4HUMB 3K4AA 5FIEA 4RGNC 3JV4A 4Q2ZB 3FONA 1QFPA 1UJ3A 4NKDA 2RAMA 5C0NC 4IMLB 4G6MH 4V1DE 1ZTXL 1T1WB 4Y1AA 1DLHA 4N68A 5CILH 5IMKB 3JV0A 1TTGA 3HG1A 4KXZH 4HG4K 4OFDA 1DBAL 3RHWK 3D9AH 3D18B 3QSKB 4KKBD 4H0HB 4IEFB 4GKNA 4JQVC 3MRCA 5C09E 1QA9A 3NCYP 4NBYB 5M7QA 4XPTH 3AU1A 5HGAA 5IQ7L 1ZT1B 3H9YA 3ARGD 1E28A 2OI9C 4C83B 3JWDL 5D7KE 1QFUL 3IFPB 5CD3A 2CLRA 1W0VA 1JV5B 5DC9B 1JE6A 4P57B 3OGOE 3QUMH 5EBGA 5C09B 4ZTPH 4NRXB 3QUKA 5HSFA 1KLGB 3HE6B 4YQXL 4Z7VB 4PV9A 4PRDB 4WDIA 3TBTB 4CMMA 1S5HB 3S7GA 3L7EA 4X7TA 1J86A 1IGIH 1SJEB 2EXWD 3HI6L 3D3VB 1MJJA 1T3FB 1XIWB 5K59F 2B0SH 1TZIA 3ZKXB 4AIZB 1T66D 2AKRA 4N0UB 4K94C 2Q1EA 3R06B 4UT6L 4FMKA 1DR9A 1CK0H 2QADC 3WNKA 4F2MA 2Z31B 1CL7L 2QJDA 3FRPA 3GMMA 2V17H 3C9NB 2XA8H 1CQYA 2ICCA 2BVOB 3ARFC 2FX8L 3QPQD 1MWAH 4ZDHA 3KPNA 2V6HA 1YEDB 5FM4A 3VXQA 1QSFA 5K9QG 4U2YA 5GQBA 2PO6C 5LGJB 3LMJL 4H0GA 5K33A 1S7TB 4MB4A 1JCKA 1HOCA 2E7CA 2EE2A 1PLGH 4HXAH 4LCCA 4P2QA 3ZKNC 2NY1D 3ZDZE 5J56B 3IDGA 2B1AL 3TIEA 4JGJA 2DL2A 4M48L 4HFUL 4P2RD 4HD9A 4JHBA 4ODWA 1U95B 2AJ3A 1RZGB 2X4OB 4NOBA 5D7IE 3QEUA 3Q1SH 4L9DA 2OL3L 1OAZL 3H3PH 4WGVB 3ZHKA 4IOSD 1MLCA 5HHXL 4ZPVB 5FKAB 4XC3L 2HT3C 1CGSL 3T65A 4GKZA 4YXKL 4LVHB 3L9RB 5CCKH 4JZJB 4Z7UA 3WIHA 2AXHA 3EYVA 4NQVA 3B2UC 1YC8A 1JF1B 1QLEH 1ZLWH 1EHXA 4EI6A 5ACZA 5D2NE 5C6TL 4OQTA 1OLZA 4PJ8D 5DSCB 4JFDD 1G6RH 4DUWA 5D9SB 5KSAB 1J0JA 5FCUH 1TTUA 1CICD 5DGRA 1UM4H 4NSKA 3MNVA 3HUJE 5D2NB 3V7MA 5GS1B 5DUML 4YPJA 1CVRA 1L7TH 4EEEA 5SWQA 2I60H 5H2BA 5SX4I 4XPFL 4DZ8A 4GUPA 3N06B 4OZGF 4XNYH 2NZ9C 2AQ1A 3HUJB 1OQOA 4RIRA 1VPOL 1YNLH 1PZUB 5DURB 1QLRA 2WNGA 3PHOB 4LEOA 3NIDE 1KUMA 3NABL 2EEDA 5CLTA 5EZLA 5D7JD 3HAEG 1WFOA 4WTZG 2VDRL 4HIJB 3SKOA 1JPGA 5HDQH 2IANB 4PJAE 2YKLH 4JFYA 1CDJA 1F58L 1U8OA 4CN4A 1J8HA 5KS9A 4WI8A 1KN2L 4ZUUB 5LAXA 1MCSA 3K2UH 3V5DB 4YBLC 1XGUA 3LSOB 5JXEC 1H8OA 4PJAB 4CGTA 4NT6B 1FNLA 3THMH 2YPLA 1FSKB 1LO4H 2XWJA 3MNZA 3V79C 2KPNA 3BO8A 3FO2A 1TJIL 1A7NH 2ZUUA 2NY0D 2F9BT 3INUL 3CZJA 3DUUA 3BOVA 5SWZB 2E9BA 4UT9H 1G9NL 2E7MA 3MBXH 4A2MA 4CMHC 3NCCB 3WFEH 1FP5A 4ZFZB 4EZMA 1VFUA 3OHXB 3DECA 4LLYB 5GRVK 3FO9B 4NZJA 2H41A 2B2XL 1ORSA 5J6HA 4XCFH 5CKAA 5GRYA 2CRZA 3T8XA 1ZA6B 2AJXH 1EUUA 2WAHA 3FFCA 4RSVA 3BIAX 1WWCA 1H3TA 1E4XI 4PJDB 2F19H 1FPTH 3GK8L 5GJSL 5IB5A 2DBLL 4U49A 4M02A 3ECBB 4MZ2A 1X3DA 2UY6A 5ADPL 4KK5D 1KELH 5DLML 2Z0BA 5I8EA 4P46C 4XVUC 2JIXD 1LDSA 2NXZD 3O2VL 1AXTL 4RBPK 1KG0B 4GW1A 4JFZL 3TBSB 3QRGH 3IAPA 4LAJH 4OIIL 4P5TA 5ACMA 1I7UB 3TT1H 4X4ME 3TO4D 1CXKA 5HHVL 4LBEA 2ILLA 4Y19B 1KC5H 4IDJH 5IMOA 3RDTA 4HJ0D 4K3HA 4LCWD 1CYGA 2NLJB 5B39B 1BFVL 2P7TA 2P8PA 3LKOA 5GHWL 4JQIL 1OAQL 2NY7H 3ULSB 1YEEH 1WFNA 5FGSA 4JB9L 5MP6L 4WUKH 1AJ7L 2PR4L 2CQVA 2YD2A 3JUYA 4UV7L 2FJHB 3BP4B 4LSPH 2CPCA 4KTDH 3MPCA 3MA9H 4KI5E 1F42A 4HKXB 1RJZB 4OFYA 4XCCL 4XB7A 3G5ZB 3LPGA 3VDAA 4OZFH 1LNUB 2ZUSA 2GK2A 3U36B 