4N1EA

Structural evidence for antigen receptor evolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
103
structure length
94
Chain Sequence
DIQMTQSPSSLSASVTITCRASQDIAAALNWYQQKPGKAPKLLIYASSYLQSGVPSRFSGSGSGTDFTLTIEDFATYYCQQDGYYPATFGQGTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords immunoglobulin variable light chain domain
publication title Structural reconstruction of protein ancestry.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 94
sequence length 103
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4n1eA00
5F9JB 1XMWA 1S9VB 3MA9L 3L3KA 2D7TH 1N6VA 4IS6B 4Z78B 4RAVA 5F88A 5TQ2H 1EEZA 4Z7VF 4XI5D 2NZ9D 4GMTH 3SE4A 4C4KT 1KTRL 2COQA 2YRLA 4MCYA 3RIFF 1FZOB 4G9FE 4XC1L 2Z8RA 4UV4L 4Q2ZB 4ONHA 3U4BH 4JQVA 1I9RH 1RK0B 1INDH 1UJ3B 1T1WA 1AR1C 1I1FA 1XF2B 4LLUA 1B6UA 3BGMB 1LK2A 3DX7B 4X5WB 4P9HH 4JRXA 4YHPB 1OGAD 4X98B 1NL0H 1NCCH 3EYQD 4OLVL 2MQ0A 4ETQA 4KY1L 5DD5H 4DOHE 3IRPX 3UTTA 3BQUA 4PB0H 4Y8DC 2E6QA 1JWMB 4NDMA 5DQJA 4S1SL 1EHLL 1CFTA 1F00I 3N1QC 3MYJA 3U4EA 2E27H 3MLWH 1A02N 4OLZL 3AAZB 1HILA 1AKJB 4RA0C 4WEBL 4WW2C 1CG9B 4RBPH 1LP9A 2QQNL 1KENH 3HNTL 3N1FC 4HPOL 4K7FB 4MDIA 5KSBE 1MCIA 4G8EB 3V7AE 3D2UB 2FSEA 3GNMH 3L9RA 4TSCL 2PW1B 3GIZL 4R7NA 3GUTA 5IHZB 2D7MA 5ISZB 4EI5B 4OI9A 4OGXH 2GW5A 2FHCA 4JRYE 1ZHNA 1TIUA 1Y6MR 1EV2E 1I8KB 4I77H 5DJ2B 3PGDA 4JJ5A 2V7NA 5FXCH 1KTDB 4HC1A 3RVWD 2Y07L 4CW1B 3KJ6H 4KC3B 5GGTL 3U2SA 2VLLA 5EU6B 2YRZA 2NX5E 3BXNA 5HY9A 2FATL 2Z91A 1F3JA 5GRJL 1WEJL 2WUCH 4P48A 3KJ4B 5EO0A 5IF0A 4JKWA 4OQ1A 4U1GC 4U6HB 5DDHA 4X6EB 1IGTA 2FH8A 4NJAL 2G9HA 4ZFOA 4CJ1A 1KB5H 5CEXB 5FUOH 1X4YA 5DGRA 3IDJA 4Y88A 5DURD 2VLKA 1SY6L 5C09D 1T7ZA 1VACB 4Z76A 4HT1L 5IFJA 1SYVA 3QDME 1WITA 3BE1H 4FFYL 1J8HE 2AJXH 4JFPB 5TQ0H 1QSVA 3UPCA 4Z7VE 2XTJC 4MVBC 4NM4H 3B6SA 2QSVA 3REWB 4QHNA 1NDGA 2AABH 4PB9H 1JHKH 1IRAY 3QUXC 3P9LB 2V2TA 1I3RB 1YEKL 1NKOA 1MPAH 3S3PA 1U8JA 4JDTL 1TPXC 5ACZA 4WDIA 2Q1EA 5MEQA 4RGND 3JTSA 1P84K 5IMOA 2BHUA 5IW6A 1YMME 5MEOB 5KSUB 4XX1G 1I9IL 4QRUB 1DANT 2DOCA 2X42A 1NCTA 3H9HB 3U1SH 1IT9H 4Z0BH 2FO4B 1KEGH 5ESQB 5DK0B 1KB9K 3BKCH 1VERA 3C5ZC 2VAAA 1WTGT 3FTGA 2VWEE 1AI1L 3TYFB 1JGLH 3O11A 1B4RA 1G0XA 5LBSH 1UQSA 1FN4A 1WSST 4YXKL 1UH4A 1OF2A 3DIFB 3WFZA 1NGZA 1P2CB 5HHXH 4P46C 1VCAA 3HFML 4LPUA 5JNYA 4M3KB 4AZ8A 2D0FA 3RUGF 4PJ5B 4IDJL 4JFYB 5CP3A 4NIKB 5FGBA 4F7CA 1I8IB 5LVEA 1YJDL 3WO3B 4GRLD 4NO0B 4HPYH 1PFCA 4X7EC 5DTFB 1EXUA 3OAZK 1J1OL 3OG6B 3RWJA 2ZKHL 4NHUA 2F74A 1JGVL 4K7PL 3FB5A 4HZLA 3ROOB 1BM3H 1FYTA 3DHMA 2X89D 1KEMH 4P2RE 5DMKA 2UUDK 3L3DA 5MEND 4GAGH 3OF6D 3ILQD 3O4OB 3VMPA 2QADC 3VD9A 3LEXA 5FHAL 5KSBA 4MJ4A 4V2BA 3T04D 4P5TB 3OR6A 1LO2L 3MRJB 1ZVYA 1MHPL 1NC4D 3DXAB 3T77B 2BOCA 3FQUA 1CD1B 2JKXA 2BX5A 4KRPD 5C0JB 4Y1AD 1Z6JT 4J12A 3GKWL 4MNQD 4NFCA 3D1MC 1LMKA 5DFVC 3W39B 3PWVB 1A6UL 3HZVB 5EOTA 3FN3A 1FRGL 5H2BA 2DDQH 4XB7A 2ATPA 4ESKA 4ZSOB 1QFOA 2VC2H 3F12A 2A2QT 3VE0A 3QQ4B 2E9BA 4PLJC 5I74B 1XIWD 4GQPH 4ZXBB 5CJ8A 2L7JA 3U7WL 2CH8A 1ZEAH 1U8QA 1TCRA 3SDCA 5I1LA 1GGYA 2BNRD 3D39D 1FJ1B 5F9WC 4EQ3A 1A7BA 5FYKU 1QYGL 1TXKA 1UKSA 4JFZL 3TVMC 1HZHL 3MUJA 3QO0B 3H0TB 4S1RH 1JTTA 5IUSA 1QR4A 1AR2A 4OZ4A 3O9WD 3MLSH 5CP7B 3DBXB 4Z7VA 1EEYB 3PP3H 4HGKC 4JN2A 1AHWA 3WUWB 2X4QB 3FO1A 1FLRH 2W38A 2ZWLT 1CFQA 2RQ8A 3GSNH 1GC1H 5SWQA 4GS7C 3NABH 35C8H 1DVFC 4KAQH 2BSTB 4Y5VC 3QUYC 3MLZL 1ZT7A 1JGEA 3B9KC 5F7LB 4FN0A 1BLNA 1MREL 4ISVA 4F15B 2VZ1A 4G8GE 2HMID 1J0HA 2DQJL 1OW0A 3FB8A 2O5YL 5KSAD 2IJ0C 3MRLA 4I2XA 3TBVA 2QSCH 3PDOA 1DDHA 4G9DA 3RTQC 1JRHH 4F3FA 4OF5A 2VLJE 2UY6A 4NCC2 5CS7A 4HJJL 2YBRB 3KGRA 4E42B 1ZT4B 3EFDL 1BD2E 4IOSD 5IIEB 4YAQB 1YEIH 4HUMB 1CBVH 5EU3A 2LVEA 3RVUC 2R23B 4P23C 2YC1B 4PP1C 4ALAL 2EKSA 3BDYH 4TVPE 5ID0A 5KN5A 1KFAL 1CFBA 3NCEB 4LLDB 4Z8FL 5J11C 1L7TH 3PL6D 3HCVA 3M07A 3P40A 1LE5B 2G5BB 5DFTA 1E4WH 4D0BA 5DJCA 4ZQKB 1V7NL 3CUPA 4U6XA 5T1DL 2BNQA 5EZIH 1T20B 2Q7YB 4M5ZL 2DQUL 2PYEA 5D1XB 5DD1H 5SX4H 4ONOA 3MACL 3TNNA 2GIYA 2C1PB 4P2RA 5BV7C 4MJ5B 2EEBA 4UIMA 1QQDB 1K6QL 3MR9B 1JPFB 3O4LD 4I3RH 2ZJSH 3PQYE 1ZHKA 2QTEA 1T66C 1ZV5A 3VWJC 1U3JA 5D96B 4NUJB 2R2BB 1GZQA 1VFUA 2XWBB 2V9QA 2YK1L 4ZYKB 5C6TH 3BZ4A 3UZEA 3LN5A 2VH5H 2Q6WA 1ADQA 3V95A 1YNLL 4FHBD 4IMLA 2HFTA 5IWLA 1B0RB 1CE1L 2DQFB 1C8PA 1HHKA 1U0QA 3QDJA 3WO4C 2FGWH 4P2OB 1IBGH 4NO5A 3VXMD 4JVUA 4HS6A 5JTWA 3CX5K 3ES6B 5DHVH 4PJ8C 5CKGA 2NXYB 4QXTA 3SOBH 3QNYA 1EBAA 5BMFL 2WBJD 2P5WE 1Q0XH 1OCWL 2XN9B 2EDRA 3PJSA 1I1AC 1AGDA 2HH0H 2FX9H 4WEUD 1X5JA 4PRDB 3TA3D 3QO1A 3TZVC 4DUXA 5CJQH 3WUWG 2J8OA 4HIXL 4AY0A 3F6LA 4ZUTA 4G6FD 1QSFD 1NGXB 3LPFA 4I0KA 3IDNA 3CSPA 5TDPA 3NFPB 3ARDB 4ZOBA 3W2DL 4JG0L 4X9IA 3C6LB 5M95B 5GZOC 4G3YH 1W72B 3DTXB 3QQ9D 5HYIA 5JOEA 5BS0B 3JWDC 4HIIB 4G6AC 1TJIL 1QLRB 4FMKA 3U0PA 2N7BA 1XGQA 4WEMB 3FONA 1HIML 5CSZA 12E8H 4G8GA 3EOBB 4PRIB 4WV1B 5CHNB 1FSKB 4I3SL 3TGXA 2XZAH 1CYGA 3CC5B 4A6YB 3STLB 3X11A 4D9LH 2VLJA 4L8CA 2WK2A 1NCDL 2WUBL 4ZUWA 3M1BB 3QIWC 5E6IA 4GMSH 5LGHH 3Q0HA 4YBHA 2X2YA 1DLHB 3CU1A 1OAUH 1BD2A 2P8LB 3DI3B 1DUYA 3SDYH 1FFNA 4CN6A 3KLHD 3QDGD 1CXKA 2WM0A 4LVNB 3VA2C 4YK4C 2KL6A 3BH9A 3P30H 5KAQF 4CVUA 1XCTA 4Y16C 4KVNL 1ED3A 5ICYB 3MUHL 1T89C 5K9KA 3G5YB 3N50A 5ESVB 3TH2T 4ZNEE 5HI5C 2Z4QB 2I5YH 1N3NB 5CEYB 1NANI 2A77H 1N64L 3G5ZB 2FHFA 5I1DA 1U8PA 2VN7A 1ZT1A 1DSFH 5EZOL 2VXSL 1ODAA 4V1DD 4G7YH 3BIKB 4EUPH 5J9PA 3UTOA 1YC7A 3MRDA 3ZE1F 3DO3A 3QUZC 2BVYA 1KCUH 5ALBH 4EN3C 1Y0LB 3SE8L 3D3VE 4LPXA 5A2IH 5LWYH 3MCKA 2AKRA 4YHNA 4JO2H 1JL8A 1IZJA 3VXTA 1U8HB 1HYRC 25C8L 6FABL 4NQUA 1OAKL 4GBXC 4DVRH 4MA3B 5HYEA 4EOWH 3QISA 4QHLB 4BM7A 3DYMA 1IEAA 1JV5A 4NKOB 3S35X 4OV5B 3OX8B 3ALPA 3FL7A 3KPRB 3RIAF 5AYUL 2JELH 2VSCA 3CMOH 2D7PA 2YD3A 3MRNB 2XA3A 3ALWA 1N26A 5FYKH 4MJ6B 4OQTL 3V6OA 2IANB 4JFEE 5A16A 4ODHH 2AJSH 4I18C 1I9JL 4HUWB 3T0ED 2PTVA 1G7JA 2P42B 4NRZB 5D7SH 1YEGL 1SEQL 3RWEA 4PJEB 2OCFD 2P5WA 5JIKA 1A7NH 1P4IL 2OL3H 4P3WA 4LPVA 3RA7L 5F9OL 1A1NB 3JV6B 5HI3D 2X10A 4PD4K 3LB6C 5ICXB 2JCCB 3GSUB 5E8OB 3X13B 2MCG1 4NQCA 5HI4C 1F4XL 4JZJA 1I1YA 2NY1C 4HWBA 5L9DL 4AQ1B 5HVGB 2HVJB 1IVLA 1ROWA 2PYFA 3EKCA 4LARL 3SGJA 1AFVL 5DZLA 1DL7L 3QFJB 2X4SB 2R0LL 5DRZB 1NEUA 4Y4FA 4Y5YB 1KT2A 4XPFH 4K3HA 4H0HB 3R8QA 3RDTA 3UTPE 2C3VA 3BDXA 4M61A 1OAYH 2R29H 1G7HB 1A2YA 1SM3H 5ENWA 5DZNA 5FYKD 1EMTL 4JQIL 4FQXB 1KUMA 5A2KH 2GCYA 1AXSB 4FQ2H 5BRZE 3H6JA 5HYFA 3F65A 5GSRB 1RJZA 1CTNA 1R3KB 2DLFH 3U7YL 4X7FC 3VH8G 2XPGA 4L3ED 1E6OL 4BSVA 2NZ9C 1PBYA 1BIIA 3GMPB 1UA6H 3MV8B 4S1DD 4WJ5B 3UROR 4WUKL 2IC2A 5BVPL 4FZ8H 1FVEA 3HPJB 4M1DL 3AXLB 1DQLL 3HNVL 3ZE1E 4RRPG 3U30C 3JTTB 3W81A 5EBMB 3RVTD 3BKYH 1SJHB 5IR1B 4S10A 4G42A 3CDCA 4JY5L 1K85A 4QOKD 3EYQC 4IRSD 2CO6B 5T3ZD 4XPBH 1WWAX 3T2QA 2HRPL 4LRIC 3N0PB 2C26A 4DCQA 1O0VA 2WBWB 3S36L 3BRFA 3LD8C 3QHFH 4UBDD 5FFLA 1K9TA 5IV2A 2I26N 3WIFB 2BC4B 2DN7A 1S7XB 3QG6B 4ZD3H 5GJSH 2YEZA 4ZNEA 1JPTH 5GZND 1MEXH 2LABA 1J0IA 1ADQL 2L7UA 5I1JL 1IGYB 4LSRH 4IM8A 3TIDB 1F6AB 1U91B 5JXAL 4PJXA 5FUCC 4R8WL 5ITFA 5C0CD 3L3JB 4JHBA 5C2BH 1DN0A 3PXJA 3QQ3B 1UH2A 3TJEL 1S9XA 1OGAA 1OM3H 1BQLH 4MMZC 2LE9A 4NZRH 3SCMA 3D0VA 4KK5D 2CLVA 5H35A 2VDPL 1DEEB 3ARYA 3D3VA 1GRWA 1KPVB 3O3UN 1IC4H 3DWTA 1CGSL 3WFBH 3ZKNC 5SWZE 1QLFB 4AEIH 2J8UF 4P9HC 3D18A 4L9LA 4GKNA 3IVKB 3LIZL 3SKUD 4Z5RB 3WE6B 4PRHB 4CRPA 4NQSB 1CLZH 1NC2D 2R1XB 1ZOXA 3LZFH 4YDLC 4RZCB 1NGYA 3I6KB 2NY5H 4MAYB 1KG0A 2Z8SA 4NQXB 5K9JL 3CFCH 2BDNH 5MHSE 1LDPL 3N9GL 1A4JB 2ESVE 3NFNB 3IFNH 1X5XA 1UXSB 4JFEA 4ZS6C 4AIZB 1YQVH 4U31A 2XZQH 1YY9D 5J4MA 2FD6L 5DEFB 2JLLA 3RZWA 3GHEL 2PF6A 3W5MA 3RU8H 3P4LA 1NCNA 1HCFX 3KLSA 3HMWL 3D69B 4U1HB 1MCRA 4OCRL 3WD5L 2FBJL 3L3IA 3QPQD 2IH1B 3UTZA 5KZCB 4L4JA 4OLUH 1YYMH 5CUSL 1OSZB 3SJVD 3MNZB 5I1GL 5I19L 4JFFD 3MLYH 4FABH 4PJ7F 4QLRA 3O8XB 2MQCA 3HC0B 2HTKC 1DQDH 4W70A 3BPCA 4DQOH 3FT4A 5B38A 3E6HA 3JWDL 4RGNC 3MFGB 4M6NL 4GG8B 5HHMB 1JNNL 4PREA 3QHTC 2CDEB 4WUUE 5D6CA 5BRZA 4JLRA 2W0LA 3AB0B 3MLRL 1UB6A 2AI0H 1T5WA 3RX7A 1FVDB 4OCSH 5T1KD 5JW3L 1VFAB 2NY0B 1FFOB 3T1WA 2AEWA 1UWGL 4YHLH 4XVSL 3O0RL 3WXWH 3SE9L 5E9DB 4M5YL 5HHPA 1SJEA 2OJZL 3MV7D 3TBYB 1GOGA 4Z0XA 3L5IA 5E03A 4BFIA 4JGUA 4PBVC 4EXPX 3KPMA 5BJTA 2J8UE 1D9KD 2A74A 1BOGA 3PHOB 2P8MB 1HHJB 2QL1A 4N5UA 3RPIB 2IADA 1P9MC 3DMMD 3ECBA 5DRWB 2YPVH 3EYSL 1A14L 5AUMA 1PY9A 5GS2D 1K8IB 3T4YB 1F4WH 5D7LB 3E8UH 3QIUD 4DAGH 3C8HA 1A3QA 2PO6C 2RCSL 2D4DA 1AD9A 4D3CH 1L4IA 5HYQB 4NZUL 1XF4B 3HR5A 5FKPB 2DI8A 3S4SA 2VLRE 4DN4L 5F7MC 4HUNB 4GRLA 4YE4L 2ENSA 3KPNA 4KRPC 5HDQH 3V5KA 1A5FH 5KSVB 1SMOA 2DKMA 3F5WA 4HEPG 2HJKA 4NYLB 1MQKH 4YC2B 4Z7OF 4PGBA 1MJUH 2IQ9L 4OSUL 2V5MA 3NPSC 4HBCH 3LKSB 5DJZB 5MENA 3G6DL 2Z31B 1NJ9B 2YSSB 2NY3C 4HWBL 1B9ZA 2NPLX 4N90D 1XIWC 2NW2A 5IJVA 5J89A 1VA9A 2GI7A 2E8YA 1NC4A 1TDQA 3HG1D 4LNRB 4WHYG 3KXFB 3TO4B 2CK0H 4GAYA 2R0KH 4JAMB 3RBSA 1OGTA 1DBKH 4GRWF 4GUPA 4JVPA 3UCRA 2NY4B 3I75A 5CJOL 2APBA 4ZFFA 5D71H 2FB4H 3D25A 4O2EB 4OCYL 2C3HA 4TTGA 1YYLH 2ZUXA 1WCBA 3QWOB 3MLVH 4E41B 3VXME 3T2NH 3DUSB 4XMPH 1CFNA 4JPIA 3SBWA 4YDKH 3MRIA 3B5TA 5KW9H 4RAVB 1PZUB 1EEZB 4LHQB 4Z95L 3D39A 2BNRA 3FFDA 2XQBH 2EZ0D 3DRQB 3LN4A 1T1ZA 4YZFE 5GGRY 1KBGL 1I7TA 1VADA 3AU1B 4XVTH 1IC1A 3R8BB 5D1QA 5TE7L 4HS8L 1T1WB 3RHWK 2UZIH 1CR9L 3DSFH 3UYRH 1LK2B 3GSOA 3O9WA 2P46B 4LCYB 4UU9A 4N0YL 4KHXH 1Z5LB 1D5XA 1MRFL 4UUJA 3HUJF 1BQSA 4NWUL 1WWCA 5KVGH 3MZGB 4YHKL 3BQUB 4TSBL 4XP6H 4NDMB 1JZ4A 5CEZH 2YUZA 4JFQA 1U42A 2YPKA 1CFTB 4NN7C 4J3TA 3LKPB 5TPWL 2PW2B 1EAPA 3TN0D 4IRZL 3FRPA 1GC1C 4TULL 3PL6C 2IPKB 1KIRA 5KSAA 4X6CF 1LK3H 2JF1A 4HBQA 1P4BL 2J8UA 2W9DH 4RFNC 1F11A 1QG3A 1HQRA 3A6CL 2J5LB 3D6GA 3GSQA 1LP9B 2CKBA 4J3SA 4MDIB 2IF7A 3MLXL 2AJVL 3BEWA 5T5FH 1WK0A 2FSEB 3UC0H 5CIPH 2B1HL 4R7NB 6CGTA 3V4VH 1T2QH 4Z7UF 3UTQA 2QQLH 3AS3A 2J6EA 1FQ9C 3H42H 3JV5A 1ZHNB 5HDLA 15C8H 1EZVX 2D7TL 2GTWA 2DWEB 4LLQA 2DLEA 1FNGA 1ZHLB 2V7NB 4GMTL 5B8CA 3U2SB 2VLLB 4FZEL 5JUEH 1UXWB 3BXNB 4IRJA 3LKQA 3U4BL 1I9RL 5HY9B 1INDL 2VLRA 3Q5TA 2Y25A 3RWIA 4GRWE 1U8IA 3VFPA 3MXVH 1LEIB 4AEHH 4P9HL 1IGTB 2G9HB 4ZFOB 1NL0L 1LO5B 3IDYC 3QZWA 5SX5H 1NCCL 3H3KA 3IDJB 4HFWA 1A21A 4KPHL 2JB5H 4L8BA 4H5SA 5DD5L 1NCBL 3H7LA 