3LCYA 2R9HD 3QI9B 2CLZA 3NAAL 2C3WA 4NKOA 4PG2C 4NN7B 2PTVA 2W91A 2BCKA 1TNNA 2VDKH 3MRPB 3GSXB 2WLZA 1B4JL 2GITB 1BHGA 4H25B 1H3WM 3QNYB 4TNWF 2MPAH 4GXVH 4ORZC 2DQJL 3MRKA 4EDXA 4EKXA 1AC6A 2HYMA 5L2JB 3QCTH 2HFGL 3MR9A 1AO7A 1FL6B 1MFDL 4IMKA 3UJIL 4I5BA 4FQIL 4YDJA 1ORQB 4Y5XB 4HIEA 1OTSD 3A6OA 3BUYB 4YWGH 1NC2B 5F70A 3CXHK 4NJAH 5MEQB 3CJJA 2K7PA 2YD7A 3LDBC 3Q5YA 4LGSB 3L3IB 4M3JA 4OZGA 3V6OA 2F15A 1F8TL 4Y4FA 2VLKE 4LSRL 3V6ZB 2XTJC 3MODH 4DQOH 5E1AA 2NXYD 4FFZL 3IDMB 3BD3A 1RUML 1GIGH 3C8HA 3DX9A 3HMWL 1XF2B 2AVGA 1MNUL 5ID1B 1IKFL 3FO1A 1G0YR 2DQEL 1PQZA 4XTRC 4XWOD 4DGIL 3DVIA 2KKQA 4FNLL 1W72A 1ZOXA 1A02N 4OF5A 1WTGT 3NA9L 5K9OA 5TE4H 5IOPA 2VLLB 2HRLA 1FG9C 1LD9A 4KMTH 5E94B 1T80A 2AXGB 2JJWA 4C56D 1FL5A 3FB6B 5D6DA 1OAYL 4JFFB 1U3JA 4LCUB 1L6ZA 4PG9A 4PGEB 1WF5A 4U6YA 5E2TL 2ED7A 3AY4C 4M7LH 4F58L 2YMXH 4F7PA 3CXHJ 3IXTB 4PJBF 1H15B 1V7NH 5DRNB 4QGTA 1U41A 3BPNC 1AR1D 2W9EH 5FO9A 1PG7L 4JRWA 1U3HC 4CW1B 4L9LB 5L7XH 4CBPA 5DMGD 2NY4D 2PXYB 4TOYL 2Q76A 3FOLA 3TCLB 4E41B 4MNGA 2APVA 3MMEA 1LEGA 2DLTA 4U0QB 5FYKU 5JW5A 2E8YA 1DVFC 2YD5A 2H2SD 4TNVK 2RCSH 3RVVD 4X6CF 1RZ8A 3QH3A 3BGFC 3SO3B 1UVQB 5KVDL 3NPSB 2XYCA 5FUCE 4Q6IC 5TQ2L 3PE9A 2KUTA 2XRAH 3OKDB 2UYLB 2OP4H 3BAEL 3BGAA 4LOUC 3GI9L 4XAWL 3CH8A 1R3IH 3ARYA 3MBEC 4KRPB 2GQHA 5DJ2B 4TUOB 1OAKH 3HI1A 1A3LL 1U6AH 2PCPB 3REWB 2D0GA 1DQQA 3QG7H 4W70A 1FAKT 3SDAB 3WNMA 5HYFA 4KDWA 5I1LB 3CLFL 4WGWB 3ARGA 1G7PB 4XPGH 4RWYL 1I7TB 2OTWB 3ALPA 1RK1B 4WHYG 1EBPA 3U48A 1Q9OB 1YEFH 5C70A 3I6LD 1M7XA 2M8XA 3PWNB 2HTKC 5JIHA 2Q86A 1DSFL 3Q2CA 4NOFA 1JYVA 2AK4B 3EDFA 5C3TA 3X12B 2FBJH 4XVJL 4JRYE 1MLBB 2HJFA 2G2RB 3BZEA 1E6OH 2ZUQC 4WW2C 1GOHA 4K3JH 5JW4R 2BZDA 4XWGH 3HMXL 2EDWA 5CIPA 4WWKB 4IRSB 4LIQE 1LHZA 3O11B 3B2VH 3FZUC 3BRDA 2CO6B 3VD9A 1RFDH 5CWSA 3BQUB 5LKNA 3ETBF 3TIDA 3BIKB 2LAGB 4LLUA 1WBXA 2ZCKL 3U46A 3DX6A 4FTVA 3L6FA 4M7LT 4TVPE 3WLWC 5E4EC 3TJEH 2F8XC 2V2WA 1S9YA 1OCWH 4I77H 1J5OH 1Q0YL 2CK2A 1WSST 5F1IB 4M9OA 5TGBA 1BFTA 2YWYA 4KC3B 4ZO7A 5B21A 4OD2A 2EYTA 2VDQL 1FE8L 1QYGH 1RZ7H 2AV1A 1LP9A 2HG5B 3PQYE 5E2WH 4AEEA 1ZLVH 3DYMA 3AGVA 3UYOD 4BA8A 1QBLH 3B5GA 1DQLH 1S3KL 4EN3A 1VDGA 2Y7QA 1I8KB 2ZJSH 1HH9A 1FYTB 2F8OA 3SDYL 1YQVL 1N0XH 1YEHH 4PY7A 1RURL 2X70A 3FRUA 4G8GD 3RIAK 1MI5D 4P2RA 4BQ9A 2R69L 2GI7A 4HMCA 4OM1L 5C0BA 1T1XA 3U7AA 3MV9E 4I3SH 3BE1L 5IBTH 4GBXB 4O5LL 4PRHA 3V2AR 5I0ZA 2DJSA 1WAAE 4JRXB 4JFEE 4EUPH 4MLIA 2ZG2A 1UJTA 2OSLB 3MUHL 5C92A 5T3ZE 4K8RL 1KPRB 5HGBA 5KTEH 4X6DE 5J1TC 2ICES 4KQ4H 5EWIH 2AGJH 1DQDH 2MOVA 4PJ8A 4Y4KC 3LQAH 4JFDA 2JKXA 4JFEB 5C07D 3AAZA 2HT4D 5DJZB 1IC5L 5DRXB 3U30C 3VFNB 3ULUH 1CICA 3QEQE 4X6FB 4X6DB 5D5MB 2BK8A 3NCJL 3OAUH 3OJVC 4NQDD 1FNGB 5D72H 4YZFE 4CU7A 3FJTA 4MWFA 2DQDH 4WO4D 5CLWA 4RGNE 3RZCB 3O3AA 3T0EC 1WWBX 2YHGA 3N1PC 3QQ9D 1P7QD 4PJBA 4PB0H 3X14B 1G7HB 4Y0GA 2RBLA 2GAZB 3CIQA 3QDJD 1YUHA 3MUZ1 