4PB0L 1XF1A 5IFJB 1T04B 2XFXB 4JPWH 1EPFA 1T83A 3BP7A 1BHGA 1X7QA 3O41B 1QR1A 2E27L 3MLWL 5D8JH 3ZL4H 4OBSA 5FM5O 2KQNA 1NMAL 5TH2B 1KENL 3TA3C 3UXFA 4LSPH 2DLGA 1U8JB 3GNML 4DZ8A 5ACZB 3IDMA 5I0ZA 4LASL 4WGVB 3HZMA 4C57C 5IMOB 4R0LB 3HUJE 2JIXD 5IW6B 4N1EA 4OI7A 2GAZB 4BK5A 3VXMA 2VIRB 3QQ9C 3KJ6L 1G6RA 1KIPB 3LKRA 4XNMA 2WBJA 1MI5D 1O7SA 5I15H 3FTGB 1WBXB 3I50L 4J3UA 3WFDH 3NTCH 4G9FB 3E2HB 2HG5A 4U6VH 5D7JA 1UQSB 1KLFA 3CD4A 2ZUVA 4Y4HD 3KVQA 4OLYL 1XGUA 3SKNA 1NGZB 5IJKA 4Z7UE 1EJOL 1NLBL 1OLLA 2OQJB 1A1OB 1GIGH 4RIRA 2ARJQ 3C60A 5TQ0L 4DOHB 3KLHC 4CDGC 4QXWA 4OKVA 3QI9D 5J57B 4YHZH 3L6FB 3RWJB 3RGVD 2F74B 3MRGB 1OHQA 4J8RA 2EH8H 3NA9H 3ESUF 3FB5B 4NM4L 2WW8A 2MHAB 1QRNE 1KJ2H 1FCCA 2AABL 1JHKL 3MCLL 3CVHA 3VFUB 3BN9C 3SQBA 2XYCA 5L88H 3L3DB 3WKNA 1MPAL 2Y6SD 5F7HA 2EIBA 5LJYH 1N4XL 4F37F 3LKOB 1TFHA 4HIJA 3GJFK 4M9OA 9CGTA 5KSBB 2Z93B 1QNZH 2W1NA 3OR6B 3VGAC 4H1LA 3MOBH 1IT9L 3AREC 4M6AA 2IBGA 1KEGL 5L6YH 2BOCB 1GOHA 3QDGA 4QOKE 3BKCL 4JRYB 4W6YB 5BW7C 3FMGH 1X6LA 4UT9H 1KXQE 4EIZC 1Z2KA 4NKDA 1RU9L 4KROD 4PJDF 1OB1A 5DJYB 4GG6F 5F9AC 2WWMD 2Q8BH 1ACZA 1DR9A 2HLAA 5C9JA 2NX5B 5EOTB 1HKLH 5H2BB 3G5VA 3RIFK 2ATPB 5FM5M 1NBQA 3GJFB 1F2XK 4ZAKD 2HFEA 4M7JH 5GIRB 1QHOA 2CSPA 3MODH 5GHWH 4JREB 5E94A 5IVOA 3NOIA 4QO1A 3GMLB 4V1DA 1U8QB 5JHDE 1TCRB 3SDCB 4ODSL 5I1LB 3WFEH 4M7LT 5E70A 2ZP0T 2IALA 4XCNA 4WW1A 2VB5A 5FDYA 2MJWA 5DJ6B 4K71C 3QDMB 4PGDB 3IU4H 1J8HB 1U9KA 4LLWA 4Z7VB 5TF0A 2H45A 4RNRA 3SO5A 3GSVA 3FO1B 2X44D 1MWAA 1CFQB 4LCCA 4LLVB 4TNVF 1SJVA 5HI3C 3S7GA 3VXUE 3O6FA 1F3DH 1W8OA 2OZ4A 4L8SA 3VFMA 4JGJA 4PBXA 3V6ZA 4D9RD 3TC9A 1JGEB 4RAUA 1BQUA 2PXYA 3CDGA 2PCPB 3FOLB 5F93C 4P57A 4YGVB 3ZDXF 4ISVB 5IESH 2XV6B 5ESAA 1YMMB 1MJJA 2ZUSA 4RISH 4ZTPH 3FB8B 5HPOA 5IEKA 5IVNA 1XZ0B 3TBVB 3T0EA 2ZCLH 3E3QE 2JK5A 3FO2B 5J3HD 2EIZA 3GZKA 1AKJD 1F3DJ 4LCUA 4P5MA 5FO7A 2VC2L 1KN2H 1AIFB 1K4CB 1C16A 3D2UD 2A6DA 4OIIL 4OLXH 1ZEAL 4S1DC 5INCA 2EDYA 5ISZD 4EI5D 2Z92A 2E7CA 1FIGH 3U0TB 3TCXA 4K8RH 3HCVB 1R5WA 4Z7UA 1SQ2N 3RP1A 3L5HA 2WINA 4KXZH 4S1RL 1ORQA 5FCUH 1KCRL 1CGTA 4D0BB 5EU6D 4LSSH 3MLSL 4H20L 4PJDE 1PG7H 4GG6E 1ZLSH 2HT4C 3FAWA 1FLRL 4LPYA 2XA8H 4ZUVA 1GC1L 1QRNA 4LEOB 5CD5D 3TNNB 3NABL 35C8L 1WAAF 4KAQL 4LSVH 4P2RB 4YO0A 4TOYH 2V17L 4L3EA 4UIMB 4LEXH 4KKLC 3V7AG 5GZNC 1ZHKB 1RHHB 2BOBA 3QG7H 3QUKA 2C3WA 1OARH 4M3JA 2AJYH 4NN5C 1K5NB 3GB7A 1GL4B 2QSCL 3BZ4B 1JRHL 2UYLA 4QOKA 4KK5C 4IRSA 2P24A 4POUB 4YBLC 4Y2DC 1I75A 4OD3L 2H3NB 1YECL 1HHKB 1AGCA 3TIEA 4PJ9C 4HHAB 1JWUB 1A7OL 4NO5B 2XRAH 5C0DA 1MLCA 5D5MF 5IB2B 2NW3B 1S9WA 4LDLB 2G75B 3QNYB 1L7TL 4NO3A 3ZDXE 5C1MB 3U82B 2NY7L 1E4WL 4H8WL 1AGDB 4Z77A 3KYKL 4YNYB 1P84J 3QO1B 4K23H 43C9A 1QUNA 4N1CA 5EZIL 1YY9C 4QRTA 1G6RL 4ZUTB 5DD1L 4MHHG 1KB9J 4YH6A 3IDNB 3DGGA 5J6GA 5T3XE 2Y1VA 3CXHK 5CGYC 3LN9A 3O3BA 3MRFA 3ARBC 4YHYB 4I3RL 1WZMA 3PP4H 2ZJSL 5I8OH 3WYRA 4NSKB 2FR4B 4QCIB 3QPQC 4NQVB 4PJ5D 3UDWA 1MFAL 1G7QA 3U0PB 4OZFH 5LAXB 3P4NA 2UUDH 1ITCA 1URLA 4BQ8A 5C6TL 4NO0D 4WFHE 4M02A 1AO7E 2AV1A 2QHLA 4G8GB 1ZANH 2BY1A 5E4EC 3PABA 2P8PA 2WP3O 5IMLA 2NY5C 4MQ7B 1I8LA 3STZB 4OV6F 4N0UE 4LKCA 2VLJB 3SE3C 4ZUWB 3JV4A 3C9NB 8FABA 2PR4H 5A2JH 4XXDA 5FB8B 5J12C 1BD2B 1DUYB 3T3PF 1FFNB 4L3CA 1CICA 4P5TD 1JCKA 1BFVH 3SJVA 5J1SC 2VOTA 3DXAD 4Q6IA 1Q0XL 1XCQA 2EXYC 2GSGB 3C87A 4JFFA 4FRWA 4G6KH 4BQBA 2HH0L 2FX9L 1CF8H 3I02A 2CUMA 5FYLE 3V0WH 3WBDA 5CJQL 5JPMA 3MRRA 4LMQI 3ROLA 2VDRH 4K3EL 5IW1A 2CRZA 1U8PB 4PJDA 2EICA 1ZT1B 4GG6A 4F9PC 1GCFA 5FA4A 4G3YL 4OIAA 1BBJA 4M93C 4OM1L 2HVKA 4YLQT 4ZXBD 2QHRH 5D5ME 3DMMC 5T1KA 3SKMA 4P9MH 4I0PB 5CFHA 3MCKB 3BFOA 2AKRB 4JFXA 3PQYB 2X4UB 5EZLA 3BW9A 4MS8C 4N9OB 3VXTB 1FLTX 5JO5A 1XGTB 1FG9C 3MNWB 3CGTA 4DKAA 1IEAB 3MV7A 1S7VA 1KLGA 3ARWA 3TWCH 4D9LL 1OPGH 5I8EA 1WZLA 1IAOB 3WFCH 1D9KA 5L0QB 1D5BA 2GTZA 4K7PX 2DQDH 2B4CH 2FX8H 5A40E 4ORGA 2ZUQB 3SDYL 1MFCL 5JW4N 4PJHA 1MWAL 5HGHA 4OF8A 3WHXA 4D94A 5FV1L 4PGEB 5FKAA 4KKAD 3P30L 3ARTA 3QIUA 4GKSA 3CZJA 4DW2L 1G7JB 3EZ8A 4LBEA 3W9DA 2GJZA 4S2SB 2P5WB 1MHEB 1IGFH 2GY5A 1JN6A 2I5YL 1H5BC 2B20A 5E0QA 2A77L 2EEDA 3SDDC 1X5AA 2HN7A 2AQ1A 4UIKH 1EO8H 2XWTA 4G7YL 1I1YB 2OP4H 2VDQH 2PYFB 1TJGL 3ILPA 3WHE0 1KCUL 5ALBL 4K9EL 5EFIA 5DMGD 5FOJA 4ODTH 4Y4FB 3LS5H 5LWYL 1KT2B 4AEFA 2NTSP 3QJFB 2R9HC 1V5JA 2ID5A 2NZIA 2ADFH 4G5ZH 5C0EA 1A2YB 4Y5XC 5ENWB 3D85B 4DVRL 3ABZA 4P4KB 3U0WH 1PEWA 5FECA 5JOPD 1X4XA 3DNKA 2AVGA 3QEGH 3TV3H 4ACPA 1RJZB 2DM3A 3FZUD 4XGZA 2VDKL 1AO7A 4MD5A 1FNEB 4BFBD 4PJCA 5EU7C 1BIIB 1MIML 2JELL 1VEMA 3ULUH 4JPVH 5D1XD 2CDGA 1FVEB 1C12A 4N0UA 4TQEH 4D9QE 5FYKL 3QUMB 4V2CB 4BELD 1JZ3A 1CLYL 3I85A 2CK2A 3U9UA 2ATKA 4W4OC 1LGVA 5D7SL 2DM2A 2DS4A 2QR0A 3S97C 1CWVA 4OFPA 4PYHA 3RNKA 2E7MA 4NRXB 5I1AA 1A7NL 2OL3L 3CVIH 1D5ZA 3DRTA 4HS3A 1NFDF 4LSUH 3G5XB 2BVPA 4XAKE 3MLPA 2YEZB 3VG0H 3IKKA 4GQ9H 4M4RA 1V3MA 2P45B 3KPOA 3ULVH 2D4FA 5T3ZL 2IPUG 1L7IH 5KVMC 4UDUA 3QCUL 5ITBH 1DN0B 4P2OD 4RA3A 1RK1A 4KHTH 4XPFL 3NZ8B 5M94B 5C0AE 3EDEA 3HE6A 3HI6H 3SCMB 2HYMA 5DQDH 2CLVB 5H35B 3ULUD 4PTTA 3S37H 4A6YH 3D3VB 3FB7A 