1OLLA 1DUYB 3Q3GA 5H37G 3SE4C 3O6FC 3RBGA 5KANI 5I2IA 1FNEA 5TDPA 5TDNB 3I6KA 3WLBA 2CH8A 4PLKC 5IW6B 5DO2C 1AXSA 1E27A 5EFIB 1OP5K 5D7JA 3NN8A 4R2GB 5I15L 3GIVB 5M95B 1ZA3B 5DMKB 4JN1H 4JJ5B 2OK0H 2HKHL 3VXUA 5A3ID 3BWUC 4HBCL 1MAMH 2X4UB 4YXHL 3MJ7A 4X6CA 3GUTB 3WFBL 5C0GA 2F74A 1WBYB 2VLJD 3FQRA 3KXFD 3VXMA 4ISVB 3RL2B 5IT2H 1YEJL 3RRQA 3B83A 4IJ3B 4YDVA 5B39G 3E6HB 3H9SE 2KZWA 3HTLX 2D7PA 4YXKH 1CDGA 5GS0H 1HN1A 2VKWA 4MDIB 1HHHB 3OKOA 4QLRA 1QRNB 1BZ7A 4JY4A 1ACYL 3H9SB 1VKXA 5BZWA 3DVGA 3S35L 2VLMD 4UIKL 2WINA 1Y18B 4P5KB 2IPTL 4EI5A 1I3UA 3TH2T 4DK6A 1NGXA 2Y06L 4KMLB 1Q9LA 3KPPB 1R3HB 5FM5M 4ZFOL 3OB8A 4J7RA 4QRRE 4HKZB 4TRPL 3S35X 2GHWB 2H2PC 3PWVB 3ULUD 5IQ9A 4JDVB 1TJGL 2CLVB 5JHDD 4YHPA 1HHGB 1T83C 2Y4SA 4QRRB 5DMIL 5MEND 3RWEB 5GGRY 4BSJA 3DLQR 5LWYL 3DRTB 4R6UA 4X9IA 2W60B 1L6XA 1PSKH 2Z35B 3QEHA 1CE1L 1F11B 4LDEB 4XCYA 1Q1JH 4UZGA 3TO4A 3FOMA 1P7HL 3PV7A 3QUXD 4NQCB 4ZAKA 32C2B 5J12C 4HJGB 4F8QA 2FHBA 1R3JA 3IAQA 3KDMA 3MUY1 4GS7C 4ELMA 4PRNA 3S36L 1MHEA 2PYED 4ODVH 4A6YH 2R0ZH 3PGFL 1UB6B 2J12B 3FFDA 3TESA 1YNTB 3QO0A 4PJXE 4HGMA 5EZOL 1SYSA 1I9RL 4H8WC 2DQHL 1TVBB 1UFUA 1BAFH 2FECL 1MCJA 3LD8C 4XNZC 2YK1L 1JHKH 1Z9LA 4HKJA 4NQED 3N9GH 5EBMA 1KNOA 1MIEL 3SGEI 7CGTA 4CN6A 2WWMD 3UJJL 1RU9L 3MRNB 3VWJC 4F15B 5D96C 4I3RL 1JZ4A 1YYMH 2NX5E 4P23B 4XP9L 4NP4H 4M5ZL 5EOTA 5EO0B 2BY0A 4L8BA 5DJYB 2X4SB 4LLDA 5HYEA 5FK9B 4OZIE 3SY0B 1FO0B 1H5BA 3PWUB 4AG4H 1JNJA 3QHZH 1CL7I 1D5XB 4OCMC 1M1SA 5JNYB 5DQJA 3C08L 1K3ZA 3UROR 4U1LA 4BK4A 5BMFH 2IEPA 2ZOKA 3PL6C 3B9KC 3OJDB 4OZIB 5C0DB 2EYSB 3O4LE 5C0RH 1HHKA 3ARUA 2CDGB 4GG6A 2AJZB 1PDKA 4QXGH 3GSQB 3OWEA 4GKSB 3RY6A 2GJ6D 2UZXB 5CINH 5CSZB 6FABH 3O4LB 1ZT4A 3L3JA 3W0WD 3B3IB 1CXIA 4M5YL 3LRSB 5IBLD 1LDPH 4GW4B 5D6CA 3LEVL 1GZPB 2ED9A 4OKVA 5F6HJ 3OSKA 4GLRI 1I7RB 4OQ1A 4HPOL 2R1XA 3VFGL 3MLWL 3SE9H 2XT1B 4ZS7L 1LEIA 3EAKA 1XH3B 5ICXB 5KSBA 4WY7L 1PZ5A 3BYYA 2Y6SD 3KAAA 4ZD3L 5JPMB 4NZRL 5L8LB 1NGWA 3MXVH 1ZE3C 4JFXA 3GZKA 4X4XA 1KLUA 2BSTB 4C56A 2YPVH 2VR5A 3O2DH 3RJDA 2AK1H 5DD3L 4Q0XH 3NCBB 3T1FA 4PS4H 1CG9B 3WYRA 3N1FC 1OAXH 3DGGA 1QSVA 2QBWA 3KJ6L 1G84A 1EFXD 2WV3A 1MAJA 4X8JA 5EO9B 1NH6A 3SE8H 3ZMRA 9CGTA 2IGFL 1A6VH 3MRIB 3VXSD 1PAMA 2ARJQ 4OZHB 1MFDH 1U2HA 1GC1L 3DV4A 3QUYA 4HIHB 1WBZB 4HWUA 1IT9L 2AEPL 5EN2B 3UO1L 5DS8A 3PF2A 3DMMC 3UTTB 1CIDA 4MD4A 3L3HB 2I5YL 1I3RB 3OKLA 4S1QL 3TBYA 1FZKB 3CMOL 5IB4A 3ZDYE 3MRRA 5BCAA 4JHWH 4I2XE 4P3CH 1QO3A 1JMXA 1I7ZA 3GHEL 1KB5A 1AD0A 1YY8A 3DV6B 1FNFA 3ZE2E 4MA3B 1C5CL 1BQLL 3DIFB 1FDLH 4OJFH 4QOKE 4WFHD 5HY9B 5BOZG 5GRJH 4X98A 1N59B 4PJFB 5DUBA 4WCYL 1K4CB 5FFLA 1A6PA 2BVPA 2ICWI 4NC1C 4KKLC 5I16A 4RAUB 5HDBF 3P0YH 2QQLH 1ZWIA 3GMQB 3A0OA 5E2UL 2F5BL 3QO1A 4UQ3A 3ZYZA 3A67H 1NSNH 1Q72H 1A6ZA 4FZ8L 4DW2H 5DYOB 1GGYA 3RY5A 5BRZD 1BZQK 2CKBL 3VE0A 2FSEB 1ZGLP 1TETH 3EYSH 1JZ7A 2C1OB 5IFAL 5E4IA 1CFTB 5T1DL 