3WN5A 5F7KC 3ZT6A 4NNXA 3UYPA 2XN9D 4XPHL 2NY2D 1VSCA 2DLFL 1CGUA 4L9LB 4I48A 4U1LB 3EZJB 5C70A 5FO8A 1BMGA 1RULH 4QHMA 1UA6L 4POZC 1CFVH 3TN0A 2VXTH 4L5FH 1IGIH 1EBPA 4MNHB 1NGYB 1KG0B 3ARDD 3QA3B 2WZPD 3C6LD 4PJIF 1U3HD 3DVIA 2YD5A 3BKYL 3HE7B 3VGHA 5BS0D 1MCPL 1DE4A 5GS1C 1KCKA 4JFEB 5EPMB 5IFAL 5F6HJ 4XPBL 3PWLA 4ONFH 4MQTB 1RSFA 4FG6C 4TPRH 3O45B 4Y19E 3WLWD 5C71A 1Q0YL 3OJDA 3U36A 3PNWB 4PRID 1BVLA 2EXWC 1RZ8A 5MI0B 1JPTL 3ZMRA 1MEXL 1EZVY 5AZ2L 2EYSA 4F7PA 4LSRL 1A6ZA 3L3IB 5GGQH 4BFEA 3MJ9H 1H15A 1JHTB 2IBBA 3CK0H 5C2BL 2ITCA 4TUOA 1RIHL 2D2OA 2EDXA 1T0MA 5F8RC 4WU7B 1BQLL 3ZTJG 4OFDA 3E6HB 3RWDB 3C5SA 4OCLC 4UQ3B 1P1ZB 1TENA 1IC4L 1ZA3A 1H3XA 3N06B 4AEIL 4QRPE 1X5KA 2H9GA 3FRUA 4FQLH 5F3BB 3SDXA 3U7AA 1BZ7B 1NFDE 3K7UA 5IBLC 5BRZB 4JLRB 1ZA6A 2R8SH 2AJ3A 1CLZL 3NMEA 3VXQA 1BJMA 2A9NH 2AJUH 3V6FB 1T5WB 2LTQC 4GO6B 1NAKH 4XTRD 4QYOA 3IXAA 3RIAK 2BDNL 4ENED 2EDNA 5E5MA 4Y4HC 3RL1A 1MCOL 3MRBB 1DQTA 5HDBE 4F7EA 4X6FA 3MRMA 5HHPB 4QY8A 1XF3A 4B0MM 2XZQL 3L7FA 1IEBA 4O4YH 2JIXA 1CL7H 4Z0XB 1KNOA 4BFIB 5JHLL 1CLCA 3GFUA 2YN5A 5EOQL 5BJTB 4N8VB 4QRRE 4ODWA 4X6DF 3RU8L 3LDBB 5JW4R 1S8DA 2OI9B 3UTSE 3KPRD 3DLQR 2IADB 2N1KA 3GMOA 3ECBB 1PLGH 3OKMB 1R0AH 5AUMB 3K8KA 4J4PD 2A0LD 3PIQB 2R2HA 3FHQA 3MLYL 4PJIE 5EDXA 2IAND 5EC2B 1AD9B 1JGDB 1IQDB 4XRCB 1F8TL 1DQDL 1JPSH 3ZYJA 5DEGB 3HR5B 5C0AA 2Q20A 1BP3B 3S4SB 3N85H 5B3NA 2VL5A 1EDQA 4WI2A 3IFLL 3RWFB 4OZIF 5I1CH 3QI9A 5SWZB 2HT2C 3RGVA 5F1IA 2AI0L 4KZEH 2HJKB 4LCWE 4XC1H 4KROC 5JIIA 1RUPL 3PWUB 4KDTC 4PGBB 5F1KC 2XWJA 3P4OA 3JVGA 4YHLL 4PD4J 2B8OT 3QFJD 4PJAF 1G1YA 3WXWL 4FOMA 3GMMA 4EDWH 1IL1A 4ZAKC 4XMLL 3QEHB 4WTXA 2ZZUT 2AJZB 2ESVB 4BH7B 3O3AA 3KG5A 1IGCH 1KTKE 4FQXD 4KY1H 3IJHB 3S5LA 3TPUA 4GAYB 3SPVA 3LS4L 3VCLA 2KKQA 4Y19A 4S1SH 1J18A 1OGTB 1EHLH 4GUPB 1IM9B 1UWEL 4H0IA 1P4LB 3L95A 3I2CH 3D25B 4YFEA 3MV8D 2BVQA 2XXMB 4XWGH 1F4WL 4OLZH 4DAGL 3ARGA 4JO1H 3MRCA 3SKOB 2FH6A 4R4BB 4D3CL 3SGEH 2QQNH 5I18L 2ICEA 2X5PA 1UJTA 2CIKA 5KAQG 3GIZH 3LN4B 5JLZB 1T1ZB 5F9JA 5E08H 1S9VA 2ADJA 3BN3B 4WI3A 5HDQL 3UJJH 4Z78A 1A5FL 5D1QB 5I9QB 3BPLB 3GSOB 1S9KC 1FZOA 4UU9B 4WUUB 1MJUL 1RK0A 4XZUA 2FECI 1UJ3A 2A9MH 1FDLL 4HBCL 4UUJB 1QFUH 4DTGH 3JWNC 1XF2A 2EDHA 3BGMA 4X5WA 2WNGA 1F4HA 5JR1H 4YHPA 2PTTA 1OP3H 4WHYH 3ZE2F 4OT1H 2A83B 2HA1A 4MA1B 1HN1A 4N8VG 3K8MA 1ZWIB 2CK0L 4EI5C 4XNZC 3WMSA 1JWMA 1AC0A 1KIRB 1DBKL 5DC4B 4OZIE 2P1YA 5D71L 4FFYH 2J8UB 4PRHD 1HQRB 1MAKA 2NR6C 3GSQB 2CKBB 5JW4M 4ZMAT 3AAZA 1E4KA 2EDKA 3BEWB 1AKJA 1YYLL 4MAYD 3KJ4C 1CG9A 1KB5A 4U1IB 3T2NL 4XMPL 4HULB 3UTQB 4PJAE 5D9SB 5CD5C 2UWEF 4YDKL 4HWEH 1YEKH 4UILL 5KOMC 3RWGB 1GSMA 3KHOA 4JDTH 2GTWB 3S4SG 1IKFL 5DRXB 4LLYA 4LLQB 3HRPA 5IHZA 2XQBL 4XPAH 5B8CB 4R26H 5CSGA 1X5LA 4X80H 4IRJB 4XVTL 4PGJA 3RZCA 2VLRB 4XP4L 3TJHD 4PJFF 3RWIB 3UYRL 4CW1A 3S36X 5EU6A 1FNFA 1U92A 2E9IA 2RIKA 1NAMB 2XY1A 4KHXL 4PG2C 5KZCD 3VXRE 3BIAX 3CSYA 4K8RC 4U6HA 5E8DH 2E9WA 4M62L 3ZTNL 1DUZA 4H5SB 5KVGL 1CT8B 4APQA 4ZTOH 1A1MB 1JTPA 3VW3H 4XP6L 3O8XD 5CEZL 3HFMH 3QFDB 3WHE1 1X7QB 4XHJD 1MVFA 1QR1B 3G6JF 4M1CC 3NACH 5HHMD 3BYYA 1LK3L 3PGFH 4FQ1H 1E28A 4YDJB 3FN9A 4I0CC 1Y6KR 3QCTH 5AZEL 3BVNA 2YHGA 3T0XA 1M6OA 5EIIA 4NNYB 1JZ8A 1R3LA 3REWA 3UC0L 4DZ8B 3IDMB 1CD8A 1T2QL 2NY0D 3HZMB 2QQLL 3H42L 1I3RA 1MCQA 4BZ2L 15C8L 2FYYB 1T7VA 1F42A 5E9DD 5AYQA 3VFNB 5KVEH 3VXMB 4HD9A 3ZE2E 5DWUH 3H3BC 4TTDD 2E7LA 5JUEL 3TCLA 5MEOA 1LO2H 4HG4K 2QKIA 4OF0A 2AQ2A 4QRUA 4YPGB 5F6IC 4WFFE 2FO4A 2QSTA 2PNDA 4HKJA 4MSWB 5ESQA 4FFWD 5DK0A 3MXVL 1OP5K 5D7JB 1DBML 4X7DC 1EFXB 5E00A 1NPUA 2F19L 5SV3A 2F8OA 4KDVA 4NNPL 3SKNB 3T0WA 3ZDYE 2WSKA 3DJ9A 1QSEE 5D7LD 1KJMB 2JB5L 2UWEE 3DETD 4R4FH 4JPWL 5EU5B 4MDJA 1RY7B 4U33A 3C60B 2FX7H 2IWGA 4PJ5A 5GRUL 4WI5A 4WFGE 5D72L 3U7WH 4P5TC 1HH9B 3FRPG 4UT7L 3GI9L 1I8IA 3VD4A 1QYGH 3CVHB 4LSPL 1HZHH 4ZPTA 3QB7C 4LSDA 4Q9RH 2OLDA 4HIJB 3QHZL 2XQYK 4L4VE 2GITA 1G0DA 3VFTA 2YA2A 3ZHDA 3H9YA 1L6XA 3MLZH 5I74C 1ZS8A 3T2PA 3H8NA 4F33B 3DXAA 5I15L 3G6JE 5B4MD 3KXFD 4O5LL 3TO4D 4NKDB 2AK4E 1MREH 1OB1B 1F3RB 3WFDL 1R5IA 5C0JA 5C9JB 1CL7I 4U6VL 4AK1A 2O5YH 2PKDA 2NY4D 1KC5H 2XI9A 3G5VB 3QZWG 4HXBL 4AENB 4WI9A 3W39A 4N5ED 4GRWB 3HZVA 1A0QL 3QRGH 2HFEB 5AEAA 4JR9H 2JJSC 5CJ5A 1PSKH 5IEHB 4UTBL 5CILL 4HJJH 5IK3A 5ICZB 4R6UA 1U3ZA 4OAWA 4ZSOA 3EFDH 3VXRA 4E41D 5F7WC 2DLHA 3QQ4A 2LU4A 1GIGL 2IALB 4ZXBA 2D0GA 4GW5A 4WW1B 3FAXA 3BO8A 4ALAH 4YHZL 1CN4A 4YHMH 1FJ1A 1KJ2L 3EW3B 3HPLB 1AY1H 4RNRB 2O93L 2BSRA 3H0TA 3K8LA 3GKZA 4ELKA 3O6FB 5JXED 4OZGF 1V7NH 4L8SB 3VFMB 2DD8H 2X4QA 1QNZL 5T1DH 3V6ZB 2DQUH 3P4MB 2PXYB 3CDGB 5HHOE 3FQRA 1UB5A 3L5WB 3MACH 4ZFZB 2K9UA 5KG9B 4WRLA 5E2WL 5L6YL 4K7PY 3HUJB 5EZJA 1PKOA 3BQUD 1R3HB 3FMGL 5DMGC 5IEKB 3QCVH 2Z35A 3EOTL 4KJWC 4PLKD 1QEWA 2B4CC 2DQCL 4PP2B 2NYYD 2BNUB 3IT8D 3JUYA 4LCUB 1OQOA 2F8VA 1T6VN 3FZUC 5F89B 5KTEL 4M7JL 3DX8B 1C16B 1FL5A 2YBRA 3MODL 1MCCA 1ZT4A 2A6DB 3QUXB 5D1XC 3WFEL 2ZSVB 4ELMF 2Z92B 2ZCKL 3CLEH 2R23A 3GIVB 5L2KE 4Z7UB 5K93A 3GGWB 1WISA 3O6ML 1HQ4A 2WINB 3FFCE 2I60L 3SGEI 1ORQB 5FYJD 1J1XH 4LLDA 