4TULL 3RIFK 2ZCLH 1MHHB 3UZQA 3W5MA 4LQFH 3RL1B 5C0EB 4Z0XB 3ULUF 1OW0C 3RWIA 4M8VA 3TPUB 5D1XC 2D03L 2YUZA 3RWCB 1FHGA 3ISWA 3EGSB 4GRWH 1U9KA 5ETUA 1DBKH 4YGVB 2UVEA 4KJYB 4C54A 4L1HA 5ECJE 4D9QE 2ADIB 4ZUWA 4R97B 3WUZA 1NGZB 1KEML 1T66C 4LMQI 3K74B 2EDYA 3GDBA 3HAEH 3MJ9L 1S5IL 2P8LB 2ATKB 2FX9H 4KZEL 2XTJE 4Z9KB 2Z4QA 2JB5L 3VA2C 1ETZA 3HB3D 3D39B 3UC0H 4PR5B 3C2AL 3D0VB 4GRLB 3H7BB 4XC1H 1MFAH 3EHBD 5KVDH 2X09A 2DS4A 1CR9H 3TVMB 5T3XL 5HGHA 5CBAB 3RNQB 3AROA 3D0LB 2R0WH 3EYQC 3HLAB 3RA7L 2Q6WA 3BESR 5JLZB 1T5XA 4R3SB 3G5VA 4UTBL 4NM4H 4R7DB 4UAOC 3RNKA 3UBXI 4MCZB 3U0TA 3C6SA 3UTSE 4YUEL 4YFDB 5DK2A 3QDMB 3O9WB 3RWHB 4PJ5E 4GSDH 4N0FA 4QNPF 1FNSL 1H8NA 1EO5A 2BRRH 1NMBH 5JQHC 5CEXA 1OGTA 2JJTA 3CVHA 3HI5L 5DWUL 5JOPD 1A9EA 3T4YB 1Q9WA 4LPVA 5DD0L 3HNTL 3G08A 2EE3A 2EDNA 1DSFH 2EO9A 5INDB 5EC2B 3T2QA 1OL0A 4HZAA 1NCCH 1IEAB 5T1MA 3SGKA 4ZFFA 3MGTA 2BNQD 2Z8VC 5C07A 4XNXL 5A16B 5I1GH 4TNVF 4JFPB 3PHSA 3I3BA 4MNHA 1MCNA 2P5WE 5I19L 4PRPA 1A6UH 3HR6A 3TYFB 4QXUH 4NNXB 4NQDA 2GTZB 4QHUA 2AS5M 4XI5D 1MQ8A 1UZ8B 1OSZA 2HTLC 4NNPH 4Q9RL 1GRWA 2P5WB 3TZVD 3D2UD 5K9QI 4BKLB 3GSUA 5GGQL 1KJVB 4XP1L 4J8RB 4CVXA 4K3DL 1GGCL 5J11B 4HS3B 1XGQA 4UILH 1A21A 1SBSH 4G42B 3VFWA 3WIFA 4HC1H 2IPKA 4UOW0 5DD6A 4RDQF 3HG1E 3JV4B 3FONB 1UJ3B 4NKDB 3B6SA 4F7CA 5I73B 5IESL 1NAML 1BBDL 1H0DA 3EJZC 4Y1AB 1DLHB 5BV7H 4GMTL 1I1AD 3MLVH 6CGTA 3HG1B 1OP3K 3GJFH 1SM3L 2K9UA 3FAXA 5DUPH 3ZE0F 3CFKA 15C8H 1ZVSA 4XHQA 1I8MA 2VLJA 4GKNB 1UKTA 3LB6D 3PP3K 3MRCB 1QA9B 2A6KA 3BE1H 5HGAB 3CVIH 4OV5A 1E28B 1JFQL 4UBDD 1JPFA 4HV8A 2CLRB 3FQUA 3WD5L 5CD3B 1W0VB 3MBEA 4HK3J 1P69B 5DJCA 5IVNA 1C7SA 3QUKB 1G0XA 2DTML 4PV9B 4N90E 3I2CL 4WDIB 3KGRA 5ITBL 2ARJA 4JCMA 3VGDA 4CMMB 1RPQA 3L7EB 4X7TB 1FZOA 5IGXL 2CJUH 4L4TD 2IPUK 4NUGL 4OKDA 3BHBA 1MJJB 4H20H 1TZIB 3MLSH 3E2HC 1Y6MR 1EHNA 1NKRA 3GO1H 4NHCL 3C2SA 4ZYKA 5BJTA 2AKRB 1UG9A 3QXAA 3MLYH 1GYAA 5L0QC 1CDUA 4X9BA 3TA3D 4GW5A 4F2MB 3GMMB 5JHDA 1QR1A 1QG3A 5EG6C 5CJOH 2BFVL 4EQ2A 3HPLA 5TFSH 5DJ6A 2ITDA 2VLRD 2EIDA 1T1ZA 4I9WD 4AMKH 4ZDHB 3KPNB 2ZSVA 4EQ3A 3VXQB 1QSFB 2WQ8A 4KGLA 2XQYG 1HOCB 4OLUL 4PJCE 4LCCB 4P2QB 4K7PX 4R0LC 4FQQA 2UUDH 3L95A 3DO7A 3QUXA 4KKCD 3V4PH 1VCAA 2WBJC 3IDGB 3TIEB 4IHOA 1IQDA 4ODWB 4HIXH 4JFHE 2AJ3B 2CMRH 4RISL 4N0RA 3P2TA 2Z8SA 3FB8A 3QEUB 4PUBH 1VFAA 1JYWA 1MCFA 4LRNH 3VD7A 4QF1A 3LQZA 1MLCB 2R4SH 2DMBA 1RUKL 1V7MH 3T65B 5CGMA 1IAIL 4GKZB 4XXDB 4ZNEA 4Z7UB 2FO1A 3EYVB 2OZ4H 1FG2A 2YN3A 4NQVB 2OL3A 1NJ9A 1E6JL 4EI6B 5ACZB 2FR4A 5IF0A 1B6DA 2R0LL 3BKJL 4TUKH 4K8RD 5I1HL 1KPVA 1BMGA 3T0EE 4HT1L 1DL7L 5I1DA 4NSKB 3MNVB 4Z7OE 3RWJA 1A1OA 1JRHH 4FS0A 1S7WA 2VWEC 2NY5L 1PD6A 4IRJC 3BDBA 5SWQB 5H2BB 3N85H 4PB9H 1AI1L 4DZ8B 1D6VL 4PJGF 4GUPB 5ICZB 2EDBA 4XP4H 2VDLL 1OARH 1Q9KA 1CF8H 1P9MA 2BY3A 3SGJC 3Q5TA 2UZIL 2VXSH 4YC2B 2W92A 1BVLA 4F3FA 2MFNA 4KJWC 1M7DA 2ZCHL 4RIRB 43C9A 