5TDOA 4H88L 5D96C 2EIDA 5BMFH 1W0WB 1LE5A 2G5BA 5B3JF 1BFTA 2D7OA 1F6LL 2VLMD 1QRNB 4CUCA 1KJVA 3C5ZB 4M48L 2VR5A 4AH2A 2O5ZH 4H0GA 4HIXH 2H8PA 4K3JL 1T20A 2Q7YA 1V7MH 2VABA 1CXFA 1UVQA 1TVBA 2E3VA 4ZNCD 5C07E 1HKFA 3EUUA 3QUKB 2C1PA 1CE6B 3W2DH 4L4VA 2J88L 4RISL 1UENA 4P2OC 3ZHLA 4P46B 4PJGF 2ILLA 2ZCLL 5GGVY 1KJ3H 3DUHA 3K2UH 4NUJA 4XBPB 5FV2A 2UYLB 2NXYC 3CX2A 4QOKB 1DANU 2P24B 2ARWA 3MV01 5KS9F 3ULUC 4RMSA 1GZPB 4ZYKA 2GKIA 1B2WH 2CD0A 3FO0L 3G6JA 2R0WH 4ZO9A 1KN2L 2AK4A 1KCVL 1NUDA 3P9MA 5CP3H 3CDYA 5HDOA 3T0VA 4OBRA 1AGCB 1KOAA 2XQYG 4OZGE 1X5YA 1PW3A 2SEBB 4OLXL 1B0RA 1MLCB 2D9CA 3WIHA 4ONGH 2DQFA 1S9WB 2D7QA 4L3AA 1MCDA 2WUBH 1FIGL 1UEMA 1LWRA 5CLWA 3AROA 4NO3B 4RMWA 2QADB 3C6LC 2I9LA 4MB3A 1RJLA 1TMCB 3BWUC 2KDGA 1NMCC 5DJDB 2NXZC 4Z77B 3SDAC 5F72S 2O61A 4MXVF 3ULVC 2AEQL 3WJLC 1PG7L 4WO4C 43C9B 4MQSB 5CINH 5D7IF 5DVLA 2XN9A 4KVNH 4J3OC 5D1ZC 4G9FD 3EBAA 3WLWC 3U4AA 3S3JA 3BP6B 1MLBA 4LSVL 5J6GB 4XMKH 4WV1C 4LEXL 4NCC1 4ZS7H 3KYOA 1MFBH 2Y23A 1N64H 1SEBB 1ZLUK 2VUYA 1NBZB 1NGXA 3QG7L 3C6SA 3ARDA 1OARL 4F37K 3C6LA 1G7QB 1U3HA 2AJYL 1W72A 4DVBA 3DTXA 5BS0A 4HIIA 4HLZH 3SE8H 5JW4Q 4OI8A 1UG9A 4MJIE 2ICWB 3LEYL 5BOZG 2H2SC 3PABB 2P8PB 4RMVA 5IMLB 1WT5C 4G43B 1LEGA 3IETA 5F9WB 3VXOB 1OTSD 1IC7L 2AK1H 2Y7QB 2MNUA 2OR7A 5B3JE 4PTUB 4LKCB 2VDNL 3EOBA 3AGVA 4PRIA 5C86A 3CH8A 4JANB 2DI7A 3CC5A 1NFIA 5I1HL 3NN8A 4LAJH 1CICB 5DUBB 4C56D 2IFFL 1B6DA 2F53D 1DLHA 2P8LA 1WZ1H 4HJ0C 4JRYD 4PJGE 1TVDA 1XT5A 4FFVC 5L2KA 4EVNB 3W82A 4X9HA 1I9JH 1TZHA 3FFCA 2WIMA 3MRRB 5KS9E 3VXPB 3ROLB 1BFOA 5J1TC 5A43C 3G5YA 5IW1B 2NX5D 4JN1H 4PJDB 4GG6B 1P4IH 5FA4B 3WLBB 1JNJA 3RTQB 1BBJB 1N3NA 3PP4L 3OTTA 5I8OL 1M71A 2HVKB 3HZKA 2R15A 2F54E 4IMKA 4TNVK 4OCWH 5T1KB 1MCWW 3SKMB 2HTLD 3GMNB 3SDCD 3ZT5A 3MUGA 3MOQA 5EZLB 3I6LD 1NCWH 1Q94A 2IFGA 3BW9B 4LARH 5C07A 1N2RB 2JE8A 4P23B 5EH1A 1Y0LA 2R0LH 3WS3A 4PR5B 2VDMH 1ZANL 2R0ZH 3QDMD 4MXVE 3CAFA 1J8HD 5D7IE 3V5HB 4XNXH 1ZTXH 1ZGLP 4IDLA 5I8EB 4MA3A 5DS8B 4N0CD 1NUGA 2PR4L 3GMRB 4OV5A 5JPNB 4ORGB 1J0YA 4HMEA 2X7LA 4KK9D 3U7YH 3KPRA 1YMHB 3LV3B 5HGHB 3MJ8A 1E6OH 2FNBA 4PIRF 1JNHA 5IB5B 1BFVL 4J4PA 1EHAA 1QBLH 4OZGA 3MRNA 4WUKH 4M1DH 5GQBA 3IAQA 4G6KL 1JK8B 4MJ6A 5BV7B 4OGZA 4LBEB 3PF2A 1YMMD 1TTGA 3W9DB 1KPUB 3V0WL 2GJZB 4LNVA 4HUWA 3Q6GH 5LCVH 1CI5A 1JN6B 3VWJB 4NRZA 4JY5H 2DQIL 1J5OL 2OTWA 2AERT 2HN7B 5T1LB 1ERNA 3S36H 4FQXC 5T5NG 3JV6A 2V2WB 4NPYB 5JDSB 3VGFA 1MAJA 5ICXA 2JCCA 3GSUA 5E8OA 3X13A 1VFOA 2QHRL 1JNLH 2CGRH 1WBZA 4ETYA 1ADQH 1KIQB 5I1JH 4L1DA 3OAUH 4R8WH 3ARXA 5IROA 3QFJA 1Q9OB 5DRZA 2XKNB 3OHXA 5C0EB 2Q3AA 4Y5YA 5FECB 1FZKA 4N0RA 5EA0L 1T7XA 5D6DA 1AO7B 2VDPH 1G7HA 3JWOH 2EE3A 3ZKXC 1OPGL 5IQ7L 5I71C 1XGPB 3VFWA 1AXSA 1CGSH 1I1AB 3NPZB 2DQDL 2B4CL 1KIUA 1Q9LA 1R3KA 2CDGB 1C12B 2DTSA 4N0UB 1D5IL 4P2RD 3U79A 3GMPA 3OQ3B 1QA9A 3JSSA 2RHEA 2VXUH 3MV8A 1UEYA 4WJ5A 5SWSE 1BF8A 4RMUA 3D5OF 2CQVA 4XP9L 3AUVA 5K9JH 4NT6B 5DD6B 2YPLE 5EBMA 5ILTH 4EBQH 1LDPH 3KPQA 3RNKB 5IR1A 3CPLA 5KANG 1IGFL 1B3JA 1D5ZB 1ZHBB 1VB9A 2FECL 4YQXH 3X14A 2APXA 3SO3B 5KVFL 3P11H 4UIKL 5KS9A 3KPOB 4JY6A 2VDQL 3GHEH 3WIFA 1X5ZA 2Y5TA 2J3SA 1S7XA 5EU7E 3QG6A 1HYSC 4UDUB 4F8TA 3KYMB 4ZG1A 2FBOJ 2EO9A 4ODTL 2EC8A 4DGVL 1IGYA 3WD5H 2FBJH 4KK8C 1A7RH 1K2DA 2NY6C 1F6AA 1U91A 3TIDA 4HDIB 3HE6B 4JM4H 1FVCB 3L3JA 3QIWB 4GAJH 1PJ9A 4F9LA 4UQ2B 1JZ7A 5D5MB 4PTTB 2ADFL 2F54A 1YEFH 5I19H 3FB7B 3WN5B 1CDIA 3WIHL 2FEDC 3U0WL 3V2AR 1Q9KA 3T09A 3WDIA 5JQ6H 3LQZB 2KZWA 1WCQA 3K3QA 3JWDH 1KPVA 4QXGL 4R2GB 4M6NH 2GK0A 3ULUL 3H9SE 4QF1A 5D7IA 1JNNH 4TQEL 3ARSA 4BJLA 5HD8D 2ZSWA 3LKNB 4Z5RA 3QXTA 2EDQA 4E0RA 5FM4A 4NCDA 3I6KA 1H9VA 1DE4B 4MAYA 5GGRA 1RVFH 4NQXA 4AEEA 5IHBA 5JW3H 4TSAL 3CXHJ 4YHIA 1U8KA 3WFHB 1UM4H 5C0RH 3BOVA 4XVSH 3CVIL 4DK6A 1B0GB 2R2CA 4EN3B 1UXSA 3SE9H 2LVCA 3OJDB 4G8GD 2HAZA 4M5YH 2FWOB 1W72L 3CH1A 3FCTB 5GISL 1DQJB 3VG0L 1H0DA 4KRLB 5DEFA 5J7CC 4GKZA 2OJZH 4UOW1 2DL2A 2EYSB 1IAIM 4EQ2A 4NJ9L 4F7PB 1F2QA 1ZKAA 2VLJD 4YFLF 2KH2B 2ITCB 4TUOB 1MCNA 5CBEA 2W0PA 3AS0A 2DYPA 3QNXA 3D69A 4KHTL 4U1HA 1BD2D 2YZ1A 2IH1A 3HI6L 4LOUC 4MXWL 3HI5L 5DQDL 1N5YH 1NUFA 3MNZA 4A6YL 2ZCHL 4QNPF 4TVPD 3THML 2NY0C 3K4ZA 1ZA3B 2AAVA 2RCSH 3B2UD 5HVFB 4XVUD 3O8XA 2H9GB 1E6JH 2F9BT 4F58H 1RULL 4TTDC 4LCIL 1ZA6B 2H26A 3Q5OA 2Y5EA 2AJ3B 4YGAB 5F96H 2V9TA 2VXTL 4MNGE 5I1KH 4DN4H 1IGIL 4O2FA 1FL3B 4HKZB 2CDEA 3WCYA 1WWWX 3ARFC 4QYOB 3IXAB 4FFWC 3H7BB 5IB1A 2C4XA 3MO1A 3RY6A 5E5MB 3ELAT 3RL1B 4W68A 4F7EB 3MRMB 4QY8B 1VFAA 4I0PD 4AQOA 4FP8L 3PQYD 4QWWD 5SWSA 2Q86A 3PGCA 1W0YT 2FL5A 4ODUB 4HWBH 1KNOB 5F71A 5E9DA 4JO3H 3HC4L 2YPLA 4ODWB 2WIIB 3A0OA 1EO5A 5HPMA 3EYOA 1S8DB 3MJ6A 1D7FA 5D70H 3GMOB 3MJ9L 1AGFA 2DJ4A 3CK0L 4L4TE 4PV9A 1ZXQA 3ZTJH 1CFSB 2P8MA 2R2HB 1HHJA 4B5EA 5CJOH 3RPIA 2R1YA 4U1SA 2Y72A 3O2VH 1G9NL 4LKXB 1K8IA 3T4YA 3NAAL 5C0AB 1P69B 4JB9L 1I85A 2Z31C 3U30B 4FFZH 4FQLL 1S7SA 5FYJE 2P5WD 1SBSH 2CDFA 5HYQA 1BFSA 1LO0H 1XF4A 5D2LF 1RUQH 5E8EB 4TUJB 4LGSB 2NNAB 4KRMB 2R8SL 2AJUL 5DEZA 5F1IB 4XXCC 3ULSA 4MHHI 5B4MC 3LD8B 1KBGH 3TO4C 1NAKL 2FDBP 3P4OB 