2DBJA 3WN5A 1N64H 4QWWC 5LCVL 5C1MB 1QLRB 4ODHL 1F13A 3Q48A 4LEOB 3WNNA 1YYLH 3GB7A 4ETYA 1OTSC 2O93L 1J8HE 1ONQA 4WFFE 5EZLB 3QCVL 2NY3C 2XKUA 2HT2D 3SKOB 1JPGB 2F54D 4E5XA 1ADQH 4AL8L 3UP1A 2GJ6A 1U8OB 1C5BH 1C5DA 1J8HB 1SY6H 2X1XR 4KHXL 5KS9B 1JPST 5LAXB 3W0WA 3GHBH 2YSSA 3QAZC 4JR9L 1XGUB 2F8VA 4WHYH 3L5XH 3TBVA 4ZOBA 3ARDD 5LJYH 2YPLB 4QRPA 3S3SA 3SDCC 3DPBA 2DM3A 2XWJB 1T7WA 2YD1A 3MNZB 4WUUE 1I4FA 2WZPD 4AEHH 3WXVH 4R4FL 3BO8B 2FJGA 3FO2B 2QSCH 3ZT5A 5I9QC 3ZYIA 1UADC 1MRFL 4WI3A 2F53E 3BKCH 3DUUB 1E4KA 1MCIA 4UQ2A 2GEEA 2IFFH 1HQRA 3BRFA 5JW4N 4P59L 2J6EL 2I26N 3W11C 3D85A 2ZUVA 3V8OA 1KCSL 4M93C 4R90H 4XMLH 4GRWF 4MA7L 1WZ1L 1ZLUK 3WXWL 1ORSB 5J6HB 3EOTH 3C60D 4I3RH 5EA0H 2OJZH 3EZ8A 3T8XB 3KYNA 3FFCB 5I18L 1EHAA 3I50H 1F5WA 5K59E 1ITBB 1EFXA 1I9JH 1KLFA 2EXYC 4FFVC 1RIVH 4QY8A 5IB5B 2MKLC 3VXSA 1MSPA 2XZZA 1RVFH 3SJVA 4CAGA 5I8EB 4XBPA 3MCLL 4YEEA 2VDPH 5GJTL 3NMEA 3LEXA 8CGTA 4GW1B 5HJ3A 1OSPH 4P5TB 3FMGL 1DUZA 1OB1A 1HHJA 2X1PA 2JELL 2C1PA 1YA5A 4HZLA 3RVVC 4LBEB 4KV5F 4XBEL 4J3UA 3WHXA 2I9LA 5HHOE 1CFSA 5IMOB 3H42L 3OR6A 3RDTB 2YN5A 1X4XA 4NJ9H 4PJIF 2VXQL 1R5WA 4PGBA 3EYOA 2P7TB 2P8PB 3LKOB 1YN7A 3QXUA 1IGCH 4JKLA 1I3GH 3WS6A 2BOCA 2FEDD 3UBXA 3MZTA 3CX5J 4KQ3L 4HAGA 3IS1X 4N5ED 3NZHL 4M1CD 3DYPA 1X9QA 2WK2A 3O3EA 2CLZB 4PGCA 1J0ZA 1CGVA 4NKOB 3GGWA 2BCKB 4M7KH 4NWUH 4OCXH 1N5AA 3TN0A 1LO5A 4J23A 1EGJH 1GCFA 2WUCH 4KK9C 1IC1A 4S1SH 3LS5H 1ZKAA 5A40E 1UCBL 4G7VL 1IQWH 3MRKB 4EDXB 5CUSL 5HVGB 5JOEA 5KSAD 5H37H 3CPLA 3HFML 2AJVL 4KGJA 3MR9B 3P0VH 1ZLSL 1AO7B 4YDLC 4I5BB 1IZKA 4LSSL 4OZGE 3V6OE 4YDJB 2DLHA 4EBQL 5GGVY 1Z5LA 4HIEB 2I5YH 4HUVA 3N1GC 4PJGA 2EDLA 1L9NA 4G80A 1JF5A 4OZGB 4Y5YC 1PFCA 3M8OL 4Y4FB 1YDPA 1UB5A 1C5CH 1AP2A 4M61A 2X4QA 1XZ0A 1JP5A 4XPBH 1X6LA 3BRGC 5E1AB 2N7BA 3LKNA 2HMID 1ZHBA 1TIUA 2VTFA 3ARPA 2PW2A 3DX9B 1E4WL 4LVOB 2IAND 4PYHA 3FO1B 5HHME 3ZKQD 2LU7A 1KULA 4JLRA 4U1JA 3S96A 1PQZB 3BPLC 2VISA 1NCBH 5D7SH 3MLRL 1OM3H 1W72B 3JUZA 3DETD 2P49B 5HHMB 1F90H 1CCZA 3FO0H 3QXTA 5K9OB 5IOPB 2ZUXA 3BT2L 3PDDA 1GGBL 4NNYA 1FL5B 2NTSP 2FECI 1KJ3H 5KJRL 5E9DD 2IWGA 3TWCH 4PG9B 3O45A 1QFOA 5C86A 3MREA 4U6YB 3MRHA 4WV1A 1KTDA 3U9UA 5F7DA 5JZ7C 2BNQA 3CFBA 3SQOL 4F7PB 4DGYH 1V3LA 4MNQE 1URLA 1MF2L 2AJUL 4OCYH 3AUVA 1OWWA 1A6AA 5FO9B 2E7HA 3DWTA 2EIBA 2YOCA 4GFTB 2B4CH 1A5FL 4OLZH 5I1CL 5JMOC 1WJ3A 1UM5H 3D2UA 4WO4C 1AY1H 2Q76B 3FOLB 5JHLL 5C7XH 3S5LA 4MNGB 3IAGC 2H6PA 3K46A 3MMEB 3MV7D 1LEGB 4P4KD 4G6FD 5EOCL 1ZVYA 5D93C 5DMYA 5JW5B 1XGYH 4NC1E 4QHNA 4X80L 5C0CD 3DVFA 5L2KE 1RZ8B 4QHLA 3QH3B 4TSAH 1KCUH 3WFDH 5I66A 2OLDA 1KENH 5D2LA 3NIFF 4P9HL 1I1AA 3AREC 5EUOE 1G9ML 1I3VA 5A3IC 1AGDA 3HI1B 2HRPH 5IVXA 1B0GA 3V5HA 1UACL 1DQQB 5CJBA 3V7AE 3KLAB 2XY1A 1AXIB 3H6JA 4JM2A 3ARGB 1FGNH 4GT7A 4RMWA 3PP4H 2ZPKL 3W82A 2D3VA 2Q86B 5B8CC 3MLXH 1EO7A 1S7VA 1RZJH 5B4MC 3PWPE 1RZFH 3BZDA 4DTGH 4FXLA 5TF0A 