3DGCR 1RUMH 1MVUB 3OKEA 3U46A 1CR9H 1T6WA 1GOFA 4NYLA 2VISA 3GMMB 4Y4FD 4WWKC 1IL1B 1MCKA 2APTA 4N0YH 4OB5H 4ODVH 2WQRA 4O4YL 1VFBB 1UT9A 1CL7L 4RWYH 1NBYB 5DJZA 4QNPE 2GUOA 1VGEH 2IG2L 3D85D 2CMRH 4P4KD 5GGSY 2B7DT 4NWUH 1NMBH 1HXMA 1TZIB 4YHKH 3SPVB 4TSBH 4Y19B 2CIIB 4HH8A 3GBLA 4KK6D 3DVNA 3EYVB 4LNRA 3SE4C 1PLGL 1QBMH 1REIA 5J13C 1R0AL 4IRZH 4I8DA 4TULH 2QV2A 1EHXA 2K1MA 3EHBD 3ARGB 4JQVC 4RBPK 5FCSH 1TETH 4PY7A 1P4BH 2CUIA 3A6CH 4X8XA 2AXHA 3KS0J 1JPSL 3EDKA 5DGQA 1YN6A 4FTVE 2FEEI 4YDLB 2CIKB 2B1HH 3N85L 3K46A 5D2NE 1HCVA 5DT1H 2HJLB 1CQKA 2ADJB 3I3EA 3L3OA 1BIHA 3BQUC 3QXWA 5I1CL 3BZEB 2RAMA 4GRMB 4QRPB 3HB3D 3V52L 3DRQA 4MMXC 4S0SD 2DLTA 2OX5A 4FZEH 1RZ7H 1NFDB 4KZEL 1NCUA 3AU1A 4D2NA 2FJHB 4XZUB 2VKWA 4MNGA 2BFVH 5F70A 1IAMA 1JI2A 4LCYA 4P2YA 2J5LC 4L8DB 1CDGA 1WJ3A 4EDWL 5JXEA 2PTTB 1Z5LA 1Q72H 3SCMD 3CSGA 1FH5L 4JZOB 3VWKB 3B5HA 4PRBA 3D3VD 4KPHH 1IGCL 2BERA 3GRWA 2IAMA 3CZFA 1NCBH 4KTDH 1RMFH 5D2LE 1TLKA 3OKKB 1I7UB 3EFFB 2AEPH 3LKPA 3I2CL 4QRRB 3F7PC 2PW2A 4X6BB 1M05B 1IAIH 4XWGL 3UTSB 1HHIB 2IPKA 3X12A 2EDTA 4JO1L 3LH2H 2VQUA 1V05A 4L4TA 1KB5B 1NMAH 3TYGL 1VENA 4X9BA 1PYWB 3HE7D 2H2PD 4PJIB 4C56E 2F53E 1A6PA 4JFED 1OLZA 2UV3A 4LLYB 4LASH 1QFHA 5E1AA 2DQHH 1BWMA 2Y9RT 4L9DA 5E08L 3AFLA 2DWEA 2V2XB 3FQTA 3RZCB 3UJJL 1ZHLA 1JJUA 5GS3A 2H41A 1I8MA 4GFTB 4A2MA 1U92B 1UXWA 4HUUB 4KMLB 5IGXL 4JFOB 2A9ML 3CSYB 3I50H 4DTGL 1QFUL 3TFKD 1LEIA 4R3SA 4DEPC 4LCWB 4RGOL 1DUZB 5JR1L 5HYSA 3ESVF 4APQB 1LO5A 4OLYH 3T8XA 4R96A 1W2KT 4HV8A 1C5CH 4OT1L 1WIPA 4KUCF 4P3CL 3SGKA 3LEVH 3I6LE 4FQJL 2PO6B 3S5LG 3VRJB 1JHLH 1EJOH 1T21B 2H6PA 1OD7A 3UTPD 3OWEA 3HHRB 1NLBH 1B0WA 1T04A 2XFXA 2R2EB 2LU3A 1E28B 3O3DB 4Q0XL 5L8LB 1FO0A 5BRZD 3O41A 4U1JA 3UZVB 1FFQA 2EDFA 3BVNB 1M6OB 5EIIB 3SKJH 1R3LB 5DMYA 3OJMB 3INUL 3QAZB 3MCLH 5TH2A 3E2HC 4HWEL 3BUYB 2IEPA 1OY3B 5E2JA 1N4XH 3V79C 1SMAA 4XPAL 3P3YA 4R0LA 1ZLWK 4R26L 3NPSB 3TCLB 2APVA 4FTVA 2HWZL 2QKIB 3MMEB 4X80L 3QT2A 1CXHA 2GAZA 2NY3B 5D2NA 2EEAA 1UWXH 5FGBC 2VIRA 1NANH 5K9OB 4HKJB 5E5RB 1KIPA 1MIEH 4P2CG 3DV4A 4U05A 5E00B 3NVQA 3KHQA 1WBXA 1RU9H 1S7RB 4IOIA 5E8DL 4G9FA 3C2SA 4WIQA 4ZTOL 1LO3L 2CO7B 3VW3L 5EU4A 2YUVA 3DX6A 4MDJB 1JYXA 5DO2D 3HMXA 1NH6A 5J1AA 5CJXA 4A2LA 1YNKL 3MPCA 1VFMA 2YN3A 4FQQA 4ODSH 2OQJA 3NACL 2APFA 1A1OA 3BSZL 3PGFL 3R0MA 3V4UH 4FQ1L 2AXJA 4LVHC 5MEPB 1MSPA 2XOTA 5SWZD 3L6FA 2CLZA 3BH8B 2BZDA 3QCTL 3MRGA 4ZPTB 3EO1A 1N59A 3PP3K 4OZIB 2VZ3A 2MHAA 4P2QE 3CCHA 4KKBD 3VFUA 4KJPD 2YMXL 2F58L 2GITB 3VFTB 3LKOA 5KVEL 5DWUL 2R39A 5MHSD 4PJAB 1WVZA 2Z93A 2ESVD 1U3YA 1ZS8B 4C56A 1TCMA 2F53A 2HTLC 5E2VH 3SDCC 1VHPA 5DA4A 1KV3A 4KJQC 1O7VA 4JRYA 1R5IB 4CVZB 3U9PH 1IM9D 4NN7B 3F7VB 2AV7A 3OL2A 1MNUH 5DJYA 5HVHB 1WFUA 3GSNB 1X4ZA 1NGWB 2NX5A 1AHWC 4NQDE 5IK3B 2Q87A 4OAWB 3VXRB 4KI5F 4HUVA 2A6JB 4R4FL 3GJFA 1EJ6A 5GIRA 2ADGB 1ONQA 4GW5B 2FX7L 3DECA 1IM3B 2YD7A 4OIIH 3BO8B 2J12B 3GMLA 2CKBH 4HGWA 2L4OA 4AIOA 5I2IB 1AGEA 3ZKMD 3MFFB 5C0GB 4M1GH 5D1QD 3L3HB 1OW0C 2BSRB 5DJ6A 5DLML 2J6EH 3QDMA 3X3FL 4PGDA 4Q9RL 1KCRH 4RGMB 2QBWA 1J8HA 4ELKB 4WUUD 4H20H 4MA7H 4PUBH 1OTUD 1MQ8A 5C8JA 3B2VH 4LLVA 3FQRB 1UB5B 4HFUL 2DWDA 4IHOB 5EN2B 2V17H 1JUFA 5EZJB 5HHNA 1T2JA 5JA8B 3RUGE 1DBBH 2OTUA 1A6WH 2Z35B 3CFDA 2PCPA 3FOLA 2YWZA 2W60B 4YGVA 5D93B 1F6FB 1QEWB 1YMMA 2NLJB 4GW4A 3AY4A 1CIUA 3GBMH 1XZ0A 1GGBH 1KC5L 3GRWL 4XWOC 1IJ9A 3NZHH 3FO2A 3LY6A 4HZAA 3QRGL 3FQWA 4JR9L 1PSKL 2G60H 4X4XB 1FL5B 2AW2A 4OD3H 1L9NA 4JFDE 2C7UB 2XICA 1U8OA 2J1KA 4KV5F 1EGJA 1YECH 4XC3L 1QSEB 1AIFA 3REVA 1K4CA 1G7IB 1A7OH 1VDGA 1HQ4B 2UWEB 1IC5H 4YFDB 4OGYH 4YHML 5TDOB 4X8JA 1S78D 3U0TA 2Q7NA 4IRJD 3DURA 1AY1L 5E2TH 2VLRD 5JORA 2NY7H 3ULVF 2IQAB 4H8WH 3IS1X 3M17B 3KYKH 1KJVB 4YDIL 4ZO7A 1ZK9A 4AH2B 4ODBD 3R4DA 2DD8L 2H8PB 4HC1L 1G6RH 2VABB 4ZUSB 3S35L 5IWLC 1UVQB 1TVBB 5DSCB 4P2QA 4LEOA 4KI5E 1HOCA 5DHVB 4L4VB 2IBZX 3BMWA 2OSLA 4U49A 1DLFH 4WTWA 2A1WL 3NGBC 3QCVL 3JWOC 1WTLA 2Q76A 4ZFOL 1RHHA 2VO5A 4QXUL 1PZ5A 4LFHG 1MFAH 3IF1A 1A9EA 5EO9B 1K5NA 3B9EA 2P47B 4OFVA 3G6JB 3DO7B 4DFIA 2AK4B 3P9MB 4U1NB 1ZVSA 3LQAH 3BAEL 1F02I 3VFSB 2H3NA 4YEEA 5BQ7A 2W9LA 2CLRB 4DN3H 1IAII 1N6UA 3CLEL 5HD8C 4NQDA 4NBXB 4HHAA 4LRNH 1JWUA 3CVHH 2I9LB 4RFOL 1RJLB 5IB2A 1YEDB 2NW3A 1J1XL 3NA4A 2G75A 3WEXA 3VGAB 3BT2L 2O61B 3I9GL 3V4PH 4Z7WF 1BVZA 5IB3A 5C6WH 3AREB 5MERB 5DI8A 2NY2B 4YNYA 5HGGS 5D7JD 2BHZA 4H1LH 4JKPL 1EFXD 1MLBB 2O5ZL 4HG4J 3ALXA 5C0ND 3KYOB 1V7ML 2C3GA 1L0XA 4K3EH 3VG9C 2QLVB 5I75C 3T0DA 4KV5E 4LLMB 3C6SB 3Q6FA 4UAOB 5E6IC 3QWRD 1S7WA 1U3HB 4OM1H 4DVBB 5HHOB 5FEBA 4NSKA 3AVEA 4GXVL 4JPKH 4N8CL 2FR4A 4QCIA 3C60D 4R7DA 5EBLA 5A3IC 1KJ3L 4NQVA 3K2UL 4Y4KA 1LNUB 2WP3T 4GRWH 4AMKH 1HH6A 3SHSA 5LAXA 3RUGA 1LEGB 3IETB 4DJMA 1B2WL 3KYNB 4K07A 3IGAA 2R0WL 3B2UC 2B5IC 3BEVA 3ULVE 4XVUC 1MH5B 2DM4A 5J56B 2UVEA 4K71B 3RGHA 1T5XB 2N4IA 4KWUA 2EYTA 3T3MF 1JPST 4MQ7A 1NFIB 3STZA 3RWHB 4EUPB 4ONGL 3NN8B 4XAWH 4N0FB 1CXLA 3HLAA 4JM2F 3C9NA 1AR1D 1GGIH 2DI9A 5DJ8B 1RAMA 5FB8A 3AM8A 2G2RA 1C08A 1MFCH 1FC1A 1MWAH 5L2KB 1DBAL 3RQ3A 5IFHH 2B2XL 2GSGA 1TZHB 3FFCB 5CINL 2OZ4H 5LG1A 5FM8A 4QWWC 4DW2H 4XHQA 5IMMB 1BFOB 3OKOB 5H37G 3S88L 1S9YB 4NFDA 2VTFA 4U2YA 3FB6A 1A3LH 2BVUA 4O00A 4XMKL 4ZS7L 1MFBL 1T4KA 5E99L 1M71B 3HZKB 3WJJA 4NKIH 2LU7A 2X6MA 1EIBA 3S34H 3MUGB 1UZ6F 2ZUQC 2QSQA 1TJGH 1Q94B 2OK0L 5C07B 3T2OA 3V6OC 3WS3B 2JB6A 4K9EH 1F58L 2DM7A 4I0PA 1N8ZB 4MWFA 4AT6A 3PQYA 2X4UA 4Z7WE 4JEGB 2AK1L 4TRPH 1UADC 3GSRB 1QPXA 1XGTA 3BD5A 3EAKA 5H8DA 1BEYH 3MNWA 2XG5A 2VDKH 2X7LB 3O6FD 2I07A 1JP5A 2BSED 3MJ8B 3JUZA 1IAOA 1MIMH 1JNHB 1WGOA 5EWIH 4QRQB 1JYNA 4OZGB 2PXYD 2EKJA 4JZJC 4PGZA 3OZ9L 3BKML 1WZ1L 3SGJC 1YEHL 2BMKB 1RIUL 4PGEA 1CLYH 3BP4B 4Y4FC 3ZKQD 4CBPA 4K3DH 3BUTA 3QPXH 3RDTC 3EJJX 4DKFL 1J05A 2OTWB 1M7IB 4JN1L 1KTLA 4S2SA 1ETZB 3GM8A 4RDQF 1MHEA 1S5HB 2D0HA 3EOYG 3D9AL 4XB8A 3VMNA 3RWCB 3T3ME 4MVBD 4KK6C 2R4RL 3EIFA 1SVZA 1WBZB 2BY0A 4OCWL 2E8ZA 1B4JH 1OSPL 3QUXD 5T3ZH 3F58L 1NCWL 5CSBA 3QCUH 4HLJA 3ZSTA 3OHXB 2VDML 4AM0B 4U6YB 2R0ZL 2PN5A 1EGJL 1U8NB 3LPWA 3QJFA 1FZKB 1G7MA 2CRYA 3MTRA 3V0VB 1PKQE 1H3VA 4XNXL 1ZTXL 1KGCE 4OM0L 5INDA 3D85A 4MJIB 4P4KA 1MUJB 4XPHH 5TE4H 3VFWB 3KPSE 1MFEH 2X1PA 1QRND 3GSWA 1Q9LB 2FEEL 3C5ZD 4JHWL 1FNEA 3UJTH 5I30H 4OZHF 4XI5C 1QA9B 3OG4B 2UVFA 1QACA 1QBLL 1Y6NR 3ARUA 3QUMA 2H32A 2VDOH 1IEHA 1UZ6E 3Q3GB 32C2B 3ARBB 3MRPB 4DWHA 1FNHA 1XH3B 3KPQB 3NCJH 4P46D 3CPLB 1BAFH 3Q6GL 5LCVL 1MCPH 4UMGA 4QTIH 3SCMC 3O3EA 3VXNA 5IFAH 4PJGB 3X14B 2XNAA 1RV6X 4EIGB 4NRXA 1IFHH 5KS9B 4JY6B 1Q0YH 2Y5TB 1U58B 3G5XA 4G8FA 1PY4A 4L9LC 3DI2B 1JNLL 1MCBA 2CGRL 1OOAA 4P59L 5EORL 5AZ2H 5GRVK 3ET9F 3B8SA 1FAIH 1K2DB 3IFOB 3OAUL 2GSIA 3LRHA 4HJGB 1RIHH 2F54B 3BX7C 2QADD 5J12B 5JHDD 3O6KL 3NZ8A 5F7NC 1Q9KB 1T2XA 4F57H 2VE6B 4R4ND 3JWOL 1FORL 1KPRA 2X70B 4U4BA 1BOYA 2DICA 2GK0B 2ERJC 3A67H 4QF1B 3FQNA 5D7IB 4U1LA 3V9FA 2ZSWB 5HHVH 2LAGB 2CR6A 1OAQL 5MI0C 3RVWC 2VXUL 4E0RB 4LGRB 1IAKA 1NKRA 1DEDA 3K4AA 3VXUD 4H26B 4MNHA 2DBLH 1OT1A 2VZSA 5GGRB 3QA3A 3B9DA 3L5XH 4YHIB 5ILTL 4EBQL 4BUHA 1U8KB 4AL8L 3HE7A 1CTOA 4QHUB 1MCOH 3G6AA 5C08D 3F8UB 5EPMA 3RVXD 5I0DA 5DK2A 4YQXL 4LPWA 3CH1B 1NSNH 4X4ME 3P0VH 1G7PB 1H0DB 4GKZB 3P11L 3O45A 4CN4A 1CLOH 1VESA 3PV6B 4U1KB 5JHLH 3PNWA 5FGCE 5I8CB 5EOQH 5FIEA 1N6QH 1MCLA 1CCZA 5CBEB 2DYPB 3QNXB 1N0XL 4OZHE 5I73C 1A7RL 3ISWA 3N1MC 2N7AA 1CICD 4JM4L 1UYWL 1JHTA 4EXKA 4GAJL 3TPKA 1YEFL 3QDHA 3R06B 5CBAA 4JM2A 4WU7A 4IEFB 5JQ6L 2RR3A 3MGOB 1P7KB 4C55A 5C0BD 2FZ3A 3RAJH 1F8TH 1CZ8L 4PV8A 4ZODA 3RWDA 4UQ3A 4AJ0A 1P1ZA 1OWRM 3IDGA 4IIQA 2H26B 4KTEH 3MGTA 5GS2H 1SBBA 5F3BA 5HGDB 1PKQA 4O2FB 2DKSA 1NGQL 1PG7X 4TVPL 3IDIA 1BZ7A 3IFLH 3KPSA 3LDBC 3RTQD 3O2DA 3S9DB 2OI9C 5IB1B 4WY7L 3MO1B 3SDDB 4Q58C 3DSNA 4MGXA 4XNQA 3V6FA 1ZLVH 3VMOA 1RVFL 4NC2B 4J7RA 4BUGA 1RUPH 5SWSB 5FO9A 4GLRI 2Q86B 5C0RL 1UM4L 3D87B 3PGCB 5TGBB 2Z8WC 4P23D 2FL5B 2MTPA 4Q6YA 3O2WL 1MFNA 3MRBA 3QXVA 2YPLB 2J4WL 4XMLH 4WCYL 5HPMB 3EYOB 2MWCA 5DO2C 5T3XH 5HBBA 5E2UH 4Y5XB 3PV7A 1YC8A 3IXTB 1AGFB 4N8VA 4PV9B 3CSBA 3PXHA 3MJ7B 3LS4H 4GRLC 3OKLA 3JBG7 1GXEA 5E8NA 1B90A 1UWEH 1U36A 4UINH 5GSVA 2R1YB 4U1SB 1ZVHA 3HKFA 2DTMH 3UBXI 1N5YL 3OKMA 1FHGA 1CGVA 3PIQA 5EOCH 4KKBC 3ARVA 5DHYA 1S7TA 3P0YL 5GS0H 4KJPC 3S98A 1HXYA 5EC2A 1JGDA 1IQDA 3ILQC 4XRCA 1S7SB 5I18H 1AC6A 4Y7MA 1E6JL 2CDFB 2VYRE 5FAAA 4F58L 3EDFA 5DEGA 4JKMA 2MCPH 3VWJD 2ENYA 4BKLA 1DZBA 5F96L 5EIVA 5T1LD 1CU4L 5I1KL 3ULSB 3IS0X 3RWFA 1MHHA 5SWZA 3H9SB 3OKEB 3U46B 2DQGH 4M9PA 5EOCJ 5T3XD 4MX7B 3OKNB 2VISB 3PWUA 5DJ0A 1FDLH 3JXAA 2GUOB 3LSOB 1HHGB 4OCNC 4PJ7E 4JO3L 5CCKL 1FL6A 1HXMB 3SBWC 3QEHA 3OPZL 1I7RA 2AJZA 2DQEL 2ESVA 4WFHD 1AO7D 2VXVH 4BH7A 3DVNB 2OJEA 3ZO0A 5D70L 5GS0D 4WTZG 3IJHA 5EULV 4X4MA 1N7MH 4NN6B 1I1AD 2BXYA 5GGTA 7CGTA 4LVOB 1MRCH 4LDOB 1IM9A 5D1QC 1NDMA 1YQ2A 2A73B 1P4LA 1QHPA 4PY7B 1QLEH 3O2VL 2CXGA 2ZOKA 5ALCL 3O9WC 4WW2F 4GSDL 5F7DB 1YN6B 4OJFL 3UO1H 2MMXA 2V5TA 1VPOL 1EFQA 1X5IA 4CVWA 3SKOA 4R4BA 4FFZL 2YWYA 3G04B 2F5BL 5FHBH 4HWNA 1BGXH 2YRPA 1SBSL 2JJTA 3QUML 4UILH 1LO0L 3L3OB 1RUQL 4G6AD 4ZDHB 3GSXA 2V5RA 1GGCH 1SY6A 5GS1B 1IKFH 4NGHH 4MA1C 43CAA 5FYLD 1RZJL 5JLZA 1KXTB 4BH8B 4M7KH 3X3GL 5EO1B 1JZ2A 2W07A 3U6RA 2HMIC 2FIKA 4XP4H 4MNGB 5KSAC 1RUML 2VR4A 4N1HB 4HCRA 4UV7L 2PETA 4DGIL 1WV7T 3C09C 3F7QA 4CMHB 4M6OL 1KSRA 5SX5K 4WUUA 5LGJA 4NC1E 3RVVD 4OB5L 4AG4H 4ODVL 3HE6D 2VITB 3MUY1 4LPTA 1PQZA 4RWYL 4HH9B 3QIWD 2OMBA 4PRBB 1VGEL 4M62H 3ZTNH 4JRXE 4E9LA 5JZ7D 3DUUA 2CMRL 4NQEE 3MRKB 1GPOH 4CVXA 1NMBL 2IAMB 3CZFB 4Y2OA 2X9XA 2A83A 1J87A 3RNQA 2F15A 4R2GD 4PY8I 3JZ7A 3MBEA 1ZWIA 1QBML 3UTTE 5B8CC 1WC7A 5C3TA 2X4RA 3X12B 4IRJC 3BPNB 3VFGH 3NCMA 1E4XI 5HI5D 1TETL 4QTHA 4L4TB 4G7VH 5AZEH 1UKTA 2MPAH 5DRNB 1J0JA 5BVJB 4Z7OE 3B9AA 1QFPA 5TFSH 2LTQB 5JIHA 4U1IA 1NCAH 5DT1L 5E1AB 5D9SA 5DD3H 3WDHA 3S8WA 2EYRA 1IMHC 4BZ2H 3RWGA 4EN3D 1BJ1J 3FQTB 5DRXA 4GAFB 4F2MB 4WI8A 4JQXA 4C54A 1T83C 1GHFL 1RZ7L 2R56H 1J88A 1I8MB 1JMXA 5CMAA 4WU5A 2ZG3A 1NBVH 4U7KA 2BFVL 5GGUA 2A6IA 4R3SB 2UZYB 2OM5A 1DBMH 1H3UA 3QDAA 4MCZA 1FYHB 1L9MA 2F19H 1JF1A 5HYSB 1NAMA 4J2XA 1Q72L 3T8XB 4R96B 4KU1A 4NNPH 4HV8B 5EUKA 4FQIL 4I3GA 