5T33H 3PV6A 1U2CA 2HJFB 3BZEB 3NIGF 1T6VN 2J7LA 3EW3B 5GXBB 1SVZA 1WT5A 4L4TA 5CIPB 1AQDA 5AD0A 3MV8D 4NN6C 4TQEL 1T21A 4RFOL 1NLDH 5CWSB 3HMXA 3LQAC 3TIDB 5C08D 1XGRA 4MSWA 4D9LH 3OR7A 4LLUB 3TA3A 1AKJD 1WBXB 3NVQA 3U46B 1H3PL 3DX6B 3L6FB 4FTVB 3ULUC 4NGHL 1FGVH 2V2WB 1OPGH 1S9YB 1UA6H 2XKNA 2LABA 4DCQA 4LFHD 4TTGA 3LEYL 1ZT7A 5AYQA 3GSWA 3RTQD 5TGBB 3UYRL 5IFHL 1KF9B 4OD2B 5J57B 1U36A 2EYTB 1FCCA 1MH5A 2WBKA 2AV1B 1LP9B 3BXNA 1BBJA 4KRMB 4JVPA 5IR1A 4FXGA 4EN3B 3VRLF 2Y7QB 4OSUL 1K2DA 4UAOB 1HH9B 4AQOA 4AEIL 1C8PA 2NY1B 4KMQA 2Z91A 3ARBA 4PY7B 5T3XD 4JHZA 2X70B 3FRUB 4P2RB 5J7CC 1AFVL 2DRUA 1H3UA 5C0BB 3VRJA 4P2CG 1T1XB 2H9GA 2MCPH 5ACLA 2ZG3A 4MZ3A 5I1KH 3UJTH 2Z8WC 3KYKL 1VACA 4PRHB 3K8MA 4JFDE 4HGKC 5FYKL 3GBML 4P99A 2LU4A 2ICWJ 2Z93A 3IU4L 3ROLA 1B4RA 1EMTL 4LCYA 4O4YH 4KPHL 5HGBB 2YD3A 4WFED 1LQSR 1SMOA 3WV0A 1A9BA 2G60L 4PJ8B 3O8XD 4JFDB 1FFRA 3AAZB 3NH7H 1HDMA 3WEXA 5GS0C 4APQA 2YUXA 1CICB 3NTCL 2K1MA 5EZIH 4JFFD 3KHOA 3X3GH 3L5WA 4PJBE 4NM8H 3UTPE 5IB3A 4KK6C 2AEQH 4GAGL 1MJ8H 2M2DA 4L5FL 4Y88A 1HXMA 3OBAA 4MWFB 4NN5C 3O3AB 1KIPA 4PJBB 2FX7H 4DUVA 3S34L 5ALBH 4K7PH 3OKMA 1YUHB 3Q3GB 4ZTOH 3LQMA 2OJEA 1FNEB 5TDPB 5HYIA 5I2IB 1I8LA 3I6KB 3WLBB 4TVPH 1AXSB 1E27B 5J13B 2JTDA 3BPOC 3RVWD 5D7JB 1JN6A 3NN8B 4TPRL 2F54A 4X4ZA 2XZAL 3HZVA 1WIPA 2IALA 4WEBL 5DRZA 5HDLA 3VXUB 4DN3L 1JPSL 2W9DH 1AE6H 3MJ7B 4ZG1A 1J1PL 4U3XA 4HKBA 4X6CB 1MEXL 2NW2A 5IBLC 4MQ7A 3VGAB 2F74B 5C0GB 1INEL 3FQRB 3VXMB 1MIMH 4BQCA 3ARDA 1B0RA 1J1OH 4HPYL 4YDVB 5FUZH 2O5YH 3MRBA 3QDHA 2NY0B 3OKOB 3SDAD 4U4BA 1BZ7B 4YNYA 4OF0A 1SJXA 4JY4B 3WBDA 4HXBH 4E42A 1D9KD 3G04A 1VKXB 5BZWB 3DVGB 5HI5D 1CD0A 2WINB 4EI5B 2DWDA 3I3EA 1NGXB 5T3ZH 5I8CA 1PYWA 3C60A 1Q9LB 5IHUH 2AK4D 2XZCH 1P53A 4PJDF 1BD2D 3VJ6A 4OTXL 2XQBH 4Z95H 1QFWH 3W2DH 5IQ9B 3C8DA 4S11A 5KW9H 4IRSD 4NQSA 4XP5H 3R1GL 5KVFL 1FZJA 5DA0B 4YHPB 4ZFOA 1MJ7L 1ZANH 3C8KA 5FAAA 1NGYA 4DOHB 4KVNH 2NCMA 5H8DA 3IYLW 5EDXA 2B1HL 2NXZB 2XA3A 1A7PH 3MJ8A 5JIKA 1CIUA 4LCWE 2QKIA 3QEHB 3LZFH 2J5LB 4XCYB 3TO4B 3FOMB 3NFSL 1NEZA 2LV4A 3OMZA 1PVHA 1WGOA 4ZAKB 2VC2H 1T1YA 1LO2L 1R3JB 3KJ4B 1X5AA 3KDMB 4O2FA 4ELMB 2VNCA 4PRNB 1A22B 1JGDA 1MHEB 2NYYD 5EULV 3SEPA 1FYTD 2OR9H 4PRID 4QYOA 1OD7A 3FFDB 3ULVL 3QO0B 4ZSOA 4HWBH 1SYSB 2EDFA 2WSKA 4D0DA 4X7CC 1G1CA 2R2EA 4GBXD 2VWEE 2EIEA 4HKJB 2VJXA 5EBMB 3S8WA 2CSPA 4JRXD 1KNOB 3TH4T 4CJ0A 1VGEH 1XF1A 3WXWH 4W68A 3LKPA 2ADJA 4D0CA 4GXUN 3GSOA 4RCAA 5F96H 1T0NA 3P9MA 1WICA 3BP5A 1EJOH 4MCYA 1AH1A 1CXFA 5EOTB 4DJMA 1J1XL 3SDXA 3AMKA 3B43A 2PETA 2FGWH 4JGUA 4L8BB 4M43L 4M8QA 1NFKA 4LLDB 4U6HA 5J3HD 4FP8L 1ND0A 1H5BB 3IDUA 4Y5VA 4K55A 5KOVC 5DQJB 1R0AH 3FHAA 1MRDH 3WDIA 2SEBA 4U1LB 3G9VA 2ZOKB 2JJSC 3K7UA 3RZCD 1XR9A 1HHKB 4TYUA 1IAMA 5EB9A 1YNKL 4GG6B 2BSRA 1RULL 3CU7A 1CXEA 2JELH 5CEZL 3DXAD 2J8HA 1IFHL 5DI8A 4WHTA 1J0IA 3QISA 3EHBC 3ARTA 5E6ZA 1ZT4B 3UTOA 3L3JB 2NXYB 3EOAA 4OCWH 4YHLL 5D6CB 1GPOL 2QL1A 4OKVB 1Y6KR 2IG2L 1PJ9A 4MJIE 3TGXA 2R1XB 4G5ZL 4PYGA 4Z8FL 2EE6A 1LEIB 4IRZH 3LKSA 2YWZA 1P84K 5KSBB 1CFQA 2EH7L 1PZ5B 4Y2DA 3CGTA 1B3JA 2R56H 4LEXL 5E6IC 1NGWB 2FWOA 1KIQA 3B9EA 3S37L 1CLOL 1WK0A 4S1DD 4X4XB 3QIUA 1KLUB 5DFVC 4C56B 1GAFL 2X4TA 4LASH 1WISA 5E9DA 3DX7A 4DEPB 2JE8A 3T1FB 5E8DL 1BOYA 5C8JA 1QRND 3RGVC 1WITA 2DI9A 3DGGB 5DJDA 5SX5K 3MOAH 3I9GL 4JFQA 4X8JB 3CSYA 4FQPA 3VWKD 3ZDXF 1MVUA 3HFMH 2QQKL 3C6LA 4LPXA 4WEUD 3V6BR 1F3RB 4OUOA 2ED8A 4I13B 4YHIA 5I1EH 5F1NA 2BSSA 3STZA 4QTIL 1FO0H 3QDGD 3DV4B 3QUYB 5HHPA 2NY4B 2DAVA 3UMTA 5DS8B 3TZVC 3GKWH 4D3CL 3KLSA 4MD4B 3S3PA 3MV7A 3OKLB 1T03L 2BX5A 4P4KA 3TBYB 5IB4B 1O7VA 5LG1A 3MRRB 4KKNA 3WIIH 1ZV5A 3SOBL 3F5WA 1QO3B 1I7ZB 1KB5B 4JZOA 3WSQL 5C0CA 1YY8B 3OJ2C 4YXLL 2IADA 1KCRL 4Y8AA 4X98B 5DUBB 5L88H 1N7ML 1EXUA 4CDHA 4HUNB 2BVPB 1WLHA 5I16B 4LPTA 2DL9A 5GGVL 3VA6A 3H3BC 2ENSA 1RMFL 4FQ1H 1ZWIB 2KQNA 2AJSL 4NQCD 4PFEA 3FL7A 3V52L 3QO1B 5JQ6L 4UQ3B 1A7OL 3F58L 3VMOA 1A6ZB 2AV7A 1IMHC 5LXGH 2E6PA 2DQGH 4EOWL 3BT2H 3VE0B 1LO0L 3P11H 2A1WL 1T0MA 1LILA 3GI8H 1UXSA 5ENWA 1JTTA 3EO0A 4OLWH 7FABH 4I0PC 1P5VA 5C3LD 2VXTH 5CP3H 2X89D 1VEMA 1CGUA 2CKBA 2YR3A 3RWIB 1RZKL 5E00A 3KNBA 5ETUB 1U3ZA 1XR8A 5TPWL 3U4AA 4HSQA 4HWEH 4KAQL 3CFEA 2P43B 5GPRA 5LGHH 1IL1A 3IDXH 3MROA 3MV8A 3VI4E 3U1SH 4ZUWB 3GFUA 5C08A 5I1IH 3ALXA 2QQNL 3OZ9L 4GAJL 4U7SA 1AKJA 2R0KL 5JO5A 4IOFD 1X5FA 3BWAA 4P23D 4X9FA 1QZ1A 4YGAB 4AQ1B 1Z3GL 2XACC 3GBNH 2GCYA 1Z9SA 1HKFA 4EXPX 4M6ML 2Z4QB 3BYTA 3P4NA 4S1RL 3B8YA 2X40A 1ETZB 2EIZA 3RTQA 2CDFA 4HS8H 5F3HA 3KPMA 3MJ9A 4XVTL 3HNVL 1XCQA 1NUNB 1JZ2A 2VOTA 4G8GE 3E0GA 1MI5E 3DRQA 5HGHB 4ENED 5DD5L 2Q6WB 5E8EA 2OTUA 1T5XB 4QHMA 4HJJH 3G5VB 4JO3H 4Y4HA 4BZYA 3RNKB 2MHAA 2W65A 3U0TB 1T89A 5DHYA 4X6BA 4KKCC 2PKDA 2CRIA 3C6SB 4Y16D 4J6RH 5DK2B 3EFFA 5GRXG 3O41A 1CFBA 5BV7C 2DJ4A 2VXUL 2XXMB 4N0FB 3TV3H 2DDQL 1BIHA 1MFEH 1R24A 4LSUL 2A9NL 3TYGL 1QHOA 5CEXB 1OGTB 4R8WL 3CVHB 3WDHA 4EIZC 3L7FA 1A9EB 2B7DT 1Q9WB 3BVNA 5AWNL 1K3IA 3G08B 3UTZA 1YY9C 4X83A 4AH2A 4U0RB 1FRGH 1IKNA 4OBSA 2P47B 4OUUA 3O81A 1T04A 5T1MB 1BFSA 3MGTB 4TSBH 5C07B 4ZFFB 3O8XA 3HA0A 4NQDE 1UWGH 3VXRA 5D5MF 4DGVH 2LVCA 1WV7T 4UDUA 5DDHA 4HCRH 4MNHB 4PRPB 3VW3L 4J3TA 1NBVL 4KKAD 5KVGL 3RVTD 1DN2A 1AHWC 4QHUB 4NQDB 1BQHA 1A1MA 4X6EA 3QDJE 1OSZB 2DTSA 2G9HA 4WTWA 2F5AL 4MX7A 4YO0A 4I0CC 1J0YA 4BK5A 1KIUA 3GSUB 4ERSH 2YPKA 1V5JA 4JO1L 5CGYC 4CVXB 1YMMD 1ZEAH 3BN3B 1XGQB 1YMHA 3VFWB 3WIFB 2IPKB 4KHTL 3RX8A 5DD6B 1PEZA 3CDGA 5BS0D 3B6SB 4F7CB 3CC5A 4FQLL 1H0DB 1J9CT 4DKEL 2HT2C 3KXFE 4F33A 4MAYA 2DKSA 1NAMA 5AAMA 3MLZH 3CFKB 3KHQA 3UDWC 5GGSY 4X7FC 1NUGA 2XNAA 1ZVSB 1I8MB 5HDBE 2VLJB 5EU5A 1NCDL 1KYOK 3PGDA 4ZODA 3EJYD 2A6KB 1FH5L 3FN0H 3QIWD 5GGTH 4OV5B 4Z18A 2VDML 1W0WA 1LO3L 2YZ1A 3GBMH 1JPFB 4FG6D 3FQUB 1X6NA 4HV8B 1NCAL 3IJSA 5HDOA 1UM6L 2BNRE 5DJCB 3T0WA 5TE6H 1PKQA 3KLHC 5D7LE 4AENA 5EU6E 2ARJB 5JIIA 1D9KA 2FL5A 3QULA 4FZEH 3VD3A 1FZOB 4RNRA 3ULUE 3KPTA 3BHBB 3O0RL 4HH8A 5C6PB 3SCMD 4FFYH 3F12A 3HE6C 5B3JE 4ZYKB 4ZS6D 5BJTB 5ANMA 1BD2A 3QXAB 4K23H 3KPSA 1CWVA 2W0FA 5MENE 4GW5B 3IJHA 5C2BH 3JV6A 3MYJA 1QR1B 5JHDB 1XIWC 2LAAA 4OI8A 2DI7A 4KJPC 3HPLB 4WU7A 5DJ6B 2ITDB 3ZKXC 5IJKA 1T1ZB 5BW7A 2V9QA 2ZSVB 3G6DH 3F7VA 5DHXB 4YDIH 5CAYB 4UV4H 4XHJC 2Z31C 4L4VA 2E27H 5EC1A 2DM2A 1UZ6E 5EBLA 4PP1C 4LIQL 1A47A 4FQQB 4WEBH 4YR6A 3D39D 2PYEE 3L95B 5E0QA 5SV4A 3QUXB 3DO7B 4RQQA 2DQUL 4K2UL 5GZOC 1QFWM 1G7MA 4IHOB 2HH0L 1IQDB 1WVZA 4YHKL 3CXDL 5EIIA 4N8PA 3NGBB 5FB8A 1VEPA 3BKML 3FB8B 2FB4L 4ZNEE 1MUJA 1OAUL 1VFAB 4O9HL 5E95B 4F57H 2MTPA 3BZ4B 1L0XA 3D69A 4QF1B 4PRIA 3LQZB 4NQEE 4QNPE 2FLRT 3BISA 3QDMD 1YJDL 5A2IH 4ODXA 4B50A 1FG2B 2OL3B 1NJ9B 1S7XA 4DUXA 2FR4B 5IF0B 3IFLH 3A6BH 2KH2B 3V6FA 3NFPA 1WCBA 1SEBA 1KPVB 4HF5H 4PBWD 5I1DB 3U79A 4LVHC 3C5SA 3RWJB 4JZJC 1A1OB 4KK8D 1S7WB 3OAZK 4KJQC 1A7RH 1NFIA 4LAQL 3V0VA 4IS6A 4FHBD 2O5XH 4OD1H 3LS4L 5F7EH 4YX2L 5I8OH 1INDL 3HC4H 1Q9KB 3U7WH 3GSRA 5KSAC 4OCRL 1BVLB 4F3FB 1TMCB 2DQTL 2WP3T 1M7DB 5D8JH 43C9B 3WN5B 3GMNA 5D2NC 1HZHH 5GS1C 1EZVY 2DD8L 2NTFA 5I6XB 4F9PA 3QXWA 4ZXBD 3GB7B 2Q7YA 3QQ3A 3ILQC 1ONQB 3W0WE 1NEUA 3FB7A 1NLBL 1KN4L 4E5XB 1U8HA 4X5WA 3DXAA 2GJ6B 1C5DB 4FXKA 1A3RH 3W0WB 2A9MH 5DVLA 3C5ZD 3DUHA 5HYJD 2YSSB 5HGGS 3HZMA 2DQCH 4M1DL 2NR6C 1GVIA 1OGAE 3TBVB 1FNAA 3G6AA 4QRPB 4XPHH 5CD5C 3KYMA 1MHPL 4YPGA 4U1MA 1I4FB 4YHOH 2GYSA 3QEGL 4M7JH 4PTTA 2FJGB 3TT3L 4F7EA 1ZSDA 5GGRA 1HNGA 3MX0A 4UINL 4UQ2B 1HQRB 3WIHH 4HX1A 1L9MA 1FSKC 5T1KA 3FQXA 3D85B 4D0BA 1MRCL 4MA8L 4OQTH 3TJHD 3BEVA 3HKFA 5FM5O 3RWDA 5EU4A 1DBMH 1U42A 3O6KH 1MCKA 5I8KH 5DZLA 2EZ0C 2J6EA 3KYNB 1QTYT 2ESVA 4G6JL 4M1GL 4A6YA 1EFXB 1NCTA 3LOWA 3VWKA 4LMQE 4GMSH 4P5MA 1IC7L 4LSVL 5C9KA 1MOEA 4OZHF 4QY8B 5I76A 4M6OH 3VFSA 3VXSB 3VGFA 3MTRA 3VFUA 5D71H 3SJVB 3QDGA 4XBPB 3UPCA 4PD4K 2VN4A 1MAKA 3LEXB 4WFHE 3T0DA 4HQQH 2X9XA 3RJQB 2BXYA 5H94A 3MOBH 1YNKH 4J2XA 5HJ3B 1DUZB 1OB1B 1UWXH 1HHJB 4QRUA 4DKDC 1NGQH 2EDDA 5CEZH 2C1PB 4HZLB 4MXWL 2FZ3A 5E8NA 1CFVL 4I0KA 3WHXB 2I9LB 4Z6AT 1CFSB 2K7QA 4ZUSA 3OR6B 5E03A 1CDYA 3BH8A 1WTLA 3RWFA 1R5WB 1DE4A 4PGBB 3EYOB 1YN7B 2X5PA 4P2QD 3MRFA 1UCTA 2VZ1A 3S9DB 2BOCB 3UBXB 5BRZE 3AS2A 1K8DA 1HWHB 2DLFL 2IH3A 3OTTA 2GK0A 3LY6A 5FHBH 1KTKE 1CXLA 1KT2A 4R96A 3P77A 3CD4A 2BSED 1MJUL 5ILTL 5BVJA 1T22A 5ERWA 4NQTA 3PDOA 4U7MA 3ULVD 3BW9A 2O5ZH 3O3EB 1Q0XL 1XFPA 4PGCB 4YJZL 3MLUH 3WKML 5T1LA 4F7TA 1D5IL 2X89A 3GGWB 1N5AB 1ES0A 5IFJA 5E5UB 3TN0B 1LO5B 1TJHH 2HWZL 3QFDA 1ZAGA 1FAIL 3P73A 2X41A 2DWEA 2APWA 2YZ8A 3QI9C 1KCLA 5MI0B 3CPLB 5FO8A 3BKYL 4NN7C 4PJGE 2ZKHL 1IGFL 4Z77A 1FL3A 4QCIA 4MJ6A 1DQJA 1Z5LB 2H1PL 3U7YH 4HUVB 5BO1L 2B4CC 3GIZH 4BFIA 1DBJL 4PJGB 5A43C 4G80B 3SOBH 3RGHA 5CZKA 1A0QL 3Q5OA 5KZCD 1YDPB 1UB5B