3BD3A 3KPPA 4HWUA 4HIHA 5F7FA 4OGAD 1A6TB 3OSKA 1CT8A 4KTDL 2ICWI 1A1MA 1L0QA 2H6PB 4H8WC 2P5EE 1RMFL 5KSBF 3QFDA 1IKNA 2VLKE 4ZOAA 4PJ7A 4FQHB 5TJWK 2AEPL 2IBZY 1A6AB 5F7UA 1FO0B 5GRUH 5D72H 3WV0A 2X41A 4U1JB 4Z7NF 4UT7H 1IAIL 3GI9H 1LE9B 2WBJC 3ZYIA 1Y18B 3LH2L 4OIBA 1I9EA 4YDJA 2RBLA 3BWAB 3WS6A 4K2UH 1AE6H 5D7JC 3GDBA 3LB6D 4D9QD 3BPOB 5F1NA 4NNYA 5C0NC 1IE5A 1A7QL 3O2DL 1XGYL 2NY1D 4DGYH 5IJKC 3QHZH 4U3HA 2DQHL 3MOAH 4KJYB 2EO1A 1J9CT 4FTVB 2FYYA 4LHUB 5KANI 3VFNA 3LQAC 5D2NB 4KUZL 1KLUB 3NCYP 1CK0H 2Q3ZA 5DYOA 3DV4B 3C60C 1S7QA 3IAGC 4YPGA 3C08L 4XAKD 4O5LH 3UPRA 4IOIB 4MSWA 4X6CE 1FZJA 2XTJE 4JFHE 1JWSA 1EFXA 1IGMH 4XCYA 2OBGA 1G0YR 4HXBH 2D31A 1C5CL 5EU4B 1H8NA 3DX6B 1A0QH 2X1QA 4WFEE 3LEVL 2VZTA 3ZT7A 4M43L 4UTBH 5CILH 1KJMA 2DAVA 5J1AB 5C0AD 4OD2A 1JHLL 2XXCB 3QWRA 1C7SA 4B7IA 4FQQB 2O5XL 5EU5A 2AXGB 1QO3A 1WIUA 3PWPE 4LIQH 3S37X 4NQEA 2PTUA 4S1QH 1HH9A 1H3WM 2CLZB 1NLDH 3EO1B 5D2LB 1N59B 3QIBA 3SKJL 5ACLA 4G6JL 3OGOE 3AS1A 5AD0A 3CCHB 2YXMA 1MCFA 2BXZA 3HZYB 1FYTE 5EIQA 4U7SA 4XH2A 2ZG1A 2ZUYA 5IVZA 4C56B 5LQBH 2DJSA 2Q8AH 2W65A 4OF6A 2F53B 5E2WH 3BP5A 1IGJA 1BREA 4XBEL 4OTXL 1MIEL 1WIOA 4Y19D 4O9HH 4F33A 3BHBB 4UTAH 2XKUA 4Z7NE 1CVRA 2AV7B 3EOTH 5ELIA 4XNZB 4KQ3L 3ZKND 2DQCH 1JFQL 5CKAA 4G80A 1AXIB 3ARGD 1TQBC 2ZG2A 5HYSG 2IGFH 4AENA 4LCCC 4HUVB 5KTEH 3GHBH 3O6FC 5IEHA 1ONQB 4L8SC 5ICZA 5A1AA 4WW2A 3VDCA 4RAHA 1TQCB 4KKCD 1CXEA 3HS0B 2PXYC 4HGWB 3UBXA 1AGEB 1G9EA 3V4UL 2ZCKH 4BSWA 3O6MH 2F8XC 4QRPD 4ZS6D 1SYSB 2P5EA 3WXVL 3C8KB 2I60H 2I9TB 3RX5A 3T0EC 3FO9A 2E6PA 4CJ0A 4H88H 5IB4A 3HPLA 4BZ1H 1D6EB 4NRYB 1F45A 1P6AB 5LKNA 5C8JB 4K9EC 2D9QB 3TBTA 4M48H 3TNMA 2DWDB 1D5MB 5CZVH 1KXVC 2K7QA 1NQBA 1JUFB 2L0DA 4HCRL 4K3JH 5HHNB 4LHUG 3VWKD 3P4MA 1CGWA 2OTUB 3L5WA 4ZFZA 5E2VL 5KG9A 3KYAA 1GJIA 3CFDB 5JW5A 5C08E 3HUJA 2J88H 4MD4A 1R3HA 4GW4B 4RFEA 3U9PL 1AXTL 4LP5A 2HTKD 1MY7A 1VGKA 4QRRD 4N9GB 4XBGA 3J7HA 1MNUL 3AMLA 3FQWB 3UTSD 3QXDA 5AWNL 4I2XE 4PP2A 2BNUA 5BZDB 3FO0H 1M7DA 2P7TB 4OLWH 1U8OB 1KCVH 4X6CA 1F4YH 5F89A 2X4PB 3CLFH 3REVB 5DFWH 3DX8A 5FGRA 5CGTA 5IOPB 2PUQT 4MZ2A 1RUAH 1NGPH 1HSBA 4QT5B 2CKBL 3QUXA 3P9WB 1RURL 2ZSVA 2E9JA 3NCCB 4X8JB 1TNMA 4JCMA 3GIVA 4UT6L 1EUUA 5C0BE 1I3GL 2I24N 1FGVL 3DURB 3GGWA 3RZCD 4FQPA 4M1GL 3RVTC 5JORB 2J6EL 3PWPA 2CRIA 4HKBB 1A7PL 3O6LH 4MA7L 2AEQH 4IRSC 2NCMA 1N0LA 4PUBL 2ORBH 5F6IB 1W0WA 3HN3A 3P2TA 2R1WB 3DVGA 3B2VL 4L29B 4P2QB 4UBDC 4LCWD 3C5ZA 4KI1A 1H8SA 1FBIH 1HOCB 2X09A 4APQD 2BNQE 4WI4A 1W8NA 2OSLB 3HRZA 2HP4A 1WFNA 1YN7B 4U3CA 1C5DA 2PYEE 1DBBL 1X44A 1A6WL 2Q76B 1I4FA 2DB8A 1NAML 2PO6D 4B50A 2YD6A 5DVKA 1CE6A 1PZ5B 4Q9BA 3QJHA 3IF1B 5JIPA 1A9EB 4PLOB 3GBML 5F7EL 4P46A 4LLAA 2BP3A 1GGBL 5IVXF 3NZHL 1TVHB 1Z9OA 1GGUA 4XBPA 5DZOA 1ZVSB 3LEYH 3BKJH 1GZPA 2G60L 4R4NC 1ZLWH 1PX4A 1IC7H 5IBUB 5BQ7B 2JJUA 2VDNH 5HYJE 1HDMA 3QEUB 4NQDB 3CJJA 2SEBA 1IC5L 2VZOA 5I1HH 4OGYL 1BJ8A 4OZFB 3VI3F 3CFKB 3WEXB 2HFFB 3QDJE 2EE9A 2IFFH 3UDWC 4XPGL 5IB3B 2NY3D 3F7YB 5E2TL 5JHDA 5M7QA 4R90H 5DJDA 4M7ZC 5DUMH 1R3IL 5DI8B 5EUOF 4XP5L 3RVXC 4NZDA 4MB4A 2HFGH 3EYFA 5DR5H 4R97B 4PRPE 3TT3L 2BJMH 2GHWB 3QULB 3E3QC 1I8LC 1T1YA 1A4KB 3BP6A 3Q6FB 1Z3GH 4MD0B 1ZMYA 3EJZD 1S7WB 1ND0A 1DLFL 3FT2B 4HMDA 3OAZH 4WENB 1SEBA 1ACYH 4CMMA 1NBZA 3VXUA 4R7DB 5EBLB 4OQTA 1CICC 4Y4KB 5GGVL 4X4YB 5TF1H 1HH6B 3RUGB 3K4DA 2E7BA 4Q6IC 3VXSE 3BGFB 3IGAB 3K2MC 3OGCA 1CXIA 5C08A 3BEVB 3LQAL 4I9WE 2ICWA 1AJ7L 3KR3H 3EO0B 2Y36H 4G43A 2MSPA 4OFYA 1ORSA 2EYTB 4NUGL 3VXOA 2Y7QA 1LQSR 4MJ2A 4U1MA 3MV9E 4M6MH 4PTUA 4Z6AT 3WL9A 3TVMA 4DN3L 3BGAA 3HLAB 1MJ8L 4JANA 1WAAE 2RFXB 4LRNL 5HVWA 3CVHL 4JFDB 2G2RB 1FE8L 1C08B 2GFBB 3EOAA 5C6PB 5DUBA 1OAZL 2C5DC 1IQWH 3V4PL 1P7HL 1QVOB 1BZ9A 1DVFA 3T0BA 4Y5VA 3QUYA 4LFHD 3F6IA 5IVXE 5C0BA 2I25N 3B9KA 3DROB 4EVNA 3FB6B 4B41A 1J86A 4LF3A 4XCEA 4CU8A 2VMFA 2HKHH 3VXPA 2DQIH 3MXWL 1OL0A 1J5OH 1T4KB 5ADOH 5FF6A 5GRXG 4MQXD 1D9KC 3VXRD 3WLBA 5DHXB 3RTQA 1FV1B 1VEOA 4MLSA 4JPKL 5IP4A 2JB6B 3VI3E 5E4IA 4AMKL 3GMNA 4MWFB 4AT6B 3GBNH 5ANME 4K3GA 3QIUC 1N2RA 2VSDA 4P23A 4PR5A 4U0QB 5EUOE 2VQ1A 3A6OA 3NBNA 5EA0H 5IBUG 3V5HA 2W9EL 2I07B 4XAWL 4X83A 4DKEH 2EECA 5F1OB 5IQ7H 5DS8A 1HK6A 1GGIL 3GMRA 2CJUH 5F3HA 5JPNA 1YMHA 1D5IH 4OZFG 3LV3A 5HYJA 3FQXA 5I8KH 1V3KA 5ECJE 5IB5A 4PJXF 2X9WA 5IFHL 5H37H 4D0DB 2C4FT 4XP9H 2OZ4L 1X5FA 2X1XR 1JK8A 3V6OE 3WSQL 1LO4H 1YDPA 1INEH 1J05B 1F90H 1KPUA 2OYPA 1KTLB 1A3LL 5FUZL 4C83B 5E24E 3BZFA 4WFFD 1RJYA 5GRZA 3VWJA 1P53A 4PJBF 5T1LA 1TJHH 5KVFH 4JGMA 4NKIL 1YEEH 5GS0C 4BFGA 3CNKA 4PRPA 2V2WA 3S34L 4NPYA 5JDSA 1QSED 1NUNB 2OS7A 3L7EB 1K3IA 2GJ6E 2YKLH 1U8MB 3E6FA 4NQCE 3T3PE 1DCLA 1KIQA 2UY7A 3AS2A 4DGVH 1KN4L 1G7MB 1NEZB 1P5VA 1L6ZA 4TRPL 4EEEA 1Q9OA 2XKNA 4UDTB 4WFGD 5INDB 2YD9A 1FIEA 3WIHH 2VZVA 2WWKT 4H25A 4BYHA 3PWNA 3V5DA 1NMCB 1BEYL 3VGDA 3VXSA 2K7PA 4BSJA 4PJ8A 2NXZB 3GSWB 3S6CA 4KMQA 3SDAB 1N5AA 1MRDH 1AQKL 5FA3B 1EVTC 4WO4B 4QXGH 3SO3C 1XGPA 5EWIL 2EZ0C 1I1AA 5D1ZB 4IJ3C 3TZVA 1R5VA 3BESR 3MV9A 4L1HA 2H32B 4L4VD 3W0WE 3QEQE 1YPZF 1WAAA 3QNZB 3GI8L 3DX9B 4